3WT2A

Crystal structure of the b'-a' domain of thermophilic fungal protein disulfide isomerase (oxidized form)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
242
structure length
242
Chain Sequence
SPLIGEIGPETYSDYMSAGIPLAYIFAETAEERKELSDKLKPIAEAQRGVINFGTIDAKAFGAHAGNLNLKTDKFPAFAIQEVAKNQKFPFDQEKEITFEAIKAFVDDFVAGKIEPSIKSEPIPEKQEGPVTVVVAKNYNEIVLDDTKDVLIEFYAPWCGHCKALAPKYEELGALYAKSEFKDRVVIAKVDATANDVPDEIQGFPTIKLYPAGAKGQPVTYSGSRTVEDLIKFIAENGKYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Protein disulfide-isomerase
publication title Redox-dependent conformational transition of catalytic domain of protein disulfide isomerase indicated by crystal structure-based molecular dynamics simulation
doi rcsb
source organism Humicola insolens
total genus 68
structure length 242
sequence length 242
chains with identical sequence B, C
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2014-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3wt2A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3wt2A01
3GHAA 3M9JA 1QMVA 3EURA 1J0FA 1SD8A 1G6YA 3F4RA 5IOWA 5FT3A 1SYRA 5DVBA 1TDIA 2QC7A 4G19A 4MZBA 1Z7PA 2H01A 2R6KA 5HFIA 1M2BA 2J9HA 3GKXA 1XOBA 3J7Yk 2ZCTA 3ZZXA 2E2MA 1THXA 3M3MA 1GH2A 3VURA 5ECSA 1A0FA 2LJRA 5ECKB 1YEXA 4PXOA 3LXTA 1EZKA 4F82A 1QGVA 4V2LA 5D9TA 2H19A 1K0AA 4PUAA 5F07A 4TXOB 2BTOT 2XHFA 2XPDA 4ZL8A 3IHQA 4TR0A 1YDKA 4ZBAA 1S3CA 4X1UA 4OFNA 2MYGA 1DE2A 2IWTA 4PX1A 1GUHA 2P5QA 1V58A 3MSZA 3F3QA 3LYKA 3L0HA 1XWBA 4GQFA 1B9YC 2IMIA 3C71A 2H66A 4HQSA 4HI7A 1O8XA 4HJ2A 3C73A 3TRQA 14GSA 4TR3A 5E4WA 4JEDA 4RUVA 3M8NA 1RQMA 4TR1B 5IIZA 3LFLA 4JE1A 2LTKA 4ZB8A 3QMXA 3EU4A 3GNJA 3GH9A 4K8MA 5J4UA 4LMWA 5GAPD 2P5RA 2M46A 3IOSA 4IGJA 2LRNA 1PMTA 2E7PA 2NTOA 1SL1B 4AJ6A 3LGCA 4F03A 2L6DA 4Q5RA 4IQ1A 2OE0A 4POKA 2NBSA 3IV4A 1RW1A 4HZ2A 2VCQA 3KD0A 2GSSA 4IP6A 1BQ7A 4ISDA 3HYPA 2FNOA 1R5PA 4AJ7A 3LEFA 5DAKA 1WOUA 2DJJA 4X43A 2IMFA 4N10A 3GURA 1ACVA 1PX6A 2QKEA 1A0RP 2CA8A 3A5WA 1ON4A 5IMVA 2JZTA 3ZFBA 1M2AA 1ABAA 4PQIA 1DE1A 4RQXA 4EXJA 4EL1A 11GSA 1SYXA 3FHKA 2YJHA 1SL0B 2R37A 1OE7A 5F8BA 2B7JA 5G2ZA 4CW9A 2AHEA 2LUSA 19GSA 5H5SA 1SK2A 2I3YA 3TKQA 4MZWA 6GSUA 2LQQA 3WGDA 2VL9A 4XCSA 4EVMA 5CAXA 2H1AA 2VLUA 4Z7XA 1Z3EA 1DUGA 1PL2A 3G7YA 3H8QA 3PH9A 3ZL5A 2YV7A 5KN1A 3ZVJD 2HI7A 4JRRA 2OADA 4V1Ag 3F6DA 3M1GA 1K3LA 2B5EA 1XFLA 4NMUA 2OBKA 4HUAA 1W4VA 3UVHA 2J23A 2TRXA 3W8SA 5EY6A 3P8WA 1ERTA 1T1VA 1JLWA 3HVVA 4GF0A 2FHEA 2EIRA 3QFAC 2WS2A 4IJ3A 3GKKA 1M9AA 1TK5B 2GQLA 1BG5A 4L0UA 2WCIA 3QR6A 1SJIA 5B8BA 2O7KA 3WGEA 3HVXA 2N5FA 4KA0A 3QAWA 1SU9A 7GSSA 3K8NA 3P7XA 4MA9A 3Q6OA 2DJ0A 4BL7A 1KNGA 4MF5A 1JZWA 1UVZA 3HKRA 3KH9A 3Q18A 2AV4A 2HZEB 3WYWA 2I4AA 6GSSA 2YANA 5DQYA 1GUMA 1ST9A 2C0DA 1EV9A 2PVQA 4DSQA 1T8EB 5GAND 1OVNA 1WMJA 4HOJA 3UIWA 3FR9A 1FG4A 2F8FA 4IJIA 3QFBC 4V2NA 2PMTA 5GZZB 2ZUPA 1QUWA 4QL9A 1JZOA 1Z9HA 2ZNMA 2YJ7A 3GTUA 3BJ5A 4JZQA 5G1LA 4AF2A 4OCEA 2D2ZA 3QOUA 5KN3A 1S3DA 2HE3A 1XWCA 3KGKA 4YQVA 2YWOA 2N5BA 4GXZA 4HU7A 4MMMA 4Q5QA 5AGYA 3TKSA 1TK0B 5G30A 1VGLA 1G7OA 1TOFA 1TU8A 5D73A 3QAGA 2RM6A 3UMAA 5C00A 3KP9A 3C1RA 2CVBA 4KE3A 1TW9A 1ZL9A 3GUSA 4CDOA 4ECIA 1M0UA 2REMA 3TJJA 4MJEA 2VCVA 3E9JB 2B1KA 2EC4A 2TIRA 4EC0A 3D21A 5ID2A 5DALA 4XS4A 1EGRA 4L5LA 1GULA 3TJBA 3LYPA 4K1FA 3CSIA 4XS6A 5COHA 4ECCA 3CSJA 4POMA 1F6MC 3U5RE 4N11A 2IJYA 2CVKA 2TRCP 4QL7A 3TKPA 3VWXA 2FUG2 5E59A 4OO5A 3UAPA 4YAPA 2L6CA 3CTFA 2C3QA 2VL3A 20GSA 4PGTA 2VUPA 5D8IA 2VIMA 3G7JA 3F0IA 4TKYA 2PUKC 5JWQB 1YQ1A 1T3BA 1A2LA 5G5EA 1BYEA 3BCIA 4TVEA 1ML6A 5JCGA 2F51A 4I6XA 1ZCPA 1AAZA 2B3SA 1V98A 3HHVA 2VM2A 3GKMA 2DIYA 4F9ZA 3ISOA 2JU5A 4N0VA 4IW9A 3CBUA 2HLSA 1YF1A 3L9VA 2GQKA 1Z6NA 3F8UA 2VOCA 3M9KA 4DEJA 5JCWA 2VLTA 3V1WA 1ILOA 3PGTA 2YZHA 3CRTA 3IXRA 2H72A 5A5KA 4ZB9A 3F6FA 1GSDA 2LQOA 2WRTA 1YF0A 1V9WA 4PUFC 2VCTA 2A2RA 4I5QA 2HZFA 2HYXA 4POLA 4WXTA 3GN3A 2IFQB 2V32A 3D22A 3EMPA 3LXZA 3I43A 1BJXA 3CXGA 5CNWA 1FW1A 4DVCA 1F3AA 4BVYA 4AGSA 3ZTLA 5JWRB 1JHBA 5ECNB 1M7TA 1OE8A 4O7HA 5HFGA 4ZL9A 1HQOA 3APOA 2PU9C 3GSTA 2DBCA 2L4CA 4XIHA 3IC4A 1B4PA 3S9FA 2R4VA 4BWQA 1TXXA 2C0GA 4EDYA 2JZRA 1B9XC 2VO4A 1OAZA 3FZAA 1FVKA 1XW5A 4HDEA 5AIXA 1PKZA 2O89A 4TR4A 8GSSA 4YQMA 2B5YA 1M99A 4FYCA 5F0GA 2LNTA 1F3BA 1NSWA 4P3YB 3H79A 5ECOB 1WPIA 2OE1A 1GUKA 1H75A 2AB6A 2B6MA 1K0CA 3FZ4A 4OWYA 2PPTA 2ON5A 4EKZA 2HSYA 4GSSA 3DD3A 1GLPA 2GTUA 3KH7A 2YZUA 3TJGA 1GSUA 2FA8A 3D4TA 1GRXA 4PQHA 4MPGA 3RHBA 3H4KA 1MTCA 1OC9A 1HYUA 5ELAA 4EE0A 2HRFA 3MDKA 3APQA 5J9BA 3C8EA 1SKRB 3QAVA 5HR0A 2F9SA 2ON7A 3IDVA 4IS0A 2AYTA 1GWCA 3TJKA 2VAFA 1V40A 2L59A 4TOPA 5IMCA 1GNEA 3HY2A 4MZCA 1KTEA 3O76A 1XWKA 1E2YA 3IE3A 2YOIA 2L4QA 1OC8A 1PL1A 3W8JA 5HQPA 3BD2A 1IYIA 2DJ3A 2X8HA 4K9ZA 2FD3A 18GSA 2H6ZA 1EEJA 1QXHA 4I97A 1X9SB 3EINA 2V6OA 3VFIA 3HDCA 1USBA 1F9MA 1B48A 3EE2A 5EL8A 4EF0A 4J2FA 1A2MA 4ZBDA 3DMLA 3D5JA 4ZXGA 3EWLA 1PA3A 2VD1A 3ZIJA 6GSVA 1WJKA 1XW9A 1GP1A 3RDWA 1GTIA 3KZQA 1I9DA 2DIZA 2YWIA 1PRXA 4PNGA 3E0UA 3L9SA 3VI5A 4XRDA 3HCZA 4FYBA 1BEDA 1CQHA 5ENUA 2O87A 4TRXA 1A23A 3HJPA 2XBQA 1AQWA 4LA1A 4V2MA 5D9VA 1TTZA 2PN8A 3KMNA 1XWAA 1ZYEA 3FKFA 1TI1A 2OBIA 3FRCA 3TOUA 4J56E 5DCGA 4O5RA 5JWOB 3EC3A 1AW9A 3OR5A 4Q5NA 1EP8A 1KBNA 1ZOFA 1EV4A 1EOHA 4IQAA 1AIUA 2DSAA 1G7EA 2MMOA 1PSQA 3TCOA 3FK8A 5CRDA 4ML1A 3VPQA 4IN0A 5HR1A 3RBTA 2V6KA 6GSWA 3EVIA 2BJXA 1T7PB 3VK9A 3J7Yb 4ECBA 2KLXA 1OKDA 3A3TA 2VCZA 1GTAA 1YKCA 2YN1A 3Q19A 1H4OA 5L71A 2IMKA 5HR2A 3LQ7A 2C1YA 5ABRA 4WBRD 1TRUA 1DBYA 3VPTA 5DQSA 4KDYA 4JR6A 1XBSA 4MH3A 3UJ1A 5J5NA 4FIWA 1Q98A 1ERWA 1TU7A 3ZYWA 3L78A 3D4MA 5EVOA 2C4JA 1S3AA 3ZIVA 4NXIA 1HD2A 3BCKA 1DSBA 4QQ7A 3UEMA 3E3EA 2FWEA 4OMVA 4KSMA 1FHEA 3EYTA 5B6NA 3WT2A 2AAWA 1R5AA 2V2GA 5H5RA 3FZ5A 2FGXA 5ECLB 3UOMA 1K0BA 2NPBA 2FA4A 2B1LA 4WF4A 3IPZA 1ERUA 4L5OA 4LLRA 3G7IA 3F4TA 17GSA 4DSSA 2GZYA 4NV2A 2LJKA 4L8EA 4FYUA 1SJZA 1X9MB 2WDUA 1EWXA 3GMFA 1YZXA 1U87A 2Z9SA 1A24A 5DAKB 5EPFA 1XPVA 5KN0A 3UVTA 3EMXA 2LV3A 5D93A 2KOKA 4G9HA 1GSQA 2X8GA 4D73A 2MMZA 2IPAA 1EOGA 3DVXA 1FVJA 4WR5A 2ALBA 4KB3A 3KIJA 4GRFA 2HNLA 4H86A 1CQGA 2O8VB 4POBA 1XOAA 3UL3A 3I69A 1SENA 3P90A 2LSTA 4ZL7A 2HT9A 2E2GA 1SKSB 3UARA 5GSTA 4G2EA 3GRXA 2KUCA 1GSYA 3DVWA 4OD7A 3P2AA 1VF4A 2LRCA 5IMFA 3CYNA 4MJAA 3RAZA 5FWGA 1ZYQB 4OO4A 1ERVA 2OACA 4GSTA 3IK9A 4YQUA 5IPGA 5IMDA 4KX4A 3SWLA 3CSHA 3O6TA 4IVFA 2DC5A 3A2VA 3GL3A 1LU4A 3CTGA 3DEXA 4ML6A 4ECJA 1T00A 2HSHA 1AXDA 3HVSA 4XS1A 4WR4A 1FO5A 2XBIA 3D6IA 4K6XA 1W89A 3M0FA 2DJKA 4KCEA 2C3NA 2GVPA 1XZOA 1O81A 3TRXA 2OJLA 4MF7A 4HEA2 3TGZA 4K7OA 3L9UA 3TKSC 1GSSA 1FB0A 1X0RA 2L5LA 1IYHA 1GSEA 3DWVA 3TRPA 1K3YA 4Q5FA 2CX4A 5CRHA 1SD9A 5JCUA 1QFNA 5A4WA 3I6AA 2OE3A 5A4UA 5ECIB 4MH2A 1ZGNA 1HNAA 1GNWA 2H0HA 2RUFA 4MF6A 1YJ6A 2K18A 4V1Ap 1V2AA 3VI7A 3KTLA 4WEYA 1R4WA 2YCDA 1J9BA 5ELGA 3TJFA 2YPMA 5D96A 3VWUA 4GCIA 2K8SA 4ZILA 2C0EA 1TK8B 3GTUB 4JR4A 2VL2C 3LSZA 2JSYA 2FCHA 2C3TA 2WB9A 2KP2A 4TXOA 1NW2A 5DCHA 1X5CA 1XVWA 5J3RA 2V41A 1X9WB 3KJYA 1O8WA 3ME8A 3DYRA 3CRUA 3C7MA 5F05A 3FY7A 5ECRB 4E8EA 5C04A 1VF1A 1ZMAA 5B7CA 2M80A 2AJQB 4WETA 4OCFA 3LORA 4J57E 2CZ3A 2H74A 3WGXA 1PD21 2YP6A 3R2QA 2FY6A 2OKAA 2CAIA 2CZ2A 3HA9A 4GLTA 1C72A 4O92A 4TR1A 4KDXA 4K7NA 3TDGA 2PERA 1GTBA 5ID2B 3RPNA 5DALB 1O7UA 4XS4B 4PQ1A 2GSRA 3HZ4A 2B5XA 2HFDA 2L5OA 4ZB6A 2YWMA 3QD9A 3QCPA 1LJRA 3Q74A 1XVQA 3CMIA 3DIEA 3GH6A 16GSA 1BX9A 4PURA 3SBCA 4MDCA 4NAXA 2PVOC 3FR6A 5CO3A 1K3OA 4MJBA 5DDLA 2F8AA 4GWRA 2JZSA 2VM1A 13GSA 2JL4A 4TN8A 4ILFA 3I9V2 2CVDA 3QDNA 3PINA 2MMNA 1N2AA 2H1GA 3F9UA 3TB2A 3VWWA 2GQMA 1MDKA 3ZLPA 12GSA 4FO5A 6GSYA 2NDOA 2K6VA 3IAM2 6GSTA 3KP8A 5G31A 3RPPA 2O85A 4K0NA 3GL5A 2VCXA 4KCAA 2JACA 2H75A 2EIOA 3N5OA 1SK0A 4NHZA 2LRTA 3KXOA 4GQCA 4GTUA 5HR3A 3HZ8A 1NHYA 1GL8A 4N30A 3GA4A 1NM3A 1EP7A 2M72A 1UC7A 2MBSA 3FW2A 4XHMA 1Y6EA 2E0QA 3D0ZA 2LS5A 4I2UA 4MLYA 2RLIA 3LJRA 1JFUA 3FR3A 3N9JA 3UBKA 1WRYA 4NPBA 2C8UA 2A4VA 2KP1A 4K2DA 5AISA 4LMVA 2R3XA 2K9FA 3DGQA 5HFKA 5KEJA 5G5FA 2H6XA 4PNFA 3ZMKA 1GSFA 3O3TA 1U3IA 5DJMA 1AQVA 5LNKe 5IOXA 4MK3A 2QSIA 1K0DA 1XIYA 3IK7A 4HS1A 5IM9A 5IO0A 3ZFLA 1TRVA 3A2WA 4WKWA 5AIVA 2C0FA 2HZEA 2DMMA 2P0GA 5B8AA 1RK4A 1U88A 3ZMLA 3HXSA 2B7KA 2JADA 1VF2A 2P31A 5AN1A 4YAVA 4ZIJA 5CRWA 1NHOA 4IBPA 4MJCA 4TXVA 3TUEA 4HU9A 3IAS2 2WULA 1HNCA 2IIYA 4HJMA 1WWJA 5A4VA 1JZDA 1SJ6A 2CQ9A 10GSA 3WD6A 3H1NA 2MBTA 5J9CA 1WIKA 3U6VA 1B4QA 1X5EA 1GLQA 3H93A 1Z6MA 4EO3A 1OC9B 2IN3A 1U3AA 2YNXA 3GIXA 1QK8A 3F3RA 2G2QA 5IPHA 3HJOA 3MNGA 1O85A 2GDRA 3BBYA 3ME7A 3ZRDA 2VCWA 3ED3A 1TP9A 5DJLA 3ZITA 4NHWA 2LNSA 5GSSA 1XW6A 1PKWA 1F2EA 2VLVA 1SK1A 3BOAA 1A8YA 2CX3A 1B8XA 5H5QA 2FLSA 2RIIA 5B6MA 4KAEA 4FH8A 3DKSA 1R7HA 2R2JA 5KN2A 3TOTA 1M2DA 2BMXA 1R26A 1Z5YE 2CAQA 2R5GA 5CP1A 4OFMA 3AY8A 3MWHA 4NV5A 2FWHA 1T4ZA 4JU5A 4TW5A 3MAKA 3HJMA 1GTUA 3FEUA 1I5GA 4MABA 4F0BA 3VWVA 2H30A 2WZ9A 2YWNA 1O6JA 2RUEA 1OC3A 3IA1A 5FHIA 1XXUA 1YEPA 1AUCA 1MDIA 4XTSA 5ECHB 3DRNA 2EIQA 3NOFA 2K8VA 2X8CA 2FWFA 1TJDA 5IMZA 4BPYA 1YY7A 2XC2A 4O32A 1FOVA 3KTBA 3KMOA 1J08A 4JBBA 4EUYA 4F0CA 3ERFA 2F3MA 4LL4B 1PGTA 4HQZA 4N0ZA 5CRGA 2CV4A 4MPFA 2I9HA 1SL2B 3IR4A 2H0IA 2LJAA 5J41A 1PQNA 3APSA 3G9BA 2IFQA 4G10A 3C1SA 4YH2A 5ECQB 1JLVA 1KEBA 2DJ2A 2PWJA 3NIVA 4RQRA 5ECPB 1VRSD 2PGTA 1OKTA 1G6WA 2V1MA 2MZCA 2N5AA 5D9XA 1LBKA 1UN2A 2JSZA 2WFCA 4X0XA 1N8JA 2H71A 4KW6A 1OYJA 4CHSA 2H1DA 2GT5A 2GGTA 2IMDA 3KEBA 2AUVA 1UA5A 3F4SA 4ID0A 2I1UA 3GKNA 3FYGA 2GS3A 1URMA 3KCMA 5INYA 4KSOA 2WGRA 2GT6A 3HD5A 3ZREA 3US3A 1M9BA 4NWYA 1MD3A 4XRAA 5D9WA 2XPEA 1WP0A 1YKAA 4I8BA 3JCML 3QPMA 1BAYA 2VL2A 2H1BA 5CYYA 2WJUA 3GYKA 1AC1A 1PX7A 4WF5A 1T4YA 3NZNA 1ZZYA 4DSSB 1WE0A 2OA7A 3EU3A 3ZVJA 3LWAA 4IHUA 1E6BA 1K0OA 2L57A 3DXBA 1V57A 5LCZA 3LG6A 5LD0A 2H6YA 4KUNA 4AJ8A 3UBLA 2X64A 1FAAA 1K0NA 1A2JA 3W6GA 1MDJA 2H73A 5IQYA 4D73B 3A2XA 2CT6A 4KH7A 4LL1B 4KGIA 1Z7RA 2GZPA 4BA7A 3GV1A 2YV9A 1FB6A 1EGOA 4OFTA 4K7IA 2GSTA 1MD4A 5ECMB 1JZRA 1Q4JA 9GSSA 2KHPA 2LKUA 1AQXA 3GX0A 4GSNA 5F06A 2GSQA 4IP1A 4ULXA 1VF3A 4DSRA 2X99A 3PR8A 1PN9A 4EDZA 1MEKA 3RHCA 4BWSA 1A8LA 3ERGA 2HRNA 5G1KA 3IBHA 4L0WA 3FZ9A 3GFKA 2H0GA 1TRWA 2DLXA 2A2SA 3L4NA 4F2IA 4KNDA 2VD0A 1THOA 3IRAA 4RI7A 2NVLA 2DMLA 1TKDB 1X5DA 2DJ1A 22GSA 2GZZA 2QGVA 2LEGA 3TKRA 2H8LA 1U6TA 5IO2A 4MP4A 1K0MA 2GLRA 1G0TA 1XCCA 5IMAA 3VLNA 4ZBBA 1SKWB 4WBJA 1EEMA 1F37A 4ACSA 4RI6A 1HNBA 2IMEA 3GX8A 3WT1A 1TRSA 1QQ2A 2ES7A 1TI3A 2H76A 1Y25A 4K0GA 1O73A 3TKSE 4BVXA 5DBQA 2C80A 2PBJA 4HZ4A 1XWGA 4IELA 2H70A 4KDUA 2MMAA 2FWGA 3F63A 2G0FA 2RM5A 2IL3A 4I2TA 4MCUA 3ERWA 3KM6A 3GSSA 6GSXA 2HXKA 4E8HA 2I81A 4IKHA 5CREA
chains in the Genus database with same CATH superfamily
3GHAA 3M9JA 1QMVA 3EURA 1J0FA 1SD8A 1G6YA 3F4RA 5IOWA 5FT3A 1SYRA 5DVBA 1TDIA 2QC7A 4G19A 4MZBA 1Z7PA 2H01A 2R6KA 5HFIA 1M2BA 2J9HA 3GKXA 5BMUA 1XOBA 3J7Yk 2ZCTA 3ZZXA 2E2MA 1THXA 3M3MA 1GH2A 3VURA 5ECSA 1A0FA 2LJRA 5ECKB 1YEXA 4PXOA 3LXTA 1EZKA 4F82A 1QGVA 4V2LA 5D9TA 2H19A 1K0AA 4PUAA 5F07A 4TXOB 2BTOT 2XHFA 2XPDA 4ZL8A 3IHQA 4TR0A 1YDKA 4ZBAA 1S3CA 4X1UA 4OFNA 2MYGA 1DE2A 2IWTA 4PX1A 1GUHA 2P5QA 1V58A 3MSZA 3F3QA 3LYKA 3L0HA 1XWBA 4GQFA 1B9YC 2IMIA 3C71A 2H66A 2HRAA 4HQSA 4HI7A 1O8XA 4HJ2A 3C73A 3TRQA 14GSA 4TR3A 4BIKA 5E4WA 4JEDA 4RUVA 3M8NA 1RQMA 4TR1B 5IIZA 3LFLA 4JE1A 2LTKA 4ZB8A 3QMXA 3EU4A 3GNJA 3GH9A 4K8MA 4PTSA 5J4UA 4LMWA 5GAPD 2P5RA 2M46A 3IOSA 4IGJA 2LRNA 1PMTA 2E7PA 2NTOA 1SL1B 4AJ6A 3LGCA 4F03A 2L6DA 4Q5RA 4IQ1A 4G0LA 2OE0A 4POKA 2NBSA 3IV4A 1RW1A 4HZ2A 2VCQA 3KD0A 2GSSA 4IP6A 1BQ7A 4ISDA 3HYPA 2FNOA 1R5PA 4AJ7A 3LEFA 5DAKA 1WOUA 2DJJA 4K5SA 4X43A 2IMFA 4N10A 3GURA 1ACVA 1PX6A 2QKEA 1A0RP 2CA8A 3A5WA 1ON4A 5IMVA 2JZTA 3ZFBA 1M2AA 1ABAA 4PQIA 1DE1A 4RQXA 4EXJA 4EL1A 11GSA 1SYXA 3FHKA 2YJHA 1SL0B 2R37A 1OE7A 1M3JA 5F8BA 2B7JA 5G2ZA 4CW9A 2AHEA 2HRKA 19GSA 2LUSA 5H5SA 1SK2A 2I3YA 3TKQA 4MZWA 6GSUA 2LQQA 3WGDA 2VL9A 4XCSA 4EVMA 5CAXA 2H1AA 2VLUA 4Z7XA 1Z3EA 3A5IA 1DUGA 1PL2A 3G7YA 3H8QA 3PH9A 3ZL5A 2YV7A 5KN1A 3ZVJD 2HI7A 4JRRA 2OADA 2R0PA 4V1Ag 4X4JA 3F6DA 3M1GA 1K3LA 2B5EA 1XFLA 4NMUA 2OBKA 4HUAA 1W4VA 3UVHA 2J23A 2TRXA 3W8SA 5EY6A 3P8WA 1ERTA 1T1VA 1JLWA 4MNNA 3HVVA 4GF0A 2FHEA 2EIRA 3QFAC 2WS2A 4IJ3A 3GKKA 1M9AA 1TK5B 2GQLA 1BG5A 4L0UA 2WCIA 3QR6A 1SJIA 5B8BA 2O7KA 3WGEA 3HVXA 2N5FA 4KA0A 3QAWA 1SU9A 7GSSA 3K8NA 3P7XA 4MA9A 3Q6OA 2DJ0A 4BL7A 1KNGA 4MF5A 1JZWA 1UVZA 3HKRA 3KH9A 1M3IA 3Q18A 2AV4A 2HZEB 3WYWA 2I4AA 6GSSA 2YANA 5DQYA 1GUMA 1ST9A 2C0DA 1EV9A 4USSA 2PVQA 3HVNA 4DSQA 1T8EB 5GAND 1OVNA 1WMJA 4HOJA 3UIWA 3FR9A 1FG4A 2F8FA 4IJIA 3QFBC 4V2NA 2PMTA 5GZZB 2ZUPA 1QUWA 4QL9A 1JZOA 1Z9HA 2ZNMA 2YJ7A 2DKHA 3GTUA 3BJ5A 4JZQA 5G1LA 4AF2A 4OCEA 2D2ZA 3QOUA 5KN3A 1S3DA 2HE3A 1XWCA 3KGKA 4YQVA 2YWOA 2N5BA 4GXZA 4HU7A 4MMMA 4Q5QA 5AGYA 3TKSA 1TK0B 5G30A 1VGLA 1G7OA 1TOFA 1TU8A 5D73A 3QAGA 2RM6A 3UMAA 5C00A 3KP9A 3C1RA 2CVBA 4KE3A 1TW9A 1ZL9A 3GUSA 4CDOA 4ECIA 1M0UA 2REMA 3TJJA 4MJEA 2VCVA 3E9JB 2B1KA 2EC4A 2TIRA 4EC0A 3D21A 5ID2A 5DALA 4XS4A 1EGRA 4L5LA 1GULA 3TJBA 3LYPA 4K1FA 3CSIA 4XS6A 5COHA 4ECCA 3CSJA 4POMA 1F6MC 3U5RE 4N11A 2IJYA 2CVKA 2TRCP 4QL7A 3TKPA 3VWXA 2FUG2 4OO5A 5E59A 3UAPA 4YAPA 2L6CA 3CTFA 2C3QA 2VL3A 20GSA 4PGTA 2VUPA 5D8IA 2VIMA 3G7JA 3F0IA 4TKYA 2PUKC 5JWQB 1YQ1A 1T3BA 1A2LA 5G5EA 1BYEA 3BCIA 4TVEA 1ML6A 5JCGA 2F51A 4I6XA 1ZCPA 1AAZA 2B3SA 1V98A 3HHVA 2VM2A 3GKMA 2DIYA 4F9ZA 3ISOA 2JU5A 4N0VA 4IW9A 3CBUA 2HLSA 4CY6A 1YF1A 3IHGA 2GQKA 1Z6NA 3F8UA 3L9VA 2VOCA 3M9KA 4DEJA 5JCWA 1ZYPA 2VLTA 3V1WA 1ILOA 3PGTA 2YZHA 3CRTA 3IXRA 2H72A 5A5KA 4ZB9A 3F6FA 1GSDA 2LQOA 2WRTA 1YF0A 1V9WA 5KOXA 4PUFC 2VCTA 2A2RA 4I5QA 2HZFA 2HYXA 4POLA 4WXTA 3GN3A 2IFQB 2V32A 3D22A 3EMPA 3LXZA 3I43A 1BJXA 4Z2RA 3CXGA 5CNWA 1FW1A 4DVCA 1F3AA 4BVYA 4AGSA 3ZTLA 5JWRB 1JHBA 4Z2UA 5ECNB 1M7TA 1OE8A 4O7HA 5HFGA 4ZL9A 2X49A 1HQOA 3APOA 2PU9C 3GSTA 2DBCA 2L4CA 4XIHA 3IC4A 1B4PA 3S9FA 2R4VA 4BWQA 1TXXA 2C0GA 4EDYA 2JZRA 1B9XC 2VO4A 1OAZA 3FZAA 1FVKA 1XW5A 4HDEA 5AIXA 1PKZA 2O89A 4TR4A 8GSSA 4YQMA 2B5YA 1M99A 4FYCA 5F0GA 2LNTA 1F3BA 1NSWA 4P3YB 3H79A 5ECOB 1WPIA 2OE1A 1GUKA 4O5QA 1H75A 1XG8A 2AB6A 2B6MA 1K0CA 3FZ4A 4OWYA 2PPTA 2ON5A 4EKZA 2HSYA 4GSSA 1PFOA 3DD3A 1GLPA 2GTUA 3KH7A 2YZUA 3TJGA 1GSUA 2FA8A 3D4TA 1GRXA 4PQHA 4MPGA 3RHBA 4ICYA 3FMWA 3H4KA 1MTCA 1OC9A 1HYUA 5ELAA 3EPTA 2R0GA 4EE0A 2HRFA 3MDKA 3APQA 5J9BA 3C8EA 1SKRB 3QAVA 5HR0A 2F9SA 2ON7A 3IDVA 4IS0A 4FQUA 2AYTA 1GWCA 3TJKA 2VAFA 1V40A 2L59A 4TOPA 5IMCA 1GNEA 3HY2A 4MZCA 1KTEA 3O76A 1XWKA 1E2YA 3IE3A 2YOIA 2L4QA 1OC8A 1PL1A 3W8JA 5HQPA 3BD2A 1IYIA 2DJ3A 2X8HA 4K9ZA 2FD3A 18GSA 2H6ZA 1EEJA 1QXHA 4I97A 1X9SB 3EINA 2V6OA 3VFIA 3HDCA 1USBA 1F9MA 1B48A 3EE2A 5EL8A 4EF0A 4J2FA 1A2MA 4ZBDA 3DMLA 3D5JA 4ZXGA 3EWLA 1PA3A 2VD1A 3ZIJA 6GSVA 1WJKA 1XW9A 1GP1A 3RDWA 2HSMA 4BVXB 1GTIA 3KZQA 1I9DA 2DIZA 2YWIA 1PRXA 4PNGA 3E0UA 3L9SA 3VI5A 4XRDA 3HCZA 4FYBA 1BEDA 1CQHA 5ENUA 2O87A 4TRXA 1A23A 3HJPA 2XBQA 1AQWA 4LA1A 4V2MA 5D9VA 1TTZA 4YKGA 2PN8A 3KMNA 1XWAA 3MIXA 1ZYEA 3FKFA 1TI1A 2OBIA 3FRCA 3TOUA 4J56E 5DCGA 4O5RA 5JWOB 3EC3A 1AW9A 3OR5A 4Q5NA 5BRTA 1EP8A 1KBNA 1ZOFA 1EV4A 1EOHA 4IQAA 1AIUA 2DSAA 1G7EA 2MMOA 1PSQA 3TCOA 3FK8A 5CRDA 4ML1A 3VPQA 4IN0A 5HR1A 3RBTA 2V6KA 6GSWA 3EVIA 2BJXA 1T7PB 3VK9A 3J7Yb 4ECBA 2KLXA 1OKDA 3A3TA 2VCZA 1GTAA 1YKCA 2YN1A 3Q19A 1H4OA 5L71A 2IMKA 5HR2A 3LQ7A 2C1YA 5ABRA 4WBRD 1TRUA 1DBYA 3VPTA 5DQSA 4KDYA 4JR6A 1XBSA 4MH3A 3UJ1A 5J5NA 4FIWA 1Q98A 1ERWA 1TU7A 3ZYWA 3L78A 3D4MA 5EVOA 2UZ8A 2C4JA 1S3AA 3ZIVA 4NXIA 1HD2A 3BCKA 1DSBA 4QQ7A 3UEMA 3E3EA 2FWEA 4OMVA 4KSMA 1FHEA 3EYTA 5B6NA 3WT2A 2AAWA 1R5AA 2V2GA 5H5RA 3FZ5A 2FGXA 5ECLB 3UOMA 1K0BA 2NPBA 2FA4A 2B1LA 4WF4A 3IPZA 1ERUA 4L5OA 4LLRA 3G7IA 3F4TA 17GSA 4DSSA 2GZYA 4NV2A 2LJKA 4L8EA 4FYUA 1SJZA 1X9MB 2WDUA 1EWXA 3GMFA 1YZXA 1U87A 2Z9SA 1A24A 5DAKB 5EPFA 1XPVA 5KN0A 3UVTA 3EMXA 2LV3A 5D93A 2KOKA 4G9HA 1GSQA 2X8GA 4D73A 2MMZA 2IPAA 1EOGA 3DVXA 1FVJA 4WR5A 2ALBA 4KB3A 3KIJA 4GRFA 2X4AA 2HNLA 4H86A 1CQGA 2O8VB 4POBA 1XOAA 3UL3A 3I69A 1SENA 3P90A 2LSTA 4ZL7A 2HT9A 2E2GA 1SKSB 3UARA 5GSTA 4G2EA 3GRXA 2KUCA 1GSYA 3DVWA 4A5PA 4OD7A 3P2AA 1VF4A 2LRCA 5IMFA 3CYNA 4MJAA 3RAZA 5FWGA 1ZYQB 4OO4A 1ERVA 2OACA 4GSTA 3IK9A 4YQUA 5IPGA 5IMDA 4KX4A 3SWLA 3CSHA 3O6TA 4IVFA 2DC5A 3A2VA 3GL3A 1LU4A 3CTGA 3DEXA 4ML6A 4ECJA 1T00A 3IC8A 2HSHA 1AXDA 3HVSA 4XS1A 4WR4A 1FO5A 2XBIA 3D6IA 4K6XA 1W89A 3M0FA 2DJKA 4KCEA 2C3NA 2GVPA 1XZOA 1O81A 3TRXA 2OJLA 4MF7A 4HEA2 3TGZA 4K7OA 3L9UA 3TKSC 4BL7B 1GSSA 1FB0A 1X0RA 2L5LA 1IYHA 1GSEA 3DWVA 3TRPA 1K3YA 4Q5FA 2CX4A 5CRHA 1SD9A 5JCUA 1QFNA 5A4WA 3I6AA 2OE3A 5A4UA 5ECIB 4MH2A 4KF9A 1ZGNA 1HNAA 1GNWA 2H0HA 2RUFA 4MF6A 1YJ6A 2K18A 4V1Ap 1V2AA 3VI7A 3KTLA 4WEYA 1R4WA 2YCDA 1J9BA 5ELGA 3TJFA 2YPMA 5D96A 3VWUA 4GCIA 2K8SA 4ZILA 2C0EA 1TK8B 3GTUB 4JR4A 2VL2C 3LSZA 2JSYA 2FCHA 2C3TA 2WB9A 2KP2A 4TXOA 1NW2A 5DCHA 1X5CA 1XVWA 5J3RA 2V41A 1X9WB 3KJYA 1O8WA 3ME8A 3DYRA 3CRUA 3C7MA 5F05A 3FY7A 5ECRB 4E8EA 5C04A 1VF1A 1ZMAA 4HSCX 5B7CA 4Z2TA 2M80A 2AJQB 4WETA 4OCFA 3LORA 4J57E 2CZ3A 2H74A 3WGXA 1PD21 2YP6A 2DKIA 3R2QA 2FY6A 2OKAA 2CAIA 2CZ2A 3HA9A 4GLTA 1C72A 4O92A 1S3RA 4TR1A 4KDXA 4K7NA 3TDGA 2PERA 1GTBA 5ID2B 3RPNA 5DALB 1O7UA 4XS4B 4PQ1A 2GSRA 3HZ4A 2B5XA 2HFDA 2L5OA 4ZB6A 2YWMA 3QD9A 3QCPA 1LJRA 3Q74A 1XVQA 3CMIA 3DIEA 3GH6A 16GSA 1BX9A 4PURA 3SBCA 4MDCA 4NAXA 2PVOC 3FR6A 5CO3A 1K3OA 4MJBA 5DDLA 2F8AA 4GWRA 2JZSA 2VM1A 13GSA 2JL4A 4TN8A 4ILFA 3I9V2 2CVDA 3QDNA 3PINA 2MMNA 1N2AA 2H1GA 3F9UA 3TB2A 3VWWA 2GQMA 1MDKA 3ZLPA 12GSA 4FO5A 6GSYA 2NDOA 2K6VA 3IAM2 6GSTA 3KP8A 5G31A 4K2XA 3RPPA 2O85A 2R0CA 4K0NA 3GL5A 2VCXA 4KCAA 2JACA 2H75A 2EIOA 3N5OA 1SK0A 4NHZA 2LRTA 3KXOA 4GQCA 4GTUA 5HR3A 3HZ8A 1NHYA 1GL8A 4N30A 3GA4A 1NM3A 4BVYB 1EP7A 2M72A 1UC7A 2MBSA 3FW2A 4XHMA 1Y6EA 2E0QA 3D0ZA 2LS5A 4I2UA 4MLYA 2RLIA 3LJRA 1JFUA 3FR3A 3N9JA 3UBKA 1WRYA 4NPBA 2C8UA 2A4VA 2KP1A 4K2DA 5AISA 4LMVA 2R3XA 2K9FA 4G0KA 3DGQA 5HFKA 5KEJA 5G5FA 2H6XA 4PNFA 3ZMKA 1GSFA 3O3TA 4G0IA 1U3IA 5DJMA 1AQVA 5LNKe 3MYDA 5IOXA 4MK3A 2QSIA 1K0DA 1XIYA 3CQFA 3IK7A 4HS1A 5IM9A 5IO0A 3ZFLA 1TRVA 3A2WA 4WKWA 5AIVA 2C0FA 2HZEA 2DMMA 2P0GA 5B8AA 1RK4A 1U88A 3ZMLA 3HXSA 2B7KA 2JADA 1VF2A 2P31A 5AN1A 4YAVA 4ZIJA 5CRWA 1NHOA 4IBPA 4MJCA 4TXVA 3TUEA 4HU9A 3IAS2 2WULA 1HNCA 2IIYA 4HJMA 1WWJA 5A4VA 1JZDA 1SJ6A 2CQ9A 10GSA 3WD6A 3H1NA 2MBTA 5J9CA 1WIKA 3U6VA 1B4QA 1X5EA 1GLQA 3H93A 1Z6MA 4EO3A 1OC9B 2A4HA 2IN3A 1U3AA 2YNXA 3GIXA 1QK8A 3F3RA 2G2QA 5IPHA 3HJOA 3MNGA 1O85A 2GDRA 3BBYA 3ME7A 3ZRDA 2VCWA 3ED3A 1TP9A 5DJLA 3ZITA 4NHWA 2LNSA 5GSSA 1XW6A 1PKWA 1F2EA 2VLVA 1SK1A 3BOAA 1A8YA 2CX3A 1B8XA 5H5QA 2FLSA 2RIIA 5B6MA 4KAEA 4FH8A 3DKSA 1R7HA 2A2PA 2R2JA 5KN2A 3TOTA 1M2DA 2BMXA 1R26A 1Z5YE 2CAQA 2R5GA 5CP1A 4OFMA 3AY8A 3MWHA 4NV5A 2FWHA 1T4ZA 4JU5A 4TW5A 3MAKA 3HJMA 1GTUA 3FEUA 1I5GA 4MABA 4F0BA 3VWVA 1FOHA 2H30A 2WZ9A 2YWNA 1O6JA 2RUEA 1OC3A 3IA1A 5FHIA 1XXUA 1YEPA 1AUCA 1MDIA 4XTSA 5ECHB 3DRNA 2EIQA 3NOFA 2K8VA 2X8CA 2FWFA 1TJDA 5IMZA 4BPYA 1YY7A 2XC2A 4O32A 1FOVA 3KTBA 5KOWA 3KMOA 1J08A 4JBBA 4EUYA 4F0CA 3ERFA 2F3MA 4LL4B 1PN0A 1PGTA 4HQZA 4N0ZA 5CRGA 2CV4A 4MPFA 2I9HA 1SL2B 3IR4A 2H0IA 2LJAA 5J41A 1PQNA 3APSA 3G9BA 2IFQA 4G10A 3C1SA 4YH2A 5ECQB 1JLVA 1KEBA 2DJ2A 2PWJA 3NIVA 4RQRA 5ECPB 1VRSD 2PGTA 1OKTA 1G6WA 2V1MA 2MZCA 2N5AA 5D9XA 1LBKA 1UN2A 2JSZA 2WFCA 4X0XA 1N8JA 2H71A 4KW6A 1OYJA 4CHSA 2H1DA 2GT5A 2GGTA 2IMDA 3KEBA 4YKFA 2AUVA 1UA5A 3F4SA 4ID0A 2I1UA 3GKNA 3FYGA 2GS3A 1URMA 3KCMA 5INYA 4KSOA 4K5RA 2WGRA 2GT6A 3HD5A 3ZREA 3US3A 1M9BA 4NWYA 1MD3A 4XRAA 5D9WA 2XPEA 1WP0A 1YKAA 4O5UA 4I8BA 1ZYNA 3JCML 3QPMA 1BAYA 2VL2A 2H1BA 5CYYA 2WJUA 3GYKA 1AC1A 1PX7A 4WF5A 1T4YA 3NZNA 1ZZYA 4DSSB 1WE0A 2OA7A 3EU3A 3ZVJA 3LWAA 4IHUA 1E6BA 1K0OA 2L57A 3DXBA 1V57A 5LCZA 3LG6A 5LD0A 2H6YA 4KUNA 4AJ8A 3UBLA 2X64A 1FAAA 1K0NA 1A2JA 3W6GA 1MDJA 2H73A 5IQYA 4D73B 3A2XA 2CT6A 4KH7A 4LL1B 4EIQA 4KGIA 1Z7RA 2GZPA 4BA7A 3GV1A 2YV9A 1FB6A 1EGOA 4OFTA 4K7IA 2GSTA 1MD4A 5ECMB 1JZRA 1Q4JA 9GSSA 2KHPA 2LKUA 1AQXA 3GX0A 4GSNA 5F06A 2GSQA 4IP1A 4ULXA 1VF3A 2QA1A 4DSRA 2X99A 3PR8A 1PN9A 4EDZA 1MEKA 3RHCA 4BWSA 1A8LA 3ERGA 2HRNA 5G1KA 3IBHA 3LW9A 4L0WA 3FZ9A 3GFKA 2H0GA 1TRWA 2DLXA 2A2SA 3L4NA 4F2IA 4KNDA 2VD0A 1THOA 3IRAA 4RI7A 2NVLA 2QA2A 2DMLA 1TKDB 4EIPA 1X5DA 2DJ1A 22GSA 2GZZA 2QGVA 2LEGA 3TKRA 2H8LA 1U6TA 5IO2A 4MP4A 1K0MA 2GLRA 1G0TA 1XCCA 3PPUA 5IMAA 3VLNA 4ZBBA 1SKWB 4WBJA 1EEMA 1F37A 4ACSA 4RI6A 1HNBA 2IMEA 3GX8A 3WT1A 1TRSA 1QQ2A 2ES7A 1TI3A 2H76A 1Y25A 4K0GA 1O73A 3TKSE 4BVXA 5DBQA 2C80A 2PBJA 4HZ4A 1XWGA 4IELA 4CY8A 2H70A 4KDUA 2MMAA 2FWGA 3R3EA 3F63A 2G0FA 2RM5A 2IL3A 4I2TA 4MCUA 3ERWA 3KM6A 3GSSA 6GSXA 2HXKA 4E8HA 2I81A 4IKHA 5CREA
chains in the Genus database with same CATH topology
3GHAA 3M9JA 1QMVA 3EURA 1J0FA 1SD8A 1G6YA 3F4RA 5IOWA 5FT3A 1SYRA 5DVBA 1TDIA 2QC7A 4G19A 4MZBA 1Z7PA 2H01A 2R6KA 5HFIA 1M2BA 2J9HA 3GKXA 5BMUA 1XOBA 3J7Yk 2ZCTA 3ZZXA 2E2MA 1THXA 3M3MA 1GH2A 3VURA 5ECSA 1A0FA 2LJRA 5ECKB 1YEXA 4PXOA 3LXTA 1EZKA 4F82A 1QGVA 4V2LA 5D9TA 2H19A 1K0AA 4PUAA 5F07A 4TXOB 2BTOT 2XHFA 2XPDA 4ZL8A 3IHQA 4TR0A 1YDKA 4ZBAA 1S3CA 4X1UA 4OFNA 2MYGA 1DE2A 2IWTA 4PX1A 1GUHA 2P5QA 1V58A 3MSZA 3F3QA 3LYKA 3L0HA 1XWBA 4GQFA 1B9YC 2IMIA 3C71A 2H66A 2HRAA 4HQSA 4HI7A 1O8XA 4HJ2A 3C73A 3TRQA 14GSA 4TR3A 5E4WA 4JEDA 4RUVA 3M8NA 1RQMA 4TR1B 5IIZA 3LFLA 4JE1A 2LTKA 4ZB8A 3QMXA 3EU4A 3GNJA 3GH9A 4K8MA 4PTSA 5J4UA 4LMWA 5GAPD 2P5RA 2M46A 3IOSA 4IGJA 2LRNA 1PMTA 2E7PA 2NTOA 1SL1B 4AJ6A 3LGCA 4F03A 2L6DA 4Q5RA 4IQ1A 4G0LA 2OE0A 4POKA 2NBSA 3IV4A 1RW1A 4HZ2A 2VCQA 3KD0A 2GSSA 4IP6A 1BQ7A 4ISDA 3HYPA 2FNOA 1R5PA 4AJ7A 3LEFA 5DAKA 1WOUA 2DJJA 4K5SA 4X43A 2IMFA 4N10A 3GURA 1ACVA 1PX6A 2QKEA 1A0RP 2CA8A 3A5WA 1ON4A 5IMVA 2JZTA 3ZFBA 1M2AA 1ABAA 4PQIA 1DE1A 4RQXA 4EXJA 4EL1A 11GSA 1SYXA 3FHKA 2YJHA 1SL0B 2R37A 1OE7A 5F8BA 2B7JA 5G2ZA 4CW9A 2AHEA 2HRKA 19GSA 2LUSA 5H5SA 1SK2A 2I3YA 3TKQA 4MZWA 6GSUA 2LQQA 3WGDA 2VL9A 4XCSA 4EVMA 5CAXA 2H1AA 2VLUA 4Z7XA 1Z3EA 3A5IA 1DUGA 1PL2A 3G7YA 3H8QA 3PH9A 3ZL5A 2YV7A 5KN1A 3ZVJD 2HI7A 4JRRA 2OADA 2R0PA 4V1Ag 4X4JA 3F6DA 3M1GA 1K3LA 2B5EA 1XFLA 4NMUA 2OBKA 4HUAA 1W4VA 3UVHA 2J23A 2TRXA 3W8SA 5EY6A 3P8WA 1ERTA 1T1VA 1JLWA 4MNNA 3HVVA 4GF0A 2FHEA 2EIRA 3QFAC 2WS2A 4IJ3A 3GKKA 1M9AA 1TK5B 2GQLA 1BG5A 4L0UA 2WCIA 3QR6A 1SJIA 5B8BA 2O7KA 3WGEA 3HVXA 2N5FA 4KA0A 3QAWA 1SU9A 7GSSA 3K8NA 3P7XA 4MA9A 3Q6OA 2DJ0A 4BL7A 1KNGA 4MF5A 1JZWA 1UVZA 3HKRA 3KH9A 3Q18A 2AV4A 2HZEB 3WYWA 2I4AA 6GSSA 2YANA 5DQYA 1GUMA 1ST9A 2C0DA 1EV9A 4USSA 2PVQA 4DSQA 1T8EB 5GAND 1OVNA 1WMJA 4HOJA 3UIWA 3FR9A 1FG4A 2F8FA 4IJIA 3QFBC 4V2NA 2PMTA 5GZZB 2ZUPA 1QUWA 4QL9A 1JZOA 1Z9HA 2ZNMA 2YJ7A 2DKHA 3GTUA 3BJ5A 4JZQA 5G1LA 4AF2A 4OCEA 2D2ZA 3QOUA 5KN3A 1S3DA 2HE3A 1XWCA 3KGKA 4YQVA 2YWOA 2N5BA 4GXZA 4HU7A 4MMMA 4Q5QA 5AGYA 3TKSA 1TK0B 5G30A 1VGLA 1G7OA 1TOFA 1TU8A 5D73A 3QAGA 2RM6A 3UMAA 5C00A 3KP9A 3C1RA 2CVBA 4KE3A 1TW9A 1ZL9A 3GUSA 4CDOA 4ECIA 1M0UA 2REMA 3TJJA 4MJEA 2VCVA 3E9JB 2B1KA 2EC4A 2TIRA 4EC0A 3D21A 5ID2A 5DALA 4XS4A 1EGRA 4L5LA 1GULA 3TJBA 3LYPA 4K1FA 3CSIA 4XS6A 5COHA 4ECCA 3CSJA 4POMA 1F6MC 3U5RE 4N11A 2IJYA 2CVKA 2TRCP 4QL7A 3TKPA 3VWXA 2FUG2 4OO5A 5E59A 3UAPA 4YAPA 2L6CA 3CTFA 2C3QA 2VL3A 20GSA 4PGTA 2VUPA 5D8IA 2VIMA 3G7JA 3F0IA 4TKYA 2PUKC 5JWQB 1YQ1A 1T3BA 1A2LA 5G5EA 1BYEA 3BCIA 4TVEA 1ML6A 5JCGA 2F51A 4I6XA 1ZCPA 1AAZA 2B3SA 1V98A 3HHVA 2VM2A 3GKMA 2DIYA 4F9ZA 3ISOA 2JU5A 4N0VA 4IW9A 3CBUA 2HLSA 4CY6A 1YF1A 3IHGA 2GQKA 1Z6NA 3F8UA 3L9VA 2VOCA 3M9KA 4DEJA 5JCWA 1ZYPA 2VLTA 3V1WA 1ILOA 3PGTA 2YZHA 3CRTA 3IXRA 2H72A 5A5KA 4ZB9A 3F6FA 1GSDA 2LQOA 2WRTA 1YF0A 1V9WA 5KOXA 4PUFC 2VCTA 2A2RA 4I5QA 2HZFA 2HYXA 4POLA 4WXTA 3GN3A 2IFQB 2V32A 3D22A 3EMPA 3LXZA 3I43A 1BJXA 4Z2RA 3CXGA 5CNWA 1FW1A 4DVCA 1F3AA 4BVYA 4AGSA 3ZTLA 5JWRB 1JHBA 4Z2UA 5ECNB 1M7TA 1OE8A 4O7HA 5HFGA 4ZL9A 2X49A 1HQOA 3APOA 2PU9C 3GSTA 2DBCA 2L4CA 4XIHA 3IC4A 1B4PA 3S9FA 2R4VA 4BWQA 1TXXA 2C0GA 4EDYA 2JZRA 1B9XC 2VO4A 1OAZA 3FZAA 1FVKA 1XW5A 4HDEA 5AIXA 1PKZA 2O89A 4TR4A 8GSSA 4YQMA 2B5YA 1M99A 4FYCA 5F0GA 2LNTA 1F3BA 1NSWA 4P3YB 3H79A 5ECOB 1WPIA 2OE1A 1GUKA 4O5QA 1H75A 2AB6A 2B6MA 1K0CA 3FZ4A 4OWYA 2PPTA 2ON5A 4EKZA 2HSYA 4GSSA 3DD3A 1GLPA 2GTUA 3KH7A 2YZUA 3TJGA 1GSUA 2FA8A 3D4TA 1GRXA 4PQHA 4MPGA 3RHBA 4ICYA 3FMWA 3H4KA 1MTCA 1OC9A 1HYUA 5ELAA 3EPTA 2R0GA 4EE0A 2HRFA 3MDKA 3APQA 5J9BA 3C8EA 1SKRB 3QAVA 5HR0A 2F9SA 2ON7A 3IDVA 4IS0A 4FQUA 2AYTA 1GWCA 3TJKA 2VAFA 1V40A 2L59A 4TOPA 5IMCA 1GNEA 3HY2A 4MZCA 1KTEA 3O76A 1XWKA 1E2YA 3IE3A 2YOIA 2L4QA 1OC8A 1PL1A 3W8JA 5HQPA 3BD2A 1IYIA 2DJ3A 2X8HA 4K9ZA 2FD3A 18GSA 2H6ZA 1EEJA 1QXHA 4I97A 1X9SB 3EINA 2V6OA 3VFIA 3HDCA 1USBA 1F9MA 1B48A 3EE2A 5EL8A 4EF0A 4J2FA 1A2MA 4ZBDA 3DMLA 3D5JA 4ZXGA 3EWLA 1PA3A 2VD1A 3ZIJA 6GSVA 1WJKA 1XW9A 1GP1A 3RDWA 2HSMA 4BVXB 1GTIA 3KZQA 1I9DA 2DIZA 2YWIA 1PRXA 4PNGA 3E0UA 3L9SA 3VI5A 4XRDA 3HCZA 4FYBA 1BEDA 1CQHA 5ENUA 2O87A 4TRXA 1A23A 3HJPA 2XBQA 1AQWA 4LA1A 4V2MA 5D9VA 1TTZA 4YKGA 2PN8A 3KMNA 1XWAA 3MIXA 1ZYEA 3FKFA 1TI1A 2OBIA 3FRCA 3TOUA 4J56E 5DCGA 4O5RA 5JWOB 3EC3A 1AW9A 3OR5A 4Q5NA 5BRTA 1EP8A 1KBNA 1ZOFA 1EV4A 1EOHA 4IQAA 1AIUA 2DSAA 1G7EA 2MMOA 1PSQA 3TCOA 3FK8A 5CRDA 4ML1A 3VPQA 4IN0A 5HR1A 3RBTA 2V6KA 6GSWA 3EVIA 2BJXA 1T7PB 3VK9A 3J7Yb 4ECBA 2KLXA 1OKDA 3A3TA 2VCZA 1GTAA 1YKCA 2YN1A 3Q19A 1H4OA 5L71A 2IMKA 5HR2A 3LQ7A 2C1YA 5ABRA 4WBRD 1TRUA 1DBYA 3VPTA 5DQSA 4KDYA 4JR6A 1XBSA 4MH3A 3UJ1A 5J5NA 4FIWA 1Q98A 1ERWA 1TU7A 3ZYWA 3L78A 3D4MA 5EVOA 2UZ8A 2C4JA 1S3AA 3ZIVA 4NXIA 1HD2A 3BCKA 1DSBA 4QQ7A 3UEMA 3E3EA 2FWEA 4OMVA 4KSMA 1FHEA 3EYTA 5B6NA 3WT2A 2AAWA 1R5AA 2V2GA 5H5RA 3FZ5A 2FGXA 5ECLB 3UOMA 1K0BA 2NPBA 2FA4A 2B1LA 4WF4A 3IPZA 1ERUA 4L5OA 4LLRA 3G7IA 3F4TA 17GSA 4DSSA 2GZYA 4NV2A 2LJKA 4L8EA 4FYUA 1SJZA 1X9MB 2WDUA 1EWXA 3GMFA 1YZXA 1U87A 2Z9SA 1A24A 5DAKB 5EPFA 1XPVA 5KN0A 3UVTA 3EMXA 2LV3A 5D93A 2KOKA 4G9HA 1GSQA 2X8GA 4D73A 2MMZA 2IPAA 1EOGA 3DVXA 1FVJA 4WR5A 2ALBA 4KB3A 3KIJA 4GRFA 2X4AA 2HNLA 4H86A 1CQGA 2O8VB 4POBA 1XOAA 3UL3A 3I69A 1SENA 3P90A 2LSTA 4ZL7A 2HT9A 2E2GA 1SKSB 3UARA 5GSTA 4G2EA 3GRXA 2KUCA 1GSYA 3DVWA 4A5PA 4OD7A 3P2AA 1VF4A 2LRCA 5IMFA 3CYNA 4MJAA 3RAZA 5FWGA 1ZYQB 4OO4A 1ERVA 2OACA 4GSTA 3IK9A 4YQUA 5IPGA 5IMDA 4KX4A 3SWLA 3CSHA 3O6TA 4IVFA 2DC5A 3A2VA 3GL3A 1LU4A 3CTGA 3DEXA 4ML6A 4ECJA 1T00A 3IC8A 2HSHA 1AXDA 3HVSA 4XS1A 4WR4A 1FO5A 2XBIA 3D6IA 4K6XA 1W89A 3M0FA 2DJKA 4KCEA 2C3NA 2GVPA 1XZOA 1O81A 3TRXA 2OJLA 4MF7A 4HEA2 3TGZA 4K7OA 3L9UA 3TKSC 4BL7B 1GSSA 1FB0A 1X0RA 2L5LA 1IYHA 1GSEA 3DWVA 3TRPA 1K3YA 4Q5FA 2CX4A 5CRHA 1SD9A 5JCUA 1QFNA 5A4WA 3I6AA 2OE3A 5A4UA 5ECIB 4MH2A 4KF9A 1ZGNA 1HNAA 1GNWA 2H0HA 2RUFA 4MF6A 1YJ6A 2K18A 4V1Ap 1V2AA 3VI7A 3KTLA 4WEYA 1R4WA 2YCDA 1J9BA 5ELGA 3TJFA 2YPMA 5D96A 3VWUA 4GCIA 2K8SA 4ZILA 2C0EA 1TK8B 3GTUB 4JR4A 2VL2C 3LSZA 2JSYA 2FCHA 2C3TA 2WB9A 2KP2A 4TXOA 1NW2A 5DCHA 1X5CA 1XVWA 5J3RA 2V41A 1X9WB 3KJYA 1O8WA 3ME8A 3DYRA 3CRUA 3C7MA 5F05A 3FY7A 5ECRB 4E8EA 5C04A 1VF1A 1ZMAA 5B7CA 4Z2TA 2M80A 2AJQB 4WETA 4OCFA 3LORA 4J57E 2CZ3A 2H74A 3WGXA 1PD21 2YP6A 2DKIA 3R2QA 2FY6A 2OKAA 2CAIA 2CZ2A 3HA9A 4GLTA 1C72A 4O92A 4TR1A 4KDXA 4K7NA 3TDGA 2PERA 1GTBA 5ID2B 3RPNA 5DALB 1O7UA 4XS4B 4PQ1A 2GSRA 3HZ4A 2B5XA 2HFDA 2L5OA 4ZB6A 2YWMA 3QD9A 3QCPA 1LJRA 3Q74A 1XVQA 3CMIA 3DIEA 3GH6A 16GSA 1BX9A 4PURA 3SBCA 4MDCA 4NAXA 2PVOC 3FR6A 5CO3A 1K3OA 4MJBA 5DDLA 2F8AA 4GWRA 2JZSA 2VM1A 13GSA 2JL4A 4TN8A 4ILFA 3I9V2 2CVDA 3QDNA 3PINA 2MMNA 1N2AA 2H1GA 3F9UA 3TB2A 3VWWA 2GQMA 1MDKA 3ZLPA 12GSA 4FO5A 6GSYA 2NDOA 2K6VA 3IAM2 6GSTA 3KP8A 5G31A 4K2XA 3RPPA 2O85A 2R0CA 4K0NA 3GL5A 2VCXA 4KCAA 2JACA 2H75A 2EIOA 3N5OA 1SK0A 4NHZA 2LRTA 3KXOA 4GQCA 4GTUA 5HR3A 3HZ8A 1NHYA 1GL8A 4N30A 3GA4A 1NM3A 4BVYB 1EP7A 2M72A 1UC7A 2MBSA 3FW2A 4XHMA 1Y6EA 2E0QA 3D0ZA 2LS5A 4I2UA 4MLYA 2RLIA 3LJRA 1JFUA 3FR3A 3N9JA 3UBKA 1WRYA 4NPBA 2C8UA 2A4VA 2KP1A 4K2DA 5AISA 4LMVA 2R3XA 2K9FA 4G0KA 3DGQA 5HFKA 5KEJA 5G5FA 2H6XA 4PNFA 3ZMKA 1GSFA 3O3TA 4G0IA 1U3IA 5DJMA 1AQVA 5LNKe 3MYDA 5IOXA 4MK3A 2QSIA 1K0DA 1XIYA 3IK7A 4HS1A 5IM9A 5IO0A 3ZFLA 1TRVA 3A2WA 4WKWA 5AIVA 2C0FA 2HZEA 2DMMA 2P0GA 5B8AA 1RK4A 1U88A 3ZMLA 3HXSA 2B7KA 2JADA 1VF2A 2P31A 5AN1A 4YAVA 4ZIJA 5CRWA 1NHOA 4IBPA 4MJCA 4TXVA 3TUEA 4HU9A 3IAS2 2WULA 1HNCA 2IIYA 4HJMA 1WWJA 5A4VA 1JZDA 1SJ6A 2CQ9A 10GSA 3WD6A 3H1NA 2MBTA 5J9CA 1WIKA 3U6VA 1B4QA 1X5EA 1GLQA 3H93A 1Z6MA 4EO3A 1OC9B 2A4HA 2IN3A 1U3AA 2YNXA 3GIXA 1QK8A 3F3RA 2G2QA 5IPHA 3HJOA 3MNGA 1O85A 2GDRA 3BBYA 3ME7A 3ZRDA 2VCWA 3ED3A 1TP9A 5DJLA 3ZITA 4NHWA 2LNSA 5GSSA 1XW6A 1PKWA 1F2EA 2VLVA 1SK1A 3BOAA 1A8YA 2CX3A 1B8XA 5H5QA 2FLSA 2RIIA 5B6MA 4KAEA 4FH8A 3DKSA 1R7HA 2A2PA 2R2JA 5KN2A 3TOTA 1M2DA 2BMXA 1R26A 1Z5YE 2CAQA 2R5GA 5CP1A 4OFMA 3AY8A 3MWHA 4NV5A 2FWHA 1T4ZA 4JU5A 4TW5A 3MAKA 3HJMA 1GTUA 3FEUA 1I5GA 4MABA 4F0BA 3VWVA 1FOHA 2H30A 2WZ9A 2YWNA 1O6JA 2RUEA 1OC3A 3IA1A 5FHIA 1XXUA 1YEPA 1AUCA 1MDIA 4XTSA 5ECHB 3DRNA 2EIQA 3NOFA 2K8VA 2X8CA 2FWFA 1TJDA 5IMZA 4BPYA 1YY7A 2XC2A 4O32A 1FOVA 3KTBA 5KOWA 3KMOA 1J08A 4JBBA 4EUYA 4F0CA 3ERFA 2F3MA 4LL4B 1PN0A 1PGTA 4HQZA 4N0ZA 5CRGA 2CV4A 4MPFA 2I9HA 1SL2B 3IR4A 2H0IA 2LJAA 5J41A 1PQNA 3APSA 3G9BA 2IFQA 4G10A 3C1SA 4YH2A 5ECQB 1JLVA 1KEBA 2DJ2A 2PWJA 3NIVA 4RQRA 5ECPB 1VRSD 2PGTA 1OKTA 1G6WA 2V1MA 2MZCA 2N5AA 5D9XA 1LBKA 1UN2A 2JSZA 2WFCA 4X0XA 1N8JA 2H71A 4KW6A 1OYJA 4CHSA 2H1DA 2GT5A 2GGTA 2IMDA 3KEBA 4YKFA 2AUVA 1UA5A 3F4SA 4ID0A 2I1UA 3GKNA 3FYGA 2GS3A 1URMA 3KCMA 5INYA 4KSOA 4K5RA 2WGRA 2GT6A 3HD5A 3ZREA 3US3A 1M9BA 4NWYA 1MD3A 4XRAA 5D9WA 2XPEA 1WP0A 1YKAA 4O5UA 4I8BA 1ZYNA 3JCML 3QPMA 1BAYA 2VL2A 2H1BA 5CYYA 2WJUA 3GYKA 1AC1A 1PX7A 4WF5A 1T4YA 3NZNA 1ZZYA 4DSSB 1WE0A 2OA7A 3EU3A 3ZVJA 3LWAA 4IHUA 1E6BA 1K0OA 2L57A 3DXBA 1V57A 5LCZA 3LG6A 5LD0A 2H6YA 4KUNA 4AJ8A 3UBLA 2X64A 1FAAA 1K0NA 1A2JA 3W6GA 1MDJA 2H73A 5IQYA 4D73B 3A2XA 2CT6A 4KH7A 4LL1B 4EIQA 4KGIA 1Z7RA 2GZPA 4BA7A 3GV1A 2YV9A 1FB6A 1EGOA 4OFTA 4K7IA 2GSTA 1MD4A 5ECMB 1JZRA 1Q4JA 9GSSA 2KHPA 2LKUA 1AQXA 3GX0A 4GSNA 5F06A 2GSQA 4IP1A 4ULXA 1VF3A 2QA1A 4DSRA 2X99A 3PR8A 1PN9A 4EDZA 1MEKA 3RHCA 4BWSA 1A8LA 3ERGA 2HRNA 5G1KA 3IBHA 3LW9A 4L0WA 3FZ9A 3GFKA 2H0GA 1TRWA 2DLXA 2A2SA 3L4NA 4F2IA 4KNDA 2VD0A 1THOA 3IRAA 4RI7A 2NVLA 2QA2A 2DMLA 1TKDB 4EIPA 1X5DA 2DJ1A 22GSA 2GZZA 2QGVA 2LEGA 3TKRA 2H8LA 1U6TA 5IO2A 4MP4A 1K0MA 2GLRA 1G0TA 1XCCA 3PPUA 5IMAA 3VLNA 4ZBBA 1SKWB 4WBJA 1EEMA 1F37A 4ACSA 4RI6A 1HNBA 2IMEA 3GX8A 3WT1A 1TRSA 1QQ2A 2ES7A 1TI3A 2H76A 1Y25A 4K0GA 1O73A 3TKSE 4BVXA 5DBQA 2C80A 2PBJA 4HZ4A 1XWGA 4IELA 4CY8A 2H70A 4KDUA 2MMAA 2FWGA 3R3EA 3F63A 2G0FA 2RM5A 2IL3A 4I2TA 4MCUA 3ERWA 3KM6A 3GSSA 6GSXA 2HXKA 4E8HA 2I81A 4IKHA 5CREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GHA A;  3M9J A;  1QMV A;  3EUR A;  1J0F A;  1SD8 A;  1G6Y A;  3F4R A;  5IOW A;  5FT3 A;  1SYR A;  5DVB A;  1TDI A;  2QC7 A;  4G19 A;  4MZB A;  1Z7P A;  2H01 A;  2R6K A;  5HFI A;  1M2B A;  2J9H A;  3GKX A;  1XOB A;  3J7Y k;  2ZCT A;  3ZZX A;  2E2M A;  1THX A;  3M3M A;  1GH2 A;  3VUR A;  5ECS A;  1A0F A;  2LJR A;  5ECK B;  1YEX A;  4PXO A;  3LXT A;  1EZK A;  4F82 A;  1QGV A;  4V2L A;  5D9T A;  2H19 A;  1K0A A;  4PUA A;  5F07 A;  4TXO B;  2BTO T;  2XHF A;  2XPD A;  4ZL8 A;  3IHQ A;  4TR0 A;  1YDK A;  4ZBA A;  1S3C A;  4X1U A;  4OFN A;  2MYG A;  1DE2 A;  2IWT A;  4PX1 A;  1GUH A;  2P5Q A;  1V58 A;  3MSZ A;  3F3Q A;  3LYK A;  3L0H A;  1XWB A;  4GQF A;  1B9Y C;  2IMI A;  3C71 A;  2H66 A;  4HQS A;  4HI7 A;  1O8X A;  4HJ2 A;  3C73 A;  3TRQ A;  14GS A;  4TR3 A;  5E4W A;  4JED A;  4RUV A;  3M8N A;  1RQM A;  4TR1 B;  5IIZ A;  3LFL A;  4JE1 A;  2LTK A;  4ZB8 A;  3QMX A;  3EU4 A;  3GNJ A;  3GH9 A;  4K8M A;  5J4U A;  4LMW A;  5GAP D;  2P5R A;  2M46 A;  3IOS A;  4IGJ A;  2LRN A;  1PMT A;  2E7P A;  2NTO A;  1SL1 B;  4AJ6 A;  3LGC A;  4F03 A;  2L6D A;  4Q5R A;  4IQ1 A;  2OE0 A;  4POK A;  2NBS A;  3IV4 A;  1RW1 A;  4HZ2 A;  2VCQ A;  3KD0 A;  2GSS A;  4IP6 A;  1BQ7 A;  4ISD A;  3HYP A;  2FNO A;  1R5P A;  4AJ7 A;  3LEF A;  5DAK A;  1WOU A;  2DJJ A;  4X43 A;  2IMF A;  4N10 A;  3GUR A;  1ACV A;  1PX6 A;  2QKE A;  1A0R P;  2CA8 A;  3A5W A;  1ON4 A;  5IMV A;  2JZT A;  3ZFB A;  1M2A A;  1ABA A;  4PQI A;  1DE1 A;  4RQX A;  4EXJ A;  4EL1 A;  11GS A;  1SYX A;  3FHK A;  2YJH A;  1SL0 B;  2R37 A;  1OE7 A;  5F8B A;  2B7J A;  5G2Z A;  4CW9 A;  2AHE A;  2LUS A;  19GS A;  5H5S A;  1SK2 A;  2I3Y A;  3TKQ A;  4MZW A;  6GSU A;  2LQQ A;  3WGD A;  2VL9 A;  4XCS A;  4EVM A;  5CAX A;  2H1A A;  2VLU A;  4Z7X A;  1Z3E A;  1DUG A;  1PL2 A;  3G7Y A;  3H8Q A;  3PH9 A;  3ZL5 A;  2YV7 A;  5KN1 A;  3ZVJ D;  2HI7 A;  4JRR A;  2OAD A;  4V1A g;  3F6D A;  3M1G A;  1K3L A;  2B5E A;  1XFL A;  4NMU A;  2OBK A;  4HUA A;  1W4V A;  3UVH A;  2J23 A;  2TRX A;  3W8S A;  5EY6 A;  3P8W A;  1ERT A;  1T1V A;  1JLW A;  3HVV A;  4GF0 A;  2FHE A;  2EIR A;  3QFA C;  2WS2 A;  4IJ3 A;  3GKK A;  1M9A A;  1TK5 B;  2GQL A;  1BG5 A;  4L0U A;  2WCI A;  3QR6 A;  1SJI A;  5B8B A;  2O7K A;  3WGE A;  3HVX A;  2N5F A;  4KA0 A;  3QAW A;  1SU9 A;  7GSS A;  3K8N A;  3P7X A;  4MA9 A;  3Q6O A;  2DJ0 A;  4BL7 A;  1KNG A;  4MF5 A;  1JZW A;  1UVZ A;  3HKR A;  3KH9 A;  3Q18 A;  2AV4 A;  2HZE B;  3WYW A;  2I4A A;  6GSS A;  2YAN A;  5DQY A;  1GUM A;  1ST9 A;  2C0D A;  1EV9 A;  2PVQ A;  4DSQ A;  1T8E B;  5GAN D;  1OVN A;  1WMJ A;  4HOJ A;  3UIW A;  3FR9 A;  1FG4 A;  2F8F A;  4IJI A;  3QFB C;  4V2N A;  2PMT A;  5GZZ B;  2ZUP A;  1QUW A;  4QL9 A;  1JZO A;  1Z9H A;  2ZNM A;  2YJ7 A;  3GTU A;  3BJ5 A;  4JZQ A;  5G1L A;  4AF2 A;  4OCE A;  2D2Z A;  3QOU A;  5KN3 A;  1S3D A;  2HE3 A;  1XWC A;  3KGK A;  4YQV A;  2YWO A;  2N5B A;  4GXZ A;  4HU7 A;  4MMM A;  4Q5Q A;  5AGY A;  3TKS A;  1TK0 B;  5G30 A;  1VGL A;  1G7O A;  1TOF A;  1TU8 A;  5D73 A;  3QAG A;  2RM6 A;  3UMA A;  5C00 A;  3KP9 A;  3C1R A;  2CVB A;  4KE3 A;  1TW9 A;  1ZL9 A;  3GUS A;  4CDO A;  4ECI A;  1M0U A;  2REM A;  3TJJ A;  4MJE A;  2VCV A;  3E9J B;  2B1K A;  2EC4 A;  2TIR A;  4EC0 A;  3D21 A;  5ID2 A;  5DAL A;  4XS4 A;  1EGR A;  4L5L A;  1GUL A;  3TJB A;  3LYP A;  4K1F A;  3CSI A;  4XS6 A;  5COH A;  4ECC A;  3CSJ A;  4POM A;  1F6M C;  3U5R E;  4N11 A;  2IJY A;  2CVK A;  2TRC P;  4QL7 A;  3TKP A;  3VWX A;  2FUG 2;  5E59 A;  4OO5 A;  3UAP A;  4YAP A;  2L6C A;  3CTF A;  2C3Q A;  2VL3 A;  20GS A;  4PGT A;  2VUP A;  5D8I A;  2VIM A;  3G7J A;  3F0I A;  4TKY A;  2PUK C;  5JWQ B;  1YQ1 A;  1T3B A;  1A2L A;  5G5E A;  1BYE A;  3BCI A;  4TVE A;  1ML6 A;  5JCG A;  2F51 A;  4I6X A;  1ZCP A;  1AAZ A;  2B3S A;  1V98 A;  3HHV A;  2VM2 A;  3GKM A;  2DIY A;  4F9Z A;  3ISO A;  2JU5 A;  4N0V A;  4IW9 A;  3CBU A;  2HLS A;  1YF1 A;  3L9V A;  2GQK A;  1Z6N A;  3F8U A;  2VOC A;  3M9K A;  4DEJ A;  5JCW A;  2VLT A;  3V1W A;  1ILO A;  3PGT A;  2YZH A;  3CRT A;  3IXR A;  2H72 A;  5A5K A;  4ZB9 A;  3F6F A;  1GSD A;  2LQO A;  2WRT A;  1YF0 A;  1V9W A;  4PUF C;  2VCT A;  2A2R A;  4I5Q A;  2HZF A;  2HYX A;  4POL A;  4WXT A;  3GN3 A;  2IFQ B;  2V32 A;  3D22 A;  3EMP A;  3LXZ A;  3I43 A;  1BJX A;  3CXG A;  5CNW A;  1FW1 A;  4DVC A;  1F3A A;  4BVY A;  4AGS A;  3ZTL A;  5JWR B;  1JHB A;  5ECN B;  1M7T A;  1OE8 A;  4O7H A;  5HFG A;  4ZL9 A;  1HQO A;  3APO A;  2PU9 C;  3GST A;  2DBC A;  2L4C A;  4XIH A;  3IC4 A;  1B4P A;  3S9F A;  2R4V A;  4BWQ A;  1TXX A;  2C0G A;  4EDY A;  2JZR A;  1B9X C;  2VO4 A;  1OAZ A;  3FZA A;  1FVK A;  1XW5 A;  4HDE A;  5AIX A;  1PKZ A;  2O89 A;  4TR4 A;  8GSS A;  4YQM A;  2B5Y A;  1M99 A;  4FYC A;  5F0G A;  2LNT A;  1F3B A;  1NSW A;  4P3Y B;  3H79 A;  5ECO B;  1WPI A;  2OE1 A;  1GUK A;  1H75 A;  2AB6 A;  2B6M A;  1K0C A;  3FZ4 A;  4OWY A;  2PPT A;  2ON5 A;  4EKZ A;  2HSY A;  4GSS A;  3DD3 A;  1GLP A;  2GTU A;  3KH7 A;  2YZU A;  3TJG A;  1GSU A;  2FA8 A;  3D4T A;  1GRX A;  4PQH A;  4MPG A;  3RHB A;  3H4K A;  1MTC A;  1OC9 A;  1HYU A;  5ELA A;  4EE0 A;  2HRF A;  3MDK A;  3APQ A;  5J9B A;  3C8E A;  1SKR B;  3QAV A;  5HR0 A;  2F9S A;  2ON7 A;  3IDV A;  4IS0 A;  2AYT A;  1GWC A;  3TJK A;  2VAF A;  1V40 A;  2L59 A;  4TOP A;  5IMC A;  1GNE A;  3HY2 A;  4MZC A;  1KTE A;  3O76 A;  1XWK A;  1E2Y A;  3IE3 A;  2YOI A;  2L4Q A;  1OC8 A;  1PL1 A;  3W8J A;  5HQP A;  3BD2 A;  1IYI A;  2DJ3 A;  2X8H A;  4K9Z A;  2FD3 A;  18GS A;  2H6Z A;  1EEJ A;  1QXH A;  4I97 A;  1X9S B;  3EIN A;  2V6O A;  3VFI A;  3HDC A;  1USB A;  1F9M A;  1B48 A;  3EE2 A;  5EL8 A;  4EF0 A;  4J2F A;  1A2M A;  4ZBD A;  3DML A;  3D5J A;  4ZXG A;  3EWL A;  1PA3 A;  2VD1 A;  3ZIJ A;  6GSV A;  1WJK A;  1XW9 A;  1GP1 A;  3RDW A;  1GTI A;  3KZQ A;  1I9D A;  2DIZ A;  2YWI A;  1PRX A;  4PNG A;  3E0U A;  3L9S A;  3VI5 A;  4XRD A;  3HCZ A;  4FYB A;  1BED A;  1CQH A;  5ENU A;  2O87 A;  4TRX A;  1A23 A;  3HJP A;  2XBQ A;  1AQW A;  4LA1 A;  4V2M A;  5D9V A;  1TTZ A;  2PN8 A;  3KMN A;  1XWA A;  1ZYE A;  3FKF A;  1TI1 A;  2OBI A;  3FRC A;  3TOU A;  4J56 E;  5DCG A;  4O5R A;  5JWO B;  3EC3 A;  1AW9 A;  3OR5 A;  4Q5N A;  1EP8 A;  1KBN A;  1ZOF A;  1EV4 A;  1EOH A;  4IQA A;  1AIU A;  2DSA A;  1G7E A;  2MMO A;  1PSQ A;  3TCO A;  3FK8 A;  5CRD A;  4ML1 A;  3VPQ A;  4IN0 A;  5HR1 A;  3RBT A;  2V6K A;  6GSW A;  3EVI A;  2BJX A;  1T7P B;  3VK9 A;  3J7Y b;  4ECB A;  2KLX A;  1OKD A;  3A3T A;  2VCZ A;  1GTA A;  1YKC A;  2YN1 A;  3Q19 A;  1H4O A;  5L71 A;  2IMK A;  5HR2 A;  3LQ7 A;  2C1Y A;  5ABR A;  4WBR D;  1TRU A;  1DBY A;  3VPT A;  5DQS A;  4KDY A;  4JR6 A;  1XBS A;  4MH3 A;  3UJ1 A;  5J5N A;  4FIW A;  1Q98 A;  1ERW A;  1TU7 A;  3ZYW A;  3L78 A;  3D4M A;  5EVO A;  2C4J A;  1S3A A;  3ZIV A;  4NXI A;  1HD2 A;  3BCK A;  1DSB A;  4QQ7 A;  3UEM A;  3E3E A;  2FWE A;  4OMV A;  4KSM A;  1FHE A;  3EYT A;  5B6N A;  3WT2 A;  2AAW A;  1R5A A;  2V2G A;  5H5R A;  3FZ5 A;  2FGX A;  5ECL B;  3UOM A;  1K0B A;  2NPB A;  2FA4 A;  2B1L A;  4WF4 A;  3IPZ A;  1ERU A;  4L5O A;  4LLR A;  3G7I A;  3F4T A;  17GS A;  4DSS A;  2GZY A;  4NV2 A;  2LJK A;  4L8E A;  4FYU A;  1SJZ A;  1X9M B;  2WDU A;  1EWX A;  3GMF A;  1YZX A;  1U87 A;  2Z9S A;  1A24 A;  5DAK B;  5EPF A;  1XPV A;  5KN0 A;  3UVT A;  3EMX A;  2LV3 A;  5D93 A;  2KOK A;  4G9H A;  1GSQ A;  2X8G A;  4D73 A;  2MMZ A;  2IPA A;  1EOG A;  3DVX A;  1FVJ A;  4WR5 A;  2ALB A;  4KB3 A;  3KIJ A;  4GRF A;  2HNL A;  4H86 A;  1CQG A;  2O8V B;  4POB A;  1XOA A;  3UL3 A;  3I69 A;  1SEN A;  3P90 A;  2LST A;  4ZL7 A;  2HT9 A;  2E2G A;  1SKS B;  3UAR A;  5GST A;  4G2E A;  3GRX A;  2KUC A;  1GSY A;  3DVW A;  4OD7 A;  3P2A A;  1VF4 A;  2LRC A;  5IMF A;  3CYN A;  4MJA A;  3RAZ A;  5FWG A;  1ZYQ B;  4OO4 A;  1ERV A;  2OAC A;  4GST A;  3IK9 A;  4YQU A;  5IPG A;  5IMD A;  4KX4 A;  3SWL A;  3CSH A;  3O6T A;  4IVF A;  2DC5 A;  3A2V A;  3GL3 A;  1LU4 A;  3CTG A;  3DEX A;  4ML6 A;  4ECJ A;  1T00 A;  2HSH A;  1AXD A;  3HVS A;  4XS1 A;  4WR4 A;  1FO5 A;  2XBI A;  3D6I A;  4K6X A;  1W89 A;  3M0F A;  2DJK A;  4KCE A;  2C3N A;  2GVP A;  1XZO A;  1O81 A;  3TRX A;  2OJL A;  4MF7 A;  4HEA 2;  3TGZ A;  4K7O A;  3L9U A;  3TKS C;  1GSS A;  1FB0 A;  1X0R A;  2L5L A;  1IYH A;  1GSE A;  3DWV A;  3TRP A;  1K3Y A;  4Q5F A;  2CX4 A;  5CRH A;  1SD9 A;  5JCU A;  1QFN A;  5A4W A;  3I6A A;  2OE3 A;  5A4U A;  5ECI B;  4MH2 A;  1ZGN A;  1HNA A;  1GNW A;  2H0H A;  2RUF A;  4MF6 A;  1YJ6 A;  2K18 A;  4V1A p;  1V2A A;  3VI7 A;  3KTL A;  4WEY A;  1R4W A;  2YCD A;  1J9B A;  5ELG A;  3TJF A;  2YPM A;  5D96 A;  3VWU A;  4GCI A;  2K8S A;  4ZIL A;  2C0E A;  1TK8 B;  3GTU B;  4JR4 A;  2VL2 C;  3LSZ A;  2JSY A;  2FCH A;  2C3T A;  2WB9 A;  2KP2 A;  4TXO A;  1NW2 A;  5DCH A;  1X5C A;  1XVW A;  5J3R A;  2V41 A;  1X9W B;  3KJY A;  1O8W A;  3ME8 A;  3DYR A;  3CRU A;  3C7M A;  5F05 A;  3FY7 A;  5ECR B;  4E8E A;  5C04 A;  1VF1 A;  1ZMA A;  5B7C A;  2M80 A;  2AJQ B;  4WET A;  4OCF A;  3LOR A;  4J57 E;  2CZ3 A;  2H74 A;  3WGX A;  1PD2 1;  2YP6 A;  3R2Q A;  2FY6 A;  2OKA A;  2CAI A;  2CZ2 A;  3HA9 A;  4GLT A;  1C72 A;  4O92 A;  4TR1 A;  4KDX A;  4K7N A;  3TDG A;  2PER A;  1GTB A;  5ID2 B;  3RPN A;  5DAL B;  1O7U A;  4XS4 B;  4PQ1 A;  2GSR A;  3HZ4 A;  2B5X A;  2HFD A;  2L5O A;  4ZB6 A;  2YWM A;  3QD9 A;  3QCP A;  1LJR A;  3Q74 A;  1XVQ A;  3CMI A;  3DIE A;  3GH6 A;  16GS A;  1BX9 A;  4PUR A;  3SBC A;  4MDC A;  4NAX A;  2PVO C;  3FR6 A;  5CO3 A;  1K3O A;  4MJB A;  5DDL A;  2F8A A;  4GWR A;  2JZS A;  2VM1 A;  13GS A;  2JL4 A;  4TN8 A;  4ILF A;  3I9V 2;  2CVD A;  3QDN A;  3PIN A;  2MMN A;  1N2A A;  2H1G A;  3F9U A;  3TB2 A;  3VWW A;  2GQM A;  1MDK A;  3ZLP A;  12GS A;  4FO5 A;  6GSY A;  2NDO A;  2K6V A;  3IAM 2;  6GST A;  3KP8 A;  5G31 A;  3RPP A;  2O85 A;  4K0N A;  3GL5 A;  2VCX A;  4KCA A;  2JAC A;  2H75 A;  2EIO A;  3N5O A;  1SK0 A;  4NHZ A;  2LRT A;  3KXO A;  4GQC A;  4GTU A;  5HR3 A;  3HZ8 A;  1NHY A;  1GL8 A;  4N30 A;  3GA4 A;  1NM3 A;  1EP7 A;  2M72 A;  1UC7 A;  2MBS A;  3FW2 A;  4XHM A;  1Y6E A;  2E0Q A;  3D0Z A;  2LS5 A;  4I2U A;  4MLY A;  2RLI A;  3LJR A;  1JFU A;  3FR3 A;  3N9J A;  3UBK A;  1WRY A;  4NPB A;  2C8U A;  2A4V A;  2KP1 A;  4K2D A;  5AIS A;  4LMV A;  2R3X A;  2K9F A;  3DGQ A;  5HFK A;  5KEJ A;  5G5F A;  2H6X A;  4PNF A;  3ZMK A;  1GSF A;  3O3T A;  1U3I A;  5DJM A;  1AQV A;  5LNK e;  5IOX A;  4MK3 A;  2QSI A;  1K0D A;  1XIY A;  3IK7 A;  4HS1 A;  5IM9 A;  5IO0 A;  3ZFL A;  1TRV A;  3A2W A;  4WKW A;  5AIV A;  2C0F A;  2HZE A;  2DMM A;  2P0G A;  5B8A A;  1RK4 A;  1U88 A;  3ZML A;  3HXS A;  2B7K A;  2JAD A;  1VF2 A;  2P31 A;  5AN1 A;  4YAV A;  4ZIJ A;  5CRW A;  1NHO A;  4IBP A;  4MJC A;  4TXV A;  3TUE A;  4HU9 A;  3IAS 2;  2WUL A;  1HNC A;  2IIY A;  4HJM A;  1WWJ A;  5A4V A;  1JZD A;  1SJ6 A;  2CQ9 A;  10GS A;  3WD6 A;  3H1N A;  2MBT A;  5J9C A;  1WIK A;  3U6V A;  1B4Q A;  1X5E A;  1GLQ A;  3H93 A;  1Z6M A;  4EO3 A;  1OC9 B;  2IN3 A;  1U3A A;  2YNX A;  3GIX A;  1QK8 A;  3F3R A;  2G2Q A;  5IPH A;  3HJO A;  3MNG A;  1O85 A;  2GDR A;  3BBY A;  3ME7 A;  3ZRD A;  2VCW A;  3ED3 A;  1TP9 A;  5DJL A;  3ZIT A;  4NHW A;  2LNS A;  5GSS A;  1XW6 A;  1PKW A;  1F2E A;  2VLV A;  1SK1 A;  3BOA A;  1A8Y A;  2CX3 A;  1B8X A;  5H5Q A;  2FLS A;  2RII A;  5B6M A;  4KAE A;  4FH8 A;  3DKS A;  1R7H A;  2R2J A;  5KN2 A;  3TOT A;  1M2D A;  2BMX A;  1R26 A;  1Z5Y E;  2CAQ A;  2R5G A;  5CP1 A;  4OFM A;  3AY8 A;  3MWH A;  4NV5 A;  2FWH A;  1T4Z A;  4JU5 A;  4TW5 A;  3MAK A;  3HJM A;  1GTU A;  3FEU A;  1I5G A;  4MAB A;  4F0B A;  3VWV A;  2H30 A;  2WZ9 A;  2YWN A;  1O6J A;  2RUE A;  1OC3 A;  3IA1 A;  5FHI A;  1XXU A;  1YEP A;  1AUC A;  1MDI A;  4XTS A;  5ECH B;  3DRN A;  2EIQ A;  3NOF A;  2K8V A;  2X8C A;  2FWF A;  1TJD A;  5IMZ A;  4BPY A;  1YY7 A;  2XC2 A;  4O32 A;  1FOV A;  3KTB A;  3KMO A;  1J08 A;  4JBB A;  4EUY A;  4F0C A;  3ERF A;  2F3M A;  4LL4 B;  1PGT A;  4HQZ A;  4N0Z A;  5CRG A;  2CV4 A;  4MPF A;  2I9H A;  1SL2 B;  3IR4 A;  2H0I A;  2LJA A;  5J41 A;  1PQN A;  3APS A;  3G9B A;  2IFQ A;  4G10 A;  3C1S A;  4YH2 A;  5ECQ B;  1JLV A;  1KEB A;  2DJ2 A;  2PWJ A;  3NIV A;  4RQR A;  5ECP B;  1VRS D;  2PGT A;  1OKT A;  1G6W A;  2V1M A;  2MZC A;  2N5A A;  5D9X A;  1LBK A;  1UN2 A;  2JSZ A;  2WFC A;  4X0X A;  1N8J A;  2H71 A;  4KW6 A;  1OYJ A;  4CHS A;  2H1D A;  2GT5 A;  2GGT A;  2IMD A;  3KEB A;  2AUV A;  1UA5 A;  3F4S A;  4ID0 A;  2I1U A;  3GKN A;  3FYG A;  2GS3 A;  1URM A;  3KCM A;  5INY A;  4KSO A;  2WGR A;  2GT6 A;  3HD5 A;  3ZRE A;  3US3 A;  1M9B A;  4NWY A;  1MD3 A;  4XRA A;  5D9W A;  2XPE A;  1WP0 A;  1YKA A;  4I8B A;  3JCM L;  3QPM A;  1BAY A;  2VL2 A;  2H1B A;  5CYY A;  2WJU A;  3GYK A;  1AC1 A;  1PX7 A;  4WF5 A;  1T4Y A;  3NZN A;  1ZZY A;  4DSS B;  1WE0 A;  2OA7 A;  3EU3 A;  3ZVJ A;  3LWA A;  4IHU A;  1E6B A;  1K0O A;  2L57 A;  3DXB A;  1V57 A;  5LCZ A;  3LG6 A;  5LD0 A;  2H6Y A;  4KUN A;  4AJ8 A;  3UBL A;  2X64 A;  1FAA A;  1K0N A;  1A2J A;  3W6G A;  1MDJ A;  2H73 A;  5IQY A;  4D73 B;  3A2X A;  2CT6 A;  4KH7 A;  4LL1 B;  4KGI A;  1Z7R A;  2GZP A;  4BA7 A;  3GV1 A;  2YV9 A;  1FB6 A;  1EGO A;  4OFT A;  4K7I A;  2GST A;  1MD4 A;  5ECM B;  1JZR A;  1Q4J A;  9GSS A;  2KHP A;  2LKU A;  1AQX A;  3GX0 A;  4GSN A;  5F06 A;  2GSQ A;  4IP1 A;  4ULX A;  1VF3 A;  4DSR A;  2X99 A;  3PR8 A;  1PN9 A;  4EDZ A;  1MEK A;  3RHC A;  4BWS A;  1A8L A;  3ERG A;  2HRN A;  5G1K A;  3IBH A;  4L0W A;  3FZ9 A;  3GFK A;  2H0G A;  1TRW A;  2DLX A;  2A2S A;  3L4N A;  4F2I A;  4KND A;  2VD0 A;  1THO A;  3IRA A;  4RI7 A;  2NVL A;  2DML A;  1TKD B;  1X5D A;  2DJ1 A;  22GS A;  2GZZ A;  2QGV A;  2LEG A;  3TKR A;  2H8L A;  1U6T A;  5IO2 A;  4MP4 A;  1K0M A;  2GLR A;  1G0T A;  1XCC A;  5IMA A;  3VLN A;  4ZBB A;  1SKW B;  4WBJ A;  1EEM A;  1F37 A;  4ACS A;  4RI6 A;  1HNB A;  2IME A;  3GX8 A;  3WT1 A;  1TRS A;  1QQ2 A;  2ES7 A;  1TI3 A;  2H76 A;  1Y25 A;  4K0G A;  1O73 A;  3TKS E;  4BVX A;  5DBQ A;  2C80 A;  2PBJ A;  4HZ4 A;  1XWG A;  4IEL A;  2H70 A;  4KDU A;  2MMA A;  2FWG A;  3F63 A;  2G0F A;  2RM5 A;  2IL3 A;  4I2T A;  4MCU A;  3ERW A;  3KM6 A;  3GSS A;  6GSX A;  2HXK A;  4E8H A;  2I81 A;  4IKH A;  5CRE A; 
#chains in the Genus database with same CATH topology
 3GHA A;  3M9J A;  1QMV A;  3EUR A;  1J0F A;  1SD8 A;  1G6Y A;  3F4R A;  5IOW A;  5FT3 A;  1SYR A;  5DVB A;  1TDI A;  2QC7 A;  4G19 A;  4MZB A;  1Z7P A;  2H01 A;  2R6K A;  5HFI A;  1M2B A;  2J9H A;  3GKX A;  5BMU A;  1XOB A;  3J7Y k;  2ZCT A;  3ZZX A;  2E2M A;  1THX A;  3M3M A;  1GH2 A;  3VUR A;  5ECS A;  1A0F A;  2LJR A;  5ECK B;  1YEX A;  4PXO A;  3LXT A;  1EZK A;  4F82 A;  1QGV A;  4V2L A;  5D9T A;  2H19 A;  1K0A A;  4PUA A;  5F07 A;  4TXO B;  2BTO T;  2XHF A;  2XPD A;  4ZL8 A;  3IHQ A;  4TR0 A;  1YDK A;  4ZBA A;  1S3C A;  4X1U A;  4OFN A;  2MYG A;  1DE2 A;  2IWT A;  4PX1 A;  1GUH A;  2P5Q A;  1V58 A;  3MSZ A;  3F3Q A;  3LYK A;  3L0H A;  1XWB A;  4GQF A;  1B9Y C;  2IMI A;  3C71 A;  2H66 A;  2HRA A;  4HQS A;  4HI7 A;  1O8X A;  4HJ2 A;  3C73 A;  3TRQ A;  14GS A;  4TR3 A;  4BIK A;  5E4W A;  4JED A;  4RUV A;  3M8N A;  1RQM A;  4TR1 B;  5IIZ A;  3LFL A;  4JE1 A;  2LTK A;  4ZB8 A;  3QMX A;  3EU4 A;  3GNJ A;  3GH9 A;  4K8M A;  4PTS A;  5J4U A;  4LMW A;  5GAP D;  2P5R A;  2M46 A;  3IOS A;  4IGJ A;  2LRN A;  1PMT A;  2E7P A;  2NTO A;  1SL1 B;  4AJ6 A;  3LGC A;  4F03 A;  2L6D A;  4Q5R A;  4IQ1 A;  4G0L A;  2OE0 A;  4POK A;  2NBS A;  3IV4 A;  1RW1 A;  4HZ2 A;  2VCQ A;  3KD0 A;  2GSS A;  4IP6 A;  1BQ7 A;  4ISD A;  3HYP A;  2FNO A;  1R5P A;  4AJ7 A;  3LEF A;  5DAK A;  1WOU A;  2DJJ A;  4K5S A;  4X43 A;  2IMF A;  4N10 A;  3GUR A;  1ACV A;  1PX6 A;  2QKE A;  1A0R P;  2CA8 A;  3A5W A;  1ON4 A;  5IMV A;  2JZT A;  3ZFB A;  1M2A A;  1ABA A;  4PQI A;  1DE1 A;  4RQX A;  4EXJ A;  4EL1 A;  11GS A;  1SYX A;  3FHK A;  2YJH A;  1SL0 B;  2R37 A;  1OE7 A;  1M3J A;  5F8B A;  2B7J A;  5G2Z A;  4CW9 A;  2AHE A;  2HRK A;  19GS A;  2LUS A;  5H5S A;  1SK2 A;  2I3Y A;  3TKQ A;  4MZW A;  6GSU A;  2LQQ A;  3WGD A;  2VL9 A;  4XCS A;  4EVM A;  5CAX A;  2H1A A;  2VLU A;  4Z7X A;  1Z3E A;  3A5I A;  1DUG A;  1PL2 A;  3G7Y A;  3H8Q A;  3PH9 A;  3ZL5 A;  2YV7 A;  5KN1 A;  3ZVJ D;  2HI7 A;  4JRR A;  2OAD A;  2R0P A;  4V1A g;  4X4J A;  3F6D A;  3M1G A;  1K3L A;  2B5E A;  1XFL A;  4NMU A;  2OBK A;  4HUA A;  1W4V A;  3UVH A;  2J23 A;  2TRX A;  3W8S A;  5EY6 A;  3P8W A;  1ERT A;  1T1V A;  1JLW A;  4MNN A;  3HVV A;  4GF0 A;  2FHE A;  2EIR A;  3QFA C;  2WS2 A;  4IJ3 A;  3GKK A;  1M9A A;  1TK5 B;  2GQL A;  1BG5 A;  4L0U A;  2WCI A;  3QR6 A;  1SJI A;  5B8B A;  2O7K A;  3WGE A;  3HVX A;  2N5F A;  4KA0 A;  3QAW A;  1SU9 A;  7GSS A;  3K8N A;  3P7X A;  4MA9 A;  3Q6O A;  2DJ0 A;  4BL7 A;  1KNG A;  4MF5 A;  1JZW A;  1UVZ A;  3HKR A;  3KH9 A;  1M3I A;  3Q18 A;  2AV4 A;  2HZE B;  3WYW A;  2I4A A;  6GSS A;  2YAN A;  5DQY A;  1GUM A;  1ST9 A;  2C0D A;  1EV9 A;  4USS A;  2PVQ A;  3HVN A;  4DSQ A;  1T8E B;  5GAN D;  1OVN A;  1WMJ A;  4HOJ A;  3UIW A;  3FR9 A;  1FG4 A;  2F8F A;  4IJI A;  3QFB C;  4V2N A;  2PMT A;  5GZZ B;  2ZUP A;  1QUW A;  4QL9 A;  1JZO A;  1Z9H A;  2ZNM A;  2YJ7 A;  2DKH A;  3GTU A;  3BJ5 A;  4JZQ A;  5G1L A;  4AF2 A;  4OCE A;  2D2Z A;  3QOU A;  5KN3 A;  1S3D A;  2HE3 A;  1XWC A;  3KGK A;  4YQV A;  2YWO A;  2N5B A;  4GXZ A;  4HU7 A;  4MMM A;  4Q5Q A;  5AGY A;  3TKS A;  1TK0 B;  5G30 A;  1VGL A;  1G7O A;  1TOF A;  1TU8 A;  5D73 A;  3QAG A;  2RM6 A;  3UMA A;  5C00 A;  3KP9 A;  3C1R A;  2CVB A;  4KE3 A;  1TW9 A;  1ZL9 A;  3GUS A;  4CDO A;  4ECI A;  1M0U A;  2REM A;  3TJJ A;  4MJE A;  2VCV A;  3E9J B;  2B1K A;  2EC4 A;  2TIR A;  4EC0 A;  3D21 A;  5ID2 A;  5DAL A;  4XS4 A;  1EGR A;  4L5L A;  1GUL A;  3TJB A;  3LYP A;  4K1F A;  3CSI A;  4XS6 A;  5COH A;  4ECC A;  3CSJ A;  4POM A;  1F6M C;  3U5R E;  4N11 A;  2IJY A;  2CVK A;  2TRC P;  4QL7 A;  3TKP A;  3VWX A;  2FUG 2;  4OO5 A;  5E59 A;  3UAP A;  4YAP A;  2L6C A;  3CTF A;  2C3Q A;  2VL3 A;  20GS A;  4PGT A;  2VUP A;  5D8I A;  2VIM A;  3G7J A;  3F0I A;  4TKY A;  2PUK C;  5JWQ B;  1YQ1 A;  1T3B A;  1A2L A;  5G5E A;  1BYE A;  3BCI A;  4TVE A;  1ML6 A;  5JCG A;  2F51 A;  4I6X A;  1ZCP A;  1AAZ A;  2B3S A;  1V98 A;  3HHV A;  2VM2 A;  3GKM A;  2DIY A;  4F9Z A;  3ISO A;  2JU5 A;  4N0V A;  4IW9 A;  3CBU A;  2HLS A;  4CY6 A;  1YF1 A;  3IHG A;  2GQK A;  1Z6N A;  3F8U A;  3L9V A;  2VOC A;  3M9K A;  4DEJ A;  5JCW A;  1ZYP A;  2VLT A;  3V1W A;  1ILO A;  3PGT A;  2YZH A;  3CRT A;  3IXR A;  2H72 A;  5A5K A;  4ZB9 A;  3F6F A;  1GSD A;  2LQO A;  2WRT A;  1YF0 A;  1V9W A;  5KOX A;  4PUF C;  2VCT A;  2A2R A;  4I5Q A;  2HZF A;  2HYX A;  4POL A;  4WXT A;  3GN3 A;  2IFQ B;  2V32 A;  3D22 A;  3EMP A;  3LXZ A;  3I43 A;  1BJX A;  4Z2R A;  3CXG A;  5CNW A;  1FW1 A;  4DVC A;  1F3A A;  4BVY A;  4AGS A;  3ZTL A;  5JWR B;  1JHB A;  4Z2U A;  5ECN B;  1M7T A;  1OE8 A;  4O7H A;  5HFG A;  4ZL9 A;  2X49 A;  1HQO A;  3APO A;  2PU9 C;  3GST A;  2DBC A;  2L4C A;  4XIH A;  3IC4 A;  1B4P A;  3S9F A;  2R4V A;  4BWQ A;  1TXX A;  2C0G A;  4EDY A;  2JZR A;  1B9X C;  2VO4 A;  1OAZ A;  3FZA A;  1FVK A;  1XW5 A;  4HDE A;  5AIX A;  1PKZ A;  2O89 A;  4TR4 A;  8GSS A;  4YQM A;  2B5Y A;  1M99 A;  4FYC A;  5F0G A;  2LNT A;  1F3B A;  1NSW A;  4P3Y B;  3H79 A;  5ECO B;  1WPI A;  2OE1 A;  1GUK A;  4O5Q A;  1H75 A;  1XG8 A;  2AB6 A;  2B6M A;  1K0C A;  3FZ4 A;  4OWY A;  2PPT A;  2ON5 A;  4EKZ A;  2HSY A;  4GSS A;  1PFO A;  3DD3 A;  1GLP A;  2GTU A;  3KH7 A;  2YZU A;  3TJG A;  1GSU A;  2FA8 A;  3D4T A;  1GRX A;  4PQH A;  4MPG A;  3RHB A;  4ICY A;  3FMW A;  3H4K A;  1MTC A;  1OC9 A;  1HYU A;  5ELA A;  3EPT A;  2R0G A;  4EE0 A;  2HRF A;  3MDK A;  3APQ A;  5J9B A;  3C8E A;  1SKR B;  3QAV A;  5HR0 A;  2F9S A;  2ON7 A;  3IDV A;  4IS0 A;  4FQU A;  2AYT A;  1GWC A;  3TJK A;  2VAF A;  1V40 A;  2L59 A;  4TOP A;  5IMC A;  1GNE A;  3HY2 A;  4MZC A;  1KTE A;  3O76 A;  1XWK A;  1E2Y A;  3IE3 A;  2YOI A;  2L4Q A;  1OC8 A;  1PL1 A;  3W8J A;  5HQP A;  3BD2 A;  1IYI A;  2DJ3 A;  2X8H A;  4K9Z A;  2FD3 A;  18GS A;  2H6Z A;  1EEJ A;  1QXH A;  4I97 A;  1X9S B;  3EIN A;  2V6O A;  3VFI A;  3HDC A;  1USB A;  1F9M A;  1B48 A;  3EE2 A;  5EL8 A;  4EF0 A;  4J2F A;  1A2M A;  4ZBD A;  3DML A;  3D5J A;  4ZXG A;  3EWL A;  1PA3 A;  2VD1 A;  3ZIJ A;  6GSV A;  1WJK A;  1XW9 A;  1GP1 A;  3RDW A;  2HSM A;  4BVX B;  1GTI A;  3KZQ A;  1I9D A;  2DIZ A;  2YWI A;  1PRX A;  4PNG A;  3E0U A;  3L9S A;  3VI5 A;  4XRD A;  3HCZ A;  4FYB A;  1BED A;  1CQH A;  5ENU A;  2O87 A;  4TRX A;  1A23 A;  3HJP A;  2XBQ A;  1AQW A;  4LA1 A;  4V2M A;  5D9V A;  1TTZ A;  4YKG A;  2PN8 A;  3KMN A;  1XWA A;  3MIX A;  1ZYE A;  3FKF A;  1TI1 A;  2OBI A;  3FRC A;  3TOU A;  4J56 E;  5DCG A;  4O5R A;  5JWO B;  3EC3 A;  1AW9 A;  3OR5 A;  4Q5N A;  5BRT A;  1EP8 A;  1KBN A;  1ZOF A;  1EV4 A;  1EOH A;  4IQA A;  1AIU A;  2DSA A;  1G7E A;  2MMO A;  1PSQ A;  3TCO A;  3FK8 A;  5CRD A;  4ML1 A;  3VPQ A;  4IN0 A;  5HR1 A;  3RBT A;  2V6K A;  6GSW A;  3EVI A;  2BJX A;  1T7P B;  3VK9 A;  3J7Y b;  4ECB A;  2KLX A;  1OKD A;  3A3T A;  2VCZ A;  1GTA A;  1YKC A;  2YN1 A;  3Q19 A;  1H4O A;  5L71 A;  2IMK A;  5HR2 A;  3LQ7 A;  2C1Y A;  5ABR A;  4WBR D;  1TRU A;  1DBY A;  3VPT A;  5DQS A;  4KDY A;  4JR6 A;  1XBS A;  4MH3 A;  3UJ1 A;  5J5N A;  4FIW A;  1Q98 A;  1ERW A;  1TU7 A;  3ZYW A;  3L78 A;  3D4M A;  5EVO A;  2UZ8 A;  2C4J A;  1S3A A;  3ZIV A;  4NXI A;  1HD2 A;  3BCK A;  1DSB A;  4QQ7 A;  3UEM A;  3E3E A;  2FWE A;  4OMV A;  4KSM A;  1FHE A;  3EYT A;  5B6N A;  3WT2 A;  2AAW A;  1R5A A;  2V2G A;  5H5R A;  3FZ5 A;  2FGX A;  5ECL B;  3UOM A;  1K0B A;  2NPB A;  2FA4 A;  2B1L A;  4WF4 A;  3IPZ A;  1ERU A;  4L5O A;  4LLR A;  3G7I A;  3F4T A;  17GS A;  4DSS A;  2GZY A;  4NV2 A;  2LJK A;  4L8E A;  4FYU A;  1SJZ A;  1X9M B;  2WDU A;  1EWX A;  3GMF A;  1YZX A;  1U87 A;  2Z9S A;  1A24 A;  5DAK B;  5EPF A;  1XPV A;  5KN0 A;  3UVT A;  3EMX A;  2LV3 A;  5D93 A;  2KOK A;  4G9H A;  1GSQ A;  2X8G A;  4D73 A;  2MMZ A;  2IPA A;  1EOG A;  3DVX A;  1FVJ A;  4WR5 A;  2ALB A;  4KB3 A;  3KIJ A;  4GRF A;  2X4A A;  2HNL A;  4H86 A;  1CQG A;  2O8V B;  4POB A;  1XOA A;  3UL3 A;  3I69 A;  1SEN A;  3P90 A;  2LST A;  4ZL7 A;  2HT9 A;  2E2G A;  1SKS B;  3UAR A;  5GST A;  4G2E A;  3GRX A;  2KUC A;  1GSY A;  3DVW A;  4A5P A;  4OD7 A;  3P2A A;  1VF4 A;  2LRC A;  5IMF A;  3CYN A;  4MJA A;  3RAZ A;  5FWG A;  1ZYQ B;  4OO4 A;  1ERV A;  2OAC A;  4GST A;  3IK9 A;  4YQU A;  5IPG A;  5IMD A;  4KX4 A;  3SWL A;  3CSH A;  3O6T A;  4IVF A;  2DC5 A;  3A2V A;  3GL3 A;  1LU4 A;  3CTG A;  3DEX A;  4ML6 A;  4ECJ A;  1T00 A;  3IC8 A;  2HSH A;  1AXD A;  3HVS A;  4XS1 A;  4WR4 A;  1FO5 A;  2XBI A;  3D6I A;  4K6X A;  1W89 A;  3M0F A;  2DJK A;  4KCE A;  2C3N A;  2GVP A;  1XZO A;  1O81 A;  3TRX A;  2OJL A;  4MF7 A;  4HEA 2;  3TGZ A;  4K7O A;  3L9U A;  3TKS C;  4BL7 B;  1GSS A;  1FB0 A;  1X0R A;  2L5L A;  1IYH A;  1GSE A;  3DWV A;  3TRP A;  1K3Y A;  4Q5F A;  2CX4 A;  5CRH A;  1SD9 A;  5JCU A;  1QFN A;  5A4W A;  3I6A A;  2OE3 A;  5A4U A;  5ECI B;  4MH2 A;  4KF9 A;  1ZGN A;  1HNA A;  1GNW A;  2H0H A;  2RUF A;  4MF6 A;  1YJ6 A;  2K18 A;  4V1A p;  1V2A A;  3VI7 A;  3KTL A;  4WEY A;  1R4W A;  2YCD A;  1J9B A;  5ELG A;  3TJF A;  2YPM A;  5D96 A;  3VWU A;  4GCI A;  2K8S A;  4ZIL A;  2C0E A;  1TK8 B;  3GTU B;  4JR4 A;  2VL2 C;  3LSZ A;  2JSY A;  2FCH A;  2C3T A;  2WB9 A;  2KP2 A;  4TXO A;  1NW2 A;  5DCH A;  1X5C A;  1XVW A;  5J3R A;  2V41 A;  1X9W B;  3KJY A;  1O8W A;  3ME8 A;  3DYR A;  3CRU A;  3C7M A;  5F05 A;  3FY7 A;  5ECR B;  4E8E A;  5C04 A;  1VF1 A;  1ZMA A;  4HSC X;  5B7C A;  4Z2T A;  2M80 A;  2AJQ B;  4WET A;  4OCF A;  3LOR A;  4J57 E;  2CZ3 A;  2H74 A;  3WGX A;  1PD2 1;  2YP6 A;  2DKI A;  3R2Q A;  2FY6 A;  2OKA A;  2CAI A;  2CZ2 A;  3HA9 A;  4GLT A;  1C72 A;  4O92 A;  1S3R A;  4TR1 A;  4KDX A;  4K7N A;  3TDG A;  2PER A;  1GTB A;  5ID2 B;  3RPN A;  5DAL B;  1O7U A;  4XS4 B;  4PQ1 A;  2GSR A;  3HZ4 A;  2B5X A;  2HFD A;  2L5O A;  4ZB6 A;  2YWM A;  3QD9 A;  3QCP A;  1LJR A;  3Q74 A;  1XVQ A;  3CMI A;  3DIE A;  3GH6 A;  16GS A;  1BX9 A;  4PUR A;  3SBC A;  4MDC A;  4NAX A;  2PVO C;  3FR6 A;  5CO3 A;  1K3O A;  4MJB A;  5DDL A;  2F8A A;  4GWR A;  2JZS A;  2VM1 A;  13GS A;  2JL4 A;  4TN8 A;  4ILF A;  3I9V 2;  2CVD A;  3QDN A;  3PIN A;  2MMN A;  1N2A A;  2H1G A;  3F9U A;  3TB2 A;  3VWW A;  2GQM A;  1MDK A;  3ZLP A;  12GS A;  4FO5 A;  6GSY A;  2NDO A;  2K6V A;  3IAM 2;  6GST A;  3KP8 A;  5G31 A;  4K2X A;  3RPP A;  2O85 A;  2R0C A;  4K0N A;  3GL5 A;  2VCX A;  4KCA A;  2JAC A;  2H75 A;  2EIO A;  3N5O A;  1SK0 A;  4NHZ A;  2LRT A;  3KXO A;  4GQC A;  4GTU A;  5HR3 A;  3HZ8 A;  1NHY A;  1GL8 A;  4N30 A;  3GA4 A;  1NM3 A;  4BVY B;  1EP7 A;  2M72 A;  1UC7 A;  2MBS A;  3FW2 A;  4XHM A;  1Y6E A;  2E0Q A;  3D0Z A;  2LS5 A;  4I2U A;  4MLY A;  2RLI A;  3LJR A;  1JFU A;  3FR3 A;  3N9J A;  3UBK A;  1WRY A;  4NPB A;  2C8U A;  2A4V A;  2KP1 A;  4K2D A;  5AIS A;  4LMV A;  2R3X A;  2K9F A;  4G0K A;  3DGQ A;  5HFK A;  5KEJ A;  5G5F A;  2H6X A;  4PNF A;  3ZMK A;  1GSF A;  3O3T A;  4G0I A;  1U3I A;  5DJM A;  1AQV A;  5LNK e;  3MYD A;  5IOX A;  4MK3 A;  2QSI A;  1K0D A;  1XIY A;  3CQF A;  3IK7 A;  4HS1 A;  5IM9 A;  5IO0 A;  3ZFL A;  1TRV A;  3A2W A;  4WKW A;  5AIV A;  2C0F A;  2HZE A;  2DMM A;  2P0G A;  5B8A A;  1RK4 A;  1U88 A;  3ZML A;  3HXS A;  2B7K A;  2JAD A;  1VF2 A;  2P31 A;  5AN1 A;  4YAV A;  4ZIJ A;  5CRW A;  1NHO A;  4IBP A;  4MJC A;  4TXV A;  3TUE A;  4HU9 A;  3IAS 2;  2WUL A;  1HNC A;  2IIY A;  4HJM A;  1WWJ A;  5A4V A;  1JZD A;  1SJ6 A;  2CQ9 A;  10GS A;  3WD6 A;  3H1N A;  2MBT A;  5J9C A;  1WIK A;  3U6V A;  1B4Q A;  1X5E A;  1GLQ A;  3H93 A;  1Z6M A;  4EO3 A;  1OC9 B;  2A4H A;  2IN3 A;  1U3A A;  2YNX A;  3GIX A;  1QK8 A;  3F3R A;  2G2Q A;  5IPH A;  3HJO A;  3MNG A;  1O85 A;  2GDR A;  3BBY A;  3ME7 A;  3ZRD A;  2VCW A;  3ED3 A;  1TP9 A;  5DJL A;  3ZIT A;  4NHW A;  2LNS A;  5GSS A;  1XW6 A;  1PKW A;  1F2E A;  2VLV A;  1SK1 A;  3BOA A;  1A8Y A;  2CX3 A;  1B8X A;  5H5Q A;  2FLS A;  2RII A;  5B6M A;  4KAE A;  4FH8 A;  3DKS A;  1R7H A;  2A2P A;  2R2J A;  5KN2 A;  3TOT A;  1M2D A;  2BMX A;  1R26 A;  1Z5Y E;  2CAQ A;  2R5G A;  5CP1 A;  4OFM A;  3AY8 A;  3MWH A;  4NV5 A;  2FWH A;  1T4Z A;  4JU5 A;  4TW5 A;  3MAK A;  3HJM A;  1GTU A;  3FEU A;  1I5G A;  4MAB A;  4F0B A;  3VWV A;  1FOH A;  2H30 A;  2WZ9 A;  2YWN A;  1O6J A;  2RUE A;  1OC3 A;  3IA1 A;  5FHI A;  1XXU A;  1YEP A;  1AUC A;  1MDI A;  4XTS A;  5ECH B;  3DRN A;  2EIQ A;  3NOF A;  2K8V A;  2X8C A;  2FWF A;  1TJD A;  5IMZ A;  4BPY A;  1YY7 A;  2XC2 A;  4O32 A;  1FOV A;  3KTB A;  5KOW A;  3KMO A;  1J08 A;  4JBB A;  4EUY A;  4F0C A;  3ERF A;  2F3M A;  4LL4 B;  1PN0 A;  1PGT A;  4HQZ A;  4N0Z A;  5CRG A;  2CV4 A;  4MPF A;  2I9H A;  1SL2 B;  3IR4 A;  2H0I A;  2LJA A;  5J41 A;  1PQN A;  3APS A;  3G9B A;  2IFQ A;  4G10 A;  3C1S A;  4YH2 A;  5ECQ B;  1JLV A;  1KEB A;  2DJ2 A;  2PWJ A;  3NIV A;  4RQR A;  5ECP B;  1VRS D;  2PGT A;  1OKT A;  1G6W A;  2V1M A;  2MZC A;  2N5A A;  5D9X A;  1LBK A;  1UN2 A;  2JSZ A;  2WFC A;  4X0X A;  1N8J A;  2H71 A;  4KW6 A;  1OYJ A;  4CHS A;  2H1D A;  2GT5 A;  2GGT A;  2IMD A;  3KEB A;  4YKF A;  2AUV A;  1UA5 A;  3F4S A;  4ID0 A;  2I1U A;  3GKN A;  3FYG A;  2GS3 A;  1URM A;  3KCM A;  5INY A;  4KSO A;  4K5R A;  2WGR A;  2GT6 A;  3HD5 A;  3ZRE A;  3US3 A;  1M9B A;  4NWY A;  1MD3 A;  4XRA A;  5D9W A;  2XPE A;  1WP0 A;  1YKA A;  4O5U A;  4I8B A;  1ZYN A;  3JCM L;  3QPM A;  1BAY A;  2VL2 A;  2H1B A;  5CYY A;  2WJU A;  3GYK A;  1AC1 A;  1PX7 A;  4WF5 A;  1T4Y A;  3NZN A;  1ZZY A;  4DSS B;  1WE0 A;  2OA7 A;  3EU3 A;  3ZVJ A;  3LWA A;  4IHU A;  1E6B A;  1K0O A;  2L57 A;  3DXB A;  1V57 A;  5LCZ A;  3LG6 A;  5LD0 A;  2H6Y A;  4KUN A;  4AJ8 A;  3UBL A;  2X64 A;  1FAA A;  1K0N A;  1A2J A;  3W6G A;  1MDJ A;  2H73 A;  5IQY A;  4D73 B;  3A2X A;  2CT6 A;  4KH7 A;  4LL1 B;  4EIQ A;  4KGI A;  1Z7R A;  2GZP A;  4BA7 A;  3GV1 A;  2YV9 A;  1FB6 A;  1EGO A;  4OFT A;  4K7I A;  2GST A;  1MD4 A;  5ECM B;  1JZR A;  1Q4J A;  9GSS A;  2KHP A;  2LKU A;  1AQX A;  3GX0 A;  4GSN A;  5F06 A;  2GSQ A;  4IP1 A;  4ULX A;  1VF3 A;  2QA1 A;  4DSR A;  2X99 A;  3PR8 A;  1PN9 A;  4EDZ A;  1MEK A;  3RHC A;  4BWS A;  1A8L A;  3ERG A;  2HRN A;  5G1K A;  3IBH A;  3LW9 A;  4L0W A;  3FZ9 A;  3GFK A;  2H0G A;  1TRW A;  2DLX A;  2A2S A;  3L4N A;  4F2I A;  4KND A;  2VD0 A;  1THO A;  3IRA A;  4RI7 A;  2NVL A;  2QA2 A;  2DML A;  1TKD B;  4EIP A;  1X5D A;  2DJ1 A;  22GS A;  2GZZ A;  2QGV A;  2LEG A;  3TKR A;  2H8L A;  1U6T A;  5IO2 A;  4MP4 A;  1K0M A;  2GLR A;  1G0T A;  1XCC A;  3PPU A;  5IMA A;  3VLN A;  4ZBB A;  1SKW B;  4WBJ A;  1EEM A;  1F37 A;  4ACS A;  4RI6 A;  1HNB A;  2IME A;  3GX8 A;  3WT1 A;  1TRS A;  1QQ2 A;  2ES7 A;  1TI3 A;  2H76 A;  1Y25 A;  4K0G A;  1O73 A;  3TKS E;  4BVX A;  5DBQ A;  2C80 A;  2PBJ A;  4HZ4 A;  1XWG A;  4IEL A;  4CY8 A;  2H70 A;  4KDU A;  2MMA A;  2FWG A;  3R3E A;  3F63 A;  2G0F A;  2RM5 A;  2IL3 A;  4I2T A;  4MCU A;  3ERW A;  3KM6 A;  3GSS A;  6GSX A;  2HXK A;  4E8H A;  2I81 A;  4IKH A;  5CRE A; 
#chains in the Genus database with same CATH homology
 3GHA A;  3M9J A;  1QMV A;  3EUR A;  1J0F A;  1SD8 A;  1G6Y A;  3F4R A;  5IOW A;  5FT3 A;  1SYR A;  5DVB A;  1TDI A;  2QC7 A;  4G19 A;  4MZB A;  1Z7P A;  2H01 A;  2R6K A;  5HFI A;  1M2B A;  2J9H A;  3GKX A;  5BMU A;  1XOB A;  3J7Y k;  2ZCT A;  3ZZX A;  2E2M A;  1THX A;  3M3M A;  1GH2 A;  3VUR A;  5ECS A;  1A0F A;  2LJR A;  5ECK B;  1YEX A;  4PXO A;  3LXT A;  1EZK A;  4F82 A;  1QGV A;  4V2L A;  5D9T A;  2H19 A;  1K0A A;  4PUA A;  5F07 A;  4TXO B;  2BTO T;  2XHF A;  2XPD A;  4ZL8 A;  3IHQ A;  4TR0 A;  1YDK A;  4ZBA A;  1S3C A;  4X1U A;  4OFN A;  2MYG A;  1DE2 A;  2IWT A;  4PX1 A;  1GUH A;  2P5Q A;  1V58 A;  3MSZ A;  3F3Q A;  3LYK A;  3L0H A;  1XWB A;  4GQF A;  1B9Y C;  2IMI A;  3C71 A;  2H66 A;  2HRA A;  4HQS A;  4HI7 A;  1O8X A;  4HJ2 A;  3C73 A;  3TRQ A;  14GS A;  4TR3 A;  5E4W A;  4JED A;  4RUV A;  3M8N A;  1RQM A;  4TR1 B;  5IIZ A;  3LFL A;  4JE1 A;  2LTK A;  4ZB8 A;  3QMX A;  3EU4 A;  3GNJ A;  3GH9 A;  4K8M A;  4PTS A;  5J4U A;  4LMW A;  5GAP D;  2P5R A;  2M46 A;  3IOS A;  4IGJ A;  2LRN A;  1PMT A;  2E7P A;  2NTO A;  1SL1 B;  4AJ6 A;  3LGC A;  4F03 A;  2L6D A;  4Q5R A;  4IQ1 A;  4G0L A;  2OE0 A;  4POK A;  2NBS A;  3IV4 A;  1RW1 A;  4HZ2 A;  2VCQ A;  3KD0 A;  2GSS A;  4IP6 A;  1BQ7 A;  4ISD A;  3HYP A;  2FNO A;  1R5P A;  4AJ7 A;  3LEF A;  5DAK A;  1WOU A;  2DJJ A;  4K5S A;  4X43 A;  2IMF A;  4N10 A;  3GUR A;  1ACV A;  1PX6 A;  2QKE A;  1A0R P;  2CA8 A;  3A5W A;  1ON4 A;  5IMV A;  2JZT A;  3ZFB A;  1M2A A;  1ABA A;  4PQI A;  1DE1 A;  4RQX A;  4EXJ A;  4EL1 A;  11GS A;  1SYX A;  3FHK A;  2YJH A;  1SL0 B;  2R37 A;  1OE7 A;  5F8B A;  2B7J A;  5G2Z A;  4CW9 A;  2AHE A;  2HRK A;  19GS A;  2LUS A;  5H5S A;  1SK2 A;  2I3Y A;  3TKQ A;  4MZW A;  6GSU A;  2LQQ A;  3WGD A;  2VL9 A;  4XCS A;  4EVM A;  5CAX A;  2H1A A;  2VLU A;  4Z7X A;  1Z3E A;  3A5I A;  1DUG A;  1PL2 A;  3G7Y A;  3H8Q A;  3PH9 A;  3ZL5 A;  2YV7 A;  5KN1 A;  3ZVJ D;  2HI7 A;  4JRR A;  2OAD A;  2R0P A;  4V1A g;  4X4J A;  3F6D A;  3M1G A;  1K3L A;  2B5E A;  1XFL A;  4NMU A;  2OBK A;  4HUA A;  1W4V A;  3UVH A;  2J23 A;  2TRX A;  3W8S A;  5EY6 A;  3P8W A;  1ERT A;  1T1V A;  1JLW A;  4MNN A;  3HVV A;  4GF0 A;  2FHE A;  2EIR A;  3QFA C;  2WS2 A;  4IJ3 A;  3GKK A;  1M9A A;  1TK5 B;  2GQL A;  1BG5 A;  4L0U A;  2WCI A;  3QR6 A;  1SJI A;  5B8B A;  2O7K A;  3WGE A;  3HVX A;  2N5F A;  4KA0 A;  3QAW A;  1SU9 A;  7GSS A;  3K8N A;  3P7X A;  4MA9 A;  3Q6O A;  2DJ0 A;  4BL7 A;  1KNG A;  4MF5 A;  1JZW A;  1UVZ A;  3HKR A;  3KH9 A;  3Q18 A;  2AV4 A;  2HZE B;  3WYW A;  2I4A A;  6GSS A;  2YAN A;  5DQY A;  1GUM A;  1ST9 A;  2C0D A;  1EV9 A;  4USS A;  2PVQ A;  4DSQ A;  1T8E B;  5GAN D;  1OVN A;  1WMJ A;  4HOJ A;  3UIW A;  3FR9 A;  1FG4 A;  2F8F A;  4IJI A;  3QFB C;  4V2N A;  2PMT A;  5GZZ B;  2ZUP A;  1QUW A;  4QL9 A;  1JZO A;  1Z9H A;  2ZNM A;  2YJ7 A;  2DKH A;  3GTU A;  3BJ5 A;  4JZQ A;  5G1L A;  4AF2 A;  4OCE A;  2D2Z A;  3QOU A;  5KN3 A;  1S3D A;  2HE3 A;  1XWC A;  3KGK A;  4YQV A;  2YWO A;  2N5B A;  4GXZ A;  4HU7 A;  4MMM A;  4Q5Q A;  5AGY A;  3TKS A;  1TK0 B;  5G30 A;  1VGL A;  1G7O A;  1TOF A;  1TU8 A;  5D73 A;  3QAG A;  2RM6 A;  3UMA A;  5C00 A;  3KP9 A;  3C1R A;  2CVB A;  4KE3 A;  1TW9 A;  1ZL9 A;  3GUS A;  4CDO A;  4ECI A;  1M0U A;  2REM A;  3TJJ A;  4MJE A;  2VCV A;  3E9J B;  2B1K A;  2EC4 A;  2TIR A;  4EC0 A;  3D21 A;  5ID2 A;  5DAL A;  4XS4 A;  1EGR A;  4L5L A;  1GUL A;  3TJB A;  3LYP A;  4K1F A;  3CSI A;  4XS6 A;  5COH A;  4ECC A;  3CSJ A;  4POM A;  1F6M C;  3U5R E;  4N11 A;  2IJY A;  2CVK A;  2TRC P;  4QL7 A;  3TKP A;  3VWX A;  2FUG 2;  4OO5 A;  5E59 A;  3UAP A;  4YAP A;  2L6C A;  3CTF A;  2C3Q A;  2VL3 A;  20GS A;  4PGT A;  2VUP A;  5D8I A;  2VIM A;  3G7J A;  3F0I A;  4TKY A;  2PUK C;  5JWQ B;  1YQ1 A;  1T3B A;  1A2L A;  5G5E A;  1BYE A;  3BCI A;  4TVE A;  1ML6 A;  5JCG A;  2F51 A;  4I6X A;  1ZCP A;  1AAZ A;  2B3S A;  1V98 A;  3HHV A;  2VM2 A;  3GKM A;  2DIY A;  4F9Z A;  3ISO A;  2JU5 A;  4N0V A;  4IW9 A;  3CBU A;  2HLS A;  4CY6 A;  1YF1 A;  3IHG A;  2GQK A;  1Z6N A;  3F8U A;  3L9V A;  2VOC A;  3M9K A;  4DEJ A;  5JCW A;  1ZYP A;  2VLT A;  3V1W A;  1ILO A;  3PGT A;  2YZH A;  3CRT A;  3IXR A;  2H72 A;  5A5K A;  4ZB9 A;  3F6F A;  1GSD A;  2LQO A;  2WRT A;  1YF0 A;  1V9W A;  5KOX A;  4PUF C;  2VCT A;  2A2R A;  4I5Q A;  2HZF A;  2HYX A;  4POL A;  4WXT A;  3GN3 A;  2IFQ B;  2V32 A;  3D22 A;  3EMP A;  3LXZ A;  3I43 A;  1BJX A;  4Z2R A;  3CXG A;  5CNW A;  1FW1 A;  4DVC A;  1F3A A;  4BVY A;  4AGS A;  3ZTL A;  5JWR B;  1JHB A;  4Z2U A;  5ECN B;  1M7T A;  1OE8 A;  4O7H A;  5HFG A;  4ZL9 A;  2X49 A;  1HQO A;  3APO A;  2PU9 C;  3GST A;  2DBC A;  2L4C A;  4XIH A;  3IC4 A;  1B4P A;  3S9F A;  2R4V A;  4BWQ A;  1TXX A;  2C0G A;  4EDY A;  2JZR A;  1B9X C;  2VO4 A;  1OAZ A;  3FZA A;  1FVK A;  1XW5 A;  4HDE A;  5AIX A;  1PKZ A;  2O89 A;  4TR4 A;  8GSS A;  4YQM A;  2B5Y A;  1M99 A;  4FYC A;  5F0G A;  2LNT A;  1F3B A;  1NSW A;  4P3Y B;  3H79 A;  5ECO B;  1WPI A;  2OE1 A;  1GUK A;  4O5Q A;  1H75 A;  2AB6 A;  2B6M A;  1K0C A;  3FZ4 A;  4OWY A;  2PPT A;  2ON5 A;  4EKZ A;  2HSY A;  4GSS A;  3DD3 A;  1GLP A;  2GTU A;  3KH7 A;  2YZU A;  3TJG A;  1GSU A;  2FA8 A;  3D4T A;  1GRX A;  4PQH A;  4MPG A;  3RHB A;  4ICY A;  3FMW A;  3H4K A;  1MTC A;  1OC9 A;  1HYU A;  5ELA A;  3EPT A;  2R0G A;  4EE0 A;  2HRF A;  3MDK A;  3APQ A;  5J9B A;  3C8E A;  1SKR B;  3QAV A;  5HR0 A;  2F9S A;  2ON7 A;  3IDV A;  4IS0 A;  4FQU A;  2AYT A;  1GWC A;  3TJK A;  2VAF A;  1V40 A;  2L59 A;  4TOP A;  5IMC A;  1GNE A;  3HY2 A;  4MZC A;  1KTE A;  3O76 A;  1XWK A;  1E2Y A;  3IE3 A;  2YOI A;  2L4Q A;  1OC8 A;  1PL1 A;  3W8J A;  5HQP A;  3BD2 A;  1IYI A;  2DJ3 A;  2X8H A;  4K9Z A;  2FD3 A;  18GS A;  2H6Z A;  1EEJ A;  1QXH A;  4I97 A;  1X9S B;  3EIN A;  2V6O A;  3VFI A;  3HDC A;  1USB A;  1F9M A;  1B48 A;  3EE2 A;  5EL8 A;  4EF0 A;  4J2F A;  1A2M A;  4ZBD A;  3DML A;  3D5J A;  4ZXG A;  3EWL A;  1PA3 A;  2VD1 A;  3ZIJ A;  6GSV A;  1WJK A;  1XW9 A;  1GP1 A;  3RDW A;  2HSM A;  4BVX B;  1GTI A;  3KZQ A;  1I9D A;  2DIZ A;  2YWI A;  1PRX A;  4PNG A;  3E0U A;  3L9S A;  3VI5 A;  4XRD A;  3HCZ A;  4FYB A;  1BED A;  1CQH A;  5ENU A;  2O87 A;  4TRX A;  1A23 A;  3HJP A;  2XBQ A;  1AQW A;  4LA1 A;  4V2M A;  5D9V A;  1TTZ A;  4YKG A;  2PN8 A;  3KMN A;  1XWA A;  3MIX A;  1ZYE A;  3FKF A;  1TI1 A;  2OBI A;  3FRC A;  3TOU A;  4J56 E;  5DCG A;  4O5R A;  5JWO B;  3EC3 A;  1AW9 A;  3OR5 A;  4Q5N A;  5BRT A;  1EP8 A;  1KBN A;  1ZOF A;  1EV4 A;  1EOH A;  4IQA A;  1AIU A;  2DSA A;  1G7E A;  2MMO A;  1PSQ A;  3TCO A;  3FK8 A;  5CRD A;  4ML1 A;  3VPQ A;  4IN0 A;  5HR1 A;  3RBT A;  2V6K A;  6GSW A;  3EVI A;  2BJX A;  1T7P B;  3VK9 A;  3J7Y b;  4ECB A;  2KLX A;  1OKD A;  3A3T A;  2VCZ A;  1GTA A;  1YKC A;  2YN1 A;  3Q19 A;  1H4O A;  5L71 A;  2IMK A;  5HR2 A;  3LQ7 A;  2C1Y A;  5ABR A;  4WBR D;  1TRU A;  1DBY A;  3VPT A;  5DQS A;  4KDY A;  4JR6 A;  1XBS A;  4MH3 A;  3UJ1 A;  5J5N A;  4FIW A;  1Q98 A;  1ERW A;  1TU7 A;  3ZYW A;  3L78 A;  3D4M A;  5EVO A;  2UZ8 A;  2C4J A;  1S3A A;  3ZIV A;  4NXI A;  1HD2 A;  3BCK A;  1DSB A;  4QQ7 A;  3UEM A;  3E3E A;  2FWE A;  4OMV A;  4KSM A;  1FHE A;  3EYT A;  5B6N A;  3WT2 A;  2AAW A;  1R5A A;  2V2G A;  5H5R A;  3FZ5 A;  2FGX A;  5ECL B;  3UOM A;  1K0B A;  2NPB A;  2FA4 A;  2B1L A;  4WF4 A;  3IPZ A;  1ERU A;  4L5O A;  4LLR A;  3G7I A;  3F4T A;  17GS A;  4DSS A;  2GZY A;  4NV2 A;  2LJK A;  4L8E A;  4FYU A;  1SJZ A;  1X9M B;  2WDU A;  1EWX A;  3GMF A;  1YZX A;  1U87 A;  2Z9S A;  1A24 A;  5DAK B;  5EPF A;  1XPV A;  5KN0 A;  3UVT A;  3EMX A;  2LV3 A;  5D93 A;  2KOK A;  4G9H A;  1GSQ A;  2X8G A;  4D73 A;  2MMZ A;  2IPA A;  1EOG A;  3DVX A;  1FVJ A;  4WR5 A;  2ALB A;  4KB3 A;  3KIJ A;  4GRF A;  2X4A A;  2HNL A;  4H86 A;  1CQG A;  2O8V B;  4POB A;  1XOA A;  3UL3 A;  3I69 A;  1SEN A;  3P90 A;  2LST A;  4ZL7 A;  2HT9 A;  2E2G A;  1SKS B;  3UAR A;  5GST A;  4G2E A;  3GRX A;  2KUC A;  1GSY A;  3DVW A;  4A5P A;  4OD7 A;  3P2A A;  1VF4 A;  2LRC A;  5IMF A;  3CYN A;  4MJA A;  3RAZ A;  5FWG A;  1ZYQ B;  4OO4 A;  1ERV A;  2OAC A;  4GST A;  3IK9 A;  4YQU A;  5IPG A;  5IMD A;  4KX4 A;  3SWL A;  3CSH A;  3O6T A;  4IVF A;  2DC5 A;  3A2V A;  3GL3 A;  1LU4 A;  3CTG A;  3DEX A;  4ML6 A;  4ECJ A;  1T00 A;  3IC8 A;  2HSH A;  1AXD A;  3HVS A;  4XS1 A;  4WR4 A;  1FO5 A;  2XBI A;  3D6I A;  4K6X A;  1W89 A;  3M0F A;  2DJK A;  4KCE A;  2C3N A;  2GVP A;  1XZO A;  1O81 A;  3TRX A;  2OJL A;  4MF7 A;  4HEA 2;  3TGZ A;  4K7O A;  3L9U A;  3TKS C;  4BL7 B;  1GSS A;  1FB0 A;  1X0R A;  2L5L A;  1IYH A;  1GSE A;  3DWV A;  3TRP A;  1K3Y A;  4Q5F A;  2CX4 A;  5CRH A;  1SD9 A;  5JCU A;  1QFN A;  5A4W A;  3I6A A;  2OE3 A;  5A4U A;  5ECI B;  4MH2 A;  4KF9 A;  1ZGN A;  1HNA A;  1GNW A;  2H0H A;  2RUF A;  4MF6 A;  1YJ6 A;  2K18 A;  4V1A p;  1V2A A;  3VI7 A;  3KTL A;  4WEY A;  1R4W A;  2YCD A;  1J9B A;  5ELG A;  3TJF A;  2YPM A;  5D96 A;  3VWU A;  4GCI A;  2K8S A;  4ZIL A;  2C0E A;  1TK8 B;  3GTU B;  4JR4 A;  2VL2 C;  3LSZ A;  2JSY A;  2FCH A;  2C3T A;  2WB9 A;  2KP2 A;  4TXO A;  1NW2 A;  5DCH A;  1X5C A;  1XVW A;  5J3R A;  2V41 A;  1X9W B;  3KJY A;  1O8W A;  3ME8 A;  3DYR A;  3CRU A;  3C7M A;  5F05 A;  3FY7 A;  5ECR B;  4E8E A;  5C04 A;  1VF1 A;  1ZMA A;  5B7C A;  4Z2T A;  2M80 A;  2AJQ B;  4WET A;  4OCF A;  3LOR A;  4J57 E;  2CZ3 A;  2H74 A;  3WGX A;  1PD2 1;  2YP6 A;  2DKI A;  3R2Q A;  2FY6 A;  2OKA A;  2CAI A;  2CZ2 A;  3HA9 A;  4GLT A;  1C72 A;  4O92 A;  4TR1 A;  4KDX A;  4K7N A;  3TDG A;  2PER A;  1GTB A;  5ID2 B;  3RPN A;  5DAL B;  1O7U A;  4XS4 B;  4PQ1 A;  2GSR A;  3HZ4 A;  2B5X A;  2HFD A;  2L5O A;  4ZB6 A;  2YWM A;  3QD9 A;  3QCP A;  1LJR A;  3Q74 A;  1XVQ A;  3CMI A;  3DIE A;  3GH6 A;  16GS A;  1BX9 A;  4PUR A;  3SBC A;  4MDC A;  4NAX A;  2PVO C;  3FR6 A;  5CO3 A;  1K3O A;  4MJB A;  5DDL A;  2F8A A;  4GWR A;  2JZS A;  2VM1 A;  13GS A;  2JL4 A;  4TN8 A;  4ILF A;  3I9V 2;  2CVD A;  3QDN A;  3PIN A;  2MMN A;  1N2A A;  2H1G A;  3F9U A;  3TB2 A;  3VWW A;  2GQM A;  1MDK A;  3ZLP A;  12GS A;  4FO5 A;  6GSY A;  2NDO A;  2K6V A;  3IAM 2;  6GST A;  3KP8 A;  5G31 A;  4K2X A;  3RPP A;  2O85 A;  2R0C A;  4K0N A;  3GL5 A;  2VCX A;  4KCA A;  2JAC A;  2H75 A;  2EIO A;  3N5O A;  1SK0 A;  4NHZ A;  2LRT A;  3KXO A;  4GQC A;  4GTU A;  5HR3 A;  3HZ8 A;  1NHY A;  1GL8 A;  4N30 A;  3GA4 A;  1NM3 A;  4BVY B;  1EP7 A;  2M72 A;  1UC7 A;  2MBS A;  3FW2 A;  4XHM A;  1Y6E A;  2E0Q A;  3D0Z A;  2LS5 A;  4I2U A;  4MLY A;  2RLI A;  3LJR A;  1JFU A;  3FR3 A;  3N9J A;  3UBK A;  1WRY A;  4NPB A;  2C8U A;  2A4V A;  2KP1 A;  4K2D A;  5AIS A;  4LMV A;  2R3X A;  2K9F A;  4G0K A;  3DGQ A;  5HFK A;  5KEJ A;  5G5F A;  2H6X A;  4PNF A;  3ZMK A;  1GSF A;  3O3T A;  4G0I A;  1U3I A;  5DJM A;  1AQV A;  5LNK e;  3MYD A;  5IOX A;  4MK3 A;  2QSI A;  1K0D A;  1XIY A;  3IK7 A;  4HS1 A;  5IM9 A;  5IO0 A;  3ZFL A;  1TRV A;  3A2W A;  4WKW A;  5AIV A;  2C0F A;  2HZE A;  2DMM A;  2P0G A;  5B8A A;  1RK4 A;  1U88 A;  3ZML A;  3HXS A;  2B7K A;  2JAD A;  1VF2 A;  2P31 A;  5AN1 A;  4YAV A;  4ZIJ A;  5CRW A;  1NHO A;  4IBP A;  4MJC A;  4TXV A;  3TUE A;  4HU9 A;  3IAS 2;  2WUL A;  1HNC A;  2IIY A;  4HJM A;  1WWJ A;  5A4V A;  1JZD A;  1SJ6 A;  2CQ9 A;  10GS A;  3WD6 A;  3H1N A;  2MBT A;  5J9C A;  1WIK A;  3U6V A;  1B4Q A;  1X5E A;  1GLQ A;  3H93 A;  1Z6M A;  4EO3 A;  1OC9 B;  2A4H A;  2IN3 A;  1U3A A;  2YNX A;  3GIX A;  1QK8 A;  3F3R A;  2G2Q A;  5IPH A;  3HJO A;  3MNG A;  1O85 A;  2GDR A;  3BBY A;  3ME7 A;  3ZRD A;  2VCW A;  3ED3 A;  1TP9 A;  5DJL A;  3ZIT A;  4NHW A;  2LNS A;  5GSS A;  1XW6 A;  1PKW A;  1F2E A;  2VLV A;  1SK1 A;  3BOA A;  1A8Y A;  2CX3 A;  1B8X A;  5H5Q A;  2FLS A;  2RII A;  5B6M A;  4KAE A;  4FH8 A;  3DKS A;  1R7H A;  2A2P A;  2R2J A;  5KN2 A;  3TOT A;  1M2D A;  2BMX A;  1R26 A;  1Z5Y E;  2CAQ A;  2R5G A;  5CP1 A;  4OFM A;  3AY8 A;  3MWH A;  4NV5 A;  2FWH A;  1T4Z A;  4JU5 A;  4TW5 A;  3MAK A;  3HJM A;  1GTU A;  3FEU A;  1I5G A;  4MAB A;  4F0B A;  3VWV A;  1FOH A;  2H30 A;  2WZ9 A;  2YWN A;  1O6J A;  2RUE A;  1OC3 A;  3IA1 A;  5FHI A;  1XXU A;  1YEP A;  1AUC A;  1MDI A;  4XTS A;  5ECH B;  3DRN A;  2EIQ A;  3NOF A;  2K8V A;  2X8C A;  2FWF A;  1TJD A;  5IMZ A;  4BPY A;  1YY7 A;  2XC2 A;  4O32 A;  1FOV A;  3KTB A;  5KOW A;  3KMO A;  1J08 A;  4JBB A;  4EUY A;  4F0C A;  3ERF A;  2F3M A;  4LL4 B;  1PN0 A;  1PGT A;  4HQZ A;  4N0Z A;  5CRG A;  2CV4 A;  4MPF A;  2I9H A;  1SL2 B;  3IR4 A;  2H0I A;  2LJA A;  5J41 A;  1PQN A;  3APS A;  3G9B A;  2IFQ A;  4G10 A;  3C1S A;  4YH2 A;  5ECQ B;  1JLV A;  1KEB A;  2DJ2 A;  2PWJ A;  3NIV A;  4RQR A;  5ECP B;  1VRS D;  2PGT A;  1OKT A;  1G6W A;  2V1M A;  2MZC A;  2N5A A;  5D9X A;  1LBK A;  1UN2 A;  2JSZ A;  2WFC A;  4X0X A;  1N8J A;  2H71 A;  4KW6 A;  1OYJ A;  4CHS A;  2H1D A;  2GT5 A;  2GGT A;  2IMD A;  3KEB A;  4YKF A;  2AUV A;  1UA5 A;  3F4S A;  4ID0 A;  2I1U A;  3GKN A;  3FYG A;  2GS3 A;  1URM A;  3KCM A;  5INY A;  4KSO A;  4K5R A;  2WGR A;  2GT6 A;  3HD5 A;  3ZRE A;  3US3 A;  1M9B A;  4NWY A;  1MD3 A;  4XRA A;  5D9W A;  2XPE A;  1WP0 A;  1YKA A;  4O5U A;  4I8B A;  1ZYN A;  3JCM L;  3QPM A;  1BAY A;  2VL2 A;  2H1B A;  5CYY A;  2WJU A;  3GYK A;  1AC1 A;  1PX7 A;  4WF5 A;  1T4Y A;  3NZN A;  1ZZY A;  4DSS B;  1WE0 A;  2OA7 A;  3EU3 A;  3ZVJ A;  3LWA A;  4IHU A;  1E6B A;  1K0O A;  2L57 A;  3DXB A;  1V57 A;  5LCZ A;  3LG6 A;  5LD0 A;  2H6Y A;  4KUN A;  4AJ8 A;  3UBL A;  2X64 A;  1FAA A;  1K0N A;  1A2J A;  3W6G A;  1MDJ A;  2H73 A;  5IQY A;  4D73 B;  3A2X A;  2CT6 A;  4KH7 A;  4LL1 B;  4EIQ A;  4KGI A;  1Z7R A;  2GZP A;  4BA7 A;  3GV1 A;  2YV9 A;  1FB6 A;  1EGO A;  4OFT A;  4K7I A;  2GST A;  1MD4 A;  5ECM B;  1JZR A;  1Q4J A;  9GSS A;  2KHP A;  2LKU A;  1AQX A;  3GX0 A;  4GSN A;  5F06 A;  2GSQ A;  4IP1 A;  4ULX A;  1VF3 A;  2QA1 A;  4DSR A;  2X99 A;  3PR8 A;  1PN9 A;  4EDZ A;  1MEK A;  3RHC A;  4BWS A;  1A8L A;  3ERG A;  2HRN A;  5G1K A;  3IBH A;  3LW9 A;  4L0W A;  3FZ9 A;  3GFK A;  2H0G A;  1TRW A;  2DLX A;  2A2S A;  3L4N A;  4F2I A;  4KND A;  2VD0 A;  1THO A;  3IRA A;  4RI7 A;  2NVL A;  2QA2 A;  2DML A;  1TKD B;  4EIP A;  1X5D A;  2DJ1 A;  22GS A;  2GZZ A;  2QGV A;  2LEG A;  3TKR A;  2H8L A;  1U6T A;  5IO2 A;  4MP4 A;  1K0M A;  2GLR A;  1G0T A;  1XCC A;  3PPU A;  5IMA A;  3VLN A;  4ZBB A;  1SKW B;  4WBJ A;  1EEM A;  1F37 A;  4ACS A;  4RI6 A;  1HNB A;  2IME A;  3GX8 A;  3WT1 A;  1TRS A;  1QQ2 A;  2ES7 A;  1TI3 A;  2H76 A;  1Y25 A;  4K0G A;  1O73 A;  3TKS E;  4BVX A;  5DBQ A;  2C80 A;  2PBJ A;  4HZ4 A;  1XWG A;  4IEL A;  4CY8 A;  2H70 A;  4KDU A;  2MMA A;  2FWG A;  3R3E A;  3F63 A;  2G0F A;  2RM5 A;  2IL3 A;  4I2T A;  4MCU A;  3ERW A;  3KM6 A;  3GSS A;  6GSX A;  2HXK A;  4E8H A;  2I81 A;  4IKH A;  5CRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...