3D22A

Crystal structure of a poplar thioredoxin h mutant, pttrxh4c61s
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
138
structure length
129
Chain Sequence
GLCLAEPHIELAGGNVHLITTKERWDQKLSEASRDGKIVLANFSARWCGPSRQIAPYYIELSENYPSLMFLVIDVDELSDFSASWEIKATPTFFFLRDGQQVDKLVGANKPELHKKITAILDSLPPSDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin H-type
publication title An Atypical Catalytic Mechanism Involving Three Cysteines of Thioredoxin.
pubmed doi rcsb
source organism Populus trichocarpa x populus deltoides
total genus 43
structure length 129
sequence length 138
ec nomenclature
pdb deposition date 2008-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3d22A00
4GWRA 4MLYA 4YQUA 4L5LA 1DE1A 1EZKA 2R6KA 3RPPA 3F4RA 3FYGA 4IELA 5DAKA 1GSDA 5HR1A 4GLTA 1A0RP 3H79A 1U3AA 2OBIA 3GA4A 2DIZA 1B9XC 5GAPD 3HYPA 1O7UA 20GSA 19GSA 3QAVA 2FGXA 2PU9C 5IPHA 1GTUA 1UA5A 5C04A 2REMA 3LEFA 2DJJA 2HZEB 3N5OA 2E2MA 3HHVA 2F8FA 4ML1A 2C3QA 3OR5A 3AY8A 1M2DA 4ULXA 4OCEA 1TTZA 1GP1A 2HXKA 5JCUA 2H6YA 4F82A 2H73A 1GTAA 5LCZA 1B9YC 2IMFA 4XRDA 1SL1B 2VM2A 1K0MA 1PSQA 3VK9A 1PKZA 2XPEA 3CXGA 2P5RA 1MEKA 4V2MA 5ABRA 4GCIA 1M9BA 4WBJA 4KSOA 4KDYA 3KZQA 2EIOA 5ECOB 3PH9A 5D73A 5ELGA 1Z5YE 4TR3A 5IIZA 3KP9A 3ERWA 5GZZB 1A8LA 2R5GA 2VCVA 5F05A 2IMIA 4XCSA 2IN3A 2FHEA 1YKCA 5DQSA 1JZOA 1GUHA 2JZRA 1GULA 2VOCA 4IP6A 1EEJA 4BVXA 1B48A 2HRFA 3CMIA 3TKRA 3ZITA 4JRRA 2FY6A 3MWHA 4NMUA 1TOFA 4X1UA 4Q5NA 2JSYA 4KDUA 3EU3A 2FWEA 3GNJA 3UBLA 1SD9A 5ELAA 2YZHA 2HE3A 4MJBA 2LS5A 3IV4A 2WS2A 3TDGA 4GSTA 3I43A 3KD0A 1GUMA 4E8HA 2V1MA 1BYEA 2WFCA 3HJPA 3HKRA 3TJFA 1ZOFA 1EV9A 3TJKA 3F6FA 4N11A 5ECIB 1TK5B 1F37A 2XHFA 3IC4A 3Q18A 2H6ZA 5ECNB 2YCDA 3M1GA 2H01A 1HD2A 2OADA 18GSA 1ACVA 1MDIA 4LL4B 4YAPA 1G6YA 1SK0A 5HR0A 2CAQA 1J9BA 1K0NA 2C3TA 1SYRA 3VFIA 5JCWA 2CVKA 3EINA 3PR8A 1X5CA 2A2SA 2IMKA 1O81A 2LEGA 1YY7A 1E6BA 4RQRA 3QAGA 1Z6MA 4JU5A 4MF7A 2HZEA 3GKXA 2OACA 3LGCA 2DC5A 2H74A 16GSA 4JR6A 4KE3A 5J9CA 4ZBAA 4ZB8A 2DJ2A 3M8NA 2EIQA 1XWBA 3TGZA 1SK1A 3G7JA 4WKWA 3LWAA 2V2GA 3VI5A 4OFTA 2H0HA 3FZAA 2G2QA 2GLRA 2I9HA 2VM1A 5H5QA 1SKSB 1VF3A 2ZCTA 1B8XA 1FW1A 5C00A 3QOUA 1FVJA 3BBYA 2KP1A 1WIKA 2NTOA 2H1DA 1XCCA 1NHYA 3BD2A 3NIVA 5CRHA 4Q5RA 4ZL7A 6GSSA 4MP4A 2PN8A 5A4WA 2D2ZA 3QDNA 5AISA 4PQ1A 3C7MA 3UL3A 3ZREA 1OVNA 4EDZA 2K8VA 1BQ7A 5D9WA 3IPZA 4YQMA 4IJIA 4BA7A 4P3YB 1R5PA 1X5EA 2DBCA 2C0FA 2H8LA 5F07A 4FH8A 4KB3A 2IJYA 4KCAA 17GSA 1M7TA 2VCWA 5KN3A 2GSTA 2FUG2 3UARA 4LMVA 4MJEA 5HQPA 5FT3A 3RBTA 4K0GA 2IWTA 2I81A 3QFBC 6GSVA 4YAVA 2LNTA 2NPBA 4ZL9A 4L5OA 2OJLA 1LU4A 1C72A 2JU5A 1F9MA 3IAM2 4K8MA 4PNGA 2GVPA 4WETA 6GSYA 3MDKA 4MZWA 4OO4A 3PGTA 4TR4A 2PVOC 3RPNA 1K0CA 1N2AA 3HJMA 4G10A 3UAPA 5LNKe 2F51A 4HQSA 2LV3A 2YZUA 2VL9A 1TU7A 3LJRA 1A8YA 1X0RA 3DIEA 4IKHA 5J9BA 12GSA 4XS4B 3KGKA 1FOVA 3ME7A 5ECLB 4HUAA 1AQWA 4DSSA 1TRUA 2H19A 4IHUA 4MZBA 1WJKA 2RIIA 2RUFA 1A0FA 2C8UA 1PN9A 4AJ6A 2LNSA 3BJ5A 2YV9A 1VF4A 3WGEA 4KX4A 2H1AA 3D6IA 3GMFA 3Q74A 5HFGA 2O85A 2V32A 4Z7XA 3LYPA 2YWIA 2H30A 3H1NA 1QMVA 3EURA 3IOSA 2VLUA 4N10A 2WJUA 1U3IA 2HNLA 1G7EA 4F2IA 2XPDA 3LG6A 3ME8A 1GL8A 4ISDA 3FEUA 4KDXA 2I3YA 4Q5QA 2H1GA 3GKNA 1GNWA 4GTUA 1USBA 3SWLA 1T4ZA 2PBJA 3A2XA 3DGQA 2I1UA 9GSSA 4PURA 2C0DA 3TKSC 1T8EB 2HRNA 1A2JA 1Z7PA 3PINA 5DCHA 1FG4A 5E4WA 2CZ3A 2LJRA 5IMVA 3GL3A 4V1Ap 4WXTA 3IK9A 2TIRA 2B5YA 2E0QA 3C71A 3WGXA 1KNGA 3IBHA 1THOA 5G5FA 1ERTA 2FWFA 1XBSA 3HZ8A 3ZIJA 4F03A 1PRXA 1R26A 4RUVA 2DMLA 2DJ3A 3EU4A 4POLA 2R2JA 3F3QA 3TJBA 4XTSA 2JL4A 2C0EA 3FR6A 4ECCA 4LL1B 1LBKA 2YP6A 3CSJA 3LSZA 2B6MA 2OE0A 1XVWA 1W89A 2VL2C 2CX3A 1QXHA 3US3A 1SJ6A 1HYUA 4PGTA 3V1WA 2E2GA 3IXRA 4E8EA 2LRTA 4OCFA 3LQ7A 3QCPA 4MH3A 1ERUA 1U88A 1FO5A 2FD3A 5ECMB 2VLTA 2L6CA 4YQVA 2N5BA 1DBYA 1K0BA 3C8EA 2L6DA 1URMA 3HVSA 1W4VA 1XXUA 4XS4A 2K18A 5CAXA 3APQA 3TUEA 1V58A 2V6KA 1BJXA 2I4AA 4NWYA 3M3MA 4OFNA 2CQ9A 1BG5A 1I9DA 1PA3A 3UVHA 1GSEA 4EL1A 2B7JA 4AJ7A 4J2FA 5KEJA 2RM5A 1TXXA 4H86A 2YJHA 5F8BA 1THXA 2GQLA 5HFKA 4FO5A 3SBCA 5J3RA 2VAFA 4N0ZA 1MTCA 2LSTA 3M9KA 2GZZA 2M80A 2YWMA 1TDIA 3HZ4A 5AGYA 2VCQA 2J23A 2GGTA 5G30A 1PKWA 13GSA 1KBNA 5GSSA 4LLRA 4ZBDA 1YQ1A 4JBBA 4POKA 1OAZA 5ECPB 4TXVA 2ZNMA 4BPYA 5F06A 1O8XA 2AUVA 3FZ5A 4LA1A 4XHMA 3ZTLA 5J41A 4LMWA 2DSAA 3D22A 1QK8A 2QC7A 1JLVA 1QFNA 4GQCA 4EXJA 3FR9A 2LJAA 4EC0A 4I6XA 3ZYWA 1OC3A 5H5RA 4GXZA 1H4OA 1JLWA 5AIVA 1GTBA 2H72A 4OO5A 3TKPA 1U6TA 3APSA 1K0DA 1TP9A 3DRNA 3EE2A 3L4NA 3A2VA 3F0IA 2AAWA 4TKYA 1A24A 5EVOA 1GSYA 1BEDA 5D9TA 3GX8A 5EY6A 2B5EA 1O85A 2WRTA 1S3AA 3HCZA 3VPTA 1SL0B 3I6AA 1EGRA 1GH2A 5DJLA 3O3TA 1BAYA 4GQFA 2VL3A 1OE8A 2LUSA 1JFUA 3IK7A 1WMJA 2H1BA 3BCKA 4FYBA 4KSMA 3EC3A 2MMAA 1MDJA 1R5AA 3QR6A 3D4TA 2HI7A 14GSA 2K6VA 1K3YA 3VWVA 1DUGA 3CRTA 3IAS2 4KA0A 3VWWA 1ZMAA 1J08A 3J7Yk 3RDWA 4ECBA 1X5DA 5ECSA 3TJGA 1A2LA 2X8HA 2XBQA 2BJXA 2R4VA 3HY2A 1M99A 4QQ7A 1TKDB 5CO3A 3S9FA 3FZ9A 2L4QA 2FWGA 3BCIA 4L8EA 4TOPA 5DDLA 5B6MA 3D0ZA 3EYTA 2LQOA 2CT6A 5L71A 2HFDA 4QL7A 3ZFBA 4MF5A 4MK3A 1WE0A 2M46A 2J9HA 4GSSA 4FYUA 2WCIA 1YF1A 1XVQA 2H71A 5ENUA 4RI7A 1AQXA 2C3NA 4X43A 3HDCA 1NM3A 1YZXA 4NXIA 2X99A 1SKRB 4TRXA 1ZZYA 2MMNA 4POMA 3F3RA 2YN1A 2LRNA 3LXTA 2CX4A 3IDVA 1XWCA 2HT9A 4JZQA 3C1SA 2L59A 4K7OA 4BWSA 4EDYA 3NZNA 1Q98A 5IOWA 3EMXA 2JZSA 2MMZA 3CSIA 2OBKA 1TK0B 1NSWA 1OKTA 1TRVA 2WGRA 3CRUA 1XIYA 3RHCA 3M9JA 4NHWA 2VIMA 3DKSA 3TKSE 4I2TA 4F9ZA 5IO2A 1ZCPA 4V1Ag 1TU8A 2GT5A 3ZLPA 4WF5A 1XWAA 3F8UA 1YDKA 1Y25A 3GURA 3ED3A 1YJ6A 1K3OA 1X9WB 1GUKA 2IIYA 2LTKA 3P7XA 4MPGA 3DD3A 1XWKA 4BL7A 2GZYA 3K8NA 1YEPA 5A4UA 5HFIA 3J7Yb 3KTLA 2G0FA 4EO3A 2B1LA 1MD3A 1M0UA 1DE2A 1XOAA 4XIHA 1S3DA 3GKKA 2B3SA 2LQQA 2GTUA 1EOGA 1SK2A 4IJ3A 4AF2A 4IN0A 1JHBA 4MF6A 3GH9A 4WR4A 5KN0A 2H0IA 1RK4A 2BMXA 3QMXA 2C1YA 3GUSA 1CQGA 4OWYA 2KOKA 4FYCA 1AW9A 3DWVA 1GWCA 1EP8A 2VO4A 1F3BA 3TKSA 3F4TA 3GHAA 3QD9A 4HJ2A 5AN1A 3ZZXA 1YKAA 1OC8A 4MPFA 4XS1A 1UC7A 3TCOA 2A2RA 3VLNA 1AQVA 4EKZA 3GSTA 2ZUPA 1ZGNA 3F6DA 3FY7A 4JE1A 1OE7A 5JCGA 4XS6A 3HVXA 3IA1A 3HXSA 2X8GA 3Q6OA 3L0HA 3R2QA 11GSA 1Z3EA 5H5SA 1M9AA 3MSZA 3D4MA 1ST9A 1GSQA 3D21A 2HLSA 2P31A 3KH7A 4L0UA 1PL1A 3H4KA 1HNAA 3WT2A 10GSA 4G19A 2HZFA 4O7HA 4ZBBA 1GLQA 3JCML 1TW9A 4YH2A 2VL2A 1GLPA 1O73A 3ZMKA 2V6OA 2O8VB 4HDEA 2DIYA 2YWNA 4KNDA 2IFQB 1T00A 1F2EA 4BVYA 3H8QA 3ZVJD 2A4VA 3IE3A 3ZMLA 3WD6A 4BWQA 1VF2A 1WRYA 2DJ1A 3GTUB 2H76A 1LJRA 3Q19A 1DSBA 3CTGA 5CREA 5FHIA 2L5OA 5EPFA 5J5NA 3ERFA 2GDRA 2PVQA 3HD5A 3GRXA 4ECJA 1WWJA 4ILFA 5DALB 3DVWA 2DJKA 3HJOA 3VPQA 1V40A 3ZL5A 4AGSA 2IMDA 3UVTA 1RQMA 2GSQA 1PL2A 1RW1A 2B1KA 1TK8B 2VCXA 3KMNA 1GNEA 1EP7A 2QKEA 5J4UA 2LRCA 5JWQB 3G9BA 2JZTA 2PPTA 5ID2B 1GSUA 1M2BA 1SJZA 8GSSA 4KCEA 3TOTA 4F0BA 4TR0A 5CRWA 3P90A 2MYGA 3KP8A 5D96A 2CVBA 5CRDA 1ERWA 1V2AA 2LJKA 1HQOA 5KN1A 2K8SA 1VRSD 3TOUA 2IMEA 3UOMA 3E9JB 3LYKA 2L4CA 3APOA 2JSZA 1ZL9A 5GSTA 2GZPA 4RI6A 3MAKA 4I5QA 1NHOA 2CAIA 3UMAA 1EGOA 2EIRA 4IQAA 4G2EA 4HOJA 4NV5A 5ECRB 2AYTA 3UJ1A 5D93A 2RM6A 3VWUA 1T1VA 4IGJA 4EVMA 2MBTA 2NBSA 2FA4A 2CA8A 5ECQB 2KLXA 4N30A 1XW5A 1M2AA 2H0GA 1TRSA 2GSRA 4PX1A 5IMFA 3FW2A 4ZB9A 1K0AA 2NDOA 3H93A 4NPBA 3O76A 1KEBA 1EEMA 5G5EA 4I8BA 4OMVA 1IYIA 2FA8A 2O87A 3M0FA 4GF0A 2WB9A 3FHKA 3UEMA 4K2DA 3WYWA 3L9UA 1T4YA 3ZVJA 1SD8A 2F3MA 4J56E 1YEXA 3EWLA 3KTBA 5IO0A 2L5LA 5DJMA 3KH9A 2IFQA 3FRCA 2F9SA 2AV4A 4MZCA 1Z6NA 3GX0A 4HI7A 4PUAA 2VCTA 1F6MC 3FKFA 5AIXA 3GIXA 4TR1B 3GTUA 6GSUA 2PWJA 3WT1A 2GQKA 1MDKA 3TKQA 2IPAA 1UVZA 1T3BA 3KCMA 4MJAA 1AC1A 1SJIA 2AHEA 4PNFA 2VUPA 4K7NA 2DMMA 5IMCA 1SKWB 1T7PB 5DALA 4RQXA 4MA9A 3A3TA 1Z9HA 1SENA 3G7IA 3KXOA 3KMOA 4TN8A 3VI7A 4KH7A 2IL3A 1ML6A 4KGIA 2VD1A 1NW2A 1JZWA 3TJJA 3UIWA 1FAAA 2H6XA 2WDUA 4WEYA 2MBSA 1B4PA 4DVCA 2M72A 1PD21 1ZYEA 3KM6A 2YOIA 4G9HA 3UBKA 1B4QA 2ON5A 2OE1A 1JZRA 3ZIVA 5F0GA 4PXOA 2X64A 3CBUA 2H66A 5ID2A 1V57A 2FWHA 1XW9A 3DXBA 1O6JA 2B7KA 2P0GA 5CRGA 4HEA2 2GT6A 1HNBA 1QQ2A 4HQZA 2HSYA 2JADA 2KUCA 1EOHA 2Z9SA 4DSRA 4HZ2A 2MMOA 3N9JA 4L0WA 4K7IA 3VURA 4PQIA 4N0VA 2YV7A 5G1LA 1XZOA 5B8BA 5COHA 4JR4A 1OYJA 1ON4A 5EL8A 4ZL8A 4PQHA 2C80A 3ISOA 6GSXA 2VLVA 4ACSA 3RHBA 2X8CA 3ZFLA 3O6TA 2H70A 1G0TA 4O92A 3FK8A 3EVIA 5DVBA 1R7HA 3TB2A 4OD7A 1ABAA 4HU9A 5A4VA 3FZ4A 1SL2B 2FLSA 1WP0A 4CDOA 3D5JA 5G2ZA 3GYKA 4TXOB 4WBRD 4K0NA 5D9XA 1AAZA 1TI3A 2PERA 3I9V2 3W8SA 5GAND 1G7OA 2C0GA 2WZ9A 3DMLA 2YPMA 5G31A 5INYA 3MNGA 3W6GA 5CNWA 3P8WA 5HR3A 1F3AA 4MMMA 5G1KA 1AUCA 4K1FA 1S3CA 4I97A 4HS1A 2MZCA 4KAEA 3GN3A 1MD4A 2E7PA 4TR1A 5JWOB 1PX6A 6GSWA 3CYNA 5IQYA 2CVDA 5D9VA 2K9FA 3ERGA 4TW5A 2YANA 4CHSA 1GRXA 3IHQA 4DSSB 3KEBA 5KN2A 3GH6A 3F9UA 4K9ZA 2DJ0A 3F63A 1U87A 1JZDA 1K3LA 4ZIJA 4IBPA 2L57A 5LD0A 1V9WA 1QUWA 2F8AA 3C1RA 3LORA 5JWRB 2BTOT 1N8JA 2R3XA 4ECIA 1A2MA 2HYXA 1EWXA 4O32A 4J57E 4KUNA 4FIWA 4HU7A 1E2YA 5A5KA 4POBA 5CYYA 4D73B 4EE0A 3DVXA 4MCUA 1FB0A 1CQHA 5B6NA 7GSSA 3CSHA 2GS3A 4ID0A 2GSSA 3GKMA 3P2AA 1GSSA 3BOAA 4IW9A 3IRAA 1Q4JA 2CV4A 3DEXA 3U5RE 4ML6A 4V2LA 4V2NA 4IQ1A 3A2WA 5B7CA 1K0OA 4GRFA 4IVFA 2GQMA 2OA7A 1J0FA 22GSA 1WPIA 3WGDA 1Z7RA 1SU9A 3DYRA 1OKDA 5DBQA 3LFLA 3VWXA 2WULA 2EC4A 1R4WA 4Q5FA 4MH2A 3IR4A 3E3EA 4EF0A 4QL9A 1A23A 2O89A 3CTFA 1O8WA 1SYXA 1PMTA 4K6XA 3HVVA 2PGTA 2DLXA 1GTIA 3L9VA 4TXOA 1XOBA 2B5XA 2XBIA 4GSNA 1OC9B 5FWGA 2ON7A 5HR2A 2LKUA 3EMPA 2FCHA 2XC2A 2R37A 2TRCP 3GL5A 1ZYQB 3HA9A 1G6WA 3C73A 1I5GA 5ECHB 2N5AA 2KP2A 1VGLA 5IMDA 1ERVA 1ILOA 4MDCA 5DAKB 5DCGA 5ECKB 2ES7A 5D8IA 2O7KA 3QAWA 4AJ8A 4NAXA 4MABA 1XPVA 2RLIA 5IM9A 4PUFC 1KTEA 2N5FA 4JEDA 2C4JA 2TRXA 1AXDA 3GV1A 1BX9A 2ALBA 1VF1A 3E0UA 1TI1A 1QGVA 4HJMA 1FHEA 6GSTA 3QFAC 4NV2A 3ZRDA 1Y6EA 3KIJA 4NHZA 1TRWA 3TRPA 1XWGA 2RUEA 4IS0A 2AJQB 2V41A 4ZB6A 4DSQA 2PMTA 3QPMA 5B8AA 2VD0A 4X0XA 1YF0A 3TRQA 1PX7A 4OFMA 4D73A 3NOFA 4CW9A 1X9SB 4EUYA 2KHPA 2YJ7A 1V98A 2OKAA 2PUKC 1X9MB 1PQNA 3L78A 4O5RA 1GSFA 4ZXGA 2P5QA 3TRXA 3GSSA 4MJCA 3GFKA 1FVKA 5IOXA 4DEJA 2VCZA 4ZILA 4TVEA 3LXZA 2QSIA 3FR3A 5IMZA 5IPGA 2OE3A 1H75A 5E59A 2H75A 2YNXA 2YWOA 4WF4A 1WOUA 2QGVA 2HSHA 1IYHA 3KJYA 4I2UA 3L9SA 3A5WA 3F4SA 5CP1A 1PGTA 2NVLA 3U6VA 5IMAA 1AIUA 4F0CA 4HZ4A 3W8JA 1EV4A 3RAZA 1XW6A 2CZ2A 3I69A 5DQYA 4KW6A 1HNCA 4WR5A 4XRAA 2JACA 3G7YA 1UN2A 1FB6A 1TJDA 1OC9A 2AB6A 4IP1A 2FNOA 1XFLA
chains in the Genus database with same CATH superfamily
4GWRA 4MLYA 4YQUA 4L5LA 1DE1A 1EZKA 4MNNA 2R6KA 3RPPA 3F4RA 3FYGA 4IELA 5DAKA 1GSDA 5HR1A 3A5IA 4GLTA 1A0RP 3H79A 1U3AA 2OBIA 3GA4A 2DIZA 1B9XC 5GAPD 3HYPA 1O7UA 20GSA 19GSA 3QAVA 2FGXA 2PU9C 5IPHA 1GTUA 1UA5A 4K5SA 5C04A 2REMA 4CY8A 3LEFA 2DJJA 2HZEB 2QA2A 3N5OA 2E2MA 3HHVA 2F8FA 4ML1A 2C3QA 3OR5A 3AY8A 1M2DA 4ULXA 4OCEA 1TTZA 1GP1A 2HXKA 5JCUA 2H6YA 4F82A 2H73A 1GTAA 5LCZA 1B9YC 2IMFA 4XRDA 1SL1B 2VM2A 1K0MA 1PSQA 3VK9A 4USSA 1PKZA 2XPEA 3CXGA 2P5RA 1MEKA 4V2MA 5ABRA 4GCIA 1M9BA 4WBJA 4KSOA 4KDYA 3KZQA 2EIOA 5ECOB 3PH9A 5D73A 5ELGA 1Z5YE 4TR3A 5IIZA 3KP9A 3ERWA 5GZZB 1A8LA 2R5GA 2VCVA 5F05A 2IMIA 4XCSA 2IN3A 2FHEA 1YKCA 5DQSA 1JZOA 1GUHA 2JZRA 1GULA 2VOCA 4IP6A 1EEJA 4BVXA 1B48A 2HRFA 3CMIA 3TKRA 3ZITA 4JRRA 2FY6A 3MWHA 4NMUA 1TOFA 4X1UA 4Q5NA 2JSYA 4KDUA 3EU3A 2FWEA 3GNJA 3UBLA 1SD9A 5ELAA 2YZHA 2HE3A 4MJBA 2LS5A 3IV4A 2WS2A 3TDGA 4GSTA 3I43A 3KD0A 1GUMA 4E8HA 2V1MA 1BYEA 2WFCA 3HJPA 3HKRA 3TJFA 1ZOFA 1EV9A 2UZ8A 3TJKA 3F6FA 4N11A 5ECIB 1TK5B 1F37A 2XHFA 3IC4A 3Q18A 2H6ZA 5ECNB 2YCDA 4X4JA 3M1GA 2H01A 1HD2A 2OADA 18GSA 1ACVA 1MDIA 4LL4B 4YAPA 1G6YA 1SK0A 5HR0A 4EIPA 2CAQA 1J9BA 4FQUA 1K0NA 2C3TA 1SYRA 3VFIA 5JCWA 2CVKA 3EINA 3PR8A 1X5CA 2A2SA 2IMKA 1O81A 2LEGA 1YY7A 1E6BA 4RQRA 3QAGA 1Z6MA 4JU5A 4MF7A 2HZEA 3GKXA 2OACA 3LGCA 2DC5A 2H74A 16GSA 4JR6A 4KE3A 5J9CA 4ZBAA 4ZB8A 2DJ2A 3M8NA 2EIQA 1XWBA 3TGZA 1SK1A 3G7JA 4WKWA 3LWAA 2V2GA 3VI5A 4OFTA 2H0HA 3FZAA 2G2QA 2GLRA 2I9HA 2VM1A 5H5QA 1SKSB 1VF3A 2ZCTA 1B8XA 1FW1A 5C00A 3QOUA 1FVJA 3BBYA 2KP1A 1WIKA 2NTOA 1ZYNA 2H1DA 3IHGA 1XCCA 1NHYA 3BD2A 3NIVA 5CRHA 4Q5RA 4ZL7A 6GSSA 4MP4A 2PN8A 5A4WA 2D2ZA 3QDNA 5AISA 4Z2UA 4PQ1A 3C7MA 3UL3A 3ZREA 1XG8A 1OVNA 4EDZA 2K8VA 1BQ7A 5D9WA 3IPZA 4YQMA 4IJIA 4BA7A 4P3YB 1R5PA 1X5EA 2DBCA 2C0FA 2H8LA 5F07A 4FH8A 4KB3A 2IJYA 4KCAA 17GSA 1M7TA 2VCWA 5KN3A 2GSTA 2FUG2 3UARA 4LMVA 1PN0A 4MJEA 5HQPA 3IC8A 5FT3A 3RBTA 4K0GA 2IWTA 2I81A 3QFBC 6GSVA 4YAVA 2LNTA 2NPBA 4ZL9A 4L5OA 1PFOA 1LU4A 1C72A 2JU5A 1F9MA 2OJLA 3IAM2 4K8MA 4PNGA 2GVPA 4WETA 6GSYA 3MDKA 4MZWA 4OO4A 3CQFA 2QA1A 3PGTA 4TR4A 2PVOC 3RPNA 1K0CA 1N2AA 3HJMA 4G10A 3UAPA 5LNKe 3LW9A 2F51A 4HQSA 2LV3A 2YZUA 2VL9A 1TU7A 3LJRA 1A8YA 2R0CA 1X0RA 3DIEA 4IKHA 5J9BA 12GSA 4XS4B 3KGKA 1FOVA 3ME7A 5ECLB 4HUAA 1AQWA 5KOXA 4DSSA 1TRUA 2H19A 4IHUA 4MZBA 1WJKA 2RIIA 2RUFA 1A0FA 2C8UA 1PN9A 4AJ6A 2LNSA 3BJ5A 2YV9A 1VF4A 3WGEA 4KX4A 2H1AA 3D6IA 3GMFA 3Q74A 5HFGA 2O85A 2V32A 4Z7XA 3LYPA 2YWIA 2H30A 3H1NA 1QMVA 3EURA 4ICYA 3IOSA 2VLUA 4N10A 2WJUA 1U3IA 2HNLA 1G7EA 4F2IA 2XPDA 3LG6A 3ME8A 1GL8A 4ISDA 3FEUA 4KDXA 2I3YA 4Q5QA 2H1GA 3GKNA 1GNWA 4GTUA 1USBA 3SWLA 1T4ZA 2PBJA 3A2XA 3DGQA 2I1UA 9GSSA 4PURA 2C0DA 3TKSC 1T8EB 2HRNA 1A2JA 1Z7PA 3PINA 5DCHA 1FG4A 5E4WA 2CZ3A 2LJRA 5IMVA 3GL3A 4V1Ap 4WXTA 3IK9A 2TIRA 2B5YA 2E0QA 3C71A 3WGXA 1KNGA 3IBHA 1THOA 5G5FA 1ERTA 2FWFA 1XBSA 3HZ8A 3ZIJA 4F03A 1PRXA 1R26A 4RUVA 2DMLA 2DJ3A 3EU4A 4POLA 2R2JA 3F3QA 3TJBA 4XTSA 2JL4A 2C0EA 3FR6A 4ECCA 4LL1B 1LBKA 2YP6A 3CSJA 3LSZA 2B6MA 2OE0A 1XVWA 1W89A 2VL2C 2CX3A 1QXHA 3US3A 1SJ6A 1HYUA 4PGTA 3V1WA 2E2GA 3IXRA 4E8EA 2LRTA 4OCFA 1ZYPA 3LQ7A 3QCPA 4MH3A 1ERUA 1U88A 1FO5A 2FD3A 5ECMB 2VLTA 2L6CA 4YQVA 2N5BA 1DBYA 1K0BA 3C8EA 2L6DA 3EPTA 1URMA 3HVSA 1W4VA 1XXUA 4XS4A 2K18A 5CAXA 3APQA 3TUEA 1V58A 2V6KA 1BJXA 2I4AA 4NWYA 3M3MA 4OFNA 2CQ9A 1BG5A 2A2PA 1I9DA 1PA3A 3UVHA 1GSEA 4EL1A 2B7JA 4AJ7A 4J2FA 5KEJA 2RM5A 1TXXA 4H86A 2HRAA 2YJHA 5F8BA 1THXA 2GQLA 5HFKA 4FO5A 3SBCA 5J3RA 2VAFA 4N0ZA 1MTCA 2LSTA 3M9KA 2GZZA 2M80A 2YWMA 1TDIA 3HZ4A 5AGYA 2VCQA 2J23A 2GGTA 5G30A 1PKWA 13GSA 1KBNA 5GSSA 4LLRA 4ZBDA 1YQ1A 4JBBA 4POKA 1OAZA 5ECPB 4TXVA 2ZNMA 4BPYA 5F06A 1O8XA 2AUVA 2DKIA 3FZ5A 4LA1A 4XHMA 3ZTLA 5J41A 4LMWA 2DSAA 3D22A 1QK8A 2QC7A 1JLVA 1QFNA 4GQCA 4EXJA 3FR9A 2LJAA 4EC0A 4I6XA 3ZYWA 1OC3A 5H5RA 4GXZA 1H4OA 1JLWA 5AIVA 1GTBA 2H72A 4OO5A 3TKPA 1U6TA 3APSA 1K0DA 1TP9A 3DRNA 3EE2A 3L4NA 3A2VA 4K5RA 3F0IA 2AAWA 4TKYA 1A24A 5EVOA 1GSYA 1BEDA 5D9TA 3GX8A 5EY6A 2B5EA 1O85A 2WRTA 1S3AA 3HCZA 4BL7B 3VPTA 1SL0B 3I6AA 1EGRA 1GH2A 5DJLA 3O3TA 1BAYA 4GQFA 2VL3A 1OE8A 2LUSA 1JFUA 3IK7A 1WMJA 2H1BA 3BCKA 4FYBA 4KSMA 3EC3A 2MMAA 1MDJA 4HSCX 1R5AA 3QR6A 3D4TA 2HI7A 14GSA 4O5UA 2K6VA 1K3YA 3VWVA 1DUGA 3CRTA 3IAS2 4KA0A 3VWWA 1ZMAA 1J08A 3J7Yk 3RDWA 4ECBA 1X5DA 5ECSA 3TJGA 1A2LA 2X8HA 2XBQA 2BJXA 2R4VA 3HY2A 1M99A 4QQ7A 1TKDB 5CO3A 3S9FA 3FZ9A 2L4QA 2FWGA 3BCIA 4L8EA 4TOPA 5DDLA 5B6MA 3D0ZA 3EYTA 2LQOA 2CT6A 5L71A 2HFDA 4QL7A 3ZFBA 4MF5A 4MK3A 1WE0A 2M46A 2J9HA 2R0PA 4GSSA 4FYUA 2WCIA 1YF1A 1XVQA 2H71A 5ENUA 4RI7A 1AQXA 2C3NA 4X43A 3HDCA 1NM3A 1YZXA 4NXIA 2X99A 1SKRB 1FOHA 4TRXA 1ZZYA 2MMNA 4POMA 3F3RA 2YN1A 2LRNA 3LXTA 2CX4A 3IDVA 1XWCA 2HT9A 4JZQA 3C1SA 2L59A 4K7OA 4BWSA 4EDYA 4BVYB 3NZNA 1Q98A 5IOWA 3EMXA 2JZSA 2MMZA 3CSIA 2OBKA 1TK0B 1NSWA 1OKTA 1TRVA 2WGRA 3CRUA 1XIYA 3RHCA 3M9JA 4NHWA 2VIMA 3DKSA 3TKSE 4I2TA 4F9ZA 5IO2A 1ZCPA 4V1Ag 1TU8A 2GT5A 3ZLPA 4WF5A 1XWAA 3F8UA 1YDKA 1Y25A 3GURA 3ED3A 1YJ6A 1K3OA 1X9WB 1GUKA 2IIYA 2LTKA 3P7XA 4MPGA 3DD3A 1XWKA 4BL7A 2GZYA 3K8NA 4Z2RA 1YEPA 5A4UA 5HFIA 3J7Yb 3KTLA 2G0FA 4EO3A 2B1LA 1MD3A 1M0UA 1DE2A 1XOAA 4XIHA 1S3DA 3GKKA 2B3SA 2LQQA 2GTUA 1EOGA 1SK2A 4IJ3A 4AF2A 4IN0A 2X4AA 1JHBA 4MF6A 3GH9A 4WR4A 5KN0A 2H0IA 1RK4A 2BMXA 3QMXA 2C1YA 3GUSA 1CQGA 4OWYA 2KOKA 4FYCA 3MYDA 1AW9A 3DWVA 1GWCA 4Z2TA 1EP8A 2VO4A 1F3BA 3TKSA 3F4TA 4CY6A 3GHAA 3QD9A 4HJ2A 5AN1A 3ZZXA 1YKAA 1OC8A 4MPFA 4XS1A 1UC7A 3TCOA 2A2RA 3FMWA 3VLNA 1AQVA 4EKZA 3GSTA 2ZUPA 1ZGNA 3F6DA 3FY7A 4JE1A 1OE7A 5JCGA 4XS6A 3HVXA 3IA1A 3HXSA 2X8GA 3Q6OA 3L0HA 3R2QA 11GSA 1Z3EA 5H5SA 1M9AA 3MSZA 3D4MA 1ST9A 1GSQA 3D21A 2HLSA 2P31A 3KH7A 4L0UA 1PL1A 3H4KA 1HNAA 3MIXA 3WT2A 10GSA 4G19A 2HZFA 4O7HA 4ZBBA 1GLQA 3JCML 1TW9A 4YH2A 2VL2A 1GLPA 1O73A 3ZMKA 2V6OA 2O8VB 4YKGA 4HDEA 2DIYA 2YWNA 4KNDA 2IFQB 1T00A 1F2EA 4BVYA 3H8QA 3ZVJD 2A4VA 3IE3A 3ZMLA 3WD6A 4BWQA 1VF2A 1WRYA 2DJ1A 3GTUB 2H76A 1LJRA 3Q19A 1DSBA 3CTGA 5CREA 5FHIA 2L5OA 5EPFA 5J5NA 3ERFA 2GDRA 2PVQA 3HD5A 3GRXA 4ECJA 1WWJA 4ILFA 5DALB 3DVWA 2DJKA 3HJOA 3VPQA 1V40A 3ZL5A 4AGSA 2IMDA 3UVTA 1RQMA 2GSQA 1PL2A 1RW1A 2B1KA 1TK8B 2VCXA 4YKFA 3KMNA 1GNEA 1EP7A 2QKEA 5J4UA 2LRCA 5JWQB 2X49A 3G9BA 2JZTA 2PPTA 3PPUA 5ID2B 1GSUA 4BIKA 1M2BA 1SJZA 8GSSA 4KCEA 3TOTA 4F0BA 4TR0A 4PTSA 5CRWA 3P90A 2MYGA 3KP8A 5D96A 2CVBA 5CRDA 1ERWA 1V2AA 2LJKA 1HQOA 5KN1A 2K8SA 1VRSD 3TOUA 2IMEA 3UOMA 3E9JB 3LYKA 2L4CA 3APOA 2JSZA 1ZL9A 5GSTA 2GZPA 4RI6A 3MAKA 4I5QA 2A4HA 4K2XA 1NHOA 2CAIA 3UMAA 1EGOA 2EIRA 4IQAA 4G2EA 4HOJA 4NV5A 5ECRB 2AYTA 3UJ1A 4KF9A 2RM6A 5D93A 3VWUA 1T1VA 4IGJA 4EVMA 2MBTA 2NBSA 2FA4A 2CA8A 5ECQB 2KLXA 4N30A 1XW5A 1M2AA 2H0GA 1TRSA 2GSRA 4PX1A 5IMFA 3FW2A 4ZB9A 1K0AA 2NDOA 3H93A 4NPBA 3O76A 1KEBA 1EEMA 5G5EA 4I8BA 4OMVA 1IYIA 3M0FA 2FA8A 2O87A 4GF0A 2WB9A 3FHKA 3UEMA 4K2DA 3WYWA 3L9UA 1T4YA 3ZVJA 1SD8A 4G0IA 4G0LA 2F3MA 4J56E 1YEXA 3EWLA 3KTBA 5IO0A 2L5LA 5DJMA 3KH9A 2IFQA 3FRCA 2F9SA 2AV4A 4MZCA 1Z6NA 1M3JA 3GX0A 4HI7A 4PUAA 2VCTA 1F6MC 3FKFA 5AIXA 3GIXA 4TR1B 3GTUA 6GSUA 2PWJA 3WT1A 2GQKA 1MDKA 3TKQA 2IPAA 1UVZA 1T3BA 3KCMA 4MJAA 1AC1A 1SJIA 2AHEA 4PNFA 2VUPA 4K7NA 2DMMA 5IMCA 1SKWB 1T7PB 5DALA 4RQXA 4MA9A 3A3TA 1Z9HA 1SENA 3G7IA 3KXOA 3KMOA 4TN8A 3VI7A 4KH7A 2IL3A 1ML6A 4G0KA 3R3EA 4KGIA 2VD1A 1NW2A 1JZWA 3TJJA 3UIWA 1FAAA 2H6XA 2WDUA 4WEYA 2MBSA 1B4PA 4DVCA 2M72A 1PD21 1ZYEA 3KM6A 2YOIA 4G9HA 3UBKA 1B4QA 2ON5A 2OE1A 1JZRA 3ZIVA 5F0GA 4PXOA 2X64A 3CBUA 2H66A 5ID2A 1V57A 2FWHA 1XW9A 3DXBA 1O6JA 2B7KA 2P0GA 5CRGA 4HEA2 2GT6A 1HNBA 1QQ2A 4HQZA 2HSYA 2JADA 2KUCA 1EOHA 2Z9SA 4DSRA 4HZ2A 2MMOA 3N9JA 4L0WA 4K7IA 2R0GA 3VURA 4PQIA 4N0VA 2YV7A 5G1LA 1XZOA 5B8BA 5COHA 4JR4A 1OYJA 1ON4A 5EL8A 4ZL8A 4PQHA 2C80A 3ISOA 6GSXA 2VLVA 4ACSA 3RHBA 2X8CA 3ZFLA 3O6TA 2H70A 1G0TA 4O92A 3FK8A 3EVIA 5DVBA 5BRTA 1R7HA 3TB2A 4OD7A 1ABAA 3HVNA 4HU9A 5A4VA 3FZ4A 1SL2B 2HRKA 2FLSA 1WP0A 4CDOA 3D5JA 5G2ZA 3GYKA 4TXOB 4WBRD 4K0NA 5D9XA 1AAZA 1TI3A 2PERA 3I9V2 3W8SA 5GAND 1G7OA 2C0GA 2WZ9A 3DMLA 2YPMA 5G31A 5INYA 3MNGA 3W6GA 5CNWA 3P8WA 5HR3A 1F3AA 4MMMA 5G1KA 1AUCA 4K1FA 1S3CA 4I97A 4HS1A 2MZCA 4KAEA 3GN3A 1MD4A 2E7PA 4TR1A 5JWOB 1PX6A 6GSWA 3CYNA 5IQYA 2CVDA 5D9VA 2K9FA 3ERGA 4TW5A 2YANA 4CHSA 1GRXA 3IHQA 4DSSB 3KEBA 5KN2A 3GH6A 3F9UA 4K9ZA 2DJ0A 3F63A 1U87A 1JZDA 1K3LA 4ZIJA 4IBPA 2L57A 5LD0A 1V9WA 1QUWA 2F8AA 3C1RA 3LORA 5KOWA 2DKHA 5JWRB 2BTOT 1N8JA 2R3XA 4ECIA 1A2MA 2HYXA 1EWXA 4O32A 4J57E 4KUNA 4EIQA 4FIWA 4HU7A 1E2YA 5A5KA 4O5QA 4POBA 5CYYA 4D73B 4EE0A 3DVXA 4MCUA 1FB0A 1CQHA 5B6NA 7GSSA 3CSHA 2GS3A 4ID0A 4A5PA 2GSSA 3GKMA 3P2AA 1GSSA 3BOAA 4IW9A 3IRAA 1Q4JA 2CV4A 3DEXA 3U5RE 4ML6A 4V2LA 4V2NA 4IQ1A 3A2WA 5B7CA 1K0OA 4GRFA 4IVFA 2GQMA 2OA7A 1J0FA 22GSA 1WPIA 3WGDA 1Z7RA 1SU9A 3DYRA 1OKDA 5DBQA 3LFLA 3VWXA 2WULA 2EC4A 1R4WA 4Q5FA 4MH2A 3IR4A 3E3EA 4EF0A 4QL9A 1A23A 2O89A 3CTFA 1O8WA 1SYXA 1PMTA 4K6XA 3HVVA 2PGTA 2DLXA 1GTIA 3L9VA 4TXOA 1XOBA 2B5XA 2XBIA 4GSNA 1OC9B 5FWGA 2ON7A 5HR2A 2LKUA 3EMPA 2FCHA 2XC2A 2R37A 2TRCP 3GL5A 1ZYQB 3HA9A 1G6WA 3C73A 1I5GA 5ECHB 2N5AA 2KP2A 1VGLA 5IMDA 1ERVA 1ILOA 4MDCA 5DAKB 5DCGA 5ECKB 2ES7A 5D8IA 2O7KA 3QAWA 4AJ8A 4NAXA 4MABA 1XPVA 2RLIA 5IM9A 4PUFC 1KTEA 2N5FA 4JEDA 2C4JA 2TRXA 1AXDA 3GV1A 1BX9A 2ALBA 1VF1A 3E0UA 1TI1A 1QGVA 4HJMA 1FHEA 6GSTA 3QFAC 4NV2A 3ZRDA 1Y6EA 3KIJA 4NHZA 1TRWA 3TRPA 1XWGA 2RUEA 4IS0A 2AJQB 2V41A 4ZB6A 4DSQA 2PMTA 1S3RA 3QPMA 5B8AA 2VD0A 4X0XA 1YF0A 3TRQA 1PX7A 4OFMA 4D73A 3NOFA 4CW9A 1X9SB 4EUYA 2KHPA 2YJ7A 1V98A 5BMUA 2OKAA 2PUKC 1X9MB 1PQNA 3L78A 4O5RA 1GSFA 4ZXGA 2P5QA 3TRXA 3GSSA 4MJCA 3GFKA 1FVKA 5IOXA 4DEJA 2VCZA 4ZILA 4TVEA 3LXZA 2QSIA 2HSMA 3FR3A 5IMZA 5IPGA 2OE3A 1H75A 5E59A 2H75A 2YNXA 2YWOA 4WF4A 1WOUA 2QGVA 2HSHA 1IYHA 3KJYA 4I2UA 3L9SA 4BVXB 3A5WA 3F4SA 5CP1A 1PGTA 2NVLA 3U6VA 5IMAA 1AIUA 4F0CA 4HZ4A 1M3IA 3W8JA 1EV4A 3RAZA 1XW6A 2CZ2A 3I69A 5DQYA 4KW6A 1HNCA 4WR5A 4XRAA 2JACA 3G7YA 1UN2A 1FB6A 1TJDA 1OC9A 2AB6A 4IP1A 2FNOA 1XFLA
chains in the Genus database with same CATH topology
4GWRA 4MLYA 4YQUA 4L5LA 1DE1A 1EZKA 4MNNA 2R6KA 3RPPA 3F4RA 3FYGA 4IELA 5DAKA 1GSDA 5HR1A 3A5IA 4GLTA 1A0RP 3H79A 1U3AA 2OBIA 3GA4A 2DIZA 1B9XC 5GAPD 3HYPA 1O7UA 20GSA 19GSA 3QAVA 2FGXA 2PU9C 5IPHA 1GTUA 1UA5A 4K5SA 5C04A 2REMA 4CY8A 3LEFA 2DJJA 2HZEB 2QA2A 3N5OA 2E2MA 3HHVA 2F8FA 4ML1A 2C3QA 3OR5A 3AY8A 1M2DA 4ULXA 4OCEA 1TTZA 1GP1A 2HXKA 5JCUA 2H6YA 4F82A 2H73A 1GTAA 5LCZA 1B9YC 2IMFA 4XRDA 1SL1B 2VM2A 1K0MA 1PSQA 3VK9A 4USSA 1PKZA 2XPEA 3CXGA 2P5RA 1MEKA 4V2MA 5ABRA 4GCIA 1M9BA 4WBJA 4KSOA 4KDYA 3KZQA 2EIOA 5ECOB 3PH9A 5D73A 5ELGA 1Z5YE 4TR3A 5IIZA 3KP9A 3ERWA 5GZZB 1A8LA 2R5GA 2VCVA 5F05A 2IMIA 4XCSA 2IN3A 2FHEA 1YKCA 5DQSA 1JZOA 1GUHA 2JZRA 1GULA 2VOCA 4IP6A 1EEJA 4BVXA 1B48A 2HRFA 3CMIA 3TKRA 3ZITA 4JRRA 2FY6A 3MWHA 4NMUA 1TOFA 4X1UA 4Q5NA 2JSYA 4KDUA 3EU3A 2FWEA 3GNJA 3UBLA 1SD9A 5ELAA 2YZHA 2HE3A 4MJBA 2LS5A 3IV4A 2WS2A 3TDGA 4GSTA 3I43A 3KD0A 1GUMA 4E8HA 2V1MA 1BYEA 2WFCA 3HJPA 3HKRA 3TJFA 1ZOFA 1EV9A 2UZ8A 3TJKA 3F6FA 4N11A 5ECIB 1TK5B 1F37A 2XHFA 3IC4A 3Q18A 2H6ZA 5ECNB 2YCDA 4X4JA 3M1GA 2H01A 1HD2A 2OADA 18GSA 1ACVA 1MDIA 4LL4B 4YAPA 1G6YA 1SK0A 5HR0A 4EIPA 2CAQA 1J9BA 4FQUA 1K0NA 2C3TA 1SYRA 3VFIA 5JCWA 2CVKA 3EINA 3PR8A 1X5CA 2A2SA 2IMKA 1O81A 2LEGA 1YY7A 1E6BA 4RQRA 3QAGA 1Z6MA 4JU5A 4MF7A 2HZEA 3GKXA 2OACA 3LGCA 2DC5A 2H74A 16GSA 4JR6A 4KE3A 5J9CA 4ZBAA 4ZB8A 2DJ2A 3M8NA 2EIQA 1XWBA 3TGZA 1SK1A 3G7JA 4WKWA 3LWAA 2V2GA 3VI5A 4OFTA 2H0HA 3FZAA 2G2QA 2GLRA 2I9HA 2VM1A 5H5QA 1SKSB 1VF3A 2ZCTA 1B8XA 1FW1A 5C00A 3QOUA 1FVJA 3BBYA 2KP1A 1WIKA 2NTOA 1ZYNA 2H1DA 3IHGA 1XCCA 1NHYA 3BD2A 3NIVA 5CRHA 4Q5RA 4ZL7A 6GSSA 4MP4A 2PN8A 5A4WA 2D2ZA 3QDNA 5AISA 4Z2UA 4PQ1A 3C7MA 3UL3A 3ZREA 1OVNA 4EDZA 2K8VA 1BQ7A 5D9WA 3IPZA 4YQMA 4IJIA 4BA7A 4P3YB 1R5PA 1X5EA 2DBCA 2C0FA 2H8LA 5F07A 4FH8A 4KB3A 2IJYA 4KCAA 17GSA 1M7TA 2VCWA 5KN3A 2GSTA 2FUG2 3UARA 4LMVA 1PN0A 4MJEA 5HQPA 3IC8A 5FT3A 3RBTA 4K0GA 2IWTA 2I81A 3QFBC 6GSVA 4YAVA 2LNTA 2NPBA 4ZL9A 4L5OA 2OJLA 1LU4A 1C72A 2JU5A 1F9MA 3IAM2 4K8MA 4PNGA 2GVPA 4WETA 6GSYA 3MDKA 4MZWA 4OO4A 2QA1A 3PGTA 4TR4A 2PVOC 3RPNA 1K0CA 1N2AA 3HJMA 4G10A 3UAPA 5LNKe 3LW9A 2F51A 4HQSA 2LV3A 2YZUA 2VL9A 1TU7A 3LJRA 1A8YA 2R0CA 1X0RA 3DIEA 4IKHA 5J9BA 12GSA 4XS4B 3KGKA 1FOVA 3ME7A 5ECLB 4HUAA 1AQWA 5KOXA 4DSSA 1TRUA 2H19A 4IHUA 4MZBA 1WJKA 2RIIA 2RUFA 1A0FA 2C8UA 1PN9A 4AJ6A 2LNSA 3BJ5A 2YV9A 1VF4A 3WGEA 4KX4A 2H1AA 3D6IA 3GMFA 3Q74A 5HFGA 2O85A 2V32A 4Z7XA 3LYPA 2YWIA 2H30A 3H1NA 1QMVA 3EURA 4ICYA 3IOSA 2VLUA 4N10A 2WJUA 1U3IA 2HNLA 1G7EA 4F2IA 2XPDA 3LG6A 3ME8A 1GL8A 4ISDA 3FEUA 4KDXA 2I3YA 4Q5QA 2H1GA 3GKNA 1GNWA 4GTUA 1USBA 3SWLA 1T4ZA 2PBJA 3A2XA 3DGQA 2I1UA 9GSSA 4PURA 2C0DA 3TKSC 1T8EB 2HRNA 1A2JA 1Z7PA 3PINA 5DCHA 1FG4A 5E4WA 2CZ3A 2LJRA 5IMVA 3GL3A 4V1Ap 4WXTA 3IK9A 2TIRA 2B5YA 2E0QA 3C71A 3WGXA 1KNGA 3IBHA 1THOA 5G5FA 1ERTA 2FWFA 1XBSA 3HZ8A 3ZIJA 4F03A 1PRXA 1R26A 4RUVA 2DMLA 2DJ3A 3EU4A 4POLA 2R2JA 3F3QA 3TJBA 4XTSA 2JL4A 2C0EA 3FR6A 4ECCA 4LL1B 1LBKA 2YP6A 3CSJA 3LSZA 2B6MA 2OE0A 1XVWA 1W89A 2VL2C 2CX3A 1QXHA 3US3A 1SJ6A 1HYUA 4PGTA 3V1WA 2E2GA 3IXRA 4E8EA 2LRTA 4OCFA 1ZYPA 3LQ7A 3QCPA 4MH3A 1ERUA 1U88A 1FO5A 2FD3A 5ECMB 2VLTA 2L6CA 4YQVA 2N5BA 1DBYA 1K0BA 3C8EA 2L6DA 3EPTA 1URMA 3HVSA 1W4VA 1XXUA 4XS4A 2K18A 5CAXA 3APQA 3TUEA 1V58A 2V6KA 1BJXA 2I4AA 4NWYA 3M3MA 4OFNA 2CQ9A 1BG5A 2A2PA 1I9DA 1PA3A 3UVHA 1GSEA 4EL1A 2B7JA 4AJ7A 4J2FA 5KEJA 2RM5A 1TXXA 4H86A 2HRAA 2YJHA 5F8BA 1THXA 2GQLA 5HFKA 4FO5A 3SBCA 5J3RA 2VAFA 4N0ZA 1MTCA 2LSTA 3M9KA 2GZZA 2M80A 2YWMA 1TDIA 3HZ4A 5AGYA 2VCQA 2J23A 2GGTA 5G30A 1PKWA 13GSA 1KBNA 5GSSA 4LLRA 4ZBDA 1YQ1A 4JBBA 4POKA 1OAZA 5ECPB 4TXVA 2ZNMA 4BPYA 5F06A 1O8XA 2AUVA 2DKIA 3FZ5A 4LA1A 4XHMA 3ZTLA 5J41A 4LMWA 2DSAA 3D22A 1QK8A 2QC7A 1JLVA 1QFNA 4GQCA 4EXJA 3FR9A 2LJAA 4EC0A 4I6XA 3ZYWA 1OC3A 5H5RA 4GXZA 1H4OA 1JLWA 5AIVA 1GTBA 2H72A 4OO5A 3TKPA 1U6TA 3APSA 1K0DA 1TP9A 3DRNA 3EE2A 3L4NA 3A2VA 4K5RA 3F0IA 2AAWA 4TKYA 1A24A 5EVOA 1GSYA 1BEDA 5D9TA 3GX8A 5EY6A 2B5EA 1O85A 2WRTA 1S3AA 3HCZA 4BL7B 3VPTA 1SL0B 3I6AA 1EGRA 1GH2A 5DJLA 3O3TA 1BAYA 4GQFA 2VL3A 1OE8A 2LUSA 1JFUA 3IK7A 1WMJA 2H1BA 3BCKA 4FYBA 4KSMA 3EC3A 2MMAA 1MDJA 1R5AA 3QR6A 3D4TA 2HI7A 14GSA 4O5UA 2K6VA 1K3YA 3VWVA 1DUGA 3CRTA 3IAS2 4KA0A 3VWWA 1ZMAA 1J08A 3J7Yk 3RDWA 4ECBA 1X5DA 5ECSA 3TJGA 1A2LA 2X8HA 2XBQA 2BJXA 2R4VA 3HY2A 1M99A 4QQ7A 1TKDB 5CO3A 3S9FA 3FZ9A 2L4QA 2FWGA 3BCIA 4L8EA 4TOPA 5DDLA 5B6MA 3D0ZA 3EYTA 2LQOA 2CT6A 5L71A 2HFDA 4QL7A 3ZFBA 4MF5A 4MK3A 1WE0A 2M46A 2J9HA 2R0PA 4GSSA 4FYUA 2WCIA 1YF1A 1XVQA 2H71A 5ENUA 4RI7A 1AQXA 2C3NA 4X43A 3HDCA 1NM3A 1YZXA 4NXIA 2X99A 1SKRB 1FOHA 4TRXA 1ZZYA 2MMNA 4POMA 3F3RA 2YN1A 2LRNA 3LXTA 2CX4A 3IDVA 1XWCA 2HT9A 4JZQA 3C1SA 2L59A 4K7OA 4BWSA 4EDYA 4BVYB 3NZNA 1Q98A 5IOWA 3EMXA 2JZSA 2MMZA 3CSIA 2OBKA 1TK0B 1NSWA 1OKTA 1TRVA 2WGRA 3CRUA 1XIYA 3RHCA 3M9JA 4NHWA 2VIMA 3DKSA 3TKSE 4I2TA 4F9ZA 5IO2A 1ZCPA 4V1Ag 1TU8A 2GT5A 3ZLPA 4WF5A 1XWAA 3F8UA 1YDKA 1Y25A 3GURA 3ED3A 1YJ6A 1K3OA 1X9WB 1GUKA 2IIYA 2LTKA 3P7XA 4MPGA 3DD3A 1XWKA 4BL7A 2GZYA 3K8NA 4Z2RA 1YEPA 5A4UA 5HFIA 3J7Yb 3KTLA 2G0FA 4EO3A 2B1LA 1MD3A 1M0UA 1DE2A 1XOAA 4XIHA 1S3DA 3GKKA 2B3SA 2LQQA 2GTUA 1EOGA 1SK2A 4IJ3A 4AF2A 4IN0A 2X4AA 1JHBA 4MF6A 3GH9A 4WR4A 5KN0A 2H0IA 1RK4A 2BMXA 3QMXA 2C1YA 3GUSA 1CQGA 4OWYA 2KOKA 4FYCA 3MYDA 1AW9A 3DWVA 1GWCA 4Z2TA 1EP8A 2VO4A 1F3BA 3TKSA 3F4TA 4CY6A 3GHAA 3QD9A 4HJ2A 5AN1A 3ZZXA 1YKAA 1OC8A 4MPFA 4XS1A 1UC7A 3TCOA 2A2RA 3FMWA 3VLNA 1AQVA 4EKZA 3GSTA 2ZUPA 1ZGNA 3F6DA 3FY7A 4JE1A 1OE7A 5JCGA 4XS6A 3HVXA 3IA1A 3HXSA 2X8GA 3Q6OA 3L0HA 3R2QA 11GSA 1Z3EA 5H5SA 1M9AA 3MSZA 3D4MA 1ST9A 1GSQA 3D21A 2HLSA 2P31A 3KH7A 4L0UA 1PL1A 3H4KA 1HNAA 3MIXA 3WT2A 10GSA 4G19A 2HZFA 4O7HA 4ZBBA 1GLQA 3JCML 1TW9A 4YH2A 2VL2A 1GLPA 1O73A 3ZMKA 2V6OA 2O8VB 4YKGA 4HDEA 2DIYA 2YWNA 4KNDA 2IFQB 1T00A 1F2EA 4BVYA 3H8QA 3ZVJD 2A4VA 3IE3A 3ZMLA 3WD6A 4BWQA 1VF2A 1WRYA 2DJ1A 3GTUB 2H76A 1LJRA 3Q19A 1DSBA 3CTGA 5CREA 5FHIA 2L5OA 5EPFA 5J5NA 3ERFA 2GDRA 2PVQA 3HD5A 3GRXA 4ECJA 1WWJA 4ILFA 5DALB 3DVWA 2DJKA 3HJOA 3VPQA 1V40A 3ZL5A 4AGSA 2IMDA 3UVTA 1RQMA 2GSQA 1PL2A 1RW1A 2B1KA 1TK8B 2VCXA 4YKFA 3KMNA 1GNEA 1EP7A 2QKEA 5J4UA 2LRCA 5JWQB 2X49A 3G9BA 2JZTA 2PPTA 3PPUA 5ID2B 1GSUA 1M2BA 1SJZA 8GSSA 4KCEA 3TOTA 4F0BA 4TR0A 4PTSA 5CRWA 3P90A 2MYGA 3KP8A 5D96A 2CVBA 5CRDA 1ERWA 1V2AA 2LJKA 1HQOA 5KN1A 2K8SA 1VRSD 3TOUA 2IMEA 3UOMA 3E9JB 3LYKA 2L4CA 3APOA 2JSZA 1ZL9A 5GSTA 2GZPA 4RI6A 3MAKA 4I5QA 2A4HA 4K2XA 1NHOA 2CAIA 3UMAA 1EGOA 2EIRA 4IQAA 4G2EA 4HOJA 4NV5A 5ECRB 2AYTA 3UJ1A 4KF9A 2RM6A 5D93A 3VWUA 1T1VA 4IGJA 4EVMA 2MBTA 2NBSA 2FA4A 2CA8A 5ECQB 2KLXA 4N30A 1XW5A 1M2AA 2H0GA 1TRSA 2GSRA 4PX1A 5IMFA 3FW2A 4ZB9A 1K0AA 2NDOA 3H93A 4NPBA 3O76A 1KEBA 1EEMA 5G5EA 4I8BA 4OMVA 1IYIA 2FA8A 2O87A 3M0FA 4GF0A 2WB9A 3FHKA 3UEMA 4K2DA 3WYWA 3L9UA 1T4YA 3ZVJA 1SD8A 4G0IA 4G0LA 2F3MA 4J56E 1YEXA 3EWLA 3KTBA 5IO0A 2L5LA 5DJMA 3KH9A 2IFQA 3FRCA 2F9SA 2AV4A 4MZCA 1Z6NA 3GX0A 4HI7A 4PUAA 2VCTA 1F6MC 3FKFA 5AIXA 3GIXA 4TR1B 3GTUA 6GSUA 2PWJA 3WT1A 2GQKA 1MDKA 3TKQA 2IPAA 1UVZA 1T3BA 3KCMA 4MJAA 1AC1A 1SJIA 2AHEA 4PNFA 2VUPA 4K7NA 2DMMA 5IMCA 1SKWB 1T7PB 5DALA 4RQXA 4MA9A 3A3TA 1Z9HA 1SENA 3G7IA 3KXOA 3KMOA 4TN8A 3VI7A 4KH7A 2IL3A 1ML6A 4G0KA 3R3EA 4KGIA 2VD1A 1NW2A 1JZWA 3TJJA 3UIWA 1FAAA 2H6XA 2WDUA 4WEYA 2MBSA 1B4PA 4DVCA 2M72A 1PD21 1ZYEA 3KM6A 2YOIA 4G9HA 3UBKA 1B4QA 2ON5A 2OE1A 1JZRA 3ZIVA 5F0GA 4PXOA 2X64A 3CBUA 2H66A 5ID2A 1V57A 2FWHA 1XW9A 3DXBA 1O6JA 2B7KA 2P0GA 5CRGA 4HEA2 2GT6A 1HNBA 1QQ2A 4HQZA 2HSYA 2JADA 2KUCA 1EOHA 2Z9SA 4DSRA 4HZ2A 2MMOA 3N9JA 4L0WA 4K7IA 2R0GA 3VURA 4PQIA 4N0VA 2YV7A 5G1LA 1XZOA 5B8BA 5COHA 4JR4A 1OYJA 1ON4A 5EL8A 4ZL8A 4PQHA 2C80A 3ISOA 6GSXA 2VLVA 4ACSA 3RHBA 2X8CA 3ZFLA 3O6TA 2H70A 1G0TA 4O92A 3FK8A 3EVIA 5DVBA 5BRTA 1R7HA 3TB2A 4OD7A 1ABAA 4HU9A 5A4VA 3FZ4A 1SL2B 2HRKA 2FLSA 1WP0A 4CDOA 3D5JA 5G2ZA 3GYKA 4TXOB 4WBRD 4K0NA 5D9XA 1AAZA 1TI3A 2PERA 3I9V2 3W8SA 5GAND 1G7OA 2C0GA 2WZ9A 3DMLA 2YPMA 5G31A 5INYA 3MNGA 3W6GA 5CNWA 3P8WA 5HR3A 1F3AA 4MMMA 5G1KA 1AUCA 4K1FA 1S3CA 4I97A 4HS1A 2MZCA 4KAEA 3GN3A 1MD4A 2E7PA 4TR1A 5JWOB 1PX6A 6GSWA 3CYNA 5IQYA 2CVDA 5D9VA 2K9FA 3ERGA 4TW5A 2YANA 4CHSA 1GRXA 3IHQA 4DSSB 3KEBA 5KN2A 3GH6A 3F9UA 4K9ZA 2DJ0A 3F63A 1U87A 1JZDA 1K3LA 4ZIJA 4IBPA 2L57A 5LD0A 1V9WA 1QUWA 2F8AA 3C1RA 3LORA 5KOWA 2DKHA 5JWRB 2BTOT 1N8JA 2R3XA 4ECIA 1A2MA 2HYXA 1EWXA 4O32A 4J57E 4KUNA 4EIQA 4FIWA 4HU7A 1E2YA 5A5KA 4O5QA 4POBA 5CYYA 4D73B 4EE0A 3DVXA 4MCUA 1FB0A 1CQHA 5B6NA 7GSSA 3CSHA 2GS3A 4ID0A 4A5PA 2GSSA 3GKMA 3P2AA 1GSSA 3BOAA 4IW9A 3IRAA 1Q4JA 2CV4A 3DEXA 3U5RE 4ML6A 4V2LA 4V2NA 4IQ1A 3A2WA 5B7CA 1K0OA 4GRFA 4IVFA 2GQMA 2OA7A 1J0FA 22GSA 1WPIA 3WGDA 1Z7RA 1SU9A 3DYRA 1OKDA 5DBQA 3LFLA 3VWXA 2WULA 2EC4A 1R4WA 4Q5FA 4MH2A 3IR4A 3E3EA 4EF0A 4QL9A 1A23A 2O89A 3CTFA 1O8WA 1SYXA 1PMTA 4K6XA 3HVVA 2PGTA 2DLXA 1GTIA 3L9VA 4TXOA 1XOBA 2B5XA 2XBIA 4GSNA 1OC9B 5FWGA 2ON7A 5HR2A 2LKUA 3EMPA 2FCHA 2XC2A 2R37A 2TRCP 3GL5A 1ZYQB 3HA9A 1G6WA 3C73A 1I5GA 5ECHB 2N5AA 2KP2A 1VGLA 5IMDA 1ERVA 1ILOA 4MDCA 5DAKB 5DCGA 5ECKB 2ES7A 5D8IA 2O7KA 3QAWA 4AJ8A 4NAXA 4MABA 1XPVA 2RLIA 5IM9A 4PUFC 1KTEA 2N5FA 4JEDA 2C4JA 2TRXA 1AXDA 3GV1A 1BX9A 2ALBA 1VF1A 3E0UA 1TI1A 1QGVA 4HJMA 1FHEA 6GSTA 3QFAC 4NV2A 3ZRDA 1Y6EA 3KIJA 4NHZA 1TRWA 3TRPA 1XWGA 2RUEA 4IS0A 2AJQB 2V41A 4ZB6A 4DSQA 2PMTA 3QPMA 5B8AA 2VD0A 4X0XA 1YF0A 3TRQA 1PX7A 4OFMA 4D73A 3NOFA 4CW9A 1X9SB 4EUYA 2KHPA 2YJ7A 1V98A 5BMUA 2OKAA 2PUKC 1X9MB 1PQNA 3L78A 4O5RA 1GSFA 4ZXGA 2P5QA 3TRXA 3GSSA 4MJCA 3GFKA 1FVKA 5IOXA 4DEJA 2VCZA 4ZILA 4TVEA 3LXZA 2QSIA 2HSMA 3FR3A 5IMZA 5IPGA 2OE3A 1H75A 5E59A 2H75A 2YNXA 2YWOA 4WF4A 1WOUA 2QGVA 2HSHA 1IYHA 3KJYA 4I2UA 3L9SA 4BVXB 3A5WA 3F4SA 5CP1A 1PGTA 2NVLA 3U6VA 5IMAA 1AIUA 4F0CA 4HZ4A 3W8JA 1EV4A 3RAZA 1XW6A 2CZ2A 3I69A 5DQYA 4KW6A 1HNCA 4WR5A 4XRAA 2JACA 3G7YA 1UN2A 1FB6A 1TJDA 1OC9A 2AB6A 4IP1A 2FNOA 1XFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GWR A;  4MLY A;  4YQU A;  4L5L A;  1DE1 A;  1EZK A;  2R6K A;  3RPP A;  3F4R A;  3FYG A;  4IEL A;  5DAK A;  1GSD A;  5HR1 A;  4GLT A;  1A0R P;  3H79 A;  1U3A A;  2OBI A;  3GA4 A;  2DIZ A;  1B9X C;  5GAP D;  3HYP A;  1O7U A;  20GS A;  19GS A;  3QAV A;  2FGX A;  2PU9 C;  5IPH A;  1GTU A;  1UA5 A;  5C04 A;  2REM A;  3LEF A;  2DJJ A;  2HZE B;  3N5O A;  2E2M A;  3HHV A;  2F8F A;  4ML1 A;  2C3Q A;  3OR5 A;  3AY8 A;  1M2D A;  4ULX A;  4OCE A;  1TTZ A;  1GP1 A;  2HXK A;  5JCU A;  2H6Y A;  4F82 A;  2H73 A;  1GTA A;  5LCZ A;  1B9Y C;  2IMF A;  4XRD A;  1SL1 B;  2VM2 A;  1K0M A;  1PSQ A;  3VK9 A;  1PKZ A;  2XPE A;  3CXG A;  2P5R A;  1MEK A;  4V2M A;  5ABR A;  4GCI A;  1M9B A;  4WBJ A;  4KSO A;  4KDY A;  3KZQ A;  2EIO A;  5ECO B;  3PH9 A;  5D73 A;  5ELG A;  1Z5Y E;  4TR3 A;  5IIZ A;  3KP9 A;  3ERW A;  5GZZ B;  1A8L A;  2R5G A;  2VCV A;  5F05 A;  2IMI A;  4XCS A;  2IN3 A;  2FHE A;  1YKC A;  5DQS A;  1JZO A;  1GUH A;  2JZR A;  1GUL A;  2VOC A;  4IP6 A;  1EEJ A;  4BVX A;  1B48 A;  2HRF A;  3CMI A;  3TKR A;  3ZIT A;  4JRR A;  2FY6 A;  3MWH A;  4NMU A;  1TOF A;  4X1U A;  4Q5N A;  2JSY A;  4KDU A;  3EU3 A;  2FWE A;  3GNJ A;  3UBL A;  1SD9 A;  5ELA A;  2YZH A;  2HE3 A;  4MJB A;  2LS5 A;  3IV4 A;  2WS2 A;  3TDG A;  4GST A;  3I43 A;  3KD0 A;  1GUM A;  4E8H A;  2V1M A;  1BYE A;  2WFC A;  3HJP A;  3HKR A;  3TJF A;  1ZOF A;  1EV9 A;  3TJK A;  3F6F A;  4N11 A;  5ECI B;  1TK5 B;  1F37 A;  2XHF A;  3IC4 A;  3Q18 A;  2H6Z A;  5ECN B;  2YCD A;  3M1G A;  2H01 A;  1HD2 A;  2OAD A;  18GS A;  1ACV A;  1MDI A;  4LL4 B;  4YAP A;  1G6Y A;  1SK0 A;  5HR0 A;  2CAQ A;  1J9B A;  1K0N A;  2C3T A;  1SYR A;  3VFI A;  5JCW A;  2CVK A;  3EIN A;  3PR8 A;  1X5C A;  2A2S A;  2IMK A;  1O81 A;  2LEG A;  1YY7 A;  1E6B A;  4RQR A;  3QAG A;  1Z6M A;  4JU5 A;  4MF7 A;  2HZE A;  3GKX A;  2OAC A;  3LGC A;  2DC5 A;  2H74 A;  16GS A;  4JR6 A;  4KE3 A;  5J9C A;  4ZBA A;  4ZB8 A;  2DJ2 A;  3M8N A;  2EIQ A;  1XWB A;  3TGZ A;  1SK1 A;  3G7J A;  4WKW A;  3LWA A;  2V2G A;  3VI5 A;  4OFT A;  2H0H A;  3FZA A;  2G2Q A;  2GLR A;  2I9H A;  2VM1 A;  5H5Q A;  1SKS B;  1VF3 A;  2ZCT A;  1B8X A;  1FW1 A;  5C00 A;  3QOU A;  1FVJ A;  3BBY A;  2KP1 A;  1WIK A;  2NTO A;  2H1D A;  1XCC A;  1NHY A;  3BD2 A;  3NIV A;  5CRH A;  4Q5R A;  4ZL7 A;  6GSS A;  4MP4 A;  2PN8 A;  5A4W A;  2D2Z A;  3QDN A;  5AIS A;  4PQ1 A;  3C7M A;  3UL3 A;  3ZRE A;  1OVN A;  4EDZ A;  2K8V A;  1BQ7 A;  5D9W A;  3IPZ A;  4YQM A;  4IJI A;  4BA7 A;  4P3Y B;  1R5P A;  1X5E A;  2DBC A;  2C0F A;  2H8L A;  5F07 A;  4FH8 A;  4KB3 A;  2IJY A;  4KCA A;  17GS A;  1M7T A;  2VCW A;  5KN3 A;  2GST A;  2FUG 2;  3UAR A;  4LMV A;  4MJE A;  5HQP A;  5FT3 A;  3RBT A;  4K0G A;  2IWT A;  2I81 A;  3QFB C;  6GSV A;  4YAV A;  2LNT A;  2NPB A;  4ZL9 A;  4L5O A;  2OJL A;  1LU4 A;  1C72 A;  2JU5 A;  1F9M A;  3IAM 2;  4K8M A;  4PNG A;  2GVP A;  4WET A;  6GSY A;  3MDK A;  4MZW A;  4OO4 A;  3PGT A;  4TR4 A;  2PVO C;  3RPN A;  1K0C A;  1N2A A;  3HJM A;  4G10 A;  3UAP A;  5LNK e;  2F51 A;  4HQS A;  2LV3 A;  2YZU A;  2VL9 A;  1TU7 A;  3LJR A;  1A8Y A;  1X0R A;  3DIE A;  4IKH A;  5J9B A;  12GS A;  4XS4 B;  3KGK A;  1FOV A;  3ME7 A;  5ECL B;  4HUA A;  1AQW A;  4DSS A;  1TRU A;  2H19 A;  4IHU A;  4MZB A;  1WJK A;  2RII A;  2RUF A;  1A0F A;  2C8U A;  1PN9 A;  4AJ6 A;  2LNS A;  3BJ5 A;  2YV9 A;  1VF4 A;  3WGE A;  4KX4 A;  2H1A A;  3D6I A;  3GMF A;  3Q74 A;  5HFG A;  2O85 A;  2V32 A;  4Z7X A;  3LYP A;  2YWI A;  2H30 A;  3H1N A;  1QMV A;  3EUR A;  3IOS A;  2VLU A;  4N10 A;  2WJU A;  1U3I A;  2HNL A;  1G7E A;  4F2I A;  2XPD A;  3LG6 A;  3ME8 A;  1GL8 A;  4ISD A;  3FEU A;  4KDX A;  2I3Y A;  4Q5Q A;  2H1G A;  3GKN A;  1GNW A;  4GTU A;  1USB A;  3SWL A;  1T4Z A;  2PBJ A;  3A2X A;  3DGQ A;  2I1U A;  9GSS A;  4PUR A;  2C0D A;  3TKS C;  1T8E B;  2HRN A;  1A2J A;  1Z7P A;  3PIN A;  5DCH A;  1FG4 A;  5E4W A;  2CZ3 A;  2LJR A;  5IMV A;  3GL3 A;  4V1A p;  4WXT A;  3IK9 A;  2TIR A;  2B5Y A;  2E0Q A;  3C71 A;  3WGX A;  1KNG A;  3IBH A;  1THO A;  5G5F A;  1ERT A;  2FWF A;  1XBS A;  3HZ8 A;  3ZIJ A;  4F03 A;  1PRX A;  1R26 A;  4RUV A;  2DML A;  2DJ3 A;  3EU4 A;  4POL A;  2R2J A;  3F3Q A;  3TJB A;  4XTS A;  2JL4 A;  2C0E A;  3FR6 A;  4ECC A;  4LL1 B;  1LBK A;  2YP6 A;  3CSJ A;  3LSZ A;  2B6M A;  2OE0 A;  1XVW A;  1W89 A;  2VL2 C;  2CX3 A;  1QXH A;  3US3 A;  1SJ6 A;  1HYU A;  4PGT A;  3V1W A;  2E2G A;  3IXR A;  4E8E A;  2LRT A;  4OCF A;  3LQ7 A;  3QCP A;  4MH3 A;  1ERU A;  1U88 A;  1FO5 A;  2FD3 A;  5ECM B;  2VLT A;  2L6C A;  4YQV A;  2N5B A;  1DBY A;  1K0B A;  3C8E A;  2L6D A;  1URM A;  3HVS A;  1W4V A;  1XXU A;  4XS4 A;  2K18 A;  5CAX A;  3APQ A;  3TUE A;  1V58 A;  2V6K A;  1BJX A;  2I4A A;  4NWY A;  3M3M A;  4OFN A;  2CQ9 A;  1BG5 A;  1I9D A;  1PA3 A;  3UVH A;  1GSE A;  4EL1 A;  2B7J A;  4AJ7 A;  4J2F A;  5KEJ A;  2RM5 A;  1TXX A;  4H86 A;  2YJH A;  5F8B A;  1THX A;  2GQL A;  5HFK A;  4FO5 A;  3SBC A;  5J3R A;  2VAF A;  4N0Z A;  1MTC A;  2LST A;  3M9K A;  2GZZ A;  2M80 A;  2YWM A;  1TDI A;  3HZ4 A;  5AGY A;  2VCQ A;  2J23 A;  2GGT A;  5G30 A;  1PKW A;  13GS A;  1KBN A;  5GSS A;  4LLR A;  4ZBD A;  1YQ1 A;  4JBB A;  4POK A;  1OAZ A;  5ECP B;  4TXV A;  2ZNM A;  4BPY A;  5F06 A;  1O8X A;  2AUV A;  3FZ5 A;  4LA1 A;  4XHM A;  3ZTL A;  5J41 A;  4LMW A;  2DSA A;  3D22 A;  1QK8 A;  2QC7 A;  1JLV A;  1QFN A;  4GQC A;  4EXJ A;  3FR9 A;  2LJA A;  4EC0 A;  4I6X A;  3ZYW A;  1OC3 A;  5H5R A;  4GXZ A;  1H4O A;  1JLW A;  5AIV A;  1GTB A;  2H72 A;  4OO5 A;  3TKP A;  1U6T A;  3APS A;  1K0D A;  1TP9 A;  3DRN A;  3EE2 A;  3L4N A;  3A2V A;  3F0I A;  2AAW A;  4TKY A;  1A24 A;  5EVO A;  1GSY A;  1BED A;  5D9T A;  3GX8 A;  5EY6 A;  2B5E A;  1O85 A;  2WRT A;  1S3A A;  3HCZ A;  3VPT A;  1SL0 B;  3I6A A;  1EGR A;  1GH2 A;  5DJL A;  3O3T A;  1BAY A;  4GQF A;  2VL3 A;  1OE8 A;  2LUS A;  1JFU A;  3IK7 A;  1WMJ A;  2H1B A;  3BCK A;  4FYB A;  4KSM A;  3EC3 A;  2MMA A;  1MDJ A;  1R5A A;  3QR6 A;  3D4T A;  2HI7 A;  14GS A;  2K6V A;  1K3Y A;  3VWV A;  1DUG A;  3CRT A;  3IAS 2;  4KA0 A;  3VWW A;  1ZMA A;  1J08 A;  3J7Y k;  3RDW A;  4ECB A;  1X5D A;  5ECS A;  3TJG A;  1A2L A;  2X8H A;  2XBQ A;  2BJX A;  2R4V A;  3HY2 A;  1M99 A;  4QQ7 A;  1TKD B;  5CO3 A;  3S9F A;  3FZ9 A;  2L4Q A;  2FWG A;  3BCI A;  4L8E A;  4TOP A;  5DDL A;  5B6M A;  3D0Z A;  3EYT A;  2LQO A;  2CT6 A;  5L71 A;  2HFD A;  4QL7 A;  3ZFB A;  4MF5 A;  4MK3 A;  1WE0 A;  2M46 A;  2J9H A;  4GSS A;  4FYU A;  2WCI A;  1YF1 A;  1XVQ A;  2H71 A;  5ENU A;  4RI7 A;  1AQX A;  2C3N A;  4X43 A;  3HDC A;  1NM3 A;  1YZX A;  4NXI A;  2X99 A;  1SKR B;  4TRX A;  1ZZY A;  2MMN A;  4POM A;  3F3R A;  2YN1 A;  2LRN A;  3LXT A;  2CX4 A;  3IDV A;  1XWC A;  2HT9 A;  4JZQ A;  3C1S A;  2L59 A;  4K7O A;  4BWS A;  4EDY A;  3NZN A;  1Q98 A;  5IOW A;  3EMX A;  2JZS A;  2MMZ A;  3CSI A;  2OBK A;  1TK0 B;  1NSW A;  1OKT A;  1TRV A;  2WGR A;  3CRU A;  1XIY A;  3RHC A;  3M9J A;  4NHW A;  2VIM A;  3DKS A;  3TKS E;  4I2T A;  4F9Z A;  5IO2 A;  1ZCP A;  4V1A g;  1TU8 A;  2GT5 A;  3ZLP A;  4WF5 A;  1XWA A;  3F8U A;  1YDK A;  1Y25 A;  3GUR A;  3ED3 A;  1YJ6 A;  1K3O A;  1X9W B;  1GUK A;  2IIY A;  2LTK A;  3P7X A;  4MPG A;  3DD3 A;  1XWK A;  4BL7 A;  2GZY A;  3K8N A;  1YEP A;  5A4U A;  5HFI A;  3J7Y b;  3KTL A;  2G0F A;  4EO3 A;  2B1L A;  1MD3 A;  1M0U A;  1DE2 A;  1XOA A;  4XIH A;  1S3D A;  3GKK A;  2B3S A;  2LQQ A;  2GTU A;  1EOG A;  1SK2 A;  4IJ3 A;  4AF2 A;  4IN0 A;  1JHB A;  4MF6 A;  3GH9 A;  4WR4 A;  5KN0 A;  2H0I A;  1RK4 A;  2BMX A;  3QMX A;  2C1Y A;  3GUS A;  1CQG A;  4OWY A;  2KOK A;  4FYC A;  1AW9 A;  3DWV A;  1GWC A;  1EP8 A;  2VO4 A;  1F3B A;  3TKS A;  3F4T A;  3GHA A;  3QD9 A;  4HJ2 A;  5AN1 A;  3ZZX A;  1YKA A;  1OC8 A;  4MPF A;  4XS1 A;  1UC7 A;  3TCO A;  2A2R A;  3VLN A;  1AQV A;  4EKZ A;  3GST A;  2ZUP A;  1ZGN A;  3F6D A;  3FY7 A;  4JE1 A;  1OE7 A;  5JCG A;  4XS6 A;  3HVX A;  3IA1 A;  3HXS A;  2X8G A;  3Q6O A;  3L0H A;  3R2Q A;  11GS A;  1Z3E A;  5H5S A;  1M9A A;  3MSZ A;  3D4M A;  1ST9 A;  1GSQ A;  3D21 A;  2HLS A;  2P31 A;  3KH7 A;  4L0U A;  1PL1 A;  3H4K A;  1HNA A;  3WT2 A;  10GS A;  4G19 A;  2HZF A;  4O7H A;  4ZBB A;  1GLQ A;  3JCM L;  1TW9 A;  4YH2 A;  2VL2 A;  1GLP A;  1O73 A;  3ZMK A;  2V6O A;  2O8V B;  4HDE A;  2DIY A;  2YWN A;  4KND A;  2IFQ B;  1T00 A;  1F2E A;  4BVY A;  3H8Q A;  3ZVJ D;  2A4V A;  3IE3 A;  3ZML A;  3WD6 A;  4BWQ A;  1VF2 A;  1WRY A;  2DJ1 A;  3GTU B;  2H76 A;  1LJR A;  3Q19 A;  1DSB A;  3CTG A;  5CRE A;  5FHI A;  2L5O A;  5EPF A;  5J5N A;  3ERF A;  2GDR A;  2PVQ A;  3HD5 A;  3GRX A;  4ECJ A;  1WWJ A;  4ILF A;  5DAL B;  3DVW A;  2DJK A;  3HJO A;  3VPQ A;  1V40 A;  3ZL5 A;  4AGS A;  2IMD A;  3UVT A;  1RQM A;  2GSQ A;  1PL2 A;  1RW1 A;  2B1K A;  1TK8 B;  2VCX A;  3KMN A;  1GNE A;  1EP7 A;  2QKE A;  5J4U A;  2LRC A;  5JWQ B;  3G9B A;  2JZT A;  2PPT A;  5ID2 B;  1GSU A;  1M2B A;  1SJZ A;  8GSS A;  4KCE A;  3TOT A;  4F0B A;  4TR0 A;  5CRW A;  3P90 A;  2MYG A;  3KP8 A;  5D96 A;  2CVB A;  5CRD A;  1ERW A;  1V2A A;  2LJK A;  1HQO A;  5KN1 A;  2K8S A;  1VRS D;  3TOU A;  2IME A;  3UOM A;  3E9J B;  3LYK A;  2L4C A;  3APO A;  2JSZ A;  1ZL9 A;  5GST A;  2GZP A;  4RI6 A;  3MAK A;  4I5Q A;  1NHO A;  2CAI A;  3UMA A;  1EGO A;  2EIR A;  4IQA A;  4G2E A;  4HOJ A;  4NV5 A;  5ECR B;  2AYT A;  3UJ1 A;  5D93 A;  2RM6 A;  3VWU A;  1T1V A;  4IGJ A;  4EVM A;  2MBT A;  2NBS A;  2FA4 A;  2CA8 A;  5ECQ B;  2KLX A;  4N30 A;  1XW5 A;  1M2A A;  2H0G A;  1TRS A;  2GSR A;  4PX1 A;  5IMF A;  3FW2 A;  4ZB9 A;  1K0A A;  2NDO A;  3H93 A;  4NPB A;  3O76 A;  1KEB A;  1EEM A;  5G5E A;  4I8B A;  4OMV A;  1IYI A;  2FA8 A;  2O87 A;  3M0F A;  4GF0 A;  2WB9 A;  3FHK A;  3UEM A;  4K2D A;  3WYW A;  3L9U A;  1T4Y A;  3ZVJ A;  1SD8 A;  2F3M A;  4J56 E;  1YEX A;  3EWL A;  3KTB A;  5IO0 A;  2L5L A;  5DJM A;  3KH9 A;  2IFQ A;  3FRC A;  2F9S A;  2AV4 A;  4MZC A;  1Z6N A;  3GX0 A;  4HI7 A;  4PUA A;  2VCT A;  1F6M C;  3FKF A;  5AIX A;  3GIX A;  4TR1 B;  3GTU A;  6GSU A;  2PWJ A;  3WT1 A;  2GQK A;  1MDK A;  3TKQ A;  2IPA A;  1UVZ A;  1T3B A;  3KCM A;  4MJA A;  1AC1 A;  1SJI A;  2AHE A;  4PNF A;  2VUP A;  4K7N A;  2DMM A;  5IMC A;  1SKW B;  1T7P B;  5DAL A;  4RQX A;  4MA9 A;  3A3T A;  1Z9H A;  1SEN A;  3G7I A;  3KXO A;  3KMO A;  4TN8 A;  3VI7 A;  4KH7 A;  2IL3 A;  1ML6 A;  4KGI A;  2VD1 A;  1NW2 A;  1JZW A;  3TJJ A;  3UIW A;  1FAA A;  2H6X A;  2WDU A;  4WEY A;  2MBS A;  1B4P A;  4DVC A;  2M72 A;  1PD2 1;  1ZYE A;  3KM6 A;  2YOI A;  4G9H A;  3UBK A;  1B4Q A;  2ON5 A;  2OE1 A;  1JZR A;  3ZIV A;  5F0G A;  4PXO A;  2X64 A;  3CBU A;  2H66 A;  5ID2 A;  1V57 A;  2FWH A;  1XW9 A;  3DXB A;  1O6J A;  2B7K A;  2P0G A;  5CRG A;  4HEA 2;  2GT6 A;  1HNB A;  1QQ2 A;  4HQZ A;  2HSY A;  2JAD A;  2KUC A;  1EOH A;  2Z9S A;  4DSR A;  4HZ2 A;  2MMO A;  3N9J A;  4L0W A;  4K7I A;  3VUR A;  4PQI A;  4N0V A;  2YV7 A;  5G1L A;  1XZO A;  5B8B A;  5COH A;  4JR4 A;  1OYJ A;  1ON4 A;  5EL8 A;  4ZL8 A;  4PQH A;  2C80 A;  3ISO A;  6GSX A;  2VLV A;  4ACS A;  3RHB A;  2X8C A;  3ZFL A;  3O6T A;  2H70 A;  1G0T A;  4O92 A;  3FK8 A;  3EVI A;  5DVB A;  1R7H A;  3TB2 A;  4OD7 A;  1ABA A;  4HU9 A;  5A4V A;  3FZ4 A;  1SL2 B;  2FLS A;  1WP0 A;  4CDO A;  3D5J A;  5G2Z A;  3GYK A;  4TXO B;  4WBR D;  4K0N A;  5D9X A;  1AAZ A;  1TI3 A;  2PER A;  3I9V 2;  3W8S A;  5GAN D;  1G7O A;  2C0G A;  2WZ9 A;  3DML A;  2YPM A;  5G31 A;  5INY A;  3MNG A;  3W6G A;  5CNW A;  3P8W A;  5HR3 A;  1F3A A;  4MMM A;  5G1K A;  1AUC A;  4K1F A;  1S3C A;  4I97 A;  4HS1 A;  2MZC A;  4KAE A;  3GN3 A;  1MD4 A;  2E7P A;  4TR1 A;  5JWO B;  1PX6 A;  6GSW A;  3CYN A;  5IQY A;  2CVD A;  5D9V A;  2K9F A;  3ERG A;  4TW5 A;  2YAN A;  4CHS A;  1GRX A;  3IHQ A;  4DSS B;  3KEB A;  5KN2 A;  3GH6 A;  3F9U A;  4K9Z A;  2DJ0 A;  3F63 A;  1U87 A;  1JZD A;  1K3L A;  4ZIJ A;  4IBP A;  2L57 A;  5LD0 A;  1V9W A;  1QUW A;  2F8A A;  3C1R A;  3LOR A;  5JWR B;  2BTO T;  1N8J A;  2R3X A;  4ECI A;  1A2M A;  2HYX A;  1EWX A;  4O32 A;  4J57 E;  4KUN A;  4FIW A;  4HU7 A;  1E2Y A;  5A5K A;  4POB A;  5CYY A;  4D73 B;  4EE0 A;  3DVX A;  4MCU A;  1FB0 A;  1CQH A;  5B6N A;  7GSS A;  3CSH A;  2GS3 A;  4ID0 A;  2GSS A;  3GKM A;  3P2A A;  1GSS A;  3BOA A;  4IW9 A;  3IRA A;  1Q4J A;  2CV4 A;  3DEX A;  3U5R E;  4ML6 A;  4V2L A;  4V2N A;  4IQ1 A;  3A2W A;  5B7C A;  1K0O A;  4GRF A;  4IVF A;  2GQM A;  2OA7 A;  1J0F A;  22GS A;  1WPI A;  3WGD A;  1Z7R A;  1SU9 A;  3DYR A;  1OKD A;  5DBQ A;  3LFL A;  3VWX A;  2WUL A;  2EC4 A;  1R4W A;  4Q5F A;  4MH2 A;  3IR4 A;  3E3E A;  4EF0 A;  4QL9 A;  1A23 A;  2O89 A;  3CTF A;  1O8W A;  1SYX A;  1PMT A;  4K6X A;  3HVV A;  2PGT A;  2DLX A;  1GTI A;  3L9V A;  4TXO A;  1XOB A;  2B5X A;  2XBI A;  4GSN A;  1OC9 B;  5FWG A;  2ON7 A;  5HR2 A;  2LKU A;  3EMP A;  2FCH A;  2XC2 A;  2R37 A;  2TRC P;  3GL5 A;  1ZYQ B;  3HA9 A;  1G6W A;  3C73 A;  1I5G A;  5ECH B;  2N5A A;  2KP2 A;  1VGL A;  5IMD A;  1ERV A;  1ILO A;  4MDC A;  5DAK B;  5DCG A;  5ECK B;  2ES7 A;  5D8I A;  2O7K A;  3QAW A;  4AJ8 A;  4NAX A;  4MAB A;  1XPV A;  2RLI A;  5IM9 A;  4PUF C;  1KTE A;  2N5F A;  4JED A;  2C4J A;  2TRX A;  1AXD A;  3GV1 A;  1BX9 A;  2ALB A;  1VF1 A;  3E0U A;  1TI1 A;  1QGV A;  4HJM A;  1FHE A;  6GST A;  3QFA C;  4NV2 A;  3ZRD A;  1Y6E A;  3KIJ A;  4NHZ A;  1TRW A;  3TRP A;  1XWG A;  2RUE A;  4IS0 A;  2AJQ B;  2V41 A;  4ZB6 A;  4DSQ A;  2PMT A;  3QPM A;  5B8A A;  2VD0 A;  4X0X A;  1YF0 A;  3TRQ A;  1PX7 A;  4OFM A;  4D73 A;  3NOF A;  4CW9 A;  1X9S B;  4EUY A;  2KHP A;  2YJ7 A;  1V98 A;  2OKA A;  2PUK C;  1X9M B;  1PQN A;  3L78 A;  4O5R A;  1GSF A;  4ZXG A;  2P5Q A;  3TRX A;  3GSS A;  4MJC A;  3GFK A;  1FVK A;  5IOX A;  4DEJ A;  2VCZ A;  4ZIL A;  4TVE A;  3LXZ A;  2QSI A;  3FR3 A;  5IMZ A;  5IPG A;  2OE3 A;  1H75 A;  5E59 A;  2H75 A;  2YNX A;  2YWO A;  4WF4 A;  1WOU A;  2QGV A;  2HSH A;  1IYH A;  3KJY A;  4I2U A;  3L9S A;  3A5W A;  3F4S A;  5CP1 A;  1PGT A;  2NVL A;  3U6V A;  5IMA A;  1AIU A;  4F0C A;  4HZ4 A;  3W8J A;  1EV4 A;  3RAZ A;  1XW6 A;  2CZ2 A;  3I69 A;  5DQY A;  4KW6 A;  1HNC A;  4WR5 A;  4XRA A;  2JAC A;  3G7Y A;  1UN2 A;  1FB6 A;  1TJD A;  1OC9 A;  2AB6 A;  4IP1 A;  2FNO A;  1XFL A; 
#chains in the Genus database with same CATH topology
 4GWR A;  4MLY A;  4YQU A;  4L5L A;  1DE1 A;  1EZK A;  4MNN A;  2R6K A;  3RPP A;  3F4R A;  3FYG A;  4IEL A;  5DAK A;  1GSD A;  5HR1 A;  3A5I A;  4GLT A;  1A0R P;  3H79 A;  1U3A A;  2OBI A;  3GA4 A;  2DIZ A;  1B9X C;  5GAP D;  3HYP A;  1O7U A;  20GS A;  19GS A;  3QAV A;  2FGX A;  2PU9 C;  5IPH A;  1GTU A;  1UA5 A;  4K5S A;  5C04 A;  2REM A;  4CY8 A;  3LEF A;  2DJJ A;  2HZE B;  2QA2 A;  3N5O A;  2E2M A;  3HHV A;  2F8F A;  4ML1 A;  2C3Q A;  3OR5 A;  3AY8 A;  1M2D A;  4ULX A;  4OCE A;  1TTZ A;  1GP1 A;  2HXK A;  5JCU A;  2H6Y A;  4F82 A;  2H73 A;  1GTA A;  5LCZ A;  1B9Y C;  2IMF A;  4XRD A;  1SL1 B;  2VM2 A;  1K0M A;  1PSQ A;  3VK9 A;  4USS A;  1PKZ A;  2XPE A;  3CXG A;  2P5R A;  1MEK A;  4V2M A;  5ABR A;  4GCI A;  1M9B A;  4WBJ A;  4KSO A;  4KDY A;  3KZQ A;  2EIO A;  5ECO B;  3PH9 A;  5D73 A;  5ELG A;  1Z5Y E;  4TR3 A;  5IIZ A;  3KP9 A;  3ERW A;  5GZZ B;  1A8L A;  2R5G A;  2VCV A;  5F05 A;  2IMI A;  4XCS A;  2IN3 A;  2FHE A;  1YKC A;  5DQS A;  1JZO A;  1GUH A;  2JZR A;  1GUL A;  2VOC A;  4IP6 A;  1EEJ A;  4BVX A;  1B48 A;  2HRF A;  3CMI A;  3TKR A;  3ZIT A;  4JRR A;  2FY6 A;  3MWH A;  4NMU A;  1TOF A;  4X1U A;  4Q5N A;  2JSY A;  4KDU A;  3EU3 A;  2FWE A;  3GNJ A;  3UBL A;  1SD9 A;  5ELA A;  2YZH A;  2HE3 A;  4MJB A;  2LS5 A;  3IV4 A;  2WS2 A;  3TDG A;  4GST A;  3I43 A;  3KD0 A;  1GUM A;  4E8H A;  2V1M A;  1BYE A;  2WFC A;  3HJP A;  3HKR A;  3TJF A;  1ZOF A;  1EV9 A;  2UZ8 A;  3TJK A;  3F6F A;  4N11 A;  5ECI B;  1TK5 B;  1F37 A;  2XHF A;  3IC4 A;  3Q18 A;  2H6Z A;  5ECN B;  2YCD A;  4X4J A;  3M1G A;  2H01 A;  1HD2 A;  2OAD A;  18GS A;  1ACV A;  1MDI A;  4LL4 B;  4YAP A;  1G6Y A;  1SK0 A;  5HR0 A;  4EIP A;  2CAQ A;  1J9B A;  4FQU A;  1K0N A;  2C3T A;  1SYR A;  3VFI A;  5JCW A;  2CVK A;  3EIN A;  3PR8 A;  1X5C A;  2A2S A;  2IMK A;  1O81 A;  2LEG A;  1YY7 A;  1E6B A;  4RQR A;  3QAG A;  1Z6M A;  4JU5 A;  4MF7 A;  2HZE A;  3GKX A;  2OAC A;  3LGC A;  2DC5 A;  2H74 A;  16GS A;  4JR6 A;  4KE3 A;  5J9C A;  4ZBA A;  4ZB8 A;  2DJ2 A;  3M8N A;  2EIQ A;  1XWB A;  3TGZ A;  1SK1 A;  3G7J A;  4WKW A;  3LWA A;  2V2G A;  3VI5 A;  4OFT A;  2H0H A;  3FZA A;  2G2Q A;  2GLR A;  2I9H A;  2VM1 A;  5H5Q A;  1SKS B;  1VF3 A;  2ZCT A;  1B8X A;  1FW1 A;  5C00 A;  3QOU A;  1FVJ A;  3BBY A;  2KP1 A;  1WIK A;  2NTO A;  1ZYN A;  2H1D A;  3IHG A;  1XCC A;  1NHY A;  3BD2 A;  3NIV A;  5CRH A;  4Q5R A;  4ZL7 A;  6GSS A;  4MP4 A;  2PN8 A;  5A4W A;  2D2Z A;  3QDN A;  5AIS A;  4Z2U A;  4PQ1 A;  3C7M A;  3UL3 A;  3ZRE A;  1XG8 A;  1OVN A;  4EDZ A;  2K8V A;  1BQ7 A;  5D9W A;  3IPZ A;  4YQM A;  4IJI A;  4BA7 A;  4P3Y B;  1R5P A;  1X5E A;  2DBC A;  2C0F A;  2H8L A;  5F07 A;  4FH8 A;  4KB3 A;  2IJY A;  4KCA A;  17GS A;  1M7T A;  2VCW A;  5KN3 A;  2GST A;  2FUG 2;  3UAR A;  4LMV A;  1PN0 A;  4MJE A;  5HQP A;  3IC8 A;  5FT3 A;  3RBT A;  4K0G A;  2IWT A;  2I81 A;  3QFB C;  6GSV A;  4YAV A;  2LNT A;  2NPB A;  4ZL9 A;  4L5O A;  1PFO A;  1LU4 A;  1C72 A;  2JU5 A;  1F9M A;  2OJL A;  3IAM 2;  4K8M A;  4PNG A;  2GVP A;  4WET A;  6GSY A;  3MDK A;  4MZW A;  4OO4 A;  3CQF A;  2QA1 A;  3PGT A;  4TR4 A;  2PVO C;  3RPN A;  1K0C A;  1N2A A;  3HJM A;  4G10 A;  3UAP A;  5LNK e;  3LW9 A;  2F51 A;  4HQS A;  2LV3 A;  2YZU A;  2VL9 A;  1TU7 A;  3LJR A;  1A8Y A;  2R0C A;  1X0R A;  3DIE A;  4IKH A;  5J9B A;  12GS A;  4XS4 B;  3KGK A;  1FOV A;  3ME7 A;  5ECL B;  4HUA A;  1AQW A;  5KOX A;  4DSS A;  1TRU A;  2H19 A;  4IHU A;  4MZB A;  1WJK A;  2RII A;  2RUF A;  1A0F A;  2C8U A;  1PN9 A;  4AJ6 A;  2LNS A;  3BJ5 A;  2YV9 A;  1VF4 A;  3WGE A;  4KX4 A;  2H1A A;  3D6I A;  3GMF A;  3Q74 A;  5HFG A;  2O85 A;  2V32 A;  4Z7X A;  3LYP A;  2YWI A;  2H30 A;  3H1N A;  1QMV A;  3EUR A;  4ICY A;  3IOS A;  2VLU A;  4N10 A;  2WJU A;  1U3I A;  2HNL A;  1G7E A;  4F2I A;  2XPD A;  3LG6 A;  3ME8 A;  1GL8 A;  4ISD A;  3FEU A;  4KDX A;  2I3Y A;  4Q5Q A;  2H1G A;  3GKN A;  1GNW A;  4GTU A;  1USB A;  3SWL A;  1T4Z A;  2PBJ A;  3A2X A;  3DGQ A;  2I1U A;  9GSS A;  4PUR A;  2C0D A;  3TKS C;  1T8E B;  2HRN A;  1A2J A;  1Z7P A;  3PIN A;  5DCH A;  1FG4 A;  5E4W A;  2CZ3 A;  2LJR A;  5IMV A;  3GL3 A;  4V1A p;  4WXT A;  3IK9 A;  2TIR A;  2B5Y A;  2E0Q A;  3C71 A;  3WGX A;  1KNG A;  3IBH A;  1THO A;  5G5F A;  1ERT A;  2FWF A;  1XBS A;  3HZ8 A;  3ZIJ A;  4F03 A;  1PRX A;  1R26 A;  4RUV A;  2DML A;  2DJ3 A;  3EU4 A;  4POL A;  2R2J A;  3F3Q A;  3TJB A;  4XTS A;  2JL4 A;  2C0E A;  3FR6 A;  4ECC A;  4LL1 B;  1LBK A;  2YP6 A;  3CSJ A;  3LSZ A;  2B6M A;  2OE0 A;  1XVW A;  1W89 A;  2VL2 C;  2CX3 A;  1QXH A;  3US3 A;  1SJ6 A;  1HYU A;  4PGT A;  3V1W A;  2E2G A;  3IXR A;  4E8E A;  2LRT A;  4OCF A;  1ZYP A;  3LQ7 A;  3QCP A;  4MH3 A;  1ERU A;  1U88 A;  1FO5 A;  2FD3 A;  5ECM B;  2VLT A;  2L6C A;  4YQV A;  2N5B A;  1DBY A;  1K0B A;  3C8E A;  2L6D A;  3EPT A;  1URM A;  3HVS A;  1W4V A;  1XXU A;  4XS4 A;  2K18 A;  5CAX A;  3APQ A;  3TUE A;  1V58 A;  2V6K A;  1BJX A;  2I4A A;  4NWY A;  3M3M A;  4OFN A;  2CQ9 A;  1BG5 A;  2A2P A;  1I9D A;  1PA3 A;  3UVH A;  1GSE A;  4EL1 A;  2B7J A;  4AJ7 A;  4J2F A;  5KEJ A;  2RM5 A;  1TXX A;  4H86 A;  2HRA A;  2YJH A;  5F8B A;  1THX A;  2GQL A;  5HFK A;  4FO5 A;  3SBC A;  5J3R A;  2VAF A;  4N0Z A;  1MTC A;  2LST A;  3M9K A;  2GZZ A;  2M80 A;  2YWM A;  1TDI A;  3HZ4 A;  5AGY A;  2VCQ A;  2J23 A;  2GGT A;  5G30 A;  1PKW A;  13GS A;  1KBN A;  5GSS A;  4LLR A;  4ZBD A;  1YQ1 A;  4JBB A;  4POK A;  1OAZ A;  5ECP B;  4TXV A;  2ZNM A;  4BPY A;  5F06 A;  1O8X A;  2AUV A;  2DKI A;  3FZ5 A;  4LA1 A;  4XHM A;  3ZTL A;  5J41 A;  4LMW A;  2DSA A;  3D22 A;  1QK8 A;  2QC7 A;  1JLV A;  1QFN A;  4GQC A;  4EXJ A;  3FR9 A;  2LJA A;  4EC0 A;  4I6X A;  3ZYW A;  1OC3 A;  5H5R A;  4GXZ A;  1H4O A;  1JLW A;  5AIV A;  1GTB A;  2H72 A;  4OO5 A;  3TKP A;  1U6T A;  3APS A;  1K0D A;  1TP9 A;  3DRN A;  3EE2 A;  3L4N A;  3A2V A;  4K5R A;  3F0I A;  2AAW A;  4TKY A;  1A24 A;  5EVO A;  1GSY A;  1BED A;  5D9T A;  3GX8 A;  5EY6 A;  2B5E A;  1O85 A;  2WRT A;  1S3A A;  3HCZ A;  4BL7 B;  3VPT A;  1SL0 B;  3I6A A;  1EGR A;  1GH2 A;  5DJL A;  3O3T A;  1BAY A;  4GQF A;  2VL3 A;  1OE8 A;  2LUS A;  1JFU A;  3IK7 A;  1WMJ A;  2H1B A;  3BCK A;  4FYB A;  4KSM A;  3EC3 A;  2MMA A;  1MDJ A;  4HSC X;  1R5A A;  3QR6 A;  3D4T A;  2HI7 A;  14GS A;  4O5U A;  2K6V A;  1K3Y A;  3VWV A;  1DUG A;  3CRT A;  3IAS 2;  4KA0 A;  3VWW A;  1ZMA A;  1J08 A;  3J7Y k;  3RDW A;  4ECB A;  1X5D A;  5ECS A;  3TJG A;  1A2L A;  2X8H A;  2XBQ A;  2BJX A;  2R4V A;  3HY2 A;  1M99 A;  4QQ7 A;  1TKD B;  5CO3 A;  3S9F A;  3FZ9 A;  2L4Q A;  2FWG A;  3BCI A;  4L8E A;  4TOP A;  5DDL A;  5B6M A;  3D0Z A;  3EYT A;  2LQO A;  2CT6 A;  5L71 A;  2HFD A;  4QL7 A;  3ZFB A;  4MF5 A;  4MK3 A;  1WE0 A;  2M46 A;  2J9H A;  2R0P A;  4GSS A;  4FYU A;  2WCI A;  1YF1 A;  1XVQ A;  2H71 A;  5ENU A;  4RI7 A;  1AQX A;  2C3N A;  4X43 A;  3HDC A;  1NM3 A;  1YZX A;  4NXI A;  2X99 A;  1SKR B;  1FOH A;  4TRX A;  1ZZY A;  2MMN A;  4POM A;  3F3R A;  2YN1 A;  2LRN A;  3LXT A;  2CX4 A;  3IDV A;  1XWC A;  2HT9 A;  4JZQ A;  3C1S A;  2L59 A;  4K7O A;  4BWS A;  4EDY A;  4BVY B;  3NZN A;  1Q98 A;  5IOW A;  3EMX A;  2JZS A;  2MMZ A;  3CSI A;  2OBK A;  1TK0 B;  1NSW A;  1OKT A;  1TRV A;  2WGR A;  3CRU A;  1XIY A;  3RHC A;  3M9J A;  4NHW A;  2VIM A;  3DKS A;  3TKS E;  4I2T A;  4F9Z A;  5IO2 A;  1ZCP A;  4V1A g;  1TU8 A;  2GT5 A;  3ZLP A;  4WF5 A;  1XWA A;  3F8U A;  1YDK A;  1Y25 A;  3GUR A;  3ED3 A;  1YJ6 A;  1K3O A;  1X9W B;  1GUK A;  2IIY A;  2LTK A;  3P7X A;  4MPG A;  3DD3 A;  1XWK A;  4BL7 A;  2GZY A;  3K8N A;  4Z2R A;  1YEP A;  5A4U A;  5HFI A;  3J7Y b;  3KTL A;  2G0F A;  4EO3 A;  2B1L A;  1MD3 A;  1M0U A;  1DE2 A;  1XOA A;  4XIH A;  1S3D A;  3GKK A;  2B3S A;  2LQQ A;  2GTU A;  1EOG A;  1SK2 A;  4IJ3 A;  4AF2 A;  4IN0 A;  2X4A A;  1JHB A;  4MF6 A;  3GH9 A;  4WR4 A;  5KN0 A;  2H0I A;  1RK4 A;  2BMX A;  3QMX A;  2C1Y A;  3GUS A;  1CQG A;  4OWY A;  2KOK A;  4FYC A;  3MYD A;  1AW9 A;  3DWV A;  1GWC A;  4Z2T A;  1EP8 A;  2VO4 A;  1F3B A;  3TKS A;  3F4T A;  4CY6 A;  3GHA A;  3QD9 A;  4HJ2 A;  5AN1 A;  3ZZX A;  1YKA A;  1OC8 A;  4MPF A;  4XS1 A;  1UC7 A;  3TCO A;  2A2R A;  3FMW A;  3VLN A;  1AQV A;  4EKZ A;  3GST A;  2ZUP A;  1ZGN A;  3F6D A;  3FY7 A;  4JE1 A;  1OE7 A;  5JCG A;  4XS6 A;  3HVX A;  3IA1 A;  3HXS A;  2X8G A;  3Q6O A;  3L0H A;  3R2Q A;  11GS A;  1Z3E A;  5H5S A;  1M9A A;  3MSZ A;  3D4M A;  1ST9 A;  1GSQ A;  3D21 A;  2HLS A;  2P31 A;  3KH7 A;  4L0U A;  1PL1 A;  3H4K A;  1HNA A;  3MIX A;  3WT2 A;  10GS A;  4G19 A;  2HZF A;  4O7H A;  4ZBB A;  1GLQ A;  3JCM L;  1TW9 A;  4YH2 A;  2VL2 A;  1GLP A;  1O73 A;  3ZMK A;  2V6O A;  2O8V B;  4YKG A;  4HDE A;  2DIY A;  2YWN A;  4KND A;  2IFQ B;  1T00 A;  1F2E A;  4BVY A;  3H8Q A;  3ZVJ D;  2A4V A;  3IE3 A;  3ZML A;  3WD6 A;  4BWQ A;  1VF2 A;  1WRY A;  2DJ1 A;  3GTU B;  2H76 A;  1LJR A;  3Q19 A;  1DSB A;  3CTG A;  5CRE A;  5FHI A;  2L5O A;  5EPF A;  5J5N A;  3ERF A;  2GDR A;  2PVQ A;  3HD5 A;  3GRX A;  4ECJ A;  1WWJ A;  4ILF A;  5DAL B;  3DVW A;  2DJK A;  3HJO A;  3VPQ A;  1V40 A;  3ZL5 A;  4AGS A;  2IMD A;  3UVT A;  1RQM A;  2GSQ A;  1PL2 A;  1RW1 A;  2B1K A;  1TK8 B;  2VCX A;  4YKF A;  3KMN A;  1GNE A;  1EP7 A;  2QKE A;  5J4U A;  2LRC A;  5JWQ B;  2X49 A;  3G9B A;  2JZT A;  2PPT A;  3PPU A;  5ID2 B;  1GSU A;  4BIK A;  1M2B A;  1SJZ A;  8GSS A;  4KCE A;  3TOT A;  4F0B A;  4TR0 A;  4PTS A;  5CRW A;  3P90 A;  2MYG A;  3KP8 A;  5D96 A;  2CVB A;  5CRD A;  1ERW A;  1V2A A;  2LJK A;  1HQO A;  5KN1 A;  2K8S A;  1VRS D;  3TOU A;  2IME A;  3UOM A;  3E9J B;  3LYK A;  2L4C A;  3APO A;  2JSZ A;  1ZL9 A;  5GST A;  2GZP A;  4RI6 A;  3MAK A;  4I5Q A;  2A4H A;  4K2X A;  1NHO A;  2CAI A;  3UMA A;  1EGO A;  2EIR A;  4IQA A;  4G2E A;  4HOJ A;  4NV5 A;  5ECR B;  2AYT A;  3UJ1 A;  4KF9 A;  2RM6 A;  5D93 A;  3VWU A;  1T1V A;  4IGJ A;  4EVM A;  2MBT A;  2NBS A;  2FA4 A;  2CA8 A;  5ECQ B;  2KLX A;  4N30 A;  1XW5 A;  1M2A A;  2H0G A;  1TRS A;  2GSR A;  4PX1 A;  5IMF A;  3FW2 A;  4ZB9 A;  1K0A A;  2NDO A;  3H93 A;  4NPB A;  3O76 A;  1KEB A;  1EEM A;  5G5E A;  4I8B A;  4OMV A;  1IYI A;  3M0F A;  2FA8 A;  2O87 A;  4GF0 A;  2WB9 A;  3FHK A;  3UEM A;  4K2D A;  3WYW A;  3L9U A;  1T4Y A;  3ZVJ A;  1SD8 A;  4G0I A;  4G0L A;  2F3M A;  4J56 E;  1YEX A;  3EWL A;  3KTB A;  5IO0 A;  2L5L A;  5DJM A;  3KH9 A;  2IFQ A;  3FRC A;  2F9S A;  2AV4 A;  4MZC A;  1Z6N A;  1M3J A;  3GX0 A;  4HI7 A;  4PUA A;  2VCT A;  1F6M C;  3FKF A;  5AIX A;  3GIX A;  4TR1 B;  3GTU A;  6GSU A;  2PWJ A;  3WT1 A;  2GQK A;  1MDK A;  3TKQ A;  2IPA A;  1UVZ A;  1T3B A;  3KCM A;  4MJA A;  1AC1 A;  1SJI A;  2AHE A;  4PNF A;  2VUP A;  4K7N A;  2DMM A;  5IMC A;  1SKW B;  1T7P B;  5DAL A;  4RQX A;  4MA9 A;  3A3T A;  1Z9H A;  1SEN A;  3G7I A;  3KXO A;  3KMO A;  4TN8 A;  3VI7 A;  4KH7 A;  2IL3 A;  1ML6 A;  4G0K A;  3R3E A;  4KGI A;  2VD1 A;  1NW2 A;  1JZW A;  3TJJ A;  3UIW A;  1FAA A;  2H6X A;  2WDU A;  4WEY A;  2MBS A;  1B4P A;  4DVC A;  2M72 A;  1PD2 1;  1ZYE A;  3KM6 A;  2YOI A;  4G9H A;  3UBK A;  1B4Q A;  2ON5 A;  2OE1 A;  1JZR A;  3ZIV A;  5F0G A;  4PXO A;  2X64 A;  3CBU A;  2H66 A;  5ID2 A;  1V57 A;  2FWH A;  1XW9 A;  3DXB A;  1O6J A;  2B7K A;  2P0G A;  5CRG A;  4HEA 2;  2GT6 A;  1HNB A;  1QQ2 A;  4HQZ A;  2HSY A;  2JAD A;  2KUC A;  1EOH A;  2Z9S A;  4DSR A;  4HZ2 A;  2MMO A;  3N9J A;  4L0W A;  4K7I A;  2R0G A;  3VUR A;  4PQI A;  4N0V A;  2YV7 A;  5G1L A;  1XZO A;  5B8B A;  5COH A;  4JR4 A;  1OYJ A;  1ON4 A;  5EL8 A;  4ZL8 A;  4PQH A;  2C80 A;  3ISO A;  6GSX A;  2VLV A;  4ACS A;  3RHB A;  2X8C A;  3ZFL A;  3O6T A;  2H70 A;  1G0T A;  4O92 A;  3FK8 A;  3EVI A;  5DVB A;  5BRT A;  1R7H A;  3TB2 A;  4OD7 A;  1ABA A;  3HVN A;  4HU9 A;  5A4V A;  3FZ4 A;  1SL2 B;  2HRK A;  2FLS A;  1WP0 A;  4CDO A;  3D5J A;  5G2Z A;  3GYK A;  4TXO B;  4WBR D;  4K0N A;  5D9X A;  1AAZ A;  1TI3 A;  2PER A;  3I9V 2;  3W8S A;  5GAN D;  1G7O A;  2C0G A;  2WZ9 A;  3DML A;  2YPM A;  5G31 A;  5INY A;  3MNG A;  3W6G A;  5CNW A;  3P8W A;  5HR3 A;  1F3A A;  4MMM A;  5G1K A;  1AUC A;  4K1F A;  1S3C A;  4I97 A;  4HS1 A;  2MZC A;  4KAE A;  3GN3 A;  1MD4 A;  2E7P A;  4TR1 A;  5JWO B;  1PX6 A;  6GSW A;  3CYN A;  5IQY A;  2CVD A;  5D9V A;  2K9F A;  3ERG A;  4TW5 A;  2YAN A;  4CHS A;  1GRX A;  3IHQ A;  4DSS B;  3KEB A;  5KN2 A;  3GH6 A;  3F9U A;  4K9Z A;  2DJ0 A;  3F63 A;  1U87 A;  1JZD A;  1K3L A;  4ZIJ A;  4IBP A;  2L57 A;  5LD0 A;  1V9W A;  1QUW A;  2F8A A;  3C1R A;  3LOR A;  5KOW A;  2DKH A;  5JWR B;  2BTO T;  1N8J A;  2R3X A;  4ECI A;  1A2M A;  2HYX A;  1EWX A;  4O32 A;  4J57 E;  4KUN A;  4EIQ A;  4FIW A;  4HU7 A;  1E2Y A;  5A5K A;  4O5Q A;  4POB A;  5CYY A;  4D73 B;  4EE0 A;  3DVX A;  4MCU A;  1FB0 A;  1CQH A;  5B6N A;  7GSS A;  3CSH A;  2GS3 A;  4ID0 A;  4A5P A;  2GSS A;  3GKM A;  3P2A A;  1GSS A;  3BOA A;  4IW9 A;  3IRA A;  1Q4J A;  2CV4 A;  3DEX A;  3U5R E;  4ML6 A;  4V2L A;  4V2N A;  4IQ1 A;  3A2W A;  5B7C A;  1K0O A;  4GRF A;  4IVF A;  2GQM A;  2OA7 A;  1J0F A;  22GS A;  1WPI A;  3WGD A;  1Z7R A;  1SU9 A;  3DYR A;  1OKD A;  5DBQ A;  3LFL A;  3VWX A;  2WUL A;  2EC4 A;  1R4W A;  4Q5F A;  4MH2 A;  3IR4 A;  3E3E A;  4EF0 A;  4QL9 A;  1A23 A;  2O89 A;  3CTF A;  1O8W A;  1SYX A;  1PMT A;  4K6X A;  3HVV A;  2PGT A;  2DLX A;  1GTI A;  3L9V A;  4TXO A;  1XOB A;  2B5X A;  2XBI A;  4GSN A;  1OC9 B;  5FWG A;  2ON7 A;  5HR2 A;  2LKU A;  3EMP A;  2FCH A;  2XC2 A;  2R37 A;  2TRC P;  3GL5 A;  1ZYQ B;  3HA9 A;  1G6W A;  3C73 A;  1I5G A;  5ECH B;  2N5A A;  2KP2 A;  1VGL A;  5IMD A;  1ERV A;  1ILO A;  4MDC A;  5DAK B;  5DCG A;  5ECK B;  2ES7 A;  5D8I A;  2O7K A;  3QAW A;  4AJ8 A;  4NAX A;  4MAB A;  1XPV A;  2RLI A;  5IM9 A;  4PUF C;  1KTE A;  2N5F A;  4JED A;  2C4J A;  2TRX A;  1AXD A;  3GV1 A;  1BX9 A;  2ALB A;  1VF1 A;  3E0U A;  1TI1 A;  1QGV A;  4HJM A;  1FHE A;  6GST A;  3QFA C;  4NV2 A;  3ZRD A;  1Y6E A;  3KIJ A;  4NHZ A;  1TRW A;  3TRP A;  1XWG A;  2RUE A;  4IS0 A;  2AJQ B;  2V41 A;  4ZB6 A;  4DSQ A;  2PMT A;  1S3R A;  3QPM A;  5B8A A;  2VD0 A;  4X0X A;  1YF0 A;  3TRQ A;  1PX7 A;  4OFM A;  4D73 A;  3NOF A;  4CW9 A;  1X9S B;  4EUY A;  2KHP A;  2YJ7 A;  1V98 A;  5BMU A;  2OKA A;  2PUK C;  1X9M B;  1PQN A;  3L78 A;  4O5R A;  1GSF A;  4ZXG A;  2P5Q A;  3TRX A;  3GSS A;  4MJC A;  3GFK A;  1FVK A;  5IOX A;  4DEJ A;  2VCZ A;  4ZIL A;  4TVE A;  3LXZ A;  2QSI A;  2HSM A;  3FR3 A;  5IMZ A;  5IPG A;  2OE3 A;  1H75 A;  5E59 A;  2H75 A;  2YNX A;  2YWO A;  4WF4 A;  1WOU A;  2QGV A;  2HSH A;  1IYH A;  3KJY A;  4I2U A;  3L9S A;  4BVX B;  3A5W A;  3F4S A;  5CP1 A;  1PGT A;  2NVL A;  3U6V A;  5IMA A;  1AIU A;  4F0C A;  4HZ4 A;  1M3I A;  3W8J A;  1EV4 A;  3RAZ A;  1XW6 A;  2CZ2 A;  3I69 A;  5DQY A;  4KW6 A;  1HNC A;  4WR5 A;  4XRA A;  2JAC A;  3G7Y A;  1UN2 A;  1FB6 A;  1TJD A;  1OC9 A;  2AB6 A;  4IP1 A;  2FNO A;  1XFL A; 
#chains in the Genus database with same CATH homology
 4GWR A;  4MLY A;  4YQU A;  4L5L A;  1DE1 A;  1EZK A;  4MNN A;  2R6K A;  3RPP A;  3F4R A;  3FYG A;  4IEL A;  5DAK A;  1GSD A;  5HR1 A;  3A5I A;  4GLT A;  1A0R P;  3H79 A;  1U3A A;  2OBI A;  3GA4 A;  2DIZ A;  1B9X C;  5GAP D;  3HYP A;  1O7U A;  20GS A;  19GS A;  3QAV A;  2FGX A;  2PU9 C;  5IPH A;  1GTU A;  1UA5 A;  4K5S A;  5C04 A;  2REM A;  4CY8 A;  3LEF A;  2DJJ A;  2HZE B;  2QA2 A;  3N5O A;  2E2M A;  3HHV A;  2F8F A;  4ML1 A;  2C3Q A;  3OR5 A;  3AY8 A;  1M2D A;  4ULX A;  4OCE A;  1TTZ A;  1GP1 A;  2HXK A;  5JCU A;  2H6Y A;  4F82 A;  2H73 A;  1GTA A;  5LCZ A;  1B9Y C;  2IMF A;  4XRD A;  1SL1 B;  2VM2 A;  1K0M A;  1PSQ A;  3VK9 A;  4USS A;  1PKZ A;  2XPE A;  3CXG A;  2P5R A;  1MEK A;  4V2M A;  5ABR A;  4GCI A;  1M9B A;  4WBJ A;  4KSO A;  4KDY A;  3KZQ A;  2EIO A;  5ECO B;  3PH9 A;  5D73 A;  5ELG A;  1Z5Y E;  4TR3 A;  5IIZ A;  3KP9 A;  3ERW A;  5GZZ B;  1A8L A;  2R5G A;  2VCV A;  5F05 A;  2IMI A;  4XCS A;  2IN3 A;  2FHE A;  1YKC A;  5DQS A;  1JZO A;  1GUH A;  2JZR A;  1GUL A;  2VOC A;  4IP6 A;  1EEJ A;  4BVX A;  1B48 A;  2HRF A;  3CMI A;  3TKR A;  3ZIT A;  4JRR A;  2FY6 A;  3MWH A;  4NMU A;  1TOF A;  4X1U A;  4Q5N A;  2JSY A;  4KDU A;  3EU3 A;  2FWE A;  3GNJ A;  3UBL A;  1SD9 A;  5ELA A;  2YZH A;  2HE3 A;  4MJB A;  2LS5 A;  3IV4 A;  2WS2 A;  3TDG A;  4GST A;  3I43 A;  3KD0 A;  1GUM A;  4E8H A;  2V1M A;  1BYE A;  2WFC A;  3HJP A;  3HKR A;  3TJF A;  1ZOF A;  1EV9 A;  2UZ8 A;  3TJK A;  3F6F A;  4N11 A;  5ECI B;  1TK5 B;  1F37 A;  2XHF A;  3IC4 A;  3Q18 A;  2H6Z A;  5ECN B;  2YCD A;  4X4J A;  3M1G A;  2H01 A;  1HD2 A;  2OAD A;  18GS A;  1ACV A;  1MDI A;  4LL4 B;  4YAP A;  1G6Y A;  1SK0 A;  5HR0 A;  4EIP A;  2CAQ A;  1J9B A;  4FQU A;  1K0N A;  2C3T A;  1SYR A;  3VFI A;  5JCW A;  2CVK A;  3EIN A;  3PR8 A;  1X5C A;  2A2S A;  2IMK A;  1O81 A;  2LEG A;  1YY7 A;  1E6B A;  4RQR A;  3QAG A;  1Z6M A;  4JU5 A;  4MF7 A;  2HZE A;  3GKX A;  2OAC A;  3LGC A;  2DC5 A;  2H74 A;  16GS A;  4JR6 A;  4KE3 A;  5J9C A;  4ZBA A;  4ZB8 A;  2DJ2 A;  3M8N A;  2EIQ A;  1XWB A;  3TGZ A;  1SK1 A;  3G7J A;  4WKW A;  3LWA A;  2V2G A;  3VI5 A;  4OFT A;  2H0H A;  3FZA A;  2G2Q A;  2GLR A;  2I9H A;  2VM1 A;  5H5Q A;  1SKS B;  1VF3 A;  2ZCT A;  1B8X A;  1FW1 A;  5C00 A;  3QOU A;  1FVJ A;  3BBY A;  2KP1 A;  1WIK A;  2NTO A;  1ZYN A;  2H1D A;  3IHG A;  1XCC A;  1NHY A;  3BD2 A;  3NIV A;  5CRH A;  4Q5R A;  4ZL7 A;  6GSS A;  4MP4 A;  2PN8 A;  5A4W A;  2D2Z A;  3QDN A;  5AIS A;  4Z2U A;  4PQ1 A;  3C7M A;  3UL3 A;  3ZRE A;  1OVN A;  4EDZ A;  2K8V A;  1BQ7 A;  5D9W A;  3IPZ A;  4YQM A;  4IJI A;  4BA7 A;  4P3Y B;  1R5P A;  1X5E A;  2DBC A;  2C0F A;  2H8L A;  5F07 A;  4FH8 A;  4KB3 A;  2IJY A;  4KCA A;  17GS A;  1M7T A;  2VCW A;  5KN3 A;  2GST A;  2FUG 2;  3UAR A;  4LMV A;  1PN0 A;  4MJE A;  5HQP A;  3IC8 A;  5FT3 A;  3RBT A;  4K0G A;  2IWT A;  2I81 A;  3QFB C;  6GSV A;  4YAV A;  2LNT A;  2NPB A;  4ZL9 A;  4L5O A;  2OJL A;  1LU4 A;  1C72 A;  2JU5 A;  1F9M A;  3IAM 2;  4K8M A;  4PNG A;  2GVP A;  4WET A;  6GSY A;  3MDK A;  4MZW A;  4OO4 A;  2QA1 A;  3PGT A;  4TR4 A;  2PVO C;  3RPN A;  1K0C A;  1N2A A;  3HJM A;  4G10 A;  3UAP A;  5LNK e;  3LW9 A;  2F51 A;  4HQS A;  2LV3 A;  2YZU A;  2VL9 A;  1TU7 A;  3LJR A;  1A8Y A;  2R0C A;  1X0R A;  3DIE A;  4IKH A;  5J9B A;  12GS A;  4XS4 B;  3KGK A;  1FOV A;  3ME7 A;  5ECL B;  4HUA A;  1AQW A;  5KOX A;  4DSS A;  1TRU A;  2H19 A;  4IHU A;  4MZB A;  1WJK A;  2RII A;  2RUF A;  1A0F A;  2C8U A;  1PN9 A;  4AJ6 A;  2LNS A;  3BJ5 A;  2YV9 A;  1VF4 A;  3WGE A;  4KX4 A;  2H1A A;  3D6I A;  3GMF A;  3Q74 A;  5HFG A;  2O85 A;  2V32 A;  4Z7X A;  3LYP A;  2YWI A;  2H30 A;  3H1N A;  1QMV A;  3EUR A;  4ICY A;  3IOS A;  2VLU A;  4N10 A;  2WJU A;  1U3I A;  2HNL A;  1G7E A;  4F2I A;  2XPD A;  3LG6 A;  3ME8 A;  1GL8 A;  4ISD A;  3FEU A;  4KDX A;  2I3Y A;  4Q5Q A;  2H1G A;  3GKN A;  1GNW A;  4GTU A;  1USB A;  3SWL A;  1T4Z A;  2PBJ A;  3A2X A;  3DGQ A;  2I1U A;  9GSS A;  4PUR A;  2C0D A;  3TKS C;  1T8E B;  2HRN A;  1A2J A;  1Z7P A;  3PIN A;  5DCH A;  1FG4 A;  5E4W A;  2CZ3 A;  2LJR A;  5IMV A;  3GL3 A;  4V1A p;  4WXT A;  3IK9 A;  2TIR A;  2B5Y A;  2E0Q A;  3C71 A;  3WGX A;  1KNG A;  3IBH A;  1THO A;  5G5F A;  1ERT A;  2FWF A;  1XBS A;  3HZ8 A;  3ZIJ A;  4F03 A;  1PRX A;  1R26 A;  4RUV A;  2DML A;  2DJ3 A;  3EU4 A;  4POL A;  2R2J A;  3F3Q A;  3TJB A;  4XTS A;  2JL4 A;  2C0E A;  3FR6 A;  4ECC A;  4LL1 B;  1LBK A;  2YP6 A;  3CSJ A;  3LSZ A;  2B6M A;  2OE0 A;  1XVW A;  1W89 A;  2VL2 C;  2CX3 A;  1QXH A;  3US3 A;  1SJ6 A;  1HYU A;  4PGT A;  3V1W A;  2E2G A;  3IXR A;  4E8E A;  2LRT A;  4OCF A;  1ZYP A;  3LQ7 A;  3QCP A;  4MH3 A;  1ERU A;  1U88 A;  1FO5 A;  2FD3 A;  5ECM B;  2VLT A;  2L6C A;  4YQV A;  2N5B A;  1DBY A;  1K0B A;  3C8E A;  2L6D A;  3EPT A;  1URM A;  3HVS A;  1W4V A;  1XXU A;  4XS4 A;  2K18 A;  5CAX A;  3APQ A;  3TUE A;  1V58 A;  2V6K A;  1BJX A;  2I4A A;  4NWY A;  3M3M A;  4OFN A;  2CQ9 A;  1BG5 A;  2A2P A;  1I9D A;  1PA3 A;  3UVH A;  1GSE A;  4EL1 A;  2B7J A;  4AJ7 A;  4J2F A;  5KEJ A;  2RM5 A;  1TXX A;  4H86 A;  2HRA A;  2YJH A;  5F8B A;  1THX A;  2GQL A;  5HFK A;  4FO5 A;  3SBC A;  5J3R A;  2VAF A;  4N0Z A;  1MTC A;  2LST A;  3M9K A;  2GZZ A;  2M80 A;  2YWM A;  1TDI A;  3HZ4 A;  5AGY A;  2VCQ A;  2J23 A;  2GGT A;  5G30 A;  1PKW A;  13GS A;  1KBN A;  5GSS A;  4LLR A;  4ZBD A;  1YQ1 A;  4JBB A;  4POK A;  1OAZ A;  5ECP B;  4TXV A;  2ZNM A;  4BPY A;  5F06 A;  1O8X A;  2AUV A;  2DKI A;  3FZ5 A;  4LA1 A;  4XHM A;  3ZTL A;  5J41 A;  4LMW A;  2DSA A;  3D22 A;  1QK8 A;  2QC7 A;  1JLV A;  1QFN A;  4GQC A;  4EXJ A;  3FR9 A;  2LJA A;  4EC0 A;  4I6X A;  3ZYW A;  1OC3 A;  5H5R A;  4GXZ A;  1H4O A;  1JLW A;  5AIV A;  1GTB A;  2H72 A;  4OO5 A;  3TKP A;  1U6T A;  3APS A;  1K0D A;  1TP9 A;  3DRN A;  3EE2 A;  3L4N A;  3A2V A;  4K5R A;  3F0I A;  2AAW A;  4TKY A;  1A24 A;  5EVO A;  1GSY A;  1BED A;  5D9T A;  3GX8 A;  5EY6 A;  2B5E A;  1O85 A;  2WRT A;  1S3A A;  3HCZ A;  4BL7 B;  3VPT A;  1SL0 B;  3I6A A;  1EGR A;  1GH2 A;  5DJL A;  3O3T A;  1BAY A;  4GQF A;  2VL3 A;  1OE8 A;  2LUS A;  1JFU A;  3IK7 A;  1WMJ A;  2H1B A;  3BCK A;  4FYB A;  4KSM A;  3EC3 A;  2MMA A;  1MDJ A;  1R5A A;  3QR6 A;  3D4T A;  2HI7 A;  14GS A;  4O5U A;  2K6V A;  1K3Y A;  3VWV A;  1DUG A;  3CRT A;  3IAS 2;  4KA0 A;  3VWW A;  1ZMA A;  1J08 A;  3J7Y k;  3RDW A;  4ECB A;  1X5D A;  5ECS A;  3TJG A;  1A2L A;  2X8H A;  2XBQ A;  2BJX A;  2R4V A;  3HY2 A;  1M99 A;  4QQ7 A;  1TKD B;  5CO3 A;  3S9F A;  3FZ9 A;  2L4Q A;  2FWG A;  3BCI A;  4L8E A;  4TOP A;  5DDL A;  5B6M A;  3D0Z A;  3EYT A;  2LQO A;  2CT6 A;  5L71 A;  2HFD A;  4QL7 A;  3ZFB A;  4MF5 A;  4MK3 A;  1WE0 A;  2M46 A;  2J9H A;  2R0P A;  4GSS A;  4FYU A;  2WCI A;  1YF1 A;  1XVQ A;  2H71 A;  5ENU A;  4RI7 A;  1AQX A;  2C3N A;  4X43 A;  3HDC A;  1NM3 A;  1YZX A;  4NXI A;  2X99 A;  1SKR B;  1FOH A;  4TRX A;  1ZZY A;  2MMN A;  4POM A;  3F3R A;  2YN1 A;  2LRN A;  3LXT A;  2CX4 A;  3IDV A;  1XWC A;  2HT9 A;  4JZQ A;  3C1S A;  2L59 A;  4K7O A;  4BWS A;  4EDY A;  4BVY B;  3NZN A;  1Q98 A;  5IOW A;  3EMX A;  2JZS A;  2MMZ A;  3CSI A;  2OBK A;  1TK0 B;  1NSW A;  1OKT A;  1TRV A;  2WGR A;  3CRU A;  1XIY A;  3RHC A;  3M9J A;  4NHW A;  2VIM A;  3DKS A;  3TKS E;  4I2T A;  4F9Z A;  5IO2 A;  1ZCP A;  4V1A g;  1TU8 A;  2GT5 A;  3ZLP A;  4WF5 A;  1XWA A;  3F8U A;  1YDK A;  1Y25 A;  3GUR A;  3ED3 A;  1YJ6 A;  1K3O A;  1X9W B;  1GUK A;  2IIY A;  2LTK A;  3P7X A;  4MPG A;  3DD3 A;  1XWK A;  4BL7 A;  2GZY A;  3K8N A;  4Z2R A;  1YEP A;  5A4U A;  5HFI A;  3J7Y b;  3KTL A;  2G0F A;  4EO3 A;  2B1L A;  1MD3 A;  1M0U A;  1DE2 A;  1XOA A;  4XIH A;  1S3D A;  3GKK A;  2B3S A;  2LQQ A;  2GTU A;  1EOG A;  1SK2 A;  4IJ3 A;  4AF2 A;  4IN0 A;  2X4A A;  1JHB A;  4MF6 A;  3GH9 A;  4WR4 A;  5KN0 A;  2H0I A;  1RK4 A;  2BMX A;  3QMX A;  2C1Y A;  3GUS A;  1CQG A;  4OWY A;  2KOK A;  4FYC A;  3MYD A;  1AW9 A;  3DWV A;  1GWC A;  4Z2T A;  1EP8 A;  2VO4 A;  1F3B A;  3TKS A;  3F4T A;  4CY6 A;  3GHA A;  3QD9 A;  4HJ2 A;  5AN1 A;  3ZZX A;  1YKA A;  1OC8 A;  4MPF A;  4XS1 A;  1UC7 A;  3TCO A;  2A2R A;  3FMW A;  3VLN A;  1AQV A;  4EKZ A;  3GST A;  2ZUP A;  1ZGN A;  3F6D A;  3FY7 A;  4JE1 A;  1OE7 A;  5JCG A;  4XS6 A;  3HVX A;  3IA1 A;  3HXS A;  2X8G A;  3Q6O A;  3L0H A;  3R2Q A;  11GS A;  1Z3E A;  5H5S A;  1M9A A;  3MSZ A;  3D4M A;  1ST9 A;  1GSQ A;  3D21 A;  2HLS A;  2P31 A;  3KH7 A;  4L0U A;  1PL1 A;  3H4K A;  1HNA A;  3MIX A;  3WT2 A;  10GS A;  4G19 A;  2HZF A;  4O7H A;  4ZBB A;  1GLQ A;  3JCM L;  1TW9 A;  4YH2 A;  2VL2 A;  1GLP A;  1O73 A;  3ZMK A;  2V6O A;  2O8V B;  4YKG A;  4HDE A;  2DIY A;  2YWN A;  4KND A;  2IFQ B;  1T00 A;  1F2E A;  4BVY A;  3H8Q A;  3ZVJ D;  2A4V A;  3IE3 A;  3ZML A;  3WD6 A;  4BWQ A;  1VF2 A;  1WRY A;  2DJ1 A;  3GTU B;  2H76 A;  1LJR A;  3Q19 A;  1DSB A;  3CTG A;  5CRE A;  5FHI A;  2L5O A;  5EPF A;  5J5N A;  3ERF A;  2GDR A;  2PVQ A;  3HD5 A;  3GRX A;  4ECJ A;  1WWJ A;  4ILF A;  5DAL B;  3DVW A;  2DJK A;  3HJO A;  3VPQ A;  1V40 A;  3ZL5 A;  4AGS A;  2IMD A;  3UVT A;  1RQM A;  2GSQ A;  1PL2 A;  1RW1 A;  2B1K A;  1TK8 B;  2VCX A;  4YKF A;  3KMN A;  1GNE A;  1EP7 A;  2QKE A;  5J4U A;  2LRC A;  5JWQ B;  2X49 A;  3G9B A;  2JZT A;  2PPT A;  3PPU A;  5ID2 B;  1GSU A;  1M2B A;  1SJZ A;  8GSS A;  4KCE A;  3TOT A;  4F0B A;  4TR0 A;  4PTS A;  5CRW A;  3P90 A;  2MYG A;  3KP8 A;  5D96 A;  2CVB A;  5CRD A;  1ERW A;  1V2A A;  2LJK A;  1HQO A;  5KN1 A;  2K8S A;  1VRS D;  3TOU A;  2IME A;  3UOM A;  3E9J B;  3LYK A;  2L4C A;  3APO A;  2JSZ A;  1ZL9 A;  5GST A;  2GZP A;  4RI6 A;  3MAK A;  4I5Q A;  2A4H A;  4K2X A;  1NHO A;  2CAI A;  3UMA A;  1EGO A;  2EIR A;  4IQA A;  4G2E A;  4HOJ A;  4NV5 A;  5ECR B;  2AYT A;  3UJ1 A;  4KF9 A;  2RM6 A;  5D93 A;  3VWU A;  1T1V A;  4IGJ A;  4EVM A;  2MBT A;  2NBS A;  2FA4 A;  2CA8 A;  5ECQ B;  2KLX A;  4N30 A;  1XW5 A;  1M2A A;  2H0G A;  1TRS A;  2GSR A;  4PX1 A;  5IMF A;  3FW2 A;  4ZB9 A;  1K0A A;  2NDO A;  3H93 A;  4NPB A;  3O76 A;  1KEB A;  1EEM A;  5G5E A;  4I8B A;  4OMV A;  1IYI A;  2FA8 A;  2O87 A;  3M0F A;  4GF0 A;  2WB9 A;  3FHK A;  3UEM A;  4K2D A;  3WYW A;  3L9U A;  1T4Y A;  3ZVJ A;  1SD8 A;  4G0I A;  4G0L A;  2F3M A;  4J56 E;  1YEX A;  3EWL A;  3KTB A;  5IO0 A;  2L5L A;  5DJM A;  3KH9 A;  2IFQ A;  3FRC A;  2F9S A;  2AV4 A;  4MZC A;  1Z6N A;  3GX0 A;  4HI7 A;  4PUA A;  2VCT A;  1F6M C;  3FKF A;  5AIX A;  3GIX A;  4TR1 B;  3GTU A;  6GSU A;  2PWJ A;  3WT1 A;  2GQK A;  1MDK A;  3TKQ A;  2IPA A;  1UVZ A;  1T3B A;  3KCM A;  4MJA A;  1AC1 A;  1SJI A;  2AHE A;  4PNF A;  2VUP A;  4K7N A;  2DMM A;  5IMC A;  1SKW B;  1T7P B;  5DAL A;  4RQX A;  4MA9 A;  3A3T A;  1Z9H A;  1SEN A;  3G7I A;  3KXO A;  3KMO A;  4TN8 A;  3VI7 A;  4KH7 A;  2IL3 A;  1ML6 A;  4G0K A;  3R3E A;  4KGI A;  2VD1 A;  1NW2 A;  1JZW A;  3TJJ A;  3UIW A;  1FAA A;  2H6X A;  2WDU A;  4WEY A;  2MBS A;  1B4P A;  4DVC A;  2M72 A;  1PD2 1;  1ZYE A;  3KM6 A;  2YOI A;  4G9H A;  3UBK A;  1B4Q A;  2ON5 A;  2OE1 A;  1JZR A;  3ZIV A;  5F0G A;  4PXO A;  2X64 A;  3CBU A;  2H66 A;  5ID2 A;  1V57 A;  2FWH A;  1XW9 A;  3DXB A;  1O6J A;  2B7K A;  2P0G A;  5CRG A;  4HEA 2;  2GT6 A;  1HNB A;  1QQ2 A;  4HQZ A;  2HSY A;  2JAD A;  2KUC A;  1EOH A;  2Z9S A;  4DSR A;  4HZ2 A;  2MMO A;  3N9J A;  4L0W A;  4K7I A;  2R0G A;  3VUR A;  4PQI A;  4N0V A;  2YV7 A;  5G1L A;  1XZO A;  5B8B A;  5COH A;  4JR4 A;  1OYJ A;  1ON4 A;  5EL8 A;  4ZL8 A;  4PQH A;  2C80 A;  3ISO A;  6GSX A;  2VLV A;  4ACS A;  3RHB A;  2X8C A;  3ZFL A;  3O6T A;  2H70 A;  1G0T A;  4O92 A;  3FK8 A;  3EVI A;  5DVB A;  5BRT A;  1R7H A;  3TB2 A;  4OD7 A;  1ABA A;  4HU9 A;  5A4V A;  3FZ4 A;  1SL2 B;  2HRK A;  2FLS A;  1WP0 A;  4CDO A;  3D5J A;  5G2Z A;  3GYK A;  4TXO B;  4WBR D;  4K0N A;  5D9X A;  1AAZ A;  1TI3 A;  2PER A;  3I9V 2;  3W8S A;  5GAN D;  1G7O A;  2C0G A;  2WZ9 A;  3DML A;  2YPM A;  5G31 A;  5INY A;  3MNG A;  3W6G A;  5CNW A;  3P8W A;  5HR3 A;  1F3A A;  4MMM A;  5G1K A;  1AUC A;  4K1F A;  1S3C A;  4I97 A;  4HS1 A;  2MZC A;  4KAE A;  3GN3 A;  1MD4 A;  2E7P A;  4TR1 A;  5JWO B;  1PX6 A;  6GSW A;  3CYN A;  5IQY A;  2CVD A;  5D9V A;  2K9F A;  3ERG A;  4TW5 A;  2YAN A;  4CHS A;  1GRX A;  3IHQ A;  4DSS B;  3KEB A;  5KN2 A;  3GH6 A;  3F9U A;  4K9Z A;  2DJ0 A;  3F63 A;  1U87 A;  1JZD A;  1K3L A;  4ZIJ A;  4IBP A;  2L57 A;  5LD0 A;  1V9W A;  1QUW A;  2F8A A;  3C1R A;  3LOR A;  5KOW A;  2DKH A;  5JWR B;  2BTO T;  1N8J A;  2R3X A;  4ECI A;  1A2M A;  2HYX A;  1EWX A;  4O32 A;  4J57 E;  4KUN A;  4EIQ A;  4FIW A;  4HU7 A;  1E2Y A;  5A5K A;  4O5Q A;  4POB A;  5CYY A;  4D73 B;  4EE0 A;  3DVX A;  4MCU A;  1FB0 A;  1CQH A;  5B6N A;  7GSS A;  3CSH A;  2GS3 A;  4ID0 A;  4A5P A;  2GSS A;  3GKM A;  3P2A A;  1GSS A;  3BOA A;  4IW9 A;  3IRA A;  1Q4J A;  2CV4 A;  3DEX A;  3U5R E;  4ML6 A;  4V2L A;  4V2N A;  4IQ1 A;  3A2W A;  5B7C A;  1K0O A;  4GRF A;  4IVF A;  2GQM A;  2OA7 A;  1J0F A;  22GS A;  1WPI A;  3WGD A;  1Z7R A;  1SU9 A;  3DYR A;  1OKD A;  5DBQ A;  3LFL A;  3VWX A;  2WUL A;  2EC4 A;  1R4W A;  4Q5F A;  4MH2 A;  3IR4 A;  3E3E A;  4EF0 A;  4QL9 A;  1A23 A;  2O89 A;  3CTF A;  1O8W A;  1SYX A;  1PMT A;  4K6X A;  3HVV A;  2PGT A;  2DLX A;  1GTI A;  3L9V A;  4TXO A;  1XOB A;  2B5X A;  2XBI A;  4GSN A;  1OC9 B;  5FWG A;  2ON7 A;  5HR2 A;  2LKU A;  3EMP A;  2FCH A;  2XC2 A;  2R37 A;  2TRC P;  3GL5 A;  1ZYQ B;  3HA9 A;  1G6W A;  3C73 A;  1I5G A;  5ECH B;  2N5A A;  2KP2 A;  1VGL A;  5IMD A;  1ERV A;  1ILO A;  4MDC A;  5DAK B;  5DCG A;  5ECK B;  2ES7 A;  5D8I A;  2O7K A;  3QAW A;  4AJ8 A;  4NAX A;  4MAB A;  1XPV A;  2RLI A;  5IM9 A;  4PUF C;  1KTE A;  2N5F A;  4JED A;  2C4J A;  2TRX A;  1AXD A;  3GV1 A;  1BX9 A;  2ALB A;  1VF1 A;  3E0U A;  1TI1 A;  1QGV A;  4HJM A;  1FHE A;  6GST A;  3QFA C;  4NV2 A;  3ZRD A;  1Y6E A;  3KIJ A;  4NHZ A;  1TRW A;  3TRP A;  1XWG A;  2RUE A;  4IS0 A;  2AJQ B;  2V41 A;  4ZB6 A;  4DSQ A;  2PMT A;  3QPM A;  5B8A A;  2VD0 A;  4X0X A;  1YF0 A;  3TRQ A;  1PX7 A;  4OFM A;  4D73 A;  3NOF A;  4CW9 A;  1X9S B;  4EUY A;  2KHP A;  2YJ7 A;  1V98 A;  5BMU A;  2OKA A;  2PUK C;  1X9M B;  1PQN A;  3L78 A;  4O5R A;  1GSF A;  4ZXG A;  2P5Q A;  3TRX A;  3GSS A;  4MJC A;  3GFK A;  1FVK A;  5IOX A;  4DEJ A;  2VCZ A;  4ZIL A;  4TVE A;  3LXZ A;  2QSI A;  2HSM A;  3FR3 A;  5IMZ A;  5IPG A;  2OE3 A;  1H75 A;  5E59 A;  2H75 A;  2YNX A;  2YWO A;  4WF4 A;  1WOU A;  2QGV A;  2HSH A;  1IYH A;  3KJY A;  4I2U A;  3L9S A;  4BVX B;  3A5W A;  3F4S A;  5CP1 A;  1PGT A;  2NVL A;  3U6V A;  5IMA A;  1AIU A;  4F0C A;  4HZ4 A;  3W8J A;  1EV4 A;  3RAZ A;  1XW6 A;  2CZ2 A;  3I69 A;  5DQY A;  4KW6 A;  1HNC A;  4WR5 A;  4XRA A;  2JAC A;  3G7Y A;  1UN2 A;  1FB6 A;  1TJD A;  1OC9 A;  2AB6 A;  4IP1 A;  2FNO A;  1XFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...