2MZCA

Metal binding of glutaredoxins
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
92
structure length
92
Chain Sequence
GPGSMVDVIIYTRPGCPYCARAKALLARKGAEFNEIDASATPELRAEMQERSGRNTFPQIFIGSVHVGGSDDLYALEDEGKLDSLLKTGKLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutaredoxin
publication title Metal Binding of Glutaredoxins
rcsb
source organism Brucella melitensis
total genus 12
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2mzcA00
1OE7A 3FYGA 1BQ7A 3WD6A 1B48A 4POLA 1OVNA 5IMCA 1V57A 2GZPA 1PKZA 2YWIA 4POKA 3HZ8A 2XC2A 4PGTA 2JZTA 1K0OA 2P5RA 4AF2A 2O8VB 2OBKA 3TKSE 2H0GA 1NM3A 3TRQA 5J4UA 4GQFA 3KD0A 1V98A 3K8NA 4IELA 4PQ1A 5A4VA 1NHYA 5B7CA 2H75A 3FZ4A 1Q4JA 4XS1A 3M9KA 3VWVA 4TR4A 1SL2B 5DBQA 3PR8A 1O85A 4JEDA 5AN1A 1H4OA 2V41A 5D9XA 5IOXA 5IMFA 5KN0A 4ILFA 3KGKA 2PWJA 3KIJA 5DCHA 1TK8B 4Q5QA 1LBKA 3GKMA 4WKWA 2H30A 3GTUB 4I8BA 1F3BA 4MH3A 3KEBA 16GSA 3R2QA 2H73A 2NDOA 1ZGNA 1ZCPA 2MBTA 2CAIA 3A5WA 1W4VA 1XVWA 3BJ5A 1YJ6A 1AQWA 1QUWA 2VIMA 4MJCA 4DVCA 1GNEA 3U6VA 3GYKA 1YQ1A 2MMOA 3NZNA 3VWXA 4ZBDA 1IYHA 2K8VA 2V1MA 3RHBA 1ST9A 1K3OA 2YNXA 4K0NA 4PURA 1S3CA 2GT6A 2HSHA 3E9JB 2LSTA 3LQ7A 3WGXA 3KH9A 2KHPA 5DALB 1HQOA 1WRYA 1EOHA 1XWCA 4L0WA 3HVVA 1K0AA 2OACA 4J56E 2H6ZA 3D0ZA 1ERVA 2NBSA 4D73A 2OA7A 2ZUPA 4RQRA 3BOAA 2RLIA 4MDCA 4TOPA 1XZOA 2GQLA 5ID2B 4CW9A 3L0HA 5IMDA 4GRFA 3TJGA 3KTLA 4K7IA 2C1YA 2MMNA 3EINA 1X9SB 1XPVA 3KMOA 14GSA 1I9DA 18GSA 1UN2A 1GULA 1Z5YE 1PX7A 1TW9A 3ZMLA 1VF1A 3MWHA 4ACSA 5J9CA 5AIVA 3H8QA 1ZOFA 3GHAA 5DVBA 2J9HA 2QGVA 5F8BA 3O76A 5DAKB 1HD2A 2N5BA 13GSA 3CRUA 3QOUA 1EWXA 2HLSA 4DSQA 4WEYA 4EL1A 2GSTA 4TN8A 1YKAA 5EVOA 4IBPA 12GSA 4Z7XA 1BAYA 2GZZA 3UARA 2F51A 2GLRA 2O87A 4GSNA 2A4VA 3GH6A 1X0RA 2X8GA 1E6BA 1HNCA 1T4ZA 3ZIJA 3GL3A 6GSVA 5DJMA 1Y25A 2I81A 6GSTA 1SK2A 1FHEA 3TRPA 2YP6A 4F03A 4Q5FA 1SD8A 1O8WA 1EP8A 2EIQA 2I4AA 1B4PA 2DMLA 1G6WA 2IJYA 2K8SA 1PKWA 2L5LA 2DIYA 1TDIA 4MH2A 2XBIA 2QKEA 1SYXA 3CMIA 4IJIA 3DMLA 4NAXA 1A8YA 1WP0A 2GZYA 3GKNA 4ZB9A 3EU4A 2AAWA 3L4NA 5E59A 3RPNA 3TRXA 2V6KA 3HD5A 3M3MA 1ZYQB 4ZL9A 1U6TA 1MDIA 4TXOB 2NVLA 6GSUA 4IGJA 4FYCA 5D9WA 4BVYA 1U87A 1WWJA 5B8BA 4POMA 5DQYA 1WPIA 4MZWA 5CRWA 2LNSA 5C00A 5KN3A 1R4WA 2Z9SA 5ECLB 3ZMKA 3P2AA 1X9WB 2EIOA 4ZXGA 5H5QA 4V2LA 2GGTA 2B5EA 1TTZA 3HJOA 1PN9A 3DRNA 3FW2A 4HZ2A 2H6XA 5G5EA 3VPTA 2VLTA 1GWCA 4TKYA 5H5RA 2X64A 1QFNA 2LQQA 1K0CA 3F4SA 4CDOA 2CX3A 1BEDA 2F3MA 2VCQA 3LG6A 5ECSA 1XWGA 3O3TA 4RI7A 5HQPA 1SKRB 3TOUA 2A2SA 1O8XA 2JZRA 3CXGA 4MLYA 4O7HA 1Z6NA 3GKXA 1T3BA 3QFBC 5H5SA 2VM1A 4WBJA 4AGSA 2H19A 3KP8A 1EOGA 5EL8A 2HYXA 5G1LA 1GTUA 4I2TA 5HFIA 1LU4A 4KCEA 1KTEA 2WJUA 5ECIB 3PINA 1X5CA 1PRXA 1KEBA 1DUGA 4MF5A 2AUVA 2H71A 3ISOA 3GSSA 4FYBA 5A5KA 3QPMA 2C0DA 2DIZA 4ISDA 3QDNA 2YV9A 3G7IA 1ZMAA 2O85A 3BCIA 5J41A 2CT6A 2VCVA 2X8CA 4GXZA 2LRNA 3DEXA 5IPHA 2GDRA 5F0GA 2B7KA 4K0GA 4IP6A 1SK1A 4EDZA 1V9WA 3H4KA 4X0XA 3CSJA 2FHEA 1XWAA 5J5NA 3RPPA 1USBA 2C80A 4DSSA 4IQ1A 4OWYA 3QCPA 4K6XA 3F63A 1HNAA 4JR6A 5IPGA 3ERWA 2YZHA 4MF6A 2AB6A 4ECBA 1X9MB 2V32A 2WB9A 1T4YA 4KCAA 2OADA 1GRXA 4WF4A 2GSRA 3HA9A 2AYTA 4TR3A 3ZLPA 2X99A 4X1UA 2FCHA 3ZYWA 4I97A 3C1SA 2M46A 3VWWA 2H0IA 1FVJA 4O32A 1ERTA 4BVXA 1DE1A 3KCMA 1XW6A 2VAFA 4GWRA 1EGOA 4HU7A 3GFKA 2RUEA 4FH8A 4K7OA 3W8SA 3UVHA 4EKZA 2AHEA 4NWYA 2WFCA 2FGXA 2C0GA 2R37A 5A4UA 1SKSB 2QC7A 1GL8A 3IK7A 2DJ1A 2RIIA 5G1KA 3GX8A 3HHVA 4WF5A 2H6YA 5G30A 4ZB6A 5AGYA 9GSSA 1PD21 1Y6EA 2NTOA 2FWFA 1ZL9A 2IMEA 2OE1A 2IMFA 2HZEB 3N9JA 2F8FA 4KSMA 3LXTA 2VCWA 3HXSA 1U3IA 3VLNA 2CVDA 3GTUA 5ECRB 3D21A 4KNDA 4H86A 4JU5A 4HJ2A 4QL7A 3TJKA 2P5QA 1N8JA 1SJIA 3M8NA 3DGQA 4ZL7A 4HQSA 4KH7A 3EMXA 1G7OA 2LV3A 1TU7A 2MMAA 3TKSA 1GSSA 3ZTLA 5JCWA 1Q98A 5ECNB 1OC3A 3J7Yb 1GUKA 4ML1A 1XFLA 4G9HA 5B6NA 2K6VA 3QAWA 5DALA 3BD2A 3GMFA 1GSDA 3TKSC 1TOFA 5HR3A 1T00A 2R4VA 6GSXA 2LRCA 1K3YA 5DDLA 1BYEA 1PL1A 3ZZXA 4OO5A 4OFNA 1XVQA 2REMA 3WGDA 5ID2A 1KBNA 3WYWA 1CQHA 4FIWA 2CX4A 1U88A 5D8IA 1V40A 4YH2A 2PBJA 4MMMA 3TOTA 3SWLA 4OD7A 1TKDB 5FWGA 3FHKA 4J2FA 4XS4B 4KDXA 2DLXA 2VM2A 3FZAA 5IQYA 2YWOA 1JLVA 3WGEA 2DJ2A 3ZVJD 1SENA 2YZUA 4O92A 5DAKA 3ZREA 4HQZA 3EWLA 2XBQA 1WE0A 1PGTA 1DSBA 5F06A 3CSIA 4IN0A 3CSHA 4E8EA 1LJRA 1A8LA 4V1Ap 3PH9A 3TCOA 1THXA 2K18A 1B8XA 5L71A 4LA1A 4MJEA 1GSUA 1EEMA 2E0QA 3FKFA 3GV1A 3ME8A 3WT2A 3FY7A 2G2QA 5JCUA 4HI7A 1CQGA 3F3QA 1VF2A 1GLPA 5GAPD 8GSSA 3VURA 1BJXA 2M72A 2PPTA 4KAEA 4TRXA 4ZL8A 2VLUA 3NIVA 2WGRA 3EVIA 1J9BA 1M2AA 3RBTA 3APQA 2HRNA 2HNLA 5GSSA 2L6CA 3P8WA 1A24A 4YAVA 2JU5A 6GSSA 1T7PB 2XPDA 2OKAA 4Q5RA 4FO5A 3GA4A 1YF0A 2GT5A 2VUPA 1VGLA 4OFTA 3KZQA 2A2RA 4MA9A 3ZL5A 1WJKA 3BBYA 2LJAA 3D6IA 1ML6A 4TXOA 1XWBA 2LKUA 3DVXA 2TRCP 1M0UA 3Q18A 2MBSA 4RUVA 3D22A 3US3A 1KNGA 4L5OA 3I9V2 4MPFA 2P31A 4NMUA 3LSZA 4DSRA 4ZBBA 3O6TA 2GS3A 2IN3A 1A0FA 2DJ3A 4F9ZA 3UIWA 4KB3A 3QFAC 4MPGA 2VL2A 1GTAA 4PUFC 3SBCA 1AW9A 2C4JA 4GF0A 1GSEA 5HFKA 2LTKA 5INYA 3TGZA 2ZCTA 2GTUA 2E2MA 4XRDA 1DE2A 2PUKC 4ECIA 3EYTA 1FAAA 3P7XA 2HZFA 2VL2C 1AAZA 5D9VA 3KM6A 2AV4A 1GSQA 2B5YA 2LQOA 2H74A 4LMWA 2H66A 5KN1A 2R3XA 2O7KA 3UJ1A 2H0HA 2YN1A 1F6MC 1TU8A 1XWKA 1H75A 5B8AA 3IAM2 2OJLA 4JRRA 1TK0B 20GSA 3FZ5A 4K2DA 3FR6A 1FB6A 1OC9B 4IVFA 4KSOA 1SKWB 1MEKA 4LLRA 2CA8A 5IOWA 3DKSA 1RW1A 3BCKA 5COHA 4TVEA 2VL3A 5CAXA 1RQMA 4GTUA 2B6MA 2L57A 4EXJA 1XOAA 2XPEA 2IMIA 4LL4B 3L9UA 3VFIA 5EPFA 2HFDA 1JFUA 2H1AA 2VD0A 2H72A 2B5XA 5JWOB 5ENUA 1TRVA 4F2IA 3LYKA 5IMZA 2DJJA 2GQKA 1HNBA 1DBYA 1M7TA 3TJFA 2C3QA 1IYIA 1VF4A 3G7JA 5IM9A 4ZIJA 1M99A 2YV7A 4XRAA 1YKCA 1GSFA 1TI1A 2M80A 3D5JA 1K0BA 19GSA 5KN2A 2JL4A 3FR3A 3KXOA 5D73A 1GSYA 1A2MA 1F3AA 1O73A 4MJAA 4E8HA 2WZ9A 3M9JA 5LD0A 4GLTA 4JBBA 2VD1A 1PL2A 3IAS2 1PA3A 4YQMA 1PMTA 3LGCA 4PQIA 2N5FA 4V2NA 1G7EA 4HEA2 4PUAA 2FA4A 4BA7A 1S3DA 1MTCA 3J7Yk 4NPBA 1FB0A 1AQVA 1F37A 5GAND 2IL3A 4PNFA 2E2GA 4KUNA 3ED3A 2JACA 1GTIA 1N2AA 1MD3A 4GSTA 1SU9A 1A0RP 1FVKA 2HZEA 1FG4A 22GSA 3TKQA 3DD3A 1QMVA 3E0UA 4GQCA 4OCEA 3A2XA 1XCCA 3GX0A 3HY2A 5CP1A 5ECKB 1GP1A 1A2LA 2I1UA 1JLWA 1S3AA 2X8HA 2I3YA 1A2JA 1M2DA 2KUCA 3HDCA 1GLQA 3ZITA 2CZ2A 1THOA 4AJ8A 2KP2A 1R26A 1K0NA 4MK3A 5HR0A 4TXVA 2VCTA 1YZXA 1I5GA 2VCZA 4MZBA 1PX6A 1XOBA 2G0FA 4NXIA 4HOJA 1TXXA 1FO5A 5D93A 3VWUA 5A4WA 2OE0A 3F9UA 3VI7A 3LJRA 1QK8A 4K8MA 11GSA 2OE3A 1SL1B 1AUCA 3C1RA 4OFMA 5AISA 3S9FA 2DJ0A 2PN8A 1B4QA 1Z7PA 17GSA 2BJXA 2FLSA 1ERWA 2H70A 1C72A 1PSQA 1TK5B 3C71A 4N30A 5CYYA 3F3RA 5CNWA 2YANA 2V2GA 1V58A 2GSQA 4QL9A 4BWQA 3RAZA 4IKHA 4IHUA 4XS4A 2IFQB 3GUSA 1AC1A 2C8UA 4IQAA 2IMKA 2E7PA 4ZB8A 4KE3A 4HDEA 1EZKA 1VRSD 4XS6A 1ERUA 2YJ7A 2F8AA 2PERA 2LUSA 5C04A 2TIRA 5IO0A 5D96A 3A2WA 2BMXA 3HJPA 4POBA 4KGIA 3CRTA 2RM6A 2H1BA 3GNJA 1A23A 1E2YA 5E4WA 2DJKA 4X43A 1YEXA 2HI7A 3IHQA 2CQ9A 2YPMA 3FEUA 1K0MA 4DSSB 3IRAA 3LXZA 3EU3A 3DXBA 1UC7A 3ERFA 2YCDA 1XW9A 3IA1A 1EV9A 1TJDA 2HT9A 2LNTA 4WBRD 3IR4A 3DYRA 5KEJA 2PU9C 5CRGA 2BTOT 3IV4A 2FWGA 2HRFA 1V2AA 1TRUA 5IIZA 3F8UA 1QQ2A 2CV4A 4MP4A 1GUMA 2VO4A 2MMZA 2L6DA 3A3TA 3H79A 5B6MA 1AQXA 2H76A 4TR1B 5JWQB 3QAGA 3TUEA 3VK9A 1EEJA 3LFLA 1URMA 1ABAA 4J57E 2DMMA 3DIEA 3W8JA 1BG5A 5JCGA 4G2EA 3P90A 4YQUA 1SYRA 1HYUA 5IO2A 2QSIA 1WMJA 4WXTA 2D2ZA 2WS2A 2DBCA 3EE2A 5LCZA 5F07A 4NHZA 1JZWA 4LMVA 1T8EB 1MDJA 3UBLA 5D9TA 5GZZB 3IDVA 4MJBA 2DSAA 5JWRB 2CZ3A 1GTBA 3H1NA 3M0FA 3TJJA 1G6YA 3F4TA 2CVKA 4F82A 2R2JA 1TRSA 3JCML 4N10A 1O7UA 1R5PA 5AIXA 1Z7RA 3LORA 2AJQB 3FZ9A 4N0ZA 2F9SA 4ULXA 2IPAA 1OC8A 4AJ7A 3OR5A 3KH7A 2JZSA 4PNGA 1OKTA 1RK4A 1XIYA 4EVMA 3ME7A 2IIYA 3UBKA 4F0CA 1NHOA 3IK9A 1ACVA 3HKRA 3AY8A 1K3LA 5DCGA 2LJRA 3UAPA 3IOSA 1ILOA 2NPBA 1M9AA 3H93A 3ERGA 2MYGA 2V6OA 2FWEA 3L9VA 4YQVA 4L8EA 1R7HA 4ID0A 4OO4A 3UMAA 3NOFA 4IP1A 2FA8A 1EV4A 2N5AA 3U5RE 1SD9A 1K0DA 3CYNA 2PGTA 3HVSA 2WDUA 1PQNA 3MNGA 2FUG2 1OC9A 1QXHA 3TB2A 4PQHA 2PVQA 1U3AA 1WOUA 1G0TA 3APSA 1M9BA 3GKKA 4EF0A 5ABRA 4P3YB 2H1GA 3IXRA 1YY7A 2ES7A 5EY6A 1SJZA 2ZNMA 3Q74A 4HUAA 4JZQA 4I5QA 5HFGA 5HR1A 1F2EA 1OAZA 3MDKA 3VPQA 2RUFA 3TKPA 1WIKA 2R6KA 3L9SA 4JE1A 3GIXA 3E3EA 3TJBA 10GSA 4ECJA 3GN3A 1ZYEA 2H8LA 4N0VA 4XHMA 3F0IA 1W89A 3V1WA 4IW9A 3C73A 1JZDA 3QR6A 2DC5A 1J0FA 2JADA 1B9YC 4G10A 3Q19A 2RM5A 3C8EA 2I9HA 3UL3A 2OBIA 3DVWA 4HZ4A 4KX4A 4XIHA 3I69A 4D73B 5DJLA 3CBUA 3HZ4A 3WT1A 3GL5A 4FYUA 2C3TA 5ELGA 1OE8A 2C0EA 4NHWA 3HVXA 5ECOB 1XW5A 1YDKA 3G9BA 3F6FA 1X5EA 2JSZA 4OCFA 3KTBA 2B3SA 4QQ7A 4JR4A 1MD4A 2L59A 3MAKA 4ZILA 5FT3A 2J23A 2HE3A 1EP7A 2PMTA 2FNOA 4XCSA 2R5GA 4ECCA 5J9BA 2ALBA 4IS0A 3FK8A 2O89A 3VI5A 1J08A 2CVBA 4NV2A 2YWNA 5DQSA 4F0BA 2K9FA 2LJKA 2GVPA 4WETA 5GSTA 4KA0A 3C7MA 2TRXA 3ZRDA 2KP1A 5CRDA 4I6XA 4PXOA 5G5FA 2HSYA 3IC4A 4RI6A 4OMVA 2IMDA 2FWHA 5G31A 1OYJA 1X5DA 3F6DA 1OKDA 1EGRA 3EC3A 3G7YA 1TI3A 2WULA 4K9ZA 1TRWA 4WR4A 5CO3A 2B1LA 2KLXA 5G2ZA 5IMAA 2MZCA 3CTGA 3I6AA 2LEGA 4ML6A 3N5OA 3L78A 1JHBA 1Z9HA 4YAPA 4N11A 5CRHA 4I2UA 4MABA 4L5LA 1GNWA 1ZZYA 2P0GA 1YEPA 4V2MA 2FY6A 2VOCA 1SL0B 4CHSA 1JZRA 1T1VA 3QD9A 2FD3A 3PGTA 2HXKA 1XXUA 2H1DA 4G19A 6GSYA 2GSSA 4BPYA 2GQMA 4BWSA 2L4QA 2ON5A 4RQXA 2L4CA 2IFQA 4DEJA 1FW1A 3TKRA 1JZOA 2YJHA 3ZIVA 1GUHA 3HJMA 6GSWA 1O6JA 2PVOC 1B9XC 3GH9A 4EDYA 1SK0A 2H01A 2WRTA 5HR2A 3DWVA 4O5RA 4GCIA 4PX1A 3UVTA 1YF1A 2WCIA 4EUYA 4TW5A 2LS5A 3UOMA 4HU9A 2JSYA 5ELAA 3APOA 2ON7A 5ECPB 2C3NA 2YOIA 3MSZA 5FHIA 4BL7A 3RDWA 3IE3A 5F05A 4Q5NA 3RHCA 2XHFA 5LNKe 4K7NA 1AXDA 3Q6OA 4KDYA 3I43A 4IJ3A 3EURA 2C0FA 1AIUA 3HCZA 3FRCA 3GRXA 4HS1A 4AJ6A 1BX9A 2VCXA 1Z6MA 3F4RA 4TR1A 2L5OA 1Z3EA 4KDUA 3QMXA 2VL9A 4MZCA 3IPZA 1ON4A 3LWAA 4MF7A 4EC0A 1UVZA 5ECMB 3EMPA 7GSSA 1NSWA 2VLVA 2IWTA 4WR5A 5IMVA 5J3RA 4V1Ag 3HYPA 1O81A 3D4MA 2YWMA 4GSSA 2EC4A 3QAVA 2B1KA 3GURA 3D4TA 4LL1B 4TR0A 3CTFA 3GSTA 3KMNA 3ZFBA 3M1GA 1R5AA 4KW6A 2EIRA 4L0UA 1UA5A 1NW2A 3A2VA 1QGVA 1MDKA 4MCUA 1TP9A 3IBHA 3LYPA 3KJYA 1SJ6A 1FOVA 5CREA 4HJMA 3FR9A 3ZFLA 2KOKA 3TDGA 3W6GA 3ZVJA 3LEFA 5ECHB 3UEMA 2B7JA 2CAQA 4XTSA 4ZBAA 1VF3A 1GH2A 3KP9A 4EO3A 2LRTA 4K1FA 1XBSA 4EE0A 5ECQB 1M2BA 4NV5A 1F9MA
chains in the Genus database with same CATH superfamily
1OE7A 3FYGA 1BQ7A 3WD6A 1B48A 4POLA 1OVNA 5IMCA 1V57A 4BVXB 2GZPA 1PKZA 2YWIA 4POKA 3HZ8A 2XC2A 2R0PA 4PGTA 2JZTA 1K0OA 2P5RA 4AF2A 2O8VB 2OBKA 3TKSE 2H0GA 1NM3A 3TRQA 5J4UA 4GQFA 3KD0A 1V98A 3K8NA 4IELA 4PQ1A 5A4VA 1NHYA 5B7CA 2H75A 3FZ4A 1Q4JA 4XS1A 3M9KA 3VWVA 4TR4A 1SL2B 5DBQA 3PR8A 1O85A 4JEDA 5AN1A 1H4OA 2V41A 5D9XA 3CQFA 5IOXA 5IMFA 5KN0A 4ILFA 3KGKA 2PWJA 3KIJA 5DCHA 1TK8B 4Q5QA 1LBKA 3GKMA 4WKWA 2H30A 3GTUB 4I8BA 1F3BA 4MH3A 3KEBA 16GSA 3R2QA 2H73A 2NDOA 1ZGNA 1ZCPA 2MBTA 2CAIA 3A5WA 1W4VA 1XVWA 3BJ5A 1YJ6A 1AQWA 1QUWA 2VIMA 4MJCA 4DVCA 1GNEA 3U6VA 3GYKA 1YQ1A 2MMOA 3NZNA 3VWXA 4ZBDA 1IYHA 2K8VA 2V1MA 3RHBA 1ST9A 1K3OA 2YNXA 4K0NA 4PURA 1S3CA 2GT6A 2HSHA 3E9JB 2LSTA 3LQ7A 3WGXA 3KH9A 2KHPA 5DALB 1HQOA 1WRYA 1EOHA 1XWCA 4L0WA 3HVVA 1K0AA 2OACA 4J56E 2H6ZA 3D0ZA 1ERVA 2NBSA 4D73A 2OA7A 2ZUPA 4RQRA 3BOAA 2RLIA 4MDCA 4TOPA 1XZOA 2GQLA 5ID2B 4CW9A 3L0HA 5IMDA 4GRFA 3TJGA 3KTLA 4K7IA 2C1YA 2MMNA 3EINA 1X9SB 1XPVA 3KMOA 14GSA 1I9DA 18GSA 1UN2A 1GULA 1Z5YE 2QA2A 1PX7A 1TW9A 3ZMLA 1VF1A 3MWHA 4ACSA 5J9CA 5AIVA 3H8QA 1ZOFA 3GHAA 5DVBA 2J9HA 2QGVA 5F8BA 3O76A 5DAKB 1HD2A 2N5BA 13GSA 3CRUA 3QOUA 1EWXA 2HLSA 4DSQA 4WEYA 4EL1A 2GSTA 4TN8A 1YKAA 5EVOA 4IBPA 12GSA 4Z7XA 1BAYA 2GZZA 3UARA 2F51A 2GLRA 2O87A 4GSNA 2A4VA 3GH6A 1X0RA 2X8GA 1E6BA 1HNCA 1T4ZA 3ZIJA 3GL3A 6GSVA 5DJMA 1Y25A 2I81A 6GSTA 1SK2A 1FHEA 3TRPA 2YP6A 4F03A 4Q5FA 3HVNA 1SD8A 1O8WA 1EP8A 2EIQA 2I4AA 1B4PA 2DMLA 1G6WA 2IJYA 2K8SA 1PKWA 2L5LA 2DIYA 1TDIA 4MH2A 2XBIA 2QKEA 1SYXA 4IJIA 3CMIA 3DMLA 4NAXA 1A8YA 1WP0A 2GZYA 3GKNA 4ZB9A 3EU4A 2AAWA 1ZYNA 3L4NA 5E59A 3RPNA 3TRXA 2V6KA 3HD5A 3M3MA 1ZYQB 4ZL9A 1U6TA 1MDIA 2UZ8A 4TXOB 2NVLA 6GSUA 4IGJA 4FYCA 5D9WA 4BVYA 1U87A 1WWJA 5B8BA 4POMA 5DQYA 1WPIA 4MZWA 5CRWA 1M3IA 2LNSA 5C00A 5KN3A 1R4WA 2Z9SA 5ECLB 3EPTA 3ZMKA 3P2AA 1X9WB 2EIOA 4ZXGA 5H5QA 4V2LA 2GGTA 2B5EA 1TTZA 3HJOA 1PN9A 3DRNA 3FW2A 4HZ2A 2H6XA 5G5EA 3VPTA 2VLTA 1GWCA 4TKYA 5H5RA 2X64A 1QFNA 2LQQA 1K0CA 3F4SA 4CDOA 2CX3A 1M3JA 1BEDA 2F3MA 4USSA 2VCQA 2X4AA 3LG6A 5ECSA 1XWGA 3O3TA 4RI7A 5HQPA 1SKRB 3TOUA 2A2SA 2DKHA 1O8XA 2JZRA 3CXGA 4MLYA 4O7HA 1Z6NA 3GKXA 1T3BA 3QFBC 5H5SA 2VM1A 4WBJA 4AGSA 2H19A 3KP8A 1EOGA 5EL8A 2HYXA 5KOWA 5G1LA 1GTUA 4I2TA 5HFIA 1LU4A 4KCEA 1KTEA 2WJUA 5ECIB 3PINA 1X5CA 1PRXA 1KEBA 1DUGA 4MF5A 2AUVA 2H71A 3ISOA 3GSSA 4FYBA 5A5KA 3QPMA 2C0DA 2DIZA 4ISDA 3QDNA 2YV9A 3G7IA 1ZMAA 2O85A 3BCIA 5J41A 2CT6A 2VCVA 2X8CA 4GXZA 2LRNA 3DEXA 5IPHA 2R0GA 2GDRA 5F0GA 2B7KA 4K0GA 4IP6A 1SK1A 4EDZA 1ZYPA 1V9WA 3H4KA 4X0XA 3CSJA 2FHEA 1XWAA 5J5NA 3RPPA 1USBA 2C80A 4DSSA 4IQ1A 4OWYA 3QCPA 4K6XA 3F63A 1HNAA 4JR6A 5IPGA 3ERWA 2YZHA 4MF6A 2AB6A 4ECBA 1X9MB 2V32A 2WB9A 1T4YA 4KCAA 2OADA 1GRXA 4WF4A 2GSRA 3HA9A 2AYTA 4TR3A 3ZLPA 2X99A 4X1UA 2FCHA 3ZYWA 4I97A 3C1SA 2M46A 3VWWA 2H0IA 1FVJA 4O32A 1ERTA 4BVXA 1DE1A 3KCMA 1XW6A 2VAFA 4GWRA 1EGOA 4HU7A 3GFKA 2RUEA 4FH8A 4K7OA 3W8SA 3UVHA 4EKZA 4PTSA 2AHEA 4NWYA 2WFCA 2FGXA 2C0GA 2R37A 5A4UA 1SKSB 2QC7A 1GL8A 3IK7A 2DJ1A 2DKIA 2RIIA 5G1KA 3GX8A 3HHVA 4WF5A 2H6YA 5G30A 4ZB6A 5AGYA 4O5QA 9GSSA 1PD21 1Y6EA 2NTOA 2FWFA 1ZL9A 2IMEA 2OE1A 2IMFA 2HZEB 3N9JA 2F8FA 2HSMA 4KSMA 3LXTA 2VCWA 3HXSA 1U3IA 3VLNA 2CVDA 3GTUA 5ECRB 3D21A 4BIKA 4KNDA 4H86A 4JU5A 4HJ2A 4QL7A 3TJKA 2P5QA 1N8JA 1SJIA 3M8NA 3DGQA 4ZL7A 4HQSA 4KH7A 3EMXA 1G7OA 2LV3A 1TU7A 2MMAA 3TKSA 1GSSA 3ZTLA 5JCWA 1Q98A 5ECNB 1OC3A 3J7Yb 1GUKA 4ML1A 1XFLA 4G9HA 5B6NA 2K6VA 3QAWA 5DALA 3BD2A 3GMFA 1GSDA 3TKSC 1TOFA 5HR3A 1T00A 2R4VA 6GSXA 2LRCA 1K3YA 5DDLA 1BYEA 1PL1A 3ZZXA 4OO5A 4OFNA 1XVQA 2REMA 3WGDA 5ID2A 1KBNA 3WYWA 1CQHA 4FIWA 2CX4A 1U88A 5D8IA 1V40A 4YH2A 2PBJA 4MMMA 3TOTA 3SWLA 4OD7A 1TKDB 5FWGA 3FHKA 4J2FA 4XS4B 4KDXA 2DLXA 2VM2A 3FZAA 5IQYA 2YWOA 1JLVA 3WGEA 2DJ2A 3ZVJD 1SENA 2YZUA 4O92A 5DAKA 3ZREA 4HQZA 3EWLA 2XBQA 1WE0A 4Z2TA 1PGTA 1DSBA 5F06A 3CSIA 4IN0A 2X49A 3CSHA 4E8EA 2QA1A 1LJRA 1A8LA 4V1Ap 3PH9A 2HRAA 3TCOA 1THXA 2K18A 1B8XA 5L71A 4LA1A 4MJEA 1GSUA 1EEMA 2E0QA 3FKFA 3GV1A 3ME8A 3WT2A 3FY7A 2G2QA 5JCUA 4HI7A 1CQGA 3F3QA 1VF2A 1GLPA 5GAPD 8GSSA 3VURA 1BJXA 2M72A 2PPTA 4KAEA 4TRXA 4ZL8A 2VLUA 3NIVA 2WGRA 3EVIA 1J9BA 1M2AA 3RBTA 3APQA 2HRNA 2HNLA 5GSSA 2L6CA 3P8WA 1A24A 4YAVA 2JU5A 6GSSA 1T7PB 2XPDA 2OKAA 4Q5RA 4FO5A 3GA4A 1YF0A 2GT5A 2VUPA 1VGLA 4OFTA 3KZQA 2A2RA 4MA9A 3ZL5A 1WJKA 3BBYA 2LJAA 3D6IA 1ML6A 4TXOA 1XWBA 2LKUA 3DVXA 2TRCP 4YKFA 1M0UA 3Q18A 2MBSA 4RUVA 3D22A 3US3A 1KNGA 4L5OA 3I9V2 4MPFA 2P31A 4NMUA 3LSZA 4DSRA 3LW9A 4ZBBA 3O6TA 2GS3A 2IN3A 1A0FA 2DJ3A 3MYDA 4F9ZA 3UIWA 4KB3A 3QFAC 4MPGA 2VL2A 1GTAA 2R0CA 4PUFC 3SBCA 1AW9A 2C4JA 4GF0A 1GSEA 5HFKA 2LTKA 5INYA 3TGZA 4G0LA 2ZCTA 2GTUA 2E2MA 4XRDA 1DE2A 2PUKC 4CY8A 4ECIA 3EYTA 1FAAA 3P7XA 2HZFA 2VL2C 1AAZA 5D9VA 3KM6A 2AV4A 1GSQA 2B5YA 2LQOA 2H74A 4LMWA 2H66A 5KN1A 2R3XA 2O7KA 3UJ1A 2H0HA 2YN1A 1F6MC 1TU8A 1XWKA 1FOHA 1H75A 5B8AA 3IAM2 2OJLA 4JRRA 1TK0B 20GSA 3FZ5A 4K2DA 3FR6A 1FB6A 1OC9B 4IVFA 4KSOA 1SKWB 1MEKA 4LLRA 2CA8A 5IOWA 3DKSA 1RW1A 3BCKA 5COHA 4TVEA 1PFOA 2VL3A 5CAXA 1RQMA 4GTUA 2B6MA 2L57A 4EXJA 1XOAA 2XPEA 2IMIA 4LL4B 3L9UA 3VFIA 5EPFA 2HFDA 1JFUA 2H1AA 2VD0A 2H72A 2B5XA 5JWOB 4MNNA 5ENUA 1TRVA 4F2IA 3LYKA 5IMZA 2DJJA 2GQKA 1HNBA 1DBYA 1M7TA 3TJFA 2C3QA 1IYIA 1VF4A 3G7JA 5IM9A 4ZIJA 1M99A 4K5RA 2YV7A 4XRAA 1YKCA 1GSFA 1TI1A 2M80A 3D5JA 1K0BA 19GSA 5KN2A 2JL4A 3FR3A 3KXOA 5D73A 1GSYA 1A2MA 1F3AA 1O73A 4MJAA 4E8HA 2WZ9A 3M9JA 5LD0A 4GLTA 4JBBA 2VD1A 1PL2A 3IAS2 1PA3A 4YQMA 1PMTA 3LGCA 4PQIA 2N5FA 4V2NA 1G7EA 4HEA2 4PUAA 2FA4A 4K2XA 4BA7A 1S3DA 2HRKA 1MTCA 3J7Yk 4NPBA 1FB0A 1AQVA 3FMWA 1F37A 5GAND 2IL3A 4PNFA 2E2GA 4KUNA 3A5IA 3ED3A 2JACA 1GTIA 1N2AA 1MD3A 4GSTA 1SU9A 1A0RP 1FVKA 2HZEA 1FG4A 22GSA 3TKQA 3DD3A 1QMVA 3E0UA 4GQCA 4OCEA 3A2XA 1XCCA 3GX0A 3HY2A 5CP1A 5ECKB 4KF9A 1GP1A 1A2LA 4EIPA 2I1UA 1JLWA 1S3AA 2X8HA 2I3YA 1A2JA 1M2DA 2KUCA 3HDCA 5BMUA 1GLQA 4Z2RA 3ZITA 2CZ2A 1THOA 4AJ8A 2KP2A 1R26A 1K0NA 4MK3A 5HR0A 4TXVA 2VCTA 1YZXA 1I5GA 2VCZA 4MZBA 1PX6A 1XOBA 2G0FA 4NXIA 4HOJA 1TXXA 1FO5A 5D93A 3VWUA 5A4WA 2OE0A 3F9UA 3VI7A 3LJRA 1QK8A 4K8MA 11GSA 2OE3A 1SL1B 1AUCA 3C1RA 4OFMA 5AISA 3S9FA 2DJ0A 2PN8A 1B4QA 1Z7PA 17GSA 2BJXA 2FLSA 1ERWA 2H70A 1C72A 1PSQA 1TK5B 3C71A 4N30A 5CYYA 3F3RA 5CNWA 2YANA 2V2GA 1V58A 2GSQA 4QL9A 4BWQA 3RAZA 4IKHA 4IHUA 4XS4A 2IFQB 3GUSA 1AC1A 2C8UA 4IQAA 2IMKA 2E7PA 4ZB8A 4KE3A 4HDEA 1EZKA 1VRSD 4XS6A 4CY6A 1ERUA 2YJ7A 2F8AA 2PERA 2LUSA 5C04A 2TIRA 5IO0A 5D96A 3A2WA 2BMXA 3HJPA 4POBA 4FQUA 4KGIA 3CRTA 2RM6A 2H1BA 3GNJA 1A23A 1E2YA 5E4WA 2DJKA 4X43A 1YEXA 2HI7A 3IHQA 2CQ9A 2YPMA 3FEUA 1K0MA 4DSSB 3IRAA 3LXZA 3EU3A 3DXBA 1UC7A 3ERFA 2YCDA 4X4JA 1XW9A 4BL7B 3IA1A 1EV9A 1TJDA 2HT9A 2LNTA 4WBRD 3IR4A 3DYRA 5KEJA 2PU9C 5CRGA 2BTOT 3IV4A 2FWGA 2HRFA 1V2AA 1TRUA 5IIZA 2A2PA 3F8UA 1QQ2A 2CV4A 4MP4A 1GUMA 2VO4A 2MMZA 2L6DA 3A3TA 3H79A 5B6MA 1AQXA 2H76A 4TR1B 5JWQB 3QAGA 3TUEA 3VK9A 1EEJA 3LFLA 1URMA 1ABAA 4J57E 2DMMA 3DIEA 3W8JA 1BG5A 5JCGA 4G2EA 3P90A 4YQUA 1SYRA 1HYUA 5IO2A 2QSIA 1WMJA 4WXTA 2D2ZA 2WS2A 2DBCA 3EE2A 5LCZA 5F07A 4NHZA 1JZWA 4LMVA 1T8EB 1MDJA 3UBLA 5D9TA 5GZZB 4G0IA 3IDVA 4MJBA 2DSAA 5JWRB 2CZ3A 1GTBA 3H1NA 3M0FA 3TJJA 1S3RA 1G6YA 3F4TA 2CVKA 4F82A 2R2JA 1TRSA 3JCML 5BRTA 3PPUA 4N10A 1O7UA 1R5PA 5AIXA 1Z7RA 3LORA 2AJQB 3IHGA 3FZ9A 4N0ZA 2F9SA 4ULXA 2IPAA 1OC8A 4AJ7A 3OR5A 3KH7A 2JZSA 4PNGA 1OKTA 1RK4A 1XIYA 4EVMA 3ME7A 2IIYA 3UBKA 4F0CA 1NHOA 3IK9A 1ACVA 5KOXA 3HKRA 4ICYA 3AY8A 1K3LA 5DCGA 4O5UA 2LJRA 3UAPA 3IOSA 1ILOA 2NPBA 1M9AA 3H93A 3ERGA 2MYGA 2V6OA 2FWEA 3L9VA 4YQVA 4L8EA 1R7HA 4ID0A 4OO4A 3UMAA 3NOFA 4IP1A 2FA8A 1EV4A 2N5AA 3U5RE 1SD9A 1K0DA 3CYNA 2PGTA 3HVSA 2WDUA 1PQNA 3MNGA 2FUG2 1OC9A 1QXHA 3TB2A 4PQHA 2PVQA 1U3AA 1WOUA 1G0TA 3APSA 1M9BA 3GKKA 4EF0A 5ABRA 4P3YB 2H1GA 3IXRA 1YY7A 2ES7A 4G0KA 5EY6A 1SJZA 2ZNMA 3Q74A 4HUAA 4JZQA 4I5QA 5HFGA 5HR1A 1F2EA 1OAZA 3MDKA 3VPQA 2RUFA 3TKPA 1WIKA 2R6KA 3L9SA 4JE1A 3GIXA 3E3EA 3TJBA 10GSA 4ECJA 3GN3A 1ZYEA 2H8LA 4N0VA 4XHMA 3F0IA 1W89A 3V1WA 4IW9A 3C73A 1JZDA 3QR6A 2DC5A 1J0FA 2JADA 4Z2UA 1B9YC 4G10A 3Q19A 2RM5A 3C8EA 2I9HA 3UL3A 2OBIA 3DVWA 4HZ4A 4KX4A 4XIHA 3I69A 4D73B 5DJLA 3CBUA 3HZ4A 3WT1A 3GL5A 4FYUA 2C3TA 5ELGA 1OE8A 2C0EA 4NHWA 3HVXA 5ECOB 1XW5A 1YDKA 3G9BA 3F6FA 1X5EA 2JSZA 4OCFA 3KTBA 2B3SA 4QQ7A 4JR4A 1MD4A 2L59A 3MAKA 4ZILA 5FT3A 2J23A 2HE3A 1EP7A 2PMTA 2FNOA 4XCSA 2R5GA 4ECCA 5J9BA 2ALBA 4IS0A 3FK8A 2O89A 3VI5A 1J08A 2CVBA 4NV2A 2YWNA 5DQSA 4F0BA 2K9FA 2LJKA 2GVPA 4WETA 5GSTA 4KA0A 3C7MA 2TRXA 3ZRDA 2KP1A 5CRDA 4I6XA 4PXOA 5G5FA 2HSYA 3IC4A 4RI6A 4OMVA 2IMDA 2FWHA 5G31A 1OYJA 1X5DA 3F6DA 1OKDA 1EGRA 3EC3A 3G7YA 1TI3A 2WULA 4K9ZA 1TRWA 4WR4A 5CO3A 2B1LA 2KLXA 5G2ZA 5IMAA 2MZCA 3CTGA 3I6AA 2LEGA 4ML6A 3N5OA 3L78A 1JHBA 1Z9HA 4YAPA 4N11A 5CRHA 4I2UA 4MABA 4L5LA 1GNWA 1ZZYA 2P0GA 4A5PA 1YEPA 4V2MA 2FY6A 2VOCA 1SL0B 4CHSA 1JZRA 1T1VA 3QD9A 2FD3A 3PGTA 2HXKA 1XXUA 2H1DA 4G19A 6GSYA 2GSSA 4BPYA 2GQMA 4BWSA 2L4QA 2ON5A 4RQXA 2L4CA 2IFQA 4DEJA 1XG8A 1FW1A 3TKRA 1JZOA 2YJHA 4K5SA 3ZIVA 4BVYB 1GUHA 3R3EA 3HJMA 6GSWA 1O6JA 2PVOC 1B9XC 3GH9A 4EDYA 1SK0A 2H01A 2WRTA 5HR2A 4EIQA 3DWVA 4O5RA 4GCIA 4PX1A 3UVTA 1YF1A 2WCIA 4EUYA 4TW5A 2LS5A 3MIXA 3UOMA 4HU9A 2JSYA 5ELAA 3APOA 2ON7A 5ECPB 2C3NA 2YOIA 3MSZA 5FHIA 4BL7A 1PN0A 3RDWA 3IE3A 5F05A 4Q5NA 3RHCA 2XHFA 5LNKe 4K7NA 1AXDA 3Q6OA 4KDYA 3I43A 4IJ3A 3EURA 2C0FA 1AIUA 3HCZA 3FRCA 3GRXA 4HS1A 4AJ6A 1BX9A 2VCXA 1Z6MA 3F4RA 4TR1A 2L5OA 1Z3EA 4KDUA 3QMXA 2VL9A 4MZCA 3IPZA 1ON4A 3LWAA 4MF7A 4EC0A 1UVZA 5ECMB 3EMPA 7GSSA 1NSWA 2VLVA 2IWTA 4WR5A 5IMVA 5J3RA 4V1Ag 3HYPA 1O81A 3D4MA 2YWMA 4GSSA 4YKGA 2EC4A 3QAVA 2B1KA 3GURA 3D4TA 4LL1B 4TR0A 3CTFA 3GSTA 3KMNA 3ZFBA 3M1GA 2A4HA 1R5AA 4KW6A 2EIRA 4L0UA 1UA5A 1NW2A 3A2VA 1QGVA 1MDKA 4MCUA 3IC8A 1TP9A 3IBHA 3LYPA 3KJYA 1SJ6A 1FOVA 5CREA 4HJMA 3FR9A 3ZFLA 2KOKA 3TDGA 3W6GA 3ZVJA 3LEFA 5ECHB 3UEMA 2B7JA 2CAQA 4XTSA 4ZBAA 1VF3A 1GH2A 3KP9A 4HSCX 4EO3A 2LRTA 4K1FA 1XBSA 4EE0A 5ECQB 1M2BA 4NV5A 1F9MA
chains in the Genus database with same CATH topology
1OE7A 3FYGA 1BQ7A 3WD6A 1B48A 4POLA 1OVNA 5IMCA 1V57A 4BVXB 2GZPA 1PKZA 2YWIA 4POKA 3HZ8A 2XC2A 2R0PA 4PGTA 2JZTA 1K0OA 2P5RA 4AF2A 2O8VB 2OBKA 3TKSE 2H0GA 1NM3A 3TRQA 5J4UA 4GQFA 3KD0A 1V98A 3K8NA 4IELA 4PQ1A 5A4VA 1NHYA 5B7CA 2H75A 3FZ4A 1Q4JA 4XS1A 3M9KA 3VWVA 4TR4A 1SL2B 5DBQA 3PR8A 1O85A 4JEDA 5AN1A 1H4OA 2V41A 5D9XA 5IOXA 5IMFA 5KN0A 4ILFA 3KGKA 2PWJA 3KIJA 5DCHA 1TK8B 4Q5QA 1LBKA 3GKMA 4WKWA 2H30A 3GTUB 4I8BA 1F3BA 4MH3A 3KEBA 16GSA 3R2QA 2H73A 2NDOA 1ZGNA 1ZCPA 2MBTA 2CAIA 3A5WA 1W4VA 1XVWA 3BJ5A 1YJ6A 1AQWA 1QUWA 2VIMA 4MJCA 4DVCA 1GNEA 3U6VA 3GYKA 1YQ1A 2MMOA 3NZNA 3VWXA 4ZBDA 1IYHA 2K8VA 2V1MA 3RHBA 1ST9A 1K3OA 2YNXA 4K0NA 4PURA 1S3CA 2GT6A 2HSHA 3E9JB 2LSTA 3LQ7A 3WGXA 3KH9A 2KHPA 5DALB 1HQOA 1WRYA 1EOHA 1XWCA 4L0WA 3HVVA 1K0AA 2OACA 4J56E 2H6ZA 3D0ZA 1ERVA 2NBSA 4D73A 2OA7A 2ZUPA 4RQRA 3BOAA 2RLIA 4MDCA 4TOPA 1XZOA 2GQLA 5ID2B 4CW9A 3L0HA 5IMDA 4GRFA 3TJGA 3KTLA 4K7IA 2C1YA 2MMNA 3EINA 1X9SB 1XPVA 3KMOA 14GSA 1I9DA 18GSA 1UN2A 1GULA 1Z5YE 2QA2A 1PX7A 1TW9A 3ZMLA 1VF1A 3MWHA 4ACSA 5J9CA 5AIVA 3H8QA 1ZOFA 3GHAA 5DVBA 2J9HA 2QGVA 5F8BA 3O76A 5DAKB 1HD2A 2N5BA 13GSA 3CRUA 3QOUA 1EWXA 2HLSA 4DSQA 4WEYA 4EL1A 2GSTA 4TN8A 1YKAA 5EVOA 4IBPA 12GSA 4Z7XA 1BAYA 2GZZA 3UARA 2F51A 2GLRA 2O87A 4GSNA 2A4VA 3GH6A 1X0RA 2X8GA 1E6BA 1HNCA 1T4ZA 3ZIJA 3GL3A 6GSVA 5DJMA 1Y25A 2I81A 6GSTA 1SK2A 1FHEA 3TRPA 2YP6A 4F03A 4Q5FA 1SD8A 1O8WA 1EP8A 2EIQA 2I4AA 1B4PA 2DMLA 1G6WA 2IJYA 2K8SA 1PKWA 2L5LA 2DIYA 1TDIA 4MH2A 2XBIA 2QKEA 1SYXA 4IJIA 3CMIA 3DMLA 4NAXA 1A8YA 1WP0A 2GZYA 3GKNA 4ZB9A 3EU4A 2AAWA 1ZYNA 3L4NA 5E59A 3RPNA 3TRXA 2V6KA 3HD5A 3M3MA 1ZYQB 4ZL9A 1U6TA 1MDIA 2UZ8A 4TXOB 2NVLA 6GSUA 4IGJA 4FYCA 5D9WA 4BVYA 1U87A 1WWJA 5B8BA 4POMA 5DQYA 1WPIA 4MZWA 5CRWA 2LNSA 5C00A 5KN3A 1R4WA 2Z9SA 5ECLB 3EPTA 3ZMKA 3P2AA 1X9WB 2EIOA 4ZXGA 5H5QA 4V2LA 2GGTA 2B5EA 1TTZA 3HJOA 1PN9A 3DRNA 3FW2A 4HZ2A 2H6XA 5G5EA 3VPTA 2VLTA 1GWCA 4TKYA 5H5RA 2X64A 1QFNA 2LQQA 1K0CA 3F4SA 4CDOA 2CX3A 1BEDA 2F3MA 4USSA 2VCQA 2X4AA 3LG6A 5ECSA 1XWGA 3O3TA 4RI7A 5HQPA 1SKRB 3TOUA 2A2SA 2DKHA 1O8XA 2JZRA 3CXGA 4MLYA 4O7HA 1Z6NA 3GKXA 1T3BA 3QFBC 5H5SA 2VM1A 4WBJA 4AGSA 2H19A 3KP8A 1EOGA 5EL8A 2HYXA 5KOWA 5G1LA 1GTUA 4I2TA 5HFIA 1LU4A 4KCEA 1KTEA 2WJUA 5ECIB 3PINA 1X5CA 1PRXA 1KEBA 1DUGA 4MF5A 2AUVA 2H71A 3ISOA 3GSSA 4FYBA 5A5KA 3QPMA 2C0DA 2DIZA 4ISDA 3QDNA 2YV9A 3G7IA 1ZMAA 2O85A 3BCIA 5J41A 2CT6A 2VCVA 2X8CA 4GXZA 2LRNA 3DEXA 5IPHA 2R0GA 2GDRA 5F0GA 2B7KA 4K0GA 4IP6A 1SK1A 4EDZA 1ZYPA 1V9WA 3H4KA 4X0XA 3CSJA 2FHEA 1XWAA 5J5NA 3RPPA 1USBA 2C80A 4DSSA 4IQ1A 4OWYA 3QCPA 4K6XA 3F63A 1HNAA 4JR6A 5IPGA 3ERWA 2YZHA 4MF6A 2AB6A 4ECBA 1X9MB 2V32A 2WB9A 1T4YA 4KCAA 2OADA 1GRXA 4WF4A 2GSRA 3HA9A 2AYTA 4TR3A 3ZLPA 2X99A 4X1UA 2FCHA 3ZYWA 4I97A 3C1SA 2M46A 3VWWA 2H0IA 1FVJA 4O32A 1ERTA 4BVXA 1DE1A 3KCMA 1XW6A 2VAFA 4GWRA 1EGOA 4HU7A 3GFKA 2RUEA 4FH8A 4K7OA 3W8SA 3UVHA 4EKZA 4PTSA 2AHEA 4NWYA 2WFCA 2FGXA 2C0GA 2R37A 5A4UA 1SKSB 2QC7A 1GL8A 3IK7A 2DJ1A 2DKIA 2RIIA 5G1KA 3GX8A 3HHVA 4WF5A 2H6YA 5G30A 4ZB6A 5AGYA 4O5QA 9GSSA 1PD21 1Y6EA 2NTOA 2FWFA 1ZL9A 2IMEA 2OE1A 2IMFA 2HZEB 3N9JA 2F8FA 2HSMA 4KSMA 3LXTA 2VCWA 3HXSA 1U3IA 3VLNA 2CVDA 3GTUA 5ECRB 3D21A 4KNDA 4H86A 4JU5A 4HJ2A 4QL7A 3TJKA 2P5QA 1N8JA 1SJIA 3M8NA 3DGQA 4ZL7A 4HQSA 4KH7A 3EMXA 1G7OA 2LV3A 1TU7A 2MMAA 3TKSA 1GSSA 3ZTLA 5JCWA 1Q98A 5ECNB 1OC3A 3J7Yb 1GUKA 4ML1A 1XFLA 4G9HA 5B6NA 2K6VA 3QAWA 5DALA 3BD2A 3GMFA 1GSDA 3TKSC 1TOFA 5HR3A 1T00A 2R4VA 6GSXA 2LRCA 1K3YA 5DDLA 1BYEA 1PL1A 3ZZXA 4OO5A 4OFNA 1XVQA 2REMA 3WGDA 5ID2A 1KBNA 3WYWA 1CQHA 4FIWA 2CX4A 1U88A 5D8IA 1V40A 4YH2A 2PBJA 4MMMA 3TOTA 3SWLA 4OD7A 1TKDB 5FWGA 3FHKA 4J2FA 4XS4B 4KDXA 2DLXA 2VM2A 3FZAA 5IQYA 2YWOA 1JLVA 3WGEA 2DJ2A 3ZVJD 1SENA 2YZUA 4O92A 5DAKA 3ZREA 4HQZA 3EWLA 2XBQA 1WE0A 4Z2TA 1PGTA 1DSBA 5F06A 3CSIA 4IN0A 2X49A 3CSHA 4E8EA 2QA1A 1LJRA 1A8LA 4V1Ap 3PH9A 2HRAA 3TCOA 1THXA 2K18A 1B8XA 5L71A 4LA1A 4MJEA 1GSUA 1EEMA 2E0QA 3FKFA 3GV1A 3ME8A 3WT2A 3FY7A 2G2QA 5JCUA 4HI7A 1CQGA 3F3QA 1VF2A 1GLPA 5GAPD 8GSSA 3VURA 1BJXA 2M72A 2PPTA 4KAEA 4TRXA 4ZL8A 2VLUA 3NIVA 2WGRA 3EVIA 1J9BA 1M2AA 3RBTA 3APQA 2HRNA 2HNLA 5GSSA 2L6CA 3P8WA 1A24A 4YAVA 2JU5A 6GSSA 1T7PB 2XPDA 2OKAA 4Q5RA 4FO5A 3GA4A 1YF0A 2GT5A 2VUPA 1VGLA 4OFTA 3KZQA 2A2RA 4MA9A 3ZL5A 1WJKA 3BBYA 2LJAA 3D6IA 1ML6A 4TXOA 1XWBA 2LKUA 3DVXA 2TRCP 4YKFA 1M0UA 3Q18A 2MBSA 4RUVA 3D22A 3US3A 1KNGA 4L5OA 3I9V2 4MPFA 2P31A 4NMUA 3LSZA 4DSRA 3LW9A 4ZBBA 3O6TA 2GS3A 2IN3A 1A0FA 2DJ3A 3MYDA 4F9ZA 3UIWA 4KB3A 3QFAC 4MPGA 2VL2A 1GTAA 2R0CA 4PUFC 3SBCA 1AW9A 2C4JA 4GF0A 1GSEA 5HFKA 2LTKA 5INYA 3TGZA 4G0LA 2ZCTA 2GTUA 2E2MA 4XRDA 1DE2A 2PUKC 4CY8A 4ECIA 3EYTA 1FAAA 3P7XA 2HZFA 2VL2C 1AAZA 5D9VA 3KM6A 2AV4A 1GSQA 2B5YA 2LQOA 2H74A 4LMWA 2H66A 5KN1A 2R3XA 2O7KA 3UJ1A 2H0HA 2YN1A 1F6MC 1TU8A 1XWKA 1FOHA 1H75A 5B8AA 3IAM2 2OJLA 4JRRA 1TK0B 20GSA 3FZ5A 4K2DA 3FR6A 1FB6A 1OC9B 4IVFA 4KSOA 1SKWB 1MEKA 4LLRA 2CA8A 5IOWA 3DKSA 1RW1A 3BCKA 5COHA 4TVEA 2VL3A 5CAXA 1RQMA 4GTUA 2B6MA 2L57A 4EXJA 1XOAA 2XPEA 2IMIA 4LL4B 3L9UA 3VFIA 5EPFA 2HFDA 1JFUA 2H1AA 2VD0A 2H72A 2B5XA 5JWOB 4MNNA 5ENUA 1TRVA 4F2IA 3LYKA 5IMZA 2DJJA 2GQKA 1HNBA 1DBYA 1M7TA 3TJFA 2C3QA 1IYIA 1VF4A 3G7JA 5IM9A 4ZIJA 1M99A 4K5RA 2YV7A 4XRAA 1YKCA 1GSFA 1TI1A 2M80A 3D5JA 1K0BA 19GSA 5KN2A 2JL4A 3FR3A 3KXOA 5D73A 1GSYA 1A2MA 1F3AA 1O73A 4MJAA 4E8HA 2WZ9A 3M9JA 5LD0A 4GLTA 4JBBA 2VD1A 1PL2A 3IAS2 1PA3A 4YQMA 1PMTA 3LGCA 4PQIA 2N5FA 4V2NA 1G7EA 4HEA2 4PUAA 2FA4A 4K2XA 4BA7A 1S3DA 2HRKA 1MTCA 3J7Yk 4NPBA 1FB0A 1AQVA 3FMWA 1F37A 5GAND 2IL3A 4PNFA 2E2GA 4KUNA 3A5IA 3ED3A 2JACA 1GTIA 1N2AA 1MD3A 4GSTA 1SU9A 1A0RP 1FVKA 2HZEA 1FG4A 22GSA 3TKQA 3DD3A 1QMVA 3E0UA 4GQCA 4OCEA 3A2XA 1XCCA 3GX0A 3HY2A 5CP1A 5ECKB 4KF9A 1GP1A 1A2LA 4EIPA 2I1UA 1JLWA 1S3AA 2X8HA 2I3YA 1A2JA 1M2DA 2KUCA 3HDCA 5BMUA 1GLQA 4Z2RA 3ZITA 2CZ2A 1THOA 4AJ8A 2KP2A 1R26A 1K0NA 4MK3A 5HR0A 4TXVA 2VCTA 1YZXA 1I5GA 2VCZA 4MZBA 1PX6A 1XOBA 2G0FA 4NXIA 4HOJA 1TXXA 1FO5A 5D93A 3VWUA 5A4WA 2OE0A 3F9UA 3VI7A 3LJRA 1QK8A 4K8MA 11GSA 2OE3A 1SL1B 1AUCA 3C1RA 4OFMA 5AISA 3S9FA 2DJ0A 2PN8A 1B4QA 1Z7PA 17GSA 2BJXA 2FLSA 1ERWA 2H70A 1C72A 1PSQA 1TK5B 3C71A 4N30A 5CYYA 3F3RA 5CNWA 2YANA 2V2GA 1V58A 2GSQA 4QL9A 4BWQA 3RAZA 4IKHA 4IHUA 4XS4A 2IFQB 3GUSA 1AC1A 2C8UA 4IQAA 2IMKA 2E7PA 4ZB8A 4KE3A 4HDEA 1EZKA 1VRSD 4XS6A 4CY6A 1ERUA 2YJ7A 2F8AA 2PERA 2LUSA 5C04A 2TIRA 5IO0A 5D96A 3A2WA 2BMXA 3HJPA 4POBA 4FQUA 4KGIA 3CRTA 2RM6A 2H1BA 3GNJA 1A23A 1E2YA 5E4WA 2DJKA 4X43A 1YEXA 2HI7A 3IHQA 2CQ9A 2YPMA 3FEUA 1K0MA 4DSSB 3IRAA 3LXZA 3EU3A 3DXBA 1UC7A 3ERFA 2YCDA 4X4JA 1XW9A 4BL7B 3IA1A 1EV9A 1TJDA 2HT9A 2LNTA 4WBRD 3IR4A 3DYRA 5KEJA 2PU9C 5CRGA 2BTOT 3IV4A 2FWGA 2HRFA 1V2AA 1TRUA 5IIZA 2A2PA 3F8UA 1QQ2A 2CV4A 4MP4A 1GUMA 2VO4A 2MMZA 2L6DA 3A3TA 3H79A 5B6MA 1AQXA 2H76A 4TR1B 5JWQB 3QAGA 3TUEA 3VK9A 1EEJA 3LFLA 1URMA 1ABAA 4J57E 2DMMA 3DIEA 3W8JA 1BG5A 5JCGA 4G2EA 3P90A 4YQUA 1SYRA 1HYUA 5IO2A 2QSIA 1WMJA 4WXTA 2D2ZA 2WS2A 2DBCA 3EE2A 5LCZA 5F07A 4NHZA 1JZWA 4LMVA 1T8EB 1MDJA 3UBLA 5D9TA 5GZZB 4G0IA 3IDVA 4MJBA 2DSAA 5JWRB 2CZ3A 1GTBA 3H1NA 3M0FA 3TJJA 1G6YA 3F4TA 2CVKA 4F82A 2R2JA 1TRSA 3JCML 5BRTA 3PPUA 4N10A 1O7UA 1R5PA 5AIXA 1Z7RA 3LORA 2AJQB 3IHGA 3FZ9A 4N0ZA 2F9SA 4ULXA 2IPAA 1OC8A 4AJ7A 3OR5A 3KH7A 2JZSA 4PNGA 1OKTA 1RK4A 1XIYA 4EVMA 3ME7A 2IIYA 3UBKA 4F0CA 1NHOA 3IK9A 1ACVA 5KOXA 3HKRA 4ICYA 3AY8A 1K3LA 5DCGA 4O5UA 2LJRA 3UAPA 3IOSA 1ILOA 2NPBA 1M9AA 3H93A 3ERGA 2MYGA 2V6OA 2FWEA 3L9VA 4YQVA 4L8EA 1R7HA 4ID0A 4OO4A 3UMAA 3NOFA 4IP1A 2FA8A 1EV4A 2N5AA 3U5RE 1SD9A 1K0DA 3CYNA 2PGTA 3HVSA 2WDUA 1PQNA 3MNGA 2FUG2 1OC9A 1QXHA 3TB2A 4PQHA 2PVQA 1U3AA 1WOUA 1G0TA 3APSA 1M9BA 3GKKA 4EF0A 5ABRA 4P3YB 2H1GA 3IXRA 1YY7A 2ES7A 4G0KA 5EY6A 1SJZA 2ZNMA 3Q74A 4HUAA 4JZQA 4I5QA 5HFGA 5HR1A 1F2EA 1OAZA 3MDKA 3VPQA 2RUFA 3TKPA 1WIKA 2R6KA 3L9SA 4JE1A 3GIXA 3E3EA 3TJBA 10GSA 4ECJA 3GN3A 1ZYEA 2H8LA 4N0VA 4XHMA 3F0IA 1W89A 3V1WA 4IW9A 3C73A 1JZDA 3QR6A 2DC5A 1J0FA 2JADA 4Z2UA 1B9YC 4G10A 3Q19A 2RM5A 3C8EA 2I9HA 3UL3A 2OBIA 3DVWA 4HZ4A 4KX4A 4XIHA 3I69A 4D73B 5DJLA 3CBUA 3HZ4A 3WT1A 3GL5A 4FYUA 2C3TA 5ELGA 1OE8A 2C0EA 4NHWA 3HVXA 5ECOB 1XW5A 1YDKA 3G9BA 3F6FA 1X5EA 2JSZA 4OCFA 3KTBA 2B3SA 4QQ7A 4JR4A 1MD4A 2L59A 3MAKA 4ZILA 5FT3A 2J23A 2HE3A 1EP7A 2PMTA 2FNOA 4XCSA 2R5GA 4ECCA 5J9BA 2ALBA 4IS0A 3FK8A 2O89A 3VI5A 1J08A 2CVBA 4NV2A 2YWNA 5DQSA 4F0BA 2K9FA 2LJKA 2GVPA 4WETA 5GSTA 4KA0A 3C7MA 2TRXA 3ZRDA 2KP1A 5CRDA 4I6XA 4PXOA 5G5FA 2HSYA 3IC4A 4RI6A 4OMVA 2IMDA 2FWHA 5G31A 1OYJA 1X5DA 3F6DA 1OKDA 1EGRA 3EC3A 3G7YA 1TI3A 2WULA 4K9ZA 1TRWA 4WR4A 5CO3A 2B1LA 2KLXA 5G2ZA 5IMAA 2MZCA 3CTGA 3I6AA 2LEGA 4ML6A 3N5OA 3L78A 1JHBA 1Z9HA 4YAPA 4N11A 5CRHA 4I2UA 4MABA 4L5LA 1GNWA 1ZZYA 2P0GA 4A5PA 1YEPA 4V2MA 2FY6A 2VOCA 1SL0B 4CHSA 1JZRA 1T1VA 3QD9A 2FD3A 3PGTA 2HXKA 1XXUA 2H1DA 4G19A 6GSYA 2GSSA 4BPYA 2GQMA 4BWSA 2L4QA 2ON5A 4RQXA 2L4CA 2IFQA 4DEJA 1FW1A 3TKRA 1JZOA 2YJHA 4K5SA 3ZIVA 4BVYB 1GUHA 3R3EA 3HJMA 6GSWA 1O6JA 2PVOC 1B9XC 3GH9A 4EDYA 1SK0A 2H01A 2WRTA 5HR2A 4EIQA 3DWVA 4O5RA 4GCIA 4PX1A 3UVTA 1YF1A 2WCIA 4EUYA 4TW5A 2LS5A 3MIXA 3UOMA 4HU9A 2JSYA 5ELAA 3APOA 2ON7A 5ECPB 2C3NA 2YOIA 3MSZA 5FHIA 4BL7A 1PN0A 3RDWA 3IE3A 5F05A 4Q5NA 3RHCA 2XHFA 5LNKe 4K7NA 1AXDA 3Q6OA 4KDYA 3I43A 4IJ3A 3EURA 2C0FA 1AIUA 3HCZA 3FRCA 3GRXA 4HS1A 4AJ6A 1BX9A 2VCXA 1Z6MA 3F4RA 4TR1A 2L5OA 1Z3EA 4KDUA 3QMXA 2VL9A 4MZCA 3IPZA 1ON4A 3LWAA 4MF7A 4EC0A 1UVZA 5ECMB 3EMPA 7GSSA 1NSWA 2VLVA 2IWTA 4WR5A 5IMVA 5J3RA 4V1Ag 3HYPA 1O81A 3D4MA 2YWMA 4GSSA 4YKGA 2EC4A 3QAVA 2B1KA 3GURA 3D4TA 4LL1B 4TR0A 3CTFA 3GSTA 3KMNA 3ZFBA 3M1GA 2A4HA 1R5AA 4KW6A 2EIRA 4L0UA 1UA5A 1NW2A 3A2VA 1QGVA 1MDKA 4MCUA 3IC8A 1TP9A 3IBHA 3LYPA 3KJYA 1SJ6A 1FOVA 5CREA 4HJMA 3FR9A 3ZFLA 2KOKA 3TDGA 3W6GA 3ZVJA 3LEFA 5ECHB 3UEMA 2B7JA 2CAQA 4XTSA 4ZBAA 1VF3A 1GH2A 3KP9A 4EO3A 2LRTA 4K1FA 1XBSA 4EE0A 5ECQB 1M2BA 4NV5A 1F9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OE7 A;  3FYG A;  1BQ7 A;  3WD6 A;  1B48 A;  4POL A;  1OVN A;  5IMC A;  1V57 A;  2GZP A;  1PKZ A;  2YWI A;  4POK A;  3HZ8 A;  2XC2 A;  4PGT A;  2JZT A;  1K0O A;  2P5R A;  4AF2 A;  2O8V B;  2OBK A;  3TKS E;  2H0G A;  1NM3 A;  3TRQ A;  5J4U A;  4GQF A;  3KD0 A;  1V98 A;  3K8N A;  4IEL A;  4PQ1 A;  5A4V A;  1NHY A;  5B7C A;  2H75 A;  3FZ4 A;  1Q4J A;  4XS1 A;  3M9K A;  3VWV A;  4TR4 A;  1SL2 B;  5DBQ A;  3PR8 A;  1O85 A;  4JED A;  5AN1 A;  1H4O A;  2V41 A;  5D9X A;  5IOX A;  5IMF A;  5KN0 A;  4ILF A;  3KGK A;  2PWJ A;  3KIJ A;  5DCH A;  1TK8 B;  4Q5Q A;  1LBK A;  3GKM A;  4WKW A;  2H30 A;  3GTU B;  4I8B A;  1F3B A;  4MH3 A;  3KEB A;  16GS A;  3R2Q A;  2H73 A;  2NDO A;  1ZGN A;  1ZCP A;  2MBT A;  2CAI A;  3A5W A;  1W4V A;  1XVW A;  3BJ5 A;  1YJ6 A;  1AQW A;  1QUW A;  2VIM A;  4MJC A;  4DVC A;  1GNE A;  3U6V A;  3GYK A;  1YQ1 A;  2MMO A;  3NZN A;  3VWX A;  4ZBD A;  1IYH A;  2K8V A;  2V1M A;  3RHB A;  1ST9 A;  1K3O A;  2YNX A;  4K0N A;  4PUR A;  1S3C A;  2GT6 A;  2HSH A;  3E9J B;  2LST A;  3LQ7 A;  3WGX A;  3KH9 A;  2KHP A;  5DAL B;  1HQO A;  1WRY A;  1EOH A;  1XWC A;  4L0W A;  3HVV A;  1K0A A;  2OAC A;  4J56 E;  2H6Z A;  3D0Z A;  1ERV A;  2NBS A;  4D73 A;  2OA7 A;  2ZUP A;  4RQR A;  3BOA A;  2RLI A;  4MDC A;  4TOP A;  1XZO A;  2GQL A;  5ID2 B;  4CW9 A;  3L0H A;  5IMD A;  4GRF A;  3TJG A;  3KTL A;  4K7I A;  2C1Y A;  2MMN A;  3EIN A;  1X9S B;  1XPV A;  3KMO A;  14GS A;  1I9D A;  18GS A;  1UN2 A;  1GUL A;  1Z5Y E;  1PX7 A;  1TW9 A;  3ZML A;  1VF1 A;  3MWH A;  4ACS A;  5J9C A;  5AIV A;  3H8Q A;  1ZOF A;  3GHA A;  5DVB A;  2J9H A;  2QGV A;  5F8B A;  3O76 A;  5DAK B;  1HD2 A;  2N5B A;  13GS A;  3CRU A;  3QOU A;  1EWX A;  2HLS A;  4DSQ A;  4WEY A;  4EL1 A;  2GST A;  4TN8 A;  1YKA A;  5EVO A;  4IBP A;  12GS A;  4Z7X A;  1BAY A;  2GZZ A;  3UAR A;  2F51 A;  2GLR A;  2O87 A;  4GSN A;  2A4V A;  3GH6 A;  1X0R A;  2X8G A;  1E6B A;  1HNC A;  1T4Z A;  3ZIJ A;  3GL3 A;  6GSV A;  5DJM A;  1Y25 A;  2I81 A;  6GST A;  1SK2 A;  1FHE A;  3TRP A;  2YP6 A;  4F03 A;  4Q5F A;  1SD8 A;  1O8W A;  1EP8 A;  2EIQ A;  2I4A A;  1B4P A;  2DML A;  1G6W A;  2IJY A;  2K8S A;  1PKW A;  2L5L A;  2DIY A;  1TDI A;  4MH2 A;  2XBI A;  2QKE A;  1SYX A;  3CMI A;  4IJI A;  3DML A;  4NAX A;  1A8Y A;  1WP0 A;  2GZY A;  3GKN A;  4ZB9 A;  3EU4 A;  2AAW A;  3L4N A;  5E59 A;  3RPN A;  3TRX A;  2V6K A;  3HD5 A;  3M3M A;  1ZYQ B;  4ZL9 A;  1U6T A;  1MDI A;  4TXO B;  2NVL A;  6GSU A;  4IGJ A;  4FYC A;  5D9W A;  4BVY A;  1U87 A;  1WWJ A;  5B8B A;  4POM A;  5DQY A;  1WPI A;  4MZW A;  5CRW A;  2LNS A;  5C00 A;  5KN3 A;  1R4W A;  2Z9S A;  5ECL B;  3ZMK A;  3P2A A;  1X9W B;  2EIO A;  4ZXG A;  5H5Q A;  4V2L A;  2GGT A;  2B5E A;  1TTZ A;  3HJO A;  1PN9 A;  3DRN A;  3FW2 A;  4HZ2 A;  2H6X A;  5G5E A;  3VPT A;  2VLT A;  1GWC A;  4TKY A;  5H5R A;  2X64 A;  1QFN A;  2LQQ A;  1K0C A;  3F4S A;  4CDO A;  2CX3 A;  1BED A;  2F3M A;  2VCQ A;  3LG6 A;  5ECS A;  1XWG A;  3O3T A;  4RI7 A;  5HQP A;  1SKR B;  3TOU A;  2A2S A;  1O8X A;  2JZR A;  3CXG A;  4MLY A;  4O7H A;  1Z6N A;  3GKX A;  1T3B A;  3QFB C;  5H5S A;  2VM1 A;  4WBJ A;  4AGS A;  2H19 A;  3KP8 A;  1EOG A;  5EL8 A;  2HYX A;  5G1L A;  1GTU A;  4I2T A;  5HFI A;  1LU4 A;  4KCE A;  1KTE A;  2WJU A;  5ECI B;  3PIN A;  1X5C A;  1PRX A;  1KEB A;  1DUG A;  4MF5 A;  2AUV A;  2H71 A;  3ISO A;  3GSS A;  4FYB A;  5A5K A;  3QPM A;  2C0D A;  2DIZ A;  4ISD A;  3QDN A;  2YV9 A;  3G7I A;  1ZMA A;  2O85 A;  3BCI A;  5J41 A;  2CT6 A;  2VCV A;  2X8C A;  4GXZ A;  2LRN A;  3DEX A;  5IPH A;  2GDR A;  5F0G A;  2B7K A;  4K0G A;  4IP6 A;  1SK1 A;  4EDZ A;  1V9W A;  3H4K A;  4X0X A;  3CSJ A;  2FHE A;  1XWA A;  5J5N A;  3RPP A;  1USB A;  2C80 A;  4DSS A;  4IQ1 A;  4OWY A;  3QCP A;  4K6X A;  3F63 A;  1HNA A;  4JR6 A;  5IPG A;  3ERW A;  2YZH A;  4MF6 A;  2AB6 A;  4ECB A;  1X9M B;  2V32 A;  2WB9 A;  1T4Y A;  4KCA A;  2OAD A;  1GRX A;  4WF4 A;  2GSR A;  3HA9 A;  2AYT A;  4TR3 A;  3ZLP A;  2X99 A;  4X1U A;  2FCH A;  3ZYW A;  4I97 A;  3C1S A;  2M46 A;  3VWW A;  2H0I A;  1FVJ A;  4O32 A;  1ERT A;  4BVX A;  1DE1 A;  3KCM A;  1XW6 A;  2VAF A;  4GWR A;  1EGO A;  4HU7 A;  3GFK A;  2RUE A;  4FH8 A;  4K7O A;  3W8S A;  3UVH A;  4EKZ A;  2AHE A;  4NWY A;  2WFC A;  2FGX A;  2C0G A;  2R37 A;  5A4U A;  1SKS B;  2QC7 A;  1GL8 A;  3IK7 A;  2DJ1 A;  2RII A;  5G1K A;  3GX8 A;  3HHV A;  4WF5 A;  2H6Y A;  5G30 A;  4ZB6 A;  5AGY A;  9GSS A;  1PD2 1;  1Y6E A;  2NTO A;  2FWF A;  1ZL9 A;  2IME A;  2OE1 A;  2IMF A;  2HZE B;  3N9J A;  2F8F A;  4KSM A;  3LXT A;  2VCW A;  3HXS A;  1U3I A;  3VLN A;  2CVD A;  3GTU A;  5ECR B;  3D21 A;  4KND A;  4H86 A;  4JU5 A;  4HJ2 A;  4QL7 A;  3TJK A;  2P5Q A;  1N8J A;  1SJI A;  3M8N A;  3DGQ A;  4ZL7 A;  4HQS A;  4KH7 A;  3EMX A;  1G7O A;  2LV3 A;  1TU7 A;  2MMA A;  3TKS A;  1GSS A;  3ZTL A;  5JCW A;  1Q98 A;  5ECN B;  1OC3 A;  3J7Y b;  1GUK A;  4ML1 A;  1XFL A;  4G9H A;  5B6N A;  2K6V A;  3QAW A;  5DAL A;  3BD2 A;  3GMF A;  1GSD A;  3TKS C;  1TOF A;  5HR3 A;  1T00 A;  2R4V A;  6GSX A;  2LRC A;  1K3Y A;  5DDL A;  1BYE A;  1PL1 A;  3ZZX A;  4OO5 A;  4OFN A;  1XVQ A;  2REM A;  3WGD A;  5ID2 A;  1KBN A;  3WYW A;  1CQH A;  4FIW A;  2CX4 A;  1U88 A;  5D8I A;  1V40 A;  4YH2 A;  2PBJ A;  4MMM A;  3TOT A;  3SWL A;  4OD7 A;  1TKD B;  5FWG A;  3FHK A;  4J2F A;  4XS4 B;  4KDX A;  2DLX A;  2VM2 A;  3FZA A;  5IQY A;  2YWO A;  1JLV A;  3WGE A;  2DJ2 A;  3ZVJ D;  1SEN A;  2YZU A;  4O92 A;  5DAK A;  3ZRE A;  4HQZ A;  3EWL A;  2XBQ A;  1WE0 A;  1PGT A;  1DSB A;  5F06 A;  3CSI A;  4IN0 A;  3CSH A;  4E8E A;  1LJR A;  1A8L A;  4V1A p;  3PH9 A;  3TCO A;  1THX A;  2K18 A;  1B8X A;  5L71 A;  4LA1 A;  4MJE A;  1GSU A;  1EEM A;  2E0Q A;  3FKF A;  3GV1 A;  3ME8 A;  3WT2 A;  3FY7 A;  2G2Q A;  5JCU A;  4HI7 A;  1CQG A;  3F3Q A;  1VF2 A;  1GLP A;  5GAP D;  8GSS A;  3VUR A;  1BJX A;  2M72 A;  2PPT A;  4KAE A;  4TRX A;  4ZL8 A;  2VLU A;  3NIV A;  2WGR A;  3EVI A;  1J9B A;  1M2A A;  3RBT A;  3APQ A;  2HRN A;  2HNL A;  5GSS A;  2L6C A;  3P8W A;  1A24 A;  4YAV A;  2JU5 A;  6GSS A;  1T7P B;  2XPD A;  2OKA A;  4Q5R A;  4FO5 A;  3GA4 A;  1YF0 A;  2GT5 A;  2VUP A;  1VGL A;  4OFT A;  3KZQ A;  2A2R A;  4MA9 A;  3ZL5 A;  1WJK A;  3BBY A;  2LJA A;  3D6I A;  1ML6 A;  4TXO A;  1XWB A;  2LKU A;  3DVX A;  2TRC P;  1M0U A;  3Q18 A;  2MBS A;  4RUV A;  3D22 A;  3US3 A;  1KNG A;  4L5O A;  3I9V 2;  4MPF A;  2P31 A;  4NMU A;  3LSZ A;  4DSR A;  4ZBB A;  3O6T A;  2GS3 A;  2IN3 A;  1A0F A;  2DJ3 A;  4F9Z A;  3UIW A;  4KB3 A;  3QFA C;  4MPG A;  2VL2 A;  1GTA A;  4PUF C;  3SBC A;  1AW9 A;  2C4J A;  4GF0 A;  1GSE A;  5HFK A;  2LTK A;  5INY A;  3TGZ A;  2ZCT A;  2GTU A;  2E2M A;  4XRD A;  1DE2 A;  2PUK C;  4ECI A;  3EYT A;  1FAA A;  3P7X A;  2HZF A;  2VL2 C;  1AAZ A;  5D9V A;  3KM6 A;  2AV4 A;  1GSQ A;  2B5Y A;  2LQO A;  2H74 A;  4LMW A;  2H66 A;  5KN1 A;  2R3X A;  2O7K A;  3UJ1 A;  2H0H A;  2YN1 A;  1F6M C;  1TU8 A;  1XWK A;  1H75 A;  5B8A A;  3IAM 2;  2OJL A;  4JRR A;  1TK0 B;  20GS A;  3FZ5 A;  4K2D A;  3FR6 A;  1FB6 A;  1OC9 B;  4IVF A;  4KSO A;  1SKW B;  1MEK A;  4LLR A;  2CA8 A;  5IOW A;  3DKS A;  1RW1 A;  3BCK A;  5COH A;  4TVE A;  2VL3 A;  5CAX A;  1RQM A;  4GTU A;  2B6M A;  2L57 A;  4EXJ A;  1XOA A;  2XPE A;  2IMI A;  4LL4 B;  3L9U A;  3VFI A;  5EPF A;  2HFD A;  1JFU A;  2H1A A;  2VD0 A;  2H72 A;  2B5X A;  5JWO B;  5ENU A;  1TRV A;  4F2I A;  3LYK A;  5IMZ A;  2DJJ A;  2GQK A;  1HNB A;  1DBY A;  1M7T A;  3TJF A;  2C3Q A;  1IYI A;  1VF4 A;  3G7J A;  5IM9 A;  4ZIJ A;  1M99 A;  2YV7 A;  4XRA A;  1YKC A;  1GSF A;  1TI1 A;  2M80 A;  3D5J A;  1K0B A;  19GS A;  5KN2 A;  2JL4 A;  3FR3 A;  3KXO A;  5D73 A;  1GSY A;  1A2M A;  1F3A A;  1O73 A;  4MJA A;  4E8H A;  2WZ9 A;  3M9J A;  5LD0 A;  4GLT A;  4JBB A;  2VD1 A;  1PL2 A;  3IAS 2;  1PA3 A;  4YQM A;  1PMT A;  3LGC A;  4PQI A;  2N5F A;  4V2N A;  1G7E A;  4HEA 2;  4PUA A;  2FA4 A;  4BA7 A;  1S3D A;  1MTC A;  3J7Y k;  4NPB A;  1FB0 A;  1AQV A;  1F37 A;  5GAN D;  2IL3 A;  4PNF A;  2E2G A;  4KUN A;  3ED3 A;  2JAC A;  1GTI A;  1N2A A;  1MD3 A;  4GST A;  1SU9 A;  1A0R P;  1FVK A;  2HZE A;  1FG4 A;  22GS A;  3TKQ A;  3DD3 A;  1QMV A;  3E0U A;  4GQC A;  4OCE A;  3A2X A;  1XCC A;  3GX0 A;  3HY2 A;  5CP1 A;  5ECK B;  1GP1 A;  1A2L A;  2I1U A;  1JLW A;  1S3A A;  2X8H A;  2I3Y A;  1A2J A;  1M2D A;  2KUC A;  3HDC A;  1GLQ A;  3ZIT A;  2CZ2 A;  1THO A;  4AJ8 A;  2KP2 A;  1R26 A;  1K0N A;  4MK3 A;  5HR0 A;  4TXV A;  2VCT A;  1YZX A;  1I5G A;  2VCZ A;  4MZB A;  1PX6 A;  1XOB A;  2G0F A;  4NXI A;  4HOJ A;  1TXX A;  1FO5 A;  5D93 A;  3VWU A;  5A4W A;  2OE0 A;  3F9U A;  3VI7 A;  3LJR A;  1QK8 A;  4K8M A;  11GS A;  2OE3 A;  1SL1 B;  1AUC A;  3C1R A;  4OFM A;  5AIS A;  3S9F A;  2DJ0 A;  2PN8 A;  1B4Q A;  1Z7P A;  17GS A;  2BJX A;  2FLS A;  1ERW A;  2H70 A;  1C72 A;  1PSQ A;  1TK5 B;  3C71 A;  4N30 A;  5CYY A;  3F3R A;  5CNW A;  2YAN A;  2V2G A;  1V58 A;  2GSQ A;  4QL9 A;  4BWQ A;  3RAZ A;  4IKH A;  4IHU A;  4XS4 A;  2IFQ B;  3GUS A;  1AC1 A;  2C8U A;  4IQA A;  2IMK A;  2E7P A;  4ZB8 A;  4KE3 A;  4HDE A;  1EZK A;  1VRS D;  4XS6 A;  1ERU A;  2YJ7 A;  2F8A A;  2PER A;  2LUS A;  5C04 A;  2TIR A;  5IO0 A;  5D96 A;  3A2W A;  2BMX A;  3HJP A;  4POB A;  4KGI A;  3CRT A;  2RM6 A;  2H1B A;  3GNJ A;  1A23 A;  1E2Y A;  5E4W A;  2DJK A;  4X43 A;  1YEX A;  2HI7 A;  3IHQ A;  2CQ9 A;  2YPM A;  3FEU A;  1K0M A;  4DSS B;  3IRA A;  3LXZ A;  3EU3 A;  3DXB A;  1UC7 A;  3ERF A;  2YCD A;  1XW9 A;  3IA1 A;  1EV9 A;  1TJD A;  2HT9 A;  2LNT A;  4WBR D;  3IR4 A;  3DYR A;  5KEJ A;  2PU9 C;  5CRG A;  2BTO T;  3IV4 A;  2FWG A;  2HRF A;  1V2A A;  1TRU A;  5IIZ A;  3F8U A;  1QQ2 A;  2CV4 A;  4MP4 A;  1GUM A;  2VO4 A;  2MMZ A;  2L6D A;  3A3T A;  3H79 A;  5B6M A;  1AQX A;  2H76 A;  4TR1 B;  5JWQ B;  3QAG A;  3TUE A;  3VK9 A;  1EEJ A;  3LFL A;  1URM A;  1ABA A;  4J57 E;  2DMM A;  3DIE A;  3W8J A;  1BG5 A;  5JCG A;  4G2E A;  3P90 A;  4YQU A;  1SYR A;  1HYU A;  5IO2 A;  2QSI A;  1WMJ A;  4WXT A;  2D2Z A;  2WS2 A;  2DBC A;  3EE2 A;  5LCZ A;  5F07 A;  4NHZ A;  1JZW A;  4LMV A;  1T8E B;  1MDJ A;  3UBL A;  5D9T A;  5GZZ B;  3IDV A;  4MJB A;  2DSA A;  5JWR B;  2CZ3 A;  1GTB A;  3H1N A;  3M0F A;  3TJJ A;  1G6Y A;  3F4T A;  2CVK A;  4F82 A;  2R2J A;  1TRS A;  3JCM L;  4N10 A;  1O7U A;  1R5P A;  5AIX A;  1Z7R A;  3LOR A;  2AJQ B;  3FZ9 A;  4N0Z A;  2F9S A;  4ULX A;  2IPA A;  1OC8 A;  4AJ7 A;  3OR5 A;  3KH7 A;  2JZS A;  4PNG A;  1OKT A;  1RK4 A;  1XIY A;  4EVM A;  3ME7 A;  2IIY A;  3UBK A;  4F0C A;  1NHO A;  3IK9 A;  1ACV A;  3HKR A;  3AY8 A;  1K3L A;  5DCG A;  2LJR A;  3UAP A;  3IOS A;  1ILO A;  2NPB A;  1M9A A;  3H93 A;  3ERG A;  2MYG A;  2V6O A;  2FWE A;  3L9V A;  4YQV A;  4L8E A;  1R7H A;  4ID0 A;  4OO4 A;  3UMA A;  3NOF A;  4IP1 A;  2FA8 A;  1EV4 A;  2N5A A;  3U5R E;  1SD9 A;  1K0D A;  3CYN A;  2PGT A;  3HVS A;  2WDU A;  1PQN A;  3MNG A;  2FUG 2;  1OC9 A;  1QXH A;  3TB2 A;  4PQH A;  2PVQ A;  1U3A A;  1WOU A;  1G0T A;  3APS A;  1M9B A;  3GKK A;  4EF0 A;  5ABR A;  4P3Y B;  2H1G A;  3IXR A;  1YY7 A;  2ES7 A;  5EY6 A;  1SJZ A;  2ZNM A;  3Q74 A;  4HUA A;  4JZQ A;  4I5Q A;  5HFG A;  5HR1 A;  1F2E A;  1OAZ A;  3MDK A;  3VPQ A;  2RUF A;  3TKP A;  1WIK A;  2R6K A;  3L9S A;  4JE1 A;  3GIX A;  3E3E A;  3TJB A;  10GS A;  4ECJ A;  3GN3 A;  1ZYE A;  2H8L A;  4N0V A;  4XHM A;  3F0I A;  1W89 A;  3V1W A;  4IW9 A;  3C73 A;  1JZD A;  3QR6 A;  2DC5 A;  1J0F A;  2JAD A;  1B9Y C;  4G10 A;  3Q19 A;  2RM5 A;  3C8E A;  2I9H A;  3UL3 A;  2OBI A;  3DVW A;  4HZ4 A;  4KX4 A;  4XIH A;  3I69 A;  4D73 B;  5DJL A;  3CBU A;  3HZ4 A;  3WT1 A;  3GL5 A;  4FYU A;  2C3T A;  5ELG A;  1OE8 A;  2C0E A;  4NHW A;  3HVX A;  5ECO B;  1XW5 A;  1YDK A;  3G9B A;  3F6F A;  1X5E A;  2JSZ A;  4OCF A;  3KTB A;  2B3S A;  4QQ7 A;  4JR4 A;  1MD4 A;  2L59 A;  3MAK A;  4ZIL A;  5FT3 A;  2J23 A;  2HE3 A;  1EP7 A;  2PMT A;  2FNO A;  4XCS A;  2R5G A;  4ECC A;  5J9B A;  2ALB A;  4IS0 A;  3FK8 A;  2O89 A;  3VI5 A;  1J08 A;  2CVB A;  4NV2 A;  2YWN A;  5DQS A;  4F0B A;  2K9F A;  2LJK A;  2GVP A;  4WET A;  5GST A;  4KA0 A;  3C7M A;  2TRX A;  3ZRD A;  2KP1 A;  5CRD A;  4I6X A;  4PXO A;  5G5F A;  2HSY A;  3IC4 A;  4RI6 A;  4OMV A;  2IMD A;  2FWH A;  5G31 A;  1OYJ A;  1X5D A;  3F6D A;  1OKD A;  1EGR A;  3EC3 A;  3G7Y A;  1TI3 A;  2WUL A;  4K9Z A;  1TRW A;  4WR4 A;  5CO3 A;  2B1L A;  2KLX A;  5G2Z A;  5IMA A;  2MZC A;  3CTG A;  3I6A A;  2LEG A;  4ML6 A;  3N5O A;  3L78 A;  1JHB A;  1Z9H A;  4YAP A;  4N11 A;  5CRH A;  4I2U A;  4MAB A;  4L5L A;  1GNW A;  1ZZY A;  2P0G A;  1YEP A;  4V2M A;  2FY6 A;  2VOC A;  1SL0 B;  4CHS A;  1JZR A;  1T1V A;  3QD9 A;  2FD3 A;  3PGT A;  2HXK A;  1XXU A;  2H1D A;  4G19 A;  6GSY A;  2GSS A;  4BPY A;  2GQM A;  4BWS A;  2L4Q A;  2ON5 A;  4RQX A;  2L4C A;  2IFQ A;  4DEJ A;  1FW1 A;  3TKR A;  1JZO A;  2YJH A;  3ZIV A;  1GUH A;  3HJM A;  6GSW A;  1O6J A;  2PVO C;  1B9X C;  3GH9 A;  4EDY A;  1SK0 A;  2H01 A;  2WRT A;  5HR2 A;  3DWV A;  4O5R A;  4GCI A;  4PX1 A;  3UVT A;  1YF1 A;  2WCI A;  4EUY A;  4TW5 A;  2LS5 A;  3UOM A;  4HU9 A;  2JSY A;  5ELA A;  3APO A;  2ON7 A;  5ECP B;  2C3N A;  2YOI A;  3MSZ A;  5FHI A;  4BL7 A;  3RDW A;  3IE3 A;  5F05 A;  4Q5N A;  3RHC A;  2XHF A;  5LNK e;  4K7N A;  1AXD A;  3Q6O A;  4KDY A;  3I43 A;  4IJ3 A;  3EUR A;  2C0F A;  1AIU A;  3HCZ A;  3FRC A;  3GRX A;  4HS1 A;  4AJ6 A;  1BX9 A;  2VCX A;  1Z6M A;  3F4R A;  4TR1 A;  2L5O A;  1Z3E A;  4KDU A;  3QMX A;  2VL9 A;  4MZC A;  3IPZ A;  1ON4 A;  3LWA A;  4MF7 A;  4EC0 A;  1UVZ A;  5ECM B;  3EMP A;  7GSS A;  1NSW A;  2VLV A;  2IWT A;  4WR5 A;  5IMV A;  5J3R A;  4V1A g;  3HYP A;  1O81 A;  3D4M A;  2YWM A;  4GSS A;  2EC4 A;  3QAV A;  2B1K A;  3GUR A;  3D4T A;  4LL1 B;  4TR0 A;  3CTF A;  3GST A;  3KMN A;  3ZFB A;  3M1G A;  1R5A A;  4KW6 A;  2EIR A;  4L0U A;  1UA5 A;  1NW2 A;  3A2V A;  1QGV A;  1MDK A;  4MCU A;  1TP9 A;  3IBH A;  3LYP A;  3KJY A;  1SJ6 A;  1FOV A;  5CRE A;  4HJM A;  3FR9 A;  3ZFL A;  2KOK A;  3TDG A;  3W6G A;  3ZVJ A;  3LEF A;  5ECH B;  3UEM A;  2B7J A;  2CAQ A;  4XTS A;  4ZBA A;  1VF3 A;  1GH2 A;  3KP9 A;  4EO3 A;  2LRT A;  4K1F A;  1XBS A;  4EE0 A;  5ECQ B;  1M2B A;  4NV5 A;  1F9M A; 
#chains in the Genus database with same CATH topology
 1OE7 A;  3FYG A;  1BQ7 A;  3WD6 A;  1B48 A;  4POL A;  1OVN A;  5IMC A;  1V57 A;  4BVX B;  2GZP A;  1PKZ A;  2YWI A;  4POK A;  3HZ8 A;  2XC2 A;  2R0P A;  4PGT A;  2JZT A;  1K0O A;  2P5R A;  4AF2 A;  2O8V B;  2OBK A;  3TKS E;  2H0G A;  1NM3 A;  3TRQ A;  5J4U A;  4GQF A;  3KD0 A;  1V98 A;  3K8N A;  4IEL A;  4PQ1 A;  5A4V A;  1NHY A;  5B7C A;  2H75 A;  3FZ4 A;  1Q4J A;  4XS1 A;  3M9K A;  3VWV A;  4TR4 A;  1SL2 B;  5DBQ A;  3PR8 A;  1O85 A;  4JED A;  5AN1 A;  1H4O A;  2V41 A;  5D9X A;  3CQF A;  5IOX A;  5IMF A;  5KN0 A;  4ILF A;  3KGK A;  2PWJ A;  3KIJ A;  5DCH A;  1TK8 B;  4Q5Q A;  1LBK A;  3GKM A;  4WKW A;  2H30 A;  3GTU B;  4I8B A;  1F3B A;  4MH3 A;  3KEB A;  16GS A;  3R2Q A;  2H73 A;  2NDO A;  1ZGN A;  1ZCP A;  2MBT A;  2CAI A;  3A5W A;  1W4V A;  1XVW A;  3BJ5 A;  1YJ6 A;  1AQW A;  1QUW A;  2VIM A;  4MJC A;  4DVC A;  1GNE A;  3U6V A;  3GYK A;  1YQ1 A;  2MMO A;  3NZN A;  3VWX A;  4ZBD A;  1IYH A;  2K8V A;  2V1M A;  3RHB A;  1ST9 A;  1K3O A;  2YNX A;  4K0N A;  4PUR A;  1S3C A;  2GT6 A;  2HSH A;  3E9J B;  2LST A;  3LQ7 A;  3WGX A;  3KH9 A;  2KHP A;  5DAL B;  1HQO A;  1WRY A;  1EOH A;  1XWC A;  4L0W A;  3HVV A;  1K0A A;  2OAC A;  4J56 E;  2H6Z A;  3D0Z A;  1ERV A;  2NBS A;  4D73 A;  2OA7 A;  2ZUP A;  4RQR A;  3BOA A;  2RLI A;  4MDC A;  4TOP A;  1XZO A;  2GQL A;  5ID2 B;  4CW9 A;  3L0H A;  5IMD A;  4GRF A;  3TJG A;  3KTL A;  4K7I A;  2C1Y A;  2MMN A;  3EIN A;  1X9S B;  1XPV A;  3KMO A;  14GS A;  1I9D A;  18GS A;  1UN2 A;  1GUL A;  1Z5Y E;  2QA2 A;  1PX7 A;  1TW9 A;  3ZML A;  1VF1 A;  3MWH A;  4ACS A;  5J9C A;  5AIV A;  3H8Q A;  1ZOF A;  3GHA A;  5DVB A;  2J9H A;  2QGV A;  5F8B A;  3O76 A;  5DAK B;  1HD2 A;  2N5B A;  13GS A;  3CRU A;  3QOU A;  1EWX A;  2HLS A;  4DSQ A;  4WEY A;  4EL1 A;  2GST A;  4TN8 A;  1YKA A;  5EVO A;  4IBP A;  12GS A;  4Z7X A;  1BAY A;  2GZZ A;  3UAR A;  2F51 A;  2GLR A;  2O87 A;  4GSN A;  2A4V A;  3GH6 A;  1X0R A;  2X8G A;  1E6B A;  1HNC A;  1T4Z A;  3ZIJ A;  3GL3 A;  6GSV A;  5DJM A;  1Y25 A;  2I81 A;  6GST A;  1SK2 A;  1FHE A;  3TRP A;  2YP6 A;  4F03 A;  4Q5F A;  3HVN A;  1SD8 A;  1O8W A;  1EP8 A;  2EIQ A;  2I4A A;  1B4P A;  2DML A;  1G6W A;  2IJY A;  2K8S A;  1PKW A;  2L5L A;  2DIY A;  1TDI A;  4MH2 A;  2XBI A;  2QKE A;  1SYX A;  4IJI A;  3CMI A;  3DML A;  4NAX A;  1A8Y A;  1WP0 A;  2GZY A;  3GKN A;  4ZB9 A;  3EU4 A;  2AAW A;  1ZYN A;  3L4N A;  5E59 A;  3RPN A;  3TRX A;  2V6K A;  3HD5 A;  3M3M A;  1ZYQ B;  4ZL9 A;  1U6T A;  1MDI A;  2UZ8 A;  4TXO B;  2NVL A;  6GSU A;  4IGJ A;  4FYC A;  5D9W A;  4BVY A;  1U87 A;  1WWJ A;  5B8B A;  4POM A;  5DQY A;  1WPI A;  4MZW A;  5CRW A;  1M3I A;  2LNS A;  5C00 A;  5KN3 A;  1R4W A;  2Z9S A;  5ECL B;  3EPT A;  3ZMK A;  3P2A A;  1X9W B;  2EIO A;  4ZXG A;  5H5Q A;  4V2L A;  2GGT A;  2B5E A;  1TTZ A;  3HJO A;  1PN9 A;  3DRN A;  3FW2 A;  4HZ2 A;  2H6X A;  5G5E A;  3VPT A;  2VLT A;  1GWC A;  4TKY A;  5H5R A;  2X64 A;  1QFN A;  2LQQ A;  1K0C A;  3F4S A;  4CDO A;  2CX3 A;  1M3J A;  1BED A;  2F3M A;  4USS A;  2VCQ A;  2X4A A;  3LG6 A;  5ECS A;  1XWG A;  3O3T A;  4RI7 A;  5HQP A;  1SKR B;  3TOU A;  2A2S A;  2DKH A;  1O8X A;  2JZR A;  3CXG A;  4MLY A;  4O7H A;  1Z6N A;  3GKX A;  1T3B A;  3QFB C;  5H5S A;  2VM1 A;  4WBJ A;  4AGS A;  2H19 A;  3KP8 A;  1EOG A;  5EL8 A;  2HYX A;  5KOW A;  5G1L A;  1GTU A;  4I2T A;  5HFI A;  1LU4 A;  4KCE A;  1KTE A;  2WJU A;  5ECI B;  3PIN A;  1X5C A;  1PRX A;  1KEB A;  1DUG A;  4MF5 A;  2AUV A;  2H71 A;  3ISO A;  3GSS A;  4FYB A;  5A5K A;  3QPM A;  2C0D A;  2DIZ A;  4ISD A;  3QDN A;  2YV9 A;  3G7I A;  1ZMA A;  2O85 A;  3BCI A;  5J41 A;  2CT6 A;  2VCV A;  2X8C A;  4GXZ A;  2LRN A;  3DEX A;  5IPH A;  2R0G A;  2GDR A;  5F0G A;  2B7K A;  4K0G A;  4IP6 A;  1SK1 A;  4EDZ A;  1ZYP A;  1V9W A;  3H4K A;  4X0X A;  3CSJ A;  2FHE A;  1XWA A;  5J5N A;  3RPP A;  1USB A;  2C80 A;  4DSS A;  4IQ1 A;  4OWY A;  3QCP A;  4K6X A;  3F63 A;  1HNA A;  4JR6 A;  5IPG A;  3ERW A;  2YZH A;  4MF6 A;  2AB6 A;  4ECB A;  1X9M B;  2V32 A;  2WB9 A;  1T4Y A;  4KCA A;  2OAD A;  1GRX A;  4WF4 A;  2GSR A;  3HA9 A;  2AYT A;  4TR3 A;  3ZLP A;  2X99 A;  4X1U A;  2FCH A;  3ZYW A;  4I97 A;  3C1S A;  2M46 A;  3VWW A;  2H0I A;  1FVJ A;  4O32 A;  1ERT A;  4BVX A;  1DE1 A;  3KCM A;  1XW6 A;  2VAF A;  4GWR A;  1EGO A;  4HU7 A;  3GFK A;  2RUE A;  4FH8 A;  4K7O A;  3W8S A;  3UVH A;  4EKZ A;  4PTS A;  2AHE A;  4NWY A;  2WFC A;  2FGX A;  2C0G A;  2R37 A;  5A4U A;  1SKS B;  2QC7 A;  1GL8 A;  3IK7 A;  2DJ1 A;  2DKI A;  2RII A;  5G1K A;  3GX8 A;  3HHV A;  4WF5 A;  2H6Y A;  5G30 A;  4ZB6 A;  5AGY A;  4O5Q A;  9GSS A;  1PD2 1;  1Y6E A;  2NTO A;  2FWF A;  1ZL9 A;  2IME A;  2OE1 A;  2IMF A;  2HZE B;  3N9J A;  2F8F A;  2HSM A;  4KSM A;  3LXT A;  2VCW A;  3HXS A;  1U3I A;  3VLN A;  2CVD A;  3GTU A;  5ECR B;  3D21 A;  4BIK A;  4KND A;  4H86 A;  4JU5 A;  4HJ2 A;  4QL7 A;  3TJK A;  2P5Q A;  1N8J A;  1SJI A;  3M8N A;  3DGQ A;  4ZL7 A;  4HQS A;  4KH7 A;  3EMX A;  1G7O A;  2LV3 A;  1TU7 A;  2MMA A;  3TKS A;  1GSS A;  3ZTL A;  5JCW A;  1Q98 A;  5ECN B;  1OC3 A;  3J7Y b;  1GUK A;  4ML1 A;  1XFL A;  4G9H A;  5B6N A;  2K6V A;  3QAW A;  5DAL A;  3BD2 A;  3GMF A;  1GSD A;  3TKS C;  1TOF A;  5HR3 A;  1T00 A;  2R4V A;  6GSX A;  2LRC A;  1K3Y A;  5DDL A;  1BYE A;  1PL1 A;  3ZZX A;  4OO5 A;  4OFN A;  1XVQ A;  2REM A;  3WGD A;  5ID2 A;  1KBN A;  3WYW A;  1CQH A;  4FIW A;  2CX4 A;  1U88 A;  5D8I A;  1V40 A;  4YH2 A;  2PBJ A;  4MMM A;  3TOT A;  3SWL A;  4OD7 A;  1TKD B;  5FWG A;  3FHK A;  4J2F A;  4XS4 B;  4KDX A;  2DLX A;  2VM2 A;  3FZA A;  5IQY A;  2YWO A;  1JLV A;  3WGE A;  2DJ2 A;  3ZVJ D;  1SEN A;  2YZU A;  4O92 A;  5DAK A;  3ZRE A;  4HQZ A;  3EWL A;  2XBQ A;  1WE0 A;  4Z2T A;  1PGT A;  1DSB A;  5F06 A;  3CSI A;  4IN0 A;  2X49 A;  3CSH A;  4E8E A;  2QA1 A;  1LJR A;  1A8L A;  4V1A p;  3PH9 A;  2HRA A;  3TCO A;  1THX A;  2K18 A;  1B8X A;  5L71 A;  4LA1 A;  4MJE A;  1GSU A;  1EEM A;  2E0Q A;  3FKF A;  3GV1 A;  3ME8 A;  3WT2 A;  3FY7 A;  2G2Q A;  5JCU A;  4HI7 A;  1CQG A;  3F3Q A;  1VF2 A;  1GLP A;  5GAP D;  8GSS A;  3VUR A;  1BJX A;  2M72 A;  2PPT A;  4KAE A;  4TRX A;  4ZL8 A;  2VLU A;  3NIV A;  2WGR A;  3EVI A;  1J9B A;  1M2A A;  3RBT A;  3APQ A;  2HRN A;  2HNL A;  5GSS A;  2L6C A;  3P8W A;  1A24 A;  4YAV A;  2JU5 A;  6GSS A;  1T7P B;  2XPD A;  2OKA A;  4Q5R A;  4FO5 A;  3GA4 A;  1YF0 A;  2GT5 A;  2VUP A;  1VGL A;  4OFT A;  3KZQ A;  2A2R A;  4MA9 A;  3ZL5 A;  1WJK A;  3BBY A;  2LJA A;  3D6I A;  1ML6 A;  4TXO A;  1XWB A;  2LKU A;  3DVX A;  2TRC P;  4YKF A;  1M0U A;  3Q18 A;  2MBS A;  4RUV A;  3D22 A;  3US3 A;  1KNG A;  4L5O A;  3I9V 2;  4MPF A;  2P31 A;  4NMU A;  3LSZ A;  4DSR A;  3LW9 A;  4ZBB A;  3O6T A;  2GS3 A;  2IN3 A;  1A0F A;  2DJ3 A;  3MYD A;  4F9Z A;  3UIW A;  4KB3 A;  3QFA C;  4MPG A;  2VL2 A;  1GTA A;  2R0C A;  4PUF C;  3SBC A;  1AW9 A;  2C4J A;  4GF0 A;  1GSE A;  5HFK A;  2LTK A;  5INY A;  3TGZ A;  4G0L A;  2ZCT A;  2GTU A;  2E2M A;  4XRD A;  1DE2 A;  2PUK C;  4CY8 A;  4ECI A;  3EYT A;  1FAA A;  3P7X A;  2HZF A;  2VL2 C;  1AAZ A;  5D9V A;  3KM6 A;  2AV4 A;  1GSQ A;  2B5Y A;  2LQO A;  2H74 A;  4LMW A;  2H66 A;  5KN1 A;  2R3X A;  2O7K A;  3UJ1 A;  2H0H A;  2YN1 A;  1F6M C;  1TU8 A;  1XWK A;  1FOH A;  1H75 A;  5B8A A;  3IAM 2;  2OJL A;  4JRR A;  1TK0 B;  20GS A;  3FZ5 A;  4K2D A;  3FR6 A;  1FB6 A;  1OC9 B;  4IVF A;  4KSO A;  1SKW B;  1MEK A;  4LLR A;  2CA8 A;  5IOW A;  3DKS A;  1RW1 A;  3BCK A;  5COH A;  4TVE A;  1PFO A;  2VL3 A;  5CAX A;  1RQM A;  4GTU A;  2B6M A;  2L57 A;  4EXJ A;  1XOA A;  2XPE A;  2IMI A;  4LL4 B;  3L9U A;  3VFI A;  5EPF A;  2HFD A;  1JFU A;  2H1A A;  2VD0 A;  2H72 A;  2B5X A;  5JWO B;  4MNN A;  5ENU A;  1TRV A;  4F2I A;  3LYK A;  5IMZ A;  2DJJ A;  2GQK A;  1HNB A;  1DBY A;  1M7T A;  3TJF A;  2C3Q A;  1IYI A;  1VF4 A;  3G7J A;  5IM9 A;  4ZIJ A;  1M99 A;  4K5R A;  2YV7 A;  4XRA A;  1YKC A;  1GSF A;  1TI1 A;  2M80 A;  3D5J A;  1K0B A;  19GS A;  5KN2 A;  2JL4 A;  3FR3 A;  3KXO A;  5D73 A;  1GSY A;  1A2M A;  1F3A A;  1O73 A;  4MJA A;  4E8H A;  2WZ9 A;  3M9J A;  5LD0 A;  4GLT A;  4JBB A;  2VD1 A;  1PL2 A;  3IAS 2;  1PA3 A;  4YQM A;  1PMT A;  3LGC A;  4PQI A;  2N5F A;  4V2N A;  1G7E A;  4HEA 2;  4PUA A;  2FA4 A;  4K2X A;  4BA7 A;  1S3D A;  2HRK A;  1MTC A;  3J7Y k;  4NPB A;  1FB0 A;  1AQV A;  3FMW A;  1F37 A;  5GAN D;  2IL3 A;  4PNF A;  2E2G A;  4KUN A;  3A5I A;  3ED3 A;  2JAC A;  1GTI A;  1N2A A;  1MD3 A;  4GST A;  1SU9 A;  1A0R P;  1FVK A;  2HZE A;  1FG4 A;  22GS A;  3TKQ A;  3DD3 A;  1QMV A;  3E0U A;  4GQC A;  4OCE A;  3A2X A;  1XCC A;  3GX0 A;  3HY2 A;  5CP1 A;  5ECK B;  4KF9 A;  1GP1 A;  1A2L A;  4EIP A;  2I1U A;  1JLW A;  1S3A A;  2X8H A;  2I3Y A;  1A2J A;  1M2D A;  2KUC A;  3HDC A;  5BMU A;  1GLQ A;  4Z2R A;  3ZIT A;  2CZ2 A;  1THO A;  4AJ8 A;  2KP2 A;  1R26 A;  1K0N A;  4MK3 A;  5HR0 A;  4TXV A;  2VCT A;  1YZX A;  1I5G A;  2VCZ A;  4MZB A;  1PX6 A;  1XOB A;  2G0F A;  4NXI A;  4HOJ A;  1TXX A;  1FO5 A;  5D93 A;  3VWU A;  5A4W A;  2OE0 A;  3F9U A;  3VI7 A;  3LJR A;  1QK8 A;  4K8M A;  11GS A;  2OE3 A;  1SL1 B;  1AUC A;  3C1R A;  4OFM A;  5AIS A;  3S9F A;  2DJ0 A;  2PN8 A;  1B4Q A;  1Z7P A;  17GS A;  2BJX A;  2FLS A;  1ERW A;  2H70 A;  1C72 A;  1PSQ A;  1TK5 B;  3C71 A;  4N30 A;  5CYY A;  3F3R A;  5CNW A;  2YAN A;  2V2G A;  1V58 A;  2GSQ A;  4QL9 A;  4BWQ A;  3RAZ A;  4IKH A;  4IHU A;  4XS4 A;  2IFQ B;  3GUS A;  1AC1 A;  2C8U A;  4IQA A;  2IMK A;  2E7P A;  4ZB8 A;  4KE3 A;  4HDE A;  1EZK A;  1VRS D;  4XS6 A;  4CY6 A;  1ERU A;  2YJ7 A;  2F8A A;  2PER A;  2LUS A;  5C04 A;  2TIR A;  5IO0 A;  5D96 A;  3A2W A;  2BMX A;  3HJP A;  4POB A;  4FQU A;  4KGI A;  3CRT A;  2RM6 A;  2H1B A;  3GNJ A;  1A23 A;  1E2Y A;  5E4W A;  2DJK A;  4X43 A;  1YEX A;  2HI7 A;  3IHQ A;  2CQ9 A;  2YPM A;  3FEU A;  1K0M A;  4DSS B;  3IRA A;  3LXZ A;  3EU3 A;  3DXB A;  1UC7 A;  3ERF A;  2YCD A;  4X4J A;  1XW9 A;  4BL7 B;  3IA1 A;  1EV9 A;  1TJD A;  2HT9 A;  2LNT A;  4WBR D;  3IR4 A;  3DYR A;  5KEJ A;  2PU9 C;  5CRG A;  2BTO T;  3IV4 A;  2FWG A;  2HRF A;  1V2A A;  1TRU A;  5IIZ A;  2A2P A;  3F8U A;  1QQ2 A;  2CV4 A;  4MP4 A;  1GUM A;  2VO4 A;  2MMZ A;  2L6D A;  3A3T A;  3H79 A;  5B6M A;  1AQX A;  2H76 A;  4TR1 B;  5JWQ B;  3QAG A;  3TUE A;  3VK9 A;  1EEJ A;  3LFL A;  1URM A;  1ABA A;  4J57 E;  2DMM A;  3DIE A;  3W8J A;  1BG5 A;  5JCG A;  4G2E A;  3P90 A;  4YQU A;  1SYR A;  1HYU A;  5IO2 A;  2QSI A;  1WMJ A;  4WXT A;  2D2Z A;  2WS2 A;  2DBC A;  3EE2 A;  5LCZ A;  5F07 A;  4NHZ A;  1JZW A;  4LMV A;  1T8E B;  1MDJ A;  3UBL A;  5D9T A;  5GZZ B;  4G0I A;  3IDV A;  4MJB A;  2DSA A;  5JWR B;  2CZ3 A;  1GTB A;  3H1N A;  3M0F A;  3TJJ A;  1S3R A;  1G6Y A;  3F4T A;  2CVK A;  4F82 A;  2R2J A;  1TRS A;  3JCM L;  5BRT A;  3PPU A;  4N10 A;  1O7U A;  1R5P A;  5AIX A;  1Z7R A;  3LOR A;  2AJQ B;  3IHG A;  3FZ9 A;  4N0Z A;  2F9S A;  4ULX A;  2IPA A;  1OC8 A;  4AJ7 A;  3OR5 A;  3KH7 A;  2JZS A;  4PNG A;  1OKT A;  1RK4 A;  1XIY A;  4EVM A;  3ME7 A;  2IIY A;  3UBK A;  4F0C A;  1NHO A;  3IK9 A;  1ACV A;  5KOX A;  3HKR A;  4ICY A;  3AY8 A;  1K3L A;  5DCG A;  4O5U A;  2LJR A;  3UAP A;  3IOS A;  1ILO A;  2NPB A;  1M9A A;  3H93 A;  3ERG A;  2MYG A;  2V6O A;  2FWE A;  3L9V A;  4YQV A;  4L8E A;  1R7H A;  4ID0 A;  4OO4 A;  3UMA A;  3NOF A;  4IP1 A;  2FA8 A;  1EV4 A;  2N5A A;  3U5R E;  1SD9 A;  1K0D A;  3CYN A;  2PGT A;  3HVS A;  2WDU A;  1PQN A;  3MNG A;  2FUG 2;  1OC9 A;  1QXH A;  3TB2 A;  4PQH A;  2PVQ A;  1U3A A;  1WOU A;  1G0T A;  3APS A;  1M9B A;  3GKK A;  4EF0 A;  5ABR A;  4P3Y B;  2H1G A;  3IXR A;  1YY7 A;  2ES7 A;  4G0K A;  5EY6 A;  1SJZ A;  2ZNM A;  3Q74 A;  4HUA A;  4JZQ A;  4I5Q A;  5HFG A;  5HR1 A;  1F2E A;  1OAZ A;  3MDK A;  3VPQ A;  2RUF A;  3TKP A;  1WIK A;  2R6K A;  3L9S A;  4JE1 A;  3GIX A;  3E3E A;  3TJB A;  10GS A;  4ECJ A;  3GN3 A;  1ZYE A;  2H8L A;  4N0V A;  4XHM A;  3F0I A;  1W89 A;  3V1W A;  4IW9 A;  3C73 A;  1JZD A;  3QR6 A;  2DC5 A;  1J0F A;  2JAD A;  4Z2U A;  1B9Y C;  4G10 A;  3Q19 A;  2RM5 A;  3C8E A;  2I9H A;  3UL3 A;  2OBI A;  3DVW A;  4HZ4 A;  4KX4 A;  4XIH A;  3I69 A;  4D73 B;  5DJL A;  3CBU A;  3HZ4 A;  3WT1 A;  3GL5 A;  4FYU A;  2C3T A;  5ELG A;  1OE8 A;  2C0E A;  4NHW A;  3HVX A;  5ECO B;  1XW5 A;  1YDK A;  3G9B A;  3F6F A;  1X5E A;  2JSZ A;  4OCF A;  3KTB A;  2B3S A;  4QQ7 A;  4JR4 A;  1MD4 A;  2L59 A;  3MAK A;  4ZIL A;  5FT3 A;  2J23 A;  2HE3 A;  1EP7 A;  2PMT A;  2FNO A;  4XCS A;  2R5G A;  4ECC A;  5J9B A;  2ALB A;  4IS0 A;  3FK8 A;  2O89 A;  3VI5 A;  1J08 A;  2CVB A;  4NV2 A;  2YWN A;  5DQS A;  4F0B A;  2K9F A;  2LJK A;  2GVP A;  4WET A;  5GST A;  4KA0 A;  3C7M A;  2TRX A;  3ZRD A;  2KP1 A;  5CRD A;  4I6X A;  4PXO A;  5G5F A;  2HSY A;  3IC4 A;  4RI6 A;  4OMV A;  2IMD A;  2FWH A;  5G31 A;  1OYJ A;  1X5D A;  3F6D A;  1OKD A;  1EGR A;  3EC3 A;  3G7Y A;  1TI3 A;  2WUL A;  4K9Z A;  1TRW A;  4WR4 A;  5CO3 A;  2B1L A;  2KLX A;  5G2Z A;  5IMA A;  2MZC A;  3CTG A;  3I6A A;  2LEG A;  4ML6 A;  3N5O A;  3L78 A;  1JHB A;  1Z9H A;  4YAP A;  4N11 A;  5CRH A;  4I2U A;  4MAB A;  4L5L A;  1GNW A;  1ZZY A;  2P0G A;  4A5P A;  1YEP A;  4V2M A;  2FY6 A;  2VOC A;  1SL0 B;  4CHS A;  1JZR A;  1T1V A;  3QD9 A;  2FD3 A;  3PGT A;  2HXK A;  1XXU A;  2H1D A;  4G19 A;  6GSY A;  2GSS A;  4BPY A;  2GQM A;  4BWS A;  2L4Q A;  2ON5 A;  4RQX A;  2L4C A;  2IFQ A;  4DEJ A;  1XG8 A;  1FW1 A;  3TKR A;  1JZO A;  2YJH A;  4K5S A;  3ZIV A;  4BVY B;  1GUH A;  3R3E A;  3HJM A;  6GSW A;  1O6J A;  2PVO C;  1B9X C;  3GH9 A;  4EDY A;  1SK0 A;  2H01 A;  2WRT A;  5HR2 A;  4EIQ A;  3DWV A;  4O5R A;  4GCI A;  4PX1 A;  3UVT A;  1YF1 A;  2WCI A;  4EUY A;  4TW5 A;  2LS5 A;  3MIX A;  3UOM A;  4HU9 A;  2JSY A;  5ELA A;  3APO A;  2ON7 A;  5ECP B;  2C3N A;  2YOI A;  3MSZ A;  5FHI A;  4BL7 A;  1PN0 A;  3RDW A;  3IE3 A;  5F05 A;  4Q5N A;  3RHC A;  2XHF A;  5LNK e;  4K7N A;  1AXD A;  3Q6O A;  4KDY A;  3I43 A;  4IJ3 A;  3EUR A;  2C0F A;  1AIU A;  3HCZ A;  3FRC A;  3GRX A;  4HS1 A;  4AJ6 A;  1BX9 A;  2VCX A;  1Z6M A;  3F4R A;  4TR1 A;  2L5O A;  1Z3E A;  4KDU A;  3QMX A;  2VL9 A;  4MZC A;  3IPZ A;  1ON4 A;  3LWA A;  4MF7 A;  4EC0 A;  1UVZ A;  5ECM B;  3EMP A;  7GSS A;  1NSW A;  2VLV A;  2IWT A;  4WR5 A;  5IMV A;  5J3R A;  4V1A g;  3HYP A;  1O81 A;  3D4M A;  2YWM A;  4GSS A;  4YKG A;  2EC4 A;  3QAV A;  2B1K A;  3GUR A;  3D4T A;  4LL1 B;  4TR0 A;  3CTF A;  3GST A;  3KMN A;  3ZFB A;  3M1G A;  2A4H A;  1R5A A;  4KW6 A;  2EIR A;  4L0U A;  1UA5 A;  1NW2 A;  3A2V A;  1QGV A;  1MDK A;  4MCU A;  3IC8 A;  1TP9 A;  3IBH A;  3LYP A;  3KJY A;  1SJ6 A;  1FOV A;  5CRE A;  4HJM A;  3FR9 A;  3ZFL A;  2KOK A;  3TDG A;  3W6G A;  3ZVJ A;  3LEF A;  5ECH B;  3UEM A;  2B7J A;  2CAQ A;  4XTS A;  4ZBA A;  1VF3 A;  1GH2 A;  3KP9 A;  4HSC X;  4EO3 A;  2LRT A;  4K1F A;  1XBS A;  4EE0 A;  5ECQ B;  1M2B A;  4NV5 A;  1F9M A; 
#chains in the Genus database with same CATH homology
 1OE7 A;  3FYG A;  1BQ7 A;  3WD6 A;  1B48 A;  4POL A;  1OVN A;  5IMC A;  1V57 A;  4BVX B;  2GZP A;  1PKZ A;  2YWI A;  4POK A;  3HZ8 A;  2XC2 A;  2R0P A;  4PGT A;  2JZT A;  1K0O A;  2P5R A;  4AF2 A;  2O8V B;  2OBK A;  3TKS E;  2H0G A;  1NM3 A;  3TRQ A;  5J4U A;  4GQF A;  3KD0 A;  1V98 A;  3K8N A;  4IEL A;  4PQ1 A;  5A4V A;  1NHY A;  5B7C A;  2H75 A;  3FZ4 A;  1Q4J A;  4XS1 A;  3M9K A;  3VWV A;  4TR4 A;  1SL2 B;  5DBQ A;  3PR8 A;  1O85 A;  4JED A;  5AN1 A;  1H4O A;  2V41 A;  5D9X A;  5IOX A;  5IMF A;  5KN0 A;  4ILF A;  3KGK A;  2PWJ A;  3KIJ A;  5DCH A;  1TK8 B;  4Q5Q A;  1LBK A;  3GKM A;  4WKW A;  2H30 A;  3GTU B;  4I8B A;  1F3B A;  4MH3 A;  3KEB A;  16GS A;  3R2Q A;  2H73 A;  2NDO A;  1ZGN A;  1ZCP A;  2MBT A;  2CAI A;  3A5W A;  1W4V A;  1XVW A;  3BJ5 A;  1YJ6 A;  1AQW A;  1QUW A;  2VIM A;  4MJC A;  4DVC A;  1GNE A;  3U6V A;  3GYK A;  1YQ1 A;  2MMO A;  3NZN A;  3VWX A;  4ZBD A;  1IYH A;  2K8V A;  2V1M A;  3RHB A;  1ST9 A;  1K3O A;  2YNX A;  4K0N A;  4PUR A;  1S3C A;  2GT6 A;  2HSH A;  3E9J B;  2LST A;  3LQ7 A;  3WGX A;  3KH9 A;  2KHP A;  5DAL B;  1HQO A;  1WRY A;  1EOH A;  1XWC A;  4L0W A;  3HVV A;  1K0A A;  2OAC A;  4J56 E;  2H6Z A;  3D0Z A;  1ERV A;  2NBS A;  4D73 A;  2OA7 A;  2ZUP A;  4RQR A;  3BOA A;  2RLI A;  4MDC A;  4TOP A;  1XZO A;  2GQL A;  5ID2 B;  4CW9 A;  3L0H A;  5IMD A;  4GRF A;  3TJG A;  3KTL A;  4K7I A;  2C1Y A;  2MMN A;  3EIN A;  1X9S B;  1XPV A;  3KMO A;  14GS A;  1I9D A;  18GS A;  1UN2 A;  1GUL A;  1Z5Y E;  2QA2 A;  1PX7 A;  1TW9 A;  3ZML A;  1VF1 A;  3MWH A;  4ACS A;  5J9C A;  5AIV A;  3H8Q A;  1ZOF A;  3GHA A;  5DVB A;  2J9H A;  2QGV A;  5F8B A;  3O76 A;  5DAK B;  1HD2 A;  2N5B A;  13GS A;  3CRU A;  3QOU A;  1EWX A;  2HLS A;  4DSQ A;  4WEY A;  4EL1 A;  2GST A;  4TN8 A;  1YKA A;  5EVO A;  4IBP A;  12GS A;  4Z7X A;  1BAY A;  2GZZ A;  3UAR A;  2F51 A;  2GLR A;  2O87 A;  4GSN A;  2A4V A;  3GH6 A;  1X0R A;  2X8G A;  1E6B A;  1HNC A;  1T4Z A;  3ZIJ A;  3GL3 A;  6GSV A;  5DJM A;  1Y25 A;  2I81 A;  6GST A;  1SK2 A;  1FHE A;  3TRP A;  2YP6 A;  4F03 A;  4Q5F A;  1SD8 A;  1O8W A;  1EP8 A;  2EIQ A;  2I4A A;  1B4P A;  2DML A;  1G6W A;  2IJY A;  2K8S A;  1PKW A;  2L5L A;  2DIY A;  1TDI A;  4MH2 A;  2XBI A;  2QKE A;  1SYX A;  4IJI A;  3CMI A;  3DML A;  4NAX A;  1A8Y A;  1WP0 A;  2GZY A;  3GKN A;  4ZB9 A;  3EU4 A;  2AAW A;  1ZYN A;  3L4N A;  5E59 A;  3RPN A;  3TRX A;  2V6K A;  3HD5 A;  3M3M A;  1ZYQ B;  4ZL9 A;  1U6T A;  1MDI A;  2UZ8 A;  4TXO B;  2NVL A;  6GSU A;  4IGJ A;  4FYC A;  5D9W A;  4BVY A;  1U87 A;  1WWJ A;  5B8B A;  4POM A;  5DQY A;  1WPI A;  4MZW A;  5CRW A;  2LNS A;  5C00 A;  5KN3 A;  1R4W A;  2Z9S A;  5ECL B;  3EPT A;  3ZMK A;  3P2A A;  1X9W B;  2EIO A;  4ZXG A;  5H5Q A;  4V2L A;  2GGT A;  2B5E A;  1TTZ A;  3HJO A;  1PN9 A;  3DRN A;  3FW2 A;  4HZ2 A;  2H6X A;  5G5E A;  3VPT A;  2VLT A;  1GWC A;  4TKY A;  5H5R A;  2X64 A;  1QFN A;  2LQQ A;  1K0C A;  3F4S A;  4CDO A;  2CX3 A;  1BED A;  2F3M A;  4USS A;  2VCQ A;  2X4A A;  3LG6 A;  5ECS A;  1XWG A;  3O3T A;  4RI7 A;  5HQP A;  1SKR B;  3TOU A;  2A2S A;  2DKH A;  1O8X A;  2JZR A;  3CXG A;  4MLY A;  4O7H A;  1Z6N A;  3GKX A;  1T3B A;  3QFB C;  5H5S A;  2VM1 A;  4WBJ A;  4AGS A;  2H19 A;  3KP8 A;  1EOG A;  5EL8 A;  2HYX A;  5KOW A;  5G1L A;  1GTU A;  4I2T A;  5HFI A;  1LU4 A;  4KCE A;  1KTE A;  2WJU A;  5ECI B;  3PIN A;  1X5C A;  1PRX A;  1KEB A;  1DUG A;  4MF5 A;  2AUV A;  2H71 A;  3ISO A;  3GSS A;  4FYB A;  5A5K A;  3QPM A;  2C0D A;  2DIZ A;  4ISD A;  3QDN A;  2YV9 A;  3G7I A;  1ZMA A;  2O85 A;  3BCI A;  5J41 A;  2CT6 A;  2VCV A;  2X8C A;  4GXZ A;  2LRN A;  3DEX A;  5IPH A;  2R0G A;  2GDR A;  5F0G A;  2B7K A;  4K0G A;  4IP6 A;  1SK1 A;  4EDZ A;  1ZYP A;  1V9W A;  3H4K A;  4X0X A;  3CSJ A;  2FHE A;  1XWA A;  5J5N A;  3RPP A;  1USB A;  2C80 A;  4DSS A;  4IQ1 A;  4OWY A;  3QCP A;  4K6X A;  3F63 A;  1HNA A;  4JR6 A;  5IPG A;  3ERW A;  2YZH A;  4MF6 A;  2AB6 A;  4ECB A;  1X9M B;  2V32 A;  2WB9 A;  1T4Y A;  4KCA A;  2OAD A;  1GRX A;  4WF4 A;  2GSR A;  3HA9 A;  2AYT A;  4TR3 A;  3ZLP A;  2X99 A;  4X1U A;  2FCH A;  3ZYW A;  4I97 A;  3C1S A;  2M46 A;  3VWW A;  2H0I A;  1FVJ A;  4O32 A;  1ERT A;  4BVX A;  1DE1 A;  3KCM A;  1XW6 A;  2VAF A;  4GWR A;  1EGO A;  4HU7 A;  3GFK A;  2RUE A;  4FH8 A;  4K7O A;  3W8S A;  3UVH A;  4EKZ A;  4PTS A;  2AHE A;  4NWY A;  2WFC A;  2FGX A;  2C0G A;  2R37 A;  5A4U A;  1SKS B;  2QC7 A;  1GL8 A;  3IK7 A;  2DJ1 A;  2DKI A;  2RII A;  5G1K A;  3GX8 A;  3HHV A;  4WF5 A;  2H6Y A;  5G30 A;  4ZB6 A;  5AGY A;  4O5Q A;  9GSS A;  1PD2 1;  1Y6E A;  2NTO A;  2FWF A;  1ZL9 A;  2IME A;  2OE1 A;  2IMF A;  2HZE B;  3N9J A;  2F8F A;  2HSM A;  4KSM A;  3LXT A;  2VCW A;  3HXS A;  1U3I A;  3VLN A;  2CVD A;  3GTU A;  5ECR B;  3D21 A;  4KND A;  4H86 A;  4JU5 A;  4HJ2 A;  4QL7 A;  3TJK A;  2P5Q A;  1N8J A;  1SJI A;  3M8N A;  3DGQ A;  4ZL7 A;  4HQS A;  4KH7 A;  3EMX A;  1G7O A;  2LV3 A;  1TU7 A;  2MMA A;  3TKS A;  1GSS A;  3ZTL A;  5JCW A;  1Q98 A;  5ECN B;  1OC3 A;  3J7Y b;  1GUK A;  4ML1 A;  1XFL A;  4G9H A;  5B6N A;  2K6V A;  3QAW A;  5DAL A;  3BD2 A;  3GMF A;  1GSD A;  3TKS C;  1TOF A;  5HR3 A;  1T00 A;  2R4V A;  6GSX A;  2LRC A;  1K3Y A;  5DDL A;  1BYE A;  1PL1 A;  3ZZX A;  4OO5 A;  4OFN A;  1XVQ A;  2REM A;  3WGD A;  5ID2 A;  1KBN A;  3WYW A;  1CQH A;  4FIW A;  2CX4 A;  1U88 A;  5D8I A;  1V40 A;  4YH2 A;  2PBJ A;  4MMM A;  3TOT A;  3SWL A;  4OD7 A;  1TKD B;  5FWG A;  3FHK A;  4J2F A;  4XS4 B;  4KDX A;  2DLX A;  2VM2 A;  3FZA A;  5IQY A;  2YWO A;  1JLV A;  3WGE A;  2DJ2 A;  3ZVJ D;  1SEN A;  2YZU A;  4O92 A;  5DAK A;  3ZRE A;  4HQZ A;  3EWL A;  2XBQ A;  1WE0 A;  4Z2T A;  1PGT A;  1DSB A;  5F06 A;  3CSI A;  4IN0 A;  2X49 A;  3CSH A;  4E8E A;  2QA1 A;  1LJR A;  1A8L A;  4V1A p;  3PH9 A;  2HRA A;  3TCO A;  1THX A;  2K18 A;  1B8X A;  5L71 A;  4LA1 A;  4MJE A;  1GSU A;  1EEM A;  2E0Q A;  3FKF A;  3GV1 A;  3ME8 A;  3WT2 A;  3FY7 A;  2G2Q A;  5JCU A;  4HI7 A;  1CQG A;  3F3Q A;  1VF2 A;  1GLP A;  5GAP D;  8GSS A;  3VUR A;  1BJX A;  2M72 A;  2PPT A;  4KAE A;  4TRX A;  4ZL8 A;  2VLU A;  3NIV A;  2WGR A;  3EVI A;  1J9B A;  1M2A A;  3RBT A;  3APQ A;  2HRN A;  2HNL A;  5GSS A;  2L6C A;  3P8W A;  1A24 A;  4YAV A;  2JU5 A;  6GSS A;  1T7P B;  2XPD A;  2OKA A;  4Q5R A;  4FO5 A;  3GA4 A;  1YF0 A;  2GT5 A;  2VUP A;  1VGL A;  4OFT A;  3KZQ A;  2A2R A;  4MA9 A;  3ZL5 A;  1WJK A;  3BBY A;  2LJA A;  3D6I A;  1ML6 A;  4TXO A;  1XWB A;  2LKU A;  3DVX A;  2TRC P;  4YKF A;  1M0U A;  3Q18 A;  2MBS A;  4RUV A;  3D22 A;  3US3 A;  1KNG A;  4L5O A;  3I9V 2;  4MPF A;  2P31 A;  4NMU A;  3LSZ A;  4DSR A;  3LW9 A;  4ZBB A;  3O6T A;  2GS3 A;  2IN3 A;  1A0F A;  2DJ3 A;  3MYD A;  4F9Z A;  3UIW A;  4KB3 A;  3QFA C;  4MPG A;  2VL2 A;  1GTA A;  2R0C A;  4PUF C;  3SBC A;  1AW9 A;  2C4J A;  4GF0 A;  1GSE A;  5HFK A;  2LTK A;  5INY A;  3TGZ A;  4G0L A;  2ZCT A;  2GTU A;  2E2M A;  4XRD A;  1DE2 A;  2PUK C;  4CY8 A;  4ECI A;  3EYT A;  1FAA A;  3P7X A;  2HZF A;  2VL2 C;  1AAZ A;  5D9V A;  3KM6 A;  2AV4 A;  1GSQ A;  2B5Y A;  2LQO A;  2H74 A;  4LMW A;  2H66 A;  5KN1 A;  2R3X A;  2O7K A;  3UJ1 A;  2H0H A;  2YN1 A;  1F6M C;  1TU8 A;  1XWK A;  1FOH A;  1H75 A;  5B8A A;  3IAM 2;  2OJL A;  4JRR A;  1TK0 B;  20GS A;  3FZ5 A;  4K2D A;  3FR6 A;  1FB6 A;  1OC9 B;  4IVF A;  4KSO A;  1SKW B;  1MEK A;  4LLR A;  2CA8 A;  5IOW A;  3DKS A;  1RW1 A;  3BCK A;  5COH A;  4TVE A;  2VL3 A;  5CAX A;  1RQM A;  4GTU A;  2B6M A;  2L57 A;  4EXJ A;  1XOA A;  2XPE A;  2IMI A;  4LL4 B;  3L9U A;  3VFI A;  5EPF A;  2HFD A;  1JFU A;  2H1A A;  2VD0 A;  2H72 A;  2B5X A;  5JWO B;  4MNN A;  5ENU A;  1TRV A;  4F2I A;  3LYK A;  5IMZ A;  2DJJ A;  2GQK A;  1HNB A;  1DBY A;  1M7T A;  3TJF A;  2C3Q A;  1IYI A;  1VF4 A;  3G7J A;  5IM9 A;  4ZIJ A;  1M99 A;  4K5R A;  2YV7 A;  4XRA A;  1YKC A;  1GSF A;  1TI1 A;  2M80 A;  3D5J A;  1K0B A;  19GS A;  5KN2 A;  2JL4 A;  3FR3 A;  3KXO A;  5D73 A;  1GSY A;  1A2M A;  1F3A A;  1O73 A;  4MJA A;  4E8H A;  2WZ9 A;  3M9J A;  5LD0 A;  4GLT A;  4JBB A;  2VD1 A;  1PL2 A;  3IAS 2;  1PA3 A;  4YQM A;  1PMT A;  3LGC A;  4PQI A;  2N5F A;  4V2N A;  1G7E A;  4HEA 2;  4PUA A;  2FA4 A;  4K2X A;  4BA7 A;  1S3D A;  2HRK A;  1MTC A;  3J7Y k;  4NPB A;  1FB0 A;  1AQV A;  3FMW A;  1F37 A;  5GAN D;  2IL3 A;  4PNF A;  2E2G A;  4KUN A;  3A5I A;  3ED3 A;  2JAC A;  1GTI A;  1N2A A;  1MD3 A;  4GST A;  1SU9 A;  1A0R P;  1FVK A;  2HZE A;  1FG4 A;  22GS A;  3TKQ A;  3DD3 A;  1QMV A;  3E0U A;  4GQC A;  4OCE A;  3A2X A;  1XCC A;  3GX0 A;  3HY2 A;  5CP1 A;  5ECK B;  4KF9 A;  1GP1 A;  1A2L A;  4EIP A;  2I1U A;  1JLW A;  1S3A A;  2X8H A;  2I3Y A;  1A2J A;  1M2D A;  2KUC A;  3HDC A;  5BMU A;  1GLQ A;  4Z2R A;  3ZIT A;  2CZ2 A;  1THO A;  4AJ8 A;  2KP2 A;  1R26 A;  1K0N A;  4MK3 A;  5HR0 A;  4TXV A;  2VCT A;  1YZX A;  1I5G A;  2VCZ A;  4MZB A;  1PX6 A;  1XOB A;  2G0F A;  4NXI A;  4HOJ A;  1TXX A;  1FO5 A;  5D93 A;  3VWU A;  5A4W A;  2OE0 A;  3F9U A;  3VI7 A;  3LJR A;  1QK8 A;  4K8M A;  11GS A;  2OE3 A;  1SL1 B;  1AUC A;  3C1R A;  4OFM A;  5AIS A;  3S9F A;  2DJ0 A;  2PN8 A;  1B4Q A;  1Z7P A;  17GS A;  2BJX A;  2FLS A;  1ERW A;  2H70 A;  1C72 A;  1PSQ A;  1TK5 B;  3C71 A;  4N30 A;  5CYY A;  3F3R A;  5CNW A;  2YAN A;  2V2G A;  1V58 A;  2GSQ A;  4QL9 A;  4BWQ A;  3RAZ A;  4IKH A;  4IHU A;  4XS4 A;  2IFQ B;  3GUS A;  1AC1 A;  2C8U A;  4IQA A;  2IMK A;  2E7P A;  4ZB8 A;  4KE3 A;  4HDE A;  1EZK A;  1VRS D;  4XS6 A;  4CY6 A;  1ERU A;  2YJ7 A;  2F8A A;  2PER A;  2LUS A;  5C04 A;  2TIR A;  5IO0 A;  5D96 A;  3A2W A;  2BMX A;  3HJP A;  4POB A;  4FQU A;  4KGI A;  3CRT A;  2RM6 A;  2H1B A;  3GNJ A;  1A23 A;  1E2Y A;  5E4W A;  2DJK A;  4X43 A;  1YEX A;  2HI7 A;  3IHQ A;  2CQ9 A;  2YPM A;  3FEU A;  1K0M A;  4DSS B;  3IRA A;  3LXZ A;  3EU3 A;  3DXB A;  1UC7 A;  3ERF A;  2YCD A;  4X4J A;  1XW9 A;  4BL7 B;  3IA1 A;  1EV9 A;  1TJD A;  2HT9 A;  2LNT A;  4WBR D;  3IR4 A;  3DYR A;  5KEJ A;  2PU9 C;  5CRG A;  2BTO T;  3IV4 A;  2FWG A;  2HRF A;  1V2A A;  1TRU A;  5IIZ A;  2A2P A;  3F8U A;  1QQ2 A;  2CV4 A;  4MP4 A;  1GUM A;  2VO4 A;  2MMZ A;  2L6D A;  3A3T A;  3H79 A;  5B6M A;  1AQX A;  2H76 A;  4TR1 B;  5JWQ B;  3QAG A;  3TUE A;  3VK9 A;  1EEJ A;  3LFL A;  1URM A;  1ABA A;  4J57 E;  2DMM A;  3DIE A;  3W8J A;  1BG5 A;  5JCG A;  4G2E A;  3P90 A;  4YQU A;  1SYR A;  1HYU A;  5IO2 A;  2QSI A;  1WMJ A;  4WXT A;  2D2Z A;  2WS2 A;  2DBC A;  3EE2 A;  5LCZ A;  5F07 A;  4NHZ A;  1JZW A;  4LMV A;  1T8E B;  1MDJ A;  3UBL A;  5D9T A;  5GZZ B;  4G0I A;  3IDV A;  4MJB A;  2DSA A;  5JWR B;  2CZ3 A;  1GTB A;  3H1N A;  3M0F A;  3TJJ A;  1G6Y A;  3F4T A;  2CVK A;  4F82 A;  2R2J A;  1TRS A;  3JCM L;  5BRT A;  3PPU A;  4N10 A;  1O7U A;  1R5P A;  5AIX A;  1Z7R A;  3LOR A;  2AJQ B;  3IHG A;  3FZ9 A;  4N0Z A;  2F9S A;  4ULX A;  2IPA A;  1OC8 A;  4AJ7 A;  3OR5 A;  3KH7 A;  2JZS A;  4PNG A;  1OKT A;  1RK4 A;  1XIY A;  4EVM A;  3ME7 A;  2IIY A;  3UBK A;  4F0C A;  1NHO A;  3IK9 A;  1ACV A;  5KOX A;  3HKR A;  4ICY A;  3AY8 A;  1K3L A;  5DCG A;  4O5U A;  2LJR A;  3UAP A;  3IOS A;  1ILO A;  2NPB A;  1M9A A;  3H93 A;  3ERG A;  2MYG A;  2V6O A;  2FWE A;  3L9V A;  4YQV A;  4L8E A;  1R7H A;  4ID0 A;  4OO4 A;  3UMA A;  3NOF A;  4IP1 A;  2FA8 A;  1EV4 A;  2N5A A;  3U5R E;  1SD9 A;  1K0D A;  3CYN A;  2PGT A;  3HVS A;  2WDU A;  1PQN A;  3MNG A;  2FUG 2;  1OC9 A;  1QXH A;  3TB2 A;  4PQH A;  2PVQ A;  1U3A A;  1WOU A;  1G0T A;  3APS A;  1M9B A;  3GKK A;  4EF0 A;  5ABR A;  4P3Y B;  2H1G A;  3IXR A;  1YY7 A;  2ES7 A;  4G0K A;  5EY6 A;  1SJZ A;  2ZNM A;  3Q74 A;  4HUA A;  4JZQ A;  4I5Q A;  5HFG A;  5HR1 A;  1F2E A;  1OAZ A;  3MDK A;  3VPQ A;  2RUF A;  3TKP A;  1WIK A;  2R6K A;  3L9S A;  4JE1 A;  3GIX A;  3E3E A;  3TJB A;  10GS A;  4ECJ A;  3GN3 A;  1ZYE A;  2H8L A;  4N0V A;  4XHM A;  3F0I A;  1W89 A;  3V1W A;  4IW9 A;  3C73 A;  1JZD A;  3QR6 A;  2DC5 A;  1J0F A;  2JAD A;  4Z2U A;  1B9Y C;  4G10 A;  3Q19 A;  2RM5 A;  3C8E A;  2I9H A;  3UL3 A;  2OBI A;  3DVW A;  4HZ4 A;  4KX4 A;  4XIH A;  3I69 A;  4D73 B;  5DJL A;  3CBU A;  3HZ4 A;  3WT1 A;  3GL5 A;  4FYU A;  2C3T A;  5ELG A;  1OE8 A;  2C0E A;  4NHW A;  3HVX A;  5ECO B;  1XW5 A;  1YDK A;  3G9B A;  3F6F A;  1X5E A;  2JSZ A;  4OCF A;  3KTB A;  2B3S A;  4QQ7 A;  4JR4 A;  1MD4 A;  2L59 A;  3MAK A;  4ZIL A;  5FT3 A;  2J23 A;  2HE3 A;  1EP7 A;  2PMT A;  2FNO A;  4XCS A;  2R5G A;  4ECC A;  5J9B A;  2ALB A;  4IS0 A;  3FK8 A;  2O89 A;  3VI5 A;  1J08 A;  2CVB A;  4NV2 A;  2YWN A;  5DQS A;  4F0B A;  2K9F A;  2LJK A;  2GVP A;  4WET A;  5GST A;  4KA0 A;  3C7M A;  2TRX A;  3ZRD A;  2KP1 A;  5CRD A;  4I6X A;  4PXO A;  5G5F A;  2HSY A;  3IC4 A;  4RI6 A;  4OMV A;  2IMD A;  2FWH A;  5G31 A;  1OYJ A;  1X5D A;  3F6D A;  1OKD A;  1EGR A;  3EC3 A;  3G7Y A;  1TI3 A;  2WUL A;  4K9Z A;  1TRW A;  4WR4 A;  5CO3 A;  2B1L A;  2KLX A;  5G2Z A;  5IMA A;  2MZC A;  3CTG A;  3I6A A;  2LEG A;  4ML6 A;  3N5O A;  3L78 A;  1JHB A;  1Z9H A;  4YAP A;  4N11 A;  5CRH A;  4I2U A;  4MAB A;  4L5L A;  1GNW A;  1ZZY A;  2P0G A;  4A5P A;  1YEP A;  4V2M A;  2FY6 A;  2VOC A;  1SL0 B;  4CHS A;  1JZR A;  1T1V A;  3QD9 A;  2FD3 A;  3PGT A;  2HXK A;  1XXU A;  2H1D A;  4G19 A;  6GSY A;  2GSS A;  4BPY A;  2GQM A;  4BWS A;  2L4Q A;  2ON5 A;  4RQX A;  2L4C A;  2IFQ A;  4DEJ A;  1FW1 A;  3TKR A;  1JZO A;  2YJH A;  4K5S A;  3ZIV A;  4BVY B;  1GUH A;  3R3E A;  3HJM A;  6GSW A;  1O6J A;  2PVO C;  1B9X C;  3GH9 A;  4EDY A;  1SK0 A;  2H01 A;  2WRT A;  5HR2 A;  4EIQ A;  3DWV A;  4O5R A;  4GCI A;  4PX1 A;  3UVT A;  1YF1 A;  2WCI A;  4EUY A;  4TW5 A;  2LS5 A;  3MIX A;  3UOM A;  4HU9 A;  2JSY A;  5ELA A;  3APO A;  2ON7 A;  5ECP B;  2C3N A;  2YOI A;  3MSZ A;  5FHI A;  4BL7 A;  1PN0 A;  3RDW A;  3IE3 A;  5F05 A;  4Q5N A;  3RHC A;  2XHF A;  5LNK e;  4K7N A;  1AXD A;  3Q6O A;  4KDY A;  3I43 A;  4IJ3 A;  3EUR A;  2C0F A;  1AIU A;  3HCZ A;  3FRC A;  3GRX A;  4HS1 A;  4AJ6 A;  1BX9 A;  2VCX A;  1Z6M A;  3F4R A;  4TR1 A;  2L5O A;  1Z3E A;  4KDU A;  3QMX A;  2VL9 A;  4MZC A;  3IPZ A;  1ON4 A;  3LWA A;  4MF7 A;  4EC0 A;  1UVZ A;  5ECM B;  3EMP A;  7GSS A;  1NSW A;  2VLV A;  2IWT A;  4WR5 A;  5IMV A;  5J3R A;  4V1A g;  3HYP A;  1O81 A;  3D4M A;  2YWM A;  4GSS A;  4YKG A;  2EC4 A;  3QAV A;  2B1K A;  3GUR A;  3D4T A;  4LL1 B;  4TR0 A;  3CTF A;  3GST A;  3KMN A;  3ZFB A;  3M1G A;  2A4H A;  1R5A A;  4KW6 A;  2EIR A;  4L0U A;  1UA5 A;  1NW2 A;  3A2V A;  1QGV A;  1MDK A;  4MCU A;  3IC8 A;  1TP9 A;  3IBH A;  3LYP A;  3KJY A;  1SJ6 A;  1FOV A;  5CRE A;  4HJM A;  3FR9 A;  3ZFL A;  2KOK A;  3TDG A;  3W6G A;  3ZVJ A;  3LEF A;  5ECH B;  3UEM A;  2B7J A;  2CAQ A;  4XTS A;  4ZBA A;  1VF3 A;  1GH2 A;  3KP9 A;  4EO3 A;  2LRT A;  4K1F A;  1XBS A;  4EE0 A;  5ECQ B;  1M2B A;  4NV5 A;  1F9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...