2M72A

Solution structure of uncharacterized thioredoxin-like protein pg_2175 from porphyromonas gingivalis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
153
structure length
153
Chain Sequence
NTYAQLPAVSLKNIEGKTVQTNKLENAGKPMIISFFATNCKPCLRELKAIQEVYADWQDETGVRLIAVSIDEGQNAQKVKPLADGNGWEYEVLLDSNGDFKRAMNVSLIPAVFIVDGNGKIVYNHTGYTEGGEAELIKKVRELVKEGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized thioredoxin-like protein
publication title Solution structure of uncharacterized thioredoxin-like protein PG_2175 from Porphyromonas gingivalis
rcsb
source organism Porphyromonas gingivalis
total genus 37
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2m72A00
5ECNB 2V1MA 1EZKA 3TJKA 4ZBDA 1EOGA 3TKSE 1FVKA 5D9VA 1TXXA 3EURA 3FYGA 5D8IA 2YWOA 1GSDA 2VLTA 4TR4A 4BVXA 3ZYWA 4GWRA 5F06A 8GSSA 3CXGA 5ECQB 4BL7A 5IPGA 1F3BA 1X5EA 4XTSA 1ST9A 2JADA 5JWOB 1PL2A 2AUVA 1OE8A 3HDCA 3WGDA 1TOFA 2C0EA 3UBLA 4TR1A 5COHA 4XS1A 3GFKA 1FVJA 2H1AA 2VCQA 5DQSA 3QD9A 2LSTA 5KN1A 2VOCA 2IMDA 1GWCA 1X0RA 4Q5QA 3O3TA 1K0DA 3F4SA 2XPEA 4EUYA 2VM2A 1FB6A 1TI1A 4AF2A 2HRNA 3O76A 1THXA 2OJLA 1MDJA 1TP9A 2H73A 1M9AA 3F0IA 5ECLB 2HSYA 4IBPA 4EE0A 1V40A 1KTEA 1M2BA 1ML6A 1EV9A 3QAGA 1Z3EA 4HUAA 4ACSA 2LJRA 4V2NA 2OA7A 1ERVA 4XRDA 3CRTA 1AXDA 3OR5A 1OC8A 4IP6A 12GSA 5L71A 2MMZA 3DD3A 1U3AA 2MBTA 2E7PA 2R4VA 2KUCA 3ZFLA 4TN8A 4EC0A 4F82A 3FR6A 3E0UA 5GZZB 4HU7A 4LL4B 1V58A 1F3AA 5D73A 5LNKe 5JWRB 1PKZA 1T4ZA 4H86A 2DC5A 1YKAA 3HVXA 4ML6A 5DCGA 1PA3A 3KH9A 3TCOA 5DBQA 4ECCA 2H71A 3LXZA 3Q74A 2OE1A 3BCKA 2IMFA 2GTUA 2NTOA 4JRRA 2PGTA 2A4VA 3M8NA 2YCDA 1M2DA 2FUG2 1LBKA 3ZIJA 2VL2C 5IMAA 4ECBA 3HCZA 1BYEA 3VWXA 2NVLA 3UEMA 1Q4JA 1N2AA 1MDKA 2IL3A 1I9DA 5KN0A 3FZ4A 3AY8A 1WRYA 1XW6A 2YV9A 4G19A 4IP1A 4RUVA 5B8BA 1ON4A 2G0FA 4OFNA 3EVIA 4X43A 5FHIA 2RUEA 4PQ1A 3IAM2 2DSAA 3BCIA 3HA9A 4F9ZA 2MYGA 2VLVA 3GX0A 2I9HA 2IJYA 3VWWA 4XCSA 3D22A 4I97A 2H76A 4OCFA 4TW5A 5HFIA 4WBJA 1MD4A 3FW2A 2C4JA 1XWCA 2L5OA 3QPMA 5F8BA 3D21A 3F3RA 2JZTA 4HS1A 3LYKA 4N10A 4XIHA 4K7NA 3W6GA 3S9FA 4MA9A 2LV3A 5C04A 3CSJA 3LWAA 1MTCA 4E8HA 2O87A 3IPZA 5E4WA 2IMEA 6GSTA 1BAYA 2F51A 1H4OA 4ZL8A 2AHEA 1A24A 2I4AA 3HYPA 1MD3A 4MJBA 4O7HA 2I3YA 4WR5A 2JU5A 4NWYA 3GTUB 4K6XA 4WKWA 2IIYA 3WD6A 1GNEA 1AAZA 1U87A 2MMOA 2X99A 2FWFA 2L6CA 2IFQB 1Z6NA 2CT6A 2XPDA 4ZB6A 1M99A 3HZ4A 4L5LA 1HNCA 2M46A 2YWNA 1YQ1A 1GSEA 1TU8A 1K0NA 1SYXA 1E6BA 1OKTA 4MZWA 2GVPA 4JBBA 1A2LA 2HZEB 5ECSA 2KLXA 2B1KA 4TXOB 3GURA 1TRWA 3UAPA 1G6WA 4AGSA 3EINA 2ZCTA 4LA1A 5J9BA 2VIMA 3GKXA 1YJ6A 4FIWA 4WF4A 2N5FA 3ZMLA 5JCGA 4CW9A 4PXOA 3M1GA 3QAVA 2EIOA 3FRCA 3VWVA 3F6DA 2C8UA 3Q18A 1M7TA 1QGVA 3A3TA 3DRNA 3TKRA 3ZITA 4L8EA 4KNDA 1SL1B 3M9JA 2I81A 3VFIA 5KEJA 2P5QA 1TK5B 3IAS2 4J57E 1HNAA 2BTOT 3J7Yk 2JL4A 3HHVA 3F3QA 4NHZA 1B9XC 5DJLA 4JR4A 2VD1A 2WDUA 5KN3A 1PKWA 4YQVA 2L59A 3PINA 1XVQA 3US3A 4OWYA 2B7JA 1GH2A 3GKKA 4WF5A 1AC1A 2C3NA 1PN9A 4NPBA 2FY6A 17GSA 5EL8A 1EGRA 2PERA 2LEGA 1CQHA 2AAWA 3MSZA 3CTFA 3PH9A 4TR0A 2WCIA 2BMXA 3GV1A 3A2VA 1FAAA 3ZMKA 1K3YA 3UL3A 4DSQA 3VPTA 1PRXA 4KAEA 5CREA 5JCUA 4WEYA 2OBIA 2M80A 4ECJA 1GSFA 3WYWA 3GUSA 4TR3A 3ZVJA 2EIQA 3RPPA 4TKYA 4ZIJA 1GSQA 2B5XA 2YN1A 3EYTA 2HZFA 2H0IA 2IPAA 4J56E 3Q19A 3DWVA 3IRAA 2R37A 4OO4A 3WT2A 13GSA 4CHSA 3FHKA 3H93A 5DAKB 5EVOA 4MABA 1K0CA 2YP6A 2KHPA 5GAND 5KN2A 3HVVA 2FLSA 3P90A 1XW9A 1TKDB 4NAXA 3L9SA 1GUKA 5D9TA 4GLTA 4IHUA 1R26A 2A2SA 2OBKA 3NOFA 4MCUA 4F0CA 5B8AA 3LFLA 1YDKA 1GLQA 1EEJA 4WR4A 1KNGA 2L4CA 1OKDA 2R5GA 4G9HA 2LQQA 1OC9B 2X8CA 3GRXA 4L0WA 2H0GA 2H1BA 2HFDA 3WGXA 2GT6A 3O6TA 3BOAA 5ECKB 2GQLA 1FO5A 5D9WA 1GUMA 1K0OA 5DJMA 1DUGA 1SJIA 2O8VB 4KCEA 2GSRA 2M72A 4DEJA 2P0GA 5JCWA 2GGTA 1XBSA 3TRQA 1FHEA 1R5PA 1UN2A 5B6NA 1ZGNA 1TRUA 5FWGA 3PR8A 1T3BA 2O85A 2DJKA 4MJAA 4MH3A 2H66A 2VCXA 1NM3A 1GUHA 5HR1A 4G2EA 3RAZA 1ERUA 3HY2A 2P31A 1O85A 4EKZA 5H5SA 5CRWA 4J2FA 3LEFA 1JFUA 2L57A 2DLXA 3P2AA 4QL7A 3WGEA 1G7EA 1ZL9A 2X64A 3MWHA 3P7XA 3I9V2 4BWQA 3HKRA 3FK8A 2WFCA 4MDCA 4K7OA 2HI7A 4V2LA 1WP0A 2H6ZA 4MF7A 3UJ1A 4ZBBA 2O7KA 4KDUA 1A8YA 1SL2B 3GSTA 2ZUPA 3KM6A 1T1VA 5ECPB 2GZYA 2J9HA 3IR4A 3SBCA 1MEKA 1AUCA 2AJQB 4KB3A 3ZVJD 1S3AA 4MZCA 2H1DA 4GTUA 2OE0A 4P3YB 3FKFA 1GP1A 1WOUA 4MK3A 4PUFC 5DALA 5AGYA 14GSA 1PD21 4POLA 3C8EA 2FHEA 5CNWA 4BPYA 3QOUA 4OMVA 4KCAA 1V98A 2F3MA 3WT1A 2H8LA 3ED3A 3VURA 3ZIVA 3UOMA 4RI6A 4V2MA 1WE0A 1A0FA 4K1FA 5A4WA 3FZ5A 6GSXA 2FCHA 3L9UA 3VI5A 3NIVA 4NXIA 3QFBC 1GL8A 2WB9A 3F4RA 1QK8A 3VPQA 2H6YA 3TOUA 3QCPA 4ZILA 1SU9A 4IQ1A 2DMLA 3GL5A 3C1RA 4GQFA 4HJ2A 3R2QA 5ABRA 2VCZA 5ECOB 2AV4A 2DIZA 1TW9A 5LD0A 1EEMA 4K2DA 2GZZA 3RHCA 2F9SA 5H5RA 2LTKA 2TRXA 2IMIA 3HJPA 3ERFA 1EWXA 1O8XA 2LQOA 1U6TA 1JHBA 2REMA 4ULXA 4OFMA 2KP1A 2MMNA 1R5AA 2PN8A 4NHWA 1O6JA 3ME7A 3L4NA 2C0GA 3IK9A 3A2XA 4I2UA 5IIZA 1X9SB 2LNTA 5IMCA 1TRSA 4N11A 2R3XA 3ZZXA 1YEPA 3LQ7A 1U3IA 4MPFA 3TB2A 11GSA 2XC2A 1SK2A 2OACA 2I1UA 3E3EA 3QAWA 3CBUA 3BJ5A 2VD0A 2NDOA 10GSA 1T4YA 1S3CA 4WBRD 2BJXA 3IK7A 1WPIA 4K0GA 3RHBA 2QKEA 3D4MA 1FG4A 3GN3A 4PX1A 4LMVA 3APQA 3KCMA 1QFNA 1F2EA 1LU4A 3DXBA 4IJ3A 5ID2B 1ACVA 3CTGA 1O8WA 3U5RE 4BA7A 3KD0A 4ML1A 1VGLA 2PWJA 2LJAA 4JEDA 1MDIA 4O32A 4MF6A 3FR3A 3TRXA 3IHQA 2XBIA 3M3MA 3KMNA 4N30A 2E2MA 3DGQA 3UBKA 1GTAA 3ZTLA 4YQMA 5IOWA 2F8FA 4D73B 2CZ3A 1F6MC 2GT5A 4MH2A 3KP8A 2O89A 1B4PA 1YF0A 5HFKA 1H75A 4ID0A 3RDWA 3MDKA 3H79A 4NMUA 2OKAA 2L4QA 2VCVA 3ZL5A 2H72A 4EF0A 4X0XA 1EGOA 4EDZA 5HR2A 3LORA 1XXUA 4I6XA 4WETA 5J5NA 3CSIA 1UC7A 1B4QA 3TOTA 3C73A 1A2MA 2H70A 1BJXA 5HFGA 4Q5FA 5B7CA 3I43A 5HR3A 5IO2A 2WULA 4PUAA 2EC4A 5F07A 5A5KA 3U6VA 1QQ2A 5D9XA 1J0FA 3TKQA 2VO4A 2V32A 4GSSA 2LRTA 5DDLA 1YZXA 1TRVA 4ZB9A 3TKPA 2KP2A 4FO5A 3KH7A 1Z9HA 5G30A 3GYKA 3TDGA 5CRDA 2B1LA 3DYRA 1YY7A 2YWIA 3UVTA 2K8VA 4DSRA 1EV4A 4IELA 4K8MA 4IKHA 3APSA 2V6OA 2AYTA 1PX6A 1ERTA 5D93A 3FR9A 1AW9A 5IM9A 3TRPA 2DJ1A 2WZ9A 5J3RA 3VK9A 1NHYA 6GSYA 1KEBA 1AQVA 3IBHA 2B6MA 2DBCA 5J4UA 1X9MB 3I6AA 3J7Yb 1VF2A 1JZOA 5HR0A 1GSSA 4PQIA 3D5JA 2YWMA 2ES7A 4FYUA 3TKSA 1QMVA 3ZRDA 2VAFA 3MNGA 2R6KA 1WWJA 4KW6A 4ISDA 2V2GA 5ENUA 2XHFA 5ECMB 4YAVA 3ME8A 2RUFA 5IPHA 4ZBAA 1EP8A 3L0HA 1SJ6A 3KGKA 4MMMA 2RLIA 4TR1B 4TOPA 3D4TA 2CVBA 4KE3A 3A5WA 4RI7A 2B5YA 4PURA 5CAXA 3HXSA 3ZFBA 3TJFA 4HDEA 6GSUA 1NW2A 2CAQA 4GRFA 1XOBA 4YH2A 3TGZA 2H01A 4MZBA 3C1SA 1K0BA 4K9ZA 5CRGA 1BQ7A 2H6XA 1XWBA 1K3OA 1Y25A 1XWGA 3M0FA 4V1Ap 2YZUA 2RM6A 1URMA 2GLRA 3GHAA 2PUKC 1FOVA 2FWHA 2X8GA 3CMIA 3GKMA 1T00A 3TUEA 2QSIA 2GSTA 4O5RA 4YAPA 1G6YA 2K9FA 5EY6A 3L9VA 2TRCP 2YOIA 3G9BA 2H19A 1J08A 2IFQA 4K0NA 3TJJA 1SKWB 2DIYA 1IYHA 2IN3A 3F8UA 1RQMA 1UVZA 3LG6A 1O7UA 1NHOA 4AJ7A 4ZL7A 3A2WA 4JU5A 2WS2A 2JZSA 4N0ZA 3EE2A 1SYRA 1XIYA 2HZEA 4KA0A 1HYUA 4TXOA 4ECIA 3JCML 4OCEA 5G1LA 3GNJA 2TIRA 2FGXA 3Q6OA 3KIJA 4XS4A 7GSSA 1O81A 1A0RP 3E9JB 3G7YA 4Q5NA 1VRSD 1PMTA 1GNWA 4GF0A 4EO3A 4JE1A 2L5LA 4GSTA 4I2TA 5EPFA 2WRTA 4FH8A 3FEUA 1A2JA 1NSWA 1BG5A 2MZCA 4IVFA 1M2AA 3BD2A 4PNFA 5CRHA 3KJYA 5G5EA 1FB0A 4Q5RA 1TJDA 2ON7A 3DVWA 2C80A 2J23A 2H0HA 1J9BA 2XBQA 4HQSA 3QFAC 1K0AA 1V57A 3DVXA 1AIUA 2D2ZA 2NPBA 4XS6A 1SK0A 1FW1A 2FNOA 1VF4A 4GQCA 1IYIA 1M9BA 3L78A 5FT3A 3IC4A 5DQYA 1W4VA 3HJMA 1DSBA 4I8BA 3BBYA 4KSMA 2HSHA 4HEA2 2MBSA 1A23A 5GSTA 2GSQA 1S3DA 2LRCA 2CAIA 2DJ0A 4LL1B 1JZRA 1B8XA 3KZQA 4QL9A 2L6DA 1SENA 3MAKA 4EL1A 1ABAA 1SD9A 5HQPA 1R4WA 5G2ZA 18GSA 5D96A 1LJRA 2G2QA 1HNBA 1SD8A 5CO3A 3UARA 1I5GA 1ILOA 3FY7A 2JACA 5IO0A 2PU9C 1Z6MA 4FYCA 5DAKA 4QQ7A 3PGTA 1W89A 3N5OA 3QR6A 1K0MA 2CX4A 3EU4A 2ZNMA 4I5QA 5IMDA 2GS3A 2X8HA 3ERGA 4PGTA 3HJOA 2CVDA 2VUPA 3GH6A 4V1Ag 2V6KA 4EXJA 2HNLA 1THOA 5B6MA 5DVBA 2CX3A 1GTIA 3KTLA 5ECRB 3H1NA 2K8SA 3APOA 3DKSA 3FZAA 3TKSC 1PSQA 2PPTA 3QDNA 1V9WA 3FZ9A 4L0UA 4DSSA 5A4UA 2OADA 6GSSA 3UMAA 1A8LA 1OC9A 2HT9A 4HJMA 4AJ8A 5J9CA 1DE2A 4GCIA 1F37A 3ZREA 4IS0A 4XRAA 1ZZYA 2H74A 5LCZA 2C1YA 4MP4A 1OYJA 3RPNA 1G7OA 2IMKA 1Z7RA 5IMVA 1X5DA 1PL1A 2VLUA 2PMTA 4AJ6A 1ZMAA 4E8EA 4RQXA 1TK8B 1GRXA 4POMA 2Z9SA 2LUSA 4IGJA 2CQ9A 5ELAA 1BEDA 1N8JA 5ELGA 1TU7A 3GIXA 1O73A 1Y6EA 1QXHA 1F9MA 22GSA 3LGCA 5DCHA 2K18A 1SKRB 5F0GA 2VCTA 3EC3A 3KXOA 5AN1A 3GSSA 4GXZA 2ALBA 2FWEA 4FYBA 2C3QA 5G31A 3ZLPA 1XZOA 1HD2A 3C71A 4OD7A 2YJHA 3IE3A 3CYNA 3IXRA 2E0QA 2DJJA 2PVOC 4OFTA 1WIKA 2C0DA 1WJKA 4LMWA 1B9YC 1ERWA 3NZNA 3C7MA 1XFLA 3LXTA 2K6VA 4IW9A 4EVMA 3P8WA 2E2GA 1ZYQB 1TK0B 5H5QA 1C72A 1R7HA 1XVWA 2V41A 3DMLA 2CZ2A 4F03A 5IQYA 1XWKA 1XPVA 4NV2A 1K3LA 1VF1A 2P5RA 3F6FA 4F0BA 2HYXA 4JR6A 2R2JA 4XHMA 3KTBA 1RW1A 5JWQB 1YEXA 4Z7XA 1JZDA 1OVNA 5CP1A 3UVHA 3TJGA 2FD3A 1RK4A 3EMXA 4HQZA 3G7JA 1SKSB 2VM1A 4DVCA 1UA5A 2FA4A 4HZ2A 1GLPA 3EMPA 2HXKA 1GSUA 3UIWA 1JZWA 5AIVA 1V2AA 3HVSA 1DE1A 1VF3A 1KBNA 1GSYA 3VI7A 2NBSA 2H1GA 3H8QA 2C0FA 2YNXA 4BWSA 16GSA 5G1KA 3D6IA 5IOXA 1JLVA 4TXVA 3GL3A 2OE3A 2GZPA 4KH7A 1OAZA 4O92A 2GDRA 2B3SA 3GA4A 4MLYA 5AIXA 2CVKA 2LJKA 5C00A 20GSA 2AB6A 1X9WB 1YF1A 2LS5A 2DJ3A 1X5CA 1ZCPA 4MF5A 2JSYA 3M9KA 3I69A 3DEXA 3IV4A 5G5FA 3GMFA 4L5OA 3EU3A 2F8AA 4KUNA 4XS4B 1OC3A 1TDIA 1PX7A 2JSZA 3G7IA 2LKUA 1Z7PA 4EDYA 5J41A 1GTUA 2VL3A 2QGVA 5INYA 4KDYA 4HI7A 19GSA 2N5AA 1U88A 2HE3A 1XOAA 4CDOA 4JZQA 1CQGA 2YPMA 3V1WA 2C3TA 2FWGA 2VCWA 1XWAA 2EIRA 2YZHA 1JLWA 2JZRA 2VL9A 2CA8A 1AQXA 3ISOA 3CSHA 1TI3A 5ECIB 3N9JA 3IA1A 3KMOA 1B48A 2B5EA 2FA8A 6GSWA 2DJ2A 2LNSA 3VLNA 1BX9A 4GSNA 1TTZA 4BVYA 4ZL9A 3SWLA 1T7PB 4ZB8A 2YJ7A 3EWLA 3F4TA 3LYPA 4G10A 4ILFA 2RIIA 3CRUA 5CYYA 1WMJA 4F2IA 4KGIA 4WXTA 5ID2A 2WJUA 2PVQA 2GQMA 2QC7A 2H75A 4KX4A 2H30A 5DALB 5GAPD 3LJRA 1T8EB 1SK1A 4MPGA 4K7IA 3QMXA 1HQOA 1Q98A 4KSOA 3F9UA 3RBTA 4IN0A 2HRFA 4OO5A 4MJEA 2PBJA 4TRXA 3GH9A 1M0UA 3GTUA 4D73A 2IWTA 4HOJA 3W8JA 3H4KA 3D0ZA 1XW5A 4ZXGA 4POKA 1QUWA 2GSSA 1GULA 1OE7A 2VL2A 2YANA 2MMAA 4RQRA 3GKNA 4MJCA 5IMZA 1ZYEA 2GQKA 4HZ4A 4NV5A 5AISA 2ON5A 4HU9A 4PNGA 4POBA 1Z5YE 3HD5A 5IMFA 4DSSB 6GSVA 2A2RA 4X1UA 2LRNA 5GSSA 1PQNA 3TJBA 4LLRA 2DMMA 2WGRA 2KOKA 1EP7A 4TVEA 3K8NA 2RM5A 1GTBA 1G0TA 3VWUA 3GX8A 1SL0B 3W8SA 3KP9A 1YKCA 2CV4A 3HZ8A 9GSSA 1DBYA 1PGTA 3F63A 4IJIA 1USBA 1ZOFA 3IOSA 5E59A 1AQWA 4IQAA 5A4VA 2N5BA 1XCCA 1E2YA 3DIEA 3IDVA 4PQHA 3ERWA 2B7KA 4N0VA 5F05A 4KDXA 5ECHB 4YQUA 1SJZA 3LSZA 2YV7A 2HLSA 1EOHA 3KEBA
chains in the Genus database with same CATH superfamily
5ECNB 2V1MA 1EZKA 3TJKA 4ZBDA 1EOGA 3TKSE 1FVKA 5D9VA 1TXXA 3EURA 3FYGA 5D8IA 2YWOA 1GSDA 2VLTA 4TR4A 4BVXA 3ZYWA 4GWRA 5F06A 8GSSA 3CXGA 5ECQB 4BL7A 5IPGA 1F3BA 1X5EA 4XTSA 1ST9A 2JADA 5JWOB 1PL2A 2AUVA 1OE8A 3HDCA 3WGDA 1TOFA 2C0EA 3UBLA 4TR1A 5COHA 4XS1A 3GFKA 1FVJA 2H1AA 2VCQA 5DQSA 3QD9A 2LSTA 5KN1A 2VOCA 2IMDA 1GWCA 4YKGA 1X0RA 4Q5QA 3O3TA 1K0DA 2HRAA 3F4SA 2XPEA 4EUYA 2VM2A 1FB6A 1TI1A 3PPUA 4AF2A 2HRNA 3O76A 1THXA 2OJLA 1MDJA 1TP9A 2H73A 1M9AA 3F0IA 5ECLB 2HSYA 4IBPA 4EE0A 1V40A 1KTEA 1M2BA 1ML6A 2DKHA 1EV9A 3QAGA 1Z3EA 4HUAA 4ACSA 2LJRA 4V2NA 2OA7A 1ERVA 4XRDA 3CRTA 1AXDA 3OR5A 1OC8A 4IP6A 12GSA 4A5PA 5L71A 2MMZA 3DD3A 1U3AA 2MBTA 2E7PA 2R4VA 2KUCA 3ZFLA 4TN8A 4EC0A 4F82A 3FR6A 3E0UA 5GZZB 4HU7A 4LL4B 1V58A 1F3AA 5D73A 5LNKe 5JWRB 1PKZA 1T4ZA 4H86A 2DC5A 1YKAA 3HVXA 4ML6A 5DCGA 1PA3A 3KH9A 3TCOA 5DBQA 4ECCA 2H71A 3LXZA 3Q74A 2OE1A 3BCKA 2IMFA 2GTUA 2NTOA 4JRRA 2PGTA 2A4VA 3M8NA 2YCDA 1M2DA 2FUG2 1LBKA 3ZIJA 2VL2C 5IMAA 4ECBA 4Z2RA 3HCZA 1BYEA 3VWXA 2NVLA 4O5UA 3UEMA 1Q4JA 1N2AA 1MDKA 2IL3A 1I9DA 5KN0A 3FZ4A 3AY8A 1WRYA 1XW6A 2YV9A 4G19A 4IP1A 4RUVA 5B8BA 1ON4A 2G0FA 4OFNA 3EVIA 4X43A 5FHIA 2RUEA 4PQ1A 3IAM2 2DSAA 3BCIA 3HA9A 4F9ZA 2MYGA 2VLVA 3GX0A 4G0KA 2I9HA 2IJYA 3VWWA 4XCSA 3D22A 4I97A 2H76A 4OCFA 4TW5A 5HFIA 4WBJA 1MD4A 3FW2A 2C4JA 1XWCA 2L5OA 3QPMA 5F8BA 3D21A 3F3RA 2JZTA 4HS1A 3LYKA 4N10A 4XIHA 4K7NA 3W6GA 3S9FA 4MA9A 3A5IA 2LV3A 5C04A 3CSJA 3LWAA 1MTCA 4E8HA 2O87A 3IPZA 5E4WA 2IMEA 6GSTA 1BAYA 2F51A 1H4OA 4ZL8A 2AHEA 1A24A 2I4AA 3HYPA 1MD3A 4MJBA 4O7HA 2I3YA 4WR5A 4ICYA 2JU5A 4NWYA 3GTUB 4K6XA 4WKWA 2IIYA 3WD6A 1GNEA 1AAZA 1U87A 2MMOA 2X99A 2FWFA 2L6CA 2IFQB 1Z6NA 2CT6A 2XPDA 4ZB6A 1M99A 3HZ4A 2R0PA 4L5LA 1HNCA 2M46A 2YWNA 1YQ1A 1GSEA 1TU8A 1K0NA 1SYXA 1E6BA 1OKTA 4MZWA 2GVPA 4JBBA 1A2LA 2HZEB 5ECSA 2KLXA 2B1KA 4TXOB 3GURA 1TRWA 3UAPA 1G6WA 4AGSA 3EINA 2ZCTA 4LA1A 5J9BA 4K5RA 2VIMA 3GKXA 1YJ6A 4FIWA 4WF4A 2N5FA 3ZMLA 4G0LA 5JCGA 4CW9A 4PXOA 3M1GA 3QAVA 2EIOA 3FRCA 3VWVA 3F6DA 2C8UA 3Q18A 1M7TA 1QGVA 3A3TA 3DRNA 3TKRA 3ZITA 4L8EA 4KNDA 1SL1B 3M9JA 1S3RA 2I81A 3VFIA 5KEJA 2P5QA 1TK5B 3IAS2 4J57E 1HNAA 2BTOT 3J7Yk 2JL4A 3HHVA 3F3QA 4NHZA 1B9XC 5DJLA 4JR4A 2VD1A 2WDUA 5KN3A 1PKWA 4YQVA 2L59A 3PINA 1XVQA 3US3A 4OWYA 2B7JA 1GH2A 3GKKA 4WF5A 1AC1A 2C3NA 1PN9A 4NPBA 2FY6A 17GSA 5EL8A 1EGRA 2PERA 2LEGA 1CQHA 2AAWA 3MSZA 3CTFA 3PH9A 4TR0A 2WCIA 2BMXA 3GV1A 3A2VA 1FAAA 3ZMKA 4BL7B 1K3YA 3UL3A 1M3IA 3MYDA 4DSQA 3VPTA 1PRXA 4KAEA 5CREA 5JCUA 4X4JA 4WEYA 2OBIA 2M80A 4ECJA 1GSFA 3WYWA 3GUSA 4TR3A 3ZVJA 2EIQA 3RPPA 4TKYA 4ZIJA 1GSQA 2B5XA 2YN1A 3EYTA 2HZFA 2H0IA 2IPAA 4J56E 3Q19A 3DWVA 3IRAA 2R37A 4OO4A 3WT2A 13GSA 4CHSA 3FHKA 3H93A 5DAKB 5EVOA 4MABA 1K0CA 2YP6A 2KHPA 5GAND 5KN2A 2A2PA 3HVVA 2FLSA 3P90A 1XW9A 1TKDB 4NAXA 3L9SA 1GUKA 5D9TA 4GLTA 4IHUA 1R26A 2A2SA 1PFOA 2A4HA 2OBKA 3NOFA 4MCUA 4F0CA 5B8AA 3LFLA 1YDKA 1GLQA 1EEJA 4WR4A 1KNGA 2L4CA 1OKDA 2R5GA 4G9HA 2LQQA 1OC9B 2X8CA 3GRXA 4L0WA 2H0GA 2H1BA 2HFDA 3LW9A 3WGXA 2GT6A 3O6TA 3BOAA 5ECKB 2GQLA 1FO5A 5D9WA 1GUMA 1K0OA 5DJMA 1DUGA 1SJIA 2O8VB 4KCEA 2GSRA 2M72A 4DEJA 2P0GA 5JCWA 2GGTA 1XBSA 3TRQA 1FHEA 1R5PA 1UN2A 5B6NA 1ZGNA 1TRUA 5FWGA 3PR8A 1T3BA 2O85A 2DJKA 4MJAA 2HSMA 4MH3A 2H66A 2VCXA 1NM3A 1GUHA 5HR1A 4G2EA 3RAZA 1ERUA 3HY2A 2P31A 1O85A 4EKZA 5H5SA 5CRWA 4J2FA 3LEFA 1JFUA 2L57A 2DLXA 3P2AA 4QL7A 3WGEA 1G7EA 1ZL9A 2X64A 3MWHA 3P7XA 3I9V2 4BWQA 3HKRA 3FK8A 2WFCA 4MDCA 4K7OA 2HI7A 4V2LA 1WP0A 2H6ZA 4MF7A 3UJ1A 4ZBBA 2O7KA 4KDUA 1A8YA 1SL2B 3GSTA 2ZUPA 3KM6A 1T1VA 5ECPB 2GZYA 2J9HA 3IR4A 3SBCA 1MEKA 1AUCA 2AJQB 4KB3A 3EPTA 3ZVJD 1S3AA 4MZCA 2H1DA 4GTUA 2OE0A 4P3YB 3FKFA 1GP1A 1WOUA 4MK3A 4PUFC 5DALA 5AGYA 14GSA 1PD21 4POLA 3C8EA 2FHEA 5CNWA 4BPYA 2X49A 3QOUA 4OMVA 4KCAA 1V98A 2F3MA 3IHGA 3WT1A 2H8LA 3ED3A 3VURA 3ZIVA 3UOMA 1FOHA 4RI6A 4V2MA 1WE0A 1A0FA 4K1FA 5A4WA 3FZ5A 6GSXA 2FCHA 3L9UA 3VI5A 3NIVA 4NXIA 3QFBC 1GL8A 2WB9A 3F4RA 1QK8A 3VPQA 2H6YA 4K5SA 3TOUA 3QCPA 4ZILA 1SU9A 4IQ1A 2DMLA 3GL5A 3C1RA 4GQFA 4HJ2A 5KOWA 3R2QA 5ABRA 2VCZA 2AV4A 5ECOB 2DIZA 1TW9A 5LD0A 1EEMA 4K2DA 2GZZA 3RHCA 2F9SA 5H5RA 2LTKA 2TRXA 2IMIA 3HJPA 3ERFA 1EWXA 1O8XA 2LQOA 1U6TA 1JHBA 2REMA 4ULXA 4OFMA 2KP1A 2MMNA 1R5AA 2PN8A 4NHWA 1O6JA 3ME7A 4CY8A 3L4NA 2C0GA 3IK9A 3A2XA 4I2UA 5IIZA 1X9SB 2LNTA 5IMCA 1TRSA 4N11A 2R3XA 3ZZXA 1YEPA 3LQ7A 1U3IA 4MPFA 3TB2A 11GSA 2XC2A 1SK2A 2OACA 2I1UA 3E3EA 3MIXA 3QAWA 3CBUA 3BJ5A 1XG8A 2VD0A 2NDOA 10GSA 1T4YA 1S3CA 4WBRD 2BJXA 3IK7A 1WPIA 4K0GA 3RHBA 2QKEA 3D4MA 1FG4A 3GN3A 4PX1A 4LMVA 4BVYB 3APQA 3KCMA 1QFNA 1F2EA 1LU4A 3DXBA 4IJ3A 5ID2B 1ACVA 3CTGA 1O8WA 3U5RE 4BA7A 3KD0A 4ML1A 1VGLA 2PWJA 2LJAA 4JEDA 1MDIA 4O32A 4MF6A 3FR3A 3TRXA 3IHQA 2XBIA 3M3MA 3KMNA 4N30A 4O5QA 2E2MA 3DGQA 3UBKA 1GTAA 4HSCX 3ZTLA 4YQMA 5IOWA 2F8FA 4D73B 2CZ3A 1F6MC 2GT5A 4MH2A 3KP8A 2O89A 1B4PA 1YF0A 5HFKA 1H75A 4ID0A 3RDWA 3MDKA 3H79A 4NMUA 2OKAA 2L4QA 2VCVA 3ZL5A 2H72A 4EF0A 4X0XA 1EGOA 4EDZA 5HR2A 3LORA 1XXUA 4I6XA 4WETA 5J5NA 3CSIA 1UC7A 1B4QA 3TOTA 3C73A 1A2MA 2H70A 1BJXA 5HFGA 4Q5FA 5B7CA 3I43A 5HR3A 5IO2A 2WULA 4PUAA 2EC4A 5F07A 5A5KA 3U6VA 1QQ2A 5D9XA 1J0FA 5KOXA 3TKQA 2VO4A 2V32A 4GSSA 2LRTA 5DDLA 1YZXA 1TRVA 4ZB9A 3TKPA 2KP2A 4FO5A 3KH7A 1Z9HA 5G30A 3GYKA 3TDGA 5CRDA 2B1LA 3DYRA 1YY7A 2YWIA 3UVTA 2K8VA 4DSRA 1EV4A 4IELA 4K8MA 4IKHA 3APSA 2V6OA 2AYTA 1PX6A 1ERTA 2X4AA 5D93A 3FR9A 1AW9A 5IM9A 3TRPA 2DJ1A 2WZ9A 5J3RA 3VK9A 1NHYA 4G0IA 6GSYA 1KEBA 1AQVA 3IBHA 2B6MA 2DBCA 5J4UA 1X9MB 3I6AA 3J7Yb 1VF2A 1JZOA 5HR0A 1GSSA 4PQIA 3D5JA 2YWMA 2ES7A 4FYUA 3TKSA 1QMVA 3ZRDA 2VAFA 3MNGA 2R6KA 1WWJA 4KW6A 4BVXB 4ISDA 2V2GA 5ENUA 2XHFA 5ECMB 4YAVA 3ME8A 2RUFA 5IPHA 4ZBAA 1EP8A 3L0HA 1SJ6A 2QA2A 3KGKA 4MMMA 2RLIA 4TR1B 4TOPA 3D4TA 2CVBA 4KE3A 3A5WA 4RI7A 2B5YA 4PURA 5CAXA 3HXSA 3ZFBA 3TJFA 4HDEA 6GSUA 1NW2A 2CAQA 4GRFA 1XOBA 4YH2A 3TGZA 2H01A 4MZBA 3C1SA 1K0BA 4K9ZA 5CRGA 1BQ7A 2H6XA 1XWBA 1K3OA 1Y25A 2UZ8A 1XWGA 3M0FA 4V1Ap 2YZUA 2RM6A 1URMA 2GLRA 3GHAA 2PUKC 1FOVA 2FWHA 2X8GA 3CMIA 3GKMA 1T00A 3TUEA 2QSIA 2GSTA 4O5RA 4YAPA 1G6YA 2K9FA 5EY6A 3L9VA 2TRCP 2YOIA 3G9BA 2H19A 4BIKA 1J08A 2IFQA 4K0NA 3TJJA 1SKWB 2DIYA 1IYHA 2IN3A 4PTSA 3F8UA 1RQMA 1UVZA 3LG6A 1O7UA 1NHOA 4AJ7A 4ZL7A 3A2WA 4JU5A 2WS2A 2JZSA 4N0ZA 3EE2A 3IC8A 1SYRA 1XIYA 2HZEA 4KA0A 1HYUA 4TXOA 4ECIA 3JCML 4OCEA 5G1LA 3GNJA 2TIRA 2FGXA 3Q6OA 3KIJA 4XS4A 7GSSA 1O81A 1A0RP 3E9JB 3G7YA 4Q5NA 1ZYNA 1VRSD 1PMTA 1GNWA 4GF0A 4EO3A 4JE1A 2L5LA 4GSTA 4I2TA 2WRTA 4FH8A 5EPFA 2R0GA 3FEUA 1A2JA 1NSWA 1BG5A 2MZCA 4IVFA 1M2AA 3BD2A 4PNFA 5CRHA 3KJYA 5G5EA 1FB0A 4Q5RA 1TJDA 2ON7A 3DVWA 2C80A 2J23A 2H0HA 1J9BA 2XBQA 4HQSA 3QFAC 1K0AA 1V57A 3DVXA 1AIUA 2D2ZA 2NPBA 4XS6A 1SK0A 1FW1A 2FNOA 1VF4A 4GQCA 2QA1A 1IYIA 1M9BA 3L78A 5FT3A 3IC4A 5DQYA 1W4VA 3HJMA 1DSBA 4I8BA 3BBYA 4KSMA 2HSHA 4HEA2 2MBSA 1A23A 5GSTA 2GSQA 1S3DA 2LRCA 2CAIA 2DJ0A 4LL1B 1JZRA 1B8XA 3KZQA 4QL9A 2L6DA 1SENA 3MAKA 4EL1A 1ABAA 1SD9A 5HQPA 1R4WA 5G2ZA 18GSA 5D96A 1LJRA 2G2QA 1HNBA 1SD8A 5CO3A 3UARA 1I5GA 4USSA 1ILOA 3FY7A 2JACA 5IO0A 2PU9C 1Z6MA 4FYCA 5DAKA 4QQ7A 3PGTA 1W89A 3N5OA 3QR6A 1K0MA 2CX4A 3EU4A 2ZNMA 4I5QA 5IMDA 2GS3A 2X8HA 3ERGA 4PGTA 3HJOA 4KF9A 2CVDA 2VUPA 3GH6A 4V1Ag 2V6KA 4EXJA 2HNLA 1THOA 5B6MA 5DVBA 2CX3A 1GTIA 3KTLA 5ECRB 3H1NA 2K8SA 3APOA 3DKSA 3FZAA 3TKSC 1PSQA 2PPTA 3QDNA 1V9WA 3FZ9A 4L0UA 4DSSA 5A4UA 2OADA 6GSSA 3UMAA 1A8LA 3R3EA 1OC9A 2HT9A 4HJMA 4AJ8A 5J9CA 1DE2A 4GCIA 1F37A 3ZREA 4IS0A 4XRAA 1ZZYA 2H74A 5LCZA 2C1YA 4MP4A 1OYJA 3RPNA 1G7OA 2IMKA 1Z7RA 5IMVA 1X5DA 1PL1A 2VLUA 2PMTA 4AJ6A 1ZMAA 4E8EA 4RQXA 1TK8B 1GRXA 4POMA 2Z9SA 2LUSA 4IGJA 2CQ9A 5ELAA 1BEDA 1N8JA 5ELGA 1TU7A 3GIXA 1O73A 1Y6EA 1QXHA 1F9MA 1PN0A 4CY6A 22GSA 3LGCA 5DCHA 2K18A 1SKRB 5F0GA 2VCTA 3EC3A 3KXOA 5AN1A 3GSSA 4GXZA 2ALBA 2FWEA 4FYBA 2C3QA 5G31A 3ZLPA 1XZOA 1HD2A 3C71A 4OD7A 2YJHA 3IE3A 3CYNA 3IXRA 2E0QA 2DJJA 2PVOC 4OFTA 1WIKA 2C0DA 1WJKA 4Z2TA 4LMWA 1B9YC 1ERWA 3NZNA 3C7MA 1XFLA 2HRKA 3LXTA 2K6VA 4IW9A 4EVMA 3P8WA 2E2GA 1ZYQB 1TK0B 5H5QA 1C72A 1R7HA 1XVWA 2V41A 3DMLA 2CZ2A 4F03A 5BRTA 5IQYA 1XWKA 1XPVA 4NV2A 1K3LA 1VF1A 2P5RA 3F6FA 4F0BA 2HYXA 4JR6A 2R2JA 4XHMA 2DKIA 3KTBA 1RW1A 5JWQB 1YEXA 4Z7XA 1JZDA 1OVNA 5CP1A 3UVHA 3TJGA 2FD3A 1RK4A 3EMXA 4HQZA 3G7JA 1SKSB 2VM1A 4DVCA 1UA5A 2FA4A 4HZ2A 1GLPA 3EMPA 2HXKA 1GSUA 1M3JA 4MNNA 3UIWA 1JZWA 5AIVA 1V2AA 3HVSA 1DE1A 1VF3A 1KBNA 1GSYA 3VI7A 2NBSA 2H1GA 3H8QA 2C0FA 2YNXA 4BWSA 16GSA 5G1KA 3D6IA 5IOXA 1JLVA 4TXVA 3GL3A 2OE3A 2GZPA 4KH7A 1OAZA 4O92A 2GDRA 2B3SA 3GA4A 4MLYA 5AIXA 2CVKA 2LJKA 5C00A 20GSA 2AB6A 1X9WB 1YF1A 2LS5A 2DJ3A 1X5CA 1ZCPA 4MF5A 2JSYA 3M9KA 3I69A 3DEXA 3IV4A 5G5FA 3GMFA 4L5OA 3EU3A 2F8AA 4KUNA 4XS4B 1OC3A 1TDIA 1PX7A 2JSZA 3G7IA 2LKUA 1Z7PA 4EDYA 5J41A 1GTUA 2VL3A 2QGVA 5INYA 4KDYA 4HI7A 19GSA 2N5AA 1U88A 2HE3A 1XOAA 4CDOA 4JZQA 1CQGA 2YPMA 3V1WA 2C3TA 2FWGA 2VCWA 1XWAA 2EIRA 2YZHA 1JLWA 2JZRA 2VL9A 2CA8A 1AQXA 3ISOA 3CSHA 1TI3A 5ECIB 3N9JA 3IA1A 3KMOA 1B48A 2B5EA 2FA8A 6GSWA 2DJ2A 2LNSA 3VLNA 1BX9A 4GSNA 1TTZA 4Z2UA 4BVYA 4ZL9A 3SWLA 1T7PB 4ZB8A 2YJ7A 3EWLA 3F4TA 3LYPA 4G10A 4ILFA 2RIIA 3CRUA 5CYYA 1WMJA 4F2IA 4KGIA 4WXTA 5ID2A 2WJUA 2PVQA 2GQMA 2QC7A 2H75A 4KX4A 2H30A 5DALB 5GAPD 3FMWA 3LJRA 1T8EB 1SK1A 4MPGA 4K7IA 3QMXA 1HQOA 1Q98A 4KSOA 3F9UA 3RBTA 4IN0A 2HRFA 4OO5A 4MJEA 2PBJA 4TRXA 3GH9A 1M0UA 3GTUA 4D73A 2IWTA 4HOJA 3W8JA 3H4KA 3D0ZA 1XW5A 4K2XA 4ZXGA 4POKA 1QUWA 2GSSA 1GULA 1OE7A 2VL2A 2YANA 2MMAA 2R0CA 4RQRA 4YKFA 3GKNA 4MJCA 4EIQA 5IMZA 1ZYEA 2GQKA 4HZ4A 4NV5A 5AISA 2ON5A 4HU9A 4PNGA 4POBA 1Z5YE 3HD5A 5IMFA 4DSSB 6GSVA 2A2RA 4X1UA 2LRNA 5GSSA 1PQNA 3TJBA 4LLRA 2DMMA 2WGRA 2KOKA 1EP7A 4TVEA 3K8NA 2RM5A 1GTBA 1G0TA 3VWUA 3GX8A 1SL0B 3W8SA 3CQFA 3KP9A 1YKCA 2CV4A 3HZ8A 3HVNA 9GSSA 1DBYA 1PGTA 3F63A 4IJIA 1USBA 1ZOFA 3IOSA 5E59A 1AQWA 4FQUA 4IQAA 5A4VA 2N5BA 1ZYPA 1XCCA 1E2YA 3DIEA 3IDVA 4PQHA 3ERWA 2B7KA 4N0VA 5F05A 4EIPA 4KDXA 5ECHB 4YQUA 5BMUA 1SJZA 3LSZA 2YV7A 2HLSA 1EOHA 3KEBA
chains in the Genus database with same CATH topology
5ECNB 2V1MA 1EZKA 3TJKA 4ZBDA 1EOGA 3TKSE 1FVKA 5D9VA 1TXXA 3EURA 3FYGA 5D8IA 2YWOA 1GSDA 2VLTA 4TR4A 4BVXA 3ZYWA 4GWRA 5F06A 8GSSA 3CXGA 5ECQB 4BL7A 5IPGA 1F3BA 1X5EA 4XTSA 1ST9A 2JADA 5JWOB 1PL2A 2AUVA 1OE8A 3HDCA 3WGDA 1TOFA 2C0EA 3UBLA 4TR1A 5COHA 4XS1A 3GFKA 1FVJA 2H1AA 2VCQA 5DQSA 3QD9A 2LSTA 5KN1A 2VOCA 2IMDA 1GWCA 4YKGA 1X0RA 4Q5QA 3O3TA 1K0DA 2HRAA 3F4SA 2XPEA 4EUYA 2VM2A 1FB6A 1TI1A 3PPUA 4AF2A 2HRNA 3O76A 1THXA 2OJLA 1MDJA 1TP9A 2H73A 1M9AA 3F0IA 5ECLB 2HSYA 4IBPA 4EE0A 1V40A 1KTEA 1M2BA 1ML6A 2DKHA 1EV9A 3QAGA 1Z3EA 4HUAA 4ACSA 2LJRA 4V2NA 2OA7A 1ERVA 4XRDA 3CRTA 1AXDA 3OR5A 1OC8A 4IP6A 12GSA 4A5PA 5L71A 2MMZA 3DD3A 1U3AA 2MBTA 2E7PA 2R4VA 2KUCA 3ZFLA 4TN8A 4EC0A 4F82A 3FR6A 3E0UA 5GZZB 4HU7A 4LL4B 1V58A 1F3AA 5D73A 5LNKe 5JWRB 1PKZA 1T4ZA 4H86A 2DC5A 1YKAA 3HVXA 4ML6A 5DCGA 1PA3A 3KH9A 3TCOA 5DBQA 4ECCA 2H71A 3LXZA 3Q74A 2OE1A 3BCKA 2IMFA 2GTUA 2NTOA 4JRRA 2PGTA 2A4VA 3M8NA 2YCDA 1M2DA 2FUG2 1LBKA 3ZIJA 2VL2C 5IMAA 4ECBA 4Z2RA 3HCZA 1BYEA 3VWXA 2NVLA 4O5UA 3UEMA 1Q4JA 1N2AA 1MDKA 2IL3A 1I9DA 5KN0A 3FZ4A 3AY8A 1WRYA 1XW6A 2YV9A 4G19A 4IP1A 4RUVA 5B8BA 1ON4A 2G0FA 4OFNA 3EVIA 4X43A 5FHIA 2RUEA 4PQ1A 3IAM2 2DSAA 3BCIA 3HA9A 4F9ZA 2MYGA 2VLVA 3GX0A 4G0KA 2I9HA 2IJYA 3VWWA 4XCSA 3D22A 4I97A 2H76A 4OCFA 4TW5A 5HFIA 4WBJA 1MD4A 3FW2A 2C4JA 1XWCA 2L5OA 3QPMA 5F8BA 3D21A 3F3RA 2JZTA 4HS1A 3LYKA 4N10A 4XIHA 4K7NA 3W6GA 3S9FA 4MA9A 3A5IA 2LV3A 5C04A 3CSJA 3LWAA 1MTCA 4E8HA 2O87A 3IPZA 5E4WA 2IMEA 6GSTA 1BAYA 2F51A 1H4OA 4ZL8A 2AHEA 1A24A 2I4AA 3HYPA 1MD3A 4MJBA 4O7HA 2I3YA 4WR5A 4ICYA 2JU5A 4NWYA 3GTUB 4K6XA 4WKWA 2IIYA 3WD6A 1GNEA 1AAZA 1U87A 2MMOA 2X99A 2FWFA 2L6CA 2IFQB 1Z6NA 2CT6A 2XPDA 4ZB6A 1M99A 3HZ4A 2R0PA 4L5LA 1HNCA 2M46A 2YWNA 1YQ1A 1GSEA 1TU8A 1K0NA 1SYXA 1E6BA 1OKTA 4MZWA 2GVPA 4JBBA 1A2LA 2HZEB 5ECSA 2KLXA 2B1KA 4TXOB 3GURA 1TRWA 3UAPA 1G6WA 4AGSA 3EINA 2ZCTA 4LA1A 5J9BA 4K5RA 2VIMA 3GKXA 1YJ6A 4FIWA 4WF4A 2N5FA 3ZMLA 4G0LA 5JCGA 4CW9A 4PXOA 3M1GA 3QAVA 2EIOA 3FRCA 3VWVA 3F6DA 2C8UA 3Q18A 1M7TA 1QGVA 3A3TA 3DRNA 3TKRA 3ZITA 4L8EA 4KNDA 1SL1B 3M9JA 2I81A 3VFIA 5KEJA 2P5QA 1TK5B 3IAS2 4J57E 1HNAA 2BTOT 3J7Yk 2JL4A 3HHVA 3F3QA 4NHZA 1B9XC 5DJLA 4JR4A 2VD1A 2WDUA 5KN3A 1PKWA 4YQVA 2L59A 3PINA 1XVQA 3US3A 4OWYA 2B7JA 1GH2A 3GKKA 4WF5A 1AC1A 2C3NA 1PN9A 4NPBA 2FY6A 17GSA 5EL8A 1EGRA 2PERA 2LEGA 1CQHA 2AAWA 3MSZA 3CTFA 3PH9A 4TR0A 2WCIA 2BMXA 3GV1A 3A2VA 1FAAA 3ZMKA 4BL7B 1K3YA 3UL3A 3MYDA 4DSQA 3VPTA 1PRXA 4KAEA 5CREA 5JCUA 4X4JA 4WEYA 2OBIA 2M80A 4ECJA 1GSFA 3WYWA 3GUSA 4TR3A 3ZVJA 2EIQA 3RPPA 4TKYA 4ZIJA 1GSQA 2B5XA 2YN1A 3EYTA 2HZFA 2H0IA 2IPAA 4J56E 3Q19A 3DWVA 3IRAA 2R37A 4OO4A 3WT2A 13GSA 4CHSA 3FHKA 3H93A 5DAKB 5EVOA 4MABA 1K0CA 2YP6A 2KHPA 5GAND 5KN2A 2A2PA 3HVVA 2FLSA 3P90A 1XW9A 1TKDB 4NAXA 3L9SA 1GUKA 5D9TA 4GLTA 4IHUA 1R26A 2A2SA 2A4HA 2OBKA 3NOFA 4MCUA 4F0CA 5B8AA 3LFLA 1YDKA 1GLQA 1EEJA 4WR4A 1KNGA 2L4CA 1OKDA 2R5GA 4G9HA 2LQQA 1OC9B 2X8CA 3GRXA 4L0WA 2H0GA 2H1BA 2HFDA 3LW9A 3WGXA 2GT6A 3O6TA 3BOAA 5ECKB 2GQLA 1FO5A 5D9WA 1GUMA 1K0OA 5DJMA 1DUGA 1SJIA 2O8VB 4KCEA 2GSRA 2M72A 4DEJA 2P0GA 5JCWA 2GGTA 1XBSA 3TRQA 1FHEA 1R5PA 1UN2A 5B6NA 1ZGNA 1TRUA 5FWGA 3PR8A 1T3BA 2O85A 2DJKA 4MJAA 2HSMA 4MH3A 2H66A 2VCXA 1NM3A 1GUHA 5HR1A 4G2EA 3RAZA 1ERUA 3HY2A 2P31A 1O85A 4EKZA 5H5SA 5CRWA 4J2FA 3LEFA 1JFUA 2L57A 2DLXA 3P2AA 4QL7A 3WGEA 1G7EA 1ZL9A 2X64A 3MWHA 3P7XA 3I9V2 4BWQA 3HKRA 3FK8A 2WFCA 4MDCA 4K7OA 2HI7A 4V2LA 1WP0A 2H6ZA 4MF7A 3UJ1A 4ZBBA 2O7KA 4KDUA 1A8YA 1SL2B 3GSTA 2ZUPA 3KM6A 1T1VA 5ECPB 2GZYA 2J9HA 3IR4A 3SBCA 1MEKA 1AUCA 2AJQB 4KB3A 3EPTA 3ZVJD 1S3AA 4MZCA 2H1DA 4GTUA 2OE0A 4P3YB 3FKFA 1GP1A 1WOUA 4MK3A 4PUFC 5DALA 5AGYA 14GSA 1PD21 4POLA 3C8EA 2FHEA 5CNWA 4BPYA 2X49A 3QOUA 4OMVA 4KCAA 1V98A 2F3MA 3IHGA 3WT1A 2H8LA 3ED3A 3VURA 3ZIVA 3UOMA 1FOHA 4RI6A 4V2MA 1WE0A 1A0FA 4K1FA 5A4WA 3FZ5A 6GSXA 2FCHA 3L9UA 3VI5A 3NIVA 4NXIA 3QFBC 1GL8A 2WB9A 3F4RA 1QK8A 3VPQA 2H6YA 4K5SA 3TOUA 3QCPA 4ZILA 1SU9A 4IQ1A 2DMLA 3GL5A 3C1RA 4GQFA 4HJ2A 5KOWA 3R2QA 5ABRA 2VCZA 2AV4A 5ECOB 2DIZA 1TW9A 5LD0A 1EEMA 4K2DA 2GZZA 3RHCA 2F9SA 5H5RA 2LTKA 2TRXA 2IMIA 3HJPA 3ERFA 1EWXA 1O8XA 2LQOA 1U6TA 1JHBA 2REMA 4ULXA 4OFMA 2KP1A 2MMNA 1R5AA 2PN8A 4NHWA 1O6JA 3ME7A 4CY8A 3L4NA 2C0GA 3IK9A 3A2XA 4I2UA 5IIZA 1X9SB 2LNTA 5IMCA 1TRSA 4N11A 2R3XA 3ZZXA 1YEPA 3LQ7A 1U3IA 4MPFA 3TB2A 11GSA 2XC2A 1SK2A 2OACA 2I1UA 3E3EA 3MIXA 3QAWA 3CBUA 3BJ5A 2VD0A 2NDOA 10GSA 1T4YA 1S3CA 4WBRD 2BJXA 3IK7A 1WPIA 4K0GA 3RHBA 2QKEA 3D4MA 1FG4A 3GN3A 4PX1A 4LMVA 4BVYB 3APQA 3KCMA 1QFNA 1F2EA 1LU4A 3DXBA 4IJ3A 5ID2B 1ACVA 3CTGA 1O8WA 3U5RE 4BA7A 3KD0A 4ML1A 1VGLA 2PWJA 2LJAA 4JEDA 1MDIA 4O32A 4MF6A 3FR3A 3TRXA 3IHQA 2XBIA 3M3MA 3KMNA 4N30A 4O5QA 2E2MA 3DGQA 3UBKA 1GTAA 3ZTLA 4YQMA 5IOWA 2F8FA 4D73B 2CZ3A 1F6MC 2GT5A 4MH2A 3KP8A 2O89A 1B4PA 1YF0A 5HFKA 1H75A 4ID0A 3RDWA 3MDKA 3H79A 4NMUA 2OKAA 2L4QA 2VCVA 3ZL5A 2H72A 4EF0A 4X0XA 1EGOA 4EDZA 5HR2A 3LORA 1XXUA 4I6XA 4WETA 5J5NA 3CSIA 1UC7A 1B4QA 3TOTA 3C73A 1A2MA 2H70A 1BJXA 5HFGA 4Q5FA 5B7CA 3I43A 5HR3A 5IO2A 2WULA 4PUAA 2EC4A 5F07A 5A5KA 3U6VA 1QQ2A 5D9XA 1J0FA 5KOXA 3TKQA 2VO4A 2V32A 4GSSA 2LRTA 5DDLA 1YZXA 1TRVA 4ZB9A 3TKPA 2KP2A 4FO5A 3KH7A 1Z9HA 5G30A 3GYKA 3TDGA 5CRDA 2B1LA 3DYRA 1YY7A 2YWIA 3UVTA 2K8VA 4DSRA 1EV4A 4IELA 4K8MA 4IKHA 3APSA 2V6OA 2AYTA 1PX6A 1ERTA 2X4AA 5D93A 3FR9A 1AW9A 5IM9A 3TRPA 2DJ1A 2WZ9A 5J3RA 3VK9A 1NHYA 4G0IA 6GSYA 1KEBA 1AQVA 3IBHA 2B6MA 2DBCA 5J4UA 1X9MB 3I6AA 3J7Yb 1VF2A 1JZOA 5HR0A 1GSSA 4PQIA 3D5JA 2YWMA 2ES7A 4FYUA 3TKSA 1QMVA 3ZRDA 2VAFA 3MNGA 2R6KA 1WWJA 4KW6A 4BVXB 4ISDA 2V2GA 5ENUA 2XHFA 5ECMB 4YAVA 3ME8A 2RUFA 5IPHA 4ZBAA 1EP8A 3L0HA 1SJ6A 2QA2A 3KGKA 4MMMA 2RLIA 4TR1B 4TOPA 3D4TA 2CVBA 4KE3A 3A5WA 4RI7A 2B5YA 4PURA 5CAXA 3HXSA 3ZFBA 3TJFA 4HDEA 6GSUA 1NW2A 2CAQA 4GRFA 1XOBA 4YH2A 3TGZA 2H01A 4MZBA 3C1SA 1K0BA 4K9ZA 5CRGA 1BQ7A 2H6XA 1XWBA 1K3OA 1Y25A 2UZ8A 1XWGA 3M0FA 4V1Ap 2YZUA 2RM6A 1URMA 2GLRA 3GHAA 2PUKC 1FOVA 2FWHA 2X8GA 3CMIA 3GKMA 1T00A 3TUEA 2QSIA 2GSTA 4O5RA 4YAPA 1G6YA 2K9FA 5EY6A 3L9VA 2TRCP 2YOIA 3G9BA 2H19A 1J08A 2IFQA 4K0NA 3TJJA 1SKWB 2DIYA 1IYHA 2IN3A 4PTSA 3F8UA 1RQMA 1UVZA 3LG6A 1O7UA 1NHOA 4AJ7A 4ZL7A 3A2WA 4JU5A 2WS2A 2JZSA 4N0ZA 3EE2A 3IC8A 1SYRA 1XIYA 2HZEA 4KA0A 1HYUA 4TXOA 4ECIA 3JCML 4OCEA 5G1LA 3GNJA 2TIRA 2FGXA 3Q6OA 3KIJA 4XS4A 7GSSA 1O81A 1A0RP 3E9JB 3G7YA 4Q5NA 1ZYNA 1VRSD 1PMTA 1GNWA 4GF0A 4EO3A 4JE1A 2L5LA 4GSTA 4I2TA 2WRTA 4FH8A 5EPFA 2R0GA 3FEUA 1A2JA 1NSWA 1BG5A 2MZCA 4IVFA 1M2AA 3BD2A 4PNFA 5CRHA 3KJYA 5G5EA 1FB0A 4Q5RA 1TJDA 2ON7A 3DVWA 2C80A 2J23A 2H0HA 1J9BA 2XBQA 4HQSA 3QFAC 1K0AA 1V57A 3DVXA 1AIUA 2D2ZA 2NPBA 4XS6A 1SK0A 1FW1A 2FNOA 1VF4A 4GQCA 2QA1A 1IYIA 1M9BA 3L78A 5FT3A 3IC4A 5DQYA 1W4VA 3HJMA 1DSBA 4I8BA 3BBYA 4KSMA 2HSHA 4HEA2 2MBSA 1A23A 5GSTA 2GSQA 1S3DA 2LRCA 2CAIA 2DJ0A 4LL1B 1JZRA 1B8XA 3KZQA 4QL9A 2L6DA 1SENA 3MAKA 4EL1A 1ABAA 1SD9A 5HQPA 1R4WA 5G2ZA 18GSA 5D96A 1LJRA 2G2QA 1HNBA 1SD8A 5CO3A 3UARA 1I5GA 4USSA 1ILOA 3FY7A 2JACA 5IO0A 2PU9C 1Z6MA 4FYCA 5DAKA 4QQ7A 3PGTA 1W89A 3N5OA 3QR6A 1K0MA 2CX4A 3EU4A 2ZNMA 4I5QA 5IMDA 2GS3A 2X8HA 3ERGA 4PGTA 3HJOA 4KF9A 2CVDA 2VUPA 3GH6A 4V1Ag 2V6KA 4EXJA 2HNLA 1THOA 5B6MA 5DVBA 2CX3A 1GTIA 3KTLA 5ECRB 3H1NA 2K8SA 3APOA 3DKSA 3FZAA 3TKSC 1PSQA 2PPTA 3QDNA 1V9WA 3FZ9A 4L0UA 4DSSA 5A4UA 2OADA 6GSSA 3UMAA 1A8LA 3R3EA 1OC9A 2HT9A 4HJMA 4AJ8A 5J9CA 1DE2A 4GCIA 1F37A 3ZREA 4IS0A 4XRAA 1ZZYA 2H74A 5LCZA 2C1YA 4MP4A 1OYJA 3RPNA 1G7OA 2IMKA 1Z7RA 5IMVA 1X5DA 1PL1A 2VLUA 2PMTA 4AJ6A 1ZMAA 4E8EA 4RQXA 1TK8B 1GRXA 4POMA 2Z9SA 2LUSA 4IGJA 2CQ9A 5ELAA 1BEDA 1N8JA 5ELGA 1TU7A 3GIXA 1O73A 1Y6EA 1QXHA 1F9MA 1PN0A 4CY6A 22GSA 3LGCA 5DCHA 2K18A 1SKRB 5F0GA 2VCTA 3EC3A 3KXOA 5AN1A 3GSSA 4GXZA 2ALBA 2FWEA 4FYBA 2C3QA 5G31A 3ZLPA 1XZOA 1HD2A 3C71A 4OD7A 2YJHA 3IE3A 3CYNA 3IXRA 2E0QA 2DJJA 2PVOC 4OFTA 1WIKA 2C0DA 1WJKA 4Z2TA 4LMWA 1B9YC 1ERWA 3NZNA 3C7MA 1XFLA 2HRKA 3LXTA 2K6VA 4IW9A 4EVMA 3P8WA 2E2GA 1ZYQB 1TK0B 5H5QA 1C72A 1R7HA 1XVWA 2V41A 3DMLA 2CZ2A 4F03A 5BRTA 5IQYA 1XWKA 1XPVA 4NV2A 1K3LA 1VF1A 2P5RA 3F6FA 4F0BA 2HYXA 4JR6A 2R2JA 4XHMA 2DKIA 3KTBA 1RW1A 5JWQB 1YEXA 4Z7XA 1JZDA 1OVNA 5CP1A 3UVHA 3TJGA 2FD3A 1RK4A 3EMXA 4HQZA 3G7JA 1SKSB 2VM1A 4DVCA 1UA5A 2FA4A 4HZ2A 1GLPA 3EMPA 2HXKA 1GSUA 4MNNA 3UIWA 1JZWA 5AIVA 1V2AA 3HVSA 1DE1A 1VF3A 1KBNA 1GSYA 3VI7A 2NBSA 2H1GA 3H8QA 2C0FA 2YNXA 4BWSA 16GSA 5G1KA 3D6IA 5IOXA 1JLVA 4TXVA 3GL3A 2OE3A 2GZPA 4KH7A 1OAZA 4O92A 2GDRA 2B3SA 3GA4A 4MLYA 5AIXA 2CVKA 2LJKA 5C00A 20GSA 2AB6A 1X9WB 1YF1A 2LS5A 2DJ3A 1X5CA 1ZCPA 4MF5A 2JSYA 3M9KA 3I69A 3DEXA 3IV4A 5G5FA 3GMFA 4L5OA 3EU3A 2F8AA 4KUNA 4XS4B 1OC3A 1TDIA 1PX7A 2JSZA 3G7IA 2LKUA 1Z7PA 4EDYA 5J41A 1GTUA 2VL3A 2QGVA 5INYA 4KDYA 4HI7A 19GSA 2N5AA 1U88A 2HE3A 1XOAA 4CDOA 4JZQA 1CQGA 2YPMA 3V1WA 2C3TA 2FWGA 2VCWA 1XWAA 2EIRA 2YZHA 1JLWA 2JZRA 2VL9A 2CA8A 1AQXA 3ISOA 3CSHA 1TI3A 5ECIB 3N9JA 3IA1A 3KMOA 1B48A 2B5EA 2FA8A 6GSWA 2DJ2A 2LNSA 3VLNA 1BX9A 4GSNA 1TTZA 4Z2UA 4BVYA 4ZL9A 3SWLA 1T7PB 4ZB8A 2YJ7A 3EWLA 3F4TA 3LYPA 4G10A 4ILFA 2RIIA 3CRUA 5CYYA 1WMJA 4F2IA 4KGIA 4WXTA 5ID2A 2WJUA 2PVQA 2GQMA 2QC7A 2H75A 4KX4A 2H30A 5DALB 5GAPD 3FMWA 3LJRA 1T8EB 1SK1A 4MPGA 4K7IA 3QMXA 1HQOA 1Q98A 4KSOA 3F9UA 3RBTA 4IN0A 2HRFA 4OO5A 4MJEA 2PBJA 4TRXA 3GH9A 1M0UA 3GTUA 4D73A 2IWTA 4HOJA 3W8JA 3H4KA 3D0ZA 1XW5A 4K2XA 4ZXGA 4POKA 1QUWA 2GSSA 1GULA 1OE7A 2VL2A 2YANA 2MMAA 2R0CA 4RQRA 4YKFA 3GKNA 4MJCA 4EIQA 5IMZA 1ZYEA 2GQKA 4HZ4A 4NV5A 5AISA 2ON5A 4HU9A 4PNGA 4POBA 1Z5YE 3HD5A 5IMFA 4DSSB 6GSVA 2A2RA 4X1UA 2LRNA 5GSSA 1PQNA 3TJBA 4LLRA 2DMMA 2WGRA 2KOKA 1EP7A 4TVEA 3K8NA 2RM5A 1GTBA 1G0TA 3VWUA 3GX8A 1SL0B 3W8SA 3KP9A 1YKCA 2CV4A 3HZ8A 9GSSA 1DBYA 1PGTA 3F63A 4IJIA 1USBA 1ZOFA 3IOSA 5E59A 1AQWA 4FQUA 4IQAA 5A4VA 2N5BA 1ZYPA 1XCCA 1E2YA 3DIEA 3IDVA 4PQHA 3ERWA 2B7KA 4N0VA 5F05A 4EIPA 4KDXA 5ECHB 4YQUA 5BMUA 1SJZA 3LSZA 2YV7A 2HLSA 1EOHA 3KEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ECN B;  2V1M A;  1EZK A;  3TJK A;  4ZBD A;  1EOG A;  3TKS E;  1FVK A;  5D9V A;  1TXX A;  3EUR A;  3FYG A;  5D8I A;  2YWO A;  1GSD A;  2VLT A;  4TR4 A;  4BVX A;  3ZYW A;  4GWR A;  5F06 A;  8GSS A;  3CXG A;  5ECQ B;  4BL7 A;  5IPG A;  1F3B A;  1X5E A;  4XTS A;  1ST9 A;  2JAD A;  5JWO B;  1PL2 A;  2AUV A;  1OE8 A;  3HDC A;  3WGD A;  1TOF A;  2C0E A;  3UBL A;  4TR1 A;  5COH A;  4XS1 A;  3GFK A;  1FVJ A;  2H1A A;  2VCQ A;  5DQS A;  3QD9 A;  2LST A;  5KN1 A;  2VOC A;  2IMD A;  1GWC A;  1X0R A;  4Q5Q A;  3O3T A;  1K0D A;  3F4S A;  2XPE A;  4EUY A;  2VM2 A;  1FB6 A;  1TI1 A;  4AF2 A;  2HRN A;  3O76 A;  1THX A;  2OJL A;  1MDJ A;  1TP9 A;  2H73 A;  1M9A A;  3F0I A;  5ECL B;  2HSY A;  4IBP A;  4EE0 A;  1V40 A;  1KTE A;  1M2B A;  1ML6 A;  1EV9 A;  3QAG A;  1Z3E A;  4HUA A;  4ACS A;  2LJR A;  4V2N A;  2OA7 A;  1ERV A;  4XRD A;  3CRT A;  1AXD A;  3OR5 A;  1OC8 A;  4IP6 A;  12GS A;  5L71 A;  2MMZ A;  3DD3 A;  1U3A A;  2MBT A;  2E7P A;  2R4V A;  2KUC A;  3ZFL A;  4TN8 A;  4EC0 A;  4F82 A;  3FR6 A;  3E0U A;  5GZZ B;  4HU7 A;  4LL4 B;  1V58 A;  1F3A A;  5D73 A;  5LNK e;  5JWR B;  1PKZ A;  1T4Z A;  4H86 A;  2DC5 A;  1YKA A;  3HVX A;  4ML6 A;  5DCG A;  1PA3 A;  3KH9 A;  3TCO A;  5DBQ A;  4ECC A;  2H71 A;  3LXZ A;  3Q74 A;  2OE1 A;  3BCK A;  2IMF A;  2GTU A;  2NTO A;  4JRR A;  2PGT A;  2A4V A;  3M8N A;  2YCD A;  1M2D A;  2FUG 2;  1LBK A;  3ZIJ A;  2VL2 C;  5IMA A;  4ECB A;  3HCZ A;  1BYE A;  3VWX A;  2NVL A;  3UEM A;  1Q4J A;  1N2A A;  1MDK A;  2IL3 A;  1I9D A;  5KN0 A;  3FZ4 A;  3AY8 A;  1WRY A;  1XW6 A;  2YV9 A;  4G19 A;  4IP1 A;  4RUV A;  5B8B A;  1ON4 A;  2G0F A;  4OFN A;  3EVI A;  4X43 A;  5FHI A;  2RUE A;  4PQ1 A;  3IAM 2;  2DSA A;  3BCI A;  3HA9 A;  4F9Z A;  2MYG A;  2VLV A;  3GX0 A;  2I9H A;  2IJY A;  3VWW A;  4XCS A;  3D22 A;  4I97 A;  2H76 A;  4OCF A;  4TW5 A;  5HFI A;  4WBJ A;  1MD4 A;  3FW2 A;  2C4J A;  1XWC A;  2L5O A;  3QPM A;  5F8B A;  3D21 A;  3F3R A;  2JZT A;  4HS1 A;  3LYK A;  4N10 A;  4XIH A;  4K7N A;  3W6G A;  3S9F A;  4MA9 A;  2LV3 A;  5C04 A;  3CSJ A;  3LWA A;  1MTC A;  4E8H A;  2O87 A;  3IPZ A;  5E4W A;  2IME A;  6GST A;  1BAY A;  2F51 A;  1H4O A;  4ZL8 A;  2AHE A;  1A24 A;  2I4A A;  3HYP A;  1MD3 A;  4MJB A;  4O7H A;  2I3Y A;  4WR5 A;  2JU5 A;  4NWY A;  3GTU B;  4K6X A;  4WKW A;  2IIY A;  3WD6 A;  1GNE A;  1AAZ A;  1U87 A;  2MMO A;  2X99 A;  2FWF A;  2L6C A;  2IFQ B;  1Z6N A;  2CT6 A;  2XPD A;  4ZB6 A;  1M99 A;  3HZ4 A;  4L5L A;  1HNC A;  2M46 A;  2YWN A;  1YQ1 A;  1GSE A;  1TU8 A;  1K0N A;  1SYX A;  1E6B A;  1OKT A;  4MZW A;  2GVP A;  4JBB A;  1A2L A;  2HZE B;  5ECS A;  2KLX A;  2B1K A;  4TXO B;  3GUR A;  1TRW A;  3UAP A;  1G6W A;  4AGS A;  3EIN A;  2ZCT A;  4LA1 A;  5J9B A;  2VIM A;  3GKX A;  1YJ6 A;  4FIW A;  4WF4 A;  2N5F A;  3ZML A;  5JCG A;  4CW9 A;  4PXO A;  3M1G A;  3QAV A;  2EIO A;  3FRC A;  3VWV A;  3F6D A;  2C8U A;  3Q18 A;  1M7T A;  1QGV A;  3A3T A;  3DRN A;  3TKR A;  3ZIT A;  4L8E A;  4KND A;  1SL1 B;  3M9J A;  2I81 A;  3VFI A;  5KEJ A;  2P5Q A;  1TK5 B;  3IAS 2;  4J57 E;  1HNA A;  2BTO T;  3J7Y k;  2JL4 A;  3HHV A;  3F3Q A;  4NHZ A;  1B9X C;  5DJL A;  4JR4 A;  2VD1 A;  2WDU A;  5KN3 A;  1PKW A;  4YQV A;  2L59 A;  3PIN A;  1XVQ A;  3US3 A;  4OWY A;  2B7J A;  1GH2 A;  3GKK A;  4WF5 A;  1AC1 A;  2C3N A;  1PN9 A;  4NPB A;  2FY6 A;  17GS A;  5EL8 A;  1EGR A;  2PER A;  2LEG A;  1CQH A;  2AAW A;  3MSZ A;  3CTF A;  3PH9 A;  4TR0 A;  2WCI A;  2BMX A;  3GV1 A;  3A2V A;  1FAA A;  3ZMK A;  1K3Y A;  3UL3 A;  4DSQ A;  3VPT A;  1PRX A;  4KAE A;  5CRE A;  5JCU A;  4WEY A;  2OBI A;  2M80 A;  4ECJ A;  1GSF A;  3WYW A;  3GUS A;  4TR3 A;  3ZVJ A;  2EIQ A;  3RPP A;  4TKY A;  4ZIJ A;  1GSQ A;  2B5X A;  2YN1 A;  3EYT A;  2HZF A;  2H0I A;  2IPA A;  4J56 E;  3Q19 A;  3DWV A;  3IRA A;  2R37 A;  4OO4 A;  3WT2 A;  13GS A;  4CHS A;  3FHK A;  3H93 A;  5DAK B;  5EVO A;  4MAB A;  1K0C A;  2YP6 A;  2KHP A;  5GAN D;  5KN2 A;  3HVV A;  2FLS A;  3P90 A;  1XW9 A;  1TKD B;  4NAX A;  3L9S A;  1GUK A;  5D9T A;  4GLT A;  4IHU A;  1R26 A;  2A2S A;  2OBK A;  3NOF A;  4MCU A;  4F0C A;  5B8A A;  3LFL A;  1YDK A;  1GLQ A;  1EEJ A;  4WR4 A;  1KNG A;  2L4C A;  1OKD A;  2R5G A;  4G9H A;  2LQQ A;  1OC9 B;  2X8C A;  3GRX A;  4L0W A;  2H0G A;  2H1B A;  2HFD A;  3WGX A;  2GT6 A;  3O6T A;  3BOA A;  5ECK B;  2GQL A;  1FO5 A;  5D9W A;  1GUM A;  1K0O A;  5DJM A;  1DUG A;  1SJI A;  2O8V B;  4KCE A;  2GSR A;  2M72 A;  4DEJ A;  2P0G A;  5JCW A;  2GGT A;  1XBS A;  3TRQ A;  1FHE A;  1R5P A;  1UN2 A;  5B6N A;  1ZGN A;  1TRU A;  5FWG A;  3PR8 A;  1T3B A;  2O85 A;  2DJK A;  4MJA A;  4MH3 A;  2H66 A;  2VCX A;  1NM3 A;  1GUH A;  5HR1 A;  4G2E A;  3RAZ A;  1ERU A;  3HY2 A;  2P31 A;  1O85 A;  4EKZ A;  5H5S A;  5CRW A;  4J2F A;  3LEF A;  1JFU A;  2L57 A;  2DLX A;  3P2A A;  4QL7 A;  3WGE A;  1G7E A;  1ZL9 A;  2X64 A;  3MWH A;  3P7X A;  3I9V 2;  4BWQ A;  3HKR A;  3FK8 A;  2WFC A;  4MDC A;  4K7O A;  2HI7 A;  4V2L A;  1WP0 A;  2H6Z A;  4MF7 A;  3UJ1 A;  4ZBB A;  2O7K A;  4KDU A;  1A8Y A;  1SL2 B;  3GST A;  2ZUP A;  3KM6 A;  1T1V A;  5ECP B;  2GZY A;  2J9H A;  3IR4 A;  3SBC A;  1MEK A;  1AUC A;  2AJQ B;  4KB3 A;  3ZVJ D;  1S3A A;  4MZC A;  2H1D A;  4GTU A;  2OE0 A;  4P3Y B;  3FKF A;  1GP1 A;  1WOU A;  4MK3 A;  4PUF C;  5DAL A;  5AGY A;  14GS A;  1PD2 1;  4POL A;  3C8E A;  2FHE A;  5CNW A;  4BPY A;  3QOU A;  4OMV A;  4KCA A;  1V98 A;  2F3M A;  3WT1 A;  2H8L A;  3ED3 A;  3VUR A;  3ZIV A;  3UOM A;  4RI6 A;  4V2M A;  1WE0 A;  1A0F A;  4K1F A;  5A4W A;  3FZ5 A;  6GSX A;  2FCH A;  3L9U A;  3VI5 A;  3NIV A;  4NXI A;  3QFB C;  1GL8 A;  2WB9 A;  3F4R A;  1QK8 A;  3VPQ A;  2H6Y A;  3TOU A;  3QCP A;  4ZIL A;  1SU9 A;  4IQ1 A;  2DML A;  3GL5 A;  3C1R A;  4GQF A;  4HJ2 A;  3R2Q A;  5ABR A;  2VCZ A;  5ECO B;  2AV4 A;  2DIZ A;  1TW9 A;  5LD0 A;  1EEM A;  4K2D A;  2GZZ A;  3RHC A;  2F9S A;  5H5R A;  2LTK A;  2TRX A;  2IMI A;  3HJP A;  3ERF A;  1EWX A;  1O8X A;  2LQO A;  1U6T A;  1JHB A;  2REM A;  4ULX A;  4OFM A;  2KP1 A;  2MMN A;  1R5A A;  2PN8 A;  4NHW A;  1O6J A;  3ME7 A;  3L4N A;  2C0G A;  3IK9 A;  3A2X A;  4I2U A;  5IIZ A;  1X9S B;  2LNT A;  5IMC A;  1TRS A;  4N11 A;  2R3X A;  3ZZX A;  1YEP A;  3LQ7 A;  1U3I A;  4MPF A;  3TB2 A;  11GS A;  2XC2 A;  1SK2 A;  2OAC A;  2I1U A;  3E3E A;  3QAW A;  3CBU A;  3BJ5 A;  2VD0 A;  2NDO A;  10GS A;  1T4Y A;  1S3C A;  4WBR D;  2BJX A;  3IK7 A;  1WPI A;  4K0G A;  3RHB A;  2QKE A;  3D4M A;  1FG4 A;  3GN3 A;  4PX1 A;  4LMV A;  3APQ A;  3KCM A;  1QFN A;  1F2E A;  1LU4 A;  3DXB A;  4IJ3 A;  5ID2 B;  1ACV A;  3CTG A;  1O8W A;  3U5R E;  4BA7 A;  3KD0 A;  4ML1 A;  1VGL A;  2PWJ A;  2LJA A;  4JED A;  1MDI A;  4O32 A;  4MF6 A;  3FR3 A;  3TRX A;  3IHQ A;  2XBI A;  3M3M A;  3KMN A;  4N30 A;  2E2M A;  3DGQ A;  3UBK A;  1GTA A;  3ZTL A;  4YQM A;  5IOW A;  2F8F A;  4D73 B;  2CZ3 A;  1F6M C;  2GT5 A;  4MH2 A;  3KP8 A;  2O89 A;  1B4P A;  1YF0 A;  5HFK A;  1H75 A;  4ID0 A;  3RDW A;  3MDK A;  3H79 A;  4NMU A;  2OKA A;  2L4Q A;  2VCV A;  3ZL5 A;  2H72 A;  4EF0 A;  4X0X A;  1EGO A;  4EDZ A;  5HR2 A;  3LOR A;  1XXU A;  4I6X A;  4WET A;  5J5N A;  3CSI A;  1UC7 A;  1B4Q A;  3TOT A;  3C73 A;  1A2M A;  2H70 A;  1BJX A;  5HFG A;  4Q5F A;  5B7C A;  3I43 A;  5HR3 A;  5IO2 A;  2WUL A;  4PUA A;  2EC4 A;  5F07 A;  5A5K A;  3U6V A;  1QQ2 A;  5D9X A;  1J0F A;  3TKQ A;  2VO4 A;  2V32 A;  4GSS A;  2LRT A;  5DDL A;  1YZX A;  1TRV A;  4ZB9 A;  3TKP A;  2KP2 A;  4FO5 A;  3KH7 A;  1Z9H A;  5G30 A;  3GYK A;  3TDG A;  5CRD A;  2B1L A;  3DYR A;  1YY7 A;  2YWI A;  3UVT A;  2K8V A;  4DSR A;  1EV4 A;  4IEL A;  4K8M A;  4IKH A;  3APS A;  2V6O A;  2AYT A;  1PX6 A;  1ERT A;  5D93 A;  3FR9 A;  1AW9 A;  5IM9 A;  3TRP A;  2DJ1 A;  2WZ9 A;  5J3R A;  3VK9 A;  1NHY A;  6GSY A;  1KEB A;  1AQV A;  3IBH A;  2B6M A;  2DBC A;  5J4U A;  1X9M B;  3I6A A;  3J7Y b;  1VF2 A;  1JZO A;  5HR0 A;  1GSS A;  4PQI A;  3D5J A;  2YWM A;  2ES7 A;  4FYU A;  3TKS A;  1QMV A;  3ZRD A;  2VAF A;  3MNG A;  2R6K A;  1WWJ A;  4KW6 A;  4ISD A;  2V2G A;  5ENU A;  2XHF A;  5ECM B;  4YAV A;  3ME8 A;  2RUF A;  5IPH A;  4ZBA A;  1EP8 A;  3L0H A;  1SJ6 A;  3KGK A;  4MMM A;  2RLI A;  4TR1 B;  4TOP A;  3D4T A;  2CVB A;  4KE3 A;  3A5W A;  4RI7 A;  2B5Y A;  4PUR A;  5CAX A;  3HXS A;  3ZFB A;  3TJF A;  4HDE A;  6GSU A;  1NW2 A;  2CAQ A;  4GRF A;  1XOB A;  4YH2 A;  3TGZ A;  2H01 A;  4MZB A;  3C1S A;  1K0B A;  4K9Z A;  5CRG A;  1BQ7 A;  2H6X A;  1XWB A;  1K3O A;  1Y25 A;  1XWG A;  3M0F A;  4V1A p;  2YZU A;  2RM6 A;  1URM A;  2GLR A;  3GHA A;  2PUK C;  1FOV A;  2FWH A;  2X8G A;  3CMI A;  3GKM A;  1T00 A;  3TUE A;  2QSI A;  2GST A;  4O5R A;  4YAP A;  1G6Y A;  2K9F A;  5EY6 A;  3L9V A;  2TRC P;  2YOI A;  3G9B A;  2H19 A;  1J08 A;  2IFQ A;  4K0N A;  3TJJ A;  1SKW B;  2DIY A;  1IYH A;  2IN3 A;  3F8U A;  1RQM A;  1UVZ A;  3LG6 A;  1O7U A;  1NHO A;  4AJ7 A;  4ZL7 A;  3A2W A;  4JU5 A;  2WS2 A;  2JZS A;  4N0Z A;  3EE2 A;  1SYR A;  1XIY A;  2HZE A;  4KA0 A;  1HYU A;  4TXO A;  4ECI A;  3JCM L;  4OCE A;  5G1L A;  3GNJ A;  2TIR A;  2FGX A;  3Q6O A;  3KIJ A;  4XS4 A;  7GSS A;  1O81 A;  1A0R P;  3E9J B;  3G7Y A;  4Q5N A;  1VRS D;  1PMT A;  1GNW A;  4GF0 A;  4EO3 A;  4JE1 A;  2L5L A;  4GST A;  4I2T A;  5EPF A;  2WRT A;  4FH8 A;  3FEU A;  1A2J A;  1NSW A;  1BG5 A;  2MZC A;  4IVF A;  1M2A A;  3BD2 A;  4PNF A;  5CRH A;  3KJY A;  5G5E A;  1FB0 A;  4Q5R A;  1TJD A;  2ON7 A;  3DVW A;  2C80 A;  2J23 A;  2H0H A;  1J9B A;  2XBQ A;  4HQS A;  3QFA C;  1K0A A;  1V57 A;  3DVX A;  1AIU A;  2D2Z A;  2NPB A;  4XS6 A;  1SK0 A;  1FW1 A;  2FNO A;  1VF4 A;  4GQC A;  1IYI A;  1M9B A;  3L78 A;  5FT3 A;  3IC4 A;  5DQY A;  1W4V A;  3HJM A;  1DSB A;  4I8B A;  3BBY A;  4KSM A;  2HSH A;  4HEA 2;  2MBS A;  1A23 A;  5GST A;  2GSQ A;  1S3D A;  2LRC A;  2CAI A;  2DJ0 A;  4LL1 B;  1JZR A;  1B8X A;  3KZQ A;  4QL9 A;  2L6D A;  1SEN A;  3MAK A;  4EL1 A;  1ABA A;  1SD9 A;  5HQP A;  1R4W A;  5G2Z A;  18GS A;  5D96 A;  1LJR A;  2G2Q A;  1HNB A;  1SD8 A;  5CO3 A;  3UAR A;  1I5G A;  1ILO A;  3FY7 A;  2JAC A;  5IO0 A;  2PU9 C;  1Z6M A;  4FYC A;  5DAK A;  4QQ7 A;  3PGT A;  1W89 A;  3N5O A;  3QR6 A;  1K0M A;  2CX4 A;  3EU4 A;  2ZNM A;  4I5Q A;  5IMD A;  2GS3 A;  2X8H A;  3ERG A;  4PGT A;  3HJO A;  2CVD A;  2VUP A;  3GH6 A;  4V1A g;  2V6K A;  4EXJ A;  2HNL A;  1THO A;  5B6M A;  5DVB A;  2CX3 A;  1GTI A;  3KTL A;  5ECR B;  3H1N A;  2K8S A;  3APO A;  3DKS A;  3FZA A;  3TKS C;  1PSQ A;  2PPT A;  3QDN A;  1V9W A;  3FZ9 A;  4L0U A;  4DSS A;  5A4U A;  2OAD A;  6GSS A;  3UMA A;  1A8L A;  1OC9 A;  2HT9 A;  4HJM A;  4AJ8 A;  5J9C A;  1DE2 A;  4GCI A;  1F37 A;  3ZRE A;  4IS0 A;  4XRA A;  1ZZY A;  2H74 A;  5LCZ A;  2C1Y A;  4MP4 A;  1OYJ A;  3RPN A;  1G7O A;  2IMK A;  1Z7R A;  5IMV A;  1X5D A;  1PL1 A;  2VLU A;  2PMT A;  4AJ6 A;  1ZMA A;  4E8E A;  4RQX A;  1TK8 B;  1GRX A;  4POM A;  2Z9S A;  2LUS A;  4IGJ A;  2CQ9 A;  5ELA A;  1BED A;  1N8J A;  5ELG A;  1TU7 A;  3GIX A;  1O73 A;  1Y6E A;  1QXH A;  1F9M A;  22GS A;  3LGC A;  5DCH A;  2K18 A;  1SKR B;  5F0G A;  2VCT A;  3EC3 A;  3KXO A;  5AN1 A;  3GSS A;  4GXZ A;  2ALB A;  2FWE A;  4FYB A;  2C3Q A;  5G31 A;  3ZLP A;  1XZO A;  1HD2 A;  3C71 A;  4OD7 A;  2YJH A;  3IE3 A;  3CYN A;  3IXR A;  2E0Q A;  2DJJ A;  2PVO C;  4OFT A;  1WIK A;  2C0D A;  1WJK A;  4LMW A;  1B9Y C;  1ERW A;  3NZN A;  3C7M A;  1XFL A;  3LXT A;  2K6V A;  4IW9 A;  4EVM A;  3P8W A;  2E2G A;  1ZYQ B;  1TK0 B;  5H5Q A;  1C72 A;  1R7H A;  1XVW A;  2V41 A;  3DML A;  2CZ2 A;  4F03 A;  5IQY A;  1XWK A;  1XPV A;  4NV2 A;  1K3L A;  1VF1 A;  2P5R A;  3F6F A;  4F0B A;  2HYX A;  4JR6 A;  2R2J A;  4XHM A;  3KTB A;  1RW1 A;  5JWQ B;  1YEX A;  4Z7X A;  1JZD A;  1OVN A;  5CP1 A;  3UVH A;  3TJG A;  2FD3 A;  1RK4 A;  3EMX A;  4HQZ A;  3G7J A;  1SKS B;  2VM1 A;  4DVC A;  1UA5 A;  2FA4 A;  4HZ2 A;  1GLP A;  3EMP A;  2HXK A;  1GSU A;  3UIW A;  1JZW A;  5AIV A;  1V2A A;  3HVS A;  1DE1 A;  1VF3 A;  1KBN A;  1GSY A;  3VI7 A;  2NBS A;  2H1G A;  3H8Q A;  2C0F A;  2YNX A;  4BWS A;  16GS A;  5G1K A;  3D6I A;  5IOX A;  1JLV A;  4TXV A;  3GL3 A;  2OE3 A;  2GZP A;  4KH7 A;  1OAZ A;  4O92 A;  2GDR A;  2B3S A;  3GA4 A;  4MLY A;  5AIX A;  2CVK A;  2LJK A;  5C00 A;  20GS A;  2AB6 A;  1X9W B;  1YF1 A;  2LS5 A;  2DJ3 A;  1X5C A;  1ZCP A;  4MF5 A;  2JSY A;  3M9K A;  3I69 A;  3DEX A;  3IV4 A;  5G5F A;  3GMF A;  4L5O A;  3EU3 A;  2F8A A;  4KUN A;  4XS4 B;  1OC3 A;  1TDI A;  1PX7 A;  2JSZ A;  3G7I A;  2LKU A;  1Z7P A;  4EDY A;  5J41 A;  1GTU A;  2VL3 A;  2QGV A;  5INY A;  4KDY A;  4HI7 A;  19GS A;  2N5A A;  1U88 A;  2HE3 A;  1XOA A;  4CDO A;  4JZQ A;  1CQG A;  2YPM A;  3V1W A;  2C3T A;  2FWG A;  2VCW A;  1XWA A;  2EIR A;  2YZH A;  1JLW A;  2JZR A;  2VL9 A;  2CA8 A;  1AQX A;  3ISO A;  3CSH A;  1TI3 A;  5ECI B;  3N9J A;  3IA1 A;  3KMO A;  1B48 A;  2B5E A;  2FA8 A;  6GSW A;  2DJ2 A;  2LNS A;  3VLN A;  1BX9 A;  4GSN A;  1TTZ A;  4BVY A;  4ZL9 A;  3SWL A;  1T7P B;  4ZB8 A;  2YJ7 A;  3EWL A;  3F4T A;  3LYP A;  4G10 A;  4ILF A;  2RII A;  3CRU A;  5CYY A;  1WMJ A;  4F2I A;  4KGI A;  4WXT A;  5ID2 A;  2WJU A;  2PVQ A;  2GQM A;  2QC7 A;  2H75 A;  4KX4 A;  2H30 A;  5DAL B;  5GAP D;  3LJR A;  1T8E B;  1SK1 A;  4MPG A;  4K7I A;  3QMX A;  1HQO A;  1Q98 A;  4KSO A;  3F9U A;  3RBT A;  4IN0 A;  2HRF A;  4OO5 A;  4MJE A;  2PBJ A;  4TRX A;  3GH9 A;  1M0U A;  3GTU A;  4D73 A;  2IWT A;  4HOJ A;  3W8J A;  3H4K A;  3D0Z A;  1XW5 A;  4ZXG A;  4POK A;  1QUW A;  2GSS A;  1GUL A;  1OE7 A;  2VL2 A;  2YAN A;  2MMA A;  4RQR A;  3GKN A;  4MJC A;  5IMZ A;  1ZYE A;  2GQK A;  4HZ4 A;  4NV5 A;  5AIS A;  2ON5 A;  4HU9 A;  4PNG A;  4POB A;  1Z5Y E;  3HD5 A;  5IMF A;  4DSS B;  6GSV A;  2A2R A;  4X1U A;  2LRN A;  5GSS A;  1PQN A;  3TJB A;  4LLR A;  2DMM A;  2WGR A;  2KOK A;  1EP7 A;  4TVE A;  3K8N A;  2RM5 A;  1GTB A;  1G0T A;  3VWU A;  3GX8 A;  1SL0 B;  3W8S A;  3KP9 A;  1YKC A;  2CV4 A;  3HZ8 A;  9GSS A;  1DBY A;  1PGT A;  3F63 A;  4IJI A;  1USB A;  1ZOF A;  3IOS A;  5E59 A;  1AQW A;  4IQA A;  5A4V A;  2N5B A;  1XCC A;  1E2Y A;  3DIE A;  3IDV A;  4PQH A;  3ERW A;  2B7K A;  4N0V A;  5F05 A;  4KDX A;  5ECH B;  4YQU A;  1SJZ A;  3LSZ A;  2YV7 A;  2HLS A;  1EOH A;  3KEB A; 
#chains in the Genus database with same CATH topology
 5ECN B;  2V1M A;  1EZK A;  3TJK A;  4ZBD A;  1EOG A;  3TKS E;  1FVK A;  5D9V A;  1TXX A;  3EUR A;  3FYG A;  5D8I A;  2YWO A;  1GSD A;  2VLT A;  4TR4 A;  4BVX A;  3ZYW A;  4GWR A;  5F06 A;  8GSS A;  3CXG A;  5ECQ B;  4BL7 A;  5IPG A;  1F3B A;  1X5E A;  4XTS A;  1ST9 A;  2JAD A;  5JWO B;  1PL2 A;  2AUV A;  1OE8 A;  3HDC A;  3WGD A;  1TOF A;  2C0E A;  3UBL A;  4TR1 A;  5COH A;  4XS1 A;  3GFK A;  1FVJ A;  2H1A A;  2VCQ A;  5DQS A;  3QD9 A;  2LST A;  5KN1 A;  2VOC A;  2IMD A;  1GWC A;  4YKG A;  1X0R A;  4Q5Q A;  3O3T A;  1K0D A;  2HRA A;  3F4S A;  2XPE A;  4EUY A;  2VM2 A;  1FB6 A;  1TI1 A;  3PPU A;  4AF2 A;  2HRN A;  3O76 A;  1THX A;  2OJL A;  1MDJ A;  1TP9 A;  2H73 A;  1M9A A;  3F0I A;  5ECL B;  2HSY A;  4IBP A;  4EE0 A;  1V40 A;  1KTE A;  1M2B A;  1ML6 A;  2DKH A;  1EV9 A;  3QAG A;  1Z3E A;  4HUA A;  4ACS A;  2LJR A;  4V2N A;  2OA7 A;  1ERV A;  4XRD A;  3CRT A;  1AXD A;  3OR5 A;  1OC8 A;  4IP6 A;  12GS A;  4A5P A;  5L71 A;  2MMZ A;  3DD3 A;  1U3A A;  2MBT A;  2E7P A;  2R4V A;  2KUC A;  3ZFL A;  4TN8 A;  4EC0 A;  4F82 A;  3FR6 A;  3E0U A;  5GZZ B;  4HU7 A;  4LL4 B;  1V58 A;  1F3A A;  5D73 A;  5LNK e;  5JWR B;  1PKZ A;  1T4Z A;  4H86 A;  2DC5 A;  1YKA A;  3HVX A;  4ML6 A;  5DCG A;  1PA3 A;  3KH9 A;  3TCO A;  5DBQ A;  4ECC A;  2H71 A;  3LXZ A;  3Q74 A;  2OE1 A;  3BCK A;  2IMF A;  2GTU A;  2NTO A;  4JRR A;  2PGT A;  2A4V A;  3M8N A;  2YCD A;  1M2D A;  2FUG 2;  1LBK A;  3ZIJ A;  2VL2 C;  5IMA A;  4ECB A;  4Z2R A;  3HCZ A;  1BYE A;  3VWX A;  2NVL A;  4O5U A;  3UEM A;  1Q4J A;  1N2A A;  1MDK A;  2IL3 A;  1I9D A;  5KN0 A;  3FZ4 A;  3AY8 A;  1WRY A;  1XW6 A;  2YV9 A;  4G19 A;  4IP1 A;  4RUV A;  5B8B A;  1ON4 A;  2G0F A;  4OFN A;  3EVI A;  4X43 A;  5FHI A;  2RUE A;  4PQ1 A;  3IAM 2;  2DSA A;  3BCI A;  3HA9 A;  4F9Z A;  2MYG A;  2VLV A;  3GX0 A;  4G0K A;  2I9H A;  2IJY A;  3VWW A;  4XCS A;  3D22 A;  4I97 A;  2H76 A;  4OCF A;  4TW5 A;  5HFI A;  4WBJ A;  1MD4 A;  3FW2 A;  2C4J A;  1XWC A;  2L5O A;  3QPM A;  5F8B A;  3D21 A;  3F3R A;  2JZT A;  4HS1 A;  3LYK A;  4N10 A;  4XIH A;  4K7N A;  3W6G A;  3S9F A;  4MA9 A;  3A5I A;  2LV3 A;  5C04 A;  3CSJ A;  3LWA A;  1MTC A;  4E8H A;  2O87 A;  3IPZ A;  5E4W A;  2IME A;  6GST A;  1BAY A;  2F51 A;  1H4O A;  4ZL8 A;  2AHE A;  1A24 A;  2I4A A;  3HYP A;  1MD3 A;  4MJB A;  4O7H A;  2I3Y A;  4WR5 A;  4ICY A;  2JU5 A;  4NWY A;  3GTU B;  4K6X A;  4WKW A;  2IIY A;  3WD6 A;  1GNE A;  1AAZ A;  1U87 A;  2MMO A;  2X99 A;  2FWF A;  2L6C A;  2IFQ B;  1Z6N A;  2CT6 A;  2XPD A;  4ZB6 A;  1M99 A;  3HZ4 A;  2R0P A;  4L5L A;  1HNC A;  2M46 A;  2YWN A;  1YQ1 A;  1GSE A;  1TU8 A;  1K0N A;  1SYX A;  1E6B A;  1OKT A;  4MZW A;  2GVP A;  4JBB A;  1A2L A;  2HZE B;  5ECS A;  2KLX A;  2B1K A;  4TXO B;  3GUR A;  1TRW A;  3UAP A;  1G6W A;  4AGS A;  3EIN A;  2ZCT A;  4LA1 A;  5J9B A;  4K5R A;  2VIM A;  3GKX A;  1YJ6 A;  4FIW A;  4WF4 A;  2N5F A;  3ZML A;  4G0L A;  5JCG A;  4CW9 A;  4PXO A;  3M1G A;  3QAV A;  2EIO A;  3FRC A;  3VWV A;  3F6D A;  2C8U A;  3Q18 A;  1M7T A;  1QGV A;  3A3T A;  3DRN A;  3TKR A;  3ZIT A;  4L8E A;  4KND A;  1SL1 B;  3M9J A;  1S3R A;  2I81 A;  3VFI A;  5KEJ A;  2P5Q A;  1TK5 B;  3IAS 2;  4J57 E;  1HNA A;  2BTO T;  3J7Y k;  2JL4 A;  3HHV A;  3F3Q A;  4NHZ A;  1B9X C;  5DJL A;  4JR4 A;  2VD1 A;  2WDU A;  5KN3 A;  1PKW A;  4YQV A;  2L59 A;  3PIN A;  1XVQ A;  3US3 A;  4OWY A;  2B7J A;  1GH2 A;  3GKK A;  4WF5 A;  1AC1 A;  2C3N A;  1PN9 A;  4NPB A;  2FY6 A;  17GS A;  5EL8 A;  1EGR A;  2PER A;  2LEG A;  1CQH A;  2AAW A;  3MSZ A;  3CTF A;  3PH9 A;  4TR0 A;  2WCI A;  2BMX A;  3GV1 A;  3A2V A;  1FAA A;  3ZMK A;  4BL7 B;  1K3Y A;  3UL3 A;  1M3I A;  3MYD A;  4DSQ A;  3VPT A;  1PRX A;  4KAE A;  5CRE A;  5JCU A;  4X4J A;  4WEY A;  2OBI A;  2M80 A;  4ECJ A;  1GSF A;  3WYW A;  3GUS A;  4TR3 A;  3ZVJ A;  2EIQ A;  3RPP A;  4TKY A;  4ZIJ A;  1GSQ A;  2B5X A;  2YN1 A;  3EYT A;  2HZF A;  2H0I A;  2IPA A;  4J56 E;  3Q19 A;  3DWV A;  3IRA A;  2R37 A;  4OO4 A;  3WT2 A;  13GS A;  4CHS A;  3FHK A;  3H93 A;  5DAK B;  5EVO A;  4MAB A;  1K0C A;  2YP6 A;  2KHP A;  5GAN D;  5KN2 A;  2A2P A;  3HVV A;  2FLS A;  3P90 A;  1XW9 A;  1TKD B;  4NAX A;  3L9S A;  1GUK A;  5D9T A;  4GLT A;  4IHU A;  1R26 A;  2A2S A;  1PFO A;  2A4H A;  2OBK A;  3NOF A;  4MCU A;  4F0C A;  5B8A A;  3LFL A;  1YDK A;  1GLQ A;  1EEJ A;  4WR4 A;  1KNG A;  2L4C A;  1OKD A;  2R5G A;  4G9H A;  2LQQ A;  1OC9 B;  2X8C A;  3GRX A;  4L0W A;  2H0G A;  2H1B A;  2HFD A;  3LW9 A;  3WGX A;  2GT6 A;  3O6T A;  3BOA A;  5ECK B;  2GQL A;  1FO5 A;  5D9W A;  1GUM A;  1K0O A;  5DJM A;  1DUG A;  1SJI A;  2O8V B;  4KCE A;  2GSR A;  2M72 A;  4DEJ A;  2P0G A;  5JCW A;  2GGT A;  1XBS A;  3TRQ A;  1FHE A;  1R5P A;  1UN2 A;  5B6N A;  1ZGN A;  1TRU A;  5FWG A;  3PR8 A;  1T3B A;  2O85 A;  2DJK A;  4MJA A;  2HSM A;  4MH3 A;  2H66 A;  2VCX A;  1NM3 A;  1GUH A;  5HR1 A;  4G2E A;  3RAZ A;  1ERU A;  3HY2 A;  2P31 A;  1O85 A;  4EKZ A;  5H5S A;  5CRW A;  4J2F A;  3LEF A;  1JFU A;  2L57 A;  2DLX A;  3P2A A;  4QL7 A;  3WGE A;  1G7E A;  1ZL9 A;  2X64 A;  3MWH A;  3P7X A;  3I9V 2;  4BWQ A;  3HKR A;  3FK8 A;  2WFC A;  4MDC A;  4K7O A;  2HI7 A;  4V2L A;  1WP0 A;  2H6Z A;  4MF7 A;  3UJ1 A;  4ZBB A;  2O7K A;  4KDU A;  1A8Y A;  1SL2 B;  3GST A;  2ZUP A;  3KM6 A;  1T1V A;  5ECP B;  2GZY A;  2J9H A;  3IR4 A;  3SBC A;  1MEK A;  1AUC A;  2AJQ B;  4KB3 A;  3EPT A;  3ZVJ D;  1S3A A;  4MZC A;  2H1D A;  4GTU A;  2OE0 A;  4P3Y B;  3FKF A;  1GP1 A;  1WOU A;  4MK3 A;  4PUF C;  5DAL A;  5AGY A;  14GS A;  1PD2 1;  4POL A;  3C8E A;  2FHE A;  5CNW A;  4BPY A;  2X49 A;  3QOU A;  4OMV A;  4KCA A;  1V98 A;  2F3M A;  3IHG A;  3WT1 A;  2H8L A;  3ED3 A;  3VUR A;  3ZIV A;  3UOM A;  1FOH A;  4RI6 A;  4V2M A;  1WE0 A;  1A0F A;  4K1F A;  5A4W A;  3FZ5 A;  6GSX A;  2FCH A;  3L9U A;  3VI5 A;  3NIV A;  4NXI A;  3QFB C;  1GL8 A;  2WB9 A;  3F4R A;  1QK8 A;  3VPQ A;  2H6Y A;  4K5S A;  3TOU A;  3QCP A;  4ZIL A;  1SU9 A;  4IQ1 A;  2DML A;  3GL5 A;  3C1R A;  4GQF A;  4HJ2 A;  5KOW A;  3R2Q A;  5ABR A;  2VCZ A;  2AV4 A;  5ECO B;  2DIZ A;  1TW9 A;  5LD0 A;  1EEM A;  4K2D A;  2GZZ A;  3RHC A;  2F9S A;  5H5R A;  2LTK A;  2TRX A;  2IMI A;  3HJP A;  3ERF A;  1EWX A;  1O8X A;  2LQO A;  1U6T A;  1JHB A;  2REM A;  4ULX A;  4OFM A;  2KP1 A;  2MMN A;  1R5A A;  2PN8 A;  4NHW A;  1O6J A;  3ME7 A;  4CY8 A;  3L4N A;  2C0G A;  3IK9 A;  3A2X A;  4I2U A;  5IIZ A;  1X9S B;  2LNT A;  5IMC A;  1TRS A;  4N11 A;  2R3X A;  3ZZX A;  1YEP A;  3LQ7 A;  1U3I A;  4MPF A;  3TB2 A;  11GS A;  2XC2 A;  1SK2 A;  2OAC A;  2I1U A;  3E3E A;  3MIX A;  3QAW A;  3CBU A;  3BJ5 A;  1XG8 A;  2VD0 A;  2NDO A;  10GS A;  1T4Y A;  1S3C A;  4WBR D;  2BJX A;  3IK7 A;  1WPI A;  4K0G A;  3RHB A;  2QKE A;  3D4M A;  1FG4 A;  3GN3 A;  4PX1 A;  4LMV A;  4BVY B;  3APQ A;  3KCM A;  1QFN A;  1F2E A;  1LU4 A;  3DXB A;  4IJ3 A;  5ID2 B;  1ACV A;  3CTG A;  1O8W A;  3U5R E;  4BA7 A;  3KD0 A;  4ML1 A;  1VGL A;  2PWJ A;  2LJA A;  4JED A;  1MDI A;  4O32 A;  4MF6 A;  3FR3 A;  3TRX A;  3IHQ A;  2XBI A;  3M3M A;  3KMN A;  4N30 A;  4O5Q A;  2E2M A;  3DGQ A;  3UBK A;  1GTA A;  4HSC X;  3ZTL A;  4YQM A;  5IOW A;  2F8F A;  4D73 B;  2CZ3 A;  1F6M C;  2GT5 A;  4MH2 A;  3KP8 A;  2O89 A;  1B4P A;  1YF0 A;  5HFK A;  1H75 A;  4ID0 A;  3RDW A;  3MDK A;  3H79 A;  4NMU A;  2OKA A;  2L4Q A;  2VCV A;  3ZL5 A;  2H72 A;  4EF0 A;  4X0X A;  1EGO A;  4EDZ A;  5HR2 A;  3LOR A;  1XXU A;  4I6X A;  4WET A;  5J5N A;  3CSI A;  1UC7 A;  1B4Q A;  3TOT A;  3C73 A;  1A2M A;  2H70 A;  1BJX A;  5HFG A;  4Q5F A;  5B7C A;  3I43 A;  5HR3 A;  5IO2 A;  2WUL A;  4PUA A;  2EC4 A;  5F07 A;  5A5K A;  3U6V A;  1QQ2 A;  5D9X A;  1J0F A;  5KOX A;  3TKQ A;  2VO4 A;  2V32 A;  4GSS A;  2LRT A;  5DDL A;  1YZX A;  1TRV A;  4ZB9 A;  3TKP A;  2KP2 A;  4FO5 A;  3KH7 A;  1Z9H A;  5G30 A;  3GYK A;  3TDG A;  5CRD A;  2B1L A;  3DYR A;  1YY7 A;  2YWI A;  3UVT A;  2K8V A;  4DSR A;  1EV4 A;  4IEL A;  4K8M A;  4IKH A;  3APS A;  2V6O A;  2AYT A;  1PX6 A;  1ERT A;  2X4A A;  5D93 A;  3FR9 A;  1AW9 A;  5IM9 A;  3TRP A;  2DJ1 A;  2WZ9 A;  5J3R A;  3VK9 A;  1NHY A;  4G0I A;  6GSY A;  1KEB A;  1AQV A;  3IBH A;  2B6M A;  2DBC A;  5J4U A;  1X9M B;  3I6A A;  3J7Y b;  1VF2 A;  1JZO A;  5HR0 A;  1GSS A;  4PQI A;  3D5J A;  2YWM A;  2ES7 A;  4FYU A;  3TKS A;  1QMV A;  3ZRD A;  2VAF A;  3MNG A;  2R6K A;  1WWJ A;  4KW6 A;  4BVX B;  4ISD A;  2V2G A;  5ENU A;  2XHF A;  5ECM B;  4YAV A;  3ME8 A;  2RUF A;  5IPH A;  4ZBA A;  1EP8 A;  3L0H A;  1SJ6 A;  2QA2 A;  3KGK A;  4MMM A;  2RLI A;  4TR1 B;  4TOP A;  3D4T A;  2CVB A;  4KE3 A;  3A5W A;  4RI7 A;  2B5Y A;  4PUR A;  5CAX A;  3HXS A;  3ZFB A;  3TJF A;  4HDE A;  6GSU A;  1NW2 A;  2CAQ A;  4GRF A;  1XOB A;  4YH2 A;  3TGZ A;  2H01 A;  4MZB A;  3C1S A;  1K0B A;  4K9Z A;  5CRG A;  1BQ7 A;  2H6X A;  1XWB A;  1K3O A;  1Y25 A;  2UZ8 A;  1XWG A;  3M0F A;  4V1A p;  2YZU A;  2RM6 A;  1URM A;  2GLR A;  3GHA A;  2PUK C;  1FOV A;  2FWH A;  2X8G A;  3CMI A;  3GKM A;  1T00 A;  3TUE A;  2QSI A;  2GST A;  4O5R A;  4YAP A;  1G6Y A;  2K9F A;  5EY6 A;  3L9V A;  2TRC P;  2YOI A;  3G9B A;  2H19 A;  4BIK A;  1J08 A;  2IFQ A;  4K0N A;  3TJJ A;  1SKW B;  2DIY A;  1IYH A;  2IN3 A;  4PTS A;  3F8U A;  1RQM A;  1UVZ A;  3LG6 A;  1O7U A;  1NHO A;  4AJ7 A;  4ZL7 A;  3A2W A;  4JU5 A;  2WS2 A;  2JZS A;  4N0Z A;  3EE2 A;  3IC8 A;  1SYR A;  1XIY A;  2HZE A;  4KA0 A;  1HYU A;  4TXO A;  4ECI A;  3JCM L;  4OCE A;  5G1L A;  3GNJ A;  2TIR A;  2FGX A;  3Q6O A;  3KIJ A;  4XS4 A;  7GSS A;  1O81 A;  1A0R P;  3E9J B;  3G7Y A;  4Q5N A;  1ZYN A;  1VRS D;  1PMT A;  1GNW A;  4GF0 A;  4EO3 A;  4JE1 A;  2L5L A;  4GST A;  4I2T A;  2WRT A;  4FH8 A;  5EPF A;  2R0G A;  3FEU A;  1A2J A;  1NSW A;  1BG5 A;  2MZC A;  4IVF A;  1M2A A;  3BD2 A;  4PNF A;  5CRH A;  3KJY A;  5G5E A;  1FB0 A;  4Q5R A;  1TJD A;  2ON7 A;  3DVW A;  2C80 A;  2J23 A;  2H0H A;  1J9B A;  2XBQ A;  4HQS A;  3QFA C;  1K0A A;  1V57 A;  3DVX A;  1AIU A;  2D2Z A;  2NPB A;  4XS6 A;  1SK0 A;  1FW1 A;  2FNO A;  1VF4 A;  4GQC A;  2QA1 A;  1IYI A;  1M9B A;  3L78 A;  5FT3 A;  3IC4 A;  5DQY A;  1W4V A;  3HJM A;  1DSB A;  4I8B A;  3BBY A;  4KSM A;  2HSH A;  4HEA 2;  2MBS A;  1A23 A;  5GST A;  2GSQ A;  1S3D A;  2LRC A;  2CAI A;  2DJ0 A;  4LL1 B;  1JZR A;  1B8X A;  3KZQ A;  4QL9 A;  2L6D A;  1SEN A;  3MAK A;  4EL1 A;  1ABA A;  1SD9 A;  5HQP A;  1R4W A;  5G2Z A;  18GS A;  5D96 A;  1LJR A;  2G2Q A;  1HNB A;  1SD8 A;  5CO3 A;  3UAR A;  1I5G A;  4USS A;  1ILO A;  3FY7 A;  2JAC A;  5IO0 A;  2PU9 C;  1Z6M A;  4FYC A;  5DAK A;  4QQ7 A;  3PGT A;  1W89 A;  3N5O A;  3QR6 A;  1K0M A;  2CX4 A;  3EU4 A;  2ZNM A;  4I5Q A;  5IMD A;  2GS3 A;  2X8H A;  3ERG A;  4PGT A;  3HJO A;  4KF9 A;  2CVD A;  2VUP A;  3GH6 A;  4V1A g;  2V6K A;  4EXJ A;  2HNL A;  1THO A;  5B6M A;  5DVB A;  2CX3 A;  1GTI A;  3KTL A;  5ECR B;  3H1N A;  2K8S A;  3APO A;  3DKS A;  3FZA A;  3TKS C;  1PSQ A;  2PPT A;  3QDN A;  1V9W A;  3FZ9 A;  4L0U A;  4DSS A;  5A4U A;  2OAD A;  6GSS A;  3UMA A;  1A8L A;  3R3E A;  1OC9 A;  2HT9 A;  4HJM A;  4AJ8 A;  5J9C A;  1DE2 A;  4GCI A;  1F37 A;  3ZRE A;  4IS0 A;  4XRA A;  1ZZY A;  2H74 A;  5LCZ A;  2C1Y A;  4MP4 A;  1OYJ A;  3RPN A;  1G7O A;  2IMK A;  1Z7R A;  5IMV A;  1X5D A;  1PL1 A;  2VLU A;  2PMT A;  4AJ6 A;  1ZMA A;  4E8E A;  4RQX A;  1TK8 B;  1GRX A;  4POM A;  2Z9S A;  2LUS A;  4IGJ A;  2CQ9 A;  5ELA A;  1BED A;  1N8J A;  5ELG A;  1TU7 A;  3GIX A;  1O73 A;  1Y6E A;  1QXH A;  1F9M A;  1PN0 A;  4CY6 A;  22GS A;  3LGC A;  5DCH A;  2K18 A;  1SKR B;  5F0G A;  2VCT A;  3EC3 A;  3KXO A;  5AN1 A;  3GSS A;  4GXZ A;  2ALB A;  2FWE A;  4FYB A;  2C3Q A;  5G31 A;  3ZLP A;  1XZO A;  1HD2 A;  3C71 A;  4OD7 A;  2YJH A;  3IE3 A;  3CYN A;  3IXR A;  2E0Q A;  2DJJ A;  2PVO C;  4OFT A;  1WIK A;  2C0D A;  1WJK A;  4Z2T A;  4LMW A;  1B9Y C;  1ERW A;  3NZN A;  3C7M A;  1XFL A;  2HRK A;  3LXT A;  2K6V A;  4IW9 A;  4EVM A;  3P8W A;  2E2G A;  1ZYQ B;  1TK0 B;  5H5Q A;  1C72 A;  1R7H A;  1XVW A;  2V41 A;  3DML A;  2CZ2 A;  4F03 A;  5BRT A;  5IQY A;  1XWK A;  1XPV A;  4NV2 A;  1K3L A;  1VF1 A;  2P5R A;  3F6F A;  4F0B A;  2HYX A;  4JR6 A;  2R2J A;  4XHM A;  2DKI A;  3KTB A;  1RW1 A;  5JWQ B;  1YEX A;  4Z7X A;  1JZD A;  1OVN A;  5CP1 A;  3UVH A;  3TJG A;  2FD3 A;  1RK4 A;  3EMX A;  4HQZ A;  3G7J A;  1SKS B;  2VM1 A;  4DVC A;  1UA5 A;  2FA4 A;  4HZ2 A;  1GLP A;  3EMP A;  2HXK A;  1GSU A;  1M3J A;  4MNN A;  3UIW A;  1JZW A;  5AIV A;  1V2A A;  3HVS A;  1DE1 A;  1VF3 A;  1KBN A;  1GSY A;  3VI7 A;  2NBS A;  2H1G A;  3H8Q A;  2C0F A;  2YNX A;  4BWS A;  16GS A;  5G1K A;  3D6I A;  5IOX A;  1JLV A;  4TXV A;  3GL3 A;  2OE3 A;  2GZP A;  4KH7 A;  1OAZ A;  4O92 A;  2GDR A;  2B3S A;  3GA4 A;  4MLY A;  5AIX A;  2CVK A;  2LJK A;  5C00 A;  20GS A;  2AB6 A;  1X9W B;  1YF1 A;  2LS5 A;  2DJ3 A;  1X5C A;  1ZCP A;  4MF5 A;  2JSY A;  3M9K A;  3I69 A;  3DEX A;  3IV4 A;  5G5F A;  3GMF A;  4L5O A;  3EU3 A;  2F8A A;  4KUN A;  4XS4 B;  1OC3 A;  1TDI A;  1PX7 A;  2JSZ A;  3G7I A;  2LKU A;  1Z7P A;  4EDY A;  5J41 A;  1GTU A;  2VL3 A;  2QGV A;  5INY A;  4KDY A;  4HI7 A;  19GS A;  2N5A A;  1U88 A;  2HE3 A;  1XOA A;  4CDO A;  4JZQ A;  1CQG A;  2YPM A;  3V1W A;  2C3T A;  2FWG A;  2VCW A;  1XWA A;  2EIR A;  2YZH A;  1JLW A;  2JZR A;  2VL9 A;  2CA8 A;  1AQX A;  3ISO A;  3CSH A;  1TI3 A;  5ECI B;  3N9J A;  3IA1 A;  3KMO A;  1B48 A;  2B5E A;  2FA8 A;  6GSW A;  2DJ2 A;  2LNS A;  3VLN A;  1BX9 A;  4GSN A;  1TTZ A;  4Z2U A;  4BVY A;  4ZL9 A;  3SWL A;  1T7P B;  4ZB8 A;  2YJ7 A;  3EWL A;  3F4T A;  3LYP A;  4G10 A;  4ILF A;  2RII A;  3CRU A;  5CYY A;  1WMJ A;  4F2I A;  4KGI A;  4WXT A;  5ID2 A;  2WJU A;  2PVQ A;  2GQM A;  2QC7 A;  2H75 A;  4KX4 A;  2H30 A;  5DAL B;  5GAP D;  3FMW A;  3LJR A;  1T8E B;  1SK1 A;  4MPG A;  4K7I A;  3QMX A;  1HQO A;  1Q98 A;  4KSO A;  3F9U A;  3RBT A;  4IN0 A;  2HRF A;  4OO5 A;  4MJE A;  2PBJ A;  4TRX A;  3GH9 A;  1M0U A;  3GTU A;  4D73 A;  2IWT A;  4HOJ A;  3W8J A;  3H4K A;  3D0Z A;  1XW5 A;  4K2X A;  4ZXG A;  4POK A;  1QUW A;  2GSS A;  1GUL A;  1OE7 A;  2VL2 A;  2YAN A;  2MMA A;  2R0C A;  4RQR A;  4YKF A;  3GKN A;  4MJC A;  4EIQ A;  5IMZ A;  1ZYE A;  2GQK A;  4HZ4 A;  4NV5 A;  5AIS A;  2ON5 A;  4HU9 A;  4PNG A;  4POB A;  1Z5Y E;  3HD5 A;  5IMF A;  4DSS B;  6GSV A;  2A2R A;  4X1U A;  2LRN A;  5GSS A;  1PQN A;  3TJB A;  4LLR A;  2DMM A;  2WGR A;  2KOK A;  1EP7 A;  4TVE A;  3K8N A;  2RM5 A;  1GTB A;  1G0T A;  3VWU A;  3GX8 A;  1SL0 B;  3W8S A;  3CQF A;  3KP9 A;  1YKC A;  2CV4 A;  3HZ8 A;  3HVN A;  9GSS A;  1DBY A;  1PGT A;  3F63 A;  4IJI A;  1USB A;  1ZOF A;  3IOS A;  5E59 A;  1AQW A;  4FQU A;  4IQA A;  5A4V A;  2N5B A;  1ZYP A;  1XCC A;  1E2Y A;  3DIE A;  3IDV A;  4PQH A;  3ERW A;  2B7K A;  4N0V A;  5F05 A;  4EIP A;  4KDX A;  5ECH B;  4YQU A;  5BMU A;  1SJZ A;  3LSZ A;  2YV7 A;  2HLS A;  1EOH A;  3KEB A; 
#chains in the Genus database with same CATH homology
 5ECN B;  2V1M A;  1EZK A;  3TJK A;  4ZBD A;  1EOG A;  3TKS E;  1FVK A;  5D9V A;  1TXX A;  3EUR A;  3FYG A;  5D8I A;  2YWO A;  1GSD A;  2VLT A;  4TR4 A;  4BVX A;  3ZYW A;  4GWR A;  5F06 A;  8GSS A;  3CXG A;  5ECQ B;  4BL7 A;  5IPG A;  1F3B A;  1X5E A;  4XTS A;  1ST9 A;  2JAD A;  5JWO B;  1PL2 A;  2AUV A;  1OE8 A;  3HDC A;  3WGD A;  1TOF A;  2C0E A;  3UBL A;  4TR1 A;  5COH A;  4XS1 A;  3GFK A;  1FVJ A;  2H1A A;  2VCQ A;  5DQS A;  3QD9 A;  2LST A;  5KN1 A;  2VOC A;  2IMD A;  1GWC A;  4YKG A;  1X0R A;  4Q5Q A;  3O3T A;  1K0D A;  2HRA A;  3F4S A;  2XPE A;  4EUY A;  2VM2 A;  1FB6 A;  1TI1 A;  3PPU A;  4AF2 A;  2HRN A;  3O76 A;  1THX A;  2OJL A;  1MDJ A;  1TP9 A;  2H73 A;  1M9A A;  3F0I A;  5ECL B;  2HSY A;  4IBP A;  4EE0 A;  1V40 A;  1KTE A;  1M2B A;  1ML6 A;  2DKH A;  1EV9 A;  3QAG A;  1Z3E A;  4HUA A;  4ACS A;  2LJR A;  4V2N A;  2OA7 A;  1ERV A;  4XRD A;  3CRT A;  1AXD A;  3OR5 A;  1OC8 A;  4IP6 A;  12GS A;  4A5P A;  5L71 A;  2MMZ A;  3DD3 A;  1U3A A;  2MBT A;  2E7P A;  2R4V A;  2KUC A;  3ZFL A;  4TN8 A;  4EC0 A;  4F82 A;  3FR6 A;  3E0U A;  5GZZ B;  4HU7 A;  4LL4 B;  1V58 A;  1F3A A;  5D73 A;  5LNK e;  5JWR B;  1PKZ A;  1T4Z A;  4H86 A;  2DC5 A;  1YKA A;  3HVX A;  4ML6 A;  5DCG A;  1PA3 A;  3KH9 A;  3TCO A;  5DBQ A;  4ECC A;  2H71 A;  3LXZ A;  3Q74 A;  2OE1 A;  3BCK A;  2IMF A;  2GTU A;  2NTO A;  4JRR A;  2PGT A;  2A4V A;  3M8N A;  2YCD A;  1M2D A;  2FUG 2;  1LBK A;  3ZIJ A;  2VL2 C;  5IMA A;  4ECB A;  4Z2R A;  3HCZ A;  1BYE A;  3VWX A;  2NVL A;  4O5U A;  3UEM A;  1Q4J A;  1N2A A;  1MDK A;  2IL3 A;  1I9D A;  5KN0 A;  3FZ4 A;  3AY8 A;  1WRY A;  1XW6 A;  2YV9 A;  4G19 A;  4IP1 A;  4RUV A;  5B8B A;  1ON4 A;  2G0F A;  4OFN A;  3EVI A;  4X43 A;  5FHI A;  2RUE A;  4PQ1 A;  3IAM 2;  2DSA A;  3BCI A;  3HA9 A;  4F9Z A;  2MYG A;  2VLV A;  3GX0 A;  4G0K A;  2I9H A;  2IJY A;  3VWW A;  4XCS A;  3D22 A;  4I97 A;  2H76 A;  4OCF A;  4TW5 A;  5HFI A;  4WBJ A;  1MD4 A;  3FW2 A;  2C4J A;  1XWC A;  2L5O A;  3QPM A;  5F8B A;  3D21 A;  3F3R A;  2JZT A;  4HS1 A;  3LYK A;  4N10 A;  4XIH A;  4K7N A;  3W6G A;  3S9F A;  4MA9 A;  3A5I A;  2LV3 A;  5C04 A;  3CSJ A;  3LWA A;  1MTC A;  4E8H A;  2O87 A;  3IPZ A;  5E4W A;  2IME A;  6GST A;  1BAY A;  2F51 A;  1H4O A;  4ZL8 A;  2AHE A;  1A24 A;  2I4A A;  3HYP A;  1MD3 A;  4MJB A;  4O7H A;  2I3Y A;  4WR5 A;  4ICY A;  2JU5 A;  4NWY A;  3GTU B;  4K6X A;  4WKW A;  2IIY A;  3WD6 A;  1GNE A;  1AAZ A;  1U87 A;  2MMO A;  2X99 A;  2FWF A;  2L6C A;  2IFQ B;  1Z6N A;  2CT6 A;  2XPD A;  4ZB6 A;  1M99 A;  3HZ4 A;  2R0P A;  4L5L A;  1HNC A;  2M46 A;  2YWN A;  1YQ1 A;  1GSE A;  1TU8 A;  1K0N A;  1SYX A;  1E6B A;  1OKT A;  4MZW A;  2GVP A;  4JBB A;  1A2L A;  2HZE B;  5ECS A;  2KLX A;  2B1K A;  4TXO B;  3GUR A;  1TRW A;  3UAP A;  1G6W A;  4AGS A;  3EIN A;  2ZCT A;  4LA1 A;  5J9B A;  4K5R A;  2VIM A;  3GKX A;  1YJ6 A;  4FIW A;  4WF4 A;  2N5F A;  3ZML A;  4G0L A;  5JCG A;  4CW9 A;  4PXO A;  3M1G A;  3QAV A;  2EIO A;  3FRC A;  3VWV A;  3F6D A;  2C8U A;  3Q18 A;  1M7T A;  1QGV A;  3A3T A;  3DRN A;  3TKR A;  3ZIT A;  4L8E A;  4KND A;  1SL1 B;  3M9J A;  2I81 A;  3VFI A;  5KEJ A;  2P5Q A;  1TK5 B;  3IAS 2;  4J57 E;  1HNA A;  2BTO T;  3J7Y k;  2JL4 A;  3HHV A;  3F3Q A;  4NHZ A;  1B9X C;  5DJL A;  4JR4 A;  2VD1 A;  2WDU A;  5KN3 A;  1PKW A;  4YQV A;  2L59 A;  3PIN A;  1XVQ A;  3US3 A;  4OWY A;  2B7J A;  1GH2 A;  3GKK A;  4WF5 A;  1AC1 A;  2C3N A;  1PN9 A;  4NPB A;  2FY6 A;  17GS A;  5EL8 A;  1EGR A;  2PER A;  2LEG A;  1CQH A;  2AAW A;  3MSZ A;  3CTF A;  3PH9 A;  4TR0 A;  2WCI A;  2BMX A;  3GV1 A;  3A2V A;  1FAA A;  3ZMK A;  4BL7 B;  1K3Y A;  3UL3 A;  3MYD A;  4DSQ A;  3VPT A;  1PRX A;  4KAE A;  5CRE A;  5JCU A;  4X4J A;  4WEY A;  2OBI A;  2M80 A;  4ECJ A;  1GSF A;  3WYW A;  3GUS A;  4TR3 A;  3ZVJ A;  2EIQ A;  3RPP A;  4TKY A;  4ZIJ A;  1GSQ A;  2B5X A;  2YN1 A;  3EYT A;  2HZF A;  2H0I A;  2IPA A;  4J56 E;  3Q19 A;  3DWV A;  3IRA A;  2R37 A;  4OO4 A;  3WT2 A;  13GS A;  4CHS A;  3FHK A;  3H93 A;  5DAK B;  5EVO A;  4MAB A;  1K0C A;  2YP6 A;  2KHP A;  5GAN D;  5KN2 A;  2A2P A;  3HVV A;  2FLS A;  3P90 A;  1XW9 A;  1TKD B;  4NAX A;  3L9S A;  1GUK A;  5D9T A;  4GLT A;  4IHU A;  1R26 A;  2A2S A;  2A4H A;  2OBK A;  3NOF A;  4MCU A;  4F0C A;  5B8A A;  3LFL A;  1YDK A;  1GLQ A;  1EEJ A;  4WR4 A;  1KNG A;  2L4C A;  1OKD A;  2R5G A;  4G9H A;  2LQQ A;  1OC9 B;  2X8C A;  3GRX A;  4L0W A;  2H0G A;  2H1B A;  2HFD A;  3LW9 A;  3WGX A;  2GT6 A;  3O6T A;  3BOA A;  5ECK B;  2GQL A;  1FO5 A;  5D9W A;  1GUM A;  1K0O A;  5DJM A;  1DUG A;  1SJI A;  2O8V B;  4KCE A;  2GSR A;  2M72 A;  4DEJ A;  2P0G A;  5JCW A;  2GGT A;  1XBS A;  3TRQ A;  1FHE A;  1R5P A;  1UN2 A;  5B6N A;  1ZGN A;  1TRU A;  5FWG A;  3PR8 A;  1T3B A;  2O85 A;  2DJK A;  4MJA A;  2HSM A;  4MH3 A;  2H66 A;  2VCX A;  1NM3 A;  1GUH A;  5HR1 A;  4G2E A;  3RAZ A;  1ERU A;  3HY2 A;  2P31 A;  1O85 A;  4EKZ A;  5H5S A;  5CRW A;  4J2F A;  3LEF A;  1JFU A;  2L57 A;  2DLX A;  3P2A A;  4QL7 A;  3WGE A;  1G7E A;  1ZL9 A;  2X64 A;  3MWH A;  3P7X A;  3I9V 2;  4BWQ A;  3HKR A;  3FK8 A;  2WFC A;  4MDC A;  4K7O A;  2HI7 A;  4V2L A;  1WP0 A;  2H6Z A;  4MF7 A;  3UJ1 A;  4ZBB A;  2O7K A;  4KDU A;  1A8Y A;  1SL2 B;  3GST A;  2ZUP A;  3KM6 A;  1T1V A;  5ECP B;  2GZY A;  2J9H A;  3IR4 A;  3SBC A;  1MEK A;  1AUC A;  2AJQ B;  4KB3 A;  3EPT A;  3ZVJ D;  1S3A A;  4MZC A;  2H1D A;  4GTU A;  2OE0 A;  4P3Y B;  3FKF A;  1GP1 A;  1WOU A;  4MK3 A;  4PUF C;  5DAL A;  5AGY A;  14GS A;  1PD2 1;  4POL A;  3C8E A;  2FHE A;  5CNW A;  4BPY A;  2X49 A;  3QOU A;  4OMV A;  4KCA A;  1V98 A;  2F3M A;  3IHG A;  3WT1 A;  2H8L A;  3ED3 A;  3VUR A;  3ZIV A;  3UOM A;  1FOH A;  4RI6 A;  4V2M A;  1WE0 A;  1A0F A;  4K1F A;  5A4W A;  3FZ5 A;  6GSX A;  2FCH A;  3L9U A;  3VI5 A;  3NIV A;  4NXI A;  3QFB C;  1GL8 A;  2WB9 A;  3F4R A;  1QK8 A;  3VPQ A;  2H6Y A;  4K5S A;  3TOU A;  3QCP A;  4ZIL A;  1SU9 A;  4IQ1 A;  2DML A;  3GL5 A;  3C1R A;  4GQF A;  4HJ2 A;  5KOW A;  3R2Q A;  5ABR A;  2VCZ A;  2AV4 A;  5ECO B;  2DIZ A;  1TW9 A;  5LD0 A;  1EEM A;  4K2D A;  2GZZ A;  3RHC A;  2F9S A;  5H5R A;  2LTK A;  2TRX A;  2IMI A;  3HJP A;  3ERF A;  1EWX A;  1O8X A;  2LQO A;  1U6T A;  1JHB A;  2REM A;  4ULX A;  4OFM A;  2KP1 A;  2MMN A;  1R5A A;  2PN8 A;  4NHW A;  1O6J A;  3ME7 A;  4CY8 A;  3L4N A;  2C0G A;  3IK9 A;  3A2X A;  4I2U A;  5IIZ A;  1X9S B;  2LNT A;  5IMC A;  1TRS A;  4N11 A;  2R3X A;  3ZZX A;  1YEP A;  3LQ7 A;  1U3I A;  4MPF A;  3TB2 A;  11GS A;  2XC2 A;  1SK2 A;  2OAC A;  2I1U A;  3E3E A;  3MIX A;  3QAW A;  3CBU A;  3BJ5 A;  2VD0 A;  2NDO A;  10GS A;  1T4Y A;  1S3C A;  4WBR D;  2BJX A;  3IK7 A;  1WPI A;  4K0G A;  3RHB A;  2QKE A;  3D4M A;  1FG4 A;  3GN3 A;  4PX1 A;  4LMV A;  4BVY B;  3APQ A;  3KCM A;  1QFN A;  1F2E A;  1LU4 A;  3DXB A;  4IJ3 A;  5ID2 B;  1ACV A;  3CTG A;  1O8W A;  3U5R E;  4BA7 A;  3KD0 A;  4ML1 A;  1VGL A;  2PWJ A;  2LJA A;  4JED A;  1MDI A;  4O32 A;  4MF6 A;  3FR3 A;  3TRX A;  3IHQ A;  2XBI A;  3M3M A;  3KMN A;  4N30 A;  4O5Q A;  2E2M A;  3DGQ A;  3UBK A;  1GTA A;  3ZTL A;  4YQM A;  5IOW A;  2F8F A;  4D73 B;  2CZ3 A;  1F6M C;  2GT5 A;  4MH2 A;  3KP8 A;  2O89 A;  1B4P A;  1YF0 A;  5HFK A;  1H75 A;  4ID0 A;  3RDW A;  3MDK A;  3H79 A;  4NMU A;  2OKA A;  2L4Q A;  2VCV A;  3ZL5 A;  2H72 A;  4EF0 A;  4X0X A;  1EGO A;  4EDZ A;  5HR2 A;  3LOR A;  1XXU A;  4I6X A;  4WET A;  5J5N A;  3CSI A;  1UC7 A;  1B4Q A;  3TOT A;  3C73 A;  1A2M A;  2H70 A;  1BJX A;  5HFG A;  4Q5F A;  5B7C A;  3I43 A;  5HR3 A;  5IO2 A;  2WUL A;  4PUA A;  2EC4 A;  5F07 A;  5A5K A;  3U6V A;  1QQ2 A;  5D9X A;  1J0F A;  5KOX A;  3TKQ A;  2VO4 A;  2V32 A;  4GSS A;  2LRT A;  5DDL A;  1YZX A;  1TRV A;  4ZB9 A;  3TKP A;  2KP2 A;  4FO5 A;  3KH7 A;  1Z9H A;  5G30 A;  3GYK A;  3TDG A;  5CRD A;  2B1L A;  3DYR A;  1YY7 A;  2YWI A;  3UVT A;  2K8V A;  4DSR A;  1EV4 A;  4IEL A;  4K8M A;  4IKH A;  3APS A;  2V6O A;  2AYT A;  1PX6 A;  1ERT A;  2X4A A;  5D93 A;  3FR9 A;  1AW9 A;  5IM9 A;  3TRP A;  2DJ1 A;  2WZ9 A;  5J3R A;  3VK9 A;  1NHY A;  4G0I A;  6GSY A;  1KEB A;  1AQV A;  3IBH A;  2B6M A;  2DBC A;  5J4U A;  1X9M B;  3I6A A;  3J7Y b;  1VF2 A;  1JZO A;  5HR0 A;  1GSS A;  4PQI A;  3D5J A;  2YWM A;  2ES7 A;  4FYU A;  3TKS A;  1QMV A;  3ZRD A;  2VAF A;  3MNG A;  2R6K A;  1WWJ A;  4KW6 A;  4BVX B;  4ISD A;  2V2G A;  5ENU A;  2XHF A;  5ECM B;  4YAV A;  3ME8 A;  2RUF A;  5IPH A;  4ZBA A;  1EP8 A;  3L0H A;  1SJ6 A;  2QA2 A;  3KGK A;  4MMM A;  2RLI A;  4TR1 B;  4TOP A;  3D4T A;  2CVB A;  4KE3 A;  3A5W A;  4RI7 A;  2B5Y A;  4PUR A;  5CAX A;  3HXS A;  3ZFB A;  3TJF A;  4HDE A;  6GSU A;  1NW2 A;  2CAQ A;  4GRF A;  1XOB A;  4YH2 A;  3TGZ A;  2H01 A;  4MZB A;  3C1S A;  1K0B A;  4K9Z A;  5CRG A;  1BQ7 A;  2H6X A;  1XWB A;  1K3O A;  1Y25 A;  2UZ8 A;  1XWG A;  3M0F A;  4V1A p;  2YZU A;  2RM6 A;  1URM A;  2GLR A;  3GHA A;  2PUK C;  1FOV A;  2FWH A;  2X8G A;  3CMI A;  3GKM A;  1T00 A;  3TUE A;  2QSI A;  2GST A;  4O5R A;  4YAP A;  1G6Y A;  2K9F A;  5EY6 A;  3L9V A;  2TRC P;  2YOI A;  3G9B A;  2H19 A;  1J08 A;  2IFQ A;  4K0N A;  3TJJ A;  1SKW B;  2DIY A;  1IYH A;  2IN3 A;  4PTS A;  3F8U A;  1RQM A;  1UVZ A;  3LG6 A;  1O7U A;  1NHO A;  4AJ7 A;  4ZL7 A;  3A2W A;  4JU5 A;  2WS2 A;  2JZS A;  4N0Z A;  3EE2 A;  3IC8 A;  1SYR A;  1XIY A;  2HZE A;  4KA0 A;  1HYU A;  4TXO A;  4ECI A;  3JCM L;  4OCE A;  5G1L A;  3GNJ A;  2TIR A;  2FGX A;  3Q6O A;  3KIJ A;  4XS4 A;  7GSS A;  1O81 A;  1A0R P;  3E9J B;  3G7Y A;  4Q5N A;  1ZYN A;  1VRS D;  1PMT A;  1GNW A;  4GF0 A;  4EO3 A;  4JE1 A;  2L5L A;  4GST A;  4I2T A;  2WRT A;  4FH8 A;  5EPF A;  2R0G A;  3FEU A;  1A2J A;  1NSW A;  1BG5 A;  2MZC A;  4IVF A;  1M2A A;  3BD2 A;  4PNF A;  5CRH A;  3KJY A;  5G5E A;  1FB0 A;  4Q5R A;  1TJD A;  2ON7 A;  3DVW A;  2C80 A;  2J23 A;  2H0H A;  1J9B A;  2XBQ A;  4HQS A;  3QFA C;  1K0A A;  1V57 A;  3DVX A;  1AIU A;  2D2Z A;  2NPB A;  4XS6 A;  1SK0 A;  1FW1 A;  2FNO A;  1VF4 A;  4GQC A;  2QA1 A;  1IYI A;  1M9B A;  3L78 A;  5FT3 A;  3IC4 A;  5DQY A;  1W4V A;  3HJM A;  1DSB A;  4I8B A;  3BBY A;  4KSM A;  2HSH A;  4HEA 2;  2MBS A;  1A23 A;  5GST A;  2GSQ A;  1S3D A;  2LRC A;  2CAI A;  2DJ0 A;  4LL1 B;  1JZR A;  1B8X A;  3KZQ A;  4QL9 A;  2L6D A;  1SEN A;  3MAK A;  4EL1 A;  1ABA A;  1SD9 A;  5HQP A;  1R4W A;  5G2Z A;  18GS A;  5D96 A;  1LJR A;  2G2Q A;  1HNB A;  1SD8 A;  5CO3 A;  3UAR A;  1I5G A;  4USS A;  1ILO A;  3FY7 A;  2JAC A;  5IO0 A;  2PU9 C;  1Z6M A;  4FYC A;  5DAK A;  4QQ7 A;  3PGT A;  1W89 A;  3N5O A;  3QR6 A;  1K0M A;  2CX4 A;  3EU4 A;  2ZNM A;  4I5Q A;  5IMD A;  2GS3 A;  2X8H A;  3ERG A;  4PGT A;  3HJO A;  4KF9 A;  2CVD A;  2VUP A;  3GH6 A;  4V1A g;  2V6K A;  4EXJ A;  2HNL A;  1THO A;  5B6M A;  5DVB A;  2CX3 A;  1GTI A;  3KTL A;  5ECR B;  3H1N A;  2K8S A;  3APO A;  3DKS A;  3FZA A;  3TKS C;  1PSQ A;  2PPT A;  3QDN A;  1V9W A;  3FZ9 A;  4L0U A;  4DSS A;  5A4U A;  2OAD A;  6GSS A;  3UMA A;  1A8L A;  3R3E A;  1OC9 A;  2HT9 A;  4HJM A;  4AJ8 A;  5J9C A;  1DE2 A;  4GCI A;  1F37 A;  3ZRE A;  4IS0 A;  4XRA A;  1ZZY A;  2H74 A;  5LCZ A;  2C1Y A;  4MP4 A;  1OYJ A;  3RPN A;  1G7O A;  2IMK A;  1Z7R A;  5IMV A;  1X5D A;  1PL1 A;  2VLU A;  2PMT A;  4AJ6 A;  1ZMA A;  4E8E A;  4RQX A;  1TK8 B;  1GRX A;  4POM A;  2Z9S A;  2LUS A;  4IGJ A;  2CQ9 A;  5ELA A;  1BED A;  1N8J A;  5ELG A;  1TU7 A;  3GIX A;  1O73 A;  1Y6E A;  1QXH A;  1F9M A;  1PN0 A;  4CY6 A;  22GS A;  3LGC A;  5DCH A;  2K18 A;  1SKR B;  5F0G A;  2VCT A;  3EC3 A;  3KXO A;  5AN1 A;  3GSS A;  4GXZ A;  2ALB A;  2FWE A;  4FYB A;  2C3Q A;  5G31 A;  3ZLP A;  1XZO A;  1HD2 A;  3C71 A;  4OD7 A;  2YJH A;  3IE3 A;  3CYN A;  3IXR A;  2E0Q A;  2DJJ A;  2PVO C;  4OFT A;  1WIK A;  2C0D A;  1WJK A;  4Z2T A;  4LMW A;  1B9Y C;  1ERW A;  3NZN A;  3C7M A;  1XFL A;  2HRK A;  3LXT A;  2K6V A;  4IW9 A;  4EVM A;  3P8W A;  2E2G A;  1ZYQ B;  1TK0 B;  5H5Q A;  1C72 A;  1R7H A;  1XVW A;  2V41 A;  3DML A;  2CZ2 A;  4F03 A;  5BRT A;  5IQY A;  1XWK A;  1XPV A;  4NV2 A;  1K3L A;  1VF1 A;  2P5R A;  3F6F A;  4F0B A;  2HYX A;  4JR6 A;  2R2J A;  4XHM A;  2DKI A;  3KTB A;  1RW1 A;  5JWQ B;  1YEX A;  4Z7X A;  1JZD A;  1OVN A;  5CP1 A;  3UVH A;  3TJG A;  2FD3 A;  1RK4 A;  3EMX A;  4HQZ A;  3G7J A;  1SKS B;  2VM1 A;  4DVC A;  1UA5 A;  2FA4 A;  4HZ2 A;  1GLP A;  3EMP A;  2HXK A;  1GSU A;  4MNN A;  3UIW A;  1JZW A;  5AIV A;  1V2A A;  3HVS A;  1DE1 A;  1VF3 A;  1KBN A;  1GSY A;  3VI7 A;  2NBS A;  2H1G A;  3H8Q A;  2C0F A;  2YNX A;  4BWS A;  16GS A;  5G1K A;  3D6I A;  5IOX A;  1JLV A;  4TXV A;  3GL3 A;  2OE3 A;  2GZP A;  4KH7 A;  1OAZ A;  4O92 A;  2GDR A;  2B3S A;  3GA4 A;  4MLY A;  5AIX A;  2CVK A;  2LJK A;  5C00 A;  20GS A;  2AB6 A;  1X9W B;  1YF1 A;  2LS5 A;  2DJ3 A;  1X5C A;  1ZCP A;  4MF5 A;  2JSY A;  3M9K A;  3I69 A;  3DEX A;  3IV4 A;  5G5F A;  3GMF A;  4L5O A;  3EU3 A;  2F8A A;  4KUN A;  4XS4 B;  1OC3 A;  1TDI A;  1PX7 A;  2JSZ A;  3G7I A;  2LKU A;  1Z7P A;  4EDY A;  5J41 A;  1GTU A;  2VL3 A;  2QGV A;  5INY A;  4KDY A;  4HI7 A;  19GS A;  2N5A A;  1U88 A;  2HE3 A;  1XOA A;  4CDO A;  4JZQ A;  1CQG A;  2YPM A;  3V1W A;  2C3T A;  2FWG A;  2VCW A;  1XWA A;  2EIR A;  2YZH A;  1JLW A;  2JZR A;  2VL9 A;  2CA8 A;  1AQX A;  3ISO A;  3CSH A;  1TI3 A;  5ECI B;  3N9J A;  3IA1 A;  3KMO A;  1B48 A;  2B5E A;  2FA8 A;  6GSW A;  2DJ2 A;  2LNS A;  3VLN A;  1BX9 A;  4GSN A;  1TTZ A;  4Z2U A;  4BVY A;  4ZL9 A;  3SWL A;  1T7P B;  4ZB8 A;  2YJ7 A;  3EWL A;  3F4T A;  3LYP A;  4G10 A;  4ILF A;  2RII A;  3CRU A;  5CYY A;  1WMJ A;  4F2I A;  4KGI A;  4WXT A;  5ID2 A;  2WJU A;  2PVQ A;  2GQM A;  2QC7 A;  2H75 A;  4KX4 A;  2H30 A;  5DAL B;  5GAP D;  3FMW A;  3LJR A;  1T8E B;  1SK1 A;  4MPG A;  4K7I A;  3QMX A;  1HQO A;  1Q98 A;  4KSO A;  3F9U A;  3RBT A;  4IN0 A;  2HRF A;  4OO5 A;  4MJE A;  2PBJ A;  4TRX A;  3GH9 A;  1M0U A;  3GTU A;  4D73 A;  2IWT A;  4HOJ A;  3W8J A;  3H4K A;  3D0Z A;  1XW5 A;  4K2X A;  4ZXG A;  4POK A;  1QUW A;  2GSS A;  1GUL A;  1OE7 A;  2VL2 A;  2YAN A;  2MMA A;  2R0C A;  4RQR A;  4YKF A;  3GKN A;  4MJC A;  4EIQ A;  5IMZ A;  1ZYE A;  2GQK A;  4HZ4 A;  4NV5 A;  5AIS A;  2ON5 A;  4HU9 A;  4PNG A;  4POB A;  1Z5Y E;  3HD5 A;  5IMF A;  4DSS B;  6GSV A;  2A2R A;  4X1U A;  2LRN A;  5GSS A;  1PQN A;  3TJB A;  4LLR A;  2DMM A;  2WGR A;  2KOK A;  1EP7 A;  4TVE A;  3K8N A;  2RM5 A;  1GTB A;  1G0T A;  3VWU A;  3GX8 A;  1SL0 B;  3W8S A;  3KP9 A;  1YKC A;  2CV4 A;  3HZ8 A;  9GSS A;  1DBY A;  1PGT A;  3F63 A;  4IJI A;  1USB A;  1ZOF A;  3IOS A;  5E59 A;  1AQW A;  4FQU A;  4IQA A;  5A4V A;  2N5B A;  1ZYP A;  1XCC A;  1E2Y A;  3DIE A;  3IDV A;  4PQH A;  3ERW A;  2B7K A;  4N0V A;  5F05 A;  4EIP A;  4KDX A;  5ECH B;  4YQU A;  5BMU A;  1SJZ A;  3LSZ A;  2YV7 A;  2HLS A;  1EOH A;  3KEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...