1Q98A

Structure of a thiol peroxidase from haemophilus influenzae rd
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
164
Chain Sequence
TVTLAGNPIEVGGHFPQVGEIVENFILVGNDLADVALNDFASKRKVLNIFPSIDTGVCATSVRKFNQQAAKLSNTIVLCISADLPFAQARFCGAEGIENAKTVSTFRNHALHSQLGVDIQTGPLAGLTSRAVIVLDEQNNVLHSQLVEEIKEEPNYEAALAVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol Peroxidase
publication title Structure of a Thiol Peroxidase from Haemophilus influenzae Rd
rcsb
source organism Haemophilus influenzae
molecule tags Oxidoreductase
total genus 48
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1q98A00
3ZVJD 3DVWA 1OC3A 1G7OA 1O73A 3KGKA 4MJEA 4ZL8A 1TDIA 4RQRA 3E9JB 1Z9HA 5H5RA 1B4QA 3ERGA 3HZ4A 2PMTA 1GNEA 2JU5A 5H5QA 4EDZA 4HOJA 4WEYA 5A5KA 5ENUA 3IHQA 3RBTA 2TIRA 1Z6MA 1K0AA 4DVCA 4MLYA 1QQ2A 2B5XA 1AQWA 5HFIA 4ZIJA 4ML6A 4CHSA 2FY6A 3O3TA 6GSYA 3D0ZA 3FZ4A 4KE3A 1V57A 3ISOA 1IYIA 1OVNA 3CRTA 5ELAA 12GSA 3ZL5A 1VF1A 4AJ7A 1WIKA 5ECLB 1JLVA 2O89A 3HY2A 2KP1A 4LMVA 4N10A 3UL3A 3UVHA 4IQ1A 1AIUA 3RAZA 1VF3A 4JE1A 2H0HA 4L8EA 1GSDA 3L9VA 4MF5A 3C71A 3F4SA 3K8NA 3QAGA 4ZBAA 2V32A 2DBCA 4YQVA 1PSQA 2GDRA 5D9WA 1XWKA 5INYA 5F07A 11GSA 4KDUA 1SJIA 4HU9A 3DEXA 4Q5RA 3KH7A 3LQ7A 1I9DA 4IELA 1T1VA 3C8EA 1QK8A 2GZZA 2QGVA 1Q4JA 3UVTA 2KHPA 2H75A 2CVKA 1FOVA 3FZAA 3MWHA 3BCKA 5GSTA 1Y25A 3KJYA 3TUEA 4N11A 4RI7A 5G1LA 5D9VA 3A2VA 1OC8A 3RHBA 1ERVA 4YAPA 14GSA 2AHEA 3QAWA 3C73A 4RI6A 4ZB9A 1YF0A 3ME7A 1AXDA 4OFTA 5F8BA 3EURA 1NSWA 4MZCA 2WS2A 4ZL9A 3TKQA 4PURA 2LNTA 5ECQB 3TB2A 5CNWA 1B4PA 3EU3A 1E2YA 3MAKA 2LJAA 3ZTLA 4WR4A 2DLXA 2CV4A 1R26A 5D93A 4NMUA 2C3QA 2DC5A 1K3OA 2IN3A 4G2EA 2VL2C 2ZUPA 5G1KA 2JL4A 3VLNA 2GQKA 4OFMA 2R37A 1SL1B 1FVJA 5B7CA 4POMA 5A4VA 2ZNMA 2EIOA 4KCAA 3SBCA 4G10A 2LNSA 3APQA 4IQAA 4MH3A 2WCIA 19GSA 1GTUA 3Q19A 2F8FA 2C3NA 3WT2A 4D73A 4JRRA 2ALBA 3FYGA 4WBJA 5IMVA 3VURA 3LSZA 3EYTA 1DUGA 3TGZA 3J7Yb 2P31A 3TRXA 2WJUA 1S3AA 4TXOA 1EP8A 2WULA 5HR0A 2B1KA 3DVXA 1GSFA 2B3SA 4E8HA 3HJOA 1Z6NA 3IAS2 3TDGA 2YV7A 3WD6A 1XIYA 3C1SA 4PNGA 4KSMA 4F0CA 4KW6A 4OD7A 2VIMA 5CP1A 1SL0B 3GL5A 1S3CA 4IHUA 1XW9A 3GX8A 4ACSA 2HT9A 4MF7A 4D73B 5DAKA 4POKA 1JLWA 5HFKA 1XPVA 5JWRB 2O87A 4TXOB 1EGRA 5EPFA 1AW9A 1Y6EA 2BMXA 4V2MA 1KNGA 3BD2A 1GSUA 2L4CA 4AJ6A 1XWBA 5JCUA 3IAM2 3LXZA 2LRTA 5IMDA 2CQ9A 4FYUA 3KM6A 4CW9A 1JHBA 4EF0A 3HA9A 2GQMA 1MDKA 2B5EA 4NPBA 2O85A 1K3YA 4TR4A 3KCMA 1XWAA 3HDCA 4ECBA 4KUNA 1OYJA 1FVKA 4I8BA 5DAKB 3CMIA 1A24A 3DRNA 3I69A 2DJJA 5D96A 5ABRA 1SYRA 2H71A 3UMAA 2YJ7A 3OR5A 4IW9A 1NM3A 3TCOA 1X9MB 5ECIB 4BL7A 4HZ2A 3DD3A 3GN3A 1YF1A 2MMOA 1USBA 4GQCA 3HCZA 4KCEA 2HZFA 5ECPB 2JZRA 1G6WA 1BEDA 2VCXA 2YP6A 5HR3A 5HR2A 3ZLPA 1MD3A 1F3BA 1H4OA 2L4QA 4ULXA 4PUFC 4NWYA 1UN2A 2VAFA 1XZOA 1OKTA 2LUSA 4BWQA 1ERWA 4XIHA 1F6MC 4WF4A 4PX1A 2OE0A 4TR3A 2HSYA 5GSSA 5GAND 4TOPA 3QFAC 4BPYA 3PR8A 3TJJA 5D9TA 3SWLA 2HE3A 1JZOA 3KTLA 3TRPA 4V2LA 1DE2A 5B8BA 4POLA 1FHEA 5AIVA 1TOFA 3A2WA 3UBKA 2X64A 4QQ7A 5H5SA 2MBTA 2QSIA 1WJKA 4DSRA 1DSBA 3LGCA 3DKSA 4LLRA 4OO5A 2M72A 5IM9A 4LL4B 2YZUA 3FR9A 3O6TA 3CSIA 2V6OA 2DJ2A 3P2AA 3F9UA 4KH7A 3ERWA 1K0MA 4K7IA 5LD0A 3C7MA 3DWVA 4IGJA 3ZMKA 1MDJA 5ECHB 3F3RA 3FK8A 4F0BA 3M9KA 3I6AA 4CDOA 4I5QA 2X8GA 4TRXA 5J9BA 3KTBA 2N5AA 3FY7A 2N5FA 4IVFA 3BJ5A 3BCIA 5IO2A 3M3MA 3FZ5A 1F3AA 2AAWA 2IWTA 4YQUA 5AISA 3GKKA 3D4MA 1SKWB 2GVPA 2WRTA 2IMKA 1W89A 5KN2A 3A2XA 5C00A 4G9HA 4GF0A 3GL3A 4FO5A 1FO5A 4XS6A 3QDNA 1M99A 3TKSC 1TTZA 3FEUA 5F0GA 22GSA 2I3YA 1GUMA 1PD21 1M9BA 4WKWA 1AQVA 3VK9A 2RLIA 3P7XA 2OACA 1YDKA 3MSZA 4Q5NA 1YJ6A 1HNBA 2CVDA 2FWHA 4BVYA 2C8UA 1V40A 4NV5A 3V1WA 2K8SA 2LJRA 4O92A 2VO4A 3GKMA 1U88A 2B1LA 1XOAA 2FLSA 2PVOC 2VL9A 3IRAA 4PXOA 2FA8A 2PN8A 3H8QA 4EUYA 1X9SB 1GWCA 2EIQA 4I2UA 1B9XC 4XCSA 2K6VA 1XCCA 4HEA2 4GLTA 4ZB6A 1X5CA 3CXGA 2VLUA 5AIXA 2XHFA 2IFQA 3FZ9A 2CX4A 4JBBA 3TJBA 1OKDA 2X8CA 1ILOA 2REMA 1THOA 5ECRB 2AUVA 3VI7A 1GH2A 4EKZA 2GSSA 3FKFA 1VGLA 2BJXA 3KIJA 1SKRB 5CRGA 2I9HA 3WT1A 2YWIA 5ECMB 1SJ6A 4KB3A 4X0XA 4ZBBA 5L71A 3G7YA 3UOMA 4KX4A 2H70A 2NVLA 2B7KA 2MMNA 2V2GA 5G31A 1EOHA 3P8WA 5F06A 1V58A 4MABA 2PWJA 4ECIA 4F2IA 1AAZA 3M8NA 5ECNB 4F82A 3F6FA 5KN0A 3G7IA 2PBJA 4JR4A 2YPMA 2IFQB 4O32A 5DALA 3FHKA 5IMAA 1XOBA 3H93A 1A2LA 4MH2A 2H6XA 2EIRA 3HYPA 3FR6A 1TI1A 2LQQA 1FAAA 4K1FA 3DIEA 5J5NA 3D21A 3L9SA 1HD2A 1OC9A 1X5EA 2C1YA 3W6GA 4EE0A 1KBNA 3RDWA 2AYTA 4X1UA 2J9HA 1ACVA 3EC3A 1JZWA 1XW5A 2OADA 1ZMAA 2DJ0A 1TJDA 1GTAA 3GHAA 5EY6A 4GQFA 2JZSA 2RUFA 2VL2A 2J23A 3IK7A 3GUSA 2LRNA 3PH9A 2WZ9A 3QAVA 2VD0A 4H86A 4ECJA 6GSWA 1EOGA 3W8SA 3VWXA 3JCML 2HSHA 2GSQA 2JZTA 2L6DA 4LMWA 4OO4A 4WXTA 5DALB 1SKSB 1ML6A 3D6IA 2E7PA 3ZFBA 4JR6A 1E6BA 1DE1A 1EGOA 2WDUA 3ZRDA 1A8YA 4HZ4A 2JACA 4ZBDA 1SYXA 2H01A 5G2ZA 1PX7A 2IJYA 1OC9B 3VWUA 1R4WA 3HZ8A 4K8MA 4L0WA 1O85A 3EINA 3M0FA 3IV4A 5DQSA 1TKDB 2FWEA 2MBSA 1ZOFA 3GA4A 2K18A 2DIYA 1OAZA 2V1MA 1EV9A 1AQXA 4I2TA 1O6JA 1VF2A 4V1Ag 3I43A 4QL7A 1J0FA 4MF6A 1N2AA 1SL2B 1NW2A 2C3TA 3APSA 1TRSA 2GQLA 3GMFA 2FUG2 4IKHA 2HRFA 2WGRA 3F6DA 2ZCTA 3ME8A 3ZIVA 5DVBA 13GSA 5HFGA 2H76A 2H6YA 3UJ1A 4YH2A 4L0UA 2JADA 1G0TA 1XVQA 2H1AA 3TOTA 1BQ7A 1PMTA 3BOAA 1Z5YE 5DDLA 2OBKA 3IK9A 5D8IA 1F2EA 2H1DA 1LBKA 4MJBA 4XRAA 5JWOB 4ZXGA 5FT3A 1GSYA 1ZCPA 3IC4A 2H30A 2RM6A 5HR1A 1JZRA 1VF4A 5IO0A 1GL8A 4GRFA 4WF5A 2HRNA 4YAVA 2YWOA 3GIXA 1XBSA 5EVOA 1GTBA 2PGTA 2L6CA 2CA8A 4I6XA 4N0VA 1K0NA 1XFLA 3EMXA 5ECKB 3CSJA 10GSA 1EWXA 4IS0A 3ZMLA 5JCGA 1IYHA 4OCFA 4ZL7A 3RPNA 2DJ3A 4DEJA 3DXBA 2F51A 1WOUA 1BJXA 4G19A 2CZ3A 3IR4A 3H1NA 4NXIA 3J7Yk 5J9CA 1H75A 2KP2A 2A2SA 1V9WA 2C0DA 1HNAA 2ES7A 1TW9A 5KN1A 1T00A 3S9FA 4GSTA 3IDVA 2H6ZA 2DJKA 4KAEA 4ML1A 2ON5A 2ON7A 1U3AA 2HYXA 4TKYA 3GRXA 3LEFA 2H8LA 3LG6A 5ECOB 3R2QA 5B8AA 2TRCP 3D5JA 2YN1A 2EC4A 1WPIA 1QUWA 3MNGA 1TU7A 2GSTA 3F4RA 2PERA 2CX3A 5CAXA 2CZ2A 3W8JA 2YV9A 2KOKA 1EEJA 1Z3EA 3UAPA 2L5LA 5KEJA 2DMLA 3I9V2 2A4VA 3GURA 3CRUA 2NPBA 4PQ1A 3QMXA 1YKCA 2HLSA 2X99A 5FWGA 2NTOA 2OA7A 1J08A 1Z7RA 4J57E 1A0FA 4K7OA 1TK8B 4TW5A 3ZIJA 4Q5QA 5B6NA 5DJMA 2XBIA 16GSA 4GTUA 4Z7XA 1V98A 1YEXA 4MP4A 2LV3A 5B6MA 2JSYA 4WETA 1TP9A 5COHA 1QGVA 5J4UA 2FHEA 1TRUA 1XWCA 1M2DA 4K9ZA 4BA7A 1KEBA 3GX0A 3NIVA 5CREA 3UEMA 3TKRA 1YQ1A 3PINA 3A5WA 3APOA 3WGEA 2VCZA 3L78A 5D73A 3QOUA 3IA1A 4PUAA 4ISDA 3FR3A 4KA0A 3WGXA 4HI7A 1M0UA 2IPAA 2HNLA 3VPTA 2XPDA 4IJ3A 1Q98A 5A4UA 4MPFA 1XVWA 5DCHA 2GGTA 1B48A 1R7HA 4NHWA 3LORA 4IN0A 4F03A 3MDKA 4GSSA 2VCVA 2PVQA 1GULA 1AUCA 4OMVA 5AGYA 2C0FA 3IOSA 2GS3A 1M9AA 2GZPA 5JWQB 1ZYEA 5J3RA 2MMZA 4GXZA 20GSA 1PL2A 2AJQB 5AN1A 6GSTA 4L5OA 1OE8A 1TK5B 3U5RE 2QKEA 1DBYA 3DYRA 3BBYA 3FW2A 3HD5A 3Q18A 3GH9A 4EO3A 2YZHA 1PKZA 1F37A 3IPZA 1A0RP 4J2FA 3TKSA 1SK1A 3M1GA 2GLRA 3LJRA 4HS1A 2V6KA 5HQPA 4MJAA 2LQOA 4QL9A 4NV2A 4TR0A 2H0GA 1FG4A 2FA4A 5IIZA 1A23A 4FYBA 1O81A 1HYUA 2L59A 1GRXA 2YJHA 2WB9A 1ERTA 3WGDA 1SJZA 1YZXA 1ABAA 1K3LA 3UARA 2GZYA 2C80A 17GSA 1AC1A 1WE0A 2H72A 2TRXA 1GP1A 2O7KA 1YEPA 5J41A 1K0BA 4V2NA 3EE2A 2OE3A 2X8HA 4TVEA 1MEKA 3HHVA 2YNXA 2I1UA 5DBQA 2JSZA 5DCGA 3CTGA 1CQHA 3KD0A 3PGTA 4IP6A 1GTIA 3ZZXA 2GTUA 1PL1A 5KN3A 5LNKe 4XTSA 3QD9A 2HXKA 4IJIA 3N9JA 5CYYA 5E4WA 2H0IA 4OFNA 2KLXA 2GSRA 2IMEA 2B6MA 3L9UA 1BYEA 3KEBA 4MK3A 4FYCA 1SENA 2K9FA 3M9JA 1PQNA 6GSVA 5CRDA 1GLPA 2XPEA 1I5GA 3TJFA 3E3EA 4OCEA 5CRWA 3KMOA 1O8XA 3GFKA 2I4AA 4HJ2A 4ID0A 1TRWA 3C1RA 3LFLA 2F9SA 2M46A 2LKUA 5ELGA 3NOFA 4K7NA 1ST9A 5G5FA 4JZQA 1MTCA 4EC0A 4GCIA 1PA3A 3KXOA 3CYNA 1BX9A 9GSSA 3TRQA 3GTUA 2NDOA 1A2JA 3HVSA 4MCUA 4LL1B 3ZREA 2VUPA 3CSHA 1HNCA 4MMMA 4K0GA 2IMIA 2HFDA 2R4VA 2H1BA 3F3QA 1SD8A 2R2JA 2OE1A 3F63A 1UC7A 1NHOA 2IMFA 1A8LA 3G7JA 3LYPA 3US3A 3ZYWA 1QFNA 3GNJA 2FGXA 5FHIA 1ZZYA 3KP9A 3ZVJA 5ECSA 1UVZA 3VWWA 3P90A 2P0GA 4L5LA 1TI3A 3LXTA 5E59A 1T7PB 2DIZA 2YANA 2KUCA 3D4TA 1O8WA 5IMFA 3FRCA 4JU5A 2XBQA 3GTUB 3GV1A 3ED3A 2VCWA 5GZZB 4HDEA 5IMZA 4EXJA 2CAIA 4Q5FA 2H19A 4AF2A 18GSA 2CAQA 4O7HA 2GT6A 4TR1A 4K0NA 4TN8A 3IE3A 1EZKA 2V41A 1W4VA 5G5EA 1SD9A 2B5YA 3HJMA 4AJ8A 2R5GA 3KZQA 2FWFA 2VOCA 2DSAA 1K0CA 3KP8A 3A3TA 4OWYA 4HUAA 4F9ZA 3KH9A 3TJKA 3CTFA 1K0OA 1GUKA 1KTEA 1PKWA 2HI7A 2CT6A 2VLTA 4NHZA 1M2BA 2VLVA 4EL1A 2O8VB 3UBLA 1TU8A 5DQYA 1C72A 3CBUA 4DSQA 4X43A 2VM2A 2BTOT 2PUKC 1EV4A 3F0IA 3HJPA 1Z7PA 5IPGA 2OKAA 1V2AA 3QFBC 2B7JA 1J9BA 1CQGA 1MD4A 3HXSA 4DSSA 2R6KA 4TR1B 6GSUA 1GSQA 1R5AA 1GNWA 3VI5A 4E8EA 3EVIA 4K6XA 3H4KA 1ZL9A 4HJMA 5IMCA 4K2DA 2G0FA 3GH6A 5G30A 2P5QA 4MZWA 1HQOA 5IQYA 4N30A 3L4NA 4MPGA 3VFIA 2N5BA 3VPQA 1THXA 3ERFA 2QC7A 1RQMA 3Q6OA 4O5RA 1SU9A 2VL3A 1U3IA 3GKNA 4IBPA 2L5OA 2G2QA 5IOXA 1G6YA 1JFUA 3L0HA 3F4TA 2VM1A 5A4WA 4WR5A 1WWJA 4FIWA 2MMAA 3AY8A 1ERUA 2MYGA 3ZFLA 6GSSA 4XHMA 2A2RA 4HQSA 1ZYQB 1U87A 1YY7A 2IMDA 4DSSB 3EU4A 3TKSE 1EEMA 4IP1A 4BWSA 3GKXA 4PNFA 3Q74A 1FW1A 4RQXA 5ID2A 1TK0B 3NZNA 1NHYA 2OJLA 2MZCA 6GSXA 2K8VA 4I97A 2LS5A 4MDCA 4NAXA 2XC2A 4XS4A 1WRYA 2YOIA 3KMNA 3TOUA 4TXVA 2PU9C 2LTKA 4XS1A 1GSEA 1ZGNA 4GSNA 2VCTA 4YQMA 1G7EA 2C0GA 3U6VA 1FB0A 1A2MA 1RK4A 1WMJA 1UA5A 3WYWA 1O7UA 4MZBA 1SK0A 3GSSA 5GAPD 1B9YC 1X5DA 2WFCA 2RIIA 5IPHA 3D22A 3ZITA 1SK2A 5C04A 2PPTA 2GT5A 1T8EB 3GSTA 1VRSD 5ID2B 2L57A 2VCQA 7GSSA 4KNDA 4J56E 3RPPA 5CO3A 1XWGA 1TXXA 3LWAA 4XS4B 2H66A 4GWRA 1BG5A 3IBHA 4KSOA 1T4YA 2OBIA 5EL8A 1GSSA 3GYKA 1EP7A 2E0QA 5IOWA 2H73A 2LJKA 3EWLA 2F8AA 4POBA 1M7TA 1MDIA 2LEGA 1U6TA 3QPMA 4PQHA 4AGSA 2C0EA 2AB6A 2H74A 2LSTA 3LYKA 4ZILA 1FB6A 4KDXA 1LU4A 2C4JA 2LRCA 2R3XA 4MA9A 2VD1A 1K0DA 1B8XA 5CRHA 1X0RA 1BAYA 2FNOA 5D9XA 4LA1A 3F8UA 1YKAA 2YWNA 1PN9A 1XW6A 3EMPA 3G9BA 2RM5A 1T3BA 5LCZA 1QMVA 4PQIA 1URMA 4KDYA 4ILFA 2FD3A 3E0UA 1F9MA 4KGIA 4FH8A 3RHCA 2E2GA 2CVBA 1QXHA 1PRXA 1R5PA 4ZB8A 4XRDA 4P3YB 2RUEA 3HVVA 3O76A 3IXRA 4RUVA 4ECCA 2DJ1A 3VWVA 8GSSA 2DMMA 3HVXA 2HZEA 1XXUA 2IIYA 4HQZA 4EVMA 2YCDA 1LJRA 2H1GA 2FCHA 1JZDA 2Z9SA 4WBRD 1T4ZA 1S3DA 4N0ZA 4V1Ap 3QR6A 2IL3A 2E2MA 4JEDA 3DMLA 2D2ZA 1RW1A 2YWMA 2P5RA 3HKRA 3H79A 4MJCA 2AV4A 1PGTA 3DGQA 3QCPA 5DJLA 1GLQA 2NBSA 2FWGA 3TJGA 1GUHA 5JCWA 1N8JA 1WP0A 3N5OA 4PGTA 5F05A 2F3MA 1M2AA 4EDYA 1OE7A 3TKPA 1TRVA 1PX6A 1X9WB 4HU7A 4BVXA 1ON4A 2HZEB 2I81A 2M80A 3UIWA
chains in the Genus database with same CATH superfamily
3ZVJD 3DVWA 1OC3A 1G7OA 1O73A 3KGKA 4MJEA 2UZ8A 4ZL8A 1TDIA 4RQRA 3E9JB 1Z9HA 5H5RA 1B4QA 3IC8A 3ERGA 3HZ4A 2PMTA 1GNEA 2JU5A 5H5QA 4EDZA 4HOJA 4WEYA 5A5KA 5ENUA 3IHQA 3RBTA 2TIRA 1Z6MA 1K0AA 2DKIA 4DVCA 4MLYA 1QQ2A 2B5XA 1AQWA 5HFIA 4ZIJA 4ML6A 4CHSA 2FY6A 3O3TA 6GSYA 3D0ZA 3FZ4A 4KE3A 1V57A 3ISOA 1IYIA 4BVXB 1OVNA 3CRTA 5ELAA 12GSA 3ZL5A 1VF1A 4AJ7A 1WIKA 5ECLB 1JLVA 2O89A 3HY2A 2KP1A 4LMVA 4N10A 3UL3A 3UVHA 4IQ1A 1AIUA 3RAZA 1VF3A 4JE1A 2H0HA 4L8EA 1GSDA 3L9VA 4MF5A 3C71A 3F4SA 3K8NA 3QAGA 4ZBAA 2V32A 2DBCA 4YQVA 1PSQA 2GDRA 5D9WA 1XWKA 5INYA 5F07A 11GSA 4KDUA 1SJIA 4HU9A 3DEXA 4Q5RA 3KH7A 3LQ7A 1I9DA 4IELA 1T1VA 3C8EA 1QK8A 2GZZA 2QGVA 1Q4JA 3UVTA 2KHPA 2H75A 2CVKA 1FOVA 3FZAA 3MWHA 3BCKA 5GSTA 1Y25A 3KJYA 3TUEA 4N11A 4RI7A 5G1LA 5D9VA 3A2VA 1OC8A 3RHBA 1ERVA 4YAPA 14GSA 2AHEA 3QAWA 3C73A 4RI6A 4ZB9A 1YF0A 3ME7A 4HSCX 1AXDA 4OFTA 5F8BA 3EURA 1NSWA 4MZCA 2WS2A 4ZL9A 3TKQA 4PURA 2LNTA 5ECQB 3TB2A 5CNWA 1B4PA 3EU3A 1E2YA 3MAKA 2LJAA 3ZTLA 4WR4A 2DLXA 2CV4A 1R26A 5D93A 4NMUA 2C3QA 2DC5A 1K3OA 4EIQA 2IN3A 4G2EA 2VL2C 4O5UA 2ZUPA 5G1KA 2JL4A 3VLNA 2GQKA 4OFMA 2R37A 1SL1B 1FVJA 5B7CA 4POMA 5A4VA 2ZNMA 2EIOA 4KCAA 3SBCA 4G10A 2LNSA 3APQA 4IQAA 4MH3A 2WCIA 19GSA 1GTUA 3Q19A 2F8FA 2C3NA 3WT2A 4D73A 4JRRA 2ALBA 3FYGA 4WBJA 5IMVA 3VURA 3LSZA 3EYTA 1DUGA 3TGZA 3J7Yb 2P31A 3TRXA 2WJUA 1S3AA 4TXOA 1EP8A 2WULA 5HR0A 2B1KA 3DVXA 1GSFA 2B3SA 4E8HA 3HJOA 1Z6NA 3IAS2 3TDGA 2YV7A 3WD6A 1XIYA 3C1SA 4PNGA 4KSMA 1ZYNA 4F0CA 4KW6A 4OD7A 2VIMA 5CP1A 1SL0B 3GL5A 1S3CA 4IHUA 1XW9A 3GX8A 4ACSA 2HT9A 4MF7A 5BRTA 4D73B 5DAKA 4POKA 5BMUA 1JLWA 5HFKA 1XPVA 5JWRB 2O87A 4TXOB 1EGRA 5EPFA 1AW9A 1Y6EA 2BMXA 4V2MA 1KNGA 3BD2A 1GSUA 2L4CA 4AJ6A 1XWBA 5JCUA 3IAM2 3LXZA 2LRTA 5IMDA 2CQ9A 4FYUA 3KM6A 4CW9A 1JHBA 4EF0A 3HA9A 2GQMA 1MDKA 2B5EA 4NPBA 2O85A 1K3YA 4TR4A 3KCMA 1XWAA 2DKHA 3HDCA 4ECBA 4KUNA 1OYJA 1FVKA 4I8BA 5DAKB 3CMIA 1A24A 3DRNA 3I69A 2DJJA 5D96A 5ABRA 1SYRA 1M3JA 2H71A 3UMAA 2YJ7A 3OR5A 4G0KA 4IW9A 1NM3A 3TCOA 1X9MB 5ECIB 4BL7A 4HZ2A 3DD3A 3GN3A 1YF1A 2MMOA 1USBA 4GQCA 3HCZA 4KCEA 2HZFA 5ECPB 3MIXA 2JZRA 1G6WA 1BEDA 2VCXA 2YP6A 5HR3A 5HR2A 3ZLPA 1MD3A 1F3BA 1H4OA 2L4QA 4ULXA 4PUFC 4NWYA 1UN2A 2VAFA 1XZOA 1OKTA 2LUSA 3R3EA 4BWQA 1ERWA 4XIHA 1F6MC 4WF4A 4PX1A 2OE0A 4TR3A 2HSYA 5GSSA 5GAND 4TOPA 3QFAC 4BPYA 3PR8A 4BL7B 3TJJA 5D9TA 3SWLA 2HE3A 1JZOA 3KTLA 3TRPA 4V2LA 1DE2A 5B8BA 4POLA 1PN0A 1FHEA 5AIVA 1TOFA 3A2WA 3UBKA 2X64A 4QQ7A 5H5SA 2MBTA 2QSIA 1WJKA 4DSRA 1DSBA 3LGCA 3DKSA 4LLRA 4OO5A 2M72A 5IM9A 4LL4B 2YZUA 3FR9A 3O6TA 3CSIA 3CQFA 1XG8A 2V6OA 2DJ2A 3P2AA 3F9UA 4KH7A 3ERWA 1K0MA 4K7IA 5LD0A 3C7MA 3DWVA 4IGJA 3ZMKA 1MDJA 5ECHB 3F3RA 3FK8A 4F0BA 3M9KA 3I6AA 4CDOA 4I5QA 2X8GA 4TRXA 5J9BA 3KTBA 2N5AA 3FY7A 2N5FA 4IVFA 3BJ5A 4YKFA 3BCIA 5IO2A 3M3MA 3FZ5A 1F3AA 2AAWA 2IWTA 4YQUA 5AISA 3GKKA 3D4MA 1SKWB 4A5PA 2GVPA 2WRTA 2IMKA 1W89A 5KN2A 3A2XA 5C00A 4KF9A 4G9HA 4GF0A 3GL3A 2R0PA 4FO5A 1FO5A 4XS6A 3QDNA 1M99A 3TKSC 1TTZA 3FEUA 5F0GA 22GSA 2I3YA 1GUMA 1FOHA 1PD21 1M9BA 4WKWA 1AQVA 3VK9A 2RLIA 3P7XA 2OACA 1YDKA 3MSZA 4Q5NA 1YJ6A 1HNBA 2CVDA 2FWHA 4BVYA 2C8UA 1V40A 4NV5A 3V1WA 2K8SA 2LJRA 4O92A 2VO4A 3GKMA 1U88A 2B1LA 1XOAA 2FLSA 2PVOC 2VL9A 3IRAA 4PXOA 2FA8A 2PN8A 3H8QA 4EUYA 1X9SB 1GWCA 2EIQA 4I2UA 1B9XC 4XCSA 2K6VA 1XCCA 4HEA2 4GLTA 4ZB6A 1X5CA 3CXGA 2VLUA 5AIXA 2XHFA 2IFQA 3FZ9A 2CX4A 4JBBA 3TJBA 1OKDA 2X8CA 1ILOA 2REMA 4G0LA 1THOA 5ECRB 2AUVA 3VI7A 1GH2A 4BVYB 4EKZA 2GSSA 3FKFA 1VGLA 2BJXA 3KIJA 1SKRB 5CRGA 2I9HA 3WT1A 2YWIA 5ECMB 1SJ6A 4KB3A 4X0XA 4ZBBA 5L71A 3G7YA 4O5QA 3UOMA 4KX4A 2H70A 2NVLA 2B7KA 2MMNA 2V2GA 5G31A 1EOHA 3P8WA 5F06A 1V58A 4MABA 2PWJA 4ECIA 4F2IA 1AAZA 3M8NA 5ECNB 4F82A 3F6FA 5KN0A 3MYDA 3G7IA 2PBJA 4JR4A 2YPMA 2IFQB 4O32A 5DALA 3FHKA 5IMAA 1XOBA 3H93A 1A2LA 4MH2A 2H6XA 2EIRA 3HYPA 3FR6A 1TI1A 2LQQA 1FAAA 4K1FA 3DIEA 5J5NA 3D21A 3L9SA 1HD2A 1OC9A 1X5EA 2C1YA 3W6GA 4EE0A 1KBNA 3RDWA 2AYTA 4X1UA 2J9HA 1ACVA 3EC3A 1JZWA 1XW5A 2OADA 1ZMAA 2DJ0A 1TJDA 1GTAA 3GHAA 5EY6A 4GQFA 2JZSA 2RUFA 2VL2A 2J23A 3IK7A 3GUSA 2LRNA 3PH9A 2WZ9A 3QAVA 5KOWA 2VD0A 4H86A 4ECJA 6GSWA 1EOGA 3W8SA 3VWXA 3JCML 2HSHA 2GSQA 2JZTA 2L6DA 4LMWA 4OO4A 4WXTA 5DALB 1SKSB 1ML6A 3D6IA 2E7PA 3ZFBA 4JR6A 1E6BA 1DE1A 4K5RA 1EGOA 2WDUA 3ZRDA 1A8YA 4HZ4A 2JACA 4ZBDA 1SYXA 2H01A 5G2ZA 1PX7A 2IJYA 1OC9B 3VWUA 1R4WA 3HZ8A 2R0GA 4K8MA 4L0WA 4EIPA 1O85A 3EINA 3M0FA 3IV4A 5DQSA 1TKDB 2FWEA 2MBSA 1ZOFA 3GA4A 2K18A 2DIYA 1OAZA 2V1MA 1EV9A 1AQXA 4I2TA 1O6JA 1VF2A 4V1Ag 3I43A 4QL7A 1J0FA 4MF6A 1N2AA 4BIKA 1SL2B 1NW2A 2C3TA 3APSA 1TRSA 2GQLA 3GMFA 2FUG2 4IKHA 2HRFA 2WGRA 3F6DA 2ZCTA 4X4JA 3ME8A 3ZIVA 5DVBA 13GSA 5HFGA 2H76A 2H6YA 3UJ1A 4YH2A 4L0UA 2JADA 1G0TA 1XVQA 2H1AA 3TOTA 1BQ7A 1PMTA 3BOAA 1Z5YE 5DDLA 2OBKA 3IK9A 5D8IA 1F2EA 2H1DA 1LBKA 4MJBA 4XRAA 4MNNA 5JWOB 4ZXGA 5FT3A 1GSYA 1ZCPA 3IC4A 2H30A 2RM6A 2QA2A 5HR1A 1JZRA 1VF4A 5IO0A 1GL8A 4GRFA 2R0CA 4WF5A 2HRNA 4YAVA 2YWOA 3GIXA 1XBSA 5EVOA 1GTBA 2PGTA 2L6CA 2CA8A 4I6XA 4N0VA 1K0NA 1XFLA 3EMXA 5ECKB 3CSJA 10GSA 1EWXA 4K5SA 4IS0A 3ZMLA 5JCGA 1IYHA 4OCFA 4ZL7A 3RPNA 2DJ3A 4DEJA 3DXBA 2F51A 1WOUA 1BJXA 4G19A 2CZ3A 3IR4A 3H1NA 4NXIA 3J7Yk 4FQUA 5J9CA 1H75A 2KP2A 2A2SA 1V9WA 2C0DA 1HNAA 2ES7A 1TW9A 5KN1A 1T00A 3S9FA 4GSTA 3IDVA 2H6ZA 2DJKA 4KAEA 4ML1A 2ON5A 2ON7A 1U3AA 2HYXA 4TKYA 3GRXA 3LEFA 2H8LA 3LG6A 5ECOB 3R2QA 5B8AA 2TRCP 3D5JA 2YN1A 2EC4A 1WPIA 1QUWA 3MNGA 1TU7A 2GSTA 3F4RA 2PERA 2CX3A 5CAXA 2CZ2A 3W8JA 2YV9A 2KOKA 1EEJA 1Z3EA 3UAPA 2L5LA 5KEJA 2DMLA 3I9V2 2A4VA 3GURA 3CRUA 2NPBA 4Z2UA 4PQ1A 3QMXA 1YKCA 2HLSA 2X99A 5FWGA 2NTOA 2OA7A 2A4HA 1J08A 1Z7RA 4J57E 1A0FA 4K7OA 1TK8B 4TW5A 3ZIJA 4Q5QA 5B6NA 5DJMA 2XBIA 16GSA 4GTUA 4Z7XA 1V98A 1YEXA 4MP4A 2LV3A 5B6MA 2JSYA 4WETA 1TP9A 5COHA 1QGVA 5J4UA 2FHEA 1TRUA 1XWCA 1M2DA 4K9ZA 4BA7A 1KEBA 2HRAA 3GX0A 3NIVA 5CREA 3FMWA 3UEMA 3TKRA 1YQ1A 3PINA 3A5WA 3APOA 3WGEA 2VCZA 3L78A 5D73A 5KOXA 3QOUA 3IA1A 4PUAA 4ISDA 3FR3A 4KA0A 3WGXA 4HI7A 1M0UA 2IPAA 2HNLA 3VPTA 2XPDA 4K2XA 4IJ3A 1Q98A 2A2PA 5A4UA 4MPFA 1XVWA 2GGTA 5DCHA 1B48A 1R7HA 4NHWA 3LORA 4IN0A 4F03A 3MDKA 4GSSA 2VCVA 2PVQA 1GULA 1AUCA 4CY6A 4OMVA 5AGYA 2C0FA 3IOSA 2GS3A 1M9AA 2GZPA 5JWQB 1ZYEA 5J3RA 2MMZA 4GXZA 20GSA 1PL2A 2AJQB 5AN1A 6GSTA 4L5OA 1OE8A 1TK5B 3U5RE 2QKEA 1DBYA 4PTSA 3DYRA 3BBYA 3FW2A 3HD5A 3Q18A 3GH9A 4EO3A 2YZHA 1PKZA 1F37A 3IPZA 1A0RP 4J2FA 3TKSA 1SK1A 3M1GA 2GLRA 3LJRA 4HS1A 2V6KA 5HQPA 4MJAA 2LQOA 4QL9A 4NV2A 4TR0A 2H0GA 1FG4A 2FA4A 5IIZA 1A23A 4FYBA 1O81A 1HYUA 2L59A 1GRXA 2YJHA 2WB9A 1ERTA 3WGDA 1SJZA 1YZXA 1ABAA 1K3LA 3UARA 2GZYA 2C80A 17GSA 1AC1A 1WE0A 2H72A 2TRXA 1GP1A 2O7KA 1YEPA 5J41A 1K0BA 4V2NA 3EE2A 2OE3A 2X8HA 4TVEA 1MEKA 3HHVA 2YNXA 2I1UA 5DBQA 2JSZA 5DCGA 3CTGA 1CQHA 3KD0A 3PGTA 4IP6A 1GTIA 3ZZXA 2GTUA 1PL1A 5KN3A 5LNKe 4XTSA 3QD9A 2HXKA 4IJIA 3N9JA 5CYYA 5E4WA 2H0IA 4OFNA 2KLXA 2GSRA 2IMEA 2B6MA 3L9UA 1BYEA 3KEBA 4MK3A 4FYCA 1SENA 2K9FA 3M9JA 1PQNA 6GSVA 5CRDA 1GLPA 2XPEA 1I5GA 3TJFA 3E3EA 4OCEA 5CRWA 3KMOA 1O8XA 3GFKA 2I4AA 4Z2TA 4HJ2A 4ID0A 1TRWA 3C1RA 3LFLA 2F9SA 2M46A 2LKUA 5ELGA 3NOFA 4K7NA 1ST9A 5G5FA 4JZQA 1MTCA 4EC0A 4GCIA 1PA3A 3KXOA 3CYNA 1BX9A 2X4AA 9GSSA 3TRQA 3GTUA 2NDOA 1A2JA 3HVSA 4MCUA 4LL1B 3ZREA 2VUPA 3CSHA 2QA1A 1HNCA 4MMMA 4K0GA 2IMIA 2HFDA 2R4VA 2H1BA 3F3QA 1SD8A 2R2JA 2OE1A 3F63A 1UC7A 1NHOA 2IMFA 3PPUA 1A8LA 3G7JA 3LYPA 3US3A 3ZYWA 1QFNA 4YKGA 3GNJA 2FGXA 5FHIA 1ZZYA 3KP9A 3ZVJA 5ECSA 1UVZA 3VWWA 3P90A 2P0GA 4L5LA 1TI3A 1ZYPA 3LXTA 5E59A 1T7PB 2DIZA 2YANA 2KUCA 3D4TA 1O8WA 5IMFA 3FRCA 4JU5A 2XBQA 3GTUB 3GV1A 3ED3A 2VCWA 5GZZB 4HDEA 5IMZA 4EXJA 2CAIA 4Q5FA 2H19A 4AF2A 18GSA 2CAQA 4O7HA 2GT6A 4TR1A 4K0NA 4TN8A 3IE3A 1EZKA 2V41A 4CY8A 1W4VA 5G5EA 1SD9A 2B5YA 3HJMA 4AJ8A 2R5GA 3KZQA 2FWFA 2VOCA 2DSAA 1K0CA 3KP8A 3A3TA 4OWYA 4HUAA 4F9ZA 3KH9A 3TJKA 3CTFA 1K0OA 1GUKA 1KTEA 1PKWA 2HI7A 2CT6A 2VLTA 4NHZA 1M2BA 2VLVA 4EL1A 2O8VB 3UBLA 1TU8A 5DQYA 1C72A 3CBUA 4DSQA 4X43A 2VM2A 2BTOT 2PUKC 1EV4A 3F0IA 3HJPA 1Z7PA 5IPGA 2OKAA 1V2AA 3QFBC 2B7JA 1J9BA 1CQGA 1MD4A 3HXSA 4DSSA 2R6KA 4TR1B 6GSUA 1GSQA 1R5AA 1GNWA 3VI5A 4E8EA 3EVIA 4K6XA 3H4KA 1ZL9A 4HJMA 1M3IA 5IMCA 4K2DA 2G0FA 3GH6A 5G30A 2P5QA 4MZWA 1HQOA 5IQYA 4N30A 3L4NA 4MPGA 3VFIA 2N5BA 3VPQA 3HVNA 1THXA 3ERFA 2QC7A 1RQMA 3Q6OA 4O5RA 1SU9A 2VL3A 1U3IA 3GKNA 4IBPA 2L5OA 4USSA 2G2QA 5IOXA 1G6YA 1JFUA 3L0HA 3F4TA 2VM1A 5A4WA 4WR5A 1WWJA 4FIWA 2MMAA 3AY8A 1ERUA 2MYGA 3ZFLA 6GSSA 4XHMA 2A2RA 4HQSA 1ZYQB 1U87A 1YY7A 2IMDA 4DSSB 3EU4A 3TKSE 4ICYA 1EEMA 4IP1A 4BWSA 3GKXA 4PNFA 3Q74A 1FW1A 4RQXA 5ID2A 1TK0B 3NZNA 1NHYA 2OJLA 2MZCA 6GSXA 2K8VA 4I97A 2LS5A 4MDCA 4NAXA 2XC2A 4XS4A 1WRYA 2YOIA 3KMNA 3TOUA 4TXVA 2PU9C 2LTKA 4XS1A 1GSEA 1ZGNA 4GSNA 2HSMA 2VCTA 4YQMA 1G7EA 2C0GA 3U6VA 1FB0A 1A2MA 1RK4A 1WMJA 1UA5A 3WYWA 1O7UA 4MZBA 1SK0A 3GSSA 5GAPD 1B9YC 2X49A 1X5DA 2WFCA 2RIIA 5IPHA 3D22A 1PFOA 3ZITA 1SK2A 5C04A 2PPTA 2GT5A 1T8EB 3GSTA 1VRSD 5ID2B 2L57A 2VCQA 7GSSA 4KNDA 4J56E 3RPPA 5CO3A 1XWGA 1TXXA 3LWAA 4XS4B 2H66A 4GWRA 1BG5A 3IBHA 4KSOA 1T4YA 2OBIA 5EL8A 1GSSA 3GYKA 1EP7A 2E0QA 5IOWA 2H73A 2LJKA 3EWLA 2F8AA 4POBA 1M7TA 1MDIA 2LEGA 1U6TA 3QPMA 4PQHA 4AGSA 2C0EA 2AB6A 2H74A 2LSTA 3LYKA 4ZILA 1FB6A 4KDXA 4G0IA 3EPTA 1LU4A 2C4JA 2LRCA 2R3XA 4MA9A 2VD1A 1K0DA 1B8XA 5CRHA 1X0RA 1BAYA 2FNOA 5D9XA 4LA1A 3F8UA 1YKAA 2YWNA 1PN9A 1XW6A 3EMPA 3G9BA 3LW9A 2RM5A 1T3BA 5LCZA 1QMVA 4PQIA 1URMA 4KDYA 4ILFA 2FD3A 3E0UA 1F9MA 4KGIA 4FH8A 3RHCA 2E2GA 2CVBA 4Z2RA 1QXHA 1PRXA 1R5PA 1S3RA 4ZB8A 4XRDA 2HRKA 4P3YB 2RUEA 3HVVA 3O76A 3IXRA 4RUVA 4ECCA 2DJ1A 3VWVA 3IHGA 8GSSA 2DMMA 3HVXA 2HZEA 1XXUA 2IIYA 4HQZA 4EVMA 2YCDA 1LJRA 2H1GA 2FCHA 1JZDA 2Z9SA 4WBRD 1T4ZA 1S3DA 4N0ZA 4V1Ap 3QR6A 2IL3A 2E2MA 4JEDA 3DMLA 2D2ZA 1RW1A 3A5IA 2YWMA 2P5RA 3HKRA 3H79A 4MJCA 2AV4A 1PGTA 3DGQA 3QCPA 5DJLA 1GLQA 2NBSA 2FWGA 3TJGA 1GUHA 5JCWA 1N8JA 1WP0A 3N5OA 4PGTA 5F05A 2F3MA 1M2AA 4EDYA 1OE7A 3TKPA 1TRVA 1PX6A 1X9WB 4HU7A 4BVXA 1ON4A 2HZEB 2I81A 2M80A 3UIWA
chains in the Genus database with same CATH topology
3ZVJD 3DVWA 1OC3A 1G7OA 1O73A 3KGKA 4MJEA 2UZ8A 4ZL8A 1TDIA 4RQRA 3E9JB 1Z9HA 5H5RA 1B4QA 3IC8A 3ERGA 3HZ4A 2PMTA 1GNEA 2JU5A 5H5QA 4EDZA 4HOJA 4WEYA 5A5KA 5ENUA 3IHQA 3RBTA 2TIRA 1Z6MA 1K0AA 2DKIA 4DVCA 4MLYA 1QQ2A 2B5XA 1AQWA 5HFIA 4ZIJA 4ML6A 4CHSA 2FY6A 3O3TA 6GSYA 3D0ZA 3FZ4A 4KE3A 1V57A 3ISOA 1IYIA 4BVXB 1OVNA 3CRTA 5ELAA 12GSA 3ZL5A 1VF1A 4AJ7A 1WIKA 5ECLB 1JLVA 2O89A 3HY2A 2KP1A 4LMVA 4N10A 3UL3A 3UVHA 4IQ1A 1AIUA 3RAZA 1VF3A 4JE1A 2H0HA 4L8EA 1GSDA 3L9VA 4MF5A 3C71A 3F4SA 3K8NA 3QAGA 4ZBAA 2V32A 2DBCA 4YQVA 1PSQA 2GDRA 5D9WA 1XWKA 5INYA 5F07A 11GSA 4KDUA 1SJIA 4HU9A 3DEXA 4Q5RA 3KH7A 3LQ7A 1I9DA 4IELA 1T1VA 3C8EA 1QK8A 2GZZA 2QGVA 1Q4JA 3UVTA 2KHPA 2H75A 2CVKA 1FOVA 3FZAA 3MWHA 3BCKA 5GSTA 1Y25A 3KJYA 3TUEA 4N11A 4RI7A 5G1LA 5D9VA 3A2VA 1OC8A 3RHBA 1ERVA 4YAPA 14GSA 2AHEA 3QAWA 3C73A 4RI6A 4ZB9A 1YF0A 3ME7A 1AXDA 4OFTA 5F8BA 3EURA 1NSWA 4MZCA 2WS2A 4ZL9A 3TKQA 4PURA 2LNTA 5ECQB 3TB2A 5CNWA 1B4PA 3EU3A 1E2YA 3MAKA 2LJAA 3ZTLA 4WR4A 2DLXA 2CV4A 1R26A 5D93A 4NMUA 2C3QA 2DC5A 1K3OA 4EIQA 2IN3A 4G2EA 2VL2C 4O5UA 2ZUPA 5G1KA 2JL4A 3VLNA 2GQKA 4OFMA 2R37A 1SL1B 1FVJA 5B7CA 4POMA 5A4VA 2ZNMA 2EIOA 4KCAA 3SBCA 4G10A 2LNSA 3APQA 4IQAA 4MH3A 2WCIA 19GSA 1GTUA 3Q19A 2F8FA 2C3NA 3WT2A 4D73A 4JRRA 2ALBA 3FYGA 4WBJA 5IMVA 3VURA 3LSZA 3EYTA 1DUGA 3TGZA 3J7Yb 2P31A 3TRXA 2WJUA 1S3AA 4TXOA 1EP8A 2WULA 5HR0A 2B1KA 3DVXA 1GSFA 2B3SA 4E8HA 3HJOA 1Z6NA 3IAS2 3TDGA 2YV7A 3WD6A 1XIYA 3C1SA 4PNGA 4KSMA 1ZYNA 4F0CA 4KW6A 4OD7A 2VIMA 5CP1A 1SL0B 3GL5A 1S3CA 4IHUA 1XW9A 3GX8A 4ACSA 2HT9A 4MF7A 5BRTA 4D73B 5DAKA 4POKA 5BMUA 1JLWA 5HFKA 1XPVA 5JWRB 2O87A 4TXOB 1EGRA 5EPFA 1AW9A 1Y6EA 2BMXA 4V2MA 1KNGA 3BD2A 1GSUA 2L4CA 4AJ6A 1XWBA 5JCUA 3IAM2 3LXZA 2LRTA 5IMDA 2CQ9A 4FYUA 3KM6A 4CW9A 1JHBA 4EF0A 3HA9A 2GQMA 1MDKA 2B5EA 4NPBA 2O85A 1K3YA 4TR4A 3KCMA 1XWAA 2DKHA 3HDCA 4ECBA 4KUNA 1OYJA 1FVKA 4I8BA 5DAKB 3CMIA 1A24A 3DRNA 3I69A 2DJJA 5D96A 5ABRA 1SYRA 2H71A 3UMAA 2YJ7A 3OR5A 4G0KA 4IW9A 1NM3A 3TCOA 1X9MB 5ECIB 4BL7A 4HZ2A 3DD3A 3GN3A 1YF1A 2MMOA 1USBA 4GQCA 3HCZA 4KCEA 2HZFA 5ECPB 3MIXA 2JZRA 1G6WA 1BEDA 2VCXA 2YP6A 5HR3A 5HR2A 3ZLPA 1MD3A 1F3BA 1H4OA 2L4QA 4ULXA 4PUFC 4NWYA 1UN2A 2VAFA 1XZOA 1OKTA 2LUSA 3R3EA 4BWQA 1ERWA 4XIHA 1F6MC 4WF4A 4PX1A 2OE0A 4TR3A 2HSYA 5GSSA 5GAND 4TOPA 3QFAC 4BPYA 3PR8A 4BL7B 3TJJA 5D9TA 3SWLA 2HE3A 1JZOA 3KTLA 3TRPA 4V2LA 1DE2A 5B8BA 4POLA 1PN0A 1FHEA 5AIVA 1TOFA 3A2WA 3UBKA 2X64A 4QQ7A 5H5SA 2MBTA 2QSIA 1WJKA 4DSRA 1DSBA 3LGCA 3DKSA 4LLRA 4OO5A 2M72A 5IM9A 4LL4B 2YZUA 3FR9A 3O6TA 3CSIA 2V6OA 2DJ2A 3P2AA 3F9UA 4KH7A 3ERWA 1K0MA 4K7IA 5LD0A 3C7MA 3DWVA 4IGJA 3ZMKA 1MDJA 5ECHB 3F3RA 3FK8A 4F0BA 3M9KA 3I6AA 4CDOA 4I5QA 2X8GA 4TRXA 5J9BA 3KTBA 2N5AA 3FY7A 2N5FA 4IVFA 3BJ5A 4YKFA 3BCIA 5IO2A 3M3MA 3FZ5A 1F3AA 2AAWA 2IWTA 4YQUA 5AISA 3GKKA 3D4MA 1SKWB 4A5PA 2GVPA 2WRTA 2IMKA 1W89A 5KN2A 3A2XA 5C00A 4KF9A 4G9HA 4GF0A 3GL3A 2R0PA 4FO5A 1FO5A 4XS6A 3QDNA 1M99A 3TKSC 1TTZA 3FEUA 5F0GA 22GSA 2I3YA 1GUMA 1FOHA 1PD21 1M9BA 4WKWA 1AQVA 3VK9A 2RLIA 3P7XA 2OACA 1YDKA 3MSZA 4Q5NA 1YJ6A 1HNBA 2CVDA 2FWHA 4BVYA 2C8UA 1V40A 4NV5A 3V1WA 2K8SA 2LJRA 4O92A 2VO4A 3GKMA 1U88A 2B1LA 1XOAA 2FLSA 2PVOC 2VL9A 3IRAA 4PXOA 2FA8A 2PN8A 3H8QA 4EUYA 1X9SB 1GWCA 2EIQA 4I2UA 1B9XC 4XCSA 2K6VA 1XCCA 4HEA2 4GLTA 4ZB6A 1X5CA 3CXGA 2VLUA 5AIXA 2XHFA 2IFQA 3FZ9A 2CX4A 4JBBA 3TJBA 1OKDA 2X8CA 1ILOA 2REMA 4G0LA 1THOA 5ECRB 2AUVA 3VI7A 1GH2A 4BVYB 4EKZA 2GSSA 3FKFA 1VGLA 2BJXA 3KIJA 1SKRB 5CRGA 2I9HA 3WT1A 2YWIA 5ECMB 1SJ6A 4KB3A 4X0XA 4ZBBA 5L71A 3G7YA 4O5QA 3UOMA 4KX4A 2H70A 2NVLA 2B7KA 2MMNA 2V2GA 5G31A 1EOHA 3P8WA 5F06A 1V58A 4MABA 2PWJA 4ECIA 4F2IA 1AAZA 3M8NA 5ECNB 4F82A 3F6FA 5KN0A 3MYDA 3G7IA 2PBJA 4JR4A 2YPMA 2IFQB 4O32A 5DALA 3FHKA 5IMAA 1XOBA 3H93A 1A2LA 4MH2A 2H6XA 2EIRA 3HYPA 3FR6A 1TI1A 2LQQA 1FAAA 4K1FA 3DIEA 5J5NA 3D21A 3L9SA 1HD2A 1OC9A 1X5EA 2C1YA 3W6GA 4EE0A 1KBNA 3RDWA 2AYTA 4X1UA 2J9HA 1ACVA 3EC3A 1JZWA 1XW5A 2OADA 1ZMAA 2DJ0A 1TJDA 1GTAA 3GHAA 5EY6A 4GQFA 2JZSA 2RUFA 2VL2A 2J23A 3IK7A 3GUSA 2LRNA 3PH9A 2WZ9A 3QAVA 5KOWA 2VD0A 4H86A 4ECJA 6GSWA 1EOGA 3W8SA 3VWXA 3JCML 2HSHA 2GSQA 2JZTA 2L6DA 4LMWA 4OO4A 4WXTA 5DALB 1SKSB 1ML6A 3D6IA 2E7PA 3ZFBA 4JR6A 1E6BA 1DE1A 4K5RA 1EGOA 2WDUA 3ZRDA 1A8YA 4HZ4A 2JACA 4ZBDA 1SYXA 2H01A 5G2ZA 1PX7A 2IJYA 1OC9B 3VWUA 1R4WA 3HZ8A 2R0GA 4K8MA 4L0WA 4EIPA 1O85A 3EINA 3M0FA 3IV4A 5DQSA 1TKDB 2FWEA 2MBSA 1ZOFA 3GA4A 2K18A 2DIYA 1OAZA 2V1MA 1EV9A 1AQXA 4I2TA 1O6JA 1VF2A 4V1Ag 3I43A 4QL7A 1J0FA 4MF6A 1N2AA 1SL2B 1NW2A 2C3TA 3APSA 1TRSA 2GQLA 3GMFA 2FUG2 4IKHA 2HRFA 2WGRA 3F6DA 2ZCTA 4X4JA 3ME8A 3ZIVA 5DVBA 13GSA 5HFGA 2H76A 2H6YA 3UJ1A 4YH2A 4L0UA 2JADA 1G0TA 1XVQA 2H1AA 3TOTA 1BQ7A 1PMTA 3BOAA 1Z5YE 5DDLA 2OBKA 3IK9A 5D8IA 1F2EA 2H1DA 1LBKA 4MJBA 4XRAA 4MNNA 5JWOB 4ZXGA 5FT3A 1GSYA 1ZCPA 3IC4A 2H30A 2RM6A 2QA2A 5HR1A 1JZRA 1VF4A 5IO0A 1GL8A 4GRFA 2R0CA 4WF5A 2HRNA 4YAVA 2YWOA 3GIXA 1XBSA 5EVOA 1GTBA 2PGTA 2L6CA 2CA8A 4I6XA 4N0VA 1K0NA 1XFLA 3EMXA 5ECKB 3CSJA 10GSA 1EWXA 4K5SA 4IS0A 3ZMLA 5JCGA 1IYHA 4OCFA 4ZL7A 3RPNA 2DJ3A 4DEJA 3DXBA 2F51A 1WOUA 1BJXA 4G19A 2CZ3A 3IR4A 3H1NA 4NXIA 3J7Yk 4FQUA 5J9CA 1H75A 2KP2A 2A2SA 1V9WA 2C0DA 1HNAA 2ES7A 1TW9A 5KN1A 1T00A 3S9FA 4GSTA 3IDVA 2H6ZA 2DJKA 4KAEA 4ML1A 2ON5A 2ON7A 1U3AA 2HYXA 4TKYA 3GRXA 3LEFA 2H8LA 3LG6A 5ECOB 3R2QA 5B8AA 2TRCP 3D5JA 2YN1A 2EC4A 1WPIA 1QUWA 3MNGA 1TU7A 2GSTA 3F4RA 2PERA 2CX3A 5CAXA 2CZ2A 3W8JA 2YV9A 2KOKA 1EEJA 1Z3EA 3UAPA 2L5LA 5KEJA 2DMLA 3I9V2 2A4VA 3GURA 3CRUA 2NPBA 4Z2UA 4PQ1A 3QMXA 1YKCA 2HLSA 2X99A 5FWGA 2NTOA 2OA7A 2A4HA 1J08A 1Z7RA 4J57E 1A0FA 4K7OA 1TK8B 4TW5A 3ZIJA 4Q5QA 5B6NA 5DJMA 2XBIA 16GSA 4GTUA 4Z7XA 1V98A 1YEXA 4MP4A 2LV3A 5B6MA 2JSYA 4WETA 1TP9A 5COHA 1QGVA 5J4UA 2FHEA 1TRUA 1XWCA 1M2DA 4K9ZA 4BA7A 1KEBA 2HRAA 3GX0A 3NIVA 5CREA 3FMWA 3UEMA 3TKRA 1YQ1A 3PINA 3A5WA 3APOA 3WGEA 2VCZA 3L78A 5D73A 5KOXA 3QOUA 3IA1A 4PUAA 4ISDA 3FR3A 4KA0A 3WGXA 4HI7A 1M0UA 2IPAA 2HNLA 3VPTA 2XPDA 4K2XA 4IJ3A 1Q98A 2A2PA 5A4UA 4MPFA 1XVWA 2GGTA 5DCHA 1B48A 1R7HA 4NHWA 3LORA 4IN0A 4F03A 3MDKA 4GSSA 2VCVA 2PVQA 1GULA 1AUCA 4CY6A 4OMVA 5AGYA 2C0FA 3IOSA 2GS3A 1M9AA 2GZPA 5JWQB 1ZYEA 5J3RA 2MMZA 4GXZA 20GSA 1PL2A 2AJQB 5AN1A 6GSTA 4L5OA 1OE8A 1TK5B 3U5RE 2QKEA 1DBYA 4PTSA 3DYRA 3BBYA 3FW2A 3HD5A 3Q18A 3GH9A 4EO3A 2YZHA 1PKZA 1F37A 3IPZA 1A0RP 4J2FA 3TKSA 1SK1A 3M1GA 2GLRA 3LJRA 4HS1A 2V6KA 5HQPA 4MJAA 2LQOA 4QL9A 4NV2A 4TR0A 2H0GA 1FG4A 2FA4A 5IIZA 1A23A 4FYBA 1O81A 1HYUA 2L59A 1GRXA 2YJHA 2WB9A 1ERTA 3WGDA 1SJZA 1YZXA 1ABAA 1K3LA 3UARA 2GZYA 2C80A 17GSA 1AC1A 1WE0A 2H72A 2TRXA 1GP1A 2O7KA 1YEPA 5J41A 1K0BA 4V2NA 3EE2A 2OE3A 2X8HA 4TVEA 1MEKA 3HHVA 2YNXA 2I1UA 5DBQA 2JSZA 5DCGA 3CTGA 1CQHA 3KD0A 3PGTA 4IP6A 1GTIA 3ZZXA 2GTUA 1PL1A 5KN3A 5LNKe 4XTSA 3QD9A 2HXKA 4IJIA 3N9JA 5CYYA 5E4WA 2H0IA 4OFNA 2KLXA 2GSRA 2IMEA 2B6MA 3L9UA 1BYEA 3KEBA 4MK3A 4FYCA 1SENA 2K9FA 3M9JA 1PQNA 6GSVA 5CRDA 1GLPA 2XPEA 1I5GA 3TJFA 3E3EA 4OCEA 5CRWA 3KMOA 1O8XA 3GFKA 2I4AA 4Z2TA 4HJ2A 4ID0A 1TRWA 3C1RA 3LFLA 2F9SA 2M46A 2LKUA 5ELGA 3NOFA 4K7NA 1ST9A 5G5FA 4JZQA 1MTCA 4EC0A 4GCIA 1PA3A 3KXOA 3CYNA 1BX9A 2X4AA 9GSSA 3TRQA 3GTUA 2NDOA 1A2JA 3HVSA 4MCUA 4LL1B 3ZREA 2VUPA 3CSHA 2QA1A 1HNCA 4MMMA 4K0GA 2IMIA 2HFDA 2R4VA 2H1BA 3F3QA 1SD8A 2R2JA 2OE1A 3F63A 1UC7A 1NHOA 2IMFA 3PPUA 1A8LA 3G7JA 3LYPA 3US3A 3ZYWA 1QFNA 4YKGA 3GNJA 2FGXA 5FHIA 1ZZYA 3KP9A 3ZVJA 5ECSA 1UVZA 3VWWA 3P90A 2P0GA 4L5LA 1TI3A 1ZYPA 3LXTA 5E59A 1T7PB 2DIZA 2YANA 2KUCA 3D4TA 1O8WA 5IMFA 3FRCA 4JU5A 2XBQA 3GTUB 3GV1A 3ED3A 2VCWA 5GZZB 4HDEA 5IMZA 4EXJA 2CAIA 4Q5FA 2H19A 4AF2A 18GSA 2CAQA 4O7HA 2GT6A 4TR1A 4K0NA 4TN8A 3IE3A 1EZKA 2V41A 4CY8A 1W4VA 5G5EA 1SD9A 2B5YA 3HJMA 4AJ8A 2R5GA 3KZQA 2FWFA 2VOCA 2DSAA 1K0CA 3KP8A 3A3TA 4OWYA 4HUAA 4F9ZA 3KH9A 3TJKA 3CTFA 1K0OA 1GUKA 1KTEA 1PKWA 2HI7A 2CT6A 2VLTA 4NHZA 1M2BA 2VLVA 4EL1A 2O8VB 3UBLA 1TU8A 5DQYA 1C72A 3CBUA 4DSQA 4X43A 2VM2A 2BTOT 2PUKC 1EV4A 3F0IA 3HJPA 1Z7PA 5IPGA 2OKAA 1V2AA 3QFBC 2B7JA 1J9BA 1CQGA 1MD4A 3HXSA 4DSSA 2R6KA 4TR1B 6GSUA 1GSQA 1R5AA 1GNWA 3VI5A 4E8EA 3EVIA 4K6XA 3H4KA 1ZL9A 4HJMA 5IMCA 4K2DA 2G0FA 3GH6A 5G30A 2P5QA 4MZWA 1HQOA 5IQYA 4N30A 3L4NA 4MPGA 3VFIA 2N5BA 3VPQA 1THXA 3ERFA 2QC7A 1RQMA 3Q6OA 4O5RA 1SU9A 2VL3A 1U3IA 3GKNA 4IBPA 2L5OA 4USSA 2G2QA 5IOXA 1G6YA 1JFUA 3L0HA 3F4TA 2VM1A 5A4WA 4WR5A 1WWJA 4FIWA 2MMAA 3AY8A 1ERUA 2MYGA 3ZFLA 6GSSA 4XHMA 2A2RA 4HQSA 1ZYQB 1U87A 1YY7A 2IMDA 4DSSB 3EU4A 3TKSE 4ICYA 1EEMA 4IP1A 4BWSA 3GKXA 4PNFA 3Q74A 1FW1A 4RQXA 5ID2A 1TK0B 3NZNA 1NHYA 2OJLA 2MZCA 6GSXA 2K8VA 4I97A 2LS5A 4MDCA 4NAXA 2XC2A 4XS4A 1WRYA 2YOIA 3KMNA 3TOUA 4TXVA 2PU9C 2LTKA 4XS1A 1GSEA 1ZGNA 4GSNA 2HSMA 2VCTA 4YQMA 1G7EA 2C0GA 3U6VA 1FB0A 1A2MA 1RK4A 1WMJA 1UA5A 3WYWA 1O7UA 4MZBA 1SK0A 3GSSA 5GAPD 1B9YC 2X49A 1X5DA 2WFCA 2RIIA 5IPHA 3D22A 3ZITA 1SK2A 5C04A 2PPTA 2GT5A 1T8EB 3GSTA 1VRSD 5ID2B 2L57A 2VCQA 7GSSA 4KNDA 4J56E 3RPPA 5CO3A 1XWGA 1TXXA 3LWAA 4XS4B 2H66A 4GWRA 1BG5A 3IBHA 4KSOA 1T4YA 2OBIA 5EL8A 1GSSA 3GYKA 1EP7A 2E0QA 5IOWA 2H73A 2LJKA 3EWLA 2F8AA 4POBA 1M7TA 1MDIA 2LEGA 1U6TA 3QPMA 4PQHA 4AGSA 2C0EA 2AB6A 2H74A 2LSTA 3LYKA 4ZILA 1FB6A 4KDXA 4G0IA 3EPTA 1LU4A 2C4JA 2LRCA 2R3XA 4MA9A 2VD1A 1K0DA 1B8XA 5CRHA 1X0RA 1BAYA 2FNOA 5D9XA 4LA1A 3F8UA 1YKAA 2YWNA 1PN9A 1XW6A 3EMPA 3G9BA 3LW9A 2RM5A 1T3BA 5LCZA 1QMVA 4PQIA 1URMA 4KDYA 4ILFA 2FD3A 3E0UA 1F9MA 4KGIA 4FH8A 3RHCA 2E2GA 2CVBA 4Z2RA 1QXHA 1PRXA 1R5PA 4ZB8A 4XRDA 2HRKA 4P3YB 2RUEA 3HVVA 3O76A 3IXRA 4RUVA 4ECCA 2DJ1A 3VWVA 3IHGA 8GSSA 2DMMA 3HVXA 2HZEA 1XXUA 2IIYA 4HQZA 4EVMA 2YCDA 1LJRA 2H1GA 2FCHA 1JZDA 2Z9SA 4WBRD 1T4ZA 1S3DA 4N0ZA 4V1Ap 3QR6A 2IL3A 2E2MA 4JEDA 3DMLA 2D2ZA 1RW1A 3A5IA 2YWMA 2P5RA 3HKRA 3H79A 4MJCA 2AV4A 1PGTA 3DGQA 3QCPA 5DJLA 1GLQA 2NBSA 2FWGA 3TJGA 1GUHA 5JCWA 1N8JA 1WP0A 3N5OA 4PGTA 5F05A 2F3MA 1M2AA 4EDYA 1OE7A 3TKPA 1TRVA 1PX6A 1X9WB 4HU7A 4BVXA 1ON4A 2HZEB 2I81A 2M80A 3UIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZVJ D;  3DVW A;  1OC3 A;  1G7O A;  1O73 A;  3KGK A;  4MJE A;  4ZL8 A;  1TDI A;  4RQR A;  3E9J B;  1Z9H A;  5H5R A;  1B4Q A;  3ERG A;  3HZ4 A;  2PMT A;  1GNE A;  2JU5 A;  5H5Q A;  4EDZ A;  4HOJ A;  4WEY A;  5A5K A;  5ENU A;  3IHQ A;  3RBT A;  2TIR A;  1Z6M A;  1K0A A;  4DVC A;  4MLY A;  1QQ2 A;  2B5X A;  1AQW A;  5HFI A;  4ZIJ A;  4ML6 A;  4CHS A;  2FY6 A;  3O3T A;  6GSY A;  3D0Z A;  3FZ4 A;  4KE3 A;  1V57 A;  3ISO A;  1IYI A;  1OVN A;  3CRT A;  5ELA A;  12GS A;  3ZL5 A;  1VF1 A;  4AJ7 A;  1WIK A;  5ECL B;  1JLV A;  2O89 A;  3HY2 A;  2KP1 A;  4LMV A;  4N10 A;  3UL3 A;  3UVH A;  4IQ1 A;  1AIU A;  3RAZ A;  1VF3 A;  4JE1 A;  2H0H A;  4L8E A;  1GSD A;  3L9V A;  4MF5 A;  3C71 A;  3F4S A;  3K8N A;  3QAG A;  4ZBA A;  2V32 A;  2DBC A;  4YQV A;  1PSQ A;  2GDR A;  5D9W A;  1XWK A;  5INY A;  5F07 A;  11GS A;  4KDU A;  1SJI A;  4HU9 A;  3DEX A;  4Q5R A;  3KH7 A;  3LQ7 A;  1I9D A;  4IEL A;  1T1V A;  3C8E A;  1QK8 A;  2GZZ A;  2QGV A;  1Q4J A;  3UVT A;  2KHP A;  2H75 A;  2CVK A;  1FOV A;  3FZA A;  3MWH A;  3BCK A;  5GST A;  1Y25 A;  3KJY A;  3TUE A;  4N11 A;  4RI7 A;  5G1L A;  5D9V A;  3A2V A;  1OC8 A;  3RHB A;  1ERV A;  4YAP A;  14GS A;  2AHE A;  3QAW A;  3C73 A;  4RI6 A;  4ZB9 A;  1YF0 A;  3ME7 A;  1AXD A;  4OFT A;  5F8B A;  3EUR A;  1NSW A;  4MZC A;  2WS2 A;  4ZL9 A;  3TKQ A;  4PUR A;  2LNT A;  5ECQ B;  3TB2 A;  5CNW A;  1B4P A;  3EU3 A;  1E2Y A;  3MAK A;  2LJA A;  3ZTL A;  4WR4 A;  2DLX A;  2CV4 A;  1R26 A;  5D93 A;  4NMU A;  2C3Q A;  2DC5 A;  1K3O A;  2IN3 A;  4G2E A;  2VL2 C;  2ZUP A;  5G1K A;  2JL4 A;  3VLN A;  2GQK A;  4OFM A;  2R37 A;  1SL1 B;  1FVJ A;  5B7C A;  4POM A;  5A4V A;  2ZNM A;  2EIO A;  4KCA A;  3SBC A;  4G10 A;  2LNS A;  3APQ A;  4IQA A;  4MH3 A;  2WCI A;  19GS A;  1GTU A;  3Q19 A;  2F8F A;  2C3N A;  3WT2 A;  4D73 A;  4JRR A;  2ALB A;  3FYG A;  4WBJ A;  5IMV A;  3VUR A;  3LSZ A;  3EYT A;  1DUG A;  3TGZ A;  3J7Y b;  2P31 A;  3TRX A;  2WJU A;  1S3A A;  4TXO A;  1EP8 A;  2WUL A;  5HR0 A;  2B1K A;  3DVX A;  1GSF A;  2B3S A;  4E8H A;  3HJO A;  1Z6N A;  3IAS 2;  3TDG A;  2YV7 A;  3WD6 A;  1XIY A;  3C1S A;  4PNG A;  4KSM A;  4F0C A;  4KW6 A;  4OD7 A;  2VIM A;  5CP1 A;  1SL0 B;  3GL5 A;  1S3C A;  4IHU A;  1XW9 A;  3GX8 A;  4ACS A;  2HT9 A;  4MF7 A;  4D73 B;  5DAK A;  4POK A;  1JLW A;  5HFK A;  1XPV A;  5JWR B;  2O87 A;  4TXO B;  1EGR A;  5EPF A;  1AW9 A;  1Y6E A;  2BMX A;  4V2M A;  1KNG A;  3BD2 A;  1GSU A;  2L4C A;  4AJ6 A;  1XWB A;  5JCU A;  3IAM 2;  3LXZ A;  2LRT A;  5IMD A;  2CQ9 A;  4FYU A;  3KM6 A;  4CW9 A;  1JHB A;  4EF0 A;  3HA9 A;  2GQM A;  1MDK A;  2B5E A;  4NPB A;  2O85 A;  1K3Y A;  4TR4 A;  3KCM A;  1XWA A;  3HDC A;  4ECB A;  4KUN A;  1OYJ A;  1FVK A;  4I8B A;  5DAK B;  3CMI A;  1A24 A;  3DRN A;  3I69 A;  2DJJ A;  5D96 A;  5ABR A;  1SYR A;  2H71 A;  3UMA A;  2YJ7 A;  3OR5 A;  4IW9 A;  1NM3 A;  3TCO A;  1X9M B;  5ECI B;  4BL7 A;  4HZ2 A;  3DD3 A;  3GN3 A;  1YF1 A;  2MMO A;  1USB A;  4GQC A;  3HCZ A;  4KCE A;  2HZF A;  5ECP B;  2JZR A;  1G6W A;  1BED A;  2VCX A;  2YP6 A;  5HR3 A;  5HR2 A;  3ZLP A;  1MD3 A;  1F3B A;  1H4O A;  2L4Q A;  4ULX A;  4PUF C;  4NWY A;  1UN2 A;  2VAF A;  1XZO A;  1OKT A;  2LUS A;  4BWQ A;  1ERW A;  4XIH A;  1F6M C;  4WF4 A;  4PX1 A;  2OE0 A;  4TR3 A;  2HSY A;  5GSS A;  5GAN D;  4TOP A;  3QFA C;  4BPY A;  3PR8 A;  3TJJ A;  5D9T A;  3SWL A;  2HE3 A;  1JZO A;  3KTL A;  3TRP A;  4V2L A;  1DE2 A;  5B8B A;  4POL A;  1FHE A;  5AIV A;  1TOF A;  3A2W A;  3UBK A;  2X64 A;  4QQ7 A;  5H5S A;  2MBT A;  2QSI A;  1WJK A;  4DSR A;  1DSB A;  3LGC A;  3DKS A;  4LLR A;  4OO5 A;  2M72 A;  5IM9 A;  4LL4 B;  2YZU A;  3FR9 A;  3O6T A;  3CSI A;  2V6O A;  2DJ2 A;  3P2A A;  3F9U A;  4KH7 A;  3ERW A;  1K0M A;  4K7I A;  5LD0 A;  3C7M A;  3DWV A;  4IGJ A;  3ZMK A;  1MDJ A;  5ECH B;  3F3R A;  3FK8 A;  4F0B A;  3M9K A;  3I6A A;  4CDO A;  4I5Q A;  2X8G A;  4TRX A;  5J9B A;  3KTB A;  2N5A A;  3FY7 A;  2N5F A;  4IVF A;  3BJ5 A;  3BCI A;  5IO2 A;  3M3M A;  3FZ5 A;  1F3A A;  2AAW A;  2IWT A;  4YQU A;  5AIS A;  3GKK A;  3D4M A;  1SKW B;  2GVP A;  2WRT A;  2IMK A;  1W89 A;  5KN2 A;  3A2X A;  5C00 A;  4G9H A;  4GF0 A;  3GL3 A;  4FO5 A;  1FO5 A;  4XS6 A;  3QDN A;  1M99 A;  3TKS C;  1TTZ A;  3FEU A;  5F0G A;  22GS A;  2I3Y A;  1GUM A;  1PD2 1;  1M9B A;  4WKW A;  1AQV A;  3VK9 A;  2RLI A;  3P7X A;  2OAC A;  1YDK A;  3MSZ A;  4Q5N A;  1YJ6 A;  1HNB A;  2CVD A;  2FWH A;  4BVY A;  2C8U A;  1V40 A;  4NV5 A;  3V1W A;  2K8S A;  2LJR A;  4O92 A;  2VO4 A;  3GKM A;  1U88 A;  2B1L A;  1XOA A;  2FLS A;  2PVO C;  2VL9 A;  3IRA A;  4PXO A;  2FA8 A;  2PN8 A;  3H8Q A;  4EUY A;  1X9S B;  1GWC A;  2EIQ A;  4I2U A;  1B9X C;  4XCS A;  2K6V A;  1XCC A;  4HEA 2;  4GLT A;  4ZB6 A;  1X5C A;  3CXG A;  2VLU A;  5AIX A;  2XHF A;  2IFQ A;  3FZ9 A;  2CX4 A;  4JBB A;  3TJB A;  1OKD A;  2X8C A;  1ILO A;  2REM A;  1THO A;  5ECR B;  2AUV A;  3VI7 A;  1GH2 A;  4EKZ A;  2GSS A;  3FKF A;  1VGL A;  2BJX A;  3KIJ A;  1SKR B;  5CRG A;  2I9H A;  3WT1 A;  2YWI A;  5ECM B;  1SJ6 A;  4KB3 A;  4X0X A;  4ZBB A;  5L71 A;  3G7Y A;  3UOM A;  4KX4 A;  2H70 A;  2NVL A;  2B7K A;  2MMN A;  2V2G A;  5G31 A;  1EOH A;  3P8W A;  5F06 A;  1V58 A;  4MAB A;  2PWJ A;  4ECI A;  4F2I A;  1AAZ A;  3M8N A;  5ECN B;  4F82 A;  3F6F A;  5KN0 A;  3G7I A;  2PBJ A;  4JR4 A;  2YPM A;  2IFQ B;  4O32 A;  5DAL A;  3FHK A;  5IMA A;  1XOB A;  3H93 A;  1A2L A;  4MH2 A;  2H6X A;  2EIR A;  3HYP A;  3FR6 A;  1TI1 A;  2LQQ A;  1FAA A;  4K1F A;  3DIE A;  5J5N A;  3D21 A;  3L9S A;  1HD2 A;  1OC9 A;  1X5E A;  2C1Y A;  3W6G A;  4EE0 A;  1KBN A;  3RDW A;  2AYT A;  4X1U A;  2J9H A;  1ACV A;  3EC3 A;  1JZW A;  1XW5 A;  2OAD A;  1ZMA A;  2DJ0 A;  1TJD A;  1GTA A;  3GHA A;  5EY6 A;  4GQF A;  2JZS A;  2RUF A;  2VL2 A;  2J23 A;  3IK7 A;  3GUS A;  2LRN A;  3PH9 A;  2WZ9 A;  3QAV A;  2VD0 A;  4H86 A;  4ECJ A;  6GSW A;  1EOG A;  3W8S A;  3VWX A;  3JCM L;  2HSH A;  2GSQ A;  2JZT A;  2L6D A;  4LMW A;  4OO4 A;  4WXT A;  5DAL B;  1SKS B;  1ML6 A;  3D6I A;  2E7P A;  3ZFB A;  4JR6 A;  1E6B A;  1DE1 A;  1EGO A;  2WDU A;  3ZRD A;  1A8Y A;  4HZ4 A;  2JAC A;  4ZBD A;  1SYX A;  2H01 A;  5G2Z A;  1PX7 A;  2IJY A;  1OC9 B;  3VWU A;  1R4W A;  3HZ8 A;  4K8M A;  4L0W A;  1O85 A;  3EIN A;  3M0F A;  3IV4 A;  5DQS A;  1TKD B;  2FWE A;  2MBS A;  1ZOF A;  3GA4 A;  2K18 A;  2DIY A;  1OAZ A;  2V1M A;  1EV9 A;  1AQX A;  4I2T A;  1O6J A;  1VF2 A;  4V1A g;  3I43 A;  4QL7 A;  1J0F A;  4MF6 A;  1N2A A;  1SL2 B;  1NW2 A;  2C3T A;  3APS A;  1TRS A;  2GQL A;  3GMF A;  2FUG 2;  4IKH A;  2HRF A;  2WGR A;  3F6D A;  2ZCT A;  3ME8 A;  3ZIV A;  5DVB A;  13GS A;  5HFG A;  2H76 A;  2H6Y A;  3UJ1 A;  4YH2 A;  4L0U A;  2JAD A;  1G0T A;  1XVQ A;  2H1A A;  3TOT A;  1BQ7 A;  1PMT A;  3BOA A;  1Z5Y E;  5DDL A;  2OBK A;  3IK9 A;  5D8I A;  1F2E A;  2H1D A;  1LBK A;  4MJB A;  4XRA A;  5JWO B;  4ZXG A;  5FT3 A;  1GSY A;  1ZCP A;  3IC4 A;  2H30 A;  2RM6 A;  5HR1 A;  1JZR A;  1VF4 A;  5IO0 A;  1GL8 A;  4GRF A;  4WF5 A;  2HRN A;  4YAV A;  2YWO A;  3GIX A;  1XBS A;  5EVO A;  1GTB A;  2PGT A;  2L6C A;  2CA8 A;  4I6X A;  4N0V A;  1K0N A;  1XFL A;  3EMX A;  5ECK B;  3CSJ A;  10GS A;  1EWX A;  4IS0 A;  3ZML A;  5JCG A;  1IYH A;  4OCF A;  4ZL7 A;  3RPN A;  2DJ3 A;  4DEJ A;  3DXB A;  2F51 A;  1WOU A;  1BJX A;  4G19 A;  2CZ3 A;  3IR4 A;  3H1N A;  4NXI A;  3J7Y k;  5J9C A;  1H75 A;  2KP2 A;  2A2S A;  1V9W A;  2C0D A;  1HNA A;  2ES7 A;  1TW9 A;  5KN1 A;  1T00 A;  3S9F A;  4GST A;  3IDV A;  2H6Z A;  2DJK A;  4KAE A;  4ML1 A;  2ON5 A;  2ON7 A;  1U3A A;  2HYX A;  4TKY A;  3GRX A;  3LEF A;  2H8L A;  3LG6 A;  5ECO B;  3R2Q A;  5B8A A;  2TRC P;  3D5J A;  2YN1 A;  2EC4 A;  1WPI A;  1QUW A;  3MNG A;  1TU7 A;  2GST A;  3F4R A;  2PER A;  2CX3 A;  5CAX A;  2CZ2 A;  3W8J A;  2YV9 A;  2KOK A;  1EEJ A;  1Z3E A;  3UAP A;  2L5L A;  5KEJ A;  2DML A;  3I9V 2;  2A4V A;  3GUR A;  3CRU A;  2NPB A;  4PQ1 A;  3QMX A;  1YKC A;  2HLS A;  2X99 A;  5FWG A;  2NTO A;  2OA7 A;  1J08 A;  1Z7R A;  4J57 E;  1A0F A;  4K7O A;  1TK8 B;  4TW5 A;  3ZIJ A;  4Q5Q A;  5B6N A;  5DJM A;  2XBI A;  16GS A;  4GTU A;  4Z7X A;  1V98 A;  1YEX A;  4MP4 A;  2LV3 A;  5B6M A;  2JSY A;  4WET A;  1TP9 A;  5COH A;  1QGV A;  5J4U A;  2FHE A;  1TRU A;  1XWC A;  1M2D A;  4K9Z A;  4BA7 A;  1KEB A;  3GX0 A;  3NIV A;  5CRE A;  3UEM A;  3TKR A;  1YQ1 A;  3PIN A;  3A5W A;  3APO A;  3WGE A;  2VCZ A;  3L78 A;  5D73 A;  3QOU A;  3IA1 A;  4PUA A;  4ISD A;  3FR3 A;  4KA0 A;  3WGX A;  4HI7 A;  1M0U A;  2IPA A;  2HNL A;  3VPT A;  2XPD A;  4IJ3 A;  1Q98 A;  5A4U A;  4MPF A;  1XVW A;  5DCH A;  2GGT A;  1B48 A;  1R7H A;  4NHW A;  3LOR A;  4IN0 A;  4F03 A;  3MDK A;  4GSS A;  2VCV A;  2PVQ A;  1GUL A;  1AUC A;  4OMV A;  5AGY A;  2C0F A;  3IOS A;  2GS3 A;  1M9A A;  2GZP A;  5JWQ B;  1ZYE A;  5J3R A;  2MMZ A;  4GXZ A;  20GS A;  1PL2 A;  2AJQ B;  5AN1 A;  6GST A;  4L5O A;  1OE8 A;  1TK5 B;  3U5R E;  2QKE A;  1DBY A;  3DYR A;  3BBY A;  3FW2 A;  3HD5 A;  3Q18 A;  3GH9 A;  4EO3 A;  2YZH A;  1PKZ A;  1F37 A;  3IPZ A;  1A0R P;  4J2F A;  3TKS A;  1SK1 A;  3M1G A;  2GLR A;  3LJR A;  4HS1 A;  2V6K A;  5HQP A;  4MJA A;  2LQO A;  4QL9 A;  4NV2 A;  4TR0 A;  2H0G A;  1FG4 A;  2FA4 A;  5IIZ A;  1A23 A;  4FYB A;  1O81 A;  1HYU A;  2L59 A;  1GRX A;  2YJH A;  2WB9 A;  1ERT A;  3WGD A;  1SJZ A;  1YZX A;  1ABA A;  1K3L A;  3UAR A;  2GZY A;  2C80 A;  17GS A;  1AC1 A;  1WE0 A;  2H72 A;  2TRX A;  1GP1 A;  2O7K A;  1YEP A;  5J41 A;  1K0B A;  4V2N A;  3EE2 A;  2OE3 A;  2X8H A;  4TVE A;  1MEK A;  3HHV A;  2YNX A;  2I1U A;  5DBQ A;  2JSZ A;  5DCG A;  3CTG A;  1CQH A;  3KD0 A;  3PGT A;  4IP6 A;  1GTI A;  3ZZX A;  2GTU A;  1PL1 A;  5KN3 A;  5LNK e;  4XTS A;  3QD9 A;  2HXK A;  4IJI A;  3N9J A;  5CYY A;  5E4W A;  2H0I A;  4OFN A;  2KLX A;  2GSR A;  2IME A;  2B6M A;  3L9U A;  1BYE A;  3KEB A;  4MK3 A;  4FYC A;  1SEN A;  2K9F A;  3M9J A;  1PQN A;  6GSV A;  5CRD A;  1GLP A;  2XPE A;  1I5G A;  3TJF A;  3E3E A;  4OCE A;  5CRW A;  3KMO A;  1O8X A;  3GFK A;  2I4A A;  4HJ2 A;  4ID0 A;  1TRW A;  3C1R A;  3LFL A;  2F9S A;  2M46 A;  2LKU A;  5ELG A;  3NOF A;  4K7N A;  1ST9 A;  5G5F A;  4JZQ A;  1MTC A;  4EC0 A;  4GCI A;  1PA3 A;  3KXO A;  3CYN A;  1BX9 A;  9GSS A;  3TRQ A;  3GTU A;  2NDO A;  1A2J A;  3HVS A;  4MCU A;  4LL1 B;  3ZRE A;  2VUP A;  3CSH A;  1HNC A;  4MMM A;  4K0G A;  2IMI A;  2HFD A;  2R4V A;  2H1B A;  3F3Q A;  1SD8 A;  2R2J A;  2OE1 A;  3F63 A;  1UC7 A;  1NHO A;  2IMF A;  1A8L A;  3G7J A;  3LYP A;  3US3 A;  3ZYW A;  1QFN A;  3GNJ A;  2FGX A;  5FHI A;  1ZZY A;  3KP9 A;  3ZVJ A;  5ECS A;  1UVZ A;  3VWW A;  3P90 A;  2P0G A;  4L5L A;  1TI3 A;  3LXT A;  5E59 A;  1T7P B;  2DIZ A;  2YAN A;  2KUC A;  3D4T A;  1O8W A;  5IMF A;  3FRC A;  4JU5 A;  2XBQ A;  3GTU B;  3GV1 A;  3ED3 A;  2VCW A;  5GZZ B;  4HDE A;  5IMZ A;  4EXJ A;  2CAI A;  4Q5F A;  2H19 A;  4AF2 A;  18GS A;  2CAQ A;  4O7H A;  2GT6 A;  4TR1 A;  4K0N A;  4TN8 A;  3IE3 A;  1EZK A;  2V41 A;  1W4V A;  5G5E A;  1SD9 A;  2B5Y A;  3HJM A;  4AJ8 A;  2R5G A;  3KZQ A;  2FWF A;  2VOC A;  2DSA A;  1K0C A;  3KP8 A;  3A3T A;  4OWY A;  4HUA A;  4F9Z A;  3KH9 A;  3TJK A;  3CTF A;  1K0O A;  1GUK A;  1KTE A;  1PKW A;  2HI7 A;  2CT6 A;  2VLT A;  4NHZ A;  1M2B A;  2VLV A;  4EL1 A;  2O8V B;  3UBL A;  1TU8 A;  5DQY A;  1C72 A;  3CBU A;  4DSQ A;  4X43 A;  2VM2 A;  2BTO T;  2PUK C;  1EV4 A;  3F0I A;  3HJP A;  1Z7P A;  5IPG A;  2OKA A;  1V2A A;  3QFB C;  2B7J A;  1J9B A;  1CQG A;  1MD4 A;  3HXS A;  4DSS A;  2R6K A;  4TR1 B;  6GSU A;  1GSQ A;  1R5A A;  1GNW A;  3VI5 A;  4E8E A;  3EVI A;  4K6X A;  3H4K A;  1ZL9 A;  4HJM A;  5IMC A;  4K2D A;  2G0F A;  3GH6 A;  5G30 A;  2P5Q A;  4MZW A;  1HQO A;  5IQY A;  4N30 A;  3L4N A;  4MPG A;  3VFI A;  2N5B A;  3VPQ A;  1THX A;  3ERF A;  2QC7 A;  1RQM A;  3Q6O A;  4O5R A;  1SU9 A;  2VL3 A;  1U3I A;  3GKN A;  4IBP A;  2L5O A;  2G2Q A;  5IOX A;  1G6Y A;  1JFU A;  3L0H A;  3F4T A;  2VM1 A;  5A4W A;  4WR5 A;  1WWJ A;  4FIW A;  2MMA A;  3AY8 A;  1ERU A;  2MYG A;  3ZFL A;  6GSS A;  4XHM A;  2A2R A;  4HQS A;  1ZYQ B;  1U87 A;  1YY7 A;  2IMD A;  4DSS B;  3EU4 A;  3TKS E;  1EEM A;  4IP1 A;  4BWS A;  3GKX A;  4PNF A;  3Q74 A;  1FW1 A;  4RQX A;  5ID2 A;  1TK0 B;  3NZN A;  1NHY A;  2OJL A;  2MZC A;  6GSX A;  2K8V A;  4I97 A;  2LS5 A;  4MDC A;  4NAX A;  2XC2 A;  4XS4 A;  1WRY A;  2YOI A;  3KMN A;  3TOU A;  4TXV A;  2PU9 C;  2LTK A;  4XS1 A;  1GSE A;  1ZGN A;  4GSN A;  2VCT A;  4YQM A;  1G7E A;  2C0G A;  3U6V A;  1FB0 A;  1A2M A;  1RK4 A;  1WMJ A;  1UA5 A;  3WYW A;  1O7U A;  4MZB A;  1SK0 A;  3GSS A;  5GAP D;  1B9Y C;  1X5D A;  2WFC A;  2RII A;  5IPH A;  3D22 A;  3ZIT A;  1SK2 A;  5C04 A;  2PPT A;  2GT5 A;  1T8E B;  3GST A;  1VRS D;  5ID2 B;  2L57 A;  2VCQ A;  7GSS A;  4KND A;  4J56 E;  3RPP A;  5CO3 A;  1XWG A;  1TXX A;  3LWA A;  4XS4 B;  2H66 A;  4GWR A;  1BG5 A;  3IBH A;  4KSO A;  1T4Y A;  2OBI A;  5EL8 A;  1GSS A;  3GYK A;  1EP7 A;  2E0Q A;  5IOW A;  2H73 A;  2LJK A;  3EWL A;  2F8A A;  4POB A;  1M7T A;  1MDI A;  2LEG A;  1U6T A;  3QPM A;  4PQH A;  4AGS A;  2C0E A;  2AB6 A;  2H74 A;  2LST A;  3LYK A;  4ZIL A;  1FB6 A;  4KDX A;  1LU4 A;  2C4J A;  2LRC A;  2R3X A;  4MA9 A;  2VD1 A;  1K0D A;  1B8X A;  5CRH A;  1X0R A;  1BAY A;  2FNO A;  5D9X A;  4LA1 A;  3F8U A;  1YKA A;  2YWN A;  1PN9 A;  1XW6 A;  3EMP A;  3G9B A;  2RM5 A;  1T3B A;  5LCZ A;  1QMV A;  4PQI A;  1URM A;  4KDY A;  4ILF A;  2FD3 A;  3E0U A;  1F9M A;  4KGI A;  4FH8 A;  3RHC A;  2E2G A;  2CVB A;  1QXH A;  1PRX A;  1R5P A;  4ZB8 A;  4XRD A;  4P3Y B;  2RUE A;  3HVV A;  3O76 A;  3IXR A;  4RUV A;  4ECC A;  2DJ1 A;  3VWV A;  8GSS A;  2DMM A;  3HVX A;  2HZE A;  1XXU A;  2IIY A;  4HQZ A;  4EVM A;  2YCD A;  1LJR A;  2H1G A;  2FCH A;  1JZD A;  2Z9S A;  4WBR D;  1T4Z A;  1S3D A;  4N0Z A;  4V1A p;  3QR6 A;  2IL3 A;  2E2M A;  4JED A;  3DML A;  2D2Z A;  1RW1 A;  2YWM A;  2P5R A;  3HKR A;  3H79 A;  4MJC A;  2AV4 A;  1PGT A;  3DGQ A;  3QCP A;  5DJL A;  1GLQ A;  2NBS A;  2FWG A;  3TJG A;  1GUH A;  5JCW A;  1N8J A;  1WP0 A;  3N5O A;  4PGT A;  5F05 A;  2F3M A;  1M2A A;  4EDY A;  1OE7 A;  3TKP A;  1TRV A;  1PX6 A;  1X9W B;  4HU7 A;  4BVX A;  1ON4 A;  2HZE B;  2I81 A;  2M80 A;  3UIW A; 
#chains in the Genus database with same CATH topology
 3ZVJ D;  3DVW A;  1OC3 A;  1G7O A;  1O73 A;  3KGK A;  4MJE A;  2UZ8 A;  4ZL8 A;  1TDI A;  4RQR A;  3E9J B;  1Z9H A;  5H5R A;  1B4Q A;  3IC8 A;  3ERG A;  3HZ4 A;  2PMT A;  1GNE A;  2JU5 A;  5H5Q A;  4EDZ A;  4HOJ A;  4WEY A;  5A5K A;  5ENU A;  3IHQ A;  3RBT A;  2TIR A;  1Z6M A;  1K0A A;  2DKI A;  4DVC A;  4MLY A;  1QQ2 A;  2B5X A;  1AQW A;  5HFI A;  4ZIJ A;  4ML6 A;  4CHS A;  2FY6 A;  3O3T A;  6GSY A;  3D0Z A;  3FZ4 A;  4KE3 A;  1V57 A;  3ISO A;  1IYI A;  4BVX B;  1OVN A;  3CRT A;  5ELA A;  12GS A;  3ZL5 A;  1VF1 A;  4AJ7 A;  1WIK A;  5ECL B;  1JLV A;  2O89 A;  3HY2 A;  2KP1 A;  4LMV A;  4N10 A;  3UL3 A;  3UVH A;  4IQ1 A;  1AIU A;  3RAZ A;  1VF3 A;  4JE1 A;  2H0H A;  4L8E A;  1GSD A;  3L9V A;  4MF5 A;  3C71 A;  3F4S A;  3K8N A;  3QAG A;  4ZBA A;  2V32 A;  2DBC A;  4YQV A;  1PSQ A;  2GDR A;  5D9W A;  1XWK A;  5INY A;  5F07 A;  11GS A;  4KDU A;  1SJI A;  4HU9 A;  3DEX A;  4Q5R A;  3KH7 A;  3LQ7 A;  1I9D A;  4IEL A;  1T1V A;  3C8E A;  1QK8 A;  2GZZ A;  2QGV A;  1Q4J A;  3UVT A;  2KHP A;  2H75 A;  2CVK A;  1FOV A;  3FZA A;  3MWH A;  3BCK A;  5GST A;  1Y25 A;  3KJY A;  3TUE A;  4N11 A;  4RI7 A;  5G1L A;  5D9V A;  3A2V A;  1OC8 A;  3RHB A;  1ERV A;  4YAP A;  14GS A;  2AHE A;  3QAW A;  3C73 A;  4RI6 A;  4ZB9 A;  1YF0 A;  3ME7 A;  4HSC X;  1AXD A;  4OFT A;  5F8B A;  3EUR A;  1NSW A;  4MZC A;  2WS2 A;  4ZL9 A;  3TKQ A;  4PUR A;  2LNT A;  5ECQ B;  3TB2 A;  5CNW A;  1B4P A;  3EU3 A;  1E2Y A;  3MAK A;  2LJA A;  3ZTL A;  4WR4 A;  2DLX A;  2CV4 A;  1R26 A;  5D93 A;  4NMU A;  2C3Q A;  2DC5 A;  1K3O A;  4EIQ A;  2IN3 A;  4G2E A;  2VL2 C;  4O5U A;  2ZUP A;  5G1K A;  2JL4 A;  3VLN A;  2GQK A;  4OFM A;  2R37 A;  1SL1 B;  1FVJ A;  5B7C A;  4POM A;  5A4V A;  2ZNM A;  2EIO A;  4KCA A;  3SBC A;  4G10 A;  2LNS A;  3APQ A;  4IQA A;  4MH3 A;  2WCI A;  19GS A;  1GTU A;  3Q19 A;  2F8F A;  2C3N A;  3WT2 A;  4D73 A;  4JRR A;  2ALB A;  3FYG A;  4WBJ A;  5IMV A;  3VUR A;  3LSZ A;  3EYT A;  1DUG A;  3TGZ A;  3J7Y b;  2P31 A;  3TRX A;  2WJU A;  1S3A A;  4TXO A;  1EP8 A;  2WUL A;  5HR0 A;  2B1K A;  3DVX A;  1GSF A;  2B3S A;  4E8H A;  3HJO A;  1Z6N A;  3IAS 2;  3TDG A;  2YV7 A;  3WD6 A;  1XIY A;  3C1S A;  4PNG A;  4KSM A;  1ZYN A;  4F0C A;  4KW6 A;  4OD7 A;  2VIM A;  5CP1 A;  1SL0 B;  3GL5 A;  1S3C A;  4IHU A;  1XW9 A;  3GX8 A;  4ACS A;  2HT9 A;  4MF7 A;  5BRT A;  4D73 B;  5DAK A;  4POK A;  5BMU A;  1JLW A;  5HFK A;  1XPV A;  5JWR B;  2O87 A;  4TXO B;  1EGR A;  5EPF A;  1AW9 A;  1Y6E A;  2BMX A;  4V2M A;  1KNG A;  3BD2 A;  1GSU A;  2L4C A;  4AJ6 A;  1XWB A;  5JCU A;  3IAM 2;  3LXZ A;  2LRT A;  5IMD A;  2CQ9 A;  4FYU A;  3KM6 A;  4CW9 A;  1JHB A;  4EF0 A;  3HA9 A;  2GQM A;  1MDK A;  2B5E A;  4NPB A;  2O85 A;  1K3Y A;  4TR4 A;  3KCM A;  1XWA A;  2DKH A;  3HDC A;  4ECB A;  4KUN A;  1OYJ A;  1FVK A;  4I8B A;  5DAK B;  3CMI A;  1A24 A;  3DRN A;  3I69 A;  2DJJ A;  5D96 A;  5ABR A;  1SYR A;  1M3J A;  2H71 A;  3UMA A;  2YJ7 A;  3OR5 A;  4G0K A;  4IW9 A;  1NM3 A;  3TCO A;  1X9M B;  5ECI B;  4BL7 A;  4HZ2 A;  3DD3 A;  3GN3 A;  1YF1 A;  2MMO A;  1USB A;  4GQC A;  3HCZ A;  4KCE A;  2HZF A;  5ECP B;  3MIX A;  2JZR A;  1G6W A;  1BED A;  2VCX A;  2YP6 A;  5HR3 A;  5HR2 A;  3ZLP A;  1MD3 A;  1F3B A;  1H4O A;  2L4Q A;  4ULX A;  4PUF C;  4NWY A;  1UN2 A;  2VAF A;  1XZO A;  1OKT A;  2LUS A;  3R3E A;  4BWQ A;  1ERW A;  4XIH A;  1F6M C;  4WF4 A;  4PX1 A;  2OE0 A;  4TR3 A;  2HSY A;  5GSS A;  5GAN D;  4TOP A;  3QFA C;  4BPY A;  3PR8 A;  4BL7 B;  3TJJ A;  5D9T A;  3SWL A;  2HE3 A;  1JZO A;  3KTL A;  3TRP A;  4V2L A;  1DE2 A;  5B8B A;  4POL A;  1PN0 A;  1FHE A;  5AIV A;  1TOF A;  3A2W A;  3UBK A;  2X64 A;  4QQ7 A;  5H5S A;  2MBT A;  2QSI A;  1WJK A;  4DSR A;  1DSB A;  3LGC A;  3DKS A;  4LLR A;  4OO5 A;  2M72 A;  5IM9 A;  4LL4 B;  2YZU A;  3FR9 A;  3O6T A;  3CSI A;  3CQF A;  1XG8 A;  2V6O A;  2DJ2 A;  3P2A A;  3F9U A;  4KH7 A;  3ERW A;  1K0M A;  4K7I A;  5LD0 A;  3C7M A;  3DWV A;  4IGJ A;  3ZMK A;  1MDJ A;  5ECH B;  3F3R A;  3FK8 A;  4F0B A;  3M9K A;  3I6A A;  4CDO A;  4I5Q A;  2X8G A;  4TRX A;  5J9B A;  3KTB A;  2N5A A;  3FY7 A;  2N5F A;  4IVF A;  3BJ5 A;  4YKF A;  3BCI A;  5IO2 A;  3M3M A;  3FZ5 A;  1F3A A;  2AAW A;  2IWT A;  4YQU A;  5AIS A;  3GKK A;  3D4M A;  1SKW B;  4A5P A;  2GVP A;  2WRT A;  2IMK A;  1W89 A;  5KN2 A;  3A2X A;  5C00 A;  4KF9 A;  4G9H A;  4GF0 A;  3GL3 A;  2R0P A;  4FO5 A;  1FO5 A;  4XS6 A;  3QDN A;  1M99 A;  3TKS C;  1TTZ A;  3FEU A;  5F0G A;  22GS A;  2I3Y A;  1GUM A;  1FOH A;  1PD2 1;  1M9B A;  4WKW A;  1AQV A;  3VK9 A;  2RLI A;  3P7X A;  2OAC A;  1YDK A;  3MSZ A;  4Q5N A;  1YJ6 A;  1HNB A;  2CVD A;  2FWH A;  4BVY A;  2C8U A;  1V40 A;  4NV5 A;  3V1W A;  2K8S A;  2LJR A;  4O92 A;  2VO4 A;  3GKM A;  1U88 A;  2B1L A;  1XOA A;  2FLS A;  2PVO C;  2VL9 A;  3IRA A;  4PXO A;  2FA8 A;  2PN8 A;  3H8Q A;  4EUY A;  1X9S B;  1GWC A;  2EIQ A;  4I2U A;  1B9X C;  4XCS A;  2K6V A;  1XCC A;  4HEA 2;  4GLT A;  4ZB6 A;  1X5C A;  3CXG A;  2VLU A;  5AIX A;  2XHF A;  2IFQ A;  3FZ9 A;  2CX4 A;  4JBB A;  3TJB A;  1OKD A;  2X8C A;  1ILO A;  2REM A;  4G0L A;  1THO A;  5ECR B;  2AUV A;  3VI7 A;  1GH2 A;  4BVY B;  4EKZ A;  2GSS A;  3FKF A;  1VGL A;  2BJX A;  3KIJ A;  1SKR B;  5CRG A;  2I9H A;  3WT1 A;  2YWI A;  5ECM B;  1SJ6 A;  4KB3 A;  4X0X A;  4ZBB A;  5L71 A;  3G7Y A;  4O5Q A;  3UOM A;  4KX4 A;  2H70 A;  2NVL A;  2B7K A;  2MMN A;  2V2G A;  5G31 A;  1EOH A;  3P8W A;  5F06 A;  1V58 A;  4MAB A;  2PWJ A;  4ECI A;  4F2I A;  1AAZ A;  3M8N A;  5ECN B;  4F82 A;  3F6F A;  5KN0 A;  3MYD A;  3G7I A;  2PBJ A;  4JR4 A;  2YPM A;  2IFQ B;  4O32 A;  5DAL A;  3FHK A;  5IMA A;  1XOB A;  3H93 A;  1A2L A;  4MH2 A;  2H6X A;  2EIR A;  3HYP A;  3FR6 A;  1TI1 A;  2LQQ A;  1FAA A;  4K1F A;  3DIE A;  5J5N A;  3D21 A;  3L9S A;  1HD2 A;  1OC9 A;  1X5E A;  2C1Y A;  3W6G A;  4EE0 A;  1KBN A;  3RDW A;  2AYT A;  4X1U A;  2J9H A;  1ACV A;  3EC3 A;  1JZW A;  1XW5 A;  2OAD A;  1ZMA A;  2DJ0 A;  1TJD A;  1GTA A;  3GHA A;  5EY6 A;  4GQF A;  2JZS A;  2RUF A;  2VL2 A;  2J23 A;  3IK7 A;  3GUS A;  2LRN A;  3PH9 A;  2WZ9 A;  3QAV A;  5KOW A;  2VD0 A;  4H86 A;  4ECJ A;  6GSW A;  1EOG A;  3W8S A;  3VWX A;  3JCM L;  2HSH A;  2GSQ A;  2JZT A;  2L6D A;  4LMW A;  4OO4 A;  4WXT A;  5DAL B;  1SKS B;  1ML6 A;  3D6I A;  2E7P A;  3ZFB A;  4JR6 A;  1E6B A;  1DE1 A;  4K5R A;  1EGO A;  2WDU A;  3ZRD A;  1A8Y A;  4HZ4 A;  2JAC A;  4ZBD A;  1SYX A;  2H01 A;  5G2Z A;  1PX7 A;  2IJY A;  1OC9 B;  3VWU A;  1R4W A;  3HZ8 A;  2R0G A;  4K8M A;  4L0W A;  4EIP A;  1O85 A;  3EIN A;  3M0F A;  3IV4 A;  5DQS A;  1TKD B;  2FWE A;  2MBS A;  1ZOF A;  3GA4 A;  2K18 A;  2DIY A;  1OAZ A;  2V1M A;  1EV9 A;  1AQX A;  4I2T A;  1O6J A;  1VF2 A;  4V1A g;  3I43 A;  4QL7 A;  1J0F A;  4MF6 A;  1N2A A;  4BIK A;  1SL2 B;  1NW2 A;  2C3T A;  3APS A;  1TRS A;  2GQL A;  3GMF A;  2FUG 2;  4IKH A;  2HRF A;  2WGR A;  3F6D A;  2ZCT A;  4X4J A;  3ME8 A;  3ZIV A;  5DVB A;  13GS A;  5HFG A;  2H76 A;  2H6Y A;  3UJ1 A;  4YH2 A;  4L0U A;  2JAD A;  1G0T A;  1XVQ A;  2H1A A;  3TOT A;  1BQ7 A;  1PMT A;  3BOA A;  1Z5Y E;  5DDL A;  2OBK A;  3IK9 A;  5D8I A;  1F2E A;  2H1D A;  1LBK A;  4MJB A;  4XRA A;  4MNN A;  5JWO B;  4ZXG A;  5FT3 A;  1GSY A;  1ZCP A;  3IC4 A;  2H30 A;  2RM6 A;  2QA2 A;  5HR1 A;  1JZR A;  1VF4 A;  5IO0 A;  1GL8 A;  4GRF A;  2R0C A;  4WF5 A;  2HRN A;  4YAV A;  2YWO A;  3GIX A;  1XBS A;  5EVO A;  1GTB A;  2PGT A;  2L6C A;  2CA8 A;  4I6X A;  4N0V A;  1K0N A;  1XFL A;  3EMX A;  5ECK B;  3CSJ A;  10GS A;  1EWX A;  4K5S A;  4IS0 A;  3ZML A;  5JCG A;  1IYH A;  4OCF A;  4ZL7 A;  3RPN A;  2DJ3 A;  4DEJ A;  3DXB A;  2F51 A;  1WOU A;  1BJX A;  4G19 A;  2CZ3 A;  3IR4 A;  3H1N A;  4NXI A;  3J7Y k;  4FQU A;  5J9C A;  1H75 A;  2KP2 A;  2A2S A;  1V9W A;  2C0D A;  1HNA A;  2ES7 A;  1TW9 A;  5KN1 A;  1T00 A;  3S9F A;  4GST A;  3IDV A;  2H6Z A;  2DJK A;  4KAE A;  4ML1 A;  2ON5 A;  2ON7 A;  1U3A A;  2HYX A;  4TKY A;  3GRX A;  3LEF A;  2H8L A;  3LG6 A;  5ECO B;  3R2Q A;  5B8A A;  2TRC P;  3D5J A;  2YN1 A;  2EC4 A;  1WPI A;  1QUW A;  3MNG A;  1TU7 A;  2GST A;  3F4R A;  2PER A;  2CX3 A;  5CAX A;  2CZ2 A;  3W8J A;  2YV9 A;  2KOK A;  1EEJ A;  1Z3E A;  3UAP A;  2L5L A;  5KEJ A;  2DML A;  3I9V 2;  2A4V A;  3GUR A;  3CRU A;  2NPB A;  4Z2U A;  4PQ1 A;  3QMX A;  1YKC A;  2HLS A;  2X99 A;  5FWG A;  2NTO A;  2OA7 A;  2A4H A;  1J08 A;  1Z7R A;  4J57 E;  1A0F A;  4K7O A;  1TK8 B;  4TW5 A;  3ZIJ A;  4Q5Q A;  5B6N A;  5DJM A;  2XBI A;  16GS A;  4GTU A;  4Z7X A;  1V98 A;  1YEX A;  4MP4 A;  2LV3 A;  5B6M A;  2JSY A;  4WET A;  1TP9 A;  5COH A;  1QGV A;  5J4U A;  2FHE A;  1TRU A;  1XWC A;  1M2D A;  4K9Z A;  4BA7 A;  1KEB A;  2HRA A;  3GX0 A;  3NIV A;  5CRE A;  3FMW A;  3UEM A;  3TKR A;  1YQ1 A;  3PIN A;  3A5W A;  3APO A;  3WGE A;  2VCZ A;  3L78 A;  5D73 A;  5KOX A;  3QOU A;  3IA1 A;  4PUA A;  4ISD A;  3FR3 A;  4KA0 A;  3WGX A;  4HI7 A;  1M0U A;  2IPA A;  2HNL A;  3VPT A;  2XPD A;  4K2X A;  4IJ3 A;  1Q98 A;  2A2P A;  5A4U A;  4MPF A;  1XVW A;  2GGT A;  5DCH A;  1B48 A;  1R7H A;  4NHW A;  3LOR A;  4IN0 A;  4F03 A;  3MDK A;  4GSS A;  2VCV A;  2PVQ A;  1GUL A;  1AUC A;  4CY6 A;  4OMV A;  5AGY A;  2C0F A;  3IOS A;  2GS3 A;  1M9A A;  2GZP A;  5JWQ B;  1ZYE A;  5J3R A;  2MMZ A;  4GXZ A;  20GS A;  1PL2 A;  2AJQ B;  5AN1 A;  6GST A;  4L5O A;  1OE8 A;  1TK5 B;  3U5R E;  2QKE A;  1DBY A;  4PTS A;  3DYR A;  3BBY A;  3FW2 A;  3HD5 A;  3Q18 A;  3GH9 A;  4EO3 A;  2YZH A;  1PKZ A;  1F37 A;  3IPZ A;  1A0R P;  4J2F A;  3TKS A;  1SK1 A;  3M1G A;  2GLR A;  3LJR A;  4HS1 A;  2V6K A;  5HQP A;  4MJA A;  2LQO A;  4QL9 A;  4NV2 A;  4TR0 A;  2H0G A;  1FG4 A;  2FA4 A;  5IIZ A;  1A23 A;  4FYB A;  1O81 A;  1HYU A;  2L59 A;  1GRX A;  2YJH A;  2WB9 A;  1ERT A;  3WGD A;  1SJZ A;  1YZX A;  1ABA A;  1K3L A;  3UAR A;  2GZY A;  2C80 A;  17GS A;  1AC1 A;  1WE0 A;  2H72 A;  2TRX A;  1GP1 A;  2O7K A;  1YEP A;  5J41 A;  1K0B A;  4V2N A;  3EE2 A;  2OE3 A;  2X8H A;  4TVE A;  1MEK A;  3HHV A;  2YNX A;  2I1U A;  5DBQ A;  2JSZ A;  5DCG A;  3CTG A;  1CQH A;  3KD0 A;  3PGT A;  4IP6 A;  1GTI A;  3ZZX A;  2GTU A;  1PL1 A;  5KN3 A;  5LNK e;  4XTS A;  3QD9 A;  2HXK A;  4IJI A;  3N9J A;  5CYY A;  5E4W A;  2H0I A;  4OFN A;  2KLX A;  2GSR A;  2IME A;  2B6M A;  3L9U A;  1BYE A;  3KEB A;  4MK3 A;  4FYC A;  1SEN A;  2K9F A;  3M9J A;  1PQN A;  6GSV A;  5CRD A;  1GLP A;  2XPE A;  1I5G A;  3TJF A;  3E3E A;  4OCE A;  5CRW A;  3KMO A;  1O8X A;  3GFK A;  2I4A A;  4Z2T A;  4HJ2 A;  4ID0 A;  1TRW A;  3C1R A;  3LFL A;  2F9S A;  2M46 A;  2LKU A;  5ELG A;  3NOF A;  4K7N A;  1ST9 A;  5G5F A;  4JZQ A;  1MTC A;  4EC0 A;  4GCI A;  1PA3 A;  3KXO A;  3CYN A;  1BX9 A;  2X4A A;  9GSS A;  3TRQ A;  3GTU A;  2NDO A;  1A2J A;  3HVS A;  4MCU A;  4LL1 B;  3ZRE A;  2VUP A;  3CSH A;  2QA1 A;  1HNC A;  4MMM A;  4K0G A;  2IMI A;  2HFD A;  2R4V A;  2H1B A;  3F3Q A;  1SD8 A;  2R2J A;  2OE1 A;  3F63 A;  1UC7 A;  1NHO A;  2IMF A;  3PPU A;  1A8L A;  3G7J A;  3LYP A;  3US3 A;  3ZYW A;  1QFN A;  4YKG A;  3GNJ A;  2FGX A;  5FHI A;  1ZZY A;  3KP9 A;  3ZVJ A;  5ECS A;  1UVZ A;  3VWW A;  3P90 A;  2P0G A;  4L5L A;  1TI3 A;  1ZYP A;  3LXT A;  5E59 A;  1T7P B;  2DIZ A;  2YAN A;  2KUC A;  3D4T A;  1O8W A;  5IMF A;  3FRC A;  4JU5 A;  2XBQ A;  3GTU B;  3GV1 A;  3ED3 A;  2VCW A;  5GZZ B;  4HDE A;  5IMZ A;  4EXJ A;  2CAI A;  4Q5F A;  2H19 A;  4AF2 A;  18GS A;  2CAQ A;  4O7H A;  2GT6 A;  4TR1 A;  4K0N A;  4TN8 A;  3IE3 A;  1EZK A;  2V41 A;  4CY8 A;  1W4V A;  5G5E A;  1SD9 A;  2B5Y A;  3HJM A;  4AJ8 A;  2R5G A;  3KZQ A;  2FWF A;  2VOC A;  2DSA A;  1K0C A;  3KP8 A;  3A3T A;  4OWY A;  4HUA A;  4F9Z A;  3KH9 A;  3TJK A;  3CTF A;  1K0O A;  1GUK A;  1KTE A;  1PKW A;  2HI7 A;  2CT6 A;  2VLT A;  4NHZ A;  1M2B A;  2VLV A;  4EL1 A;  2O8V B;  3UBL A;  1TU8 A;  5DQY A;  1C72 A;  3CBU A;  4DSQ A;  4X43 A;  2VM2 A;  2BTO T;  2PUK C;  1EV4 A;  3F0I A;  3HJP A;  1Z7P A;  5IPG A;  2OKA A;  1V2A A;  3QFB C;  2B7J A;  1J9B A;  1CQG A;  1MD4 A;  3HXS A;  4DSS A;  2R6K A;  4TR1 B;  6GSU A;  1GSQ A;  1R5A A;  1GNW A;  3VI5 A;  4E8E A;  3EVI A;  4K6X A;  3H4K A;  1ZL9 A;  4HJM A;  1M3I A;  5IMC A;  4K2D A;  2G0F A;  3GH6 A;  5G30 A;  2P5Q A;  4MZW A;  1HQO A;  5IQY A;  4N30 A;  3L4N A;  4MPG A;  3VFI A;  2N5B A;  3VPQ A;  3HVN A;  1THX A;  3ERF A;  2QC7 A;  1RQM A;  3Q6O A;  4O5R A;  1SU9 A;  2VL3 A;  1U3I A;  3GKN A;  4IBP A;  2L5O A;  4USS A;  2G2Q A;  5IOX A;  1G6Y A;  1JFU A;  3L0H A;  3F4T A;  2VM1 A;  5A4W A;  4WR5 A;  1WWJ A;  4FIW A;  2MMA A;  3AY8 A;  1ERU A;  2MYG A;  3ZFL A;  6GSS A;  4XHM A;  2A2R A;  4HQS A;  1ZYQ B;  1U87 A;  1YY7 A;  2IMD A;  4DSS B;  3EU4 A;  3TKS E;  4ICY A;  1EEM A;  4IP1 A;  4BWS A;  3GKX A;  4PNF A;  3Q74 A;  1FW1 A;  4RQX A;  5ID2 A;  1TK0 B;  3NZN A;  1NHY A;  2OJL A;  2MZC A;  6GSX A;  2K8V A;  4I97 A;  2LS5 A;  4MDC A;  4NAX A;  2XC2 A;  4XS4 A;  1WRY A;  2YOI A;  3KMN A;  3TOU A;  4TXV A;  2PU9 C;  2LTK A;  4XS1 A;  1GSE A;  1ZGN A;  4GSN A;  2HSM A;  2VCT A;  4YQM A;  1G7E A;  2C0G A;  3U6V A;  1FB0 A;  1A2M A;  1RK4 A;  1WMJ A;  1UA5 A;  3WYW A;  1O7U A;  4MZB A;  1SK0 A;  3GSS A;  5GAP D;  1B9Y C;  2X49 A;  1X5D A;  2WFC A;  2RII A;  5IPH A;  3D22 A;  1PFO A;  3ZIT A;  1SK2 A;  5C04 A;  2PPT A;  2GT5 A;  1T8E B;  3GST A;  1VRS D;  5ID2 B;  2L57 A;  2VCQ A;  7GSS A;  4KND A;  4J56 E;  3RPP A;  5CO3 A;  1XWG A;  1TXX A;  3LWA A;  4XS4 B;  2H66 A;  4GWR A;  1BG5 A;  3IBH A;  4KSO A;  1T4Y A;  2OBI A;  5EL8 A;  1GSS A;  3GYK A;  1EP7 A;  2E0Q A;  5IOW A;  2H73 A;  2LJK A;  3EWL A;  2F8A A;  4POB A;  1M7T A;  1MDI A;  2LEG A;  1U6T A;  3QPM A;  4PQH A;  4AGS A;  2C0E A;  2AB6 A;  2H74 A;  2LST A;  3LYK A;  4ZIL A;  1FB6 A;  4KDX A;  4G0I A;  3EPT A;  1LU4 A;  2C4J A;  2LRC A;  2R3X A;  4MA9 A;  2VD1 A;  1K0D A;  1B8X A;  5CRH A;  1X0R A;  1BAY A;  2FNO A;  5D9X A;  4LA1 A;  3F8U A;  1YKA A;  2YWN A;  1PN9 A;  1XW6 A;  3EMP A;  3G9B A;  3LW9 A;  2RM5 A;  1T3B A;  5LCZ A;  1QMV A;  4PQI A;  1URM A;  4KDY A;  4ILF A;  2FD3 A;  3E0U A;  1F9M A;  4KGI A;  4FH8 A;  3RHC A;  2E2G A;  2CVB A;  4Z2R A;  1QXH A;  1PRX A;  1R5P A;  1S3R A;  4ZB8 A;  4XRD A;  2HRK A;  4P3Y B;  2RUE A;  3HVV A;  3O76 A;  3IXR A;  4RUV A;  4ECC A;  2DJ1 A;  3VWV A;  3IHG A;  8GSS A;  2DMM A;  3HVX A;  2HZE A;  1XXU A;  2IIY A;  4HQZ A;  4EVM A;  2YCD A;  1LJR A;  2H1G A;  2FCH A;  1JZD A;  2Z9S A;  4WBR D;  1T4Z A;  1S3D A;  4N0Z A;  4V1A p;  3QR6 A;  2IL3 A;  2E2M A;  4JED A;  3DML A;  2D2Z A;  1RW1 A;  3A5I A;  2YWM A;  2P5R A;  3HKR A;  3H79 A;  4MJC A;  2AV4 A;  1PGT A;  3DGQ A;  3QCP A;  5DJL A;  1GLQ A;  2NBS A;  2FWG A;  3TJG A;  1GUH A;  5JCW A;  1N8J A;  1WP0 A;  3N5O A;  4PGT A;  5F05 A;  2F3M A;  1M2A A;  4EDY A;  1OE7 A;  3TKP A;  1TRV A;  1PX6 A;  1X9W B;  4HU7 A;  4BVX A;  1ON4 A;  2HZE B;  2I81 A;  2M80 A;  3UIW A; 
#chains in the Genus database with same CATH homology
 3ZVJ D;  3DVW A;  1OC3 A;  1G7O A;  1O73 A;  3KGK A;  4MJE A;  2UZ8 A;  4ZL8 A;  1TDI A;  4RQR A;  3E9J B;  1Z9H A;  5H5R A;  1B4Q A;  3IC8 A;  3ERG A;  3HZ4 A;  2PMT A;  1GNE A;  2JU5 A;  5H5Q A;  4EDZ A;  4HOJ A;  4WEY A;  5A5K A;  5ENU A;  3IHQ A;  3RBT A;  2TIR A;  1Z6M A;  1K0A A;  2DKI A;  4DVC A;  4MLY A;  1QQ2 A;  2B5X A;  1AQW A;  5HFI A;  4ZIJ A;  4ML6 A;  4CHS A;  2FY6 A;  3O3T A;  6GSY A;  3D0Z A;  3FZ4 A;  4KE3 A;  1V57 A;  3ISO A;  1IYI A;  4BVX B;  1OVN A;  3CRT A;  5ELA A;  12GS A;  3ZL5 A;  1VF1 A;  4AJ7 A;  1WIK A;  5ECL B;  1JLV A;  2O89 A;  3HY2 A;  2KP1 A;  4LMV A;  4N10 A;  3UL3 A;  3UVH A;  4IQ1 A;  1AIU A;  3RAZ A;  1VF3 A;  4JE1 A;  2H0H A;  4L8E A;  1GSD A;  3L9V A;  4MF5 A;  3C71 A;  3F4S A;  3K8N A;  3QAG A;  4ZBA A;  2V32 A;  2DBC A;  4YQV A;  1PSQ A;  2GDR A;  5D9W A;  1XWK A;  5INY A;  5F07 A;  11GS A;  4KDU A;  1SJI A;  4HU9 A;  3DEX A;  4Q5R A;  3KH7 A;  3LQ7 A;  1I9D A;  4IEL A;  1T1V A;  3C8E A;  1QK8 A;  2GZZ A;  2QGV A;  1Q4J A;  3UVT A;  2KHP A;  2H75 A;  2CVK A;  1FOV A;  3FZA A;  3MWH A;  3BCK A;  5GST A;  1Y25 A;  3KJY A;  3TUE A;  4N11 A;  4RI7 A;  5G1L A;  5D9V A;  3A2V A;  1OC8 A;  3RHB A;  1ERV A;  4YAP A;  14GS A;  2AHE A;  3QAW A;  3C73 A;  4RI6 A;  4ZB9 A;  1YF0 A;  3ME7 A;  1AXD A;  4OFT A;  5F8B A;  3EUR A;  1NSW A;  4MZC A;  2WS2 A;  4ZL9 A;  3TKQ A;  4PUR A;  2LNT A;  5ECQ B;  3TB2 A;  5CNW A;  1B4P A;  3EU3 A;  1E2Y A;  3MAK A;  2LJA A;  3ZTL A;  4WR4 A;  2DLX A;  2CV4 A;  1R26 A;  5D93 A;  4NMU A;  2C3Q A;  2DC5 A;  1K3O A;  4EIQ A;  2IN3 A;  4G2E A;  2VL2 C;  4O5U A;  2ZUP A;  5G1K A;  2JL4 A;  3VLN A;  2GQK A;  4OFM A;  2R37 A;  1SL1 B;  1FVJ A;  5B7C A;  4POM A;  5A4V A;  2ZNM A;  2EIO A;  4KCA A;  3SBC A;  4G10 A;  2LNS A;  3APQ A;  4IQA A;  4MH3 A;  2WCI A;  19GS A;  1GTU A;  3Q19 A;  2F8F A;  2C3N A;  3WT2 A;  4D73 A;  4JRR A;  2ALB A;  3FYG A;  4WBJ A;  5IMV A;  3VUR A;  3LSZ A;  3EYT A;  1DUG A;  3TGZ A;  3J7Y b;  2P31 A;  3TRX A;  2WJU A;  1S3A A;  4TXO A;  1EP8 A;  2WUL A;  5HR0 A;  2B1K A;  3DVX A;  1GSF A;  2B3S A;  4E8H A;  3HJO A;  1Z6N A;  3IAS 2;  3TDG A;  2YV7 A;  3WD6 A;  1XIY A;  3C1S A;  4PNG A;  4KSM A;  1ZYN A;  4F0C A;  4KW6 A;  4OD7 A;  2VIM A;  5CP1 A;  1SL0 B;  3GL5 A;  1S3C A;  4IHU A;  1XW9 A;  3GX8 A;  4ACS A;  2HT9 A;  4MF7 A;  5BRT A;  4D73 B;  5DAK A;  4POK A;  5BMU A;  1JLW A;  5HFK A;  1XPV A;  5JWR B;  2O87 A;  4TXO B;  1EGR A;  5EPF A;  1AW9 A;  1Y6E A;  2BMX A;  4V2M A;  1KNG A;  3BD2 A;  1GSU A;  2L4C A;  4AJ6 A;  1XWB A;  5JCU A;  3IAM 2;  3LXZ A;  2LRT A;  5IMD A;  2CQ9 A;  4FYU A;  3KM6 A;  4CW9 A;  1JHB A;  4EF0 A;  3HA9 A;  2GQM A;  1MDK A;  2B5E A;  4NPB A;  2O85 A;  1K3Y A;  4TR4 A;  3KCM A;  1XWA A;  2DKH A;  3HDC A;  4ECB A;  4KUN A;  1OYJ A;  1FVK A;  4I8B A;  5DAK B;  3CMI A;  1A24 A;  3DRN A;  3I69 A;  2DJJ A;  5D96 A;  5ABR A;  1SYR A;  2H71 A;  3UMA A;  2YJ7 A;  3OR5 A;  4G0K A;  4IW9 A;  1NM3 A;  3TCO A;  1X9M B;  5ECI B;  4BL7 A;  4HZ2 A;  3DD3 A;  3GN3 A;  1YF1 A;  2MMO A;  1USB A;  4GQC A;  3HCZ A;  4KCE A;  2HZF A;  5ECP B;  3MIX A;  2JZR A;  1G6W A;  1BED A;  2VCX A;  2YP6 A;  5HR3 A;  5HR2 A;  3ZLP A;  1MD3 A;  1F3B A;  1H4O A;  2L4Q A;  4ULX A;  4PUF C;  4NWY A;  1UN2 A;  2VAF A;  1XZO A;  1OKT A;  2LUS A;  3R3E A;  4BWQ A;  1ERW A;  4XIH A;  1F6M C;  4WF4 A;  4PX1 A;  2OE0 A;  4TR3 A;  2HSY A;  5GSS A;  5GAN D;  4TOP A;  3QFA C;  4BPY A;  3PR8 A;  4BL7 B;  3TJJ A;  5D9T A;  3SWL A;  2HE3 A;  1JZO A;  3KTL A;  3TRP A;  4V2L A;  1DE2 A;  5B8B A;  4POL A;  1PN0 A;  1FHE A;  5AIV A;  1TOF A;  3A2W A;  3UBK A;  2X64 A;  4QQ7 A;  5H5S A;  2MBT A;  2QSI A;  1WJK A;  4DSR A;  1DSB A;  3LGC A;  3DKS A;  4LLR A;  4OO5 A;  2M72 A;  5IM9 A;  4LL4 B;  2YZU A;  3FR9 A;  3O6T A;  3CSI A;  2V6O A;  2DJ2 A;  3P2A A;  3F9U A;  4KH7 A;  3ERW A;  1K0M A;  4K7I A;  5LD0 A;  3C7M A;  3DWV A;  4IGJ A;  3ZMK A;  1MDJ A;  5ECH B;  3F3R A;  3FK8 A;  4F0B A;  3M9K A;  3I6A A;  4CDO A;  4I5Q A;  2X8G A;  4TRX A;  5J9B A;  3KTB A;  2N5A A;  3FY7 A;  2N5F A;  4IVF A;  3BJ5 A;  4YKF A;  3BCI A;  5IO2 A;  3M3M A;  3FZ5 A;  1F3A A;  2AAW A;  2IWT A;  4YQU A;  5AIS A;  3GKK A;  3D4M A;  1SKW B;  4A5P A;  2GVP A;  2WRT A;  2IMK A;  1W89 A;  5KN2 A;  3A2X A;  5C00 A;  4KF9 A;  4G9H A;  4GF0 A;  3GL3 A;  2R0P A;  4FO5 A;  1FO5 A;  4XS6 A;  3QDN A;  1M99 A;  3TKS C;  1TTZ A;  3FEU A;  5F0G A;  22GS A;  2I3Y A;  1GUM A;  1FOH A;  1PD2 1;  1M9B A;  4WKW A;  1AQV A;  3VK9 A;  2RLI A;  3P7X A;  2OAC A;  1YDK A;  3MSZ A;  4Q5N A;  1YJ6 A;  1HNB A;  2CVD A;  2FWH A;  4BVY A;  2C8U A;  1V40 A;  4NV5 A;  3V1W A;  2K8S A;  2LJR A;  4O92 A;  2VO4 A;  3GKM A;  1U88 A;  2B1L A;  1XOA A;  2FLS A;  2PVO C;  2VL9 A;  3IRA A;  4PXO A;  2FA8 A;  2PN8 A;  3H8Q A;  4EUY A;  1X9S B;  1GWC A;  2EIQ A;  4I2U A;  1B9X C;  4XCS A;  2K6V A;  1XCC A;  4HEA 2;  4GLT A;  4ZB6 A;  1X5C A;  3CXG A;  2VLU A;  5AIX A;  2XHF A;  2IFQ A;  3FZ9 A;  2CX4 A;  4JBB A;  3TJB A;  1OKD A;  2X8C A;  1ILO A;  2REM A;  4G0L A;  1THO A;  5ECR B;  2AUV A;  3VI7 A;  1GH2 A;  4BVY B;  4EKZ A;  2GSS A;  3FKF A;  1VGL A;  2BJX A;  3KIJ A;  1SKR B;  5CRG A;  2I9H A;  3WT1 A;  2YWI A;  5ECM B;  1SJ6 A;  4KB3 A;  4X0X A;  4ZBB A;  5L71 A;  3G7Y A;  4O5Q A;  3UOM A;  4KX4 A;  2H70 A;  2NVL A;  2B7K A;  2MMN A;  2V2G A;  5G31 A;  1EOH A;  3P8W A;  5F06 A;  1V58 A;  4MAB A;  2PWJ A;  4ECI A;  4F2I A;  1AAZ A;  3M8N A;  5ECN B;  4F82 A;  3F6F A;  5KN0 A;  3MYD A;  3G7I A;  2PBJ A;  4JR4 A;  2YPM A;  2IFQ B;  4O32 A;  5DAL A;  3FHK A;  5IMA A;  1XOB A;  3H93 A;  1A2L A;  4MH2 A;  2H6X A;  2EIR A;  3HYP A;  3FR6 A;  1TI1 A;  2LQQ A;  1FAA A;  4K1F A;  3DIE A;  5J5N A;  3D21 A;  3L9S A;  1HD2 A;  1OC9 A;  1X5E A;  2C1Y A;  3W6G A;  4EE0 A;  1KBN A;  3RDW A;  2AYT A;  4X1U A;  2J9H A;  1ACV A;  3EC3 A;  1JZW A;  1XW5 A;  2OAD A;  1ZMA A;  2DJ0 A;  1TJD A;  1GTA A;  3GHA A;  5EY6 A;  4GQF A;  2JZS A;  2RUF A;  2VL2 A;  2J23 A;  3IK7 A;  3GUS A;  2LRN A;  3PH9 A;  2WZ9 A;  3QAV A;  5KOW A;  2VD0 A;  4H86 A;  4ECJ A;  6GSW A;  1EOG A;  3W8S A;  3VWX A;  3JCM L;  2HSH A;  2GSQ A;  2JZT A;  2L6D A;  4LMW A;  4OO4 A;  4WXT A;  5DAL B;  1SKS B;  1ML6 A;  3D6I A;  2E7P A;  3ZFB A;  4JR6 A;  1E6B A;  1DE1 A;  4K5R A;  1EGO A;  2WDU A;  3ZRD A;  1A8Y A;  4HZ4 A;  2JAC A;  4ZBD A;  1SYX A;  2H01 A;  5G2Z A;  1PX7 A;  2IJY A;  1OC9 B;  3VWU A;  1R4W A;  3HZ8 A;  2R0G A;  4K8M A;  4L0W A;  4EIP A;  1O85 A;  3EIN A;  3M0F A;  3IV4 A;  5DQS A;  1TKD B;  2FWE A;  2MBS A;  1ZOF A;  3GA4 A;  2K18 A;  2DIY A;  1OAZ A;  2V1M A;  1EV9 A;  1AQX A;  4I2T A;  1O6J A;  1VF2 A;  4V1A g;  3I43 A;  4QL7 A;  1J0F A;  4MF6 A;  1N2A A;  1SL2 B;  1NW2 A;  2C3T A;  3APS A;  1TRS A;  2GQL A;  3GMF A;  2FUG 2;  4IKH A;  2HRF A;  2WGR A;  3F6D A;  2ZCT A;  4X4J A;  3ME8 A;  3ZIV A;  5DVB A;  13GS A;  5HFG A;  2H76 A;  2H6Y A;  3UJ1 A;  4YH2 A;  4L0U A;  2JAD A;  1G0T A;  1XVQ A;  2H1A A;  3TOT A;  1BQ7 A;  1PMT A;  3BOA A;  1Z5Y E;  5DDL A;  2OBK A;  3IK9 A;  5D8I A;  1F2E A;  2H1D A;  1LBK A;  4MJB A;  4XRA A;  4MNN A;  5JWO B;  4ZXG A;  5FT3 A;  1GSY A;  1ZCP A;  3IC4 A;  2H30 A;  2RM6 A;  2QA2 A;  5HR1 A;  1JZR A;  1VF4 A;  5IO0 A;  1GL8 A;  4GRF A;  2R0C A;  4WF5 A;  2HRN A;  4YAV A;  2YWO A;  3GIX A;  1XBS A;  5EVO A;  1GTB A;  2PGT A;  2L6C A;  2CA8 A;  4I6X A;  4N0V A;  1K0N A;  1XFL A;  3EMX A;  5ECK B;  3CSJ A;  10GS A;  1EWX A;  4K5S A;  4IS0 A;  3ZML A;  5JCG A;  1IYH A;  4OCF A;  4ZL7 A;  3RPN A;  2DJ3 A;  4DEJ A;  3DXB A;  2F51 A;  1WOU A;  1BJX A;  4G19 A;  2CZ3 A;  3IR4 A;  3H1N A;  4NXI A;  3J7Y k;  4FQU A;  5J9C A;  1H75 A;  2KP2 A;  2A2S A;  1V9W A;  2C0D A;  1HNA A;  2ES7 A;  1TW9 A;  5KN1 A;  1T00 A;  3S9F A;  4GST A;  3IDV A;  2H6Z A;  2DJK A;  4KAE A;  4ML1 A;  2ON5 A;  2ON7 A;  1U3A A;  2HYX A;  4TKY A;  3GRX A;  3LEF A;  2H8L A;  3LG6 A;  5ECO B;  3R2Q A;  5B8A A;  2TRC P;  3D5J A;  2YN1 A;  2EC4 A;  1WPI A;  1QUW A;  3MNG A;  1TU7 A;  2GST A;  3F4R A;  2PER A;  2CX3 A;  5CAX A;  2CZ2 A;  3W8J A;  2YV9 A;  2KOK A;  1EEJ A;  1Z3E A;  3UAP A;  2L5L A;  5KEJ A;  2DML A;  3I9V 2;  2A4V A;  3GUR A;  3CRU A;  2NPB A;  4Z2U A;  4PQ1 A;  3QMX A;  1YKC A;  2HLS A;  2X99 A;  5FWG A;  2NTO A;  2OA7 A;  2A4H A;  1J08 A;  1Z7R A;  4J57 E;  1A0F A;  4K7O A;  1TK8 B;  4TW5 A;  3ZIJ A;  4Q5Q A;  5B6N A;  5DJM A;  2XBI A;  16GS A;  4GTU A;  4Z7X A;  1V98 A;  1YEX A;  4MP4 A;  2LV3 A;  5B6M A;  2JSY A;  4WET A;  1TP9 A;  5COH A;  1QGV A;  5J4U A;  2FHE A;  1TRU A;  1XWC A;  1M2D A;  4K9Z A;  4BA7 A;  1KEB A;  2HRA A;  3GX0 A;  3NIV A;  5CRE A;  3FMW A;  3UEM A;  3TKR A;  1YQ1 A;  3PIN A;  3A5W A;  3APO A;  3WGE A;  2VCZ A;  3L78 A;  5D73 A;  5KOX A;  3QOU A;  3IA1 A;  4PUA A;  4ISD A;  3FR3 A;  4KA0 A;  3WGX A;  4HI7 A;  1M0U A;  2IPA A;  2HNL A;  3VPT A;  2XPD A;  4K2X A;  4IJ3 A;  1Q98 A;  2A2P A;  5A4U A;  4MPF A;  1XVW A;  2GGT A;  5DCH A;  1B48 A;  1R7H A;  4NHW A;  3LOR A;  4IN0 A;  4F03 A;  3MDK A;  4GSS A;  2VCV A;  2PVQ A;  1GUL A;  1AUC A;  4CY6 A;  4OMV A;  5AGY A;  2C0F A;  3IOS A;  2GS3 A;  1M9A A;  2GZP A;  5JWQ B;  1ZYE A;  5J3R A;  2MMZ A;  4GXZ A;  20GS A;  1PL2 A;  2AJQ B;  5AN1 A;  6GST A;  4L5O A;  1OE8 A;  1TK5 B;  3U5R E;  2QKE A;  1DBY A;  4PTS A;  3DYR A;  3BBY A;  3FW2 A;  3HD5 A;  3Q18 A;  3GH9 A;  4EO3 A;  2YZH A;  1PKZ A;  1F37 A;  3IPZ A;  1A0R P;  4J2F A;  3TKS A;  1SK1 A;  3M1G A;  2GLR A;  3LJR A;  4HS1 A;  2V6K A;  5HQP A;  4MJA A;  2LQO A;  4QL9 A;  4NV2 A;  4TR0 A;  2H0G A;  1FG4 A;  2FA4 A;  5IIZ A;  1A23 A;  4FYB A;  1O81 A;  1HYU A;  2L59 A;  1GRX A;  2YJH A;  2WB9 A;  1ERT A;  3WGD A;  1SJZ A;  1YZX A;  1ABA A;  1K3L A;  3UAR A;  2GZY A;  2C80 A;  17GS A;  1AC1 A;  1WE0 A;  2H72 A;  2TRX A;  1GP1 A;  2O7K A;  1YEP A;  5J41 A;  1K0B A;  4V2N A;  3EE2 A;  2OE3 A;  2X8H A;  4TVE A;  1MEK A;  3HHV A;  2YNX A;  2I1U A;  5DBQ A;  2JSZ A;  5DCG A;  3CTG A;  1CQH A;  3KD0 A;  3PGT A;  4IP6 A;  1GTI A;  3ZZX A;  2GTU A;  1PL1 A;  5KN3 A;  5LNK e;  4XTS A;  3QD9 A;  2HXK A;  4IJI A;  3N9J A;  5CYY A;  5E4W A;  2H0I A;  4OFN A;  2KLX A;  2GSR A;  2IME A;  2B6M A;  3L9U A;  1BYE A;  3KEB A;  4MK3 A;  4FYC A;  1SEN A;  2K9F A;  3M9J A;  1PQN A;  6GSV A;  5CRD A;  1GLP A;  2XPE A;  1I5G A;  3TJF A;  3E3E A;  4OCE A;  5CRW A;  3KMO A;  1O8X A;  3GFK A;  2I4A A;  4Z2T A;  4HJ2 A;  4ID0 A;  1TRW A;  3C1R A;  3LFL A;  2F9S A;  2M46 A;  2LKU A;  5ELG A;  3NOF A;  4K7N A;  1ST9 A;  5G5F A;  4JZQ A;  1MTC A;  4EC0 A;  4GCI A;  1PA3 A;  3KXO A;  3CYN A;  1BX9 A;  2X4A A;  9GSS A;  3TRQ A;  3GTU A;  2NDO A;  1A2J A;  3HVS A;  4MCU A;  4LL1 B;  3ZRE A;  2VUP A;  3CSH A;  2QA1 A;  1HNC A;  4MMM A;  4K0G A;  2IMI A;  2HFD A;  2R4V A;  2H1B A;  3F3Q A;  1SD8 A;  2R2J A;  2OE1 A;  3F63 A;  1UC7 A;  1NHO A;  2IMF A;  3PPU A;  1A8L A;  3G7J A;  3LYP A;  3US3 A;  3ZYW A;  1QFN A;  4YKG A;  3GNJ A;  2FGX A;  5FHI A;  1ZZY A;  3KP9 A;  3ZVJ A;  5ECS A;  1UVZ A;  3VWW A;  3P90 A;  2P0G A;  4L5L A;  1TI3 A;  1ZYP A;  3LXT A;  5E59 A;  1T7P B;  2DIZ A;  2YAN A;  2KUC A;  3D4T A;  1O8W A;  5IMF A;  3FRC A;  4JU5 A;  2XBQ A;  3GTU B;  3GV1 A;  3ED3 A;  2VCW A;  5GZZ B;  4HDE A;  5IMZ A;  4EXJ A;  2CAI A;  4Q5F A;  2H19 A;  4AF2 A;  18GS A;  2CAQ A;  4O7H A;  2GT6 A;  4TR1 A;  4K0N A;  4TN8 A;  3IE3 A;  1EZK A;  2V41 A;  4CY8 A;  1W4V A;  5G5E A;  1SD9 A;  2B5Y A;  3HJM A;  4AJ8 A;  2R5G A;  3KZQ A;  2FWF A;  2VOC A;  2DSA A;  1K0C A;  3KP8 A;  3A3T A;  4OWY A;  4HUA A;  4F9Z A;  3KH9 A;  3TJK A;  3CTF A;  1K0O A;  1GUK A;  1KTE A;  1PKW A;  2HI7 A;  2CT6 A;  2VLT A;  4NHZ A;  1M2B A;  2VLV A;  4EL1 A;  2O8V B;  3UBL A;  1TU8 A;  5DQY A;  1C72 A;  3CBU A;  4DSQ A;  4X43 A;  2VM2 A;  2BTO T;  2PUK C;  1EV4 A;  3F0I A;  3HJP A;  1Z7P A;  5IPG A;  2OKA A;  1V2A A;  3QFB C;  2B7J A;  1J9B A;  1CQG A;  1MD4 A;  3HXS A;  4DSS A;  2R6K A;  4TR1 B;  6GSU A;  1GSQ A;  1R5A A;  1GNW A;  3VI5 A;  4E8E A;  3EVI A;  4K6X A;  3H4K A;  1ZL9 A;  4HJM A;  5IMC A;  4K2D A;  2G0F A;  3GH6 A;  5G30 A;  2P5Q A;  4MZW A;  1HQO A;  5IQY A;  4N30 A;  3L4N A;  4MPG A;  3VFI A;  2N5B A;  3VPQ A;  1THX A;  3ERF A;  2QC7 A;  1RQM A;  3Q6O A;  4O5R A;  1SU9 A;  2VL3 A;  1U3I A;  3GKN A;  4IBP A;  2L5O A;  4USS A;  2G2Q A;  5IOX A;  1G6Y A;  1JFU A;  3L0H A;  3F4T A;  2VM1 A;  5A4W A;  4WR5 A;  1WWJ A;  4FIW A;  2MMA A;  3AY8 A;  1ERU A;  2MYG A;  3ZFL A;  6GSS A;  4XHM A;  2A2R A;  4HQS A;  1ZYQ B;  1U87 A;  1YY7 A;  2IMD A;  4DSS B;  3EU4 A;  3TKS E;  4ICY A;  1EEM A;  4IP1 A;  4BWS A;  3GKX A;  4PNF A;  3Q74 A;  1FW1 A;  4RQX A;  5ID2 A;  1TK0 B;  3NZN A;  1NHY A;  2OJL A;  2MZC A;  6GSX A;  2K8V A;  4I97 A;  2LS5 A;  4MDC A;  4NAX A;  2XC2 A;  4XS4 A;  1WRY A;  2YOI A;  3KMN A;  3TOU A;  4TXV A;  2PU9 C;  2LTK A;  4XS1 A;  1GSE A;  1ZGN A;  4GSN A;  2HSM A;  2VCT A;  4YQM A;  1G7E A;  2C0G A;  3U6V A;  1FB0 A;  1A2M A;  1RK4 A;  1WMJ A;  1UA5 A;  3WYW A;  1O7U A;  4MZB A;  1SK0 A;  3GSS A;  5GAP D;  1B9Y C;  2X49 A;  1X5D A;  2WFC A;  2RII A;  5IPH A;  3D22 A;  3ZIT A;  1SK2 A;  5C04 A;  2PPT A;  2GT5 A;  1T8E B;  3GST A;  1VRS D;  5ID2 B;  2L57 A;  2VCQ A;  7GSS A;  4KND A;  4J56 E;  3RPP A;  5CO3 A;  1XWG A;  1TXX A;  3LWA A;  4XS4 B;  2H66 A;  4GWR A;  1BG5 A;  3IBH A;  4KSO A;  1T4Y A;  2OBI A;  5EL8 A;  1GSS A;  3GYK A;  1EP7 A;  2E0Q A;  5IOW A;  2H73 A;  2LJK A;  3EWL A;  2F8A A;  4POB A;  1M7T A;  1MDI A;  2LEG A;  1U6T A;  3QPM A;  4PQH A;  4AGS A;  2C0E A;  2AB6 A;  2H74 A;  2LST A;  3LYK A;  4ZIL A;  1FB6 A;  4KDX A;  4G0I A;  3EPT A;  1LU4 A;  2C4J A;  2LRC A;  2R3X A;  4MA9 A;  2VD1 A;  1K0D A;  1B8X A;  5CRH A;  1X0R A;  1BAY A;  2FNO A;  5D9X A;  4LA1 A;  3F8U A;  1YKA A;  2YWN A;  1PN9 A;  1XW6 A;  3EMP A;  3G9B A;  3LW9 A;  2RM5 A;  1T3B A;  5LCZ A;  1QMV A;  4PQI A;  1URM A;  4KDY A;  4ILF A;  2FD3 A;  3E0U A;  1F9M A;  4KGI A;  4FH8 A;  3RHC A;  2E2G A;  2CVB A;  4Z2R A;  1QXH A;  1PRX A;  1R5P A;  4ZB8 A;  4XRD A;  2HRK A;  4P3Y B;  2RUE A;  3HVV A;  3O76 A;  3IXR A;  4RUV A;  4ECC A;  2DJ1 A;  3VWV A;  3IHG A;  8GSS A;  2DMM A;  3HVX A;  2HZE A;  1XXU A;  2IIY A;  4HQZ A;  4EVM A;  2YCD A;  1LJR A;  2H1G A;  2FCH A;  1JZD A;  2Z9S A;  4WBR D;  1T4Z A;  1S3D A;  4N0Z A;  4V1A p;  3QR6 A;  2IL3 A;  2E2M A;  4JED A;  3DML A;  2D2Z A;  1RW1 A;  3A5I A;  2YWM A;  2P5R A;  3HKR A;  3H79 A;  4MJC A;  2AV4 A;  1PGT A;  3DGQ A;  3QCP A;  5DJL A;  1GLQ A;  2NBS A;  2FWG A;  3TJG A;  1GUH A;  5JCW A;  1N8J A;  1WP0 A;  3N5O A;  4PGT A;  5F05 A;  2F3M A;  1M2A A;  4EDY A;  1OE7 A;  3TKP A;  1TRV A;  1PX6 A;  1X9W B;  4HU7 A;  4BVX A;  1ON4 A;  2HZE B;  2I81 A;  2M80 A;  3UIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...