1Q98A

Structure of a thiol peroxidase from haemophilus influenzae rd
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
164
Chain Sequence
TVTLAGNPIEVGGHFPQVGEIVENFILVGNDLADVALNDFASKRKVLNIFPSIDTGVCATSVRKFNQQAAKLSNTIVLCISADLPFAQARFCGAEGIENAKTVSTFRNHALHSQLGVDIQTGPLAGLTSRAVIVLDEQNNVLHSQLVEEIKEEPNYEAALAVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol Peroxidase
publication title Structure of a Thiol Peroxidase from Haemophilus influenzae Rd
rcsb
source organism Haemophilus influenzae
total genus 48
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1q98A00
3IAM2 2C0FA 4NV2A 4V2MA 5KN0A 1O6JA 3U6VA 1HNCA 3KP9A 7GSSA 2VLUA 5LD0A 3WGEA 2H75A 2VCWA 1TRVA 1O8XA 2AHEA 2FLSA 5IPHA 2PERA 4ZBAA 1TTZA 4IGJA 4L5LA 2K6VA 2YZUA 1URMA 1E2YA 4RI6A 3KMOA 1NSWA 1SD8A 1B8XA 5HFIA 2GT6A 2ES7A 1ZOFA 4EDYA 1GUHA 2FUG2 4PQ1A 3V1WA 1V98A 2CZ3A 4ZBDA 2K8SA 4N0VA 2OADA 4EKZA 3C1SA 4NXIA 3R2QA 4GSSA 3EU4A 1PQNA 4PNGA 2AB6A 3QAGA 3QR6A 1XWGA 2C0DA 3L0HA 6GSXA 2PWJA 6GSSA 2HE3A 5LCZA 4MDCA 3KZQA 1G6YA 3UBLA 3EU3A 3KMNA 1FB0A 2GQKA 4H86A 2VCTA 4BWSA 1AQVA 2H0HA 4TOPA 3HVXA 5L71A 3TUEA 4MLYA 4HJ2A 2N5FA 3FHKA 2H73A 3APOA 3FR3A 4L8EA 4KA0A 5HR0A 3ME8A 1EEMA 1B9XC 4PQHA 3ZTLA 1CQHA 3CMIA 4WETA 4EUYA 4TKYA 1WE0A 1K0OA 3HJPA 4PURA 2FWGA 4WBRD 3F6DA 2I4AA 2P0GA 2MMOA 1OE7A 1W89A 3BCIA 3P90A 1X9SB 3SBCA 4DSRA 5FWGA 2YOIA 2LNSA 2QC7A 4EVMA 2B5YA 3TJFA 3ED3A 4HZ2A 4E8HA 3F4SA 2VCVA 2GDRA 1K0AA 2R5GA 1NW2A 1FAAA 4GSNA 4XS1A 4PX1A 1XWAA 1K0CA 2M46A 1BJXA 4LMVA 1QUWA 3D4TA 2NDOA 2GT5A 2L6DA 4AF2A 1TP9A 2B7KA 1AC1A 4O32A 2LS5A 4I2TA 5IOXA 5ECNB 3PGTA 4ZILA 4MABA 1MTCA 5KN2A 4MF6A 3ZZXA 4WR5A 1DE2A 5F07A 2E2GA 2CVKA 2OKAA 3M9KA 4G2EA 5D93A 2JADA 4OCEA 2L4QA 4YQMA 4EXJA 5G31A 1R4WA 3CYNA 3AY8A 2FGXA 4LMWA 3TCOA 3GTUA 2F8FA 4I8BA 1M0UA 4JZQA 3ME7A 1AW9A 3HDCA 5AIXA 1MD4A 2YWOA 2H74A 4BA7A 4Q5QA 4HZ4A 1FO5A 1FB6A 1QQ2A 2GGTA 3M0FA 4OFMA 1PL1A 3EC3A 2CZ2A 1R5AA 2V6OA 3DVXA 3IXRA 3QAWA 3QDNA 4RQRA 4MJBA 2JSZA 4K1FA 1K0MA 2GZZA 5GAPD 5ID2B 4YQUA 3W6GA 1GTUA 5ID2A 1S3DA 4GXZA 3FZ4A 1ZYQB 3F6FA 2WZ9A 5DBQA 1K0NA 1G6WA 2ON5A 4IQ1A 1T7PB 2C0GA 3LEFA 3C1RA 1RW1A 5IPGA 1TKDB 3RPNA 5FHIA 2L4CA 3HVVA 2WRTA 3ERWA 3HY2A 3ZIVA 1HNBA 4KCAA 1F3AA 3GMFA 1QMVA 2EIRA 3EWLA 1EEJA 4MK3A 1O8WA 2VCZA 1R26A 2MZCA 5D9XA 1MEKA 3DEXA 1KTEA 4NMUA 5E4WA 4HI7A 5CRGA 1JZOA 1H75A 1ML6A 2GQLA 4POLA 1MDJA 2K9FA 3FW2A 2HRNA 3GX0A 1V40A 3Q74A 4NPBA 5A4UA 4JRRA 5DALB 1I9DA 3HKRA 5DALA 3DD3A 3GKKA 3LYPA 1W4VA 4QL7A 2MBTA 4AJ6A 3F3RA 1SL0B 2KP2A 1O7UA 2D2ZA 1AQXA 4MZBA 4ECBA 2H0IA 1A2MA 4J56E 2CAIA 3MAKA 2A2SA 2RM5A 1TK5B 1AAZA 1UVZA 3GX8A 5A5KA 1Z7RA 2OJLA 3SWLA 2V1MA 3J7Yb 1K3OA 2FA8A 4POBA 2VLTA 4JR4A 1DUGA 5AISA 4FYBA 3PINA 1HYUA 4XS4B 4XS4A 6GSUA 1GSFA 1AIUA 4MCUA 4ZL7A 3DYRA 1R5PA 2PN8A 3Q19A 1XBSA 4GF0A 11GSA 2YPMA 1RK4A 2JACA 12GSA 2FNOA 3E0UA 1M9AA 2H6XA 4XS6A 5C04A 2IMEA 2VM1A 4XRAA 2XHFA 4K0GA 4MF7A 1USBA 3KEBA 3HD5A 1PSQA 2PVQA 1MDIA 3BBYA 2IMDA 1JZDA 3N5OA 2VCXA 3GRXA 1N8JA 4YH2A 4Z7XA 1ERWA 3HZ4A 3WGXA 2E2MA 3D0ZA 1VF2A 1XIYA 2B3SA 4ML6A 1AQWA 4FO5A 3C73A 2YANA 2YZHA 2DC5A 3HHVA 1OC9B 1VF4A 3VPTA 4N0ZA 4DVCA 2H1AA 1OC9A 3VWVA 4E8EA 2F51A 2KP1A 1K0DA 1ZGNA 2XC2A 4ID0A 5C00A 1A2LA 1SL1B 1X5DA 1V58A 3IC4A 1TRSA 3ZREA 2H8LA 5ECQB 4QL9A 1V2AA 4ZIJA 4PNFA 4HU7A 2XBIA 3GURA 2PU9C 3HXSA 4GWRA 3RHCA 4FH8A 3GKMA 4EE0A 2CA8A 2X8CA 4GLTA 1LBKA 4JE1A 4AGSA 3H1NA 2NBSA 4TXOB 4MPGA 3DXBA 1XWCA 4IJ3A 4TXOA 2HLSA 3LYKA 2O7KA 3OR5A 3DVWA 1ERUA 4KSOA 1EV4A 2DLXA 4IELA 2H6YA 2YCDA 2PVOC 5KEJA 4KDYA 1HD2A 2C3NA 2CVDA 4NHWA 1SK2A 2P5RA 2X64A 5ECIB 3IK7A 2GS3A 3WYWA 1OKDA 2ZUPA 2IWTA 1F3BA 3F0IA 5AGYA 3G7IA 4I5QA 3LG6A 3KM6A 1JFUA 1ZL9A 1KNGA 4OCFA 1ABAA 4K7IA 2V32A 4RUVA 1T3BA 2OE1A 4GCIA 3DMLA 1GRXA 2IL3A 1YEPA 3FZ5A 5B6MA 2LQOA 1Z6NA 4XRDA 5JCGA 2YV7A 1XXUA 1Z6MA 2H1DA 1U3IA 2PBJA 2CX3A 4TXVA 1T4YA 2YJ7A 1PKWA 2H70A 3FK8A 3O76A 2CX4A 4NAXA 5JWQB 2R3XA 3MNGA 1I5GA 1QXHA 1M99A 2ON7A 4N10A 2YWMA 2H30A 3L9UA 1GSYA 3H93A 4BL7A 1EP8A 2AJQB 1ZZYA 1ERVA 5ECKB 2FWEA 2BMXA 3L9VA 4GQFA 4Q5FA 4HQZA 1HQOA 4GSTA 2DJ0A 1B9YC 3D6IA 2CV4A 3G9BA 2NPBA 2AAWA 2JZRA 3G7YA 1CQGA 5CRDA 3O6TA 5HR1A 1KEBA 3BD2A 4G19A 3DIEA 3WGDA 3HVSA 3LJRA 4BPYA 2H0GA 2VL9A 1X5CA 3EMPA 3JCML 2IJYA 1R7HA 3QD9A 1SJIA 4HOJA 2JL4A 1SK1A 3GA4A 4K9ZA 3D21A 3ZYWA 4EO3A 1TOFA 5D8IA 2F3MA 4IP6A 5JCUA 4LL1B 5AN1A 3GSTA 2LUSA 5ABRA 2VL2A 2YV9A 1VF1A 5HFGA 1F9MA 4L0UA 2OBIA 1X0RA 4MF5A 2ZCTA 2LRTA 1M2AA 4F0CA 5DAKB 1X5EA 2H66A 5DAKA 2LKUA 1VF3A 1BAYA 4KW6A 5DCHA 4KUNA 3EE2A 2M72A 4ECCA 3QCPA 5CNWA 5F0GA 4V2LA 3GSSA 3H4KA 4MJAA 4Q5RA 3O3TA 3CRTA 2VD0A 3MSZA 1IYHA 3H79A 2FWHA 5DVBA 4X0XA 2TRXA 1TK0B 1WP0A 4LA1A 4D73B 3NZNA 1GWCA 4D73A 4WF4A 2IMKA 5ECLB 5COHA 5IMVA 3GUSA 1OKTA 2VO4A 1A2JA 2GZPA 3EYTA 3NIVA 1Z3EA 4FIWA 1NHOA 5IQYA 1PKZA 1M7TA 3UAPA 5ELGA 4BVXA 3GTUB 3N9JA 3TOUA 2C3QA 4I6XA 1YF0A 2R2JA 5IMFA 2RUEA 6GSVA 1SJZA 1O73A 3BOAA 1EWXA 1G0TA 1DSBA 4FYUA 2GVPA 5IMAA 2IFQB 3PH9A 3EVIA 3HJOA 1M2BA 2IFQA 5IMDA 3LXZA 5CRHA 18GSA 4DSQA 1KBNA 3CSHA 1WWJA 3UL3A 3ISOA 3DGQA 2ZNMA 2VL3A 1X9WB 3KXOA 2DMLA 2MMZA 2H19A 1ZYEA 3D22A 3Q18A 2WJUA 1GTBA 1JZWA 4MP4A 1NM3A 5G2ZA 2X8GA 4IW9A 5ECSA 1S3CA 1XCCA 2GSRA 4WR4A 4RI7A 3RHBA 1J0FA 3KCMA 3LORA 4J57E 2K8VA 1QK8A 5D96A 4NWYA 5J3RA 1M9BA 2LJRA 3P2AA 1AXDA 1XZOA 3BJ5A 1VRSD 4MZWA 3GL5A 3HJMA 3UOMA 3UIWA 1UC7A 4K6XA 1V9WA 2HSYA 5G5EA 2A4VA 4XCSA 5GSSA 3IR4A 20GSA 6GSWA 3CTGA 3FZAA 2L5LA 3GYKA 2C3TA 2FWFA 1THXA 3GL3A 1PGTA 3UARA 1OC8A 1GP1A 4IS0A 4TR4A 2VM2A 2Z9SA 3WD6A 2A2RA 1GNEA 4JBBA 3KIJA 1M2DA 1JHBA 2C0EA 2GTUA 2VL2C 4XTSA 2R6KA 4ECJA 2HFDA 5CREA 2WS2A 2O89A 1GLQA 3FEUA 4KB3A 5FT3A 4N30A 1F6MC 1SKWB 1OVNA 1T8EB 1AUCA 1GUMA 3IDVA 2J9HA 3ZFBA 2AV4A 2PGTA 1TK8B 2OACA 3UVHA 4F9ZA 3G7JA 2IIYA 2WDUA 1EV9A 3ZRDA 4O92A 1XPVA 9GSSA 1EGRA 5G5FA 4WF5A 1FG4A 4FYCA 3M9JA 5B7CA 4PXOA 4KX4A 1XVWA 3TKPA 4N11A 4IHUA 1NHYA 1TW9A 2KHPA 3KH7A 1A8LA 1N2AA 2DBCA 3F8UA 3W8SA 4ZB9A 2R4VA 3GNJA 3LSZA 3I43A 4PGTA 3S9FA 4V2NA 2IMFA 2G2QA 4HQSA 5HR3A 5A4VA 1XW5A 2PPTA 4K7NA 4TR0A 2DJJA 1PA3A 2EC4A 4KDXA 5B8BA 2MMNA 5G1KA 2GSSA 2H1BA 4O5RA 2O8VB 3QMXA 2CAQA 4MH3A 3GH9A 4MJCA 1YY7A 1GSUA 3TRQA 2LV3A 4CDOA 3UMAA 4QQ7A 2WULA 2YWIA 3VFIA 2C4JA 3HYPA 1G7EA 4JU5A 5CYYA 1YDKA 4BWQA 3GH6A 4F0BA 2OE0A 4IP1A 1TDIA 5GZZB 2WCIA 6GSYA 3RBTA 1UA5A 1K3YA 4WBJA 5AIVA 4TN8A 4ML1A 1SYXA 3KTBA 4K0NA 2LSTA 5J5NA 3UJ1A 4XIHA 3US3A 5A4WA 4WXTA 5GSTA 1DBYA 4HEA2 3TJGA 2BTOT 3TKSE 1J08A 1ERTA 1YEXA 1GSDA 1XWKA 2TIRA 3F3QA 3FY7A 3LFLA 3FR6A 1A0FA 2RLIA 3A2XA 2C1YA 1B4PA 1SL2B 3CSIA 3UEMA 5H5SA 5J4UA 3TJBA 3CBUA 4DEJA 4MMMA 3GKNA 3HZ8A 4PUFC 3A5WA 3KP8A 2AUVA 4V1Ag 1O81A 1TU7A 4ZB6A 1FHEA 2OE3A 4RQXA 4LL4B 3KJYA 1BQ7A 16GSA 3VK9A 2I81A 4YAPA 2DJKA 2LNTA 1Q98A 4ACSA 4KSMA 14GSA 1ACVA 3ZLPA 2VUPA 2PMTA 1TRWA 3RPPA 3TKSC 4TW5A 3F4TA 1G7OA 2O87A 2YJHA 1YZXA 3LWAA 8GSSA 5F06A 5DJLA 2HYXA 4L5OA 3ZMKA 5ECPB 1EZKA 2IN3A 1THOA 1GSEA 3F4RA 2YP6A 2HT9A 2TRCP 4EF0A 3VWWA 2KLXA 2F9SA 2YWNA 3DWVA 2B1LA 5F8BA 3KTLA 4IVFA 2MYGA 1BEDA 3F9UA 4XHMA 3IK9A 2HI7A 5EY6A 2QKEA 2XBQA 4K8MA 5CP1A 2DSAA 2VOCA 3TJKA 4ZXGA 2DJ2A 2B7JA 3GN3A 3QFBC 2GQMA 4KE3A 4TR3A 3D4MA 5EVOA 4ILFA 4MH2A 3ZIJA 2REMA 3C8EA 4HJMA 5INYA 3CTFA 3QFAC 1BYEA 3BCKA 2DIYA 1PMTA 3A3TA 4KNDA 1EOHA 3QAVA 1V57A 1F2EA 3MDKA 2LQQA 2H6ZA 1TRUA 3E3EA 3VWUA 2R37A 4ULXA 4X1UA 1XVQA 4YAVA 5B6NA 3EMXA 1GSQA 5ECRB 1FVJA 3CXGA 4I2UA 4ISDA 2V6KA 1F37A 2EIQA 2X99A 2WFCA 2MMAA 3KD0A 2M80A 4KCEA 1YKAA 4EL1A 5ENUA 4OD7A 1U6TA 4K2DA 4KH7A 3ZFLA 2MBSA 2L57A 2XPDA 4CHSA 4IQAA 19GSA 2PUKC 4AJ8A 4KDUA 1Q4JA 3VLNA 2E0QA 4YQVA 2HZEB 4X43A 1PL2A 2HZEA 3NOFA 3H8QA 4GRFA 1A0RP 5DQYA 1OAZA 2K18A 1Z5YE 2B5EA 2LRCA 3IE3A 1QFNA 3VPQA 1A8YA 3KGKA 2FCHA 1T1VA 5J9BA 1K0BA 1Z9HA 2YNXA 1PX6A 4GTUA 2EIOA 5DQSA 4L0WA 2H01A 3QPMA 4GQCA 3ZL5A 2HXKA 4PQIA 1EOGA 4OO5A 2C8UA 3J7Yk 2OBKA 3FZ9A 4IBPA 4OMVA 4I97A 5D9VA 2L5OA 3L4NA 3GIXA 5D73A 5IO2A 2IMIA 1WIKA 3P8WA 1Z7PA 1LU4A 3M8NA 1B48A 2RIIA 2CQ9A 2LEGA 2KOKA 3U5RE 3APQA 1WJKA 2HRFA 3A2VA 5HR2A 3K8NA 3ZVJA 2VIMA 2YN1A 3ZMLA 5IMCA 4MJEA 5DJMA 2VCQA 5D9TA 5ELAA 2V2GA 4HUAA 3KH9A 2LJAA 3L78A 1YJ6A 1T00A 3EINA 2H71A 1SK0A 4JR6A 1WOUA 5B8AA 2VD1A 1RQMA 1GULA 2GLRA 2O85A 4K7OA 4PUAA 2QSIA 1YKCA 4OWYA 5EPFA 3LXTA 1OE8A 2B1KA 1U3AA 3A2WA 2AYTA 2VLVA 3TRXA 3C71A 10GSA 1GLPA 3CSJA 2I1UA 3IHQA 4F2IA 5IMZA 4LLRA 3VI7A 1SU9A 1PN9A 2HSHA 1C72A 2B5XA 3UBKA 1SKRB 1VGLA 4P3YB 1YF1A 3I69A 2LTKA 1XW9A 3GFKA 2GSTA 22GSA 1BX9A 2IPAA 2JSYA 2VAFA 3F63A 1GH2A 2LJKA 5GAND 2FA4A 3ZITA 2BJXA 1OC3A 1WPIA 4NV5A 4IN0A 1ILOA 2JZTA 1H4OA 1XOAA 2L6CA 2QGVA 3L9SA 3ERGA 2X8HA 1MDKA 4HS1A 4ZB8A 2I9HA 1QGVA 3TB2A 1JLVA 5F05A 1T4ZA 4Q5NA 5HFKA 1TU8A 3IA1A 1XOBA 3TKSA 1Y6EA 5LNKe 2G0FA 3CRUA 4ZBBA 1FOVA 2FY6A 1FW1A 1ZMAA 3VI5A 4JEDA 3VWXA 5DCGA 2OA7A 5J41A 3W8JA 1B4QA 2DJ3A 3HCZA 2WGRA 1GTIA 1DE1A 3P7XA 3Q6OA 1ST9A 17GSA 1XW6A 1EGOA 4CW9A 4F03A 1Y25A 3UVTA 1MD3A 1PD21 3IRAA 2JZSA 2FHEA 2CT6A 3FKFA 5D9WA 3PR8A 1GTAA 5J9CA 1A24A 3RDWA 4MA9A 2JU5A 4IKHA 3MWHA 1SKSB 4ZL9A 2P31A 1TXXA 3C7MA 3TOTA 4G10A 2GSQA 5CO3A 2F8AA 1J9BA 4OFNA 2CVBA 2H72A 1GNWA 3I9V2 1GUKA 3EURA 4G9HA 4TR1B 3TKQA 1O85A 1FVKA 2B6MA 2J23A 4TR1A 4DSSB 3IAS2 3IPZA 1SJ6A 3TRPA 5DDLA 4DSSA 1HNAA 3D5JA 5IM9A 3WT1A 2H1GA 5EL8A 5H5RA 1LJRA 4AJ7A 2E7PA 1EP7A 6GSTA 5JCWA 2N5AA 1E6BA 1JZRA 3DRNA 3ZVJD 4POKA 5ECOB 1ON4A 5H5QA 2V41A 4O7HA 1YQ1A 5G1LA 5E59A 1SD9A 3IOSA 5G30A 2GZYA 5JWOB 1XWBA 3WT2A 4ECIA 2ALBA 2LRNA 2NTOA 3M1GA 4NHZA 1IYIA 4HDEA 3APSA 1WRYA 2XPEA 3ERFA 2L59A 3IV4A 1SENA 5IIZA 2NVLA 1K3LA 5KN3A 1UN2A 3FR9A 4TRXA 5KN1A 4WKWA 1SYRA 4F82A 2I3YA 4ZL8A 3RAZA 3TGZA 2HZFA 3LQ7A 3GKXA 1PX7A 3GV1A 2DMMA 4KGIA 1JLWA 1TJDA 2WB9A 3TKRA 1WMJA 5CAXA 4OFTA 4OO4A 4V1Ap 3FRCA 2H76A 4IJIA 1OYJA 4POMA 3E9JB 3GHAA 1TI1A 3I6AA 3M3MA 5IOWA 2P5QA 2DIZA 2N5BA 1X9MB 3TJJA 5IO0A 1XFLA 2C80A 3TDGA 1GL8A 4J2FA 1BG5A 3LGCA 1S3AA 1U87A 1A23A 4MPFA 4EDZA 2DJ1A 3QOUA 4HU9A 5HQPA 3HA9A 4EC0A 2KUCA 4MZCA 1GSSA 1ZCPA 2HNLA 5CRWA 5ECMB 3DKSA 5JWRB 1TI3A 4BVYA 3IBHA 2FD3A 4TVEA 1PRXA 2RM6A 3FYGA 1U88A 3VURA 4WEYA 2RUFA 5ECHB 4KAEA 13GSA
chains in the Genus database with same CATH superfamily
3IAM2 2C0FA 4NV2A 4V2MA 5KN0A 1O6JA 3U6VA 1HNCA 3KP9A 7GSSA 2VLUA 5LD0A 1FOHA 3WGEA 2H75A 2VCWA 1TRVA 1O8XA 2AHEA 2FLSA 5IPHA 2PERA 4ZBAA 1TTZA 4IGJA 4L5LA 2K6VA 2YZUA 1URMA 1E2YA 4RI6A 3KMOA 1NSWA 1SD8A 1B8XA 5HFIA 2GT6A 2ES7A 1ZOFA 4EDYA 1GUHA 2FUG2 4PQ1A 3V1WA 1V98A 2CZ3A 4ZBDA 2K8SA 4N0VA 2OADA 4EKZA 3C1SA 4NXIA 3R2QA 4GSSA 3EU4A 1PQNA 4PNGA 2AB6A 3QAGA 3QR6A 1XWGA 2C0DA 3L0HA 6GSXA 2PWJA 6GSSA 2HE3A 5LCZA 4MDCA 3KZQA 1G6YA 3UBLA 3EU3A 3KMNA 1FB0A 2GQKA 4H86A 2VCTA 4BWSA 1AQVA 2H0HA 4TOPA 3HVXA 5L71A 3TUEA 4MLYA 4HJ2A 2N5FA 3FHKA 2H73A 3APOA 3FR3A 4L8EA 4KA0A 5HR0A 3ME8A 1EEMA 1B9XC 4PQHA 3ZTLA 1CQHA 3CMIA 4WETA 4EUYA 4TKYA 1WE0A 1K0OA 3HJPA 4PURA 2FWGA 4WBRD 3F6DA 2I4AA 2P0GA 2MMOA 1OE7A 1W89A 3BCIA 3P90A 1X9SB 3SBCA 4DSRA 5FWGA 2YOIA 2LNSA 2QC7A 4EVMA 2B5YA 3TJFA 3ED3A 4HZ2A 4E8HA 3F4SA 2VCVA 2GDRA 1K0AA 2R5GA 1NW2A 1FAAA 4GSNA 4XS1A 4PX1A 1XWAA 1K0CA 2M46A 1BJXA 4LMVA 1QUWA 3D4TA 2NDOA 2GT5A 2L6DA 4AF2A 1TP9A 2B7KA 1AC1A 4O32A 2LS5A 4I2TA 5IOXA 5ECNB 3PGTA 4ZILA 4MABA 1MTCA 5KN2A 4MF6A 3ZZXA 4WR5A 1DE2A 5F07A 2E2GA 2CVKA 2OKAA 3M9KA 4G2EA 5D93A 2JADA 4OCEA 2L4QA 4YQMA 4EXJA 5G31A 1R4WA 3CYNA 3AY8A 2FGXA 4LMWA 3TCOA 3GTUA 2F8FA 4I8BA 1M0UA 4JZQA 3ME7A 1AW9A 3HDCA 5AIXA 1MD4A 2YWOA 2H74A 4BA7A 4Q5QA 4HZ4A 1FO5A 1FB6A 1QQ2A 2GGTA 3M0FA 4OFMA 4G0IA 1PL1A 3EC3A 2CZ2A 1R5AA 2V6OA 3DVXA 3IXRA 3QAWA 3QDNA 4RQRA 4MJBA 2JSZA 4K1FA 1K0MA 2GZZA 5GAPD 5ID2B 4YQUA 3W6GA 1GTUA 2UZ8A 5ID2A 1S3DA 4GXZA 3FZ4A 1ZYQB 3F6FA 2WZ9A 5DBQA 1K0NA 1G6WA 2ON5A 4IQ1A 1T7PB 2C0GA 3LEFA 3C1RA 1RW1A 5IPGA 1TKDB 3RPNA 5FHIA 2L4CA 3HVVA 2WRTA 3ERWA 3HY2A 3ZIVA 1HNBA 4KCAA 1F3AA 3GMFA 1QMVA 2EIRA 3EWLA 1EEJA 4MK3A 1O8WA 2VCZA 1R26A 2MZCA 5D9XA 1MEKA 3DEXA 1KTEA 3IHGA 4NMUA 5E4WA 4HI7A 5CRGA 1JZOA 4O5UA 1H75A 1ML6A 2GQLA 4POLA 1MDJA 2K9FA 3FW2A 4Z2RA 2HRNA 3GX0A 1V40A 3Q74A 4NPBA 1M3JA 5A4UA 4JRRA 5DALB 1I9DA 3HKRA 5DALA 3DD3A 3GKKA 3LYPA 1W4VA 4QL7A 2MBTA 4AJ6A 3F3RA 1SL0B 2KP2A 1O7UA 2D2ZA 1AQXA 4MZBA 4ECBA 2H0IA 1A2MA 4J56E 2CAIA 3MAKA 2A2SA 2RM5A 1TK5B 1AAZA 1UVZA 3GX8A 5A5KA 1Z7RA 2OJLA 3SWLA 2V1MA 3J7Yb 1K3OA 2FA8A 4POBA 2VLTA 4JR4A 1DUGA 5AISA 4FYBA 3PINA 1HYUA 4XS4B 4XS4A 6GSUA 1GSFA 1AIUA 4MCUA 4ZL7A 3DYRA 1R5PA 2PN8A 3Q19A 1XBSA 4GF0A 1ZYPA 11GSA 2YPMA 1RK4A 2JACA 12GSA 2FNOA 3E0UA 1M9AA 2H6XA 4XS6A 5C04A 2IMEA 2VM1A 4XRAA 2XHFA 4K0GA 4MF7A 1USBA 2DKIA 3KEBA 3HD5A 1PSQA 2PVQA 1MDIA 3BBYA 2IMDA 1JZDA 3N5OA 2VCXA 3GRXA 1N8JA 4YH2A 4Z7XA 1ERWA 3HZ4A 3WGXA 2E2MA 3D0ZA 1VF2A 4O5QA 1XIYA 2B3SA 4ML6A 1AQWA 4FO5A 3C73A 2YANA 2QA2A 2YZHA 2DC5A 3HHVA 1OC9B 1VF4A 3VPTA 4N0ZA 4DVCA 2H1AA 1OC9A 3VWVA 4E8EA 2F51A 2KP1A 1K0DA 1ZGNA 2XC2A 4ID0A 5C00A 1A2LA 1SL1B 1X5DA 1V58A 3IC4A 1TRSA 3ZREA 2H8LA 5ECQB 4QL9A 1V2AA 4ZIJA 4PNFA 4HU7A 2XBIA 3GURA 2PU9C 3HXSA 4GWRA 4FQUA 3RHCA 4FH8A 3GKMA 4EE0A 2CA8A 2X8CA 4GLTA 1LBKA 4JE1A 4AGSA 3H1NA 2NBSA 4TXOB 4MPGA 3DXBA 4MNNA 1XWCA 4IJ3A 4TXOA 2HLSA 3LYKA 2O7KA 3OR5A 3DVWA 1ERUA 4KSOA 1EV4A 2DLXA 4IELA 2H6YA 2YCDA 2PVOC 5KEJA 4KDYA 1HD2A 2C3NA 2CVDA 4NHWA 1SK2A 2P5RA 2X64A 5ECIB 3IK7A 2GS3A 3WYWA 1OKDA 2ZUPA 2IWTA 1F3BA 3F0IA 5AGYA 3G7IA 4I5QA 3LG6A 3KM6A 1JFUA 1ZL9A 1KNGA 4OCFA 1ABAA 4K7IA 2V32A 4RUVA 1T3BA 2OE1A 4GCIA 3DMLA 3FMWA 3A5IA 1GRXA 2IL3A 1YEPA 3FZ5A 5B6MA 2LQOA 1Z6NA 4XRDA 5JCGA 2YV7A 1XXUA 1Z6MA 2H1DA 1U3IA 2PBJA 2CX3A 4TXVA 1T4YA 2YJ7A 2R0GA 1M3IA 1PKWA 2H70A 3FK8A 3O76A 2CX4A 4NAXA 5JWQB 2R3XA 3MNGA 1I5GA 1QXHA 1M99A 2ON7A 4N10A 2YWMA 4BL7B 2H30A 3L9UA 1GSYA 3H93A 3R3EA 4BL7A 4EIQA 1EP8A 2AJQB 1ZZYA 1ERVA 4PTSA 2FWEA 5ECKB 2BMXA 3L9VA 4ICYA 4GQFA 4Q5FA 4HQZA 1HQOA 4GSTA 2DJ0A 4YKFA 1B9YC 3D6IA 2CV4A 3G9BA 2NPBA 2AAWA 2JZRA 3G7YA 1CQGA 5CRDA 3O6TA 5HR1A 1KEBA 3BD2A 4G19A 3DIEA 3WGDA 3HVSA 3LJRA 4BPYA 2H0GA 2VL9A 1X5CA 3EMPA 2X4AA 3JCML 2IJYA 1R7HA 3QD9A 1SJIA 2HSMA 4HOJA 2JL4A 1SK1A 3GA4A 4K9ZA 3D21A 3ZYWA 4EO3A 1TOFA 5D8IA 2F3MA 4IP6A 5JCUA 4LL1B 5AN1A 3GSTA 2LUSA 5BMUA 5BRTA 5ABRA 2VL2A 2YV9A 1VF1A 4A5PA 5HFGA 1F9MA 4L0UA 2OBIA 1X0RA 4MF5A 2ZCTA 2LRTA 1M2AA 4F0CA 5DAKB 1X5EA 2H66A 5DAKA 2LKUA 1VF3A 1BAYA 4KW6A 5DCHA 4KUNA 2X49A 3EE2A 2M72A 4ECCA 3QCPA 5CNWA 5F0GA 4V2LA 3GSSA 3H4KA 4MJAA 4Q5RA 3O3TA 3CRTA 2VD0A 3MSZA 1IYHA 3H79A 2FWHA 5DVBA 4X0XA 2TRXA 1TK0B 1WP0A 4LA1A 4D73B 3NZNA 2QA1A 1GWCA 4D73A 4WF4A 2IMKA 5ECLB 5COHA 5IMVA 3GUSA 1OKTA 2VO4A 1A2JA 2GZPA 3EYTA 3NIVA 1Z3EA 4FIWA 1NHOA 4BVXB 5IQYA 1PKZA 1M7TA 3EPTA 3UAPA 5ELGA 4BVXA 3GTUB 3N9JA 3CQFA 3TOUA 2C3QA 3HVNA 4I6XA 1YF0A 2R2JA 5IMFA 2RUEA 6GSVA 1SJZA 1O73A 3BOAA 1EWXA 1G0TA 1DSBA 4FYUA 2GVPA 5IMAA 2IFQB 3PH9A 3EVIA 3HJOA 1M2BA 2IFQA 5IMDA 3LXZA 5CRHA 18GSA 4DSQA 1KBNA 3CSHA 1WWJA 3UL3A 3ISOA 3DGQA 2ZNMA 2VL3A 1X9WB 3KXOA 2DMLA 2MMZA 2H19A 1ZYEA 3D22A 3Q18A 2WJUA 1GTBA 1JZWA 4MP4A 1NM3A 5G2ZA 2X8GA 4IW9A 5ECSA 1S3CA 1XCCA 2GSRA 4WR4A 4RI7A 3RHBA 1J0FA 3KCMA 3LORA 4J57E 2K8VA 1QK8A 5D96A 4NWYA 5J3RA 1M9BA 2LJRA 3P2AA 1AXDA 1XZOA 3BJ5A 1VRSD 4MZWA 3GL5A 3HJMA 3UOMA 3UIWA 1UC7A 4K6XA 1V9WA 2HSYA 5G5EA 2A4VA 4XCSA 5GSSA 3IR4A 20GSA 6GSWA 3CTGA 3FZAA 2L5LA 3GYKA 2C3TA 2FWFA 1THXA 3GL3A 1PGTA 3UARA 1OC8A 1GP1A 4IS0A 4TR4A 2VM2A 2Z9SA 3WD6A 2A2RA 1GNEA 4JBBA 3KIJA 1M2DA 1JHBA 2C0EA 2GTUA 2VL2C 4XTSA 1XG8A 2R6KA 4ECJA 2HFDA 5CREA 2WS2A 2O89A 1GLQA 3FEUA 4KB3A 2HRAA 5FT3A 4N30A 1F6MC 1SKWB 1OVNA 1T8EB 1AUCA 1GUMA 3IDVA 2J9HA 3ZFBA 2AV4A 2PGTA 1TK8B 2OACA 3UVHA 4F9ZA 3G7JA 2IIYA 2WDUA 1EV9A 3ZRDA 4O92A 1XPVA 9GSSA 1EGRA 5G5FA 4WF5A 1FG4A 4FYCA 3M9JA 5B7CA 4PXOA 4KX4A 1XVWA 3TKPA 4BIKA 4N11A 4IHUA 1NHYA 1TW9A 2KHPA 3KH7A 1A8LA 2A4HA 1N2AA 2DBCA 3F8UA 3W8SA 4ZB9A 2R4VA 3GNJA 3LSZA 3I43A 4PGTA 3S9FA 4V2NA 2IMFA 2G2QA 4HQSA 5HR3A 5A4VA 1XW5A 2PPTA 4K7NA 4TR0A 2DJJA 1PA3A 2EC4A 4KDXA 5B8BA 2MMNA 5G1KA 2GSSA 2H1BA 4O5RA 2O8VB 3QMXA 2CAQA 4MH3A 3GH9A 4MJCA 1YY7A 1GSUA 3TRQA 2LV3A 4CDOA 3UMAA 4QQ7A 2WULA 2YWIA 3VFIA 2C4JA 3HYPA 1G7EA 4JU5A 5CYYA 1YDKA 4BWQA 3GH6A 4Z2UA 4F0BA 2OE0A 4IP1A 1TDIA 5GZZB 2WCIA 6GSYA 3RBTA 1UA5A 1K3YA 4WBJA 5AIVA 4TN8A 4ML1A 1SYXA 3KTBA 4K0NA 2LSTA 5J5NA 3UJ1A 4XIHA 3US3A 5A4WA 4WXTA 5GSTA 1DBYA 4HEA2 3TJGA 2BTOT 3TKSE 1J08A 1ERTA 1YEXA 1GSDA 1XWKA 2TIRA 3F3QA 3FY7A 3LFLA 3FR6A 1A0FA 2RLIA 3A2XA 2C1YA 1B4PA 1SL2B 3CSIA 3UEMA 5H5SA 5J4UA 3TJBA 3CBUA 4DEJA 4MMMA 3GKNA 3HZ8A 4PUFC 3A5WA 3KP8A 2AUVA 4V1Ag 1O81A 1TU7A 4ZB6A 1FHEA 2OE3A 4RQXA 4LL4B 3KJYA 1BQ7A 16GSA 3VK9A 2I81A 4YAPA 2DJKA 2LNTA 1Q98A 4ACSA 4KSMA 14GSA 1ACVA 3ZLPA 2VUPA 2PMTA 1TRWA 3RPPA 3TKSC 4TW5A 3F4TA 1G7OA 2O87A 2YJHA 1YZXA 3LWAA 8GSSA 5F06A 5DJLA 2HYXA 4L5OA 3ZMKA 5ECPB 1EZKA 2IN3A 1THOA 1GSEA 3F4RA 2YP6A 2HT9A 2TRCP 4EF0A 3VWWA 2KLXA 2F9SA 2R0CA 2YWNA 3DWVA 2B1LA 5F8BA 3KTLA 4IVFA 2MYGA 1BEDA 3F9UA 4XHMA 3IK9A 2HI7A 5EY6A 2QKEA 2XBQA 4K8MA 5CP1A 2DSAA 2VOCA 3TJKA 4ZXGA 2DJ2A 2B7JA 3GN3A 3QFBC 2GQMA 4KE3A 4TR3A 3D4MA 5EVOA 4ILFA 4MH2A 3ZIJA 2REMA 3C8EA 4HJMA 5INYA 3CTFA 3QFAC 1BYEA 3BCKA 2DIYA 1PMTA 3A3TA 4KNDA 1EOHA 3QAVA 1V57A 1F2EA 3MDKA 2LQQA 2H6ZA 4YKGA 1TRUA 3E3EA 3VWUA 2R37A 4ULXA 4X1UA 1XVQA 4YAVA 5B6NA 3EMXA 1GSQA 4HSCX 5ECRB 1FVJA 3CXGA 4G0KA 4I2UA 4ISDA 2V6KA 1F37A 2EIQA 2X99A 3MIXA 2WFCA 2MMAA 3KD0A 2M80A 4KCEA 1YKAA 4EL1A 5ENUA 4OD7A 4G0LA 1U6TA 4K2DA 5KOXA 4KH7A 3ZFLA 2MBSA 2L57A 2XPDA 4CHSA 4IQAA 19GSA 2PUKC 3PPUA 4AJ8A 4KDUA 1Q4JA 3VLNA 2E0QA 4YQVA 2HZEB 4X43A 1PL2A 2HZEA 4USSA 1PFOA 3NOFA 3H8QA 4GRFA 1A0RP 5DQYA 1OAZA 2K18A 1Z5YE 2B5EA 2LRCA 3IE3A 1QFNA 4CY6A 3VPQA 1A8YA 3KGKA 2FCHA 1T1VA 5J9BA 1K0BA 1Z9HA 2YNXA 1PX6A 4GTUA 2EIOA 5DQSA 4L0WA 2H01A 4CY8A 3QPMA 4GQCA 3ZL5A 2HXKA 4PQIA 1EOGA 4OO5A 2C8UA 3J7Yk 2OBKA 3FZ9A 4IBPA 4OMVA 4I97A 4X4JA 5D9VA 2L5OA 3L4NA 3GIXA 5D73A 2A2PA 5IO2A 2IMIA 1WIKA 3P8WA 1Z7PA 1LU4A 3M8NA 1S3RA 1B48A 2RIIA 2CQ9A 2LEGA 2KOKA 3U5RE 3APQA 4K5RA 1WJKA 2HRFA 3A2VA 5HR2A 3K8NA 3ZVJA 2VIMA 2YN1A 3MYDA 3ZMLA 5IMCA 4MJEA 5DJMA 2VCQA 5D9TA 5ELAA 2V2GA 4HUAA 3KH9A 2LJAA 3L78A 1YJ6A 1T00A 3EINA 2H71A 1SK0A 4JR6A 1WOUA 5B8AA 2VD1A 1RQMA 1GULA 2GLRA 2O85A 4K7OA 4Z2TA 4PUAA 2QSIA 1YKCA 3IC8A 4OWYA 5EPFA 3LXTA 1OE8A 2B1KA 1U3AA 3A2WA 2AYTA 2VLVA 3TRXA 3C71A 10GSA 1GLPA 3CSJA 2I1UA 3IHQA 4F2IA 5IMZA 4LLRA 3VI7A 1SU9A 1PN9A 2HSHA 1C72A 2B5XA 3UBKA 1SKRB 1VGLA 4P3YB 1YF1A 3I69A 2LTKA 1XW9A 3GFKA 2GSTA 22GSA 1BX9A 2IPAA 2JSYA 2VAFA 3F63A 1GH2A 2LJKA 5GAND 2FA4A 3ZITA 2R0PA 2BJXA 1OC3A 1WPIA 4NV5A 4IN0A 1ILOA 2JZTA 1H4OA 1XOAA 2L6CA 2QGVA 3L9SA 3ERGA 2X8HA 4K2XA 1MDKA 4HS1A 4ZB8A 2I9HA 1QGVA 3TB2A 1JLVA 5F05A 1T4ZA 4Q5NA 5HFKA 1TU8A 3IA1A 1XOBA 3TKSA 1Y6EA 5LNKe 2G0FA 3CRUA 4ZBBA 1FOVA 2FY6A 1PN0A 1FW1A 1ZMAA 3VI5A 4JEDA 3VWXA 5DCGA 2OA7A 5J41A 3W8JA 1B4QA 2DJ3A 3HCZA 2WGRA 1GTIA 1DE1A 3P7XA 3Q6OA 1ST9A 17GSA 1XW6A 1EGOA 4CW9A 4F03A 1Y25A 3UVTA 1MD3A 1PD21 3IRAA 2JZSA 2FHEA 2CT6A 3FKFA 5D9WA 3PR8A 1GTAA 5J9CA 1A24A 3RDWA 4MA9A 2JU5A 4IKHA 3LW9A 3MWHA 1SKSB 4ZL9A 2P31A 1TXXA 3C7MA 3TOTA 4G10A 2GSQA 5CO3A 2F8AA 1J9BA 4OFNA 2CVBA 2H72A 1GNWA 3I9V2 1GUKA 3EURA 4G9HA 4TR1B 3TKQA 1O85A 1FVKA 2B6MA 2J23A 4TR1A 4DSSB 3IAS2 3IPZA 1SJ6A 3TRPA 5DDLA 4DSSA 1HNAA 3D5JA 5IM9A 3WT1A 2H1GA 5EL8A 5H5RA 4KF9A 1LJRA 4AJ7A 2E7PA 1EP7A 6GSTA 5JCWA 2N5AA 1E6BA 1JZRA 3DRNA 3ZVJD 4POKA 5ECOB 1ON4A 5H5QA 2V41A 4O7HA 1YQ1A 5G1LA 5E59A 1SD9A 3IOSA 5G30A 2GZYA 5JWOB 1XWBA 3WT2A 4ECIA 2ALBA 2LRNA 2NTOA 3M1GA 4NHZA 1IYIA 4HDEA 3APSA 1WRYA 2XPEA 3ERFA 2L59A 3IV4A 1SENA 5IIZA 2NVLA 1K3LA 5KN3A 1UN2A 3FR9A 4TRXA 5KOWA 5KN1A 4WKWA 1SYRA 4F82A 2I3YA 4ZL8A 3RAZA 3TGZA 2HZFA 3LQ7A 1ZYNA 3GKXA 1PX7A 3GV1A 2DMMA 4KGIA 1JLWA 1TJDA 2WB9A 3TKRA 1WMJA 5CAXA 4OFTA 4OO4A 4V1Ap 3FRCA 2H76A 4IJIA 1OYJA 4POMA 3E9JB 3GHAA 1TI1A 3I6AA 3M3MA 5IOWA 2P5QA 2DIZA 2N5BA 1X9MB 3TJJA 4EIPA 5IO0A 1XFLA 2C80A 3TDGA 1GL8A 4J2FA 1BG5A 3LGCA 1S3AA 1U87A 1A23A 4MPFA 4EDZA 2DJ1A 3QOUA 4HU9A 5HQPA 3HA9A 4K5SA 4EC0A 2KUCA 4MZCA 1GSSA 1ZCPA 2HNLA 5CRWA 5ECMB 3DKSA 4BVYB 5JWRB 1TI3A 4BVYA 3IBHA 2FD3A 2HRKA 2DKHA 4TVEA 1PRXA 2RM6A 3FYGA 1U88A 3VURA 4WEYA 2RUFA 5ECHB 4KAEA 13GSA
chains in the Genus database with same CATH topology
3IAM2 2C0FA 4NV2A 4V2MA 5KN0A 1O6JA 3U6VA 1HNCA 3KP9A 7GSSA 2VLUA 5LD0A 1FOHA 3WGEA 2H75A 2VCWA 1TRVA 1O8XA 2AHEA 2FLSA 5IPHA 2PERA 4ZBAA 1TTZA 4IGJA 4L5LA 2K6VA 2YZUA 1URMA 1E2YA 4RI6A 3KMOA 1NSWA 1SD8A 1B8XA 5HFIA 2GT6A 2ES7A 1ZOFA 4EDYA 1GUHA 2FUG2 4PQ1A 3V1WA 1V98A 2CZ3A 4ZBDA 2K8SA 4N0VA 2OADA 4EKZA 3C1SA 4NXIA 3R2QA 4GSSA 3EU4A 1PQNA 4PNGA 2AB6A 3QAGA 3QR6A 1XWGA 2C0DA 3L0HA 6GSXA 2PWJA 6GSSA 2HE3A 5LCZA 4MDCA 3KZQA 1G6YA 3UBLA 3EU3A 3KMNA 1FB0A 2GQKA 4H86A 2VCTA 4BWSA 1AQVA 2H0HA 4TOPA 3HVXA 5L71A 3TUEA 4MLYA 4HJ2A 2N5FA 3FHKA 2H73A 3APOA 3FR3A 4L8EA 4KA0A 5HR0A 3ME8A 1EEMA 1B9XC 4PQHA 3ZTLA 1CQHA 3CMIA 4WETA 4EUYA 4TKYA 1WE0A 1K0OA 3HJPA 4PURA 2FWGA 4WBRD 3F6DA 2I4AA 2P0GA 2MMOA 1OE7A 1W89A 3BCIA 3P90A 1X9SB 3SBCA 4DSRA 5FWGA 2YOIA 2LNSA 2QC7A 4EVMA 2B5YA 3TJFA 3ED3A 4HZ2A 4E8HA 3F4SA 2VCVA 2GDRA 1K0AA 2R5GA 1NW2A 1FAAA 4GSNA 4XS1A 4PX1A 1XWAA 1K0CA 2M46A 1BJXA 4LMVA 1QUWA 3D4TA 2NDOA 2GT5A 2L6DA 4AF2A 1TP9A 2B7KA 1AC1A 4O32A 2LS5A 4I2TA 5IOXA 5ECNB 3PGTA 4ZILA 4MABA 1MTCA 5KN2A 4MF6A 3ZZXA 4WR5A 1DE2A 5F07A 2E2GA 2CVKA 2OKAA 3M9KA 4G2EA 5D93A 2JADA 4OCEA 2L4QA 4YQMA 4EXJA 5G31A 1R4WA 3CYNA 3AY8A 2FGXA 4LMWA 3TCOA 3GTUA 2F8FA 4I8BA 1M0UA 4JZQA 3ME7A 1AW9A 3HDCA 5AIXA 1MD4A 2YWOA 2H74A 4BA7A 4Q5QA 4HZ4A 1FO5A 1FB6A 1QQ2A 2GGTA 3M0FA 4OFMA 4G0IA 1PL1A 3EC3A 2CZ2A 1R5AA 2V6OA 3DVXA 3IXRA 3QAWA 3QDNA 4RQRA 4MJBA 2JSZA 4K1FA 1K0MA 2GZZA 5GAPD 5ID2B 4YQUA 3W6GA 1GTUA 2UZ8A 5ID2A 1S3DA 4GXZA 3FZ4A 1ZYQB 3F6FA 2WZ9A 5DBQA 1K0NA 1G6WA 2ON5A 4IQ1A 1T7PB 2C0GA 3LEFA 3C1RA 1RW1A 5IPGA 1TKDB 3RPNA 5FHIA 2L4CA 3HVVA 2WRTA 3ERWA 3HY2A 3ZIVA 1HNBA 4KCAA 1F3AA 3GMFA 1QMVA 2EIRA 3EWLA 1EEJA 4MK3A 1O8WA 2VCZA 1R26A 2MZCA 5D9XA 1MEKA 3DEXA 1KTEA 3IHGA 4NMUA 5E4WA 4HI7A 5CRGA 1JZOA 4O5UA 1H75A 1ML6A 2GQLA 4POLA 1MDJA 2K9FA 3FW2A 4Z2RA 2HRNA 3GX0A 1V40A 3Q74A 4NPBA 5A4UA 4JRRA 5DALB 1I9DA 3HKRA 5DALA 3DD3A 3GKKA 3LYPA 1W4VA 4QL7A 2MBTA 4AJ6A 3F3RA 1SL0B 2KP2A 1O7UA 2D2ZA 1AQXA 4MZBA 4ECBA 2H0IA 1A2MA 4J56E 2CAIA 3MAKA 2A2SA 2RM5A 1TK5B 1AAZA 1UVZA 3GX8A 5A5KA 1Z7RA 2OJLA 3SWLA 2V1MA 3J7Yb 1K3OA 2FA8A 4POBA 2VLTA 4JR4A 1DUGA 5AISA 4FYBA 3PINA 1HYUA 4XS4B 4XS4A 6GSUA 1GSFA 1AIUA 4MCUA 4ZL7A 3DYRA 1R5PA 2PN8A 3Q19A 1XBSA 4GF0A 1ZYPA 11GSA 2YPMA 1RK4A 2JACA 12GSA 2FNOA 3E0UA 1M9AA 2H6XA 4XS6A 5C04A 2IMEA 2VM1A 4XRAA 2XHFA 4K0GA 4MF7A 1USBA 2DKIA 3KEBA 3HD5A 1PSQA 2PVQA 1MDIA 3BBYA 2IMDA 1JZDA 3N5OA 2VCXA 3GRXA 1N8JA 4YH2A 4Z7XA 1ERWA 3HZ4A 3WGXA 2E2MA 3D0ZA 1VF2A 4O5QA 1XIYA 2B3SA 4ML6A 1AQWA 4FO5A 3C73A 2YANA 2QA2A 2YZHA 2DC5A 3HHVA 1OC9B 1VF4A 3VPTA 4N0ZA 4DVCA 2H1AA 1OC9A 3VWVA 4E8EA 2F51A 2KP1A 1K0DA 1ZGNA 2XC2A 4ID0A 5C00A 1A2LA 1SL1B 1X5DA 1V58A 3IC4A 1TRSA 3ZREA 2H8LA 5ECQB 4QL9A 1V2AA 4ZIJA 4PNFA 4HU7A 2XBIA 3GURA 2PU9C 3HXSA 4GWRA 4FQUA 3RHCA 4FH8A 3GKMA 4EE0A 2CA8A 2X8CA 4GLTA 1LBKA 4JE1A 4AGSA 3H1NA 2NBSA 4TXOB 4MPGA 3DXBA 4MNNA 1XWCA 4IJ3A 4TXOA 2HLSA 3LYKA 2O7KA 3OR5A 3DVWA 1ERUA 4KSOA 1EV4A 2DLXA 4IELA 2H6YA 2YCDA 2PVOC 5KEJA 4KDYA 1HD2A 2C3NA 2CVDA 4NHWA 1SK2A 2P5RA 2X64A 5ECIB 3IK7A 2GS3A 3WYWA 1OKDA 2ZUPA 2IWTA 1F3BA 3F0IA 5AGYA 3G7IA 4I5QA 3LG6A 3KM6A 1JFUA 1ZL9A 1KNGA 4OCFA 1ABAA 4K7IA 2V32A 4RUVA 1T3BA 2OE1A 4GCIA 3DMLA 3FMWA 3A5IA 1GRXA 2IL3A 1YEPA 3FZ5A 5B6MA 2LQOA 1Z6NA 4XRDA 5JCGA 2YV7A 1XXUA 1Z6MA 2H1DA 1U3IA 2PBJA 2CX3A 4TXVA 1T4YA 2YJ7A 2R0GA 1PKWA 2H70A 3FK8A 3O76A 2CX4A 4NAXA 5JWQB 2R3XA 3MNGA 1I5GA 1QXHA 1M99A 2ON7A 4N10A 2YWMA 4BL7B 2H30A 3L9UA 1GSYA 3H93A 3R3EA 4BL7A 4EIQA 1EP8A 2AJQB 1ZZYA 1ERVA 4PTSA 2FWEA 5ECKB 2BMXA 3L9VA 4ICYA 4GQFA 4Q5FA 4HQZA 1HQOA 4GSTA 2DJ0A 4YKFA 1B9YC 3D6IA 2CV4A 3G9BA 2NPBA 2AAWA 2JZRA 3G7YA 1CQGA 5CRDA 3O6TA 5HR1A 1KEBA 3BD2A 4G19A 3DIEA 3WGDA 3HVSA 3LJRA 4BPYA 2H0GA 2VL9A 1X5CA 3EMPA 2X4AA 3JCML 2IJYA 1R7HA 3QD9A 1SJIA 2HSMA 4HOJA 2JL4A 1SK1A 3GA4A 4K9ZA 3D21A 3ZYWA 4EO3A 1TOFA 5D8IA 2F3MA 4IP6A 5JCUA 4LL1B 5AN1A 3GSTA 2LUSA 5BMUA 5BRTA 5ABRA 2VL2A 2YV9A 1VF1A 4A5PA 5HFGA 1F9MA 4L0UA 2OBIA 1X0RA 4MF5A 2ZCTA 2LRTA 1M2AA 4F0CA 5DAKB 1X5EA 2H66A 5DAKA 2LKUA 1VF3A 1BAYA 4KW6A 5DCHA 4KUNA 2X49A 3EE2A 2M72A 4ECCA 3QCPA 5CNWA 5F0GA 4V2LA 3GSSA 3H4KA 4MJAA 4Q5RA 3O3TA 3CRTA 2VD0A 3MSZA 1IYHA 3H79A 2FWHA 5DVBA 4X0XA 2TRXA 1TK0B 1WP0A 4LA1A 4D73B 3NZNA 2QA1A 1GWCA 4D73A 4WF4A 2IMKA 5ECLB 5COHA 5IMVA 3GUSA 1OKTA 2VO4A 1A2JA 2GZPA 3EYTA 3NIVA 1Z3EA 4FIWA 1NHOA 4BVXB 5IQYA 1PKZA 1M7TA 3EPTA 3UAPA 5ELGA 4BVXA 3GTUB 3N9JA 3TOUA 2C3QA 4I6XA 1YF0A 2R2JA 5IMFA 2RUEA 6GSVA 1SJZA 1O73A 3BOAA 1EWXA 1G0TA 1DSBA 4FYUA 2GVPA 5IMAA 2IFQB 3PH9A 3EVIA 3HJOA 1M2BA 2IFQA 5IMDA 3LXZA 5CRHA 18GSA 4DSQA 1KBNA 3CSHA 1WWJA 3UL3A 3ISOA 3DGQA 2ZNMA 2VL3A 1X9WB 3KXOA 2DMLA 2MMZA 2H19A 1ZYEA 3D22A 3Q18A 2WJUA 1GTBA 1JZWA 4MP4A 1NM3A 5G2ZA 2X8GA 4IW9A 5ECSA 1S3CA 1XCCA 2GSRA 4WR4A 4RI7A 3RHBA 1J0FA 3KCMA 3LORA 4J57E 2K8VA 1QK8A 5D96A 4NWYA 5J3RA 1M9BA 2LJRA 3P2AA 1AXDA 1XZOA 3BJ5A 1VRSD 4MZWA 3GL5A 3HJMA 3UOMA 3UIWA 1UC7A 4K6XA 1V9WA 2HSYA 5G5EA 2A4VA 4XCSA 5GSSA 3IR4A 20GSA 6GSWA 3CTGA 3FZAA 2L5LA 3GYKA 2C3TA 2FWFA 1THXA 3GL3A 1PGTA 3UARA 1OC8A 1GP1A 4IS0A 4TR4A 2VM2A 2Z9SA 3WD6A 2A2RA 1GNEA 4JBBA 3KIJA 1M2DA 1JHBA 2C0EA 2GTUA 2VL2C 4XTSA 2R6KA 4ECJA 2HFDA 5CREA 2WS2A 2O89A 1GLQA 3FEUA 4KB3A 2HRAA 5FT3A 4N30A 1F6MC 1SKWB 1OVNA 1T8EB 1AUCA 1GUMA 3IDVA 2J9HA 3ZFBA 2AV4A 2PGTA 1TK8B 2OACA 3UVHA 4F9ZA 3G7JA 2IIYA 2WDUA 1EV9A 3ZRDA 4O92A 1XPVA 9GSSA 1EGRA 5G5FA 4WF5A 1FG4A 4FYCA 3M9JA 5B7CA 4PXOA 4KX4A 1XVWA 3TKPA 4N11A 4IHUA 1NHYA 1TW9A 2KHPA 3KH7A 1A8LA 2A4HA 1N2AA 2DBCA 3F8UA 3W8SA 4ZB9A 2R4VA 3GNJA 3LSZA 3I43A 4PGTA 3S9FA 4V2NA 2IMFA 2G2QA 4HQSA 5HR3A 5A4VA 1XW5A 2PPTA 4K7NA 4TR0A 2DJJA 1PA3A 2EC4A 4KDXA 5B8BA 2MMNA 5G1KA 2GSSA 2H1BA 4O5RA 2O8VB 3QMXA 2CAQA 4MH3A 3GH9A 4MJCA 1YY7A 1GSUA 3TRQA 2LV3A 4CDOA 3UMAA 4QQ7A 2WULA 2YWIA 3VFIA 2C4JA 3HYPA 1G7EA 4JU5A 5CYYA 1YDKA 4BWQA 3GH6A 4Z2UA 4F0BA 2OE0A 4IP1A 1TDIA 5GZZB 2WCIA 6GSYA 3RBTA 1UA5A 1K3YA 4WBJA 5AIVA 4TN8A 4ML1A 1SYXA 3KTBA 4K0NA 2LSTA 5J5NA 3UJ1A 4XIHA 3US3A 5A4WA 4WXTA 5GSTA 1DBYA 4HEA2 3TJGA 2BTOT 3TKSE 1J08A 1ERTA 1YEXA 1GSDA 1XWKA 2TIRA 3F3QA 3FY7A 3LFLA 3FR6A 1A0FA 2RLIA 3A2XA 2C1YA 1B4PA 1SL2B 3CSIA 3UEMA 5H5SA 5J4UA 3TJBA 3CBUA 4DEJA 4MMMA 3GKNA 3HZ8A 4PUFC 3A5WA 3KP8A 2AUVA 4V1Ag 1O81A 1TU7A 4ZB6A 1FHEA 2OE3A 4RQXA 4LL4B 3KJYA 1BQ7A 16GSA 3VK9A 2I81A 4YAPA 2DJKA 2LNTA 1Q98A 4ACSA 4KSMA 14GSA 1ACVA 3ZLPA 2VUPA 2PMTA 1TRWA 3RPPA 3TKSC 4TW5A 3F4TA 1G7OA 2O87A 2YJHA 1YZXA 3LWAA 8GSSA 5F06A 5DJLA 2HYXA 4L5OA 3ZMKA 5ECPB 1EZKA 2IN3A 1THOA 1GSEA 3F4RA 2YP6A 2HT9A 2TRCP 4EF0A 3VWWA 2KLXA 2F9SA 2R0CA 2YWNA 3DWVA 2B1LA 5F8BA 3KTLA 4IVFA 2MYGA 1BEDA 3F9UA 4XHMA 3IK9A 2HI7A 5EY6A 2QKEA 2XBQA 4K8MA 5CP1A 2DSAA 2VOCA 3TJKA 4ZXGA 2DJ2A 2B7JA 3GN3A 3QFBC 2GQMA 4KE3A 4TR3A 3D4MA 5EVOA 4ILFA 4MH2A 3ZIJA 2REMA 3C8EA 4HJMA 5INYA 3CTFA 3QFAC 1BYEA 3BCKA 2DIYA 1PMTA 3A3TA 4KNDA 1EOHA 3QAVA 1V57A 1F2EA 3MDKA 2LQQA 2H6ZA 4YKGA 1TRUA 3E3EA 3VWUA 2R37A 4ULXA 4X1UA 1XVQA 4YAVA 5B6NA 3EMXA 1GSQA 5ECRB 1FVJA 3CXGA 4G0KA 4I2UA 4ISDA 2V6KA 1F37A 2EIQA 2X99A 3MIXA 2WFCA 2MMAA 3KD0A 2M80A 4KCEA 1YKAA 4EL1A 5ENUA 4OD7A 4G0LA 1U6TA 4K2DA 5KOXA 4KH7A 3ZFLA 2MBSA 2L57A 2XPDA 4CHSA 4IQAA 19GSA 2PUKC 3PPUA 4AJ8A 4KDUA 1Q4JA 3VLNA 2E0QA 4YQVA 2HZEB 4X43A 1PL2A 2HZEA 4USSA 3NOFA 3H8QA 4GRFA 1A0RP 5DQYA 1OAZA 2K18A 1Z5YE 2B5EA 2LRCA 3IE3A 1QFNA 4CY6A 3VPQA 1A8YA 3KGKA 2FCHA 1T1VA 5J9BA 1K0BA 1Z9HA 2YNXA 1PX6A 4GTUA 2EIOA 5DQSA 4L0WA 2H01A 4CY8A 3QPMA 4GQCA 3ZL5A 2HXKA 4PQIA 1EOGA 4OO5A 2C8UA 3J7Yk 2OBKA 3FZ9A 4IBPA 4OMVA 4I97A 4X4JA 5D9VA 2L5OA 3L4NA 3GIXA 5D73A 2A2PA 5IO2A 2IMIA 1WIKA 3P8WA 1Z7PA 1LU4A 3M8NA 1B48A 2RIIA 2CQ9A 2LEGA 2KOKA 3U5RE 3APQA 4K5RA 1WJKA 2HRFA 3A2VA 5HR2A 3K8NA 3ZVJA 2VIMA 2YN1A 3MYDA 3ZMLA 5IMCA 4MJEA 5DJMA 2VCQA 5D9TA 5ELAA 2V2GA 4HUAA 3KH9A 2LJAA 3L78A 1YJ6A 1T00A 3EINA 2H71A 1SK0A 4JR6A 1WOUA 5B8AA 2VD1A 1RQMA 1GULA 2GLRA 2O85A 4K7OA 4Z2TA 4PUAA 2QSIA 1YKCA 3IC8A 4OWYA 5EPFA 3LXTA 1OE8A 2B1KA 1U3AA 3A2WA 2AYTA 2VLVA 3TRXA 3C71A 10GSA 1GLPA 3CSJA 2I1UA 3IHQA 4F2IA 5IMZA 4LLRA 3VI7A 1SU9A 1PN9A 2HSHA 1C72A 2B5XA 3UBKA 1SKRB 1VGLA 4P3YB 1YF1A 3I69A 2LTKA 1XW9A 3GFKA 2GSTA 22GSA 1BX9A 2IPAA 2JSYA 2VAFA 3F63A 1GH2A 2LJKA 5GAND 2FA4A 3ZITA 2R0PA 2BJXA 1OC3A 1WPIA 4NV5A 4IN0A 1ILOA 2JZTA 1H4OA 1XOAA 2L6CA 2QGVA 3L9SA 3ERGA 2X8HA 4K2XA 1MDKA 4HS1A 4ZB8A 2I9HA 1QGVA 3TB2A 1JLVA 5F05A 1T4ZA 4Q5NA 5HFKA 1TU8A 3IA1A 1XOBA 3TKSA 1Y6EA 5LNKe 2G0FA 3CRUA 4ZBBA 1FOVA 2FY6A 1PN0A 1FW1A 1ZMAA 3VI5A 4JEDA 3VWXA 5DCGA 2OA7A 5J41A 3W8JA 1B4QA 2DJ3A 3HCZA 2WGRA 1GTIA 1DE1A 3P7XA 3Q6OA 1ST9A 17GSA 1XW6A 1EGOA 4CW9A 4F03A 1Y25A 3UVTA 1MD3A 1PD21 3IRAA 2JZSA 2FHEA 2CT6A 3FKFA 5D9WA 3PR8A 1GTAA 5J9CA 1A24A 3RDWA 4MA9A 2JU5A 4IKHA 3LW9A 3MWHA 1SKSB 4ZL9A 2P31A 1TXXA 3C7MA 3TOTA 4G10A 2GSQA 5CO3A 2F8AA 1J9BA 4OFNA 2CVBA 2H72A 1GNWA 3I9V2 1GUKA 3EURA 4G9HA 4TR1B 3TKQA 1O85A 1FVKA 2B6MA 2J23A 4TR1A 4DSSB 3IAS2 3IPZA 1SJ6A 3TRPA 5DDLA 4DSSA 1HNAA 3D5JA 5IM9A 3WT1A 2H1GA 5EL8A 5H5RA 4KF9A 1LJRA 4AJ7A 2E7PA 1EP7A 6GSTA 5JCWA 2N5AA 1E6BA 1JZRA 3DRNA 3ZVJD 4POKA 5ECOB 1ON4A 5H5QA 2V41A 4O7HA 1YQ1A 5G1LA 5E59A 1SD9A 3IOSA 5G30A 2GZYA 5JWOB 1XWBA 3WT2A 4ECIA 2ALBA 2LRNA 2NTOA 3M1GA 4NHZA 1IYIA 4HDEA 3APSA 1WRYA 2XPEA 3ERFA 2L59A 3IV4A 1SENA 5IIZA 2NVLA 1K3LA 5KN3A 1UN2A 3FR9A 4TRXA 5KOWA 5KN1A 4WKWA 1SYRA 4F82A 2I3YA 4ZL8A 3RAZA 3TGZA 2HZFA 3LQ7A 1ZYNA 3GKXA 1PX7A 3GV1A 2DMMA 4KGIA 1JLWA 1TJDA 2WB9A 3TKRA 1WMJA 5CAXA 4OFTA 4OO4A 4V1Ap 3FRCA 2H76A 4IJIA 1OYJA 4POMA 3E9JB 3GHAA 1TI1A 3I6AA 3M3MA 5IOWA 2P5QA 2DIZA 2N5BA 1X9MB 3TJJA 4EIPA 5IO0A 1XFLA 2C80A 3TDGA 1GL8A 4J2FA 1BG5A 3LGCA 1S3AA 1U87A 1A23A 4MPFA 4EDZA 2DJ1A 3QOUA 4HU9A 5HQPA 3HA9A 4K5SA 4EC0A 2KUCA 4MZCA 1GSSA 1ZCPA 2HNLA 5CRWA 5ECMB 3DKSA 4BVYB 5JWRB 1TI3A 4BVYA 3IBHA 2FD3A 2HRKA 2DKHA 4TVEA 1PRXA 2RM6A 3FYGA 1U88A 3VURA 4WEYA 2RUFA 5ECHB 4KAEA 13GSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IAM 2;  2C0F A;  4NV2 A;  4V2M A;  5KN0 A;  1O6J A;  3U6V A;  1HNC A;  3KP9 A;  7GSS A;  2VLU A;  5LD0 A;  3WGE A;  2H75 A;  2VCW A;  1TRV A;  1O8X A;  2AHE A;  2FLS A;  5IPH A;  2PER A;  4ZBA A;  1TTZ A;  4IGJ A;  4L5L A;  2K6V A;  2YZU A;  1URM A;  1E2Y A;  4RI6 A;  3KMO A;  1NSW A;  1SD8 A;  1B8X A;  5HFI A;  2GT6 A;  2ES7 A;  1ZOF A;  4EDY A;  1GUH A;  2FUG 2;  4PQ1 A;  3V1W A;  1V98 A;  2CZ3 A;  4ZBD A;  2K8S A;  4N0V A;  2OAD A;  4EKZ A;  3C1S A;  4NXI A;  3R2Q A;  4GSS A;  3EU4 A;  1PQN A;  4PNG A;  2AB6 A;  3QAG A;  3QR6 A;  1XWG A;  2C0D A;  3L0H A;  6GSX A;  2PWJ A;  6GSS A;  2HE3 A;  5LCZ A;  4MDC A;  3KZQ A;  1G6Y A;  3UBL A;  3EU3 A;  3KMN A;  1FB0 A;  2GQK A;  4H86 A;  2VCT A;  4BWS A;  1AQV A;  2H0H A;  4TOP A;  3HVX A;  5L71 A;  3TUE A;  4MLY A;  4HJ2 A;  2N5F A;  3FHK A;  2H73 A;  3APO A;  3FR3 A;  4L8E A;  4KA0 A;  5HR0 A;  3ME8 A;  1EEM A;  1B9X C;  4PQH A;  3ZTL A;  1CQH A;  3CMI A;  4WET A;  4EUY A;  4TKY A;  1WE0 A;  1K0O A;  3HJP A;  4PUR A;  2FWG A;  4WBR D;  3F6D A;  2I4A A;  2P0G A;  2MMO A;  1OE7 A;  1W89 A;  3BCI A;  3P90 A;  1X9S B;  3SBC A;  4DSR A;  5FWG A;  2YOI A;  2LNS A;  2QC7 A;  4EVM A;  2B5Y A;  3TJF A;  3ED3 A;  4HZ2 A;  4E8H A;  3F4S A;  2VCV A;  2GDR A;  1K0A A;  2R5G A;  1NW2 A;  1FAA A;  4GSN A;  4XS1 A;  4PX1 A;  1XWA A;  1K0C A;  2M46 A;  1BJX A;  4LMV A;  1QUW A;  3D4T A;  2NDO A;  2GT5 A;  2L6D A;  4AF2 A;  1TP9 A;  2B7K A;  1AC1 A;  4O32 A;  2LS5 A;  4I2T A;  5IOX A;  5ECN B;  3PGT A;  4ZIL A;  4MAB A;  1MTC A;  5KN2 A;  4MF6 A;  3ZZX A;  4WR5 A;  1DE2 A;  5F07 A;  2E2G A;  2CVK A;  2OKA A;  3M9K A;  4G2E A;  5D93 A;  2JAD A;  4OCE A;  2L4Q A;  4YQM A;  4EXJ A;  5G31 A;  1R4W A;  3CYN A;  3AY8 A;  2FGX A;  4LMW A;  3TCO A;  3GTU A;  2F8F A;  4I8B A;  1M0U A;  4JZQ A;  3ME7 A;  1AW9 A;  3HDC A;  5AIX A;  1MD4 A;  2YWO A;  2H74 A;  4BA7 A;  4Q5Q A;  4HZ4 A;  1FO5 A;  1FB6 A;  1QQ2 A;  2GGT A;  3M0F A;  4OFM A;  1PL1 A;  3EC3 A;  2CZ2 A;  1R5A A;  2V6O A;  3DVX A;  3IXR A;  3QAW A;  3QDN A;  4RQR A;  4MJB A;  2JSZ A;  4K1F A;  1K0M A;  2GZZ A;  5GAP D;  5ID2 B;  4YQU A;  3W6G A;  1GTU A;  5ID2 A;  1S3D A;  4GXZ A;  3FZ4 A;  1ZYQ B;  3F6F A;  2WZ9 A;  5DBQ A;  1K0N A;  1G6W A;  2ON5 A;  4IQ1 A;  1T7P B;  2C0G A;  3LEF A;  3C1R A;  1RW1 A;  5IPG A;  1TKD B;  3RPN A;  5FHI A;  2L4C A;  3HVV A;  2WRT A;  3ERW A;  3HY2 A;  3ZIV A;  1HNB A;  4KCA A;  1F3A A;  3GMF A;  1QMV A;  2EIR A;  3EWL A;  1EEJ A;  4MK3 A;  1O8W A;  2VCZ A;  1R26 A;  2MZC A;  5D9X A;  1MEK A;  3DEX A;  1KTE A;  4NMU A;  5E4W A;  4HI7 A;  5CRG A;  1JZO A;  1H75 A;  1ML6 A;  2GQL A;  4POL A;  1MDJ A;  2K9F A;  3FW2 A;  2HRN A;  3GX0 A;  1V40 A;  3Q74 A;  4NPB A;  5A4U A;  4JRR A;  5DAL B;  1I9D A;  3HKR A;  5DAL A;  3DD3 A;  3GKK A;  3LYP A;  1W4V A;  4QL7 A;  2MBT A;  4AJ6 A;  3F3R A;  1SL0 B;  2KP2 A;  1O7U A;  2D2Z A;  1AQX A;  4MZB A;  4ECB A;  2H0I A;  1A2M A;  4J56 E;  2CAI A;  3MAK A;  2A2S A;  2RM5 A;  1TK5 B;  1AAZ A;  1UVZ A;  3GX8 A;  5A5K A;  1Z7R A;  2OJL A;  3SWL A;  2V1M A;  3J7Y b;  1K3O A;  2FA8 A;  4POB A;  2VLT A;  4JR4 A;  1DUG A;  5AIS A;  4FYB A;  3PIN A;  1HYU A;  4XS4 B;  4XS4 A;  6GSU A;  1GSF A;  1AIU A;  4MCU A;  4ZL7 A;  3DYR A;  1R5P A;  2PN8 A;  3Q19 A;  1XBS A;  4GF0 A;  11GS A;  2YPM A;  1RK4 A;  2JAC A;  12GS A;  2FNO A;  3E0U A;  1M9A A;  2H6X A;  4XS6 A;  5C04 A;  2IME A;  2VM1 A;  4XRA A;  2XHF A;  4K0G A;  4MF7 A;  1USB A;  3KEB A;  3HD5 A;  1PSQ A;  2PVQ A;  1MDI A;  3BBY A;  2IMD A;  1JZD A;  3N5O A;  2VCX A;  3GRX A;  1N8J A;  4YH2 A;  4Z7X A;  1ERW A;  3HZ4 A;  3WGX A;  2E2M A;  3D0Z A;  1VF2 A;  1XIY A;  2B3S A;  4ML6 A;  1AQW A;  4FO5 A;  3C73 A;  2YAN A;  2YZH A;  2DC5 A;  3HHV A;  1OC9 B;  1VF4 A;  3VPT A;  4N0Z A;  4DVC A;  2H1A A;  1OC9 A;  3VWV A;  4E8E A;  2F51 A;  2KP1 A;  1K0D A;  1ZGN A;  2XC2 A;  4ID0 A;  5C00 A;  1A2L A;  1SL1 B;  1X5D A;  1V58 A;  3IC4 A;  1TRS A;  3ZRE A;  2H8L A;  5ECQ B;  4QL9 A;  1V2A A;  4ZIJ A;  4PNF A;  4HU7 A;  2XBI A;  3GUR A;  2PU9 C;  3HXS A;  4GWR A;  3RHC A;  4FH8 A;  3GKM A;  4EE0 A;  2CA8 A;  2X8C A;  4GLT A;  1LBK A;  4JE1 A;  4AGS A;  3H1N A;  2NBS A;  4TXO B;  4MPG A;  3DXB A;  1XWC A;  4IJ3 A;  4TXO A;  2HLS A;  3LYK A;  2O7K A;  3OR5 A;  3DVW A;  1ERU A;  4KSO A;  1EV4 A;  2DLX A;  4IEL A;  2H6Y A;  2YCD A;  2PVO C;  5KEJ A;  4KDY A;  1HD2 A;  2C3N A;  2CVD A;  4NHW A;  1SK2 A;  2P5R A;  2X64 A;  5ECI B;  3IK7 A;  2GS3 A;  3WYW A;  1OKD A;  2ZUP A;  2IWT A;  1F3B A;  3F0I A;  5AGY A;  3G7I A;  4I5Q A;  3LG6 A;  3KM6 A;  1JFU A;  1ZL9 A;  1KNG A;  4OCF A;  1ABA A;  4K7I A;  2V32 A;  4RUV A;  1T3B A;  2OE1 A;  4GCI A;  3DML A;  1GRX A;  2IL3 A;  1YEP A;  3FZ5 A;  5B6M A;  2LQO A;  1Z6N A;  4XRD A;  5JCG A;  2YV7 A;  1XXU A;  1Z6M A;  2H1D A;  1U3I A;  2PBJ A;  2CX3 A;  4TXV A;  1T4Y A;  2YJ7 A;  1PKW A;  2H70 A;  3FK8 A;  3O76 A;  2CX4 A;  4NAX A;  5JWQ B;  2R3X A;  3MNG A;  1I5G A;  1QXH A;  1M99 A;  2ON7 A;  4N10 A;  2YWM A;  2H30 A;  3L9U A;  1GSY A;  3H93 A;  4BL7 A;  1EP8 A;  2AJQ B;  1ZZY A;  1ERV A;  5ECK B;  2FWE A;  2BMX A;  3L9V A;  4GQF A;  4Q5F A;  4HQZ A;  1HQO A;  4GST A;  2DJ0 A;  1B9Y C;  3D6I A;  2CV4 A;  3G9B A;  2NPB A;  2AAW A;  2JZR A;  3G7Y A;  1CQG A;  5CRD A;  3O6T A;  5HR1 A;  1KEB A;  3BD2 A;  4G19 A;  3DIE A;  3WGD A;  3HVS A;  3LJR A;  4BPY A;  2H0G A;  2VL9 A;  1X5C A;  3EMP A;  3JCM L;  2IJY A;  1R7H A;  3QD9 A;  1SJI A;  4HOJ A;  2JL4 A;  1SK1 A;  3GA4 A;  4K9Z A;  3D21 A;  3ZYW A;  4EO3 A;  1TOF A;  5D8I A;  2F3M A;  4IP6 A;  5JCU A;  4LL1 B;  5AN1 A;  3GST A;  2LUS A;  5ABR A;  2VL2 A;  2YV9 A;  1VF1 A;  5HFG A;  1F9M A;  4L0U A;  2OBI A;  1X0R A;  4MF5 A;  2ZCT A;  2LRT A;  1M2A A;  4F0C A;  5DAK B;  1X5E A;  2H66 A;  5DAK A;  2LKU A;  1VF3 A;  1BAY A;  4KW6 A;  5DCH A;  4KUN A;  3EE2 A;  2M72 A;  4ECC A;  3QCP A;  5CNW A;  5F0G A;  4V2L A;  3GSS A;  3H4K A;  4MJA A;  4Q5R A;  3O3T A;  3CRT A;  2VD0 A;  3MSZ A;  1IYH A;  3H79 A;  2FWH A;  5DVB A;  4X0X A;  2TRX A;  1TK0 B;  1WP0 A;  4LA1 A;  4D73 B;  3NZN A;  1GWC A;  4D73 A;  4WF4 A;  2IMK A;  5ECL B;  5COH A;  5IMV A;  3GUS A;  1OKT A;  2VO4 A;  1A2J A;  2GZP A;  3EYT A;  3NIV A;  1Z3E A;  4FIW A;  1NHO A;  5IQY A;  1PKZ A;  1M7T A;  3UAP A;  5ELG A;  4BVX A;  3GTU B;  3N9J A;  3TOU A;  2C3Q A;  4I6X A;  1YF0 A;  2R2J A;  5IMF A;  2RUE A;  6GSV A;  1SJZ A;  1O73 A;  3BOA A;  1EWX A;  1G0T A;  1DSB A;  4FYU A;  2GVP A;  5IMA A;  2IFQ B;  3PH9 A;  3EVI A;  3HJO A;  1M2B A;  2IFQ A;  5IMD A;  3LXZ A;  5CRH A;  18GS A;  4DSQ A;  1KBN A;  3CSH A;  1WWJ A;  3UL3 A;  3ISO A;  3DGQ A;  2ZNM A;  2VL3 A;  1X9W B;  3KXO A;  2DML A;  2MMZ A;  2H19 A;  1ZYE A;  3D22 A;  3Q18 A;  2WJU A;  1GTB A;  1JZW A;  4MP4 A;  1NM3 A;  5G2Z A;  2X8G A;  4IW9 A;  5ECS A;  1S3C A;  1XCC A;  2GSR A;  4WR4 A;  4RI7 A;  3RHB A;  1J0F A;  3KCM A;  3LOR A;  4J57 E;  2K8V A;  1QK8 A;  5D96 A;  4NWY A;  5J3R A;  1M9B A;  2LJR A;  3P2A A;  1AXD A;  1XZO A;  3BJ5 A;  1VRS D;  4MZW A;  3GL5 A;  3HJM A;  3UOM A;  3UIW A;  1UC7 A;  4K6X A;  1V9W A;  2HSY A;  5G5E A;  2A4V A;  4XCS A;  5GSS A;  3IR4 A;  20GS A;  6GSW A;  3CTG A;  3FZA A;  2L5L A;  3GYK A;  2C3T A;  2FWF A;  1THX A;  3GL3 A;  1PGT A;  3UAR A;  1OC8 A;  1GP1 A;  4IS0 A;  4TR4 A;  2VM2 A;  2Z9S A;  3WD6 A;  2A2R A;  1GNE A;  4JBB A;  3KIJ A;  1M2D A;  1JHB A;  2C0E A;  2GTU A;  2VL2 C;  4XTS A;  2R6K A;  4ECJ A;  2HFD A;  5CRE A;  2WS2 A;  2O89 A;  1GLQ A;  3FEU A;  4KB3 A;  5FT3 A;  4N30 A;  1F6M C;  1SKW B;  1OVN A;  1T8E B;  1AUC A;  1GUM A;  3IDV A;  2J9H A;  3ZFB A;  2AV4 A;  2PGT A;  1TK8 B;  2OAC A;  3UVH A;  4F9Z A;  3G7J A;  2IIY A;  2WDU A;  1EV9 A;  3ZRD A;  4O92 A;  1XPV A;  9GSS A;  1EGR A;  5G5F A;  4WF5 A;  1FG4 A;  4FYC A;  3M9J A;  5B7C A;  4PXO A;  4KX4 A;  1XVW A;  3TKP A;  4N11 A;  4IHU A;  1NHY A;  1TW9 A;  2KHP A;  3KH7 A;  1A8L A;  1N2A A;  2DBC A;  3F8U A;  3W8S A;  4ZB9 A;  2R4V A;  3GNJ A;  3LSZ A;  3I43 A;  4PGT A;  3S9F A;  4V2N A;  2IMF A;  2G2Q A;  4HQS A;  5HR3 A;  5A4V A;  1XW5 A;  2PPT A;  4K7N A;  4TR0 A;  2DJJ A;  1PA3 A;  2EC4 A;  4KDX A;  5B8B A;  2MMN A;  5G1K A;  2GSS A;  2H1B A;  4O5R A;  2O8V B;  3QMX A;  2CAQ A;  4MH3 A;  3GH9 A;  4MJC A;  1YY7 A;  1GSU A;  3TRQ A;  2LV3 A;  4CDO A;  3UMA A;  4QQ7 A;  2WUL A;  2YWI A;  3VFI A;  2C4J A;  3HYP A;  1G7E A;  4JU5 A;  5CYY A;  1YDK A;  4BWQ A;  3GH6 A;  4F0B A;  2OE0 A;  4IP1 A;  1TDI A;  5GZZ B;  2WCI A;  6GSY A;  3RBT A;  1UA5 A;  1K3Y A;  4WBJ A;  5AIV A;  4TN8 A;  4ML1 A;  1SYX A;  3KTB A;  4K0N A;  2LST A;  5J5N A;  3UJ1 A;  4XIH A;  3US3 A;  5A4W A;  4WXT A;  5GST A;  1DBY A;  4HEA 2;  3TJG A;  2BTO T;  3TKS E;  1J08 A;  1ERT A;  1YEX A;  1GSD A;  1XWK A;  2TIR A;  3F3Q A;  3FY7 A;  3LFL A;  3FR6 A;  1A0F A;  2RLI A;  3A2X A;  2C1Y A;  1B4P A;  1SL2 B;  3CSI A;  3UEM A;  5H5S A;  5J4U A;  3TJB A;  3CBU A;  4DEJ A;  4MMM A;  3GKN A;  3HZ8 A;  4PUF C;  3A5W A;  3KP8 A;  2AUV A;  4V1A g;  1O81 A;  1TU7 A;  4ZB6 A;  1FHE A;  2OE3 A;  4RQX A;  4LL4 B;  3KJY A;  1BQ7 A;  16GS A;  3VK9 A;  2I81 A;  4YAP A;  2DJK A;  2LNT A;  1Q98 A;  4ACS A;  4KSM A;  14GS A;  1ACV A;  3ZLP A;  2VUP A;  2PMT A;  1TRW A;  3RPP A;  3TKS C;  4TW5 A;  3F4T A;  1G7O A;  2O87 A;  2YJH A;  1YZX A;  3LWA A;  8GSS A;  5F06 A;  5DJL A;  2HYX A;  4L5O A;  3ZMK A;  5ECP B;  1EZK A;  2IN3 A;  1THO A;  1GSE A;  3F4R A;  2YP6 A;  2HT9 A;  2TRC P;  4EF0 A;  3VWW A;  2KLX A;  2F9S A;  2YWN A;  3DWV A;  2B1L A;  5F8B A;  3KTL A;  4IVF A;  2MYG A;  1BED A;  3F9U A;  4XHM A;  3IK9 A;  2HI7 A;  5EY6 A;  2QKE A;  2XBQ A;  4K8M A;  5CP1 A;  2DSA A;  2VOC A;  3TJK A;  4ZXG A;  2DJ2 A;  2B7J A;  3GN3 A;  3QFB C;  2GQM A;  4KE3 A;  4TR3 A;  3D4M A;  5EVO A;  4ILF A;  4MH2 A;  3ZIJ A;  2REM A;  3C8E A;  4HJM A;  5INY A;  3CTF A;  3QFA C;  1BYE A;  3BCK A;  2DIY A;  1PMT A;  3A3T A;  4KND A;  1EOH A;  3QAV A;  1V57 A;  1F2E A;  3MDK A;  2LQQ A;  2H6Z A;  1TRU A;  3E3E A;  3VWU A;  2R37 A;  4ULX A;  4X1U A;  1XVQ A;  4YAV A;  5B6N A;  3EMX A;  1GSQ A;  5ECR B;  1FVJ A;  3CXG A;  4I2U A;  4ISD A;  2V6K A;  1F37 A;  2EIQ A;  2X99 A;  2WFC A;  2MMA A;  3KD0 A;  2M80 A;  4KCE A;  1YKA A;  4EL1 A;  5ENU A;  4OD7 A;  1U6T A;  4K2D A;  4KH7 A;  3ZFL A;  2MBS A;  2L57 A;  2XPD A;  4CHS A;  4IQA A;  19GS A;  2PUK C;  4AJ8 A;  4KDU A;  1Q4J A;  3VLN A;  2E0Q A;  4YQV A;  2HZE B;  4X43 A;  1PL2 A;  2HZE A;  3NOF A;  3H8Q A;  4GRF A;  1A0R P;  5DQY A;  1OAZ A;  2K18 A;  1Z5Y E;  2B5E A;  2LRC A;  3IE3 A;  1QFN A;  3VPQ A;  1A8Y A;  3KGK A;  2FCH A;  1T1V A;  5J9B A;  1K0B A;  1Z9H A;  2YNX A;  1PX6 A;  4GTU A;  2EIO A;  5DQS A;  4L0W A;  2H01 A;  3QPM A;  4GQC A;  3ZL5 A;  2HXK A;  4PQI A;  1EOG A;  4OO5 A;  2C8U A;  3J7Y k;  2OBK A;  3FZ9 A;  4IBP A;  4OMV A;  4I97 A;  5D9V A;  2L5O A;  3L4N A;  3GIX A;  5D73 A;  5IO2 A;  2IMI A;  1WIK A;  3P8W A;  1Z7P A;  1LU4 A;  3M8N A;  1B48 A;  2RII A;  2CQ9 A;  2LEG A;  2KOK A;  3U5R E;  3APQ A;  1WJK A;  2HRF A;  3A2V A;  5HR2 A;  3K8N A;  3ZVJ A;  2VIM A;  2YN1 A;  3ZML A;  5IMC A;  4MJE A;  5DJM A;  2VCQ A;  5D9T A;  5ELA A;  2V2G A;  4HUA A;  3KH9 A;  2LJA A;  3L78 A;  1YJ6 A;  1T00 A;  3EIN A;  2H71 A;  1SK0 A;  4JR6 A;  1WOU A;  5B8A A;  2VD1 A;  1RQM A;  1GUL A;  2GLR A;  2O85 A;  4K7O A;  4PUA A;  2QSI A;  1YKC A;  4OWY A;  5EPF A;  3LXT A;  1OE8 A;  2B1K A;  1U3A A;  3A2W A;  2AYT A;  2VLV A;  3TRX A;  3C71 A;  10GS A;  1GLP A;  3CSJ A;  2I1U A;  3IHQ A;  4F2I A;  5IMZ A;  4LLR A;  3VI7 A;  1SU9 A;  1PN9 A;  2HSH A;  1C72 A;  2B5X A;  3UBK A;  1SKR B;  1VGL A;  4P3Y B;  1YF1 A;  3I69 A;  2LTK A;  1XW9 A;  3GFK A;  2GST A;  22GS A;  1BX9 A;  2IPA A;  2JSY A;  2VAF A;  3F63 A;  1GH2 A;  2LJK A;  5GAN D;  2FA4 A;  3ZIT A;  2BJX A;  1OC3 A;  1WPI A;  4NV5 A;  4IN0 A;  1ILO A;  2JZT A;  1H4O A;  1XOA A;  2L6C A;  2QGV A;  3L9S A;  3ERG A;  2X8H A;  1MDK A;  4HS1 A;  4ZB8 A;  2I9H A;  1QGV A;  3TB2 A;  1JLV A;  5F05 A;  1T4Z A;  4Q5N A;  5HFK A;  1TU8 A;  3IA1 A;  1XOB A;  3TKS A;  1Y6E A;  5LNK e;  2G0F A;  3CRU A;  4ZBB A;  1FOV A;  2FY6 A;  1FW1 A;  1ZMA A;  3VI5 A;  4JED A;  3VWX A;  5DCG A;  2OA7 A;  5J41 A;  3W8J A;  1B4Q A;  2DJ3 A;  3HCZ A;  2WGR A;  1GTI A;  1DE1 A;  3P7X A;  3Q6O A;  1ST9 A;  17GS A;  1XW6 A;  1EGO A;  4CW9 A;  4F03 A;  1Y25 A;  3UVT A;  1MD3 A;  1PD2 1;  3IRA A;  2JZS A;  2FHE A;  2CT6 A;  3FKF A;  5D9W A;  3PR8 A;  1GTA A;  5J9C A;  1A24 A;  3RDW A;  4MA9 A;  2JU5 A;  4IKH A;  3MWH A;  1SKS B;  4ZL9 A;  2P31 A;  1TXX A;  3C7M A;  3TOT A;  4G10 A;  2GSQ A;  5CO3 A;  2F8A A;  1J9B A;  4OFN A;  2CVB A;  2H72 A;  1GNW A;  3I9V 2;  1GUK A;  3EUR A;  4G9H A;  4TR1 B;  3TKQ A;  1O85 A;  1FVK A;  2B6M A;  2J23 A;  4TR1 A;  4DSS B;  3IAS 2;  3IPZ A;  1SJ6 A;  3TRP A;  5DDL A;  4DSS A;  1HNA A;  3D5J A;  5IM9 A;  3WT1 A;  2H1G A;  5EL8 A;  5H5R A;  1LJR A;  4AJ7 A;  2E7P A;  1EP7 A;  6GST A;  5JCW A;  2N5A A;  1E6B A;  1JZR A;  3DRN A;  3ZVJ D;  4POK A;  5ECO B;  1ON4 A;  5H5Q A;  2V41 A;  4O7H A;  1YQ1 A;  5G1L A;  5E59 A;  1SD9 A;  3IOS A;  5G30 A;  2GZY A;  5JWO B;  1XWB A;  3WT2 A;  4ECI A;  2ALB A;  2LRN A;  2NTO A;  3M1G A;  4NHZ A;  1IYI A;  4HDE A;  3APS A;  1WRY A;  2XPE A;  3ERF A;  2L59 A;  3IV4 A;  1SEN A;  5IIZ A;  2NVL A;  1K3L A;  5KN3 A;  1UN2 A;  3FR9 A;  4TRX A;  5KN1 A;  4WKW A;  1SYR A;  4F82 A;  2I3Y A;  4ZL8 A;  3RAZ A;  3TGZ A;  2HZF A;  3LQ7 A;  3GKX A;  1PX7 A;  3GV1 A;  2DMM A;  4KGI A;  1JLW A;  1TJD A;  2WB9 A;  3TKR A;  1WMJ A;  5CAX A;  4OFT A;  4OO4 A;  4V1A p;  3FRC A;  2H76 A;  4IJI A;  1OYJ A;  4POM A;  3E9J B;  3GHA A;  1TI1 A;  3I6A A;  3M3M A;  5IOW A;  2P5Q A;  2DIZ A;  2N5B A;  1X9M B;  3TJJ A;  5IO0 A;  1XFL A;  2C80 A;  3TDG A;  1GL8 A;  4J2F A;  1BG5 A;  3LGC A;  1S3A A;  1U87 A;  1A23 A;  4MPF A;  4EDZ A;  2DJ1 A;  3QOU A;  4HU9 A;  5HQP A;  3HA9 A;  4EC0 A;  2KUC A;  4MZC A;  1GSS A;  1ZCP A;  2HNL A;  5CRW A;  5ECM B;  3DKS A;  5JWR B;  1TI3 A;  4BVY A;  3IBH A;  2FD3 A;  4TVE A;  1PRX A;  2RM6 A;  3FYG A;  1U88 A;  3VUR A;  4WEY A;  2RUF A;  5ECH B;  4KAE A;  13GS A; 
#chains in the Genus database with same CATH topology
 3IAM 2;  2C0F A;  4NV2 A;  4V2M A;  5KN0 A;  1O6J A;  3U6V A;  1HNC A;  3KP9 A;  7GSS A;  2VLU A;  5LD0 A;  1FOH A;  3WGE A;  2H75 A;  2VCW A;  1TRV A;  1O8X A;  2AHE A;  2FLS A;  5IPH A;  2PER A;  4ZBA A;  1TTZ A;  4IGJ A;  4L5L A;  2K6V A;  2YZU A;  1URM A;  1E2Y A;  4RI6 A;  3KMO A;  1NSW A;  1SD8 A;  1B8X A;  5HFI A;  2GT6 A;  2ES7 A;  1ZOF A;  4EDY A;  1GUH A;  2FUG 2;  4PQ1 A;  3V1W A;  1V98 A;  2CZ3 A;  4ZBD A;  2K8S A;  4N0V A;  2OAD A;  4EKZ A;  3C1S A;  4NXI A;  3R2Q A;  4GSS A;  3EU4 A;  1PQN A;  4PNG A;  2AB6 A;  3QAG A;  3QR6 A;  1XWG A;  2C0D A;  3L0H A;  6GSX A;  2PWJ A;  6GSS A;  2HE3 A;  5LCZ A;  4MDC A;  3KZQ A;  1G6Y A;  3UBL A;  3EU3 A;  3KMN A;  1FB0 A;  2GQK A;  4H86 A;  2VCT A;  4BWS A;  1AQV A;  2H0H A;  4TOP A;  3HVX A;  5L71 A;  3TUE A;  4MLY A;  4HJ2 A;  2N5F A;  3FHK A;  2H73 A;  3APO A;  3FR3 A;  4L8E A;  4KA0 A;  5HR0 A;  3ME8 A;  1EEM A;  1B9X C;  4PQH A;  3ZTL A;  1CQH A;  3CMI A;  4WET A;  4EUY A;  4TKY A;  1WE0 A;  1K0O A;  3HJP A;  4PUR A;  2FWG A;  4WBR D;  3F6D A;  2I4A A;  2P0G A;  2MMO A;  1OE7 A;  1W89 A;  3BCI A;  3P90 A;  1X9S B;  3SBC A;  4DSR A;  5FWG A;  2YOI A;  2LNS A;  2QC7 A;  4EVM A;  2B5Y A;  3TJF A;  3ED3 A;  4HZ2 A;  4E8H A;  3F4S A;  2VCV A;  2GDR A;  1K0A A;  2R5G A;  1NW2 A;  1FAA A;  4GSN A;  4XS1 A;  4PX1 A;  1XWA A;  1K0C A;  2M46 A;  1BJX A;  4LMV A;  1QUW A;  3D4T A;  2NDO A;  2GT5 A;  2L6D A;  4AF2 A;  1TP9 A;  2B7K A;  1AC1 A;  4O32 A;  2LS5 A;  4I2T A;  5IOX A;  5ECN B;  3PGT A;  4ZIL A;  4MAB A;  1MTC A;  5KN2 A;  4MF6 A;  3ZZX A;  4WR5 A;  1DE2 A;  5F07 A;  2E2G A;  2CVK A;  2OKA A;  3M9K A;  4G2E A;  5D93 A;  2JAD A;  4OCE A;  2L4Q A;  4YQM A;  4EXJ A;  5G31 A;  1R4W A;  3CYN A;  3AY8 A;  2FGX A;  4LMW A;  3TCO A;  3GTU A;  2F8F A;  4I8B A;  1M0U A;  4JZQ A;  3ME7 A;  1AW9 A;  3HDC A;  5AIX A;  1MD4 A;  2YWO A;  2H74 A;  4BA7 A;  4Q5Q A;  4HZ4 A;  1FO5 A;  1FB6 A;  1QQ2 A;  2GGT A;  3M0F A;  4OFM A;  4G0I A;  1PL1 A;  3EC3 A;  2CZ2 A;  1R5A A;  2V6O A;  3DVX A;  3IXR A;  3QAW A;  3QDN A;  4RQR A;  4MJB A;  2JSZ A;  4K1F A;  1K0M A;  2GZZ A;  5GAP D;  5ID2 B;  4YQU A;  3W6G A;  1GTU A;  2UZ8 A;  5ID2 A;  1S3D A;  4GXZ A;  3FZ4 A;  1ZYQ B;  3F6F A;  2WZ9 A;  5DBQ A;  1K0N A;  1G6W A;  2ON5 A;  4IQ1 A;  1T7P B;  2C0G A;  3LEF A;  3C1R A;  1RW1 A;  5IPG A;  1TKD B;  3RPN A;  5FHI A;  2L4C A;  3HVV A;  2WRT A;  3ERW A;  3HY2 A;  3ZIV A;  1HNB A;  4KCA A;  1F3A A;  3GMF A;  1QMV A;  2EIR A;  3EWL A;  1EEJ A;  4MK3 A;  1O8W A;  2VCZ A;  1R26 A;  2MZC A;  5D9X A;  1MEK A;  3DEX A;  1KTE A;  3IHG A;  4NMU A;  5E4W A;  4HI7 A;  5CRG A;  1JZO A;  4O5U A;  1H75 A;  1ML6 A;  2GQL A;  4POL A;  1MDJ A;  2K9F A;  3FW2 A;  4Z2R A;  2HRN A;  3GX0 A;  1V40 A;  3Q74 A;  4NPB A;  1M3J A;  5A4U A;  4JRR A;  5DAL B;  1I9D A;  3HKR A;  5DAL A;  3DD3 A;  3GKK A;  3LYP A;  1W4V A;  4QL7 A;  2MBT A;  4AJ6 A;  3F3R A;  1SL0 B;  2KP2 A;  1O7U A;  2D2Z A;  1AQX A;  4MZB A;  4ECB A;  2H0I A;  1A2M A;  4J56 E;  2CAI A;  3MAK A;  2A2S A;  2RM5 A;  1TK5 B;  1AAZ A;  1UVZ A;  3GX8 A;  5A5K A;  1Z7R A;  2OJL A;  3SWL A;  2V1M A;  3J7Y b;  1K3O A;  2FA8 A;  4POB A;  2VLT A;  4JR4 A;  1DUG A;  5AIS A;  4FYB A;  3PIN A;  1HYU A;  4XS4 B;  4XS4 A;  6GSU A;  1GSF A;  1AIU A;  4MCU A;  4ZL7 A;  3DYR A;  1R5P A;  2PN8 A;  3Q19 A;  1XBS A;  4GF0 A;  1ZYP A;  11GS A;  2YPM A;  1RK4 A;  2JAC A;  12GS A;  2FNO A;  3E0U A;  1M9A A;  2H6X A;  4XS6 A;  5C04 A;  2IME A;  2VM1 A;  4XRA A;  2XHF A;  4K0G A;  4MF7 A;  1USB A;  2DKI A;  3KEB A;  3HD5 A;  1PSQ A;  2PVQ A;  1MDI A;  3BBY A;  2IMD A;  1JZD A;  3N5O A;  2VCX A;  3GRX A;  1N8J A;  4YH2 A;  4Z7X A;  1ERW A;  3HZ4 A;  3WGX A;  2E2M A;  3D0Z A;  1VF2 A;  4O5Q A;  1XIY A;  2B3S A;  4ML6 A;  1AQW A;  4FO5 A;  3C73 A;  2YAN A;  2QA2 A;  2YZH A;  2DC5 A;  3HHV A;  1OC9 B;  1VF4 A;  3VPT A;  4N0Z A;  4DVC A;  2H1A A;  1OC9 A;  3VWV A;  4E8E A;  2F51 A;  2KP1 A;  1K0D A;  1ZGN A;  2XC2 A;  4ID0 A;  5C00 A;  1A2L A;  1SL1 B;  1X5D A;  1V58 A;  3IC4 A;  1TRS A;  3ZRE A;  2H8L A;  5ECQ B;  4QL9 A;  1V2A A;  4ZIJ A;  4PNF A;  4HU7 A;  2XBI A;  3GUR A;  2PU9 C;  3HXS A;  4GWR A;  4FQU A;  3RHC A;  4FH8 A;  3GKM A;  4EE0 A;  2CA8 A;  2X8C A;  4GLT A;  1LBK A;  4JE1 A;  4AGS A;  3H1N A;  2NBS A;  4TXO B;  4MPG A;  3DXB A;  4MNN A;  1XWC A;  4IJ3 A;  4TXO A;  2HLS A;  3LYK A;  2O7K A;  3OR5 A;  3DVW A;  1ERU A;  4KSO A;  1EV4 A;  2DLX A;  4IEL A;  2H6Y A;  2YCD A;  2PVO C;  5KEJ A;  4KDY A;  1HD2 A;  2C3N A;  2CVD A;  4NHW A;  1SK2 A;  2P5R A;  2X64 A;  5ECI B;  3IK7 A;  2GS3 A;  3WYW A;  1OKD A;  2ZUP A;  2IWT A;  1F3B A;  3F0I A;  5AGY A;  3G7I A;  4I5Q A;  3LG6 A;  3KM6 A;  1JFU A;  1ZL9 A;  1KNG A;  4OCF A;  1ABA A;  4K7I A;  2V32 A;  4RUV A;  1T3B A;  2OE1 A;  4GCI A;  3DML A;  3FMW A;  3A5I A;  1GRX A;  2IL3 A;  1YEP A;  3FZ5 A;  5B6M A;  2LQO A;  1Z6N A;  4XRD A;  5JCG A;  2YV7 A;  1XXU A;  1Z6M A;  2H1D A;  1U3I A;  2PBJ A;  2CX3 A;  4TXV A;  1T4Y A;  2YJ7 A;  2R0G A;  1M3I A;  1PKW A;  2H70 A;  3FK8 A;  3O76 A;  2CX4 A;  4NAX A;  5JWQ B;  2R3X A;  3MNG A;  1I5G A;  1QXH A;  1M99 A;  2ON7 A;  4N10 A;  2YWM A;  4BL7 B;  2H30 A;  3L9U A;  1GSY A;  3H93 A;  3R3E A;  4BL7 A;  4EIQ A;  1EP8 A;  2AJQ B;  1ZZY A;  1ERV A;  4PTS A;  2FWE A;  5ECK B;  2BMX A;  3L9V A;  4ICY A;  4GQF A;  4Q5F A;  4HQZ A;  1HQO A;  4GST A;  2DJ0 A;  4YKF A;  1B9Y C;  3D6I A;  2CV4 A;  3G9B A;  2NPB A;  2AAW A;  2JZR A;  3G7Y A;  1CQG A;  5CRD A;  3O6T A;  5HR1 A;  1KEB A;  3BD2 A;  4G19 A;  3DIE A;  3WGD A;  3HVS A;  3LJR A;  4BPY A;  2H0G A;  2VL9 A;  1X5C A;  3EMP A;  2X4A A;  3JCM L;  2IJY A;  1R7H A;  3QD9 A;  1SJI A;  2HSM A;  4HOJ A;  2JL4 A;  1SK1 A;  3GA4 A;  4K9Z A;  3D21 A;  3ZYW A;  4EO3 A;  1TOF A;  5D8I A;  2F3M A;  4IP6 A;  5JCU A;  4LL1 B;  5AN1 A;  3GST A;  2LUS A;  5BMU A;  5BRT A;  5ABR A;  2VL2 A;  2YV9 A;  1VF1 A;  4A5P A;  5HFG A;  1F9M A;  4L0U A;  2OBI A;  1X0R A;  4MF5 A;  2ZCT A;  2LRT A;  1M2A A;  4F0C A;  5DAK B;  1X5E A;  2H66 A;  5DAK A;  2LKU A;  1VF3 A;  1BAY A;  4KW6 A;  5DCH A;  4KUN A;  2X49 A;  3EE2 A;  2M72 A;  4ECC A;  3QCP A;  5CNW A;  5F0G A;  4V2L A;  3GSS A;  3H4K A;  4MJA A;  4Q5R A;  3O3T A;  3CRT A;  2VD0 A;  3MSZ A;  1IYH A;  3H79 A;  2FWH A;  5DVB A;  4X0X A;  2TRX A;  1TK0 B;  1WP0 A;  4LA1 A;  4D73 B;  3NZN A;  2QA1 A;  1GWC A;  4D73 A;  4WF4 A;  2IMK A;  5ECL B;  5COH A;  5IMV A;  3GUS A;  1OKT A;  2VO4 A;  1A2J A;  2GZP A;  3EYT A;  3NIV A;  1Z3E A;  4FIW A;  1NHO A;  4BVX B;  5IQY A;  1PKZ A;  1M7T A;  3EPT A;  3UAP A;  5ELG A;  4BVX A;  3GTU B;  3N9J A;  3CQF A;  3TOU A;  2C3Q A;  3HVN A;  4I6X A;  1YF0 A;  2R2J A;  5IMF A;  2RUE A;  6GSV A;  1SJZ A;  1O73 A;  3BOA A;  1EWX A;  1G0T A;  1DSB A;  4FYU A;  2GVP A;  5IMA A;  2IFQ B;  3PH9 A;  3EVI A;  3HJO A;  1M2B A;  2IFQ A;  5IMD A;  3LXZ A;  5CRH A;  18GS A;  4DSQ A;  1KBN A;  3CSH A;  1WWJ A;  3UL3 A;  3ISO A;  3DGQ A;  2ZNM A;  2VL3 A;  1X9W B;  3KXO A;  2DML A;  2MMZ A;  2H19 A;  1ZYE A;  3D22 A;  3Q18 A;  2WJU A;  1GTB A;  1JZW A;  4MP4 A;  1NM3 A;  5G2Z A;  2X8G A;  4IW9 A;  5ECS A;  1S3C A;  1XCC A;  2GSR A;  4WR4 A;  4RI7 A;  3RHB A;  1J0F A;  3KCM A;  3LOR A;  4J57 E;  2K8V A;  1QK8 A;  5D96 A;  4NWY A;  5J3R A;  1M9B A;  2LJR A;  3P2A A;  1AXD A;  1XZO A;  3BJ5 A;  1VRS D;  4MZW A;  3GL5 A;  3HJM A;  3UOM A;  3UIW A;  1UC7 A;  4K6X A;  1V9W A;  2HSY A;  5G5E A;  2A4V A;  4XCS A;  5GSS A;  3IR4 A;  20GS A;  6GSW A;  3CTG A;  3FZA A;  2L5L A;  3GYK A;  2C3T A;  2FWF A;  1THX A;  3GL3 A;  1PGT A;  3UAR A;  1OC8 A;  1GP1 A;  4IS0 A;  4TR4 A;  2VM2 A;  2Z9S A;  3WD6 A;  2A2R A;  1GNE A;  4JBB A;  3KIJ A;  1M2D A;  1JHB A;  2C0E A;  2GTU A;  2VL2 C;  4XTS A;  1XG8 A;  2R6K A;  4ECJ A;  2HFD A;  5CRE A;  2WS2 A;  2O89 A;  1GLQ A;  3FEU A;  4KB3 A;  2HRA A;  5FT3 A;  4N30 A;  1F6M C;  1SKW B;  1OVN A;  1T8E B;  1AUC A;  1GUM A;  3IDV A;  2J9H A;  3ZFB A;  2AV4 A;  2PGT A;  1TK8 B;  2OAC A;  3UVH A;  4F9Z A;  3G7J A;  2IIY A;  2WDU A;  1EV9 A;  3ZRD A;  4O92 A;  1XPV A;  9GSS A;  1EGR A;  5G5F A;  4WF5 A;  1FG4 A;  4FYC A;  3M9J A;  5B7C A;  4PXO A;  4KX4 A;  1XVW A;  3TKP A;  4BIK A;  4N11 A;  4IHU A;  1NHY A;  1TW9 A;  2KHP A;  3KH7 A;  1A8L A;  2A4H A;  1N2A A;  2DBC A;  3F8U A;  3W8S A;  4ZB9 A;  2R4V A;  3GNJ A;  3LSZ A;  3I43 A;  4PGT A;  3S9F A;  4V2N A;  2IMF A;  2G2Q A;  4HQS A;  5HR3 A;  5A4V A;  1XW5 A;  2PPT A;  4K7N A;  4TR0 A;  2DJJ A;  1PA3 A;  2EC4 A;  4KDX A;  5B8B A;  2MMN A;  5G1K A;  2GSS A;  2H1B A;  4O5R A;  2O8V B;  3QMX A;  2CAQ A;  4MH3 A;  3GH9 A;  4MJC A;  1YY7 A;  1GSU A;  3TRQ A;  2LV3 A;  4CDO A;  3UMA A;  4QQ7 A;  2WUL A;  2YWI A;  3VFI A;  2C4J A;  3HYP A;  1G7E A;  4JU5 A;  5CYY A;  1YDK A;  4BWQ A;  3GH6 A;  4Z2U A;  4F0B A;  2OE0 A;  4IP1 A;  1TDI A;  5GZZ B;  2WCI A;  6GSY A;  3RBT A;  1UA5 A;  1K3Y A;  4WBJ A;  5AIV A;  4TN8 A;  4ML1 A;  1SYX A;  3KTB A;  4K0N A;  2LST A;  5J5N A;  3UJ1 A;  4XIH A;  3US3 A;  5A4W A;  4WXT A;  5GST A;  1DBY A;  4HEA 2;  3TJG A;  2BTO T;  3TKS E;  1J08 A;  1ERT A;  1YEX A;  1GSD A;  1XWK A;  2TIR A;  3F3Q A;  3FY7 A;  3LFL A;  3FR6 A;  1A0F A;  2RLI A;  3A2X A;  2C1Y A;  1B4P A;  1SL2 B;  3CSI A;  3UEM A;  5H5S A;  5J4U A;  3TJB A;  3CBU A;  4DEJ A;  4MMM A;  3GKN A;  3HZ8 A;  4PUF C;  3A5W A;  3KP8 A;  2AUV A;  4V1A g;  1O81 A;  1TU7 A;  4ZB6 A;  1FHE A;  2OE3 A;  4RQX A;  4LL4 B;  3KJY A;  1BQ7 A;  16GS A;  3VK9 A;  2I81 A;  4YAP A;  2DJK A;  2LNT A;  1Q98 A;  4ACS A;  4KSM A;  14GS A;  1ACV A;  3ZLP A;  2VUP A;  2PMT A;  1TRW A;  3RPP A;  3TKS C;  4TW5 A;  3F4T A;  1G7O A;  2O87 A;  2YJH A;  1YZX A;  3LWA A;  8GSS A;  5F06 A;  5DJL A;  2HYX A;  4L5O A;  3ZMK A;  5ECP B;  1EZK A;  2IN3 A;  1THO A;  1GSE A;  3F4R A;  2YP6 A;  2HT9 A;  2TRC P;  4EF0 A;  3VWW A;  2KLX A;  2F9S A;  2R0C A;  2YWN A;  3DWV A;  2B1L A;  5F8B A;  3KTL A;  4IVF A;  2MYG A;  1BED A;  3F9U A;  4XHM A;  3IK9 A;  2HI7 A;  5EY6 A;  2QKE A;  2XBQ A;  4K8M A;  5CP1 A;  2DSA A;  2VOC A;  3TJK A;  4ZXG A;  2DJ2 A;  2B7J A;  3GN3 A;  3QFB C;  2GQM A;  4KE3 A;  4TR3 A;  3D4M A;  5EVO A;  4ILF A;  4MH2 A;  3ZIJ A;  2REM A;  3C8E A;  4HJM A;  5INY A;  3CTF A;  3QFA C;  1BYE A;  3BCK A;  2DIY A;  1PMT A;  3A3T A;  4KND A;  1EOH A;  3QAV A;  1V57 A;  1F2E A;  3MDK A;  2LQQ A;  2H6Z A;  4YKG A;  1TRU A;  3E3E A;  3VWU A;  2R37 A;  4ULX A;  4X1U A;  1XVQ A;  4YAV A;  5B6N A;  3EMX A;  1GSQ A;  4HSC X;  5ECR B;  1FVJ A;  3CXG A;  4G0K A;  4I2U A;  4ISD A;  2V6K A;  1F37 A;  2EIQ A;  2X99 A;  3MIX A;  2WFC A;  2MMA A;  3KD0 A;  2M80 A;  4KCE A;  1YKA A;  4EL1 A;  5ENU A;  4OD7 A;  4G0L A;  1U6T A;  4K2D A;  5KOX A;  4KH7 A;  3ZFL A;  2MBS A;  2L57 A;  2XPD A;  4CHS A;  4IQA A;  19GS A;  2PUK C;  3PPU A;  4AJ8 A;  4KDU A;  1Q4J A;  3VLN A;  2E0Q A;  4YQV A;  2HZE B;  4X43 A;  1PL2 A;  2HZE A;  4USS A;  1PFO A;  3NOF A;  3H8Q A;  4GRF A;  1A0R P;  5DQY A;  1OAZ A;  2K18 A;  1Z5Y E;  2B5E A;  2LRC A;  3IE3 A;  1QFN A;  4CY6 A;  3VPQ A;  1A8Y A;  3KGK A;  2FCH A;  1T1V A;  5J9B A;  1K0B A;  1Z9H A;  2YNX A;  1PX6 A;  4GTU A;  2EIO A;  5DQS A;  4L0W A;  2H01 A;  4CY8 A;  3QPM A;  4GQC A;  3ZL5 A;  2HXK A;  4PQI A;  1EOG A;  4OO5 A;  2C8U A;  3J7Y k;  2OBK A;  3FZ9 A;  4IBP A;  4OMV A;  4I97 A;  4X4J A;  5D9V A;  2L5O A;  3L4N A;  3GIX A;  5D73 A;  2A2P A;  5IO2 A;  2IMI A;  1WIK A;  3P8W A;  1Z7P A;  1LU4 A;  3M8N A;  1S3R A;  1B48 A;  2RII A;  2CQ9 A;  2LEG A;  2KOK A;  3U5R E;  3APQ A;  4K5R A;  1WJK A;  2HRF A;  3A2V A;  5HR2 A;  3K8N A;  3ZVJ A;  2VIM A;  2YN1 A;  3MYD A;  3ZML A;  5IMC A;  4MJE A;  5DJM A;  2VCQ A;  5D9T A;  5ELA A;  2V2G A;  4HUA A;  3KH9 A;  2LJA A;  3L78 A;  1YJ6 A;  1T00 A;  3EIN A;  2H71 A;  1SK0 A;  4JR6 A;  1WOU A;  5B8A A;  2VD1 A;  1RQM A;  1GUL A;  2GLR A;  2O85 A;  4K7O A;  4Z2T A;  4PUA A;  2QSI A;  1YKC A;  3IC8 A;  4OWY A;  5EPF A;  3LXT A;  1OE8 A;  2B1K A;  1U3A A;  3A2W A;  2AYT A;  2VLV A;  3TRX A;  3C71 A;  10GS A;  1GLP A;  3CSJ A;  2I1U A;  3IHQ A;  4F2I A;  5IMZ A;  4LLR A;  3VI7 A;  1SU9 A;  1PN9 A;  2HSH A;  1C72 A;  2B5X A;  3UBK A;  1SKR B;  1VGL A;  4P3Y B;  1YF1 A;  3I69 A;  2LTK A;  1XW9 A;  3GFK A;  2GST A;  22GS A;  1BX9 A;  2IPA A;  2JSY A;  2VAF A;  3F63 A;  1GH2 A;  2LJK A;  5GAN D;  2FA4 A;  3ZIT A;  2R0P A;  2BJX A;  1OC3 A;  1WPI A;  4NV5 A;  4IN0 A;  1ILO A;  2JZT A;  1H4O A;  1XOA A;  2L6C A;  2QGV A;  3L9S A;  3ERG A;  2X8H A;  4K2X A;  1MDK A;  4HS1 A;  4ZB8 A;  2I9H A;  1QGV A;  3TB2 A;  1JLV A;  5F05 A;  1T4Z A;  4Q5N A;  5HFK A;  1TU8 A;  3IA1 A;  1XOB A;  3TKS A;  1Y6E A;  5LNK e;  2G0F A;  3CRU A;  4ZBB A;  1FOV A;  2FY6 A;  1PN0 A;  1FW1 A;  1ZMA A;  3VI5 A;  4JED A;  3VWX A;  5DCG A;  2OA7 A;  5J41 A;  3W8J A;  1B4Q A;  2DJ3 A;  3HCZ A;  2WGR A;  1GTI A;  1DE1 A;  3P7X A;  3Q6O A;  1ST9 A;  17GS A;  1XW6 A;  1EGO A;  4CW9 A;  4F03 A;  1Y25 A;  3UVT A;  1MD3 A;  1PD2 1;  3IRA A;  2JZS A;  2FHE A;  2CT6 A;  3FKF A;  5D9W A;  3PR8 A;  1GTA A;  5J9C A;  1A24 A;  3RDW A;  4MA9 A;  2JU5 A;  4IKH A;  3LW9 A;  3MWH A;  1SKS B;  4ZL9 A;  2P31 A;  1TXX A;  3C7M A;  3TOT A;  4G10 A;  2GSQ A;  5CO3 A;  2F8A A;  1J9B A;  4OFN A;  2CVB A;  2H72 A;  1GNW A;  3I9V 2;  1GUK A;  3EUR A;  4G9H A;  4TR1 B;  3TKQ A;  1O85 A;  1FVK A;  2B6M A;  2J23 A;  4TR1 A;  4DSS B;  3IAS 2;  3IPZ A;  1SJ6 A;  3TRP A;  5DDL A;  4DSS A;  1HNA A;  3D5J A;  5IM9 A;  3WT1 A;  2H1G A;  5EL8 A;  5H5R A;  4KF9 A;  1LJR A;  4AJ7 A;  2E7P A;  1EP7 A;  6GST A;  5JCW A;  2N5A A;  1E6B A;  1JZR A;  3DRN A;  3ZVJ D;  4POK A;  5ECO B;  1ON4 A;  5H5Q A;  2V41 A;  4O7H A;  1YQ1 A;  5G1L A;  5E59 A;  1SD9 A;  3IOS A;  5G30 A;  2GZY A;  5JWO B;  1XWB A;  3WT2 A;  4ECI A;  2ALB A;  2LRN A;  2NTO A;  3M1G A;  4NHZ A;  1IYI A;  4HDE A;  3APS A;  1WRY A;  2XPE A;  3ERF A;  2L59 A;  3IV4 A;  1SEN A;  5IIZ A;  2NVL A;  1K3L A;  5KN3 A;  1UN2 A;  3FR9 A;  4TRX A;  5KOW A;  5KN1 A;  4WKW A;  1SYR A;  4F82 A;  2I3Y A;  4ZL8 A;  3RAZ A;  3TGZ A;  2HZF A;  3LQ7 A;  1ZYN A;  3GKX A;  1PX7 A;  3GV1 A;  2DMM A;  4KGI A;  1JLW A;  1TJD A;  2WB9 A;  3TKR A;  1WMJ A;  5CAX A;  4OFT A;  4OO4 A;  4V1A p;  3FRC A;  2H76 A;  4IJI A;  1OYJ A;  4POM A;  3E9J B;  3GHA A;  1TI1 A;  3I6A A;  3M3M A;  5IOW A;  2P5Q A;  2DIZ A;  2N5B A;  1X9M B;  3TJJ A;  4EIP A;  5IO0 A;  1XFL A;  2C80 A;  3TDG A;  1GL8 A;  4J2F A;  1BG5 A;  3LGC A;  1S3A A;  1U87 A;  1A23 A;  4MPF A;  4EDZ A;  2DJ1 A;  3QOU A;  4HU9 A;  5HQP A;  3HA9 A;  4K5S A;  4EC0 A;  2KUC A;  4MZC A;  1GSS A;  1ZCP A;  2HNL A;  5CRW A;  5ECM B;  3DKS A;  4BVY B;  5JWR B;  1TI3 A;  4BVY A;  3IBH A;  2FD3 A;  2HRK A;  2DKH A;  4TVE A;  1PRX A;  2RM6 A;  3FYG A;  1U88 A;  3VUR A;  4WEY A;  2RUF A;  5ECH B;  4KAE A;  13GS A; 
#chains in the Genus database with same CATH homology
 3IAM 2;  2C0F A;  4NV2 A;  4V2M A;  5KN0 A;  1O6J A;  3U6V A;  1HNC A;  3KP9 A;  7GSS A;  2VLU A;  5LD0 A;  1FOH A;  3WGE A;  2H75 A;  2VCW A;  1TRV A;  1O8X A;  2AHE A;  2FLS A;  5IPH A;  2PER A;  4ZBA A;  1TTZ A;  4IGJ A;  4L5L A;  2K6V A;  2YZU A;  1URM A;  1E2Y A;  4RI6 A;  3KMO A;  1NSW A;  1SD8 A;  1B8X A;  5HFI A;  2GT6 A;  2ES7 A;  1ZOF A;  4EDY A;  1GUH A;  2FUG 2;  4PQ1 A;  3V1W A;  1V98 A;  2CZ3 A;  4ZBD A;  2K8S A;  4N0V A;  2OAD A;  4EKZ A;  3C1S A;  4NXI A;  3R2Q A;  4GSS A;  3EU4 A;  1PQN A;  4PNG A;  2AB6 A;  3QAG A;  3QR6 A;  1XWG A;  2C0D A;  3L0H A;  6GSX A;  2PWJ A;  6GSS A;  2HE3 A;  5LCZ A;  4MDC A;  3KZQ A;  1G6Y A;  3UBL A;  3EU3 A;  3KMN A;  1FB0 A;  2GQK A;  4H86 A;  2VCT A;  4BWS A;  1AQV A;  2H0H A;  4TOP A;  3HVX A;  5L71 A;  3TUE A;  4MLY A;  4HJ2 A;  2N5F A;  3FHK A;  2H73 A;  3APO A;  3FR3 A;  4L8E A;  4KA0 A;  5HR0 A;  3ME8 A;  1EEM A;  1B9X C;  4PQH A;  3ZTL A;  1CQH A;  3CMI A;  4WET A;  4EUY A;  4TKY A;  1WE0 A;  1K0O A;  3HJP A;  4PUR A;  2FWG A;  4WBR D;  3F6D A;  2I4A A;  2P0G A;  2MMO A;  1OE7 A;  1W89 A;  3BCI A;  3P90 A;  1X9S B;  3SBC A;  4DSR A;  5FWG A;  2YOI A;  2LNS A;  2QC7 A;  4EVM A;  2B5Y A;  3TJF A;  3ED3 A;  4HZ2 A;  4E8H A;  3F4S A;  2VCV A;  2GDR A;  1K0A A;  2R5G A;  1NW2 A;  1FAA A;  4GSN A;  4XS1 A;  4PX1 A;  1XWA A;  1K0C A;  2M46 A;  1BJX A;  4LMV A;  1QUW A;  3D4T A;  2NDO A;  2GT5 A;  2L6D A;  4AF2 A;  1TP9 A;  2B7K A;  1AC1 A;  4O32 A;  2LS5 A;  4I2T A;  5IOX A;  5ECN B;  3PGT A;  4ZIL A;  4MAB A;  1MTC A;  5KN2 A;  4MF6 A;  3ZZX A;  4WR5 A;  1DE2 A;  5F07 A;  2E2G A;  2CVK A;  2OKA A;  3M9K A;  4G2E A;  5D93 A;  2JAD A;  4OCE A;  2L4Q A;  4YQM A;  4EXJ A;  5G31 A;  1R4W A;  3CYN A;  3AY8 A;  2FGX A;  4LMW A;  3TCO A;  3GTU A;  2F8F A;  4I8B A;  1M0U A;  4JZQ A;  3ME7 A;  1AW9 A;  3HDC A;  5AIX A;  1MD4 A;  2YWO A;  2H74 A;  4BA7 A;  4Q5Q A;  4HZ4 A;  1FO5 A;  1FB6 A;  1QQ2 A;  2GGT A;  3M0F A;  4OFM A;  4G0I A;  1PL1 A;  3EC3 A;  2CZ2 A;  1R5A A;  2V6O A;  3DVX A;  3IXR A;  3QAW A;  3QDN A;  4RQR A;  4MJB A;  2JSZ A;  4K1F A;  1K0M A;  2GZZ A;  5GAP D;  5ID2 B;  4YQU A;  3W6G A;  1GTU A;  2UZ8 A;  5ID2 A;  1S3D A;  4GXZ A;  3FZ4 A;  1ZYQ B;  3F6F A;  2WZ9 A;  5DBQ A;  1K0N A;  1G6W A;  2ON5 A;  4IQ1 A;  1T7P B;  2C0G A;  3LEF A;  3C1R A;  1RW1 A;  5IPG A;  1TKD B;  3RPN A;  5FHI A;  2L4C A;  3HVV A;  2WRT A;  3ERW A;  3HY2 A;  3ZIV A;  1HNB A;  4KCA A;  1F3A A;  3GMF A;  1QMV A;  2EIR A;  3EWL A;  1EEJ A;  4MK3 A;  1O8W A;  2VCZ A;  1R26 A;  2MZC A;  5D9X A;  1MEK A;  3DEX A;  1KTE A;  3IHG A;  4NMU A;  5E4W A;  4HI7 A;  5CRG A;  1JZO A;  4O5U A;  1H75 A;  1ML6 A;  2GQL A;  4POL A;  1MDJ A;  2K9F A;  3FW2 A;  4Z2R A;  2HRN A;  3GX0 A;  1V40 A;  3Q74 A;  4NPB A;  5A4U A;  4JRR A;  5DAL B;  1I9D A;  3HKR A;  5DAL A;  3DD3 A;  3GKK A;  3LYP A;  1W4V A;  4QL7 A;  2MBT A;  4AJ6 A;  3F3R A;  1SL0 B;  2KP2 A;  1O7U A;  2D2Z A;  1AQX A;  4MZB A;  4ECB A;  2H0I A;  1A2M A;  4J56 E;  2CAI A;  3MAK A;  2A2S A;  2RM5 A;  1TK5 B;  1AAZ A;  1UVZ A;  3GX8 A;  5A5K A;  1Z7R A;  2OJL A;  3SWL A;  2V1M A;  3J7Y b;  1K3O A;  2FA8 A;  4POB A;  2VLT A;  4JR4 A;  1DUG A;  5AIS A;  4FYB A;  3PIN A;  1HYU A;  4XS4 B;  4XS4 A;  6GSU A;  1GSF A;  1AIU A;  4MCU A;  4ZL7 A;  3DYR A;  1R5P A;  2PN8 A;  3Q19 A;  1XBS A;  4GF0 A;  1ZYP A;  11GS A;  2YPM A;  1RK4 A;  2JAC A;  12GS A;  2FNO A;  3E0U A;  1M9A A;  2H6X A;  4XS6 A;  5C04 A;  2IME A;  2VM1 A;  4XRA A;  2XHF A;  4K0G A;  4MF7 A;  1USB A;  2DKI A;  3KEB A;  3HD5 A;  1PSQ A;  2PVQ A;  1MDI A;  3BBY A;  2IMD A;  1JZD A;  3N5O A;  2VCX A;  3GRX A;  1N8J A;  4YH2 A;  4Z7X A;  1ERW A;  3HZ4 A;  3WGX A;  2E2M A;  3D0Z A;  1VF2 A;  4O5Q A;  1XIY A;  2B3S A;  4ML6 A;  1AQW A;  4FO5 A;  3C73 A;  2YAN A;  2QA2 A;  2YZH A;  2DC5 A;  3HHV A;  1OC9 B;  1VF4 A;  3VPT A;  4N0Z A;  4DVC A;  2H1A A;  1OC9 A;  3VWV A;  4E8E A;  2F51 A;  2KP1 A;  1K0D A;  1ZGN A;  2XC2 A;  4ID0 A;  5C00 A;  1A2L A;  1SL1 B;  1X5D A;  1V58 A;  3IC4 A;  1TRS A;  3ZRE A;  2H8L A;  5ECQ B;  4QL9 A;  1V2A A;  4ZIJ A;  4PNF A;  4HU7 A;  2XBI A;  3GUR A;  2PU9 C;  3HXS A;  4GWR A;  4FQU A;  3RHC A;  4FH8 A;  3GKM A;  4EE0 A;  2CA8 A;  2X8C A;  4GLT A;  1LBK A;  4JE1 A;  4AGS A;  3H1N A;  2NBS A;  4TXO B;  4MPG A;  3DXB A;  4MNN A;  1XWC A;  4IJ3 A;  4TXO A;  2HLS A;  3LYK A;  2O7K A;  3OR5 A;  3DVW A;  1ERU A;  4KSO A;  1EV4 A;  2DLX A;  4IEL A;  2H6Y A;  2YCD A;  2PVO C;  5KEJ A;  4KDY A;  1HD2 A;  2C3N A;  2CVD A;  4NHW A;  1SK2 A;  2P5R A;  2X64 A;  5ECI B;  3IK7 A;  2GS3 A;  3WYW A;  1OKD A;  2ZUP A;  2IWT A;  1F3B A;  3F0I A;  5AGY A;  3G7I A;  4I5Q A;  3LG6 A;  3KM6 A;  1JFU A;  1ZL9 A;  1KNG A;  4OCF A;  1ABA A;  4K7I A;  2V32 A;  4RUV A;  1T3B A;  2OE1 A;  4GCI A;  3DML A;  3FMW A;  3A5I A;  1GRX A;  2IL3 A;  1YEP A;  3FZ5 A;  5B6M A;  2LQO A;  1Z6N A;  4XRD A;  5JCG A;  2YV7 A;  1XXU A;  1Z6M A;  2H1D A;  1U3I A;  2PBJ A;  2CX3 A;  4TXV A;  1T4Y A;  2YJ7 A;  2R0G A;  1PKW A;  2H70 A;  3FK8 A;  3O76 A;  2CX4 A;  4NAX A;  5JWQ B;  2R3X A;  3MNG A;  1I5G A;  1QXH A;  1M99 A;  2ON7 A;  4N10 A;  2YWM A;  4BL7 B;  2H30 A;  3L9U A;  1GSY A;  3H93 A;  3R3E A;  4BL7 A;  4EIQ A;  1EP8 A;  2AJQ B;  1ZZY A;  1ERV A;  4PTS A;  2FWE A;  5ECK B;  2BMX A;  3L9V A;  4ICY A;  4GQF A;  4Q5F A;  4HQZ A;  1HQO A;  4GST A;  2DJ0 A;  4YKF A;  1B9Y C;  3D6I A;  2CV4 A;  3G9B A;  2NPB A;  2AAW A;  2JZR A;  3G7Y A;  1CQG A;  5CRD A;  3O6T A;  5HR1 A;  1KEB A;  3BD2 A;  4G19 A;  3DIE A;  3WGD A;  3HVS A;  3LJR A;  4BPY A;  2H0G A;  2VL9 A;  1X5C A;  3EMP A;  2X4A A;  3JCM L;  2IJY A;  1R7H A;  3QD9 A;  1SJI A;  2HSM A;  4HOJ A;  2JL4 A;  1SK1 A;  3GA4 A;  4K9Z A;  3D21 A;  3ZYW A;  4EO3 A;  1TOF A;  5D8I A;  2F3M A;  4IP6 A;  5JCU A;  4LL1 B;  5AN1 A;  3GST A;  2LUS A;  5BMU A;  5BRT A;  5ABR A;  2VL2 A;  2YV9 A;  1VF1 A;  4A5P A;  5HFG A;  1F9M A;  4L0U A;  2OBI A;  1X0R A;  4MF5 A;  2ZCT A;  2LRT A;  1M2A A;  4F0C A;  5DAK B;  1X5E A;  2H66 A;  5DAK A;  2LKU A;  1VF3 A;  1BAY A;  4KW6 A;  5DCH A;  4KUN A;  2X49 A;  3EE2 A;  2M72 A;  4ECC A;  3QCP A;  5CNW A;  5F0G A;  4V2L A;  3GSS A;  3H4K A;  4MJA A;  4Q5R A;  3O3T A;  3CRT A;  2VD0 A;  3MSZ A;  1IYH A;  3H79 A;  2FWH A;  5DVB A;  4X0X A;  2TRX A;  1TK0 B;  1WP0 A;  4LA1 A;  4D73 B;  3NZN A;  2QA1 A;  1GWC A;  4D73 A;  4WF4 A;  2IMK A;  5ECL B;  5COH A;  5IMV A;  3GUS A;  1OKT A;  2VO4 A;  1A2J A;  2GZP A;  3EYT A;  3NIV A;  1Z3E A;  4FIW A;  1NHO A;  4BVX B;  5IQY A;  1PKZ A;  1M7T A;  3EPT A;  3UAP A;  5ELG A;  4BVX A;  3GTU B;  3N9J A;  3TOU A;  2C3Q A;  4I6X A;  1YF0 A;  2R2J A;  5IMF A;  2RUE A;  6GSV A;  1SJZ A;  1O73 A;  3BOA A;  1EWX A;  1G0T A;  1DSB A;  4FYU A;  2GVP A;  5IMA A;  2IFQ B;  3PH9 A;  3EVI A;  3HJO A;  1M2B A;  2IFQ A;  5IMD A;  3LXZ A;  5CRH A;  18GS A;  4DSQ A;  1KBN A;  3CSH A;  1WWJ A;  3UL3 A;  3ISO A;  3DGQ A;  2ZNM A;  2VL3 A;  1X9W B;  3KXO A;  2DML A;  2MMZ A;  2H19 A;  1ZYE A;  3D22 A;  3Q18 A;  2WJU A;  1GTB A;  1JZW A;  4MP4 A;  1NM3 A;  5G2Z A;  2X8G A;  4IW9 A;  5ECS A;  1S3C A;  1XCC A;  2GSR A;  4WR4 A;  4RI7 A;  3RHB A;  1J0F A;  3KCM A;  3LOR A;  4J57 E;  2K8V A;  1QK8 A;  5D96 A;  4NWY A;  5J3R A;  1M9B A;  2LJR A;  3P2A A;  1AXD A;  1XZO A;  3BJ5 A;  1VRS D;  4MZW A;  3GL5 A;  3HJM A;  3UOM A;  3UIW A;  1UC7 A;  4K6X A;  1V9W A;  2HSY A;  5G5E A;  2A4V A;  4XCS A;  5GSS A;  3IR4 A;  20GS A;  6GSW A;  3CTG A;  3FZA A;  2L5L A;  3GYK A;  2C3T A;  2FWF A;  1THX A;  3GL3 A;  1PGT A;  3UAR A;  1OC8 A;  1GP1 A;  4IS0 A;  4TR4 A;  2VM2 A;  2Z9S A;  3WD6 A;  2A2R A;  1GNE A;  4JBB A;  3KIJ A;  1M2D A;  1JHB A;  2C0E A;  2GTU A;  2VL2 C;  4XTS A;  2R6K A;  4ECJ A;  2HFD A;  5CRE A;  2WS2 A;  2O89 A;  1GLQ A;  3FEU A;  4KB3 A;  2HRA A;  5FT3 A;  4N30 A;  1F6M C;  1SKW B;  1OVN A;  1T8E B;  1AUC A;  1GUM A;  3IDV A;  2J9H A;  3ZFB A;  2AV4 A;  2PGT A;  1TK8 B;  2OAC A;  3UVH A;  4F9Z A;  3G7J A;  2IIY A;  2WDU A;  1EV9 A;  3ZRD A;  4O92 A;  1XPV A;  9GSS A;  1EGR A;  5G5F A;  4WF5 A;  1FG4 A;  4FYC A;  3M9J A;  5B7C A;  4PXO A;  4KX4 A;  1XVW A;  3TKP A;  4N11 A;  4IHU A;  1NHY A;  1TW9 A;  2KHP A;  3KH7 A;  1A8L A;  2A4H A;  1N2A A;  2DBC A;  3F8U A;  3W8S A;  4ZB9 A;  2R4V A;  3GNJ A;  3LSZ A;  3I43 A;  4PGT A;  3S9F A;  4V2N A;  2IMF A;  2G2Q A;  4HQS A;  5HR3 A;  5A4V A;  1XW5 A;  2PPT A;  4K7N A;  4TR0 A;  2DJJ A;  1PA3 A;  2EC4 A;  4KDX A;  5B8B A;  2MMN A;  5G1K A;  2GSS A;  2H1B A;  4O5R A;  2O8V B;  3QMX A;  2CAQ A;  4MH3 A;  3GH9 A;  4MJC A;  1YY7 A;  1GSU A;  3TRQ A;  2LV3 A;  4CDO A;  3UMA A;  4QQ7 A;  2WUL A;  2YWI A;  3VFI A;  2C4J A;  3HYP A;  1G7E A;  4JU5 A;  5CYY A;  1YDK A;  4BWQ A;  3GH6 A;  4Z2U A;  4F0B A;  2OE0 A;  4IP1 A;  1TDI A;  5GZZ B;  2WCI A;  6GSY A;  3RBT A;  1UA5 A;  1K3Y A;  4WBJ A;  5AIV A;  4TN8 A;  4ML1 A;  1SYX A;  3KTB A;  4K0N A;  2LST A;  5J5N A;  3UJ1 A;  4XIH A;  3US3 A;  5A4W A;  4WXT A;  5GST A;  1DBY A;  4HEA 2;  3TJG A;  2BTO T;  3TKS E;  1J08 A;  1ERT A;  1YEX A;  1GSD A;  1XWK A;  2TIR A;  3F3Q A;  3FY7 A;  3LFL A;  3FR6 A;  1A0F A;  2RLI A;  3A2X A;  2C1Y A;  1B4P A;  1SL2 B;  3CSI A;  3UEM A;  5H5S A;  5J4U A;  3TJB A;  3CBU A;  4DEJ A;  4MMM A;  3GKN A;  3HZ8 A;  4PUF C;  3A5W A;  3KP8 A;  2AUV A;  4V1A g;  1O81 A;  1TU7 A;  4ZB6 A;  1FHE A;  2OE3 A;  4RQX A;  4LL4 B;  3KJY A;  1BQ7 A;  16GS A;  3VK9 A;  2I81 A;  4YAP A;  2DJK A;  2LNT A;  1Q98 A;  4ACS A;  4KSM A;  14GS A;  1ACV A;  3ZLP A;  2VUP A;  2PMT A;  1TRW A;  3RPP A;  3TKS C;  4TW5 A;  3F4T A;  1G7O A;  2O87 A;  2YJH A;  1YZX A;  3LWA A;  8GSS A;  5F06 A;  5DJL A;  2HYX A;  4L5O A;  3ZMK A;  5ECP B;  1EZK A;  2IN3 A;  1THO A;  1GSE A;  3F4R A;  2YP6 A;  2HT9 A;  2TRC P;  4EF0 A;  3VWW A;  2KLX A;  2F9S A;  2R0C A;  2YWN A;  3DWV A;  2B1L A;  5F8B A;  3KTL A;  4IVF A;  2MYG A;  1BED A;  3F9U A;  4XHM A;  3IK9 A;  2HI7 A;  5EY6 A;  2QKE A;  2XBQ A;  4K8M A;  5CP1 A;  2DSA A;  2VOC A;  3TJK A;  4ZXG A;  2DJ2 A;  2B7J A;  3GN3 A;  3QFB C;  2GQM A;  4KE3 A;  4TR3 A;  3D4M A;  5EVO A;  4ILF A;  4MH2 A;  3ZIJ A;  2REM A;  3C8E A;  4HJM A;  5INY A;  3CTF A;  3QFA C;  1BYE A;  3BCK A;  2DIY A;  1PMT A;  3A3T A;  4KND A;  1EOH A;  3QAV A;  1V57 A;  1F2E A;  3MDK A;  2LQQ A;  2H6Z A;  4YKG A;  1TRU A;  3E3E A;  3VWU A;  2R37 A;  4ULX A;  4X1U A;  1XVQ A;  4YAV A;  5B6N A;  3EMX A;  1GSQ A;  5ECR B;  1FVJ A;  3CXG A;  4G0K A;  4I2U A;  4ISD A;  2V6K A;  1F37 A;  2EIQ A;  2X99 A;  3MIX A;  2WFC A;  2MMA A;  3KD0 A;  2M80 A;  4KCE A;  1YKA A;  4EL1 A;  5ENU A;  4OD7 A;  4G0L A;  1U6T A;  4K2D A;  5KOX A;  4KH7 A;  3ZFL A;  2MBS A;  2L57 A;  2XPD A;  4CHS A;  4IQA A;  19GS A;  2PUK C;  3PPU A;  4AJ8 A;  4KDU A;  1Q4J A;  3VLN A;  2E0Q A;  4YQV A;  2HZE B;  4X43 A;  1PL2 A;  2HZE A;  4USS A;  3NOF A;  3H8Q A;  4GRF A;  1A0R P;  5DQY A;  1OAZ A;  2K18 A;  1Z5Y E;  2B5E A;  2LRC A;  3IE3 A;  1QFN A;  4CY6 A;  3VPQ A;  1A8Y A;  3KGK A;  2FCH A;  1T1V A;  5J9B A;  1K0B A;  1Z9H A;  2YNX A;  1PX6 A;  4GTU A;  2EIO A;  5DQS A;  4L0W A;  2H01 A;  4CY8 A;  3QPM A;  4GQC A;  3ZL5 A;  2HXK A;  4PQI A;  1EOG A;  4OO5 A;  2C8U A;  3J7Y k;  2OBK A;  3FZ9 A;  4IBP A;  4OMV A;  4I97 A;  4X4J A;  5D9V A;  2L5O A;  3L4N A;  3GIX A;  5D73 A;  2A2P A;  5IO2 A;  2IMI A;  1WIK A;  3P8W A;  1Z7P A;  1LU4 A;  3M8N A;  1B48 A;  2RII A;  2CQ9 A;  2LEG A;  2KOK A;  3U5R E;  3APQ A;  4K5R A;  1WJK A;  2HRF A;  3A2V A;  5HR2 A;  3K8N A;  3ZVJ A;  2VIM A;  2YN1 A;  3MYD A;  3ZML A;  5IMC A;  4MJE A;  5DJM A;  2VCQ A;  5D9T A;  5ELA A;  2V2G A;  4HUA A;  3KH9 A;  2LJA A;  3L78 A;  1YJ6 A;  1T00 A;  3EIN A;  2H71 A;  1SK0 A;  4JR6 A;  1WOU A;  5B8A A;  2VD1 A;  1RQM A;  1GUL A;  2GLR A;  2O85 A;  4K7O A;  4Z2T A;  4PUA A;  2QSI A;  1YKC A;  3IC8 A;  4OWY A;  5EPF A;  3LXT A;  1OE8 A;  2B1K A;  1U3A A;  3A2W A;  2AYT A;  2VLV A;  3TRX A;  3C71 A;  10GS A;  1GLP A;  3CSJ A;  2I1U A;  3IHQ A;  4F2I A;  5IMZ A;  4LLR A;  3VI7 A;  1SU9 A;  1PN9 A;  2HSH A;  1C72 A;  2B5X A;  3UBK A;  1SKR B;  1VGL A;  4P3Y B;  1YF1 A;  3I69 A;  2LTK A;  1XW9 A;  3GFK A;  2GST A;  22GS A;  1BX9 A;  2IPA A;  2JSY A;  2VAF A;  3F63 A;  1GH2 A;  2LJK A;  5GAN D;  2FA4 A;  3ZIT A;  2R0P A;  2BJX A;  1OC3 A;  1WPI A;  4NV5 A;  4IN0 A;  1ILO A;  2JZT A;  1H4O A;  1XOA A;  2L6C A;  2QGV A;  3L9S A;  3ERG A;  2X8H A;  4K2X A;  1MDK A;  4HS1 A;  4ZB8 A;  2I9H A;  1QGV A;  3TB2 A;  1JLV A;  5F05 A;  1T4Z A;  4Q5N A;  5HFK A;  1TU8 A;  3IA1 A;  1XOB A;  3TKS A;  1Y6E A;  5LNK e;  2G0F A;  3CRU A;  4ZBB A;  1FOV A;  2FY6 A;  1PN0 A;  1FW1 A;  1ZMA A;  3VI5 A;  4JED A;  3VWX A;  5DCG A;  2OA7 A;  5J41 A;  3W8J A;  1B4Q A;  2DJ3 A;  3HCZ A;  2WGR A;  1GTI A;  1DE1 A;  3P7X A;  3Q6O A;  1ST9 A;  17GS A;  1XW6 A;  1EGO A;  4CW9 A;  4F03 A;  1Y25 A;  3UVT A;  1MD3 A;  1PD2 1;  3IRA A;  2JZS A;  2FHE A;  2CT6 A;  3FKF A;  5D9W A;  3PR8 A;  1GTA A;  5J9C A;  1A24 A;  3RDW A;  4MA9 A;  2JU5 A;  4IKH A;  3LW9 A;  3MWH A;  1SKS B;  4ZL9 A;  2P31 A;  1TXX A;  3C7M A;  3TOT A;  4G10 A;  2GSQ A;  5CO3 A;  2F8A A;  1J9B A;  4OFN A;  2CVB A;  2H72 A;  1GNW A;  3I9V 2;  1GUK A;  3EUR A;  4G9H A;  4TR1 B;  3TKQ A;  1O85 A;  1FVK A;  2B6M A;  2J23 A;  4TR1 A;  4DSS B;  3IAS 2;  3IPZ A;  1SJ6 A;  3TRP A;  5DDL A;  4DSS A;  1HNA A;  3D5J A;  5IM9 A;  3WT1 A;  2H1G A;  5EL8 A;  5H5R A;  4KF9 A;  1LJR A;  4AJ7 A;  2E7P A;  1EP7 A;  6GST A;  5JCW A;  2N5A A;  1E6B A;  1JZR A;  3DRN A;  3ZVJ D;  4POK A;  5ECO B;  1ON4 A;  5H5Q A;  2V41 A;  4O7H A;  1YQ1 A;  5G1L A;  5E59 A;  1SD9 A;  3IOS A;  5G30 A;  2GZY A;  5JWO B;  1XWB A;  3WT2 A;  4ECI A;  2ALB A;  2LRN A;  2NTO A;  3M1G A;  4NHZ A;  1IYI A;  4HDE A;  3APS A;  1WRY A;  2XPE A;  3ERF A;  2L59 A;  3IV4 A;  1SEN A;  5IIZ A;  2NVL A;  1K3L A;  5KN3 A;  1UN2 A;  3FR9 A;  4TRX A;  5KOW A;  5KN1 A;  4WKW A;  1SYR A;  4F82 A;  2I3Y A;  4ZL8 A;  3RAZ A;  3TGZ A;  2HZF A;  3LQ7 A;  1ZYN A;  3GKX A;  1PX7 A;  3GV1 A;  2DMM A;  4KGI A;  1JLW A;  1TJD A;  2WB9 A;  3TKR A;  1WMJ A;  5CAX A;  4OFT A;  4OO4 A;  4V1A p;  3FRC A;  2H76 A;  4IJI A;  1OYJ A;  4POM A;  3E9J B;  3GHA A;  1TI1 A;  3I6A A;  3M3M A;  5IOW A;  2P5Q A;  2DIZ A;  2N5B A;  1X9M B;  3TJJ A;  4EIP A;  5IO0 A;  1XFL A;  2C80 A;  3TDG A;  1GL8 A;  4J2F A;  1BG5 A;  3LGC A;  1S3A A;  1U87 A;  1A23 A;  4MPF A;  4EDZ A;  2DJ1 A;  3QOU A;  4HU9 A;  5HQP A;  3HA9 A;  4K5S A;  4EC0 A;  2KUC A;  4MZC A;  1GSS A;  1ZCP A;  2HNL A;  5CRW A;  5ECM B;  3DKS A;  4BVY B;  5JWR B;  1TI3 A;  4BVY A;  3IBH A;  2FD3 A;  2HRK A;  2DKH A;  4TVE A;  1PRX A;  2RM6 A;  3FYG A;  1U88 A;  3VUR A;  4WEY A;  2RUF A;  5ECH B;  4KAE A;  13GS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...