3WT2A

Crystal structure of the b'-a' domain of thermophilic fungal protein disulfide isomerase (oxidized form)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
242
structure length
242
Chain Sequence
SPLIGEIGPETYSDYMSAGIPLAYIFAETAEERKELSDKLKPIAEAQRGVINFGTIDAKAFGAHAGNLNLKTDKFPAFAIQEVAKNQKFPFDQEKEITFEAIKAFVDDFVAGKIEPSIKSEPIPEKQEGPVTVVVAKNYNEIVLDDTKDVLIEFYAPWCGHCKALAPKYEELGALYAKSEFKDRVVIAKVDATANDVPDEIQGFPTIKLYPAGAKGQPVTYSGSRTVEDLIKFIAENGKYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein disulfide-isomerase
publication title Redox-dependent conformational transition of catalytic domain of protein disulfide isomerase indicated by crystal structure-based molecular dynamics simulation
doi rcsb
source organism Humicola insolens
molecule tags Isomerase
total genus 68
structure length 242
sequence length 242
chains with identical sequence B, C
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2014-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3wt2A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3wt2A01
1VF3A 2G0FA 3MWHA 2Z9SA 2O87A 2LJRA 1M7TA 2LKUA 1CQHA 3IR4A 2HSYA 1XWKA 5FHIA 1FHEA 2KOKA 1HNCA 3I43A 2C1YA 5E59A 1SL2B 3Q6OA 2QGVA 2DC5A 1XWGA 2DSAA 5DAKA 1X5EA 1TRUA 4KAEA 3RPPA 5IOXA 4OD7A 2C3TA 4PNGA 3LG6A 2A2SA 1J9BA 4KA0A 4F9ZA 1RQMA 4OO4A 1B48A 5KN0A 5EL8A 9GSSA 1GSYA 3LQ7A 5ECLB 2E0QA 5J41A 1MTCA 1G6WA 3HD5A 3EINA 1YQ1A 1HNBA 5HFKA 4V1Ap 2EC4A 2VLTA 3DVXA 2H72A 4L8EA 5ECKB 2FY6A 1BAYA 4MK3A 4FO5A 4GSTA 5HQPA 2B3SA 4PQHA 4I2TA 1IYIA 1GTUA 3LSZA 2KHPA 5H5SA 1Z6NA 3IV4A 1OE8A 1MEKA 1A0RP 4TW5A 5KEJA 2L4CA 3RBTA 1UA5A 1E2YA 3IPZA 3EYTA 4DSSB 2WGRA 2F8AA 2M46A 1H75A 2BTOT 1R26A 1X5CA 4JE1A 3D21A 4NWYA 1SD8A 2HYXA 4NAXA 4K9ZA 2X8CA 3ZREA 2X64A 4HQSA 2HZEA 2ZNMA 1S3AA 3KZQA 5DJLA 3LYPA 1YF0A 2C8UA 4J57E 1V9WA 3TJFA 5IOWA 3W6GA 1PD21 3MSZA 1FVJA 3ZRDA 2J23A 2FWEA 2VL9A 2O7KA 4BVXA 4ECBA 4XTSA 2LEGA 1F9MA 4YAPA 2WS2A 3QFAC 3I69A 2H0HA 2HSHA 2H0IA 1PGTA 4YQUA 1G7OA 1TK0B 2TRXA 2CQ9A 2RM5A 1A2JA 1JZRA 2B6MA 2RM6A 3H1NA 4TOPA 5DCGA 2VM1A 3HVVA 2H1DA 3L78A 2X8GA 1JZOA 1V58A 3RHBA 2IJYA 1EV9A 1F3BA 2PVOC 4WBJA 2ON5A 2I81A 1URMA 5ECNB 2V32A 5DBQA 5IMFA 2P31A 2CVKA 4MF7A 1DSBA 3V1WA 1VGLA 4J56E 2FCHA 1JZWA 3MDKA 2CX3A 2REMA 4MH2A 3KTLA 5DCHA 4F03A 2IMIA 1EV4A 2BMXA 4G2EA 4V2NA 3HJPA 18GSA 3FEUA 1Y6EA 1EOHA 1O7UA 1YEXA 4PXOA 4MDCA 4TR1B 2FUG2 1G7EA 1AIUA 3O3TA 4FH8A 1FB6A 2YWIA 2A2RA 3GX0A 5ECRB 1PL1A 1Z6MA 1JFUA 4OCEA 1K3OA 3GTUA 3F4RA 1EGOA 3LYKA 4KDUA 1DUGA 3Q18A 3TOTA 5IIZA 4POMA 4EE0A 4KW6A 1B9YC 5A4WA 4XS4B 3ZIVA 4EC0A 1ON4A 6GSTA 3H93A 4POLA 1U6TA 4OMVA 4ZL8A 3VI7A 4RI6A 3GYKA 4XS6A 4MA9A 2KLXA 1LBKA 1MD4A 2LRTA 4LL4B 1WJKA 5GZZB 1OAZA 1V57A 2GTUA 3TRPA 2HNLA 2ES7A 4L5LA 4IHUA 5CP1A 2VOCA 4PQIA 2P5QA 1MD3A 4HJ2A 4PQ1A 4GRFA 3GL5A 1FW1A 2IIYA 2GQLA 3UVTA 1SKSB 2FWGA 4V1Ag 1J08A 2L6CA 2P5RA 1TRVA 1WWJA 1R5AA 4HJMA 1PKWA 2ALBA 1GTAA 1M2BA 5D73A 3RDWA 1ZL9A 2H66A 2YWOA 2I1UA 4OWYA 3QOUA 4H86A 3ZFLA 2VCVA 3M1GA 4ML1A 1M2DA 2CAIA 1NHYA 2H73A 3HVSA 4IQAA 3TJJA 1MDJA 1T1VA 5ENUA 5DDLA 1BQ7A 3IAS2 3LWAA 2B7JA 1TTZA 1TI3A 2V2GA 2VLVA 3EMPA 5E4WA 5KN1A 3IRAA 2AHEA 4POBA 3GKNA 1AQWA 4DSQA 1PL2A 3CSIA 4EDZA 3UIWA 5G5FA 3FZ5A 4KDYA 4DEJA 2YJ7A 4N0VA 3QAGA 5B6NA 1SENA 4DSRA 1G6YA 2JACA 4NXIA 2D2ZA 4I2UA 2J9HA 2K8SA 5CYYA 3GURA 1T8EB 4NV5A 1TK8B 2VLUA 3SWLA 2FWFA 2M80A 1WP0A 5HR1A 2GLRA 1EWXA 1SD9A 1GUHA 2YANA 3APSA 4WXTA 2PUKC 2JADA 1PA3A 3ZVJD 4PX1A 1XXUA 2L59A 3GSTA 4IGJA 3OR5A 4DVCA 4EF0A 1BX9A 1A2MA 1GSEA 4F0CA 3KCMA 1EZKA 5GSTA 3ZL5A 3ZTLA 1V98A 2ON7A 4AF2A 4TKYA 2OA7A 5EY6A 3PH9A 3EU4A 2VCQA 4ZL9A 1TW9A 1Q4JA 4RI7A 3IDVA 4IP6A 2EIOA 3TJKA 5C04A 1TKDB 2GGTA 20GSA 3NZNA 3US3A 3ISOA 1R4WA 2LSTA 3HHVA 4HZ4A 4PURA 1W4VA 3FKFA 4PUFC 2CVBA 3HZ8A 1ZGNA 2AJQB 2MMOA 2FD3A 1EEMA 3ME8A 3BBYA 3BJ5A 1THOA 3GL3A 1SKWB 1M0UA 2OE3A 2DLXA 5D93A 5CAXA 3K8NA 5EPFA 3DXBA 2YPMA 2LJKA 2V6OA 1YEPA 2DJ0A 3RAZA 4WF5A 2YOIA 3D22A 2RUEA 2N5AA 1ML6A 3TJBA 4FYUA 4FYBA 4F0BA 5DALB 11GSA 1GP1A 2A4VA 1EEJA 4MJEA 1FG4A 16GSA 3A3TA 2N5BA 1O73A 1GWCA 4J2FA 4LLRA 2DJ1A 3FK8A 3CYNA 1YF1A 2AAWA 4CW9A 4DSSA 3UBKA 3HA9A 3UOMA 1M2AA 4N0ZA 3F4TA 1QXHA 14GSA 3KMOA 1T4ZA 4O5RA 4EUYA 4I5QA 5J5NA 4Z7XA 4MCUA 1GNEA 1KNGA 1UC7A 1TP9A 3VWWA 2PBJA 4ECJA 1SK0A 2PN8A 2JZRA 1EOGA 4F82A 1YDKA 2DJJA 3DGQA 1XBSA 4Q5RA 5CREA 5HR2A 1X9WB 1S3DA 3HXSA 5G31A 2KUCA 4F2IA 2DJKA 2F51A 3UL3A 4FIWA 3HCZA 5EVOA 3VPQA 2AYTA 5JCUA 3L4NA 1TU8A 1VF2A 5D8IA 2HI7A 4MJAA 4JEDA 1VF4A 2GDRA 1WRYA 1PSQA 1X5DA 1JZDA 5ABRA 1XVWA 1HQOA 2LRCA 1GRXA 2YWNA 3P7XA 4ECCA 3C71A 4XHMA 2RIIA 1O81A 5CRGA 2HLSA 1PQNA 4AGSA 5JCGA 1H4OA 2GZZA 2YN1A 2VL2C 3KTBA 2AB6A 2KP1A 5LD0A 4ZILA 3TKRA 2YP6A 1OVNA 2NTOA 1GSDA 12GSA 2DJ3A 5CO3A 3VWUA 3M8NA 2WB9A 7GSSA 5HFIA 4MPGA 2M72A 1F3AA 5ECHB 2VM2A 5J9BA 3KH7A 1R7HA 3IBHA 4AJ8A 4MJCA 3F0IA 5B8AA 2R4VA 2JSYA 1G0TA 3F9UA 2H76A 4TR1A 3QAWA 4HQZA 2DMLA 1SJZA 2VCWA 3UAPA 2CVDA 4WEYA 1XWBA 2GT5A 5IO0A 4K7OA 4HUAA 2TRCP 2C3QA 5A4UA 2K6VA 2H6ZA 1X9MB 4HU7A 5A5KA 1U88A 4P3YB 2P0GA 5ID2B 2VL3A 3FR9A 4IP1A 4X43A 3TDGA 5CRDA 1WMJA 5KN3A 19GSA 3IAM2 4IS0A 2GSTA 2N5FA 1OKDA 3KXOA 1XZOA 3EURA 2GT6A 1WIKA 2CZ2A 1A23A 2X8HA 4ZB8A 1K0MA 1UN2A 1T3BA 4FYCA 1U87A 2XC2A 4D73B 2DIYA 5D9VA 3VWXA 5G2ZA 1B8XA 3C8EA 3S9FA 1TI1A 3FY7A 1ERWA 1F6MC 2OE0A 4JBBA 1F37A 3GNJA 1V2AA 3G7IA 1UVZA 3IC4A 4WKWA 3GMFA 1ILOA 3GH6A 4LL1B 5FWGA 1SYXA 3ZLPA 1XOAA 2G2QA 3TUEA 1EP7A 3QPMA 4ZB6A 4GF0A 4QL7A 4KNDA 5IMVA 4ISDA 2HRNA 2O8VB 1NM3A 3CTGA 4X0XA 2V41A 1PN9A 5IMDA 2LV3A 3H79A 2O85A 1NSWA 2PVQA 4ZBAA 3F6DA 4ILFA 3EU3A 2O89A 3WGEA 3ZYWA 2F3MA 4K0NA 3DWVA 5IMZA 1Q98A 6GSSA 1E6BA 2MYGA 4GSSA 1YJ6A 5A4VA 1TU7A 4WETA 2MMNA 3UMAA 4MABA 1CQGA 1F2EA 3KIJA 3KM6A 5H5RA 2WDUA 2YCDA 3GSSA 4OO5A 1BYEA 4I97A 4GQFA 4WBRD 3G7YA 5CNWA 1THXA 5G30A 3A2VA 1XIYA 4LA1A 5IPGA 2GSRA 3HDCA 3L9VA 5IMAA 1EP8A 1FVKA 3IXRA 1XCCA 1BG5A 3TJGA 3F3QA 4LMWA 3GA4A 4IELA 1A2LA 1ERVA 4TR0A 2QSIA 2DBCA 2DMMA 1U3AA 2VCTA 5AIXA 1Z7PA 5ECIB 5D96A 3EC3A 3QDNA 3ZZXA 1ZZYA 2MBTA 3JCML 1A0FA 2JSZA 3KH9A 2VIMA 3D4TA 5C00A 2E2GA 2IL3A 1AAZA 3WT2A 3A5WA 1B4PA 2WULA 2XHFA 4EO3A 1MDIA 4GCIA 3A2WA 3J7Yb 2K9FA 2B5EA 4TR4A 6GSWA 1EGRA 3F4SA 2JZSA 4KUNA 4AJ6A 3WGDA 3HZ4A 1OC9B 3L9UA 5ECPB 3C1SA 1TDIA 1B4QA 5J4UA 3ZIJA 2R2JA 4KCEA 4RUVA 2AUVA 3O76A 3AY8A 4L0WA 1TJDA 1WPIA 3O6TA 1GUMA 4KDXA 4E8EA 3ZITA 2HE3A 5JWOB 3DVWA 4KB3A 2JL4A 1K0BA 2L4QA 1PRXA 2VL2A 4GTUA 2FLSA 1AUCA 5DVBA 3DMLA 4MP4A 4XIHA 1GSQA 2YV7A 1OC8A 4MZCA 3FRCA 4TVEA 4HOJA 1A8LA 2H8LA 4KH7A 4JU5A 4O92A 6GSXA 4NPBA 2FHEA 1XWCA 2H70A 2I9HA 3H8QA 3CSHA 5D9XA 6GSYA 1J0FA 1HD2A 3TKSC 5DALA 4MJBA 1YKCA 2F8FA 1FAAA 4BL7A 4HI7A 4QQ7A 6GSVA 2OKAA 4GSNA 2VD1A 3UEMA 2EIRA 1RK4A 4JZQA 4V2LA 4K2DA 5AGYA 3U6VA 4OFMA 3KP8A 3E3EA 4MH3A 3KP9A 17GSA 4X1UA 5CRHA 3DKSA 1ACVA 3BD2A 4KE3A 1SKRB 1GULA 2K18A 1LJRA 2H71A 1YKAA 1SL1B 4KX4A 1Z3EA 1QGVA 1LU4A 4WR4A 5F07A 2MZCA 2F9SA 2PU9C 1ZCPA 3LJRA 5IO2A 5INYA 5AIVA 1GTIA 5B8BA 1T4YA 8GSSA 1YY7A 5L71A 4PNFA 3QD9A 5LCZA 2CAQA 4K6XA 3FZAA 3APQA 2IMDA 2XBQA 5JWRB 2IFQB 2C0GA 2FA4A 1TRSA 3SBCA 1T7PB 3ERFA 3WD6A 3MNGA 3TRXA 3C73A 2VD0A 6GSUA 3TGZA 3GX8A 3F3RA 5GAND 5IM9A 4KSMA 3QFBC 3ME7A 1AQVA 4KCAA 1SJ6A 3FW2A 2R3XA 1AC1A 1JLVA 5IMCA 1HYUA 4ECIA 4QL9A 3CMIA 3TKSE 1K3LA 3P90A 2LUSA 3FR6A 5F0GA 3M9JA 4K0GA 13GSA 2H01A 3N9JA 3ZMKA 4TXOB 5B7CA 1Z9HA 3TB2A 5JCWA 4GWRA 3D5JA 2QKEA 2CX4A 2L5OA 1GNWA 1QQ2A 1O8WA 3UVHA 2H1BA 3DD3A 2LNSA 4K7IA 5H5QA 1GLPA 3IK9A 5F06A 2DIZA 3A2XA 3F6FA 4HDEA 1K0DA 1ERUA 3VLNA 2JU5A 3E0UA 1TXXA 1O8XA 4ZB9A 5JWQB 4GXZA 2OACA 5J3RA 1QUWA 3LXTA 4MZWA 2H19A 1C72A 2GSSA 3LXZA 5F8BA 3CRTA 4NHWA 2OE1A 3TCOA 4CHSA 1K3YA 3GFKA 3FYGA 4BA7A 3H4KA 4I8BA 2VO4A 1ST9A 2FWHA 5ID2A 2LTKA 2CV4A 1WOUA 3HY2A 3QCPA 2GS3A 4MLYA 1S3CA 4BVYA 2RLIA 10GSA 2YZHA 4N30A 3MAKA 3CTFA 5COHA 3G7JA 5ECMB 3PGTA 2R6KA 1BEDA 3KEBA 4EVMA 1SU9A 1XWAA 1SL0B 3J7Yk 2WCIA 1N8JA 2V6KA 3LORA 4KGIA 4JR6A 4TXVA 4N11A 1X9SB 3I9V2 1M99A 5DAKB 4D73A 4TR3A 1GL8A 4Q5FA 1SK1A 2IMKA 4G10A 3FR3A 5ELAA 2HFDA 4WF4A 1JLWA 4TRXA 3VWVA 5J9CA 2K8VA 3DRNA 4V2MA 5IQYA 1TK5B 2OBKA 3Q19A 4EL1A 2H1GA 2X99A 4EKZA 2H6YA 5CRWA 1VF1A 4AJ7A 4L5OA 4I6XA 1M9BA 4K8MA 3IE3A 3PR8A 2H0GA 1DE2A 2R5GA 3FHKA 3VI5A 1VRSD 4HU9A 3KD0A 1QMVA 2I3YA 3VFIA 2FGXA 2C0DA 2TIRA 4ZBBA 1ABAA 3APOA 1PX7A 3BCIA 3VK9A 2VCXA 2C0FA 2ZUPA 3LFLA 2WJUA 4G19A 3DEXA 4XS4A 3TKQA 4ZL7A 1SYRA 4GQCA 4IKHA 4O7HA 3DYRA 3L9SA 2H6XA 1V40A 1K0OA 1ZMAA 1R5PA 2XBIA 2PWJA 3ERGA 2H75A 3KMNA 3TKSA 22GSA 3TKPA 5LNKe 2NDOA 4IQ1A 1I5GA 5ECQB 4WR5A 4HZ2A 2PPTA 2B5XA 3Q74A 1AXDA 1QK8A 3W8JA 2YZUA 1KTEA 1FOVA 3M9KA 1KBNA 1GSUA 3CSJA 2OADA 4EDYA 2HZEB 1PMTA 3D4MA 2V1MA 3ZFBA 3KJYA 3IA1A 2ZCTA 3TOUA 3FZ4A 4XRAA 2IMFA 1GUKA 1ERTA 4NHZA 2C3NA 4XCSA 3ERWA 1XVQA 2C80A 1USBA 2WFCA 5HR3A 4NMUA 3EMXA 1XOBA 2BJXA 4K7NA 4BWQA 3G9BA 2GQMA 3WGXA 2HT9A 1NHOA 2CT6A 5GSSA 2E7PA 2LQOA 2C4JA 5ECOB 3P8WA 1DE1A 3UARA 1OC9A 2VAFA 1NW2A 2PGTA 4CDOA 2HXKA 2IMEA 5GAPD 4ML6A 1A8YA 2PMTA 3U5RE 1XW5A 4GLTA 1FO5A 5G1LA 5D9TA 3ZMLA 2GQKA 2VUPA 3QMXA 4HEA2 2AV4A 1TOFA 4IBPA 3GUSA 4YH2A 3TRQA 4EXJA 2NPBA 2GZYA 2IN3A 1DBYA 1GSFA 3C1RA 4O32A 4MMMA 1T00A 1ZYEA 2DJ2A 2L6DA 4MPFA 5AISA 2B7KA 4RQXA 2IPAA 1RW1A 2R37A 2HRFA 2H1AA 1KEBA 1I9DA 2LNTA 2LRNA 2L57A 4XS1A 4MF5A 2FA8A 3F63A 1PKZA 1IYHA 2WRTA 3UJ1A 4IVFA 1QFNA 4RQRA 5DQSA 5AN1A 1X0RA 3M3MA 3GTUB 3LEFA 2GVPA 5G1KA 4L0UA 4OFNA 2YNXA 3BCKA 2XPEA 2WZ9A 3UBLA 1Z5YE 2MBSA 3GRXA 4OFTA 1AW9A 4ID0A 2YJHA 3HYPA 4YAVA 4XRDA 1W89A 4ZIJA 1XFLA 1GTBA 5ELGA 1JHBA 3GV1A 3GH9A 3EVIA 3P2AA 2OJLA 2H30A 5HFGA 2LJAA 3HJOA 5D9WA 5KN2A 3IHQA 3WT1A 4Q5QA 3IK7A 3KGKA 4IJIA 4KSOA 4Q5NA 1O85A 1K0NA 3EE2A 3QAVA 2XPDA 4ACSA 1YZXA 4YQVA 3VPTA 1FB0A 2E2MA 2KP2A 1M9AA 1AQXA 2H74A 3DIEA 3CXGA 3CBUA 4OCFA 5ECSA 2GZPA 1K0AA 4MZBA 3FZ9A 1BJXA 1OE7A 4N10A 2LQQA 3D0ZA 1WE0A 5IPHA 1SK2A 2IFQA 2I4AA 3BOAA 1Z7RA 2B1LA 3N5OA 2VCZA 1XW9A 3C7MA 3M0FA 3HKRA 4BPYA 1GLQA 3HVXA 2B1KA 3W8SA 1XW6A 1A24A 1U3IA 4IN0A 5G5EA 2L5LA 3GN3A 1Y25A 3GKKA 4PUAA 5F05A 3VURA 2FNOA 4K1FA 4JR4A 3WYWA 3EWLA 5B6MA 3GIXA 2CA8A 4IJ3A 4LMVA 2JZTA 2YWMA 3QR6A 1GSSA 3LGCA 3L0HA 2RUFA 2QC7A 3HJMA 2C0EA 4TXOA 1OC3A 3IOSA 2YV9A 1ZYQB 3CRUA 2LS5A 4YQMA 1OYJA 2GSQA 3D6IA 4ZXGA 2MMZA 2OBIA 3ED3A 2HZFA 3NOFA 3E9JB 3GKMA 1GH2A 2NVLA 3GHAA 1SJIA 2IWTA 4BWSA 1PX6A 1HNAA 1OKTA 5DQYA 3I6AA 3GKXA 1B9XC 2CZ3A 1ZOFA 3F8UA 4G9HA 4NV2A 4ZBDA 2PERA 1MDKA 2B5YA 3PINA 4JRRA 1O6JA 1XPVA 5DJMA 3NIVA 2EIQA 4TN8A 3ZVJA 3RPNA 1K0CA 2NBSA 4E8HA 4HS1A 1N2AA 2MMAA 3RHCA 4IW9A 5FT3A 4ULXA 4MF6A 4PGTA 3R2QA 4POKA 5HR0A 1TRWA
chains in the Genus database with same CATH superfamily
1VF3A 2G0FA 3MWHA 2Z9SA 2O87A 2LJRA 1M7TA 2LKUA 1CQHA 3IR4A 2HSYA 1XWKA 5FHIA 1FHEA 2KOKA 1HNCA 3I43A 2C1YA 5E59A 1SL2B 3Q6OA 3FMWA 2QGVA 2DC5A 1XWGA 2DSAA 5DAKA 1X5EA 1TRUA 4KAEA 3RPPA 5IOXA 4OD7A 2C3TA 4PNGA 3LG6A 4MNNA 2A2SA 1J9BA 4KA0A 4F9ZA 1RQMA 4OO4A 1B48A 5KN0A 5EL8A 9GSSA 1GSYA 3LQ7A 5ECLB 2E0QA 5J41A 1MTCA 1G6WA 3HD5A 3EINA 1YQ1A 1HNBA 5HFKA 4V1Ap 2EC4A 2VLTA 3DVXA 2H72A 4L8EA 5ECKB 2FY6A 1BAYA 4MK3A 4FO5A 4GSTA 5HQPA 2B3SA 4PQHA 4I2TA 1IYIA 1GTUA 3LSZA 2KHPA 4YKGA 5H5SA 1Z6NA 3IV4A 1OE8A 1MEKA 1A0RP 4TW5A 5KEJA 2L4CA 3RBTA 1UA5A 1E2YA 3IPZA 3EYTA 4DSSB 2WGRA 2F8AA 2M46A 1H75A 2BTOT 1R26A 1X5CA 4JE1A 3D21A 4NWYA 1SD8A 2HYXA 4NAXA 4K9ZA 2X8CA 3ZREA 2X64A 4HQSA 2HZEA 2ZNMA 1S3AA 3KZQA 5DJLA 3LYPA 1YF0A 2C8UA 4J57E 1V9WA 1ZYPA 3TJFA 5IOWA 3W6GA 1PD21 3MSZA 1FVJA 3ZRDA 2J23A 2FWEA 2VL9A 2O7KA 4BVXA 4ECBA 4XTSA 2LEGA 4Z2UA 1F9MA 4YAPA 2WS2A 3QFAC 3I69A 2H0HA 2HSHA 2H0IA 1PGTA 4YQUA 1G7OA 1TK0B 2TRXA 2CQ9A 2RM5A 1A2JA 1JZRA 2B6MA 2RM6A 4FQUA 3H1NA 4TOPA 5DCGA 2VM1A 3HVVA 2H1DA 3L78A 2X8GA 1JZOA 1V58A 3RHBA 2IJYA 1EV9A 1F3BA 2PVOC 4K5RA 4WBJA 2ON5A 2I81A 1URMA 5ECNB 2V32A 5DBQA 5IMFA 2P31A 2CVKA 4MF7A 1DSBA 3V1WA 1VGLA 4J56E 2FCHA 1JZWA 3MDKA 2CX3A 2REMA 4MH2A 3KTLA 5DCHA 4F03A 2IMIA 1EV4A 2BMXA 4G2EA 4V2NA 3HJPA 18GSA 3FEUA 1Y6EA 1EOHA 1O7UA 1YEXA 4PXOA 4MDCA 4TR1B 2FUG2 1G7EA 1AIUA 3O3TA 4FH8A 1FB6A 2YWIA 2A2RA 3IC8A 3GX0A 5ECRB 1PL1A 1Z6MA 1JFUA 4OCEA 1K3OA 3GTUA 3F4RA 1EGOA 3LYKA 4KDUA 1DUGA 3Q18A 3TOTA 5IIZA 3A5IA 4POMA 4EE0A 4KW6A 2R0GA 1B9YC 5A4WA 4XS4B 3ZIVA 4EC0A 1ON4A 5KOXA 6GSTA 3H93A 4HSCX 4POLA 1U6TA 4OMVA 4ZL8A 3VI7A 4RI6A 3GYKA 4XS6A 4MA9A 2KLXA 1LBKA 1MD4A 3LW9A 2LRTA 4LL4B 1WJKA 5GZZB 1OAZA 1V57A 2GTUA 3TRPA 2HNLA 2ES7A 4L5LA 4IHUA 5CP1A 2VOCA 4PQIA 2P5QA 1MD3A 4HJ2A 4PQ1A 4GRFA 4A5PA 3GL5A 1FW1A 2IIYA 4G0KA 2GQLA 3UVTA 1SKSB 2FWGA 4V1Ag 1J08A 2QA2A 2L6CA 2P5RA 1TRVA 1WWJA 1R5AA 4HJMA 1PKWA 2ALBA 1GTAA 1M2BA 5D73A 3RDWA 1ZL9A 2H66A 2YWOA 2I1UA 4OWYA 3QOUA 4H86A 3ZFLA 2VCVA 3M1GA 4ML1A 1M2DA 2CAIA 1NHYA 2H73A 3HVSA 4IQAA 3TJJA 1MDJA 1T1VA 5ENUA 5DDLA 1BQ7A 3IAS2 3LWAA 2B7JA 1TTZA 1TI3A 2V2GA 2VLVA 3EMPA 5E4WA 5KN1A 3IRAA 2AHEA 4POBA 3GKNA 1AQWA 4DSQA 1PL2A 3CSIA 4EDZA 3UIWA 5G5FA 3FZ5A 4KDYA 4DEJA 2YJ7A 4N0VA 3QAGA 5B6NA 1SENA 4EIPA 4DSRA 1G6YA 2JACA 4NXIA 2D2ZA 4I2UA 2J9HA 2K8SA 5CYYA 3GURA 1T8EB 4NV5A 1TK8B 2VLUA 4O5QA 3SWLA 2FWFA 2M80A 1WP0A 5HR1A 2GLRA 1EWXA 1SD9A 1GUHA 2YANA 3APSA 4WXTA 2PUKC 2JADA 1PA3A 3ZVJD 4PX1A 1XXUA 2L59A 3GSTA 4IGJA 3OR5A 4DVCA 4EF0A 1BX9A 1A2MA 1GSEA 4F0CA 3KCMA 1EZKA 5GSTA 3ZL5A 3ZTLA 1V98A 2ON7A 4AF2A 4TKYA 2OA7A 5EY6A 3PH9A 3EU4A 2QA1A 2VCQA 4ZL9A 1TW9A 1Q4JA 4RI7A 3IDVA 4IP6A 2EIOA 3TJKA 5C04A 1TKDB 2GGTA 20GSA 3NZNA 3US3A 3ISOA 1R4WA 2LSTA 3HHVA 4HZ4A 4PURA 1W4VA 3FKFA 4PUFC 2CVBA 3HZ8A 1ZGNA 2AJQB 2MMOA 2FD3A 1EEMA 3ME8A 3BBYA 3MYDA 3BJ5A 1THOA 3GL3A 1SKWB 1M0UA 2OE3A 2DLXA 5D93A 5CAXA 3K8NA 5EPFA 3DXBA 2YPMA 2LJKA 2V6OA 1YEPA 2DJ0A 3RAZA 4WF5A 2YOIA 3D22A 2RUEA 2N5AA 4USSA 1ML6A 3TJBA 4FYUA 4FYBA 4F0BA 5DALB 11GSA 1GP1A 2A4VA 1EEJA 4MJEA 1FG4A 16GSA 1ZYNA 3A3TA 2N5BA 1O73A 4BL7B 4Z2RA 1GWCA 4J2FA 4LLRA 2DJ1A 3FK8A 3CYNA 1YF1A 2AAWA 4CW9A 4DSSA 3UBKA 3HA9A 3UOMA 1M2AA 4N0ZA 3F4TA 1QXHA 14GSA 3KMOA 1T4ZA 4O5RA 4EUYA 4I5QA 5J5NA 4Z7XA 4MCUA 1GNEA 1KNGA 1UC7A 1TP9A 3VWWA 2PBJA 4ECJA 1SK0A 2PN8A 2JZRA 1EOGA 4F82A 1YDKA 2DJJA 3DGQA 1XBSA 4Q5RA 5CREA 5HR2A 1X9WB 1S3DA 3HXSA 5G31A 2KUCA 4YKFA 4F2IA 2DJKA 2F51A 3UL3A 4FIWA 3HCZA 5EVOA 3VPQA 2AYTA 5JCUA 3L4NA 1TU8A 1VF2A 5D8IA 2HI7A 4MJAA 4JEDA 1VF4A 2GDRA 1WRYA 1PSQA 1X5DA 1JZDA 5ABRA 1XVWA 1HQOA 2LRCA 1GRXA 2YWNA 3P7XA 4ECCA 3C71A 4XHMA 2RIIA 1O81A 5CRGA 2HLSA 1PQNA 4AGSA 4PTSA 5JCGA 1H4OA 2GZZA 2YN1A 2VL2C 3KTBA 2AB6A 1M3IA 2KP1A 5LD0A 4ZILA 3TKRA 2YP6A 1OVNA 2NTOA 1GSDA 12GSA 2DJ3A 5CO3A 3VWUA 3M8NA 2WB9A 7GSSA 5HFIA 4MPGA 2M72A 1F3AA 5ECHB 2VM2A 5J9BA 3KH7A 1R7HA 3IBHA 4AJ8A 4MJCA 3F0IA 5B8AA 2R4VA 2JSYA 1G0TA 3F9UA 2H76A 4TR1A 3QAWA 4HQZA 2DMLA 1SJZA 2VCWA 3UAPA 2HRAA 2CVDA 4WEYA 1XWBA 2GT5A 3PPUA 5IO0A 4K7OA 4HUAA 2TRCP 2C3QA 5A4UA 2K6VA 2H6ZA 1X9MB 4HU7A 5A5KA 1PFOA 1U88A 4P3YB 2P0GA 5ID2B 2VL3A 3FR9A 4IP1A 4X43A 3TDGA 5CRDA 1WMJA 5KN3A 19GSA 3IAM2 4IS0A 2GSTA 4BVYB 2N5FA 1OKDA 3KXOA 1XZOA 3EURA 2GT6A 5KOWA 1WIKA 2CZ2A 1A23A 2X8HA 4ZB8A 1K0MA 1UN2A 1T3BA 4FYCA 1U87A 2XC2A 4D73B 2DIYA 5D9VA 3VWXA 5G2ZA 1B8XA 3C8EA 3S9FA 1TI1A 3FY7A 1ERWA 1F6MC 2OE0A 4JBBA 1F37A 3GNJA 1V2AA 3G7IA 1UVZA 3IC4A 4WKWA 1XG8A 3GMFA 1ILOA 3GH6A 4LL1B 5FWGA 1SYXA 3ZLPA 1XOAA 2G2QA 3TUEA 1EP7A 3QPMA 4ZB6A 4GF0A 4QL7A 4KNDA 5IMVA 4ISDA 2HRNA 2O8VB 1NM3A 3CTGA 4X0XA 2V41A 1PN9A 5IMDA 4X4JA 2LV3A 3H79A 2O85A 1NSWA 2PVQA 4ZBAA 3F6DA 4ILFA 3EU3A 2O89A 3WGEA 3ZYWA 2F3MA 4K0NA 3DWVA 5IMZA 1Q98A 6GSSA 1E6BA 2MYGA 4GSSA 1YJ6A 5A4VA 1TU7A 4WETA 2MMNA 3UMAA 4MABA 1CQGA 1F2EA 3KIJA 3KM6A 5H5RA 2WDUA 2YCDA 3GSSA 4OO5A 1BYEA 4I97A 4GQFA 4WBRD 3G7YA 5CNWA 1THXA 5G30A 3A2VA 1XIYA 4LA1A 5IPGA 2GSRA 3HDCA 3L9VA 3R3EA 5IMAA 1EP8A 1FVKA 3IXRA 1XCCA 1BG5A 2A2PA 3TJGA 3F3QA 4LMWA 3GA4A 4IELA 1A2LA 1ERVA 4TR0A 4O5UA 2QSIA 2DBCA 2DMMA 1U3AA 2VCTA 5AIXA 1Z7PA 5ECIB 5D96A 3EC3A 3QDNA 3ZZXA 3MIXA 1ZZYA 2MBTA 3JCML 1A0FA 2JSZA 3KH9A 2VIMA 3D4TA 5C00A 2E2GA 2IL3A 5BRTA 1AAZA 3WT2A 3A5WA 1B4PA 2WULA 2XHFA 4EO3A 1MDIA 4GCIA 3A2WA 3J7Yb 2K9FA 2B5EA 4TR4A 6GSWA 1EGRA 5BMUA 3F4SA 4KF9A 2JZSA 4KUNA 4AJ6A 3WGDA 3HZ4A 1OC9B 3L9UA 5ECPB 4EIQA 3C1SA 1TDIA 1B4QA 5J4UA 3ZIJA 2R2JA 4KCEA 4RUVA 2AUVA 3O76A 3AY8A 4L0WA 1TJDA 1WPIA 3O6TA 1GUMA 4KDXA 4E8EA 3ZITA 2HE3A 5JWOB 3DVWA 4KB3A 2JL4A 1K0BA 2L4QA 1PRXA 2VL2A 4GTUA 1M3JA 2FLSA 1AUCA 5DVBA 3DMLA 4MP4A 4XIHA 2R0CA 1GSQA 2YV7A 1OC8A 4MZCA 3FRCA 4TVEA 4HOJA 1A8LA 2H8LA 4KH7A 4JU5A 4O92A 6GSXA 4NPBA 2FHEA 1XWCA 2H70A 2I9HA 3H8QA 3CSHA 5D9XA 6GSYA 1J0FA 1HD2A 2X4AA 3TKSC 5DALA 4MJBA 1YKCA 2F8FA 1FAAA 2UZ8A 4BL7A 4HI7A 4QQ7A 6GSVA 2OKAA 4GSNA 2VD1A 3UEMA 2EIRA 1RK4A 4JZQA 4V2LA 4K2DA 5AGYA 3U6VA 4ICYA 4OFMA 3KP8A 3E3EA 3HVNA 4MH3A 3KP9A 17GSA 4X1UA 5CRHA 3DKSA 1ACVA 4K5SA 3BD2A 4KE3A 1SKRB 1GULA 2K18A 1LJRA 2H71A 1YKAA 1SL1B 4KX4A 1Z3EA 1QGVA 1LU4A 4WR4A 5F07A 2MZCA 2F9SA 2PU9C 1ZCPA 3LJRA 5IO2A 5INYA 5AIVA 1PN0A 1GTIA 1FOHA 5B8BA 1T4YA 8GSSA 1YY7A 5L71A 4PNFA 3QD9A 5LCZA 4CY8A 2CAQA 4K6XA 3FZAA 3APQA 2IMDA 2XBQA 5JWRB 2IFQB 2C0GA 2FA4A 1TRSA 3SBCA 1T7PB 3ERFA 3WD6A 3MNGA 3TRXA 3C73A 2VD0A 6GSUA 3TGZA 3GX8A 3F3RA 5GAND 5IM9A 4KSMA 3QFBC 3ME7A 1AQVA 4KCAA 1SJ6A 3FW2A 2R3XA 1AC1A 1JLVA 5IMCA 1HYUA 4ECIA 4QL9A 3CMIA 3TKSE 1K3LA 3P90A 2LUSA 3FR6A 5F0GA 3M9JA 4K0GA 13GSA 2H01A 3N9JA 3ZMKA 4TXOB 5B7CA 1Z9HA 3TB2A 5JCWA 4GWRA 3D5JA 2QKEA 2CX4A 2L5OA 1GNWA 1QQ2A 1O8WA 3UVHA 2H1BA 3DD3A 4BIKA 2LNSA 4K7IA 5H5QA 1GLPA 3IK9A 5F06A 2DIZA 3A2XA 3F6FA 4HDEA 1K0DA 1ERUA 3VLNA 2JU5A 3E0UA 2HRKA 1TXXA 1O8XA 4ZB9A 5JWQB 4GXZA 2OACA 2DKHA 5J3RA 1QUWA 3LXTA 4MZWA 2H19A 1C72A 2GSSA 3LXZA 5F8BA 3CRTA 4NHWA 2OE1A 3TCOA 4CHSA 1K3YA 3GFKA 3FYGA 4BA7A 3H4KA 4I8BA 2VO4A 1ST9A 2FWHA 5ID2A 2LTKA 2CV4A 4Z2TA 1WOUA 3HY2A 3QCPA 4G0LA 2GS3A 4MLYA 1S3CA 4BVYA 2RLIA 10GSA 2YZHA 4N30A 3MAKA 3CTFA 5COHA 3G7JA 5ECMB 3PGTA 2R6KA 1BEDA 3KEBA 4EVMA 1SU9A 1XWAA 1SL0B 3J7Yk 2WCIA 1N8JA 2V6KA 3LORA 4KGIA 4JR6A 4TXVA 2R0PA 4N11A 1X9SB 3I9V2 1M99A 5DAKB 4D73A 4TR3A 1GL8A 4Q5FA 1SK1A 2IMKA 4G10A 3FR3A 5ELAA 2HFDA 4WF4A 1JLWA 4TRXA 3VWVA 5J9CA 2K8VA 3DRNA 4V2MA 5IQYA 1TK5B 2OBKA 3Q19A 4EL1A 2H1GA 2X99A 4EKZA 2H6YA 5CRWA 1VF1A 4AJ7A 4L5OA 4I6XA 1M9BA 4K8MA 4CY6A 3IE3A 3PR8A 2H0GA 1DE2A 2R5GA 3FHKA 3VI5A 1VRSD 4HU9A 3KD0A 1QMVA 2I3YA 3VFIA 2FGXA 2C0DA 2TIRA 4ZBBA 1ABAA 3APOA 1PX7A 3BCIA 3VK9A 2VCXA 2C0FA 2ZUPA 3LFLA 2WJUA 4G19A 3DEXA 4XS4A 3TKQA 4ZL7A 1SYRA 4GQCA 4IKHA 4O7HA 3DYRA 3L9SA 2H6XA 1V40A 1K0OA 1ZMAA 1R5PA 2A4HA 2XBIA 2PWJA 3ERGA 2H75A 3KMNA 3TKSA 22GSA 3TKPA 5LNKe 2NDOA 4IQ1A 1I5GA 5ECQB 4WR5A 4HZ2A 2PPTA 2B5XA 3Q74A 1AXDA 1QK8A 3W8JA 2YZUA 1KTEA 1FOVA 3M9KA 1KBNA 1GSUA 3CSJA 2OADA 4EDYA 2HZEB 1PMTA 3D4MA 2V1MA 3ZFBA 3KJYA 3IA1A 2ZCTA 3TOUA 3FZ4A 4XRAA 2IMFA 1GUKA 1ERTA 4NHZA 2C3NA 4XCSA 3ERWA 1XVQA 2C80A 4BVXB 1USBA 2WFCA 5HR3A 4NMUA 3EMXA 1XOBA 2BJXA 4K7NA 3EPTA 4BWQA 3G9BA 2GQMA 3WGXA 2HT9A 1NHOA 2CT6A 5GSSA 2E7PA 2LQOA 2C4JA 1S3RA 5ECOB 3P8WA 1DE1A 3UARA 1OC9A 2VAFA 1NW2A 2PGTA 4CDOA 2HXKA 2IMEA 5GAPD 4ML6A 1A8YA 2PMTA 3U5RE 1XW5A 4GLTA 1FO5A 5G1LA 5D9TA 3ZMLA 2GQKA 2HSMA 2X49A 2VUPA 3QMXA 4HEA2 2AV4A 1TOFA 4IBPA 3GUSA 4YH2A 3TRQA 4EXJA 2NPBA 2GZYA 2IN3A 1DBYA 1GSFA 3C1RA 4O32A 4MMMA 1T00A 3CQFA 1ZYEA 2DJ2A 2L6DA 4MPFA 5AISA 2B7KA 4RQXA 2IPAA 1RW1A 2R37A 2HRFA 2H1AA 1KEBA 1I9DA 2LNTA 2LRNA 2L57A 4XS1A 4MF5A 2FA8A 3F63A 1PKZA 1IYHA 2WRTA 3UJ1A 4IVFA 1QFNA 4RQRA 5DQSA 5AN1A 1X0RA 3M3MA 3GTUB 3LEFA 2GVPA 5G1KA 4L0UA 4OFNA 2YNXA 3BCKA 2XPEA 2WZ9A 3UBLA 1Z5YE 2MBSA 3GRXA 4OFTA 1AW9A 4ID0A 2YJHA 3HYPA 4YAVA 4XRDA 1W89A 4ZIJA 1XFLA 1GTBA 5ELGA 1JHBA 3GV1A 3GH9A 3EVIA 3P2AA 2OJLA 2H30A 5HFGA 2LJAA 3HJOA 5D9WA 5KN2A 3IHQA 3WT1A 4Q5QA 3IK7A 3KGKA 4IJIA 4KSOA 4Q5NA 1O85A 1K0NA 3EE2A 3QAVA 2XPDA 4ACSA 1YZXA 4YQVA 3VPTA 1FB0A 2E2MA 2KP2A 1M9AA 1AQXA 2H74A 3DIEA 3CXGA 3CBUA 4OCFA 5ECSA 2GZPA 1K0AA 2DKIA 4MZBA 3FZ9A 1BJXA 1OE7A 4N10A 2LQQA 3D0ZA 1WE0A 5IPHA 1SK2A 2IFQA 2I4AA 3BOAA 1Z7RA 2B1LA 3N5OA 2VCZA 1XW9A 3C7MA 3M0FA 3HKRA 4BPYA 1GLQA 3HVXA 2B1KA 3W8SA 1XW6A 1A24A 1U3IA 4IN0A 5G5EA 2L5LA 3GN3A 1Y25A 3GKKA 4PUAA 5F05A 3VURA 2FNOA 4K1FA 4JR4A 3WYWA 3EWLA 5B6MA 3GIXA 2CA8A 4IJ3A 4LMVA 2JZTA 2YWMA 3QR6A 1GSSA 3LGCA 3L0HA 2RUFA 2QC7A 3HJMA 2C0EA 4TXOA 1OC3A 3IOSA 2YV9A 1ZYQB 3CRUA 2LS5A 4YQMA 1OYJA 2GSQA 4G0IA 3D6IA 4ZXGA 2MMZA 2OBIA 3ED3A 2HZFA 3NOFA 3E9JB 3GKMA 1GH2A 2NVLA 3GHAA 1SJIA 2IWTA 4BWSA 1PX6A 1HNAA 1OKTA 4K2XA 5DQYA 3I6AA 3GKXA 1B9XC 2CZ3A 1ZOFA 3F8UA 4G9HA 4NV2A 4ZBDA 2PERA 1MDKA 2B5YA 3PINA 4JRRA 1O6JA 1XPVA 5DJMA 3NIVA 2EIQA 4TN8A 3ZVJA 3RPNA 1K0CA 2NBSA 4E8HA 3IHGA 4HS1A 1N2AA 2MMAA 3RHCA 4IW9A 5FT3A 4ULXA 4MF6A 4PGTA 3R2QA 4POKA 5HR0A 1TRWA
chains in the Genus database with same CATH topology
1VF3A 2G0FA 3MWHA 2Z9SA 2O87A 2LJRA 1M7TA 2LKUA 1CQHA 3IR4A 2HSYA 1XWKA 5FHIA 1FHEA 2KOKA 1HNCA 3I43A 2C1YA 5E59A 1SL2B 3Q6OA 3FMWA 2QGVA 2DC5A 1XWGA 2DSAA 5DAKA 1X5EA 1TRUA 4KAEA 3RPPA 5IOXA 4OD7A 2C3TA 4PNGA 3LG6A 4MNNA 2A2SA 1J9BA 4KA0A 4F9ZA 1RQMA 4OO4A 1B48A 5KN0A 5EL8A 9GSSA 1GSYA 3LQ7A 5ECLB 2E0QA 5J41A 1MTCA 1G6WA 3HD5A 3EINA 1YQ1A 1HNBA 5HFKA 4V1Ap 2EC4A 2VLTA 3DVXA 2H72A 4L8EA 5ECKB 2FY6A 1BAYA 4MK3A 4FO5A 4GSTA 5HQPA 2B3SA 4PQHA 4I2TA 1IYIA 1GTUA 3LSZA 2KHPA 4YKGA 5H5SA 1Z6NA 3IV4A 1OE8A 1MEKA 1A0RP 4TW5A 5KEJA 2L4CA 3RBTA 1UA5A 1E2YA 3IPZA 3EYTA 4DSSB 2WGRA 2F8AA 2M46A 1H75A 2BTOT 1R26A 1X5CA 4JE1A 3D21A 4NWYA 1SD8A 2HYXA 4NAXA 4K9ZA 2X8CA 3ZREA 2X64A 4HQSA 2HZEA 2ZNMA 1S3AA 3KZQA 5DJLA 3LYPA 1YF0A 2C8UA 4J57E 1V9WA 1ZYPA 3TJFA 5IOWA 3W6GA 1PD21 3MSZA 1FVJA 3ZRDA 2J23A 2FWEA 2VL9A 2O7KA 4BVXA 4ECBA 4XTSA 2LEGA 4Z2UA 1F9MA 4YAPA 2WS2A 3QFAC 3I69A 2H0HA 2HSHA 2H0IA 1PGTA 4YQUA 1G7OA 1TK0B 2TRXA 2CQ9A 2RM5A 1A2JA 1JZRA 2B6MA 2RM6A 4FQUA 3H1NA 4TOPA 5DCGA 2VM1A 3HVVA 2H1DA 3L78A 2X8GA 1JZOA 1V58A 3RHBA 2IJYA 1EV9A 1F3BA 2PVOC 4K5RA 4WBJA 2ON5A 2I81A 1URMA 5ECNB 2V32A 5DBQA 5IMFA 2P31A 2CVKA 4MF7A 1DSBA 3V1WA 1VGLA 4J56E 2FCHA 1JZWA 3MDKA 2CX3A 2REMA 4MH2A 3KTLA 5DCHA 4F03A 2IMIA 1EV4A 2BMXA 4G2EA 4V2NA 3HJPA 18GSA 3FEUA 1Y6EA 1EOHA 1O7UA 1YEXA 4PXOA 4MDCA 4TR1B 2FUG2 1G7EA 1AIUA 3O3TA 4FH8A 1FB6A 2YWIA 2A2RA 3IC8A 3GX0A 5ECRB 1PL1A 1Z6MA 1JFUA 4OCEA 1K3OA 3GTUA 3F4RA 1EGOA 3LYKA 4KDUA 1DUGA 3Q18A 3TOTA 5IIZA 3A5IA 4POMA 4EE0A 4KW6A 2R0GA 1B9YC 5A4WA 4XS4B 3ZIVA 4EC0A 1ON4A 5KOXA 6GSTA 3H93A 4POLA 1U6TA 4OMVA 4ZL8A 3VI7A 4RI6A 3GYKA 4XS6A 4MA9A 2KLXA 1LBKA 1MD4A 3LW9A 2LRTA 4LL4B 1WJKA 5GZZB 1OAZA 1V57A 2GTUA 3TRPA 2HNLA 2ES7A 4L5LA 4IHUA 5CP1A 2VOCA 4PQIA 2P5QA 1MD3A 4HJ2A 4PQ1A 4GRFA 4A5PA 3GL5A 1FW1A 2IIYA 4G0KA 2GQLA 3UVTA 1SKSB 2FWGA 4V1Ag 1J08A 2QA2A 2L6CA 2P5RA 1TRVA 1WWJA 1R5AA 4HJMA 1PKWA 2ALBA 1GTAA 1M2BA 5D73A 3RDWA 1ZL9A 2H66A 2YWOA 2I1UA 4OWYA 3QOUA 4H86A 3ZFLA 2VCVA 3M1GA 4ML1A 1M2DA 2CAIA 1NHYA 2H73A 3HVSA 4IQAA 3TJJA 1MDJA 1T1VA 5ENUA 5DDLA 1BQ7A 3IAS2 3LWAA 2B7JA 1TTZA 1TI3A 2V2GA 2VLVA 3EMPA 5E4WA 5KN1A 3IRAA 2AHEA 4POBA 3GKNA 1AQWA 4DSQA 1PL2A 3CSIA 4EDZA 3UIWA 5G5FA 3FZ5A 4KDYA 4DEJA 2YJ7A 4N0VA 3QAGA 5B6NA 1SENA 4EIPA 4DSRA 1G6YA 2JACA 4NXIA 2D2ZA 4I2UA 2J9HA 2K8SA 5CYYA 3GURA 1T8EB 4NV5A 1TK8B 2VLUA 4O5QA 3SWLA 2FWFA 2M80A 1WP0A 5HR1A 2GLRA 1EWXA 1SD9A 1GUHA 2YANA 3APSA 4WXTA 2PUKC 2JADA 1PA3A 3ZVJD 4PX1A 1XXUA 2L59A 3GSTA 4IGJA 3OR5A 4DVCA 4EF0A 1BX9A 1A2MA 1GSEA 4F0CA 3KCMA 1EZKA 5GSTA 3ZL5A 3ZTLA 1V98A 2ON7A 4AF2A 4TKYA 2OA7A 5EY6A 3PH9A 3EU4A 2QA1A 2VCQA 4ZL9A 1TW9A 1Q4JA 4RI7A 3IDVA 4IP6A 2EIOA 3TJKA 5C04A 1TKDB 2GGTA 20GSA 3NZNA 3US3A 3ISOA 1R4WA 2LSTA 3HHVA 4HZ4A 4PURA 1W4VA 3FKFA 4PUFC 2CVBA 3HZ8A 1ZGNA 2AJQB 2MMOA 2FD3A 1EEMA 3ME8A 3BBYA 3MYDA 3BJ5A 1THOA 3GL3A 1SKWB 1M0UA 2OE3A 2DLXA 5D93A 5CAXA 3K8NA 5EPFA 3DXBA 2YPMA 2LJKA 2V6OA 1YEPA 2DJ0A 3RAZA 4WF5A 2YOIA 3D22A 2RUEA 2N5AA 4USSA 1ML6A 3TJBA 4FYUA 4FYBA 4F0BA 5DALB 11GSA 1GP1A 2A4VA 1EEJA 4MJEA 1FG4A 16GSA 1ZYNA 3A3TA 2N5BA 1O73A 4BL7B 4Z2RA 1GWCA 4J2FA 4LLRA 2DJ1A 3FK8A 3CYNA 1YF1A 2AAWA 4CW9A 4DSSA 3UBKA 3HA9A 3UOMA 1M2AA 4N0ZA 3F4TA 1QXHA 14GSA 3KMOA 1T4ZA 4O5RA 4EUYA 4I5QA 5J5NA 4Z7XA 4MCUA 1GNEA 1KNGA 1UC7A 1TP9A 3VWWA 2PBJA 4ECJA 1SK0A 2PN8A 2JZRA 1EOGA 4F82A 1YDKA 2DJJA 3DGQA 1XBSA 4Q5RA 5CREA 5HR2A 1X9WB 1S3DA 3HXSA 5G31A 2KUCA 4YKFA 4F2IA 2DJKA 2F51A 3UL3A 4FIWA 3HCZA 5EVOA 3VPQA 2AYTA 5JCUA 3L4NA 1TU8A 1VF2A 5D8IA 2HI7A 4MJAA 4JEDA 1VF4A 2GDRA 1WRYA 1PSQA 1X5DA 1JZDA 5ABRA 1XVWA 1HQOA 2LRCA 1GRXA 2YWNA 3P7XA 4ECCA 3C71A 4XHMA 2RIIA 1O81A 5CRGA 2HLSA 1PQNA 4AGSA 4PTSA 5JCGA 1H4OA 2GZZA 2YN1A 2VL2C 3KTBA 2AB6A 2KP1A 5LD0A 4ZILA 3TKRA 2YP6A 1OVNA 2NTOA 1GSDA 12GSA 2DJ3A 5CO3A 3VWUA 3M8NA 2WB9A 7GSSA 5HFIA 4MPGA 2M72A 1F3AA 5ECHB 2VM2A 5J9BA 3KH7A 1R7HA 3IBHA 4AJ8A 4MJCA 3F0IA 5B8AA 2R4VA 2JSYA 1G0TA 3F9UA 2H76A 4TR1A 3QAWA 4HQZA 2DMLA 1SJZA 2VCWA 3UAPA 2HRAA 2CVDA 4WEYA 1XWBA 2GT5A 3PPUA 5IO0A 4K7OA 4HUAA 2TRCP 2C3QA 5A4UA 2K6VA 2H6ZA 1X9MB 4HU7A 5A5KA 1U88A 4P3YB 2P0GA 5ID2B 2VL3A 3FR9A 4IP1A 4X43A 3TDGA 5CRDA 1WMJA 5KN3A 19GSA 3IAM2 4IS0A 2GSTA 4BVYB 2N5FA 1OKDA 3KXOA 1XZOA 3EURA 2GT6A 5KOWA 1WIKA 2CZ2A 1A23A 2X8HA 4ZB8A 1K0MA 1UN2A 1T3BA 4FYCA 1U87A 2XC2A 4D73B 2DIYA 5D9VA 3VWXA 5G2ZA 1B8XA 3C8EA 3S9FA 1TI1A 3FY7A 1ERWA 1F6MC 2OE0A 4JBBA 1F37A 3GNJA 1V2AA 3G7IA 1UVZA 3IC4A 4WKWA 3GMFA 1ILOA 3GH6A 4LL1B 5FWGA 1SYXA 3ZLPA 1XOAA 2G2QA 3TUEA 1EP7A 3QPMA 4ZB6A 4GF0A 4QL7A 4KNDA 5IMVA 4ISDA 2HRNA 2O8VB 1NM3A 3CTGA 4X0XA 2V41A 1PN9A 5IMDA 4X4JA 2LV3A 3H79A 2O85A 1NSWA 2PVQA 4ZBAA 3F6DA 4ILFA 3EU3A 2O89A 3WGEA 3ZYWA 2F3MA 4K0NA 3DWVA 5IMZA 1Q98A 6GSSA 1E6BA 2MYGA 4GSSA 1YJ6A 5A4VA 1TU7A 4WETA 2MMNA 3UMAA 4MABA 1CQGA 1F2EA 3KIJA 3KM6A 5H5RA 2WDUA 2YCDA 3GSSA 4OO5A 1BYEA 4I97A 4GQFA 4WBRD 3G7YA 5CNWA 1THXA 5G30A 3A2VA 1XIYA 4LA1A 5IPGA 2GSRA 3HDCA 3L9VA 3R3EA 5IMAA 1EP8A 1FVKA 3IXRA 1XCCA 1BG5A 2A2PA 3TJGA 3F3QA 4LMWA 3GA4A 4IELA 1A2LA 1ERVA 4TR0A 4O5UA 2QSIA 2DBCA 2DMMA 1U3AA 2VCTA 5AIXA 1Z7PA 5ECIB 5D96A 3EC3A 3QDNA 3ZZXA 3MIXA 1ZZYA 2MBTA 3JCML 1A0FA 2JSZA 3KH9A 2VIMA 3D4TA 5C00A 2E2GA 2IL3A 5BRTA 1AAZA 3WT2A 3A5WA 1B4PA 2WULA 2XHFA 4EO3A 1MDIA 4GCIA 3A2WA 3J7Yb 2K9FA 2B5EA 4TR4A 6GSWA 1EGRA 5BMUA 3F4SA 4KF9A 2JZSA 4KUNA 4AJ6A 3WGDA 3HZ4A 1OC9B 3L9UA 5ECPB 4EIQA 3C1SA 1TDIA 1B4QA 5J4UA 3ZIJA 2R2JA 4KCEA 4RUVA 2AUVA 3O76A 3AY8A 4L0WA 1TJDA 1WPIA 3O6TA 1GUMA 4KDXA 4E8EA 3ZITA 2HE3A 5JWOB 3DVWA 4KB3A 2JL4A 1K0BA 2L4QA 1PRXA 2VL2A 4GTUA 2FLSA 1AUCA 5DVBA 3DMLA 4MP4A 4XIHA 2R0CA 1GSQA 2YV7A 1OC8A 4MZCA 3FRCA 4TVEA 4HOJA 1A8LA 2H8LA 4KH7A 4JU5A 4O92A 6GSXA 4NPBA 2FHEA 1XWCA 2H70A 2I9HA 3H8QA 3CSHA 5D9XA 6GSYA 1J0FA 1HD2A 2X4AA 3TKSC 5DALA 4MJBA 1YKCA 2F8FA 1FAAA 2UZ8A 4BL7A 4HI7A 4QQ7A 6GSVA 2OKAA 4GSNA 2VD1A 3UEMA 2EIRA 1RK4A 4JZQA 4V2LA 4K2DA 5AGYA 3U6VA 4ICYA 4OFMA 3KP8A 3E3EA 4MH3A 3KP9A 17GSA 4X1UA 5CRHA 3DKSA 1ACVA 4K5SA 3BD2A 4KE3A 1SKRB 1GULA 2K18A 1LJRA 2H71A 1YKAA 1SL1B 4KX4A 1Z3EA 1QGVA 1LU4A 4WR4A 5F07A 2MZCA 2F9SA 2PU9C 1ZCPA 3LJRA 5IO2A 5INYA 5AIVA 1PN0A 1GTIA 1FOHA 5B8BA 1T4YA 8GSSA 1YY7A 5L71A 4PNFA 3QD9A 5LCZA 4CY8A 2CAQA 4K6XA 3FZAA 3APQA 2IMDA 2XBQA 5JWRB 2IFQB 2C0GA 2FA4A 1TRSA 3SBCA 1T7PB 3ERFA 3WD6A 3MNGA 3TRXA 3C73A 2VD0A 6GSUA 3TGZA 3GX8A 3F3RA 5GAND 5IM9A 4KSMA 3QFBC 3ME7A 1AQVA 4KCAA 1SJ6A 3FW2A 2R3XA 1AC1A 1JLVA 5IMCA 1HYUA 4ECIA 4QL9A 3CMIA 3TKSE 1K3LA 3P90A 2LUSA 3FR6A 5F0GA 3M9JA 4K0GA 13GSA 2H01A 3N9JA 3ZMKA 4TXOB 5B7CA 1Z9HA 3TB2A 5JCWA 4GWRA 3D5JA 2QKEA 2CX4A 2L5OA 1GNWA 1QQ2A 1O8WA 3UVHA 2H1BA 3DD3A 2LNSA 4K7IA 5H5QA 1GLPA 3IK9A 5F06A 2DIZA 3A2XA 3F6FA 4HDEA 1K0DA 1ERUA 3VLNA 2JU5A 3E0UA 2HRKA 1TXXA 1O8XA 4ZB9A 5JWQB 4GXZA 2OACA 2DKHA 5J3RA 1QUWA 3LXTA 4MZWA 2H19A 1C72A 2GSSA 3LXZA 5F8BA 3CRTA 4NHWA 2OE1A 3TCOA 4CHSA 1K3YA 3GFKA 3FYGA 4BA7A 3H4KA 4I8BA 2VO4A 1ST9A 2FWHA 5ID2A 2LTKA 2CV4A 4Z2TA 1WOUA 3HY2A 3QCPA 4G0LA 2GS3A 4MLYA 1S3CA 4BVYA 2RLIA 10GSA 2YZHA 4N30A 3MAKA 3CTFA 5COHA 3G7JA 5ECMB 3PGTA 2R6KA 1BEDA 3KEBA 4EVMA 1SU9A 1XWAA 1SL0B 3J7Yk 2WCIA 1N8JA 2V6KA 3LORA 4KGIA 4JR6A 4TXVA 2R0PA 4N11A 1X9SB 3I9V2 1M99A 5DAKB 4D73A 4TR3A 1GL8A 4Q5FA 1SK1A 2IMKA 4G10A 3FR3A 5ELAA 2HFDA 4WF4A 1JLWA 4TRXA 3VWVA 5J9CA 2K8VA 3DRNA 4V2MA 5IQYA 1TK5B 2OBKA 3Q19A 4EL1A 2H1GA 2X99A 4EKZA 2H6YA 5CRWA 1VF1A 4AJ7A 4L5OA 4I6XA 1M9BA 4K8MA 4CY6A 3IE3A 3PR8A 2H0GA 1DE2A 2R5GA 3FHKA 3VI5A 1VRSD 4HU9A 3KD0A 1QMVA 2I3YA 3VFIA 2FGXA 2C0DA 2TIRA 4ZBBA 1ABAA 3APOA 1PX7A 3BCIA 3VK9A 2VCXA 2C0FA 2ZUPA 3LFLA 2WJUA 4G19A 3DEXA 4XS4A 3TKQA 4ZL7A 1SYRA 4GQCA 4IKHA 4O7HA 3DYRA 3L9SA 2H6XA 1V40A 1K0OA 1ZMAA 1R5PA 2A4HA 2XBIA 2PWJA 3ERGA 2H75A 3KMNA 3TKSA 22GSA 3TKPA 5LNKe 2NDOA 4IQ1A 1I5GA 5ECQB 4WR5A 4HZ2A 2PPTA 2B5XA 3Q74A 1AXDA 1QK8A 3W8JA 2YZUA 1KTEA 1FOVA 3M9KA 1KBNA 1GSUA 3CSJA 2OADA 4EDYA 2HZEB 1PMTA 3D4MA 2V1MA 3ZFBA 3KJYA 3IA1A 2ZCTA 3TOUA 3FZ4A 4XRAA 2IMFA 1GUKA 1ERTA 4NHZA 2C3NA 4XCSA 3ERWA 1XVQA 2C80A 4BVXB 1USBA 2WFCA 5HR3A 4NMUA 3EMXA 1XOBA 2BJXA 4K7NA 3EPTA 4BWQA 3G9BA 2GQMA 3WGXA 2HT9A 1NHOA 2CT6A 5GSSA 2E7PA 2LQOA 2C4JA 5ECOB 3P8WA 1DE1A 3UARA 1OC9A 2VAFA 1NW2A 2PGTA 4CDOA 2HXKA 2IMEA 5GAPD 4ML6A 1A8YA 2PMTA 3U5RE 1XW5A 4GLTA 1FO5A 5G1LA 5D9TA 3ZMLA 2GQKA 2HSMA 2X49A 2VUPA 3QMXA 4HEA2 2AV4A 1TOFA 4IBPA 3GUSA 4YH2A 3TRQA 4EXJA 2NPBA 2GZYA 2IN3A 1DBYA 1GSFA 3C1RA 4O32A 4MMMA 1T00A 1ZYEA 2DJ2A 2L6DA 5AISA 4MPFA 2B7KA 4RQXA 2IPAA 1RW1A 2R37A 2HRFA 2H1AA 1KEBA 1I9DA 2LNTA 2LRNA 2L57A 4XS1A 4MF5A 2FA8A 3F63A 1PKZA 1IYHA 2WRTA 3UJ1A 4IVFA 1QFNA 4RQRA 5DQSA 5AN1A 1X0RA 3M3MA 3GTUB 3LEFA 2GVPA 5G1KA 4L0UA 4OFNA 2YNXA 3BCKA 2XPEA 2WZ9A 3UBLA 1Z5YE 2MBSA 3GRXA 4OFTA 1AW9A 4ID0A 2YJHA 3HYPA 4YAVA 4XRDA 1W89A 4ZIJA 1XFLA 1GTBA 5ELGA 1JHBA 3GV1A 3GH9A 3EVIA 3P2AA 2OJLA 2H30A 5HFGA 2LJAA 3HJOA 5D9WA 5KN2A 3IHQA 3WT1A 4Q5QA 3IK7A 3KGKA 4IJIA 4KSOA 4Q5NA 1O85A 1K0NA 3EE2A 3QAVA 2XPDA 4ACSA 1YZXA 4YQVA 3VPTA 1FB0A 2E2MA 2KP2A 1M9AA 1AQXA 2H74A 3DIEA 3CXGA 3CBUA 4OCFA 5ECSA 2GZPA 1K0AA 2DKIA 4MZBA 3FZ9A 1BJXA 1OE7A 4N10A 2LQQA 3D0ZA 1WE0A 5IPHA 1SK2A 2IFQA 2I4AA 3BOAA 1Z7RA 2B1LA 3N5OA 2VCZA 1XW9A 3C7MA 3M0FA 3HKRA 4BPYA 1GLQA 3HVXA 2B1KA 3W8SA 1XW6A 1A24A 1U3IA 4IN0A 5G5EA 2L5LA 3GN3A 1Y25A 3GKKA 4PUAA 5F05A 3VURA 2FNOA 4K1FA 4JR4A 3WYWA 3EWLA 5B6MA 3GIXA 2CA8A 4IJ3A 4LMVA 2JZTA 2YWMA 3QR6A 1GSSA 3LGCA 3L0HA 2RUFA 2QC7A 3HJMA 2C0EA 4TXOA 1OC3A 3IOSA 2YV9A 1ZYQB 3CRUA 2LS5A 4YQMA 1OYJA 2GSQA 4G0IA 3D6IA 4ZXGA 2MMZA 2OBIA 3ED3A 2HZFA 3NOFA 3E9JB 3GKMA 1GH2A 2NVLA 3GHAA 1SJIA 2IWTA 4BWSA 1PX6A 1HNAA 1OKTA 4K2XA 5DQYA 3I6AA 3GKXA 1B9XC 2CZ3A 1ZOFA 3F8UA 4G9HA 4NV2A 4ZBDA 2PERA 1MDKA 2B5YA 3PINA 4JRRA 1O6JA 1XPVA 5DJMA 3NIVA 2EIQA 4TN8A 3ZVJA 3RPNA 1K0CA 2NBSA 4E8HA 3IHGA 4HS1A 1N2AA 2MMAA 3RHCA 4IW9A 5FT3A 4ULXA 4MF6A 4PGTA 3R2QA 4POKA 5HR0A 1TRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF3 A;  2G0F A;  3MWH A;  2Z9S A;  2O87 A;  2LJR A;  1M7T A;  2LKU A;  1CQH A;  3IR4 A;  2HSY A;  1XWK A;  5FHI A;  1FHE A;  2KOK A;  1HNC A;  3I43 A;  2C1Y A;  5E59 A;  1SL2 B;  3Q6O A;  2QGV A;  2DC5 A;  1XWG A;  2DSA A;  5DAK A;  1X5E A;  1TRU A;  4KAE A;  3RPP A;  5IOX A;  4OD7 A;  2C3T A;  4PNG A;  3LG6 A;  2A2S A;  1J9B A;  4KA0 A;  4F9Z A;  1RQM A;  4OO4 A;  1B48 A;  5KN0 A;  5EL8 A;  9GSS A;  1GSY A;  3LQ7 A;  5ECL B;  2E0Q A;  5J41 A;  1MTC A;  1G6W A;  3HD5 A;  3EIN A;  1YQ1 A;  1HNB A;  5HFK A;  4V1A p;  2EC4 A;  2VLT A;  3DVX A;  2H72 A;  4L8E A;  5ECK B;  2FY6 A;  1BAY A;  4MK3 A;  4FO5 A;  4GST A;  5HQP A;  2B3S A;  4PQH A;  4I2T A;  1IYI A;  1GTU A;  3LSZ A;  2KHP A;  5H5S A;  1Z6N A;  3IV4 A;  1OE8 A;  1MEK A;  1A0R P;  4TW5 A;  5KEJ A;  2L4C A;  3RBT A;  1UA5 A;  1E2Y A;  3IPZ A;  3EYT A;  4DSS B;  2WGR A;  2F8A A;  2M46 A;  1H75 A;  2BTO T;  1R26 A;  1X5C A;  4JE1 A;  3D21 A;  4NWY A;  1SD8 A;  2HYX A;  4NAX A;  4K9Z A;  2X8C A;  3ZRE A;  2X64 A;  4HQS A;  2HZE A;  2ZNM A;  1S3A A;  3KZQ A;  5DJL A;  3LYP A;  1YF0 A;  2C8U A;  4J57 E;  1V9W A;  3TJF A;  5IOW A;  3W6G A;  1PD2 1;  3MSZ A;  1FVJ A;  3ZRD A;  2J23 A;  2FWE A;  2VL9 A;  2O7K A;  4BVX A;  4ECB A;  4XTS A;  2LEG A;  1F9M A;  4YAP A;  2WS2 A;  3QFA C;  3I69 A;  2H0H A;  2HSH A;  2H0I A;  1PGT A;  4YQU A;  1G7O A;  1TK0 B;  2TRX A;  2CQ9 A;  2RM5 A;  1A2J A;  1JZR A;  2B6M A;  2RM6 A;  3H1N A;  4TOP A;  5DCG A;  2VM1 A;  3HVV A;  2H1D A;  3L78 A;  2X8G A;  1JZO A;  1V58 A;  3RHB A;  2IJY A;  1EV9 A;  1F3B A;  2PVO C;  4WBJ A;  2ON5 A;  2I81 A;  1URM A;  5ECN B;  2V32 A;  5DBQ A;  5IMF A;  2P31 A;  2CVK A;  4MF7 A;  1DSB A;  3V1W A;  1VGL A;  4J56 E;  2FCH A;  1JZW A;  3MDK A;  2CX3 A;  2REM A;  4MH2 A;  3KTL A;  5DCH A;  4F03 A;  2IMI A;  1EV4 A;  2BMX A;  4G2E A;  4V2N A;  3HJP A;  18GS A;  3FEU A;  1Y6E A;  1EOH A;  1O7U A;  1YEX A;  4PXO A;  4MDC A;  4TR1 B;  2FUG 2;  1G7E A;  1AIU A;  3O3T A;  4FH8 A;  1FB6 A;  2YWI A;  2A2R A;  3GX0 A;  5ECR B;  1PL1 A;  1Z6M A;  1JFU A;  4OCE A;  1K3O A;  3GTU A;  3F4R A;  1EGO A;  3LYK A;  4KDU A;  1DUG A;  3Q18 A;  3TOT A;  5IIZ A;  4POM A;  4EE0 A;  4KW6 A;  1B9Y C;  5A4W A;  4XS4 B;  3ZIV A;  4EC0 A;  1ON4 A;  6GST A;  3H93 A;  4POL A;  1U6T A;  4OMV A;  4ZL8 A;  3VI7 A;  4RI6 A;  3GYK A;  4XS6 A;  4MA9 A;  2KLX A;  1LBK A;  1MD4 A;  2LRT A;  4LL4 B;  1WJK A;  5GZZ B;  1OAZ A;  1V57 A;  2GTU A;  3TRP A;  2HNL A;  2ES7 A;  4L5L A;  4IHU A;  5CP1 A;  2VOC A;  4PQI A;  2P5Q A;  1MD3 A;  4HJ2 A;  4PQ1 A;  4GRF A;  3GL5 A;  1FW1 A;  2IIY A;  2GQL A;  3UVT A;  1SKS B;  2FWG A;  4V1A g;  1J08 A;  2L6C A;  2P5R A;  1TRV A;  1WWJ A;  1R5A A;  4HJM A;  1PKW A;  2ALB A;  1GTA A;  1M2B A;  5D73 A;  3RDW A;  1ZL9 A;  2H66 A;  2YWO A;  2I1U A;  4OWY A;  3QOU A;  4H86 A;  3ZFL A;  2VCV A;  3M1G A;  4ML1 A;  1M2D A;  2CAI A;  1NHY A;  2H73 A;  3HVS A;  4IQA A;  3TJJ A;  1MDJ A;  1T1V A;  5ENU A;  5DDL A;  1BQ7 A;  3IAS 2;  3LWA A;  2B7J A;  1TTZ A;  1TI3 A;  2V2G A;  2VLV A;  3EMP A;  5E4W A;  5KN1 A;  3IRA A;  2AHE A;  4POB A;  3GKN A;  1AQW A;  4DSQ A;  1PL2 A;  3CSI A;  4EDZ A;  3UIW A;  5G5F A;  3FZ5 A;  4KDY A;  4DEJ A;  2YJ7 A;  4N0V A;  3QAG A;  5B6N A;  1SEN A;  4DSR A;  1G6Y A;  2JAC A;  4NXI A;  2D2Z A;  4I2U A;  2J9H A;  2K8S A;  5CYY A;  3GUR A;  1T8E B;  4NV5 A;  1TK8 B;  2VLU A;  3SWL A;  2FWF A;  2M80 A;  1WP0 A;  5HR1 A;  2GLR A;  1EWX A;  1SD9 A;  1GUH A;  2YAN A;  3APS A;  4WXT A;  2PUK C;  2JAD A;  1PA3 A;  3ZVJ D;  4PX1 A;  1XXU A;  2L59 A;  3GST A;  4IGJ A;  3OR5 A;  4DVC A;  4EF0 A;  1BX9 A;  1A2M A;  1GSE A;  4F0C A;  3KCM A;  1EZK A;  5GST A;  3ZL5 A;  3ZTL A;  1V98 A;  2ON7 A;  4AF2 A;  4TKY A;  2OA7 A;  5EY6 A;  3PH9 A;  3EU4 A;  2VCQ A;  4ZL9 A;  1TW9 A;  1Q4J A;  4RI7 A;  3IDV A;  4IP6 A;  2EIO A;  3TJK A;  5C04 A;  1TKD B;  2GGT A;  20GS A;  3NZN A;  3US3 A;  3ISO A;  1R4W A;  2LST A;  3HHV A;  4HZ4 A;  4PUR A;  1W4V A;  3FKF A;  4PUF C;  2CVB A;  3HZ8 A;  1ZGN A;  2AJQ B;  2MMO A;  2FD3 A;  1EEM A;  3ME8 A;  3BBY A;  3BJ5 A;  1THO A;  3GL3 A;  1SKW B;  1M0U A;  2OE3 A;  2DLX A;  5D93 A;  5CAX A;  3K8N A;  5EPF A;  3DXB A;  2YPM A;  2LJK A;  2V6O A;  1YEP A;  2DJ0 A;  3RAZ A;  4WF5 A;  2YOI A;  3D22 A;  2RUE A;  2N5A A;  1ML6 A;  3TJB A;  4FYU A;  4FYB A;  4F0B A;  5DAL B;  11GS A;  1GP1 A;  2A4V A;  1EEJ A;  4MJE A;  1FG4 A;  16GS A;  3A3T A;  2N5B A;  1O73 A;  1GWC A;  4J2F A;  4LLR A;  2DJ1 A;  3FK8 A;  3CYN A;  1YF1 A;  2AAW A;  4CW9 A;  4DSS A;  3UBK A;  3HA9 A;  3UOM A;  1M2A A;  4N0Z A;  3F4T A;  1QXH A;  14GS A;  3KMO A;  1T4Z A;  4O5R A;  4EUY A;  4I5Q A;  5J5N A;  4Z7X A;  4MCU A;  1GNE A;  1KNG A;  1UC7 A;  1TP9 A;  3VWW A;  2PBJ A;  4ECJ A;  1SK0 A;  2PN8 A;  2JZR A;  1EOG A;  4F82 A;  1YDK A;  2DJJ A;  3DGQ A;  1XBS A;  4Q5R A;  5CRE A;  5HR2 A;  1X9W B;  1S3D A;  3HXS A;  5G31 A;  2KUC A;  4F2I A;  2DJK A;  2F51 A;  3UL3 A;  4FIW A;  3HCZ A;  5EVO A;  3VPQ A;  2AYT A;  5JCU A;  3L4N A;  1TU8 A;  1VF2 A;  5D8I A;  2HI7 A;  4MJA A;  4JED A;  1VF4 A;  2GDR A;  1WRY A;  1PSQ A;  1X5D A;  1JZD A;  5ABR A;  1XVW A;  1HQO A;  2LRC A;  1GRX A;  2YWN A;  3P7X A;  4ECC A;  3C71 A;  4XHM A;  2RII A;  1O81 A;  5CRG A;  2HLS A;  1PQN A;  4AGS A;  5JCG A;  1H4O A;  2GZZ A;  2YN1 A;  2VL2 C;  3KTB A;  2AB6 A;  2KP1 A;  5LD0 A;  4ZIL A;  3TKR A;  2YP6 A;  1OVN A;  2NTO A;  1GSD A;  12GS A;  2DJ3 A;  5CO3 A;  3VWU A;  3M8N A;  2WB9 A;  7GSS A;  5HFI A;  4MPG A;  2M72 A;  1F3A A;  5ECH B;  2VM2 A;  5J9B A;  3KH7 A;  1R7H A;  3IBH A;  4AJ8 A;  4MJC A;  3F0I A;  5B8A A;  2R4V A;  2JSY A;  1G0T A;  3F9U A;  2H76 A;  4TR1 A;  3QAW A;  4HQZ A;  2DML A;  1SJZ A;  2VCW A;  3UAP A;  2CVD A;  4WEY A;  1XWB A;  2GT5 A;  5IO0 A;  4K7O A;  4HUA A;  2TRC P;  2C3Q A;  5A4U A;  2K6V A;  2H6Z A;  1X9M B;  4HU7 A;  5A5K A;  1U88 A;  4P3Y B;  2P0G A;  5ID2 B;  2VL3 A;  3FR9 A;  4IP1 A;  4X43 A;  3TDG A;  5CRD A;  1WMJ A;  5KN3 A;  19GS A;  3IAM 2;  4IS0 A;  2GST A;  2N5F A;  1OKD A;  3KXO A;  1XZO A;  3EUR A;  2GT6 A;  1WIK A;  2CZ2 A;  1A23 A;  2X8H A;  4ZB8 A;  1K0M A;  1UN2 A;  1T3B A;  4FYC A;  1U87 A;  2XC2 A;  4D73 B;  2DIY A;  5D9V A;  3VWX A;  5G2Z A;  1B8X A;  3C8E A;  3S9F A;  1TI1 A;  3FY7 A;  1ERW A;  1F6M C;  2OE0 A;  4JBB A;  1F37 A;  3GNJ A;  1V2A A;  3G7I A;  1UVZ A;  3IC4 A;  4WKW A;  3GMF A;  1ILO A;  3GH6 A;  4LL1 B;  5FWG A;  1SYX A;  3ZLP A;  1XOA A;  2G2Q A;  3TUE A;  1EP7 A;  3QPM A;  4ZB6 A;  4GF0 A;  4QL7 A;  4KND A;  5IMV A;  4ISD A;  2HRN A;  2O8V B;  1NM3 A;  3CTG A;  4X0X A;  2V41 A;  1PN9 A;  5IMD A;  2LV3 A;  3H79 A;  2O85 A;  1NSW A;  2PVQ A;  4ZBA A;  3F6D A;  4ILF A;  3EU3 A;  2O89 A;  3WGE A;  3ZYW A;  2F3M A;  4K0N A;  3DWV A;  5IMZ A;  1Q98 A;  6GSS A;  1E6B A;  2MYG A;  4GSS A;  1YJ6 A;  5A4V A;  1TU7 A;  4WET A;  2MMN A;  3UMA A;  4MAB A;  1CQG A;  1F2E A;  3KIJ A;  3KM6 A;  5H5R A;  2WDU A;  2YCD A;  3GSS A;  4OO5 A;  1BYE A;  4I97 A;  4GQF A;  4WBR D;  3G7Y A;  5CNW A;  1THX A;  5G30 A;  3A2V A;  1XIY A;  4LA1 A;  5IPG A;  2GSR A;  3HDC A;  3L9V A;  5IMA A;  1EP8 A;  1FVK A;  3IXR A;  1XCC A;  1BG5 A;  3TJG A;  3F3Q A;  4LMW A;  3GA4 A;  4IEL A;  1A2L A;  1ERV A;  4TR0 A;  2QSI A;  2DBC A;  2DMM A;  1U3A A;  2VCT A;  5AIX A;  1Z7P A;  5ECI B;  5D96 A;  3EC3 A;  3QDN A;  3ZZX A;  1ZZY A;  2MBT A;  3JCM L;  1A0F A;  2JSZ A;  3KH9 A;  2VIM A;  3D4T A;  5C00 A;  2E2G A;  2IL3 A;  1AAZ A;  3WT2 A;  3A5W A;  1B4P A;  2WUL A;  2XHF A;  4EO3 A;  1MDI A;  4GCI A;  3A2W A;  3J7Y b;  2K9F A;  2B5E A;  4TR4 A;  6GSW A;  1EGR A;  3F4S A;  2JZS A;  4KUN A;  4AJ6 A;  3WGD A;  3HZ4 A;  1OC9 B;  3L9U A;  5ECP B;  3C1S A;  1TDI A;  1B4Q A;  5J4U A;  3ZIJ A;  2R2J A;  4KCE A;  4RUV A;  2AUV A;  3O76 A;  3AY8 A;  4L0W A;  1TJD A;  1WPI A;  3O6T A;  1GUM A;  4KDX A;  4E8E A;  3ZIT A;  2HE3 A;  5JWO B;  3DVW A;  4KB3 A;  2JL4 A;  1K0B A;  2L4Q A;  1PRX A;  2VL2 A;  4GTU A;  2FLS A;  1AUC A;  5DVB A;  3DML A;  4MP4 A;  4XIH A;  1GSQ A;  2YV7 A;  1OC8 A;  4MZC A;  3FRC A;  4TVE A;  4HOJ A;  1A8L A;  2H8L A;  4KH7 A;  4JU5 A;  4O92 A;  6GSX A;  4NPB A;  2FHE A;  1XWC A;  2H70 A;  2I9H A;  3H8Q A;  3CSH A;  5D9X A;  6GSY A;  1J0F A;  1HD2 A;  3TKS C;  5DAL A;  4MJB A;  1YKC A;  2F8F A;  1FAA A;  4BL7 A;  4HI7 A;  4QQ7 A;  6GSV A;  2OKA A;  4GSN A;  2VD1 A;  3UEM A;  2EIR A;  1RK4 A;  4JZQ A;  4V2L A;  4K2D A;  5AGY A;  3U6V A;  4OFM A;  3KP8 A;  3E3E A;  4MH3 A;  3KP9 A;  17GS A;  4X1U A;  5CRH A;  3DKS A;  1ACV A;  3BD2 A;  4KE3 A;  1SKR B;  1GUL A;  2K18 A;  1LJR A;  2H71 A;  1YKA A;  1SL1 B;  4KX4 A;  1Z3E A;  1QGV A;  1LU4 A;  4WR4 A;  5F07 A;  2MZC A;  2F9S A;  2PU9 C;  1ZCP A;  3LJR A;  5IO2 A;  5INY A;  5AIV A;  1GTI A;  5B8B A;  1T4Y A;  8GSS A;  1YY7 A;  5L71 A;  4PNF A;  3QD9 A;  5LCZ A;  2CAQ A;  4K6X A;  3FZA A;  3APQ A;  2IMD A;  2XBQ A;  5JWR B;  2IFQ B;  2C0G A;  2FA4 A;  1TRS A;  3SBC A;  1T7P B;  3ERF A;  3WD6 A;  3MNG A;  3TRX A;  3C73 A;  2VD0 A;  6GSU A;  3TGZ A;  3GX8 A;  3F3R A;  5GAN D;  5IM9 A;  4KSM A;  3QFB C;  3ME7 A;  1AQV A;  4KCA A;  1SJ6 A;  3FW2 A;  2R3X A;  1AC1 A;  1JLV A;  5IMC A;  1HYU A;  4ECI A;  4QL9 A;  3CMI A;  3TKS E;  1K3L A;  3P90 A;  2LUS A;  3FR6 A;  5F0G A;  3M9J A;  4K0G A;  13GS A;  2H01 A;  3N9J A;  3ZMK A;  4TXO B;  5B7C A;  1Z9H A;  3TB2 A;  5JCW A;  4GWR A;  3D5J A;  2QKE A;  2CX4 A;  2L5O A;  1GNW A;  1QQ2 A;  1O8W A;  3UVH A;  2H1B A;  3DD3 A;  2LNS A;  4K7I A;  5H5Q A;  1GLP A;  3IK9 A;  5F06 A;  2DIZ A;  3A2X A;  3F6F A;  4HDE A;  1K0D A;  1ERU A;  3VLN A;  2JU5 A;  3E0U A;  1TXX A;  1O8X A;  4ZB9 A;  5JWQ B;  4GXZ A;  2OAC A;  5J3R A;  1QUW A;  3LXT A;  4MZW A;  2H19 A;  1C72 A;  2GSS A;  3LXZ A;  5F8B A;  3CRT A;  4NHW A;  2OE1 A;  3TCO A;  4CHS A;  1K3Y A;  3GFK A;  3FYG A;  4BA7 A;  3H4K A;  4I8B A;  2VO4 A;  1ST9 A;  2FWH A;  5ID2 A;  2LTK A;  2CV4 A;  1WOU A;  3HY2 A;  3QCP A;  2GS3 A;  4MLY A;  1S3C A;  4BVY A;  2RLI A;  10GS A;  2YZH A;  4N30 A;  3MAK A;  3CTF A;  5COH A;  3G7J A;  5ECM B;  3PGT A;  2R6K A;  1BED A;  3KEB A;  4EVM A;  1SU9 A;  1XWA A;  1SL0 B;  3J7Y k;  2WCI A;  1N8J A;  2V6K A;  3LOR A;  4KGI A;  4JR6 A;  4TXV A;  4N11 A;  1X9S B;  3I9V 2;  1M99 A;  5DAK B;  4D73 A;  4TR3 A;  1GL8 A;  4Q5F A;  1SK1 A;  2IMK A;  4G10 A;  3FR3 A;  5ELA A;  2HFD A;  4WF4 A;  1JLW A;  4TRX A;  3VWV A;  5J9C A;  2K8V A;  3DRN A;  4V2M A;  5IQY A;  1TK5 B;  2OBK A;  3Q19 A;  4EL1 A;  2H1G A;  2X99 A;  4EKZ A;  2H6Y A;  5CRW A;  1VF1 A;  4AJ7 A;  4L5O A;  4I6X A;  1M9B A;  4K8M A;  3IE3 A;  3PR8 A;  2H0G A;  1DE2 A;  2R5G A;  3FHK A;  3VI5 A;  1VRS D;  4HU9 A;  3KD0 A;  1QMV A;  2I3Y A;  3VFI A;  2FGX A;  2C0D A;  2TIR A;  4ZBB A;  1ABA A;  3APO A;  1PX7 A;  3BCI A;  3VK9 A;  2VCX A;  2C0F A;  2ZUP A;  3LFL A;  2WJU A;  4G19 A;  3DEX A;  4XS4 A;  3TKQ A;  4ZL7 A;  1SYR A;  4GQC A;  4IKH A;  4O7H A;  3DYR A;  3L9S A;  2H6X A;  1V40 A;  1K0O A;  1ZMA A;  1R5P A;  2XBI A;  2PWJ A;  3ERG A;  2H75 A;  3KMN A;  3TKS A;  22GS A;  3TKP A;  5LNK e;  2NDO A;  4IQ1 A;  1I5G A;  5ECQ B;  4WR5 A;  4HZ2 A;  2PPT A;  2B5X A;  3Q74 A;  1AXD A;  1QK8 A;  3W8J A;  2YZU A;  1KTE A;  1FOV A;  3M9K A;  1KBN A;  1GSU A;  3CSJ A;  2OAD A;  4EDY A;  2HZE B;  1PMT A;  3D4M A;  2V1M A;  3ZFB A;  3KJY A;  3IA1 A;  2ZCT A;  3TOU A;  3FZ4 A;  4XRA A;  2IMF A;  1GUK A;  1ERT A;  4NHZ A;  2C3N A;  4XCS A;  3ERW A;  1XVQ A;  2C80 A;  1USB A;  2WFC A;  5HR3 A;  4NMU A;  3EMX A;  1XOB A;  2BJX A;  4K7N A;  4BWQ A;  3G9B A;  2GQM A;  3WGX A;  2HT9 A;  1NHO A;  2CT6 A;  5GSS A;  2E7P A;  2LQO A;  2C4J A;  5ECO B;  3P8W A;  1DE1 A;  3UAR A;  1OC9 A;  2VAF A;  1NW2 A;  2PGT A;  4CDO A;  2HXK A;  2IME A;  5GAP D;  4ML6 A;  1A8Y A;  2PMT A;  3U5R E;  1XW5 A;  4GLT A;  1FO5 A;  5G1L A;  5D9T A;  3ZML A;  2GQK A;  2VUP A;  3QMX A;  4HEA 2;  2AV4 A;  1TOF A;  4IBP A;  3GUS A;  4YH2 A;  3TRQ A;  4EXJ A;  2NPB A;  2GZY A;  2IN3 A;  1DBY A;  1GSF A;  3C1R A;  4O32 A;  4MMM A;  1T00 A;  1ZYE A;  2DJ2 A;  2L6D A;  4MPF A;  5AIS A;  2B7K A;  4RQX A;  2IPA A;  1RW1 A;  2R37 A;  2HRF A;  2H1A A;  1KEB A;  1I9D A;  2LNT A;  2LRN A;  2L57 A;  4XS1 A;  4MF5 A;  2FA8 A;  3F63 A;  1PKZ A;  1IYH A;  2WRT A;  3UJ1 A;  4IVF A;  1QFN A;  4RQR A;  5DQS A;  5AN1 A;  1X0R A;  3M3M A;  3GTU B;  3LEF A;  2GVP A;  5G1K A;  4L0U A;  4OFN A;  2YNX A;  3BCK A;  2XPE A;  2WZ9 A;  3UBL A;  1Z5Y E;  2MBS A;  3GRX A;  4OFT A;  1AW9 A;  4ID0 A;  2YJH A;  3HYP A;  4YAV A;  4XRD A;  1W89 A;  4ZIJ A;  1XFL A;  1GTB A;  5ELG A;  1JHB A;  3GV1 A;  3GH9 A;  3EVI A;  3P2A A;  2OJL A;  2H30 A;  5HFG A;  2LJA A;  3HJO A;  5D9W A;  5KN2 A;  3IHQ A;  3WT1 A;  4Q5Q A;  3IK7 A;  3KGK A;  4IJI A;  4KSO A;  4Q5N A;  1O85 A;  1K0N A;  3EE2 A;  3QAV A;  2XPD A;  4ACS A;  1YZX A;  4YQV A;  3VPT A;  1FB0 A;  2E2M A;  2KP2 A;  1M9A A;  1AQX A;  2H74 A;  3DIE A;  3CXG A;  3CBU A;  4OCF A;  5ECS A;  2GZP A;  1K0A A;  4MZB A;  3FZ9 A;  1BJX A;  1OE7 A;  4N10 A;  2LQQ A;  3D0Z A;  1WE0 A;  5IPH A;  1SK2 A;  2IFQ A;  2I4A A;  3BOA A;  1Z7R A;  2B1L A;  3N5O A;  2VCZ A;  1XW9 A;  3C7M A;  3M0F A;  3HKR A;  4BPY A;  1GLQ A;  3HVX A;  2B1K A;  3W8S A;  1XW6 A;  1A24 A;  1U3I A;  4IN0 A;  5G5E A;  2L5L A;  3GN3 A;  1Y25 A;  3GKK A;  4PUA A;  5F05 A;  3VUR A;  2FNO A;  4K1F A;  4JR4 A;  3WYW A;  3EWL A;  5B6M A;  3GIX A;  2CA8 A;  4IJ3 A;  4LMV A;  2JZT A;  2YWM A;  3QR6 A;  1GSS A;  3LGC A;  3L0H A;  2RUF A;  2QC7 A;  3HJM A;  2C0E A;  4TXO A;  1OC3 A;  3IOS A;  2YV9 A;  1ZYQ B;  3CRU A;  2LS5 A;  4YQM A;  1OYJ A;  2GSQ A;  3D6I A;  4ZXG A;  2MMZ A;  2OBI A;  3ED3 A;  2HZF A;  3NOF A;  3E9J B;  3GKM A;  1GH2 A;  2NVL A;  3GHA A;  1SJI A;  2IWT A;  4BWS A;  1PX6 A;  1HNA A;  1OKT A;  5DQY A;  3I6A A;  3GKX A;  1B9X C;  2CZ3 A;  1ZOF A;  3F8U A;  4G9H A;  4NV2 A;  4ZBD A;  2PER A;  1MDK A;  2B5Y A;  3PIN A;  4JRR A;  1O6J A;  1XPV A;  5DJM A;  3NIV A;  2EIQ A;  4TN8 A;  3ZVJ A;  3RPN A;  1K0C A;  2NBS A;  4E8H A;  4HS1 A;  1N2A A;  2MMA A;  3RHC A;  4IW9 A;  5FT3 A;  4ULX A;  4MF6 A;  4PGT A;  3R2Q A;  4POK A;  5HR0 A;  1TRW A; 
#chains in the Genus database with same CATH topology
 1VF3 A;  2G0F A;  3MWH A;  2Z9S A;  2O87 A;  2LJR A;  1M7T A;  2LKU A;  1CQH A;  3IR4 A;  2HSY A;  1XWK A;  5FHI A;  1FHE A;  2KOK A;  1HNC A;  3I43 A;  2C1Y A;  5E59 A;  1SL2 B;  3Q6O A;  3FMW A;  2QGV A;  2DC5 A;  1XWG A;  2DSA A;  5DAK A;  1X5E A;  1TRU A;  4KAE A;  3RPP A;  5IOX A;  4OD7 A;  2C3T A;  4PNG A;  3LG6 A;  4MNN A;  2A2S A;  1J9B A;  4KA0 A;  4F9Z A;  1RQM A;  4OO4 A;  1B48 A;  5KN0 A;  5EL8 A;  9GSS A;  1GSY A;  3LQ7 A;  5ECL B;  2E0Q A;  5J41 A;  1MTC A;  1G6W A;  3HD5 A;  3EIN A;  1YQ1 A;  1HNB A;  5HFK A;  4V1A p;  2EC4 A;  2VLT A;  3DVX A;  2H72 A;  4L8E A;  5ECK B;  2FY6 A;  1BAY A;  4MK3 A;  4FO5 A;  4GST A;  5HQP A;  2B3S A;  4PQH A;  4I2T A;  1IYI A;  1GTU A;  3LSZ A;  2KHP A;  4YKG A;  5H5S A;  1Z6N A;  3IV4 A;  1OE8 A;  1MEK A;  1A0R P;  4TW5 A;  5KEJ A;  2L4C A;  3RBT A;  1UA5 A;  1E2Y A;  3IPZ A;  3EYT A;  4DSS B;  2WGR A;  2F8A A;  2M46 A;  1H75 A;  2BTO T;  1R26 A;  1X5C A;  4JE1 A;  3D21 A;  4NWY A;  1SD8 A;  2HYX A;  4NAX A;  4K9Z A;  2X8C A;  3ZRE A;  2X64 A;  4HQS A;  2HZE A;  2ZNM A;  1S3A A;  3KZQ A;  5DJL A;  3LYP A;  1YF0 A;  2C8U A;  4J57 E;  1V9W A;  1ZYP A;  3TJF A;  5IOW A;  3W6G A;  1PD2 1;  3MSZ A;  1FVJ A;  3ZRD A;  2J23 A;  2FWE A;  2VL9 A;  2O7K A;  4BVX A;  4ECB A;  4XTS A;  2LEG A;  4Z2U A;  1F9M A;  4YAP A;  2WS2 A;  3QFA C;  3I69 A;  2H0H A;  2HSH A;  2H0I A;  1PGT A;  4YQU A;  1G7O A;  1TK0 B;  2TRX A;  2CQ9 A;  2RM5 A;  1A2J A;  1JZR A;  2B6M A;  2RM6 A;  4FQU A;  3H1N A;  4TOP A;  5DCG A;  2VM1 A;  3HVV A;  2H1D A;  3L78 A;  2X8G A;  1JZO A;  1V58 A;  3RHB A;  2IJY A;  1EV9 A;  1F3B A;  2PVO C;  4K5R A;  4WBJ A;  2ON5 A;  2I81 A;  1URM A;  5ECN B;  2V32 A;  5DBQ A;  5IMF A;  2P31 A;  2CVK A;  4MF7 A;  1DSB A;  3V1W A;  1VGL A;  4J56 E;  2FCH A;  1JZW A;  3MDK A;  2CX3 A;  2REM A;  4MH2 A;  3KTL A;  5DCH A;  4F03 A;  2IMI A;  1EV4 A;  2BMX A;  4G2E A;  4V2N A;  3HJP A;  18GS A;  3FEU A;  1Y6E A;  1EOH A;  1O7U A;  1YEX A;  4PXO A;  4MDC A;  4TR1 B;  2FUG 2;  1G7E A;  1AIU A;  3O3T A;  4FH8 A;  1FB6 A;  2YWI A;  2A2R A;  3IC8 A;  3GX0 A;  5ECR B;  1PL1 A;  1Z6M A;  1JFU A;  4OCE A;  1K3O A;  3GTU A;  3F4R A;  1EGO A;  3LYK A;  4KDU A;  1DUG A;  3Q18 A;  3TOT A;  5IIZ A;  3A5I A;  4POM A;  4EE0 A;  4KW6 A;  2R0G A;  1B9Y C;  5A4W A;  4XS4 B;  3ZIV A;  4EC0 A;  1ON4 A;  5KOX A;  6GST A;  3H93 A;  4HSC X;  4POL A;  1U6T A;  4OMV A;  4ZL8 A;  3VI7 A;  4RI6 A;  3GYK A;  4XS6 A;  4MA9 A;  2KLX A;  1LBK A;  1MD4 A;  3LW9 A;  2LRT A;  4LL4 B;  1WJK A;  5GZZ B;  1OAZ A;  1V57 A;  2GTU A;  3TRP A;  2HNL A;  2ES7 A;  4L5L A;  4IHU A;  5CP1 A;  2VOC A;  4PQI A;  2P5Q A;  1MD3 A;  4HJ2 A;  4PQ1 A;  4GRF A;  4A5P A;  3GL5 A;  1FW1 A;  2IIY A;  4G0K A;  2GQL A;  3UVT A;  1SKS B;  2FWG A;  4V1A g;  1J08 A;  2QA2 A;  2L6C A;  2P5R A;  1TRV A;  1WWJ A;  1R5A A;  4HJM A;  1PKW A;  2ALB A;  1GTA A;  1M2B A;  5D73 A;  3RDW A;  1ZL9 A;  2H66 A;  2YWO A;  2I1U A;  4OWY A;  3QOU A;  4H86 A;  3ZFL A;  2VCV A;  3M1G A;  4ML1 A;  1M2D A;  2CAI A;  1NHY A;  2H73 A;  3HVS A;  4IQA A;  3TJJ A;  1MDJ A;  1T1V A;  5ENU A;  5DDL A;  1BQ7 A;  3IAS 2;  3LWA A;  2B7J A;  1TTZ A;  1TI3 A;  2V2G A;  2VLV A;  3EMP A;  5E4W A;  5KN1 A;  3IRA A;  2AHE A;  4POB A;  3GKN A;  1AQW A;  4DSQ A;  1PL2 A;  3CSI A;  4EDZ A;  3UIW A;  5G5F A;  3FZ5 A;  4KDY A;  4DEJ A;  2YJ7 A;  4N0V A;  3QAG A;  5B6N A;  1SEN A;  4EIP A;  4DSR A;  1G6Y A;  2JAC A;  4NXI A;  2D2Z A;  4I2U A;  2J9H A;  2K8S A;  5CYY A;  3GUR A;  1T8E B;  4NV5 A;  1TK8 B;  2VLU A;  4O5Q A;  3SWL A;  2FWF A;  2M80 A;  1WP0 A;  5HR1 A;  2GLR A;  1EWX A;  1SD9 A;  1GUH A;  2YAN A;  3APS A;  4WXT A;  2PUK C;  2JAD A;  1PA3 A;  3ZVJ D;  4PX1 A;  1XXU A;  2L59 A;  3GST A;  4IGJ A;  3OR5 A;  4DVC A;  4EF0 A;  1BX9 A;  1A2M A;  1GSE A;  4F0C A;  3KCM A;  1EZK A;  5GST A;  3ZL5 A;  3ZTL A;  1V98 A;  2ON7 A;  4AF2 A;  4TKY A;  2OA7 A;  5EY6 A;  3PH9 A;  3EU4 A;  2QA1 A;  2VCQ A;  4ZL9 A;  1TW9 A;  1Q4J A;  4RI7 A;  3IDV A;  4IP6 A;  2EIO A;  3TJK A;  5C04 A;  1TKD B;  2GGT A;  20GS A;  3NZN A;  3US3 A;  3ISO A;  1R4W A;  2LST A;  3HHV A;  4HZ4 A;  4PUR A;  1W4V A;  3FKF A;  4PUF C;  2CVB A;  3HZ8 A;  1ZGN A;  2AJQ B;  2MMO A;  2FD3 A;  1EEM A;  3ME8 A;  3BBY A;  3MYD A;  3BJ5 A;  1THO A;  3GL3 A;  1SKW B;  1M0U A;  2OE3 A;  2DLX A;  5D93 A;  5CAX A;  3K8N A;  5EPF A;  3DXB A;  2YPM A;  2LJK A;  2V6O A;  1YEP A;  2DJ0 A;  3RAZ A;  4WF5 A;  2YOI A;  3D22 A;  2RUE A;  2N5A A;  4USS A;  1ML6 A;  3TJB A;  4FYU A;  4FYB A;  4F0B A;  5DAL B;  11GS A;  1GP1 A;  2A4V A;  1EEJ A;  4MJE A;  1FG4 A;  16GS A;  1ZYN A;  3A3T A;  2N5B A;  1O73 A;  4BL7 B;  4Z2R A;  1GWC A;  4J2F A;  4LLR A;  2DJ1 A;  3FK8 A;  3CYN A;  1YF1 A;  2AAW A;  4CW9 A;  4DSS A;  3UBK A;  3HA9 A;  3UOM A;  1M2A A;  4N0Z A;  3F4T A;  1QXH A;  14GS A;  3KMO A;  1T4Z A;  4O5R A;  4EUY A;  4I5Q A;  5J5N A;  4Z7X A;  4MCU A;  1GNE A;  1KNG A;  1UC7 A;  1TP9 A;  3VWW A;  2PBJ A;  4ECJ A;  1SK0 A;  2PN8 A;  2JZR A;  1EOG A;  4F82 A;  1YDK A;  2DJJ A;  3DGQ A;  1XBS A;  4Q5R A;  5CRE A;  5HR2 A;  1X9W B;  1S3D A;  3HXS A;  5G31 A;  2KUC A;  4YKF A;  4F2I A;  2DJK A;  2F51 A;  3UL3 A;  4FIW A;  3HCZ A;  5EVO A;  3VPQ A;  2AYT A;  5JCU A;  3L4N A;  1TU8 A;  1VF2 A;  5D8I A;  2HI7 A;  4MJA A;  4JED A;  1VF4 A;  2GDR A;  1WRY A;  1PSQ A;  1X5D A;  1JZD A;  5ABR A;  1XVW A;  1HQO A;  2LRC A;  1GRX A;  2YWN A;  3P7X A;  4ECC A;  3C71 A;  4XHM A;  2RII A;  1O81 A;  5CRG A;  2HLS A;  1PQN A;  4AGS A;  4PTS A;  5JCG A;  1H4O A;  2GZZ A;  2YN1 A;  2VL2 C;  3KTB A;  2AB6 A;  1M3I A;  2KP1 A;  5LD0 A;  4ZIL A;  3TKR A;  2YP6 A;  1OVN A;  2NTO A;  1GSD A;  12GS A;  2DJ3 A;  5CO3 A;  3VWU A;  3M8N A;  2WB9 A;  7GSS A;  5HFI A;  4MPG A;  2M72 A;  1F3A A;  5ECH B;  2VM2 A;  5J9B A;  3KH7 A;  1R7H A;  3IBH A;  4AJ8 A;  4MJC A;  3F0I A;  5B8A A;  2R4V A;  2JSY A;  1G0T A;  3F9U A;  2H76 A;  4TR1 A;  3QAW A;  4HQZ A;  2DML A;  1SJZ A;  2VCW A;  3UAP A;  2HRA A;  2CVD A;  4WEY A;  1XWB A;  2GT5 A;  3PPU A;  5IO0 A;  4K7O A;  4HUA A;  2TRC P;  2C3Q A;  5A4U A;  2K6V A;  2H6Z A;  1X9M B;  4HU7 A;  5A5K A;  1PFO A;  1U88 A;  4P3Y B;  2P0G A;  5ID2 B;  2VL3 A;  3FR9 A;  4IP1 A;  4X43 A;  3TDG A;  5CRD A;  1WMJ A;  5KN3 A;  19GS A;  3IAM 2;  4IS0 A;  2GST A;  4BVY B;  2N5F A;  1OKD A;  3KXO A;  1XZO A;  3EUR A;  2GT6 A;  5KOW A;  1WIK A;  2CZ2 A;  1A23 A;  2X8H A;  4ZB8 A;  1K0M A;  1UN2 A;  1T3B A;  4FYC A;  1U87 A;  2XC2 A;  4D73 B;  2DIY A;  5D9V A;  3VWX A;  5G2Z A;  1B8X A;  3C8E A;  3S9F A;  1TI1 A;  3FY7 A;  1ERW A;  1F6M C;  2OE0 A;  4JBB A;  1F37 A;  3GNJ A;  1V2A A;  3G7I A;  1UVZ A;  3IC4 A;  4WKW A;  1XG8 A;  3GMF A;  1ILO A;  3GH6 A;  4LL1 B;  5FWG A;  1SYX A;  3ZLP A;  1XOA A;  2G2Q A;  3TUE A;  1EP7 A;  3QPM A;  4ZB6 A;  4GF0 A;  4QL7 A;  4KND A;  5IMV A;  4ISD A;  2HRN A;  2O8V B;  1NM3 A;  3CTG A;  4X0X A;  2V41 A;  1PN9 A;  5IMD A;  4X4J A;  2LV3 A;  3H79 A;  2O85 A;  1NSW A;  2PVQ A;  4ZBA A;  3F6D A;  4ILF A;  3EU3 A;  2O89 A;  3WGE A;  3ZYW A;  2F3M A;  4K0N A;  3DWV A;  5IMZ A;  1Q98 A;  6GSS A;  1E6B A;  2MYG A;  4GSS A;  1YJ6 A;  5A4V A;  1TU7 A;  4WET A;  2MMN A;  3UMA A;  4MAB A;  1CQG A;  1F2E A;  3KIJ A;  3KM6 A;  5H5R A;  2WDU A;  2YCD A;  3GSS A;  4OO5 A;  1BYE A;  4I97 A;  4GQF A;  4WBR D;  3G7Y A;  5CNW A;  1THX A;  5G30 A;  3A2V A;  1XIY A;  4LA1 A;  5IPG A;  2GSR A;  3HDC A;  3L9V A;  3R3E A;  5IMA A;  1EP8 A;  1FVK A;  3IXR A;  1XCC A;  1BG5 A;  2A2P A;  3TJG A;  3F3Q A;  4LMW A;  3GA4 A;  4IEL A;  1A2L A;  1ERV A;  4TR0 A;  4O5U A;  2QSI A;  2DBC A;  2DMM A;  1U3A A;  2VCT A;  5AIX A;  1Z7P A;  5ECI B;  5D96 A;  3EC3 A;  3QDN A;  3ZZX A;  3MIX A;  1ZZY A;  2MBT A;  3JCM L;  1A0F A;  2JSZ A;  3KH9 A;  2VIM A;  3D4T A;  5C00 A;  2E2G A;  2IL3 A;  5BRT A;  1AAZ A;  3WT2 A;  3A5W A;  1B4P A;  2WUL A;  2XHF A;  4EO3 A;  1MDI A;  4GCI A;  3A2W A;  3J7Y b;  2K9F A;  2B5E A;  4TR4 A;  6GSW A;  1EGR A;  5BMU A;  3F4S A;  4KF9 A;  2JZS A;  4KUN A;  4AJ6 A;  3WGD A;  3HZ4 A;  1OC9 B;  3L9U A;  5ECP B;  4EIQ A;  3C1S A;  1TDI A;  1B4Q A;  5J4U A;  3ZIJ A;  2R2J A;  4KCE A;  4RUV A;  2AUV A;  3O76 A;  3AY8 A;  4L0W A;  1TJD A;  1WPI A;  3O6T A;  1GUM A;  4KDX A;  4E8E A;  3ZIT A;  2HE3 A;  5JWO B;  3DVW A;  4KB3 A;  2JL4 A;  1K0B A;  2L4Q A;  1PRX A;  2VL2 A;  4GTU A;  1M3J A;  2FLS A;  1AUC A;  5DVB A;  3DML A;  4MP4 A;  4XIH A;  2R0C A;  1GSQ A;  2YV7 A;  1OC8 A;  4MZC A;  3FRC A;  4TVE A;  4HOJ A;  1A8L A;  2H8L A;  4KH7 A;  4JU5 A;  4O92 A;  6GSX A;  4NPB A;  2FHE A;  1XWC A;  2H70 A;  2I9H A;  3H8Q A;  3CSH A;  5D9X A;  6GSY A;  1J0F A;  1HD2 A;  2X4A A;  3TKS C;  5DAL A;  4MJB A;  1YKC A;  2F8F A;  1FAA A;  2UZ8 A;  4BL7 A;  4HI7 A;  4QQ7 A;  6GSV A;  2OKA A;  4GSN A;  2VD1 A;  3UEM A;  2EIR A;  1RK4 A;  4JZQ A;  4V2L A;  4K2D A;  5AGY A;  3U6V A;  4ICY A;  4OFM A;  3KP8 A;  3E3E A;  3HVN A;  4MH3 A;  3KP9 A;  17GS A;  4X1U A;  5CRH A;  3DKS A;  1ACV A;  4K5S A;  3BD2 A;  4KE3 A;  1SKR B;  1GUL A;  2K18 A;  1LJR A;  2H71 A;  1YKA A;  1SL1 B;  4KX4 A;  1Z3E A;  1QGV A;  1LU4 A;  4WR4 A;  5F07 A;  2MZC A;  2F9S A;  2PU9 C;  1ZCP A;  3LJR A;  5IO2 A;  5INY A;  5AIV A;  1PN0 A;  1GTI A;  1FOH A;  5B8B A;  1T4Y A;  8GSS A;  1YY7 A;  5L71 A;  4PNF A;  3QD9 A;  5LCZ A;  4CY8 A;  2CAQ A;  4K6X A;  3FZA A;  3APQ A;  2IMD A;  2XBQ A;  5JWR B;  2IFQ B;  2C0G A;  2FA4 A;  1TRS A;  3SBC A;  1T7P B;  3ERF A;  3WD6 A;  3MNG A;  3TRX A;  3C73 A;  2VD0 A;  6GSU A;  3TGZ A;  3GX8 A;  3F3R A;  5GAN D;  5IM9 A;  4KSM A;  3QFB C;  3ME7 A;  1AQV A;  4KCA A;  1SJ6 A;  3FW2 A;  2R3X A;  1AC1 A;  1JLV A;  5IMC A;  1HYU A;  4ECI A;  4QL9 A;  3CMI A;  3TKS E;  1K3L A;  3P90 A;  2LUS A;  3FR6 A;  5F0G A;  3M9J A;  4K0G A;  13GS A;  2H01 A;  3N9J A;  3ZMK A;  4TXO B;  5B7C A;  1Z9H A;  3TB2 A;  5JCW A;  4GWR A;  3D5J A;  2QKE A;  2CX4 A;  2L5O A;  1GNW A;  1QQ2 A;  1O8W A;  3UVH A;  2H1B A;  3DD3 A;  4BIK A;  2LNS A;  4K7I A;  5H5Q A;  1GLP A;  3IK9 A;  5F06 A;  2DIZ A;  3A2X A;  3F6F A;  4HDE A;  1K0D A;  1ERU A;  3VLN A;  2JU5 A;  3E0U A;  2HRK A;  1TXX A;  1O8X A;  4ZB9 A;  5JWQ B;  4GXZ A;  2OAC A;  2DKH A;  5J3R A;  1QUW A;  3LXT A;  4MZW A;  2H19 A;  1C72 A;  2GSS A;  3LXZ A;  5F8B A;  3CRT A;  4NHW A;  2OE1 A;  3TCO A;  4CHS A;  1K3Y A;  3GFK A;  3FYG A;  4BA7 A;  3H4K A;  4I8B A;  2VO4 A;  1ST9 A;  2FWH A;  5ID2 A;  2LTK A;  2CV4 A;  4Z2T A;  1WOU A;  3HY2 A;  3QCP A;  4G0L A;  2GS3 A;  4MLY A;  1S3C A;  4BVY A;  2RLI A;  10GS A;  2YZH A;  4N30 A;  3MAK A;  3CTF A;  5COH A;  3G7J A;  5ECM B;  3PGT A;  2R6K A;  1BED A;  3KEB A;  4EVM A;  1SU9 A;  1XWA A;  1SL0 B;  3J7Y k;  2WCI A;  1N8J A;  2V6K A;  3LOR A;  4KGI A;  4JR6 A;  4TXV A;  2R0P A;  4N11 A;  1X9S B;  3I9V 2;  1M99 A;  5DAK B;  4D73 A;  4TR3 A;  1GL8 A;  4Q5F A;  1SK1 A;  2IMK A;  4G10 A;  3FR3 A;  5ELA A;  2HFD A;  4WF4 A;  1JLW A;  4TRX A;  3VWV A;  5J9C A;  2K8V A;  3DRN A;  4V2M A;  5IQY A;  1TK5 B;  2OBK A;  3Q19 A;  4EL1 A;  2H1G A;  2X99 A;  4EKZ A;  2H6Y A;  5CRW A;  1VF1 A;  4AJ7 A;  4L5O A;  4I6X A;  1M9B A;  4K8M A;  4CY6 A;  3IE3 A;  3PR8 A;  2H0G A;  1DE2 A;  2R5G A;  3FHK A;  3VI5 A;  1VRS D;  4HU9 A;  3KD0 A;  1QMV A;  2I3Y A;  3VFI A;  2FGX A;  2C0D A;  2TIR A;  4ZBB A;  1ABA A;  3APO A;  1PX7 A;  3BCI A;  3VK9 A;  2VCX A;  2C0F A;  2ZUP A;  3LFL A;  2WJU A;  4G19 A;  3DEX A;  4XS4 A;  3TKQ A;  4ZL7 A;  1SYR A;  4GQC A;  4IKH A;  4O7H A;  3DYR A;  3L9S A;  2H6X A;  1V40 A;  1K0O A;  1ZMA A;  1R5P A;  2A4H A;  2XBI A;  2PWJ A;  3ERG A;  2H75 A;  3KMN A;  3TKS A;  22GS A;  3TKP A;  5LNK e;  2NDO A;  4IQ1 A;  1I5G A;  5ECQ B;  4WR5 A;  4HZ2 A;  2PPT A;  2B5X A;  3Q74 A;  1AXD A;  1QK8 A;  3W8J A;  2YZU A;  1KTE A;  1FOV A;  3M9K A;  1KBN A;  1GSU A;  3CSJ A;  2OAD A;  4EDY A;  2HZE B;  1PMT A;  3D4M A;  2V1M A;  3ZFB A;  3KJY A;  3IA1 A;  2ZCT A;  3TOU A;  3FZ4 A;  4XRA A;  2IMF A;  1GUK A;  1ERT A;  4NHZ A;  2C3N A;  4XCS A;  3ERW A;  1XVQ A;  2C80 A;  4BVX B;  1USB A;  2WFC A;  5HR3 A;  4NMU A;  3EMX A;  1XOB A;  2BJX A;  4K7N A;  3EPT A;  4BWQ A;  3G9B A;  2GQM A;  3WGX A;  2HT9 A;  1NHO A;  2CT6 A;  5GSS A;  2E7P A;  2LQO A;  2C4J A;  1S3R A;  5ECO B;  3P8W A;  1DE1 A;  3UAR A;  1OC9 A;  2VAF A;  1NW2 A;  2PGT A;  4CDO A;  2HXK A;  2IME A;  5GAP D;  4ML6 A;  1A8Y A;  2PMT A;  3U5R E;  1XW5 A;  4GLT A;  1FO5 A;  5G1L A;  5D9T A;  3ZML A;  2GQK A;  2HSM A;  2X49 A;  2VUP A;  3QMX A;  4HEA 2;  2AV4 A;  1TOF A;  4IBP A;  3GUS A;  4YH2 A;  3TRQ A;  4EXJ A;  2NPB A;  2GZY A;  2IN3 A;  1DBY A;  1GSF A;  3C1R A;  4O32 A;  4MMM A;  1T00 A;  3CQF A;  1ZYE A;  2DJ2 A;  2L6D A;  4MPF A;  5AIS A;  2B7K A;  4RQX A;  2IPA A;  1RW1 A;  2R37 A;  2HRF A;  2H1A A;  1KEB A;  1I9D A;  2LNT A;  2LRN A;  2L57 A;  4XS1 A;  4MF5 A;  2FA8 A;  3F63 A;  1PKZ A;  1IYH A;  2WRT A;  3UJ1 A;  4IVF A;  1QFN A;  4RQR A;  5DQS A;  5AN1 A;  1X0R A;  3M3M A;  3GTU B;  3LEF A;  2GVP A;  5G1K A;  4L0U A;  4OFN A;  2YNX A;  3BCK A;  2XPE A;  2WZ9 A;  3UBL A;  1Z5Y E;  2MBS A;  3GRX A;  4OFT A;  1AW9 A;  4ID0 A;  2YJH A;  3HYP A;  4YAV A;  4XRD A;  1W89 A;  4ZIJ A;  1XFL A;  1GTB A;  5ELG A;  1JHB A;  3GV1 A;  3GH9 A;  3EVI A;  3P2A A;  2OJL A;  2H30 A;  5HFG A;  2LJA A;  3HJO A;  5D9W A;  5KN2 A;  3IHQ A;  3WT1 A;  4Q5Q A;  3IK7 A;  3KGK A;  4IJI A;  4KSO A;  4Q5N A;  1O85 A;  1K0N A;  3EE2 A;  3QAV A;  2XPD A;  4ACS A;  1YZX A;  4YQV A;  3VPT A;  1FB0 A;  2E2M A;  2KP2 A;  1M9A A;  1AQX A;  2H74 A;  3DIE A;  3CXG A;  3CBU A;  4OCF A;  5ECS A;  2GZP A;  1K0A A;  2DKI A;  4MZB A;  3FZ9 A;  1BJX A;  1OE7 A;  4N10 A;  2LQQ A;  3D0Z A;  1WE0 A;  5IPH A;  1SK2 A;  2IFQ A;  2I4A A;  3BOA A;  1Z7R A;  2B1L A;  3N5O A;  2VCZ A;  1XW9 A;  3C7M A;  3M0F A;  3HKR A;  4BPY A;  1GLQ A;  3HVX A;  2B1K A;  3W8S A;  1XW6 A;  1A24 A;  1U3I A;  4IN0 A;  5G5E A;  2L5L A;  3GN3 A;  1Y25 A;  3GKK A;  4PUA A;  5F05 A;  3VUR A;  2FNO A;  4K1F A;  4JR4 A;  3WYW A;  3EWL A;  5B6M A;  3GIX A;  2CA8 A;  4IJ3 A;  4LMV A;  2JZT A;  2YWM A;  3QR6 A;  1GSS A;  3LGC A;  3L0H A;  2RUF A;  2QC7 A;  3HJM A;  2C0E A;  4TXO A;  1OC3 A;  3IOS A;  2YV9 A;  1ZYQ B;  3CRU A;  2LS5 A;  4YQM A;  1OYJ A;  2GSQ A;  4G0I A;  3D6I A;  4ZXG A;  2MMZ A;  2OBI A;  3ED3 A;  2HZF A;  3NOF A;  3E9J B;  3GKM A;  1GH2 A;  2NVL A;  3GHA A;  1SJI A;  2IWT A;  4BWS A;  1PX6 A;  1HNA A;  1OKT A;  4K2X A;  5DQY A;  3I6A A;  3GKX A;  1B9X C;  2CZ3 A;  1ZOF A;  3F8U A;  4G9H A;  4NV2 A;  4ZBD A;  2PER A;  1MDK A;  2B5Y A;  3PIN A;  4JRR A;  1O6J A;  1XPV A;  5DJM A;  3NIV A;  2EIQ A;  4TN8 A;  3ZVJ A;  3RPN A;  1K0C A;  2NBS A;  4E8H A;  3IHG A;  4HS1 A;  1N2A A;  2MMA A;  3RHC A;  4IW9 A;  5FT3 A;  4ULX A;  4MF6 A;  4PGT A;  3R2Q A;  4POK A;  5HR0 A;  1TRW A; 
#chains in the Genus database with same CATH homology
 1VF3 A;  2G0F A;  3MWH A;  2Z9S A;  2O87 A;  2LJR A;  1M7T A;  2LKU A;  1CQH A;  3IR4 A;  2HSY A;  1XWK A;  5FHI A;  1FHE A;  2KOK A;  1HNC A;  3I43 A;  2C1Y A;  5E59 A;  1SL2 B;  3Q6O A;  3FMW A;  2QGV A;  2DC5 A;  1XWG A;  2DSA A;  5DAK A;  1X5E A;  1TRU A;  4KAE A;  3RPP A;  5IOX A;  4OD7 A;  2C3T A;  4PNG A;  3LG6 A;  4MNN A;  2A2S A;  1J9B A;  4KA0 A;  4F9Z A;  1RQM A;  4OO4 A;  1B48 A;  5KN0 A;  5EL8 A;  9GSS A;  1GSY A;  3LQ7 A;  5ECL B;  2E0Q A;  5J41 A;  1MTC A;  1G6W A;  3HD5 A;  3EIN A;  1YQ1 A;  1HNB A;  5HFK A;  4V1A p;  2EC4 A;  2VLT A;  3DVX A;  2H72 A;  4L8E A;  5ECK B;  2FY6 A;  1BAY A;  4MK3 A;  4FO5 A;  4GST A;  5HQP A;  2B3S A;  4PQH A;  4I2T A;  1IYI A;  1GTU A;  3LSZ A;  2KHP A;  4YKG A;  5H5S A;  1Z6N A;  3IV4 A;  1OE8 A;  1MEK A;  1A0R P;  4TW5 A;  5KEJ A;  2L4C A;  3RBT A;  1UA5 A;  1E2Y A;  3IPZ A;  3EYT A;  4DSS B;  2WGR A;  2F8A A;  2M46 A;  1H75 A;  2BTO T;  1R26 A;  1X5C A;  4JE1 A;  3D21 A;  4NWY A;  1SD8 A;  2HYX A;  4NAX A;  4K9Z A;  2X8C A;  3ZRE A;  2X64 A;  4HQS A;  2HZE A;  2ZNM A;  1S3A A;  3KZQ A;  5DJL A;  3LYP A;  1YF0 A;  2C8U A;  4J57 E;  1V9W A;  1ZYP A;  3TJF A;  5IOW A;  3W6G A;  1PD2 1;  3MSZ A;  1FVJ A;  3ZRD A;  2J23 A;  2FWE A;  2VL9 A;  2O7K A;  4BVX A;  4ECB A;  4XTS A;  2LEG A;  4Z2U A;  1F9M A;  4YAP A;  2WS2 A;  3QFA C;  3I69 A;  2H0H A;  2HSH A;  2H0I A;  1PGT A;  4YQU A;  1G7O A;  1TK0 B;  2TRX A;  2CQ9 A;  2RM5 A;  1A2J A;  1JZR A;  2B6M A;  2RM6 A;  4FQU A;  3H1N A;  4TOP A;  5DCG A;  2VM1 A;  3HVV A;  2H1D A;  3L78 A;  2X8G A;  1JZO A;  1V58 A;  3RHB A;  2IJY A;  1EV9 A;  1F3B A;  2PVO C;  4K5R A;  4WBJ A;  2ON5 A;  2I81 A;  1URM A;  5ECN B;  2V32 A;  5DBQ A;  5IMF A;  2P31 A;  2CVK A;  4MF7 A;  1DSB A;  3V1W A;  1VGL A;  4J56 E;  2FCH A;  1JZW A;  3MDK A;  2CX3 A;  2REM A;  4MH2 A;  3KTL A;  5DCH A;  4F03 A;  2IMI A;  1EV4 A;  2BMX A;  4G2E A;  4V2N A;  3HJP A;  18GS A;  3FEU A;  1Y6E A;  1EOH A;  1O7U A;  1YEX A;  4PXO A;  4MDC A;  4TR1 B;  2FUG 2;  1G7E A;  1AIU A;  3O3T A;  4FH8 A;  1FB6 A;  2YWI A;  2A2R A;  3IC8 A;  3GX0 A;  5ECR B;  1PL1 A;  1Z6M A;  1JFU A;  4OCE A;  1K3O A;  3GTU A;  3F4R A;  1EGO A;  3LYK A;  4KDU A;  1DUG A;  3Q18 A;  3TOT A;  5IIZ A;  3A5I A;  4POM A;  4EE0 A;  4KW6 A;  2R0G A;  1B9Y C;  5A4W A;  4XS4 B;  3ZIV A;  4EC0 A;  1ON4 A;  5KOX A;  6GST A;  3H93 A;  4POL A;  1U6T A;  4OMV A;  4ZL8 A;  3VI7 A;  4RI6 A;  3GYK A;  4XS6 A;  4MA9 A;  2KLX A;  1LBK A;  1MD4 A;  3LW9 A;  2LRT A;  4LL4 B;  1WJK A;  5GZZ B;  1OAZ A;  1V57 A;  2GTU A;  3TRP A;  2HNL A;  2ES7 A;  4L5L A;  4IHU A;  5CP1 A;  2VOC A;  4PQI A;  2P5Q A;  1MD3 A;  4HJ2 A;  4PQ1 A;  4GRF A;  4A5P A;  3GL5 A;  1FW1 A;  2IIY A;  4G0K A;  2GQL A;  3UVT A;  1SKS B;  2FWG A;  4V1A g;  1J08 A;  2QA2 A;  2L6C A;  2P5R A;  1TRV A;  1WWJ A;  1R5A A;  4HJM A;  1PKW A;  2ALB A;  1GTA A;  1M2B A;  5D73 A;  3RDW A;  1ZL9 A;  2H66 A;  2YWO A;  2I1U A;  4OWY A;  3QOU A;  4H86 A;  3ZFL A;  2VCV A;  3M1G A;  4ML1 A;  1M2D A;  2CAI A;  1NHY A;  2H73 A;  3HVS A;  4IQA A;  3TJJ A;  1MDJ A;  1T1V A;  5ENU A;  5DDL A;  1BQ7 A;  3IAS 2;  3LWA A;  2B7J A;  1TTZ A;  1TI3 A;  2V2G A;  2VLV A;  3EMP A;  5E4W A;  5KN1 A;  3IRA A;  2AHE A;  4POB A;  3GKN A;  1AQW A;  4DSQ A;  1PL2 A;  3CSI A;  4EDZ A;  3UIW A;  5G5F A;  3FZ5 A;  4KDY A;  4DEJ A;  2YJ7 A;  4N0V A;  3QAG A;  5B6N A;  1SEN A;  4EIP A;  4DSR A;  1G6Y A;  2JAC A;  4NXI A;  2D2Z A;  4I2U A;  2J9H A;  2K8S A;  5CYY A;  3GUR A;  1T8E B;  4NV5 A;  1TK8 B;  2VLU A;  4O5Q A;  3SWL A;  2FWF A;  2M80 A;  1WP0 A;  5HR1 A;  2GLR A;  1EWX A;  1SD9 A;  1GUH A;  2YAN A;  3APS A;  4WXT A;  2PUK C;  2JAD A;  1PA3 A;  3ZVJ D;  4PX1 A;  1XXU A;  2L59 A;  3GST A;  4IGJ A;  3OR5 A;  4DVC A;  4EF0 A;  1BX9 A;  1A2M A;  1GSE A;  4F0C A;  3KCM A;  1EZK A;  5GST A;  3ZL5 A;  3ZTL A;  1V98 A;  2ON7 A;  4AF2 A;  4TKY A;  2OA7 A;  5EY6 A;  3PH9 A;  3EU4 A;  2QA1 A;  2VCQ A;  4ZL9 A;  1TW9 A;  1Q4J A;  4RI7 A;  3IDV A;  4IP6 A;  2EIO A;  3TJK A;  5C04 A;  1TKD B;  2GGT A;  20GS A;  3NZN A;  3US3 A;  3ISO A;  1R4W A;  2LST A;  3HHV A;  4HZ4 A;  4PUR A;  1W4V A;  3FKF A;  4PUF C;  2CVB A;  3HZ8 A;  1ZGN A;  2AJQ B;  2MMO A;  2FD3 A;  1EEM A;  3ME8 A;  3BBY A;  3MYD A;  3BJ5 A;  1THO A;  3GL3 A;  1SKW B;  1M0U A;  2OE3 A;  2DLX A;  5D93 A;  5CAX A;  3K8N A;  5EPF A;  3DXB A;  2YPM A;  2LJK A;  2V6O A;  1YEP A;  2DJ0 A;  3RAZ A;  4WF5 A;  2YOI A;  3D22 A;  2RUE A;  2N5A A;  4USS A;  1ML6 A;  3TJB A;  4FYU A;  4FYB A;  4F0B A;  5DAL B;  11GS A;  1GP1 A;  2A4V A;  1EEJ A;  4MJE A;  1FG4 A;  16GS A;  1ZYN A;  3A3T A;  2N5B A;  1O73 A;  4BL7 B;  4Z2R A;  1GWC A;  4J2F A;  4LLR A;  2DJ1 A;  3FK8 A;  3CYN A;  1YF1 A;  2AAW A;  4CW9 A;  4DSS A;  3UBK A;  3HA9 A;  3UOM A;  1M2A A;  4N0Z A;  3F4T A;  1QXH A;  14GS A;  3KMO A;  1T4Z A;  4O5R A;  4EUY A;  4I5Q A;  5J5N A;  4Z7X A;  4MCU A;  1GNE A;  1KNG A;  1UC7 A;  1TP9 A;  3VWW A;  2PBJ A;  4ECJ A;  1SK0 A;  2PN8 A;  2JZR A;  1EOG A;  4F82 A;  1YDK A;  2DJJ A;  3DGQ A;  1XBS A;  4Q5R A;  5CRE A;  5HR2 A;  1X9W B;  1S3D A;  3HXS A;  5G31 A;  2KUC A;  4YKF A;  4F2I A;  2DJK A;  2F51 A;  3UL3 A;  4FIW A;  3HCZ A;  5EVO A;  3VPQ A;  2AYT A;  5JCU A;  3L4N A;  1TU8 A;  1VF2 A;  5D8I A;  2HI7 A;  4MJA A;  4JED A;  1VF4 A;  2GDR A;  1WRY A;  1PSQ A;  1X5D A;  1JZD A;  5ABR A;  1XVW A;  1HQO A;  2LRC A;  1GRX A;  2YWN A;  3P7X A;  4ECC A;  3C71 A;  4XHM A;  2RII A;  1O81 A;  5CRG A;  2HLS A;  1PQN A;  4AGS A;  4PTS A;  5JCG A;  1H4O A;  2GZZ A;  2YN1 A;  2VL2 C;  3KTB A;  2AB6 A;  2KP1 A;  5LD0 A;  4ZIL A;  3TKR A;  2YP6 A;  1OVN A;  2NTO A;  1GSD A;  12GS A;  2DJ3 A;  5CO3 A;  3VWU A;  3M8N A;  2WB9 A;  7GSS A;  5HFI A;  4MPG A;  2M72 A;  1F3A A;  5ECH B;  2VM2 A;  5J9B A;  3KH7 A;  1R7H A;  3IBH A;  4AJ8 A;  4MJC A;  3F0I A;  5B8A A;  2R4V A;  2JSY A;  1G0T A;  3F9U A;  2H76 A;  4TR1 A;  3QAW A;  4HQZ A;  2DML A;  1SJZ A;  2VCW A;  3UAP A;  2HRA A;  2CVD A;  4WEY A;  1XWB A;  2GT5 A;  3PPU A;  5IO0 A;  4K7O A;  4HUA A;  2TRC P;  2C3Q A;  5A4U A;  2K6V A;  2H6Z A;  1X9M B;  4HU7 A;  5A5K A;  1U88 A;  4P3Y B;  2P0G A;  5ID2 B;  2VL3 A;  3FR9 A;  4IP1 A;  4X43 A;  3TDG A;  5CRD A;  1WMJ A;  5KN3 A;  19GS A;  3IAM 2;  4IS0 A;  2GST A;  4BVY B;  2N5F A;  1OKD A;  3KXO A;  1XZO A;  3EUR A;  2GT6 A;  5KOW A;  1WIK A;  2CZ2 A;  1A23 A;  2X8H A;  4ZB8 A;  1K0M A;  1UN2 A;  1T3B A;  4FYC A;  1U87 A;  2XC2 A;  4D73 B;  2DIY A;  5D9V A;  3VWX A;  5G2Z A;  1B8X A;  3C8E A;  3S9F A;  1TI1 A;  3FY7 A;  1ERW A;  1F6M C;  2OE0 A;  4JBB A;  1F37 A;  3GNJ A;  1V2A A;  3G7I A;  1UVZ A;  3IC4 A;  4WKW A;  3GMF A;  1ILO A;  3GH6 A;  4LL1 B;  5FWG A;  1SYX A;  3ZLP A;  1XOA A;  2G2Q A;  3TUE A;  1EP7 A;  3QPM A;  4ZB6 A;  4GF0 A;  4QL7 A;  4KND A;  5IMV A;  4ISD A;  2HRN A;  2O8V B;  1NM3 A;  3CTG A;  4X0X A;  2V41 A;  1PN9 A;  5IMD A;  4X4J A;  2LV3 A;  3H79 A;  2O85 A;  1NSW A;  2PVQ A;  4ZBA A;  3F6D A;  4ILF A;  3EU3 A;  2O89 A;  3WGE A;  3ZYW A;  2F3M A;  4K0N A;  3DWV A;  5IMZ A;  1Q98 A;  6GSS A;  1E6B A;  2MYG A;  4GSS A;  1YJ6 A;  5A4V A;  1TU7 A;  4WET A;  2MMN A;  3UMA A;  4MAB A;  1CQG A;  1F2E A;  3KIJ A;  3KM6 A;  5H5R A;  2WDU A;  2YCD A;  3GSS A;  4OO5 A;  1BYE A;  4I97 A;  4GQF A;  4WBR D;  3G7Y A;  5CNW A;  1THX A;  5G30 A;  3A2V A;  1XIY A;  4LA1 A;  5IPG A;  2GSR A;  3HDC A;  3L9V A;  3R3E A;  5IMA A;  1EP8 A;  1FVK A;  3IXR A;  1XCC A;  1BG5 A;  2A2P A;  3TJG A;  3F3Q A;  4LMW A;  3GA4 A;  4IEL A;  1A2L A;  1ERV A;  4TR0 A;  4O5U A;  2QSI A;  2DBC A;  2DMM A;  1U3A A;  2VCT A;  5AIX A;  1Z7P A;  5ECI B;  5D96 A;  3EC3 A;  3QDN A;  3ZZX A;  3MIX A;  1ZZY A;  2MBT A;  3JCM L;  1A0F A;  2JSZ A;  3KH9 A;  2VIM A;  3D4T A;  5C00 A;  2E2G A;  2IL3 A;  5BRT A;  1AAZ A;  3WT2 A;  3A5W A;  1B4P A;  2WUL A;  2XHF A;  4EO3 A;  1MDI A;  4GCI A;  3A2W A;  3J7Y b;  2K9F A;  2B5E A;  4TR4 A;  6GSW A;  1EGR A;  5BMU A;  3F4S A;  4KF9 A;  2JZS A;  4KUN A;  4AJ6 A;  3WGD A;  3HZ4 A;  1OC9 B;  3L9U A;  5ECP B;  4EIQ A;  3C1S A;  1TDI A;  1B4Q A;  5J4U A;  3ZIJ A;  2R2J A;  4KCE A;  4RUV A;  2AUV A;  3O76 A;  3AY8 A;  4L0W A;  1TJD A;  1WPI A;  3O6T A;  1GUM A;  4KDX A;  4E8E A;  3ZIT A;  2HE3 A;  5JWO B;  3DVW A;  4KB3 A;  2JL4 A;  1K0B A;  2L4Q A;  1PRX A;  2VL2 A;  4GTU A;  2FLS A;  1AUC A;  5DVB A;  3DML A;  4MP4 A;  4XIH A;  2R0C A;  1GSQ A;  2YV7 A;  1OC8 A;  4MZC A;  3FRC A;  4TVE A;  4HOJ A;  1A8L A;  2H8L A;  4KH7 A;  4JU5 A;  4O92 A;  6GSX A;  4NPB A;  2FHE A;  1XWC A;  2H70 A;  2I9H A;  3H8Q A;  3CSH A;  5D9X A;  6GSY A;  1J0F A;  1HD2 A;  2X4A A;  3TKS C;  5DAL A;  4MJB A;  1YKC A;  2F8F A;  1FAA A;  2UZ8 A;  4BL7 A;  4HI7 A;  4QQ7 A;  6GSV A;  2OKA A;  4GSN A;  2VD1 A;  3UEM A;  2EIR A;  1RK4 A;  4JZQ A;  4V2L A;  4K2D A;  5AGY A;  3U6V A;  4ICY A;  4OFM A;  3KP8 A;  3E3E A;  4MH3 A;  3KP9 A;  17GS A;  4X1U A;  5CRH A;  3DKS A;  1ACV A;  4K5S A;  3BD2 A;  4KE3 A;  1SKR B;  1GUL A;  2K18 A;  1LJR A;  2H71 A;  1YKA A;  1SL1 B;  4KX4 A;  1Z3E A;  1QGV A;  1LU4 A;  4WR4 A;  5F07 A;  2MZC A;  2F9S A;  2PU9 C;  1ZCP A;  3LJR A;  5IO2 A;  5INY A;  5AIV A;  1PN0 A;  1GTI A;  1FOH A;  5B8B A;  1T4Y A;  8GSS A;  1YY7 A;  5L71 A;  4PNF A;  3QD9 A;  5LCZ A;  4CY8 A;  2CAQ A;  4K6X A;  3FZA A;  3APQ A;  2IMD A;  2XBQ A;  5JWR B;  2IFQ B;  2C0G A;  2FA4 A;  1TRS A;  3SBC A;  1T7P B;  3ERF A;  3WD6 A;  3MNG A;  3TRX A;  3C73 A;  2VD0 A;  6GSU A;  3TGZ A;  3GX8 A;  3F3R A;  5GAN D;  5IM9 A;  4KSM A;  3QFB C;  3ME7 A;  1AQV A;  4KCA A;  1SJ6 A;  3FW2 A;  2R3X A;  1AC1 A;  1JLV A;  5IMC A;  1HYU A;  4ECI A;  4QL9 A;  3CMI A;  3TKS E;  1K3L A;  3P90 A;  2LUS A;  3FR6 A;  5F0G A;  3M9J A;  4K0G A;  13GS A;  2H01 A;  3N9J A;  3ZMK A;  4TXO B;  5B7C A;  1Z9H A;  3TB2 A;  5JCW A;  4GWR A;  3D5J A;  2QKE A;  2CX4 A;  2L5O A;  1GNW A;  1QQ2 A;  1O8W A;  3UVH A;  2H1B A;  3DD3 A;  2LNS A;  4K7I A;  5H5Q A;  1GLP A;  3IK9 A;  5F06 A;  2DIZ A;  3A2X A;  3F6F A;  4HDE A;  1K0D A;  1ERU A;  3VLN A;  2JU5 A;  3E0U A;  2HRK A;  1TXX A;  1O8X A;  4ZB9 A;  5JWQ B;  4GXZ A;  2OAC A;  2DKH A;  5J3R A;  1QUW A;  3LXT A;  4MZW A;  2H19 A;  1C72 A;  2GSS A;  3LXZ A;  5F8B A;  3CRT A;  4NHW A;  2OE1 A;  3TCO A;  4CHS A;  1K3Y A;  3GFK A;  3FYG A;  4BA7 A;  3H4K A;  4I8B A;  2VO4 A;  1ST9 A;  2FWH A;  5ID2 A;  2LTK A;  2CV4 A;  4Z2T A;  1WOU A;  3HY2 A;  3QCP A;  4G0L A;  2GS3 A;  4MLY A;  1S3C A;  4BVY A;  2RLI A;  10GS A;  2YZH A;  4N30 A;  3MAK A;  3CTF A;  5COH A;  3G7J A;  5ECM B;  3PGT A;  2R6K A;  1BED A;  3KEB A;  4EVM A;  1SU9 A;  1XWA A;  1SL0 B;  3J7Y k;  2WCI A;  1N8J A;  2V6K A;  3LOR A;  4KGI A;  4JR6 A;  4TXV A;  2R0P A;  4N11 A;  1X9S B;  3I9V 2;  1M99 A;  5DAK B;  4D73 A;  4TR3 A;  1GL8 A;  4Q5F A;  1SK1 A;  2IMK A;  4G10 A;  3FR3 A;  5ELA A;  2HFD A;  4WF4 A;  1JLW A;  4TRX A;  3VWV A;  5J9C A;  2K8V A;  3DRN A;  4V2M A;  5IQY A;  1TK5 B;  2OBK A;  3Q19 A;  4EL1 A;  2H1G A;  2X99 A;  4EKZ A;  2H6Y A;  5CRW A;  1VF1 A;  4AJ7 A;  4L5O A;  4I6X A;  1M9B A;  4K8M A;  4CY6 A;  3IE3 A;  3PR8 A;  2H0G A;  1DE2 A;  2R5G A;  3FHK A;  3VI5 A;  1VRS D;  4HU9 A;  3KD0 A;  1QMV A;  2I3Y A;  3VFI A;  2FGX A;  2C0D A;  2TIR A;  4ZBB A;  1ABA A;  3APO A;  1PX7 A;  3BCI A;  3VK9 A;  2VCX A;  2C0F A;  2ZUP A;  3LFL A;  2WJU A;  4G19 A;  3DEX A;  4XS4 A;  3TKQ A;  4ZL7 A;  1SYR A;  4GQC A;  4IKH A;  4O7H A;  3DYR A;  3L9S A;  2H6X A;  1V40 A;  1K0O A;  1ZMA A;  1R5P A;  2A4H A;  2XBI A;  2PWJ A;  3ERG A;  2H75 A;  3KMN A;  3TKS A;  22GS A;  3TKP A;  5LNK e;  2NDO A;  4IQ1 A;  1I5G A;  5ECQ B;  4WR5 A;  4HZ2 A;  2PPT A;  2B5X A;  3Q74 A;  1AXD A;  1QK8 A;  3W8J A;  2YZU A;  1KTE A;  1FOV A;  3M9K A;  1KBN A;  1GSU A;  3CSJ A;  2OAD A;  4EDY A;  2HZE B;  1PMT A;  3D4M A;  2V1M A;  3ZFB A;  3KJY A;  3IA1 A;  2ZCT A;  3TOU A;  3FZ4 A;  4XRA A;  2IMF A;  1GUK A;  1ERT A;  4NHZ A;  2C3N A;  4XCS A;  3ERW A;  1XVQ A;  2C80 A;  4BVX B;  1USB A;  2WFC A;  5HR3 A;  4NMU A;  3EMX A;  1XOB A;  2BJX A;  4K7N A;  3EPT A;  4BWQ A;  3G9B A;  2GQM A;  3WGX A;  2HT9 A;  1NHO A;  2CT6 A;  5GSS A;  2E7P A;  2LQO A;  2C4J A;  5ECO B;  3P8W A;  1DE1 A;  3UAR A;  1OC9 A;  2VAF A;  1NW2 A;  2PGT A;  4CDO A;  2HXK A;  2IME A;  5GAP D;  4ML6 A;  1A8Y A;  2PMT A;  3U5R E;  1XW5 A;  4GLT A;  1FO5 A;  5G1L A;  5D9T A;  3ZML A;  2GQK A;  2HSM A;  2X49 A;  2VUP A;  3QMX A;  4HEA 2;  2AV4 A;  1TOF A;  4IBP A;  3GUS A;  4YH2 A;  3TRQ A;  4EXJ A;  2NPB A;  2GZY A;  2IN3 A;  1DBY A;  1GSF A;  3C1R A;  4O32 A;  4MMM A;  1T00 A;  1ZYE A;  2DJ2 A;  2L6D A;  5AIS A;  4MPF A;  2B7K A;  4RQX A;  2IPA A;  1RW1 A;  2R37 A;  2HRF A;  2H1A A;  1KEB A;  1I9D A;  2LNT A;  2LRN A;  2L57 A;  4XS1 A;  4MF5 A;  2FA8 A;  3F63 A;  1PKZ A;  1IYH A;  2WRT A;  3UJ1 A;  4IVF A;  1QFN A;  4RQR A;  5DQS A;  5AN1 A;  1X0R A;  3M3M A;  3GTU B;  3LEF A;  2GVP A;  5G1K A;  4L0U A;  4OFN A;  2YNX A;  3BCK A;  2XPE A;  2WZ9 A;  3UBL A;  1Z5Y E;  2MBS A;  3GRX A;  4OFT A;  1AW9 A;  4ID0 A;  2YJH A;  3HYP A;  4YAV A;  4XRD A;  1W89 A;  4ZIJ A;  1XFL A;  1GTB A;  5ELG A;  1JHB A;  3GV1 A;  3GH9 A;  3EVI A;  3P2A A;  2OJL A;  2H30 A;  5HFG A;  2LJA A;  3HJO A;  5D9W A;  5KN2 A;  3IHQ A;  3WT1 A;  4Q5Q A;  3IK7 A;  3KGK A;  4IJI A;  4KSO A;  4Q5N A;  1O85 A;  1K0N A;  3EE2 A;  3QAV A;  2XPD A;  4ACS A;  1YZX A;  4YQV A;  3VPT A;  1FB0 A;  2E2M A;  2KP2 A;  1M9A A;  1AQX A;  2H74 A;  3DIE A;  3CXG A;  3CBU A;  4OCF A;  5ECS A;  2GZP A;  1K0A A;  2DKI A;  4MZB A;  3FZ9 A;  1BJX A;  1OE7 A;  4N10 A;  2LQQ A;  3D0Z A;  1WE0 A;  5IPH A;  1SK2 A;  2IFQ A;  2I4A A;  3BOA A;  1Z7R A;  2B1L A;  3N5O A;  2VCZ A;  1XW9 A;  3C7M A;  3M0F A;  3HKR A;  4BPY A;  1GLQ A;  3HVX A;  2B1K A;  3W8S A;  1XW6 A;  1A24 A;  1U3I A;  4IN0 A;  5G5E A;  2L5L A;  3GN3 A;  1Y25 A;  3GKK A;  4PUA A;  5F05 A;  3VUR A;  2FNO A;  4K1F A;  4JR4 A;  3WYW A;  3EWL A;  5B6M A;  3GIX A;  2CA8 A;  4IJ3 A;  4LMV A;  2JZT A;  2YWM A;  3QR6 A;  1GSS A;  3LGC A;  3L0H A;  2RUF A;  2QC7 A;  3HJM A;  2C0E A;  4TXO A;  1OC3 A;  3IOS A;  2YV9 A;  1ZYQ B;  3CRU A;  2LS5 A;  4YQM A;  1OYJ A;  2GSQ A;  4G0I A;  3D6I A;  4ZXG A;  2MMZ A;  2OBI A;  3ED3 A;  2HZF A;  3NOF A;  3E9J B;  3GKM A;  1GH2 A;  2NVL A;  3GHA A;  1SJI A;  2IWT A;  4BWS A;  1PX6 A;  1HNA A;  1OKT A;  4K2X A;  5DQY A;  3I6A A;  3GKX A;  1B9X C;  2CZ3 A;  1ZOF A;  3F8U A;  4G9H A;  4NV2 A;  4ZBD A;  2PER A;  1MDK A;  2B5Y A;  3PIN A;  4JRR A;  1O6J A;  1XPV A;  5DJM A;  3NIV A;  2EIQ A;  4TN8 A;  3ZVJ A;  3RPN A;  1K0C A;  2NBS A;  4E8H A;  3IHG A;  4HS1 A;  1N2A A;  2MMA A;  3RHC A;  4IW9 A;  5FT3 A;  4ULX A;  4MF6 A;  4PGT A;  3R2Q A;  4POK A;  5HR0 A;  1TRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...