5G31A

Crystallographic structure of mutant c73s of thioredoxin from litopenaeus vannamei
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
105
structure length
105
Chain Sequence
MVYQVKDQEDFTKQLNEAGNKLVVIDFYATWCGPCKMIAPKLEELSQSMSDVVFLKVDVDECEDIAQDNQIASMPTFLFMKNGQKLDSLSGANYDKLLELVEKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title Is dimerization a common feature in thioredoxins? The case of thioredoxin from Litopenaeus vannamei.
pubmed doi rcsb
source organism Litopenaeus vannamei
molecule tags Oxidoreductase
total genus 34
structure length 105
sequence length 105
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5g31A00
4BWSA 1ERWA 1SYRA 2DJ3A 3UL3A 1TW9A 4L5LA 2H6XA 1R26A 2WB9A 4ISDA 2DSAA 2PGTA 4HU9A 5ENUA 2AJQB 4G19A 2A2RA 3I43A 4MJEA 3E3EA 4DVCA 3ERFA 3CTGA 3RAZA 3TDGA 3M0FA 3UARA 3F3RA 1W89A 4EDZA 1O85A 3WGDA 4GCIA 1TK5B 3LEFA 2VL2C 5JCGA 3D4TA 2P5RA 3IAS2 4RQRA 2K18A 1NHOA 5CRDA 3VWWA 4ML1A 2PMTA 4K0NA 3GH9A 3APOA 5FHIA 4WF5A 3IE3A 3LORA 1PKZA 5C00A 2YOIA 1FVKA 4Q5FA 2V6KA 2R4VA 2GT5A 4TW5A 3M9JA 4OMVA 3TJKA 4PQ1A 1V98A 3CBUA 4LLRA 1PMTA 1GSDA 1SJIA 2VD0A 2K6VA 1M2DA 3UAPA 1TI3A 3UOMA 4ECJA 2KP2A 2X64A 4PURA 3F63A 1FB0A 3HVSA 2O89A 4PUFC 4DSQA 3ZVJA 16GSA 5D9WA 2RUFA 4QL9A 4PNFA 1K0NA 2DMMA 2REMA 4PXOA 2GZPA 4Q5RA 1EGRA 2C80A 4MABA 3DWVA 3OR5A 1ACVA 1CQGA 3J7Yb 2YPMA 1IYHA 1DSBA 1A8YA 4LL4B 4TXOA 1EGOA 1YF1A 2HZEA 4IBPA 1NW2A 1XOAA 2OA7A 1TP9A 5AIVA 3L78A 3IDVA 5HR3A 2B7KA 3VFIA 4HZ2A 3D21A 6GSXA 1DE1A 3ZRDA 4I97A 4K0GA 2HNLA 3FR6A 4MF5A 2K8SA 4L5OA 1DUGA 1JLWA 4XS4B 4PGTA 4LMWA 2GZZA 5LD0A 1XVWA 4EXJA 3D22A 5B8AA 2VCTA 5IOWA 5IPGA 3KXOA 1OC9B 3ZREA 4G10A 3C1SA 1JFUA 5GSTA 4KCAA 1PD21 5D93A 1X0RA 2X8GA 2VD1A 3DKSA 3LQ7A 4TR1B 5AGYA 3H4KA 5F06A 3BD2A 2H1GA 2RUEA 4ILFA 4ID0A 1ZCPA 3KP8A 5B7CA 4ZB6A 3BBYA 2GQKA 1GUHA 3ZIJA 2KUCA 2R5GA 3JCML 5IMFA 5H5QA 3WT1A 5KN0A 2X8HA 4POBA 1C72A 3RPPA 5JWQB 4KGIA 4J2FA 2V1MA 3TJJA 1GTBA 1UA5A 4POKA 3A5WA 3VI7A 1GTIA 2CX4A 2NBSA 3TKSA 4HUAA 5FWGA 5J5NA 3EVIA 4AF2A 4DSSB 5IMCA 1T4ZA 2VL3A 1GNEA 3HJOA 1SK2A 3KD0A 1MD3A 3WYWA 1PSQA 4JR4A 2R6KA 2L5LA 1HNBA 1O6JA 1WIKA 2LNTA 2L6DA 3ZFBA 5HFIA 2JACA 5E4WA 2IIYA 1U3AA 1AXDA 1U87A 1Z3EA 2J9HA 2XHFA 4K7NA 4YH2A 2QC7A 2FGXA 3KEBA 3KP9A 3IOSA 1OE8A 3W8JA 1YY7A 3KJYA 1AIUA 2V41A 1VF2A 1AUCA 3C1RA 2C0EA 6GSYA 1YZXA 3CSIA 2GT6A 4I2TA 3MWHA 1MDKA 1TU7A 3EINA 5ECRB 4OO4A 2AUVA 2O85A 4GTUA 1ZYQB 1MD4A 2MZCA 1I9DA 1GSFA 3LWAA 2HRFA 4TR4A 4TVEA 2PBJA 1V57A 2ON7A 1B8XA 2FHEA 3BCIA 3FY7A 4MP4A 3VI5A 5L71A 1FOVA 3GNJA 4BPYA 3HYPA 1TRUA 3FRCA 3GKXA 3L9SA 1BEDA 2E2MA 2JSYA 2V2GA 1T3BA 5CRGA 3FZ4A 2H30A 3HHVA 1SJ6A 3FK8A 3QFAC 2O8VB 2CZ3A 2KLXA 2VLTA 5J9BA 4WEYA 1TI1A 2YWOA 4O7HA 5IPHA 1OKTA 3DD3A 1XFLA 4RUVA 1HNCA 2BMXA 4ZBDA 2VCVA 3A2VA 5AIXA 12GSA 4KNDA 3F6DA 3BCKA 3GMFA 1IYIA 1S3DA 3GURA 5ID2B 5IMZA 2YN1A 1VF4A 4I2UA 3KTLA 4TRXA 2CX3A 3NIVA 4FYBA 3ZVJD 1A2JA 4OFTA 1URMA 2C8UA 4EE0A 5LNKe 4NV5A 4IQ1A 4MF7A 4TKYA 5HFKA 3IHQA 4J56E 2VCQA 4GLTA 4ZL9A 4EKZA 2QGVA 3MDKA 4ECIA 3WD6A 1GSUA 3TOTA 2E7PA 2IMDA 1FO5A 4HJ2A 5D8IA 4D73A 1H75A 1WOUA 3GTUB 5IMVA 4JRRA 2FWGA 2MBTA 5ECPB 2AB6A 5KN2A 3UBKA 2H71A 1XWAA 2QSIA 4JEDA 5B6MA 1SU9A 3F4TA 2XBIA 2XC2A 3GL5A 5G30A 4EO3A 2QKEA 3QOUA 3IAM2 4OO5A 2AYTA 1BYEA 2H6YA 3U6VA 3GHAA 3DMLA 1VF1A 5IOXA 1GWCA 1OC8A 4QL7A 2HSHA 4EC0A 2H0HA 4OFNA 5ECNB 2WGRA 3VURA 1AQVA 1HYUA 4OWYA 4XS1A 5COHA 1A0FA 2B3SA 2G2QA 1S3AA 4F82A 3VWXA 1DBYA 1GRXA 1AQWA 1TRVA 4GQCA 1PQNA 4XS4A 2JU5A 2CT6A 1THOA 1GULA 1TDIA 3GSTA 1XWCA 2H0GA 4I8BA 4WKWA 3TCOA 2C0FA 2OADA 1YKAA 1TTZA 4FYCA 1A24A 2BJXA 3KM6A 4PX1A 1TKDB 1SKSB 1THXA 3ISOA 5HQPA 1B48A 3GFKA 1JZDA 4TR1A 4K1FA 3TJGA 1LJRA 1OVNA 3A2XA 3A3TA 1JLVA 4XRDA 3LXZA 3TB2A 2F51A 3IPZA 3O6TA 2H73A 2E0QA 4EF0A 3KTBA 2PWJA 1G0TA 2GZYA 2RM5A 2HZFA 5ECHB 1O81A 20GSA 1ZOFA 3G9BA 4XTSA 2H1AA 3RPNA 1XW5A 3VK9A 4HU7A 1WPIA 3HCZA 1JZWA 2VL2A 1M2BA 2DC5A 5CRWA 4V2NA 4F0CA 5IM9A 4O92A 2EIRA 2OE0A 3L4NA 5HR0A 3P8WA 1U6TA 5KN3A 2VO4A 4FH8A 4POLA 4MA9A 3V1WA 1TRWA 2X99A 2LTKA 3FEUA 1EWXA 1XVQA 3UJ1A 2RLIA 4XCSA 3HZ8A 1G6YA 3EU4A 4WBJA 2HRNA 1UVZA 2IFQB 5J4UA 5A4UA 2N5AA 2YZHA 1GUKA 14GSA 4BVYA 2B7JA 1B9XC 4HDEA 5DCHA 5ECOB 1B9YC 1RW1A 1R4WA 4IGJA 1ZMAA 1GLPA 4MMMA 2ZUPA 1SKWB 3EMPA 1X5CA 1K3OA 3I6AA 6GSWA 5EY6A 2R2JA 2BTOT 4MDCA 3ZL5A 4ZIJA 1XBSA 1H4OA 1O8WA 4NAXA 4KAEA 4JE1A 5AISA 3Q19A 4NV2A 2PVOC 2IN3A 2JADA 1GLQA 5DQSA 5JCUA 3EU3A 4IN0A 2PVQA 1Z7PA 2FLSA 3UEMA 1T4YA 1E6BA 2CA8A 3D5JA 5CRHA 2GGTA 2OACA 2L4CA 1QGVA 2GQMA 1SL1B 2X8CA 4ZB9A 3W8SA 1SK0A 4ACSA 1F6MC 4PUAA 4HI7A 2NVLA 2NDOA 3UIWA 3HA9A 5LCZA 2HXKA 4MH3A 1CQHA 5IQYA 5HR1A 2YJHA 4IW9A 5ID2A 2OBKA 2GS3A 5D9VA 2LS5A 2H70A 3Q18A 4POMA 3I69A 2K8VA 1FAAA 3GKNA 3C7MA 3F9UA 2B1LA 1GNWA 1OKDA 3MAKA 5C04A 1VRSD 2JZTA 1K0OA 4XIHA 1K0BA 3TOUA 3CMIA 4HOJA 3TRPA 2F8FA 1J0FA 1XPVA 3FW2A 4LL1B 3ME8A 1HD2A 2L59A 3ZMKA 3M1GA 5B8BA 4O32A 3N9JA 1RQMA 3LFLA 4KH7A 4V2LA 10GSA 1KNGA 3UBLA 3KMOA 4F2IA 4YAPA 11GSA 5A5KA 2G0FA 4MJAA 2MMZA 2B5YA 2ALBA 2CV4A 4G2EA 4AJ6A 3PGTA 4NPBA 1PA3A 1PX7A 3EMXA 4CHSA 1U88A 3R2QA 4HQZA 3GKKA 2OE1A 1R7HA 1OYJA 4J57E 1A0RP 2I9HA 1M99A 3GKMA 5J9CA 3CTFA 4CW9A 1HQOA 3M3MA 3EURA 5KN1A 2LJAA 1FW1A 2YZUA 2LJRA 1K0AA 3BJ5A 3LYKA 2MYGA 5EL8A 1NHYA 2YANA 3ME7A 4EDYA 5GSSA 2EC4A 4HZ4A 1Y6EA 3F4RA 4X43A 4OCFA 3TJFA 5CYYA 3ERWA 4HS1A 4MZBA 3KGKA 2FA8A 4K7OA 4KW6A 1J08A 2I81A 2I4AA 5ECIB 4KCEA 3GH6A 1SJZA 3H1NA 3G7IA 1A2LA 3RHBA 4ML6A 3Q74A 2FWEA 4GXZA 1F2EA 2TIRA 4WBRD 5J41A 3F6FA 5CO3A 3J7Yk 3QFBC 1V2AA 3HZ4A 3DIEA 3O3TA 4X0XA 5ELAA 5J3RA 2F9SA 4EUYA 3FZ9A 5ABRA 2GSSA 2IMKA 2VM1A 1XWBA 2H76A 1ERVA 3HDCA 2IMEA 4YQMA 4GF0A 3IRAA 2CQ9A 3QCPA 4TR3A 3W6GA 4XS6A 4HQSA 3GYKA 3VLNA 5JWRB 3UVHA 1BAYA 1AQXA 1SD8A 5G1LA 2PPTA 3D6IA 4YQVA 2L5OA 3KMNA 3ZITA 1GH2A 4XHMA 2B6MA 2IFQA 3HKRA 1EV9A 3GV1A 1SK1A 2H1DA 1GSEA 3QR6A 2VM2A 1ABAA 2YWMA 4PQIA 4Q5NA 1BQ7A 4L0WA 6GSVA 2VLUA 1RK4A 3IA1A 1GSSA 2XPDA 2IJYA 3H79A 2MMOA 4GSNA 2C4JA 2YJ7A 2GSQA 3O76A 2PERA 5HR2A 5HFGA 5D73A 3PINA 4KUNA 4TOPA 1QFNA 1X5EA 5DVBA 4H86A 1OC3A 2DMLA 4ZB8A 2FWHA 4JBBA 2DBCA 1PL1A 4RQXA 4ZL8A 2LKUA 4BVXA 3U5RE 1YDKA 1ON4A 2VLVA 1B4PA 1Z7RA 2P5QA 2H1BA 1PL2A 5KEJA 1T8EB 1N2AA 5G5EA 1UC7A 5DCGA 4F03A 4KE3A 4NMUA 3UMAA 3C73A 2HFDA 3ZYWA 1GTUA 4ZBBA 1U3IA 2LSTA 2RIIA 4ZILA 4V2MA 2WS2A 3LXTA 3FHKA 4L8EA 1OC9A 1YKCA 5G31A 2IL3A 1B4QA 6GSTA 3QDNA 2LEGA 4WXTA 3MNGA 3CSHA 3L9VA 3H93A 2LQOA 2KHPA 3DVWA 2DIZA 1USBA 4IJIA 3ERGA 1Q4JA 2FNOA 1Q98A 2H6ZA 2FD3A 1ILOA 2L4QA 2WZ9A 2AV4A 3QPMA 5H5SA 1X9MB 3IV4A 4N11A 3WGXA 5CP1A 2AAWA 5D96A 1PGTA 5ECMB 4OCEA 2VCWA 5ECLB 3CYNA 2FY6A 3HY2A 3EE2A 3GL3A 4O5RA 3DGQA 6GSSA 2DJKA 1K0DA 4MJCA 3DEXA 1MDJA 2WRTA 1KBNA 4DSSA 2NTOA 2N5BA 2GDRA 4MPGA 4NHZA 4IKHA 2CAQA 2H0IA 4KDXA 4JU5A 1GUMA 4N0ZA 2N5FA 2PU9C 3KH9A 3GX0A 1YEXA 3IC4A 1BX9A 2M80A 1NSWA 5ECSA 2TRXA 1R5AA 5IMAA 2YWIA 5JWOB 3GRXA 1LBKA 5CREA 5DDLA 4JR6A 4YAVA 1T7PB 1V40A 1X5DA 4I6XA 4KDYA 3F0IA 4OD7A 3GA4A 2HI7A 1SKRB 2C3NA 2PUKC 5INYA 2GQLA 1VF3A 4Z7XA 3FR3A 4IHUA 1TOFA 3KIJA 1ML6A 3WT2A 3HJPA 1M9AA 1ST9A 1EZKA 2VOCA 1WWJA 1ZL9A 3GUSA 2OJLA 3CSJA 4HJMA 5G2ZA 2FWFA 5G5FA 1HNAA 1XWKA 3PH9A 4K9ZA 4MZWA 4ZL7A 5FT3A 3CRTA 1EP7A 3KH7A 2WJUA 3LGCA 1BG5A 5G1KA 2VCZA 4AGSA 3QAVA 2VAFA 5H5RA 3GN3A 4D73B 3L0HA 5IO0A 2C0DA 3DXBA 1JZRA 4K6XA 3GX8A 2C0GA 2ON5A 2H8LA 4WF4A 2R3XA 2LRNA 5EPFA 2FA4A 2FCHA 1GL8A 2TRCP 3G7JA 2PN8A 3GIXA 5ECKB 2LRTA 3ZTLA 1OE7A 2B5EA 4PNGA 1E2YA 2R37A 4N30A 2M46A 2LNSA 3LYPA 5GAND 1EOGA 1AW9A 3VWUA 1ZGNA 3I9V2 3N5OA 5AN1A 3WGEA 2O7KA 2WDUA 3FZ5A 1SD9A 1KEBA 4DSRA 4L0UA 3QD9A 2CVBA 5DALB 1TK8B 3EC3A 1EOHA 2LJKA 3HJMA 1QK8A 2OKAA 5DAKB 13GSA 3HXSA 1QUWA 2VL9A 4ECCA 2H01A 4AJ8A 4WR4A 3RHCA 1XW9A 3GTUA 1G7OA 1TU8A 1QMVA 1KTEA 2YP6A 2EIQA 5DQYA 3TKRA 3M8NA 2MMNA 4MPFA 4GSSA 9GSSA 4BL7A 3DYRA 3VWVA 2MMAA 1PKWA 3FZAA 4TN8A 2HYXA 3VPTA 3P90A 5D9XA 1JHBA 4IP6A 2XBQA 2GSTA 19GSA 4F0BA 3TRQA 1K0MA 2YV9A 3P2AA 1M2AA 2ZCTA 3ZIVA 1JZOA 4XRAA 1ERTA 1YF0A 1Y25A 1V9WA 4MK3A 1PX6A 5ELGA 3G7YA 2VCXA 4NXIA 3C71A 18GSA 5JCWA 5ECQB 1QXHA 1M9BA 2HSYA 1SL2B 1FB6A 2H72A 2WFCA 3ZZXA 5IO2A 2H75A 3ZFLA 1XOBA 2LV3A 3TKSC 2GLRA 22GSA 3M9KA 3EYTA 1WP0A 1GP1A 5D9TA 4MCUA 2HE3A 1YEPA 4IP1A 2H66A 1I5GA 1QQ2A 5F0GA 17GSA 3QAWA 2JZRA 2C1YA 4BA7A 3FKFA 4IS0A 2CZ2A 1GTAA 4MLYA 3CXGA 2OBIA 4RI6A 3NZNA 3IBHA 3APQA 4V1Ag 1EV4A 2O87A 1XXUA 3RBTA 1F37A 4N0VA 2L57A 3D4MA 1M0UA 2YNXA 1J9BA 4FIWA 4BWQA 2LRCA 1FHEA 1O7UA 4K7IA 3GSSA 2GSRA 4N10A 1XIYA 1S3CA 4GWRA 8GSSA 3DVXA 3US3A 5F07A 1WE0A 2CAIA 3IR4A 1T00A 1WRYA 3K8NA 6GSUA 2B1KA 1PN9A 5F05A 3UVTA 1MTCA 1OAZA 1Z6NA 2IMIA 4KA0A 4K2DA 4TXVA 4FYUA 3L9UA 2P0GA 4I5QA 2F3MA 1TJDA 5DJMA 2Z9SA 5IIZA 1Z9HA 5IMDA 3NOFA 2CVDA 4JZQA 1X9SB 3LSZA 3TKQA 4GQFA 3IXRA 5E59A 4TXOB 2DJ2A 2HZEB 3SWLA 2KP1A 4LA1A 1SL0B 1DE2A 4KSOA 1XW6A 4OFMA 2C3QA 4NHWA 2VUPA 4K8MA 4DEJA 2I1UA 3E0UA 4RI7A 1EP8A 3IK9A 1K3YA 2CVKA 2V6OA 2ES7A 3MSZA 1NM3A 2HLSA 4Q5QA 4ZXGA 4MH2A 2YCDA 1V58A 4EL1A 2YV7A 4CDOA 5B6NA 2WCIA 1WMJA 1ERUA 1TXXA 3HVXA 5A4WA 1N8JA 4IVFA 2J23A 3ZMLA 1A23A 2RM6A 2V32A 4IELA 1F3BA 3FYGA 2JL4A 3H8QA 4G9HA 2XPEA 2L6CA 4KSMA 2H74A 1XWGA 1BJXA 1F3AA 4KDUA 4AJ7A 3TGZA 1R5PA 4WR5A 3LJRA 3DRNA 2IPAA 3ED3A 2H19A 2B5XA 3FR9A 1TK0B 2IWTA 5CAXA 5EVOA 3HD5A 1AAZA 4KB3A 1Z6MA 1GSQA 5GAPD 1XZOA 3QMXA 3EWLA 3QAGA 3F8UA 1YJ6A 1A2MA 1UN2A 1MEKA 4QQ7A 2A2SA 2YWNA 4FO5A 4IQAA 4MF6A 1ZYEA 1LU4A 3KZQA 3P7XA 5DJLA 2GVPA 3S9FA 1VGLA 2F8AA 3LG6A 4F9ZA 1G7EA 2E2GA 2OE3A 4MZCA 3F4SA 1X9WB 2IMFA 2ZNMA 3Q6OA 3TKPA 3TRXA 3APSA 2VIMA 1O73A 1YQ1A 1EEMA 2DJJA 2KOKA 1WJKA 4GRFA 2FUG2 4P3YB 5DALA 4ECBA 3SBCA 3KCMA 1MDIA 2GTUA 3F3QA 3HVVA 1EEJA 3TUEA 1M7TA 3CRUA 3VPQA 4IJ3A 2HT9A 2JSZA 5DAKA 2DLXA 4MJBA 2NPBA 2P31A 1A8LA 3PR8A 1F9MA 3IK7A 5CNWA 2M72A 1SYXA 2DJ0A 4E8EA 5DBQA 2LQQA 5GZZB 2A4VA 7GSSA 5F8BA 3E9JB 1XCCA 4X1UA 3BOAA 4KX4A 2AHEA 2C3TA 2EIOA 4PQHA 1G6WA 3ZLPA 4V1Ap 3D0ZA 2WULA 2D2ZA 2LUSA 4GSTA 5A4VA 1GSYA 1SENA 1K0CA 1T1VA 4ULXA 4LMVA 2MBSA 4EVMA 1FVJA 4YQUA 1FG4A 1ZZYA 2DJ1A 4E8HA 4NWYA 2DIYA 1AC1A 1TRSA 3TKSE 1PRXA 1O8XA 1K3LA 2K9FA 3A2WA 1W4VA 1Z5YE 3C8EA 3AY8A 2I3YA 4ZBAA 3TJBA 4HEA2 4WETA 2JZSA 3RDWA 4TR0A
chains in the Genus database with same CATH superfamily
4BWSA 1ERWA 1SYRA 2DJ3A 3UL3A 1TW9A 4L5LA 2H6XA 2HSMA 1R26A 2WB9A 4ISDA 2DSAA 2PGTA 4HU9A 5ENUA 2AJQB 4G19A 2A2RA 3I43A 4MJEA 3E3EA 4DVCA 3ERFA 3CTGA 4ICYA 3RAZA 3M0FA 3TDGA 3UARA 3F3RA 1W89A 4EDZA 1O85A 3WGDA 4GCIA 1TK5B 3LEFA 2VL2C 5JCGA 4Z2UA 3D4TA 2P5RA 3IAS2 4RQRA 2K18A 1NHOA 5CRDA 3VWWA 4ML1A 2PMTA 4K0NA 3GH9A 3APOA 5FHIA 4WF5A 3IE3A 3LORA 1PKZA 5C00A 2YOIA 1FVKA 4Q5FA 2V6KA 3MIXA 2R4VA 4EIPA 2GT5A 4TW5A 3M9JA 4OMVA 3TJKA 4PQ1A 1V98A 3CBUA 4LLRA 1PMTA 1GSDA 1SJIA 2VD0A 2K6VA 1M2DA 3UAPA 2A4HA 1TI3A 3UOMA 4ECJA 2KP2A 2X64A 4PURA 3F63A 1PN0A 1FB0A 3HVSA 2O89A 4PUFC 4DSQA 3ZVJA 16GSA 5D9WA 2RUFA 4QL9A 4PNFA 1K0NA 2DMMA 2REMA 4PXOA 2GZPA 4Q5RA 1EGRA 2C80A 4MABA 3DWVA 3OR5A 1ACVA 1CQGA 3J7Yb 2YPMA 1IYHA 1DSBA 1A8YA 4LL4B 4TXOA 1EGOA 1YF1A 2HZEA 4IBPA 1NW2A 1XOAA 2OA7A 1TP9A 5AIVA 3L78A 3IDVA 5HR3A 2B7KA 3VFIA 4HZ2A 3D21A 6GSXA 1DE1A 3ZRDA 4I97A 4K0GA 2HNLA 3FR6A 4MF5A 2K8SA 4L5OA 1DUGA 1JLWA 4XS4B 4PGTA 4LMWA 2GZZA 5LD0A 1XVWA 4EXJA 3D22A 5B8AA 2VCTA 5IOWA 5IPGA 3KXOA 1OC9B 3ZREA 4G10A 3C1SA 1JFUA 5GSTA 4KCAA 1PD21 5D93A 1X0RA 2X8GA 2VD1A 2UZ8A 3DKSA 3LQ7A 4TR1B 5AGYA 3H4KA 5F06A 3BD2A 2H1GA 2RUEA 4ILFA 4ID0A 1ZCPA 3KP8A 5B7CA 4ZB6A 3BBYA 2GQKA 4CY6A 1GUHA 3ZIJA 2KUCA 2R5GA 3JCML 4K5RA 5IMFA 5H5QA 3WT1A 5KN0A 2X8HA 4POBA 1C72A 3RPPA 5JWQB 4KGIA 4J2FA 2V1MA 3TJJA 1GTBA 1UA5A 4POKA 3A5WA 3VI7A 1GTIA 2CX4A 2NBSA 3TKSA 4HUAA 5FWGA 5J5NA 3EVIA 4AF2A 4DSSB 5IMCA 1T4ZA 2VL3A 1GNEA 4X4JA 3HJOA 1SK2A 3KD0A 1MD3A 3WYWA 1PSQA 4JR4A 2R6KA 2L5LA 1HNBA 1O6JA 2R0GA 1WIKA 2LNTA 2L6DA 3ZFBA 5HFIA 2JACA 2IIYA 5E4WA 1U3AA 1AXDA 1U87A 1Z3EA 2J9HA 2XHFA 4K7NA 4YH2A 2QC7A 2FGXA 3KEBA 3KP9A 3IOSA 1OE8A 3W8JA 1YY7A 3KJYA 1AIUA 2V41A 1VF2A 1AUCA 3C1RA 2C0EA 6GSYA 1YZXA 3CSIA 2GT6A 4I2TA 3MWHA 1MDKA 1TU7A 3EINA 5ECRB 4OO4A 2AUVA 2O85A 4YKFA 4GTUA 1ZYQB 1MD4A 2MZCA 1I9DA 1GSFA 3LWAA 2HRFA 4TR4A 4TVEA 2PBJA 1V57A 2ON7A 1B8XA 4G0KA 2FHEA 3BCIA 3FY7A 4MP4A 3VI5A 5L71A 1FOVA 3GNJA 4BPYA 3HYPA 1TRUA 3FRCA 3GKXA 3L9SA 1BEDA 2E2MA 2JSYA 2V2GA 1T3BA 5CRGA 3FZ4A 2H30A 3HHVA 1SJ6A 3FK8A 4KF9A 3QFAC 2O8VB 2CZ3A 2KLXA 2VLTA 5J9BA 4WEYA 1TI1A 2YWOA 4O7HA 5IPHA 1OKTA 3DD3A 1XFLA 4RUVA 1HNCA 3R3EA 2BMXA 4ZBDA 1M3JA 2VCVA 3A2VA 5AIXA 12GSA 4KNDA 3F6DA 3BCKA 3GMFA 1IYIA 1S3DA 3GURA 5ID2B 5IMZA 2YN1A 4EIQA 1VF4A 4I2UA 3KTLA 4TRXA 2CX3A 3NIVA 4FYBA 3ZVJD 1A2JA 4OFTA 1URMA 2C8UA 4EE0A 5LNKe 4NV5A 4IQ1A 4MF7A 4TKYA 5HFKA 4USSA 3IHQA 4J56E 2VCQA 4GLTA 4ZL9A 4EKZA 2QGVA 3MDKA 4ECIA 3WD6A 1GSUA 3TOTA 2E7PA 2IMDA 1FO5A 4HJ2A 5D8IA 4D73A 1H75A 1WOUA 3GTUB 5IMVA 4JRRA 2FWGA 2MBTA 5ECPB 2AB6A 5KN2A 3UBKA 2H71A 1XWAA 2QSIA 4JEDA 5B6MA 1SU9A 3F4TA 2XBIA 2XC2A 3GL5A 5G30A 4EO3A 2QKEA 3QOUA 3IAM2 4OO5A 2AYTA 1BYEA 2H6YA 3U6VA 3GHAA 3DMLA 1VF1A 5IOXA 1GWCA 1OC8A 4QL7A 2HSHA 4EC0A 2H0HA 4OFNA 5ECNB 2WGRA 3VURA 1AQVA 1HYUA 4OWYA 4XS1A 5COHA 1A0FA 2B3SA 2G2QA 1S3AA 4F82A 3VWXA 4Z2TA 1DBYA 1GRXA 1AQWA 1TRVA 4GQCA 1PQNA 4XS4A 2JU5A 2CT6A 1THOA 1GULA 1TDIA 3GSTA 1XWCA 2H0GA 4I8BA 4WKWA 3TCOA 2C0FA 2OADA 1YKAA 1TTZA 4FYCA 1A24A 2BJXA 3KM6A 4PX1A 2DKHA 1TKDB 1SKSB 1THXA 3ISOA 5HQPA 1B48A 3GFKA 1JZDA 4TR1A 4K1FA 3TJGA 1LJRA 1OVNA 3A2XA 3A3TA 1JLVA 4XRDA 3LXZA 3TB2A 1M3IA 2F51A 3IPZA 3O6TA 2H73A 2E0QA 4EF0A 3KTBA 2PWJA 1G0TA 2GZYA 2RM5A 2HZFA 5ECHB 1O81A 20GSA 1ZOFA 3G9BA 4XTSA 2H1AA 3RPNA 1XW5A 3VK9A 4HU7A 1WPIA 3HCZA 1JZWA 4PTSA 2VL2A 1M2BA 2DC5A 5CRWA 4V2NA 4F0CA 5IM9A 4O92A 2EIRA 2OE0A 3L4NA 5HR0A 3P8WA 1U6TA 5KN3A 2VO4A 4FH8A 4POLA 4MA9A 3V1WA 1TRWA 2X99A 2LTKA 3FEUA 1EWXA 1XVQA 3UJ1A 2RLIA 4XCSA 3HZ8A 1G6YA 3EU4A 4WBJA 2HRNA 1UVZA 2IFQB 5J4UA 5A4UA 2N5AA 2YZHA 1GUKA 14GSA 4BVYA 2B7JA 1B9XC 4HDEA 5DCHA 5ECOB 1B9YC 1RW1A 1R4WA 4IGJA 1ZMAA 1GLPA 4MMMA 2ZUPA 3FMWA 1SKWB 3EMPA 1X5CA 1K3OA 3I6AA 6GSWA 5EY6A 2R2JA 2BTOT 4MDCA 3ZL5A 4ZIJA 1XBSA 1H4OA 1O8WA 4NAXA 4KAEA 4JE1A 5AISA 3Q19A 4NV2A 2PVOC 3EPTA 2IN3A 2JADA 1GLQA 5DQSA 5JCUA 3EU3A 4IN0A 2PVQA 4A5PA 1Z7PA 2FLSA 3UEMA 1T4YA 1E6BA 2CA8A 3D5JA 5CRHA 2GGTA 2OACA 2L4CA 1QGVA 4BVXB 2GQMA 1SL1B 2X8CA 4ZB9A 3W8SA 1SK0A 4ACSA 1F6MC 4PUAA 4HI7A 2NVLA 2NDOA 3UIWA 3HA9A 5LCZA 2HXKA 4MH3A 1CQHA 5IQYA 5HR1A 2YJHA 4IW9A 5ID2A 2OBKA 2GS3A 2HRAA 2HRKA 5D9VA 2LS5A 2H70A 3Q18A 4POMA 3I69A 2K8VA 1FAAA 3GKNA 3C7MA 3F9UA 2DKIA 2B1LA 1GNWA 1OKDA 3MAKA 5C04A 1VRSD 2JZTA 1K0OA 4XIHA 1K0BA 3TOUA 1S3RA 3CMIA 4HOJA 3TRPA 2F8FA 1J0FA 1XPVA 3FW2A 4LL1B 3ME8A 1HD2A 2L59A 3ZMKA 3M1GA 5B8BA 4O32A 3N9JA 1RQMA 3LFLA 4KH7A 4V2LA 10GSA 1KNGA 3UBLA 3KMOA 4F2IA 1PFOA 4YAPA 11GSA 5A5KA 2G0FA 4MJAA 2MMZA 2B5YA 2ALBA 2CV4A 4G2EA 4AJ6A 3PGTA 3IC8A 4NPBA 1PA3A 1PX7A 3EMXA 4CHSA 1U88A 3R2QA 4HQZA 3GKKA 2OE1A 1R7HA 1OYJA 4J57E 1A0RP 2I9HA 1M99A 3GKMA 5J9CA 3CTFA 4CW9A 1HQOA 3M3MA 3EURA 5KN1A 2LJAA 1FW1A 2YZUA 2X4AA 2LJRA 1ZYNA 1K0AA 3BJ5A 3LYKA 2MYGA 5EL8A 1NHYA 2YANA 3ME7A 4EDYA 5GSSA 1ZYPA 2EC4A 4HZ4A 1Y6EA 3F4RA 4X43A 4OCFA 3TJFA 5CYYA 3ERWA 4HS1A 4MZBA 3KGKA 2FA8A 4K7OA 4KW6A 1J08A 2I81A 2I4AA 5ECIB 4KCEA 3GH6A 1SJZA 3H1NA 3G7IA 1A2LA 3RHBA 4ML6A 3Q74A 2FWEA 4GXZA 1F2EA 2TIRA 4WBRD 5J41A 3F6FA 5CO3A 3J7Yk 3QFBC 1V2AA 3HZ4A 3DIEA 3O3TA 4X0XA 5ELAA 5J3RA 2F9SA 4EUYA 3FZ9A 5ABRA 2GSSA 2IMKA 2VM1A 1XWBA 2H76A 1ERVA 3HDCA 2IMEA 4YQMA 4GF0A 3IRAA 2CQ9A 3QCPA 4TR3A 3W6GA 4XS6A 4HQSA 3GYKA 3VLNA 5JWRB 3UVHA 1BAYA 2R0CA 1AQXA 1SD8A 5G1LA 2PPTA 3D6IA 4YQVA 2L5OA 3KMNA 3ZITA 1GH2A 4XHMA 2B6MA 2IFQA 3HKRA 1EV9A 3GV1A 1SK1A 2H1DA 1GSEA 3QR6A 2VM2A 1ABAA 2YWMA 4PQIA 4Q5NA 1BQ7A 4L0WA 6GSVA 2VLUA 1RK4A 3IA1A 1GSSA 2XPDA 2IJYA 3H79A 2MMOA 4GSNA 2C4JA 2YJ7A 2GSQA 3O76A 2PERA 5HR2A 5KOWA 5HFGA 5D73A 3PINA 4KUNA 1FOHA 4TOPA 1QFNA 1X5EA 5DVBA 4H86A 1OC3A 2DMLA 4ZB8A 2FWHA 4JBBA 2DBCA 1PL1A 4RQXA 4BL7B 4ZL8A 2LKUA 4BVXA 3U5RE 1YDKA 1ON4A 2VLVA 1B4PA 1Z7RA 2P5QA 2H1BA 1PL2A 5KEJA 1T8EB 1N2AA 3CQFA 5G5EA 1UC7A 5DCGA 4F03A 4KE3A 4NMUA 3UMAA 3C73A 2HFDA 3ZYWA 1GTUA 4ZBBA 1U3IA 2LSTA 2RIIA 4ZILA 4V2MA 2WS2A 3LXTA 3FHKA 4L8EA 1OC9A 1YKCA 5G31A 4BIKA 2IL3A 1B4QA 6GSTA 3QDNA 2LEGA 4WXTA 3MNGA 3CSHA 3L9VA 3H93A 2LQOA 2KHPA 3DVWA 2DIZA 1USBA 4IJIA 3ERGA 1Q4JA 2FNOA 1Q98A 2H6ZA 2FD3A 1ILOA 2L4QA 2WZ9A 2AV4A 3QPMA 5H5SA 1X9MB 3IV4A 4N11A 3WGXA 5CP1A 2AAWA 5D96A 1PGTA 5ECMB 4OCEA 2VCWA 5ECLB 3CYNA 2FY6A 3HY2A 3EE2A 3GL3A 4O5RA 3DGQA 6GSSA 2DJKA 1K0DA 4MJCA 3DEXA 1MDJA 2WRTA 3A5IA 1KBNA 4DSSA 2NTOA 2N5BA 2GDRA 4MPGA 4NHZA 4IKHA 2CAQA 2H0IA 4KDXA 4JU5A 1GUMA 4N0ZA 2N5FA 2PU9C 3KH9A 3GX0A 1YEXA 3IC4A 1BX9A 2M80A 1NSWA 5ECSA 2TRXA 1R5AA 5IMAA 2YWIA 5JWOB 2QA1A 3GRXA 1LBKA 5CREA 5DDLA 4JR6A 4YAVA 1T7PB 1V40A 1X5DA 4I6XA 4KDYA 3F0IA 4OD7A 3GA4A 2HI7A 1SKRB 2C3NA 2PUKC 5INYA 2GQLA 1VF3A 4Z7XA 3FR3A 4IHUA 1TOFA 3KIJA 1ML6A 3WT2A 2A2PA 3HJPA 1M9AA 1ST9A 1EZKA 2VOCA 1WWJA 1ZL9A 3GUSA 2OJLA 3CSJA 4HJMA 3MYDA 5G2ZA 2FWFA 5G5FA 1HNAA 1XWKA 3PH9A 4K9ZA 4MZWA 4ZL7A 5FT3A 3CRTA 1EP7A 2X49A 3KH7A 2WJUA 3LGCA 1BG5A 5G1KA 2VCZA 4AGSA 3QAVA 2VAFA 5H5RA 3GN3A 4D73B 3L0HA 5IO0A 2C0DA 3DXBA 1JZRA 4K6XA 3GX8A 2C0GA 2ON5A 2H8LA 4WF4A 2R3XA 2LRNA 5EPFA 2FA4A 2FCHA 1GL8A 2TRCP 3G7JA 2PN8A 3GIXA 5ECKB 2LRTA 3ZTLA 1OE7A 2B5EA 4PNGA 1E2YA 2R37A 4N30A 2M46A 2LNSA 3LYPA 5GAND 1EOGA 1AW9A 3VWUA 1ZGNA 3I9V2 5BMUA 3N5OA 5AN1A 3WGEA 2O7KA 2WDUA 3FZ5A 1SD9A 1KEBA 4DSRA 4L0UA 3QD9A 2CVBA 5DALB 1TK8B 3EC3A 1EOHA 2LJKA 3HJMA 1QK8A 2OKAA 5DAKB 13GSA 3HXSA 1QUWA 2VL9A 4ECCA 2H01A 4AJ8A 4WR4A 3RHCA 1XW9A 3GTUA 1G7OA 4K2XA 1TU8A 1QMVA 1KTEA 2YP6A 2EIQA 5DQYA 3TKRA 3M8NA 2MMNA 4MPFA 4GSSA 9GSSA 4O5UA 4BL7A 3DYRA 3VWVA 2MMAA 1PKWA 3FZAA 4TN8A 2HYXA 3VPTA 3P90A 5D9XA 1JHBA 4IP6A 2XBQA 2GSTA 19GSA 4F0BA 3TRQA 1K0MA 2YV9A 4FQUA 3P2AA 1M2AA 2ZCTA 3ZIVA 1JZOA 4XRAA 1ERTA 1YF0A 1Y25A 1V9WA 4HSCX 4MK3A 1PX6A 5ELGA 3G7YA 2VCXA 4NXIA 3C71A 18GSA 5JCWA 1QXHA 5ECQB 1M9BA 2HSYA 3LW9A 1SL2B 1FB6A 2H72A 2WFCA 3ZZXA 5IO2A 2H75A 3ZFLA 1XOBA 2LV3A 3TKSC 2GLRA 22GSA 3M9KA 3EYTA 1WP0A 3HVNA 1GP1A 5D9TA 4MCUA 2HE3A 1YEPA 4IP1A 5KOXA 2H66A 1I5GA 1QQ2A 5F0GA 17GSA 3QAWA 2JZRA 2R0PA 2C1YA 4BA7A 3FKFA 4IS0A 2CZ2A 1GTAA 4MLYA 3CXGA 2OBIA 4RI6A 3NZNA 3IBHA 3APQA 4V1Ag 1EV4A 1XG8A 2O87A 1XXUA 3RBTA 1F37A 4N0VA 2L57A 3D4MA 1M0UA 2YNXA 1J9BA 4FIWA 4BWQA 2LRCA 1FHEA 1O7UA 4K7IA 3GSSA 2GSRA 4N10A 1XIYA 1S3CA 4GWRA 4BVYB 8GSSA 3DVXA 3US3A 5F07A 1WE0A 2CAIA 3IR4A 3IHGA 1T00A 1WRYA 3K8NA 6GSUA 2B1KA 1PN9A 5F05A 3UVTA 1MTCA 1OAZA 1Z6NA 2IMIA 4KA0A 4K2DA 4TXVA 4FYUA 3L9UA 2P0GA 4I5QA 2F3MA 1TJDA 5DJMA 4K5SA 2Z9SA 5IIZA 1Z9HA 5IMDA 3NOFA 2CVDA 4JZQA 1X9SB 3LSZA 3TKQA 4GQFA 3IXRA 5E59A 4TXOB 2DJ2A 2HZEB 3SWLA 2KP1A 4LA1A 1SL0B 1DE2A 4KSOA 1XW6A 4OFMA 2C3QA 4NHWA 2VUPA 5BRTA 4K8MA 4DEJA 2I1UA 3E0UA 4CY8A 4RI7A 1EP8A 3IK9A 1K3YA 2CVKA 2V6OA 4MNNA 2ES7A 3MSZA 4G0LA 1NM3A 2HLSA 4Q5QA 4ZXGA 4G0IA 2YCDA 4MH2A 1V58A 4EL1A 2YV7A 4CDOA 5B6NA 2WCIA 1WMJA 4O5QA 1ERUA 1TXXA 3HVXA 5A4WA 1N8JA 4IVFA 2J23A 3ZMLA 1A23A 2RM6A 2V32A 4IELA 1F3BA 3FYGA 2QA2A 2JL4A 3H8QA 4G9HA 2XPEA 2L6CA 4KSMA 2H74A 1XWGA 1BJXA 1F3AA 4KDUA 4AJ7A 3TGZA 1R5PA 4WR5A 3LJRA 3DRNA 2IPAA 3ED3A 2H19A 2B5XA 3FR9A 1TK0B 2IWTA 5CAXA 5EVOA 3HD5A 1AAZA 4KB3A 1Z6MA 1GSQA 5GAPD 1XZOA 3QMXA 3EWLA 3QAGA 3F8UA 1YJ6A 1A2MA 1UN2A 1MEKA 4QQ7A 2A2SA 2YWNA 4FO5A 4IQAA 4MF6A 1ZYEA 1LU4A 3KZQA 3P7XA 5DJLA 2GVPA 3S9FA 1VGLA 2F8AA 3LG6A 4F9ZA 1G7EA 2E2GA 2OE3A 4MZCA 3F4SA 1X9WB 2IMFA 2ZNMA 3Q6OA 3TKPA 3TRXA 3APSA 2VIMA 1O73A 1YQ1A 1EEMA 2DJJA 2KOKA 1WJKA 4Z2RA 4GRFA 2FUG2 4P3YB 5DALA 4ECBA 3SBCA 3KCMA 1MDIA 2GTUA 3F3QA 3HVVA 1EEJA 3TUEA 1M7TA 3CRUA 3VPQA 4IJ3A 2HT9A 2JSZA 5DAKA 2DLXA 4MJBA 2NPBA 2P31A 1A8LA 3PR8A 1F9MA 3IK7A 5CNWA 2M72A 1SYXA 2DJ0A 4E8EA 5DBQA 2LQQA 5GZZB 2A4VA 7GSSA 5F8BA 3E9JB 1XCCA 4X1UA 3PPUA 3BOAA 4KX4A 2AHEA 2C3TA 2EIOA 4PQHA 1G6WA 3ZLPA 4V1Ap 3D0ZA 2WULA 2D2ZA 2LUSA 4GSTA 5A4VA 1GSYA 1SENA 1K0CA 1T1VA 4YKGA 4ULXA 4LMVA 2MBSA 4EVMA 1FVJA 4YQUA 1FG4A 1ZZYA 2DJ1A 4E8HA 4NWYA 2DIYA 1AC1A 1TRSA 3TKSE 1PRXA 1O8XA 1K3LA 2K9FA 3A2WA 1W4VA 1Z5YE 3C8EA 3AY8A 2I3YA 4ZBAA 3TJBA 4HEA2 4WETA 2JZSA 3RDWA 4TR0A
chains in the Genus database with same CATH topology
4BWSA 1ERWA 1SYRA 2DJ3A 3UL3A 1TW9A 4L5LA 2H6XA 2HSMA 1R26A 2WB9A 4ISDA 2DSAA 2PGTA 4HU9A 5ENUA 2AJQB 4G19A 2A2RA 3I43A 4MJEA 3E3EA 4DVCA 3ERFA 3CTGA 4ICYA 3RAZA 3M0FA 3TDGA 3UARA 3F3RA 1W89A 4EDZA 1O85A 3WGDA 4GCIA 1TK5B 3LEFA 2VL2C 5JCGA 4Z2UA 3D4TA 2P5RA 3IAS2 4RQRA 2K18A 1NHOA 5CRDA 3VWWA 4ML1A 2PMTA 4K0NA 3GH9A 3APOA 5FHIA 4WF5A 3IE3A 3LORA 1PKZA 5C00A 2YOIA 1FVKA 4Q5FA 2V6KA 3MIXA 2R4VA 4EIPA 2GT5A 4TW5A 3M9JA 4OMVA 3TJKA 4PQ1A 1V98A 3CBUA 4LLRA 1PMTA 1GSDA 1SJIA 2VD0A 2K6VA 1M2DA 3UAPA 2A4HA 1TI3A 3UOMA 4ECJA 2KP2A 2X64A 4PURA 3F63A 1PN0A 1FB0A 3HVSA 2O89A 4PUFC 4DSQA 3ZVJA 16GSA 5D9WA 2RUFA 4QL9A 4PNFA 1K0NA 2DMMA 2REMA 4PXOA 2GZPA 4Q5RA 1EGRA 2C80A 4MABA 3DWVA 3OR5A 1ACVA 1CQGA 3J7Yb 2YPMA 1IYHA 1DSBA 1A8YA 4LL4B 4TXOA 1EGOA 1YF1A 2HZEA 4IBPA 1NW2A 1XOAA 2OA7A 1TP9A 5AIVA 3L78A 3IDVA 5HR3A 2B7KA 3VFIA 4HZ2A 3D21A 6GSXA 1DE1A 3ZRDA 4I97A 4K0GA 2HNLA 3FR6A 4MF5A 2K8SA 4L5OA 1DUGA 1JLWA 4XS4B 4PGTA 4LMWA 2GZZA 5LD0A 1XVWA 4EXJA 3D22A 5B8AA 2VCTA 5IOWA 5IPGA 3KXOA 1OC9B 3ZREA 4G10A 3C1SA 1JFUA 5GSTA 4KCAA 1PD21 5D93A 1X0RA 2X8GA 2VD1A 2UZ8A 3DKSA 3LQ7A 4TR1B 5AGYA 3H4KA 5F06A 3BD2A 2H1GA 2RUEA 4ILFA 4ID0A 1ZCPA 3KP8A 5B7CA 4ZB6A 3BBYA 2GQKA 4CY6A 1GUHA 3ZIJA 2KUCA 2R5GA 3JCML 4K5RA 5IMFA 5H5QA 3WT1A 5KN0A 2X8HA 4POBA 1C72A 3RPPA 5JWQB 4KGIA 4J2FA 2V1MA 3TJJA 1GTBA 1UA5A 4POKA 3A5WA 3VI7A 1GTIA 2CX4A 2NBSA 3TKSA 4HUAA 5FWGA 5J5NA 3EVIA 4AF2A 4DSSB 5IMCA 1T4ZA 2VL3A 1GNEA 4X4JA 3HJOA 1SK2A 3KD0A 1MD3A 3WYWA 1PSQA 4JR4A 2R6KA 2L5LA 1HNBA 1O6JA 2R0GA 1WIKA 2LNTA 2L6DA 3ZFBA 5HFIA 2JACA 2IIYA 5E4WA 1U3AA 1AXDA 1U87A 1Z3EA 2J9HA 2XHFA 4K7NA 4YH2A 2QC7A 2FGXA 3KEBA 3KP9A 3IOSA 1OE8A 3W8JA 1YY7A 3KJYA 1AIUA 2V41A 1VF2A 1AUCA 3C1RA 2C0EA 6GSYA 1YZXA 3CSIA 2GT6A 4I2TA 3MWHA 1MDKA 1TU7A 3EINA 5ECRB 4OO4A 2AUVA 2O85A 4YKFA 4GTUA 1ZYQB 1MD4A 2MZCA 1I9DA 1GSFA 3LWAA 2HRFA 4TR4A 4TVEA 2PBJA 1V57A 2ON7A 1B8XA 4G0KA 2FHEA 3BCIA 3FY7A 4MP4A 3VI5A 5L71A 1FOVA 3GNJA 4BPYA 3HYPA 1TRUA 3FRCA 3GKXA 3L9SA 1BEDA 2E2MA 2JSYA 2V2GA 1T3BA 5CRGA 3FZ4A 2H30A 3HHVA 1SJ6A 3FK8A 4KF9A 3QFAC 2O8VB 2CZ3A 2KLXA 2VLTA 5J9BA 4WEYA 1TI1A 2YWOA 4O7HA 5IPHA 1OKTA 3DD3A 1XFLA 4RUVA 1HNCA 3R3EA 2BMXA 4ZBDA 2VCVA 3A2VA 5AIXA 12GSA 4KNDA 3F6DA 3BCKA 3GMFA 1IYIA 1S3DA 3GURA 5ID2B 5IMZA 2YN1A 4EIQA 1VF4A 4I2UA 3KTLA 4TRXA 2CX3A 3NIVA 4FYBA 3ZVJD 1A2JA 4OFTA 1URMA 2C8UA 4EE0A 5LNKe 4NV5A 4IQ1A 4MF7A 4TKYA 5HFKA 4USSA 3IHQA 4J56E 2VCQA 4GLTA 4ZL9A 4EKZA 2QGVA 3MDKA 4ECIA 3WD6A 1GSUA 3TOTA 2E7PA 2IMDA 1FO5A 4HJ2A 5D8IA 4D73A 1H75A 1WOUA 3GTUB 5IMVA 4JRRA 2FWGA 2MBTA 5ECPB 2AB6A 5KN2A 3UBKA 2H71A 1XWAA 2QSIA 4JEDA 5B6MA 1SU9A 3F4TA 2XBIA 2XC2A 3GL5A 5G30A 4EO3A 2QKEA 3QOUA 3IAM2 4OO5A 2AYTA 1BYEA 2H6YA 3U6VA 3GHAA 3DMLA 1VF1A 5IOXA 1GWCA 1OC8A 4QL7A 2HSHA 4EC0A 2H0HA 4OFNA 5ECNB 2WGRA 3VURA 1AQVA 1HYUA 4OWYA 4XS1A 5COHA 1A0FA 2B3SA 2G2QA 1S3AA 4F82A 3VWXA 4Z2TA 1DBYA 1GRXA 1AQWA 1TRVA 4GQCA 1PQNA 4XS4A 2JU5A 2CT6A 1THOA 1GULA 1TDIA 3GSTA 1XWCA 2H0GA 4I8BA 4WKWA 3TCOA 2C0FA 2OADA 1YKAA 1TTZA 4FYCA 1A24A 2BJXA 3KM6A 4PX1A 2DKHA 1TKDB 1SKSB 1THXA 3ISOA 5HQPA 1B48A 3GFKA 1JZDA 4TR1A 4K1FA 3TJGA 1LJRA 1OVNA 3A2XA 3A3TA 1JLVA 4XRDA 3LXZA 3TB2A 2F51A 3IPZA 3O6TA 2H73A 2E0QA 4EF0A 3KTBA 2PWJA 1G0TA 2GZYA 2RM5A 2HZFA 5ECHB 1O81A 20GSA 1ZOFA 3G9BA 4XTSA 2H1AA 3RPNA 1XW5A 3VK9A 4HU7A 1WPIA 3HCZA 1JZWA 4PTSA 2VL2A 1M2BA 2DC5A 5CRWA 4V2NA 4F0CA 5IM9A 4O92A 2EIRA 2OE0A 3L4NA 5HR0A 3P8WA 1U6TA 5KN3A 2VO4A 4FH8A 4POLA 4MA9A 3V1WA 1TRWA 2X99A 2LTKA 3FEUA 1EWXA 1XVQA 3UJ1A 2RLIA 4XCSA 3HZ8A 1G6YA 3EU4A 4WBJA 2HRNA 1UVZA 2IFQB 5J4UA 5A4UA 2N5AA 2YZHA 1GUKA 14GSA 4BVYA 2B7JA 1B9XC 4HDEA 5DCHA 5ECOB 1B9YC 1RW1A 1R4WA 4IGJA 1ZMAA 1GLPA 4MMMA 2ZUPA 3FMWA 1SKWB 3EMPA 1X5CA 1K3OA 3I6AA 6GSWA 5EY6A 2R2JA 2BTOT 4MDCA 3ZL5A 4ZIJA 1XBSA 1H4OA 1O8WA 4NAXA 4KAEA 4JE1A 5AISA 3Q19A 4NV2A 2PVOC 3EPTA 2IN3A 2JADA 1GLQA 5DQSA 5JCUA 3EU3A 4IN0A 2PVQA 4A5PA 1Z7PA 2FLSA 3UEMA 1T4YA 1E6BA 2CA8A 3D5JA 5CRHA 2GGTA 2OACA 2L4CA 1QGVA 4BVXB 2GQMA 1SL1B 2X8CA 4ZB9A 3W8SA 1SK0A 4ACSA 1F6MC 4PUAA 4HI7A 2NVLA 2NDOA 3UIWA 3HA9A 5LCZA 2HXKA 4MH3A 1CQHA 5IQYA 5HR1A 2YJHA 4IW9A 5ID2A 2OBKA 2GS3A 2HRAA 2HRKA 5D9VA 2LS5A 2H70A 3Q18A 4POMA 3I69A 2K8VA 1FAAA 3GKNA 3C7MA 3F9UA 2DKIA 2B1LA 1GNWA 1OKDA 3MAKA 5C04A 1VRSD 2JZTA 1K0OA 4XIHA 1K0BA 3TOUA 3CMIA 4HOJA 3TRPA 2F8FA 1J0FA 1XPVA 3FW2A 4LL1B 3ME8A 1HD2A 2L59A 3ZMKA 3M1GA 5B8BA 4O32A 3N9JA 1RQMA 3LFLA 4KH7A 4V2LA 10GSA 1KNGA 3UBLA 3KMOA 4F2IA 4YAPA 11GSA 5A5KA 2G0FA 4MJAA 2MMZA 2B5YA 2ALBA 2CV4A 4G2EA 4AJ6A 3PGTA 3IC8A 4NPBA 1PA3A 1PX7A 3EMXA 4CHSA 1U88A 3R2QA 4HQZA 3GKKA 2OE1A 1R7HA 1OYJA 4J57E 1A0RP 2I9HA 1M99A 3GKMA 5J9CA 3CTFA 4CW9A 1HQOA 3M3MA 3EURA 5KN1A 2LJAA 1FW1A 2YZUA 2X4AA 2LJRA 1ZYNA 1K0AA 3BJ5A 3LYKA 2MYGA 5EL8A 1NHYA 2YANA 3ME7A 4EDYA 5GSSA 1ZYPA 2EC4A 4HZ4A 1Y6EA 3F4RA 4X43A 4OCFA 3TJFA 5CYYA 3ERWA 4HS1A 4MZBA 3KGKA 2FA8A 4K7OA 4KW6A 1J08A 2I81A 2I4AA 5ECIB 4KCEA 3GH6A 1SJZA 3H1NA 3G7IA 1A2LA 3RHBA 4ML6A 3Q74A 2FWEA 4GXZA 1F2EA 2TIRA 4WBRD 5J41A 3F6FA 5CO3A 3J7Yk 3QFBC 1V2AA 3HZ4A 3DIEA 3O3TA 4X0XA 5ELAA 5J3RA 2F9SA 4EUYA 3FZ9A 5ABRA 2GSSA 2IMKA 2VM1A 1XWBA 2H76A 1ERVA 3HDCA 2IMEA 4YQMA 4GF0A 3IRAA 2CQ9A 3QCPA 4TR3A 3W6GA 4XS6A 4HQSA 3GYKA 3VLNA 5JWRB 3UVHA 1BAYA 2R0CA 1AQXA 1SD8A 5G1LA 2PPTA 3D6IA 4YQVA 2L5OA 3KMNA 3ZITA 1GH2A 4XHMA 2B6MA 2IFQA 3HKRA 1EV9A 3GV1A 1SK1A 2H1DA 1GSEA 3QR6A 2VM2A 1ABAA 2YWMA 4PQIA 4Q5NA 1BQ7A 4L0WA 6GSVA 2VLUA 1RK4A 3IA1A 1GSSA 2XPDA 2IJYA 3H79A 2MMOA 4GSNA 2C4JA 2YJ7A 2GSQA 3O76A 2PERA 5HR2A 5KOWA 5HFGA 5D73A 3PINA 4KUNA 1FOHA 4TOPA 1QFNA 1X5EA 5DVBA 4H86A 1OC3A 2DMLA 4ZB8A 2FWHA 4JBBA 2DBCA 1PL1A 4RQXA 4BL7B 4ZL8A 2LKUA 4BVXA 3U5RE 1YDKA 1ON4A 2VLVA 1B4PA 1Z7RA 2P5QA 2H1BA 1PL2A 5KEJA 1T8EB 1N2AA 5G5EA 1UC7A 5DCGA 4F03A 4KE3A 4NMUA 3UMAA 3C73A 2HFDA 3ZYWA 1GTUA 4ZBBA 1U3IA 2LSTA 2RIIA 4ZILA 4V2MA 2WS2A 3LXTA 3FHKA 4L8EA 1OC9A 1YKCA 5G31A 2IL3A 1B4QA 6GSTA 3QDNA 2LEGA 4WXTA 3MNGA 3CSHA 3L9VA 3H93A 2LQOA 2KHPA 3DVWA 2DIZA 1USBA 4IJIA 3ERGA 1Q4JA 2FNOA 1Q98A 2H6ZA 2FD3A 1ILOA 2L4QA 2WZ9A 2AV4A 3QPMA 5H5SA 1X9MB 3IV4A 4N11A 3WGXA 5CP1A 2AAWA 5D96A 1PGTA 5ECMB 4OCEA 2VCWA 5ECLB 3CYNA 2FY6A 3HY2A 3EE2A 3GL3A 4O5RA 3DGQA 6GSSA 2DJKA 1K0DA 4MJCA 3DEXA 1MDJA 2WRTA 3A5IA 1KBNA 4DSSA 2NTOA 2N5BA 2GDRA 4MPGA 4NHZA 4IKHA 2CAQA 2H0IA 4KDXA 4JU5A 1GUMA 4N0ZA 2N5FA 2PU9C 3KH9A 3GX0A 1YEXA 3IC4A 1BX9A 2M80A 1NSWA 5ECSA 2TRXA 1R5AA 5IMAA 2YWIA 5JWOB 2QA1A 3GRXA 1LBKA 5CREA 5DDLA 4JR6A 4YAVA 1T7PB 1V40A 1X5DA 4I6XA 4KDYA 3F0IA 4OD7A 3GA4A 2HI7A 1SKRB 2C3NA 2PUKC 5INYA 2GQLA 1VF3A 4Z7XA 3FR3A 4IHUA 1TOFA 3KIJA 1ML6A 3WT2A 2A2PA 3HJPA 1M9AA 1ST9A 1EZKA 2VOCA 1WWJA 1ZL9A 3GUSA 2OJLA 3CSJA 4HJMA 3MYDA 5G2ZA 2FWFA 5G5FA 1HNAA 1XWKA 3PH9A 4K9ZA 4MZWA 4ZL7A 5FT3A 3CRTA 1EP7A 2X49A 3KH7A 2WJUA 3LGCA 1BG5A 5G1KA 2VCZA 4AGSA 3QAVA 2VAFA 5H5RA 3GN3A 4D73B 3L0HA 5IO0A 2C0DA 3DXBA 1JZRA 4K6XA 3GX8A 2C0GA 2ON5A 2H8LA 4WF4A 2R3XA 2LRNA 5EPFA 2FA4A 2FCHA 1GL8A 2TRCP 3G7JA 2PN8A 3GIXA 5ECKB 2LRTA 3ZTLA 1OE7A 2B5EA 4PNGA 1E2YA 2R37A 4N30A 2M46A 2LNSA 3LYPA 5GAND 1EOGA 1AW9A 3VWUA 1ZGNA 3I9V2 5BMUA 3N5OA 5AN1A 3WGEA 2O7KA 2WDUA 3FZ5A 1SD9A 1KEBA 4DSRA 4L0UA 3QD9A 2CVBA 5DALB 1TK8B 3EC3A 1EOHA 2LJKA 3HJMA 1QK8A 2OKAA 5DAKB 13GSA 3HXSA 1QUWA 2VL9A 4ECCA 2H01A 4AJ8A 4WR4A 3RHCA 1XW9A 3GTUA 1G7OA 4K2XA 1TU8A 1QMVA 1KTEA 2YP6A 2EIQA 5DQYA 3TKRA 3M8NA 2MMNA 4MPFA 4GSSA 9GSSA 4O5UA 4BL7A 3DYRA 3VWVA 2MMAA 1PKWA 3FZAA 4TN8A 2HYXA 3VPTA 3P90A 5D9XA 1JHBA 4IP6A 2XBQA 2GSTA 19GSA 4F0BA 3TRQA 1K0MA 2YV9A 4FQUA 3P2AA 1M2AA 2ZCTA 3ZIVA 1JZOA 4XRAA 1ERTA 1YF0A 1Y25A 1V9WA 4MK3A 1PX6A 5ELGA 3G7YA 2VCXA 4NXIA 3C71A 18GSA 5JCWA 1QXHA 5ECQB 1M9BA 2HSYA 3LW9A 1SL2B 1FB6A 2H72A 2WFCA 3ZZXA 5IO2A 2H75A 3ZFLA 1XOBA 2LV3A 3TKSC 2GLRA 22GSA 3M9KA 3EYTA 1WP0A 1GP1A 5D9TA 4MCUA 2HE3A 1YEPA 4IP1A 5KOXA 2H66A 1I5GA 1QQ2A 5F0GA 17GSA 3QAWA 2JZRA 2R0PA 2C1YA 4BA7A 3FKFA 4IS0A 2CZ2A 1GTAA 4MLYA 3CXGA 2OBIA 4RI6A 3NZNA 3IBHA 3APQA 4V1Ag 1EV4A 2O87A 1XXUA 3RBTA 1F37A 4N0VA 2L57A 3D4MA 1M0UA 2YNXA 1J9BA 4FIWA 4BWQA 2LRCA 1FHEA 1O7UA 4K7IA 3GSSA 2GSRA 4N10A 1XIYA 1S3CA 4GWRA 4BVYB 8GSSA 3DVXA 3US3A 5F07A 1WE0A 2CAIA 3IR4A 3IHGA 1T00A 1WRYA 3K8NA 6GSUA 2B1KA 1PN9A 5F05A 3UVTA 1MTCA 1OAZA 1Z6NA 2IMIA 4KA0A 4K2DA 4TXVA 4FYUA 3L9UA 2P0GA 4I5QA 2F3MA 1TJDA 5DJMA 4K5SA 2Z9SA 5IIZA 1Z9HA 5IMDA 3NOFA 2CVDA 4JZQA 1X9SB 3LSZA 3TKQA 4GQFA 3IXRA 5E59A 4TXOB 2DJ2A 2HZEB 3SWLA 2KP1A 4LA1A 1SL0B 1DE2A 4KSOA 1XW6A 4OFMA 2C3QA 4NHWA 2VUPA 5BRTA 4K8MA 4DEJA 2I1UA 3E0UA 4CY8A 4RI7A 1EP8A 3IK9A 1K3YA 2CVKA 2V6OA 4MNNA 2ES7A 3MSZA 4G0LA 1NM3A 2HLSA 4Q5QA 4ZXGA 4G0IA 2YCDA 4MH2A 1V58A 4EL1A 2YV7A 4CDOA 5B6NA 2WCIA 1WMJA 4O5QA 1ERUA 1TXXA 3HVXA 5A4WA 1N8JA 4IVFA 2J23A 3ZMLA 1A23A 2RM6A 2V32A 4IELA 1F3BA 3FYGA 2QA2A 2JL4A 3H8QA 4G9HA 2XPEA 2L6CA 4KSMA 2H74A 1XWGA 1BJXA 1F3AA 4KDUA 4AJ7A 3TGZA 1R5PA 4WR5A 3LJRA 3DRNA 2IPAA 3ED3A 2H19A 2B5XA 3FR9A 1TK0B 2IWTA 5CAXA 5EVOA 3HD5A 1AAZA 4KB3A 1Z6MA 1GSQA 5GAPD 1XZOA 3QMXA 3EWLA 3QAGA 3F8UA 1YJ6A 1A2MA 1UN2A 1MEKA 4QQ7A 2A2SA 2YWNA 4FO5A 4IQAA 4MF6A 1ZYEA 1LU4A 3KZQA 3P7XA 5DJLA 2GVPA 3S9FA 1VGLA 2F8AA 3LG6A 4F9ZA 1G7EA 2E2GA 2OE3A 4MZCA 3F4SA 1X9WB 2IMFA 2ZNMA 3Q6OA 3TKPA 3TRXA 3APSA 2VIMA 1O73A 1YQ1A 1EEMA 2DJJA 2KOKA 1WJKA 4Z2RA 4GRFA 2FUG2 4P3YB 5DALA 4ECBA 3SBCA 3KCMA 1MDIA 2GTUA 3F3QA 3HVVA 1EEJA 3TUEA 1M7TA 3CRUA 3VPQA 4IJ3A 2HT9A 2JSZA 5DAKA 2DLXA 4MJBA 2NPBA 2P31A 1A8LA 3PR8A 1F9MA 3IK7A 5CNWA 2M72A 1SYXA 2DJ0A 4E8EA 5DBQA 2LQQA 5GZZB 2A4VA 7GSSA 5F8BA 3E9JB 1XCCA 4X1UA 3PPUA 3BOAA 4KX4A 2AHEA 2C3TA 2EIOA 4PQHA 1G6WA 3ZLPA 4V1Ap 3D0ZA 2WULA 2D2ZA 2LUSA 4GSTA 5A4VA 1GSYA 1SENA 1K0CA 1T1VA 4YKGA 4ULXA 4LMVA 2MBSA 4EVMA 1FVJA 4YQUA 1FG4A 1ZZYA 2DJ1A 4E8HA 4NWYA 2DIYA 1AC1A 1TRSA 3TKSE 1PRXA 1O8XA 1K3LA 2K9FA 3A2WA 1W4VA 1Z5YE 3C8EA 3AY8A 2I3YA 4ZBAA 3TJBA 4HEA2 4WETA 2JZSA 3RDWA 4TR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BWS A;  1ERW A;  1SYR A;  2DJ3 A;  3UL3 A;  1TW9 A;  4L5L A;  2H6X A;  1R26 A;  2WB9 A;  4ISD A;  2DSA A;  2PGT A;  4HU9 A;  5ENU A;  2AJQ B;  4G19 A;  2A2R A;  3I43 A;  4MJE A;  3E3E A;  4DVC A;  3ERF A;  3CTG A;  3RAZ A;  3TDG A;  3M0F A;  3UAR A;  3F3R A;  1W89 A;  4EDZ A;  1O85 A;  3WGD A;  4GCI A;  1TK5 B;  3LEF A;  2VL2 C;  5JCG A;  3D4T A;  2P5R A;  3IAS 2;  4RQR A;  2K18 A;  1NHO A;  5CRD A;  3VWW A;  4ML1 A;  2PMT A;  4K0N A;  3GH9 A;  3APO A;  5FHI A;  4WF5 A;  3IE3 A;  3LOR A;  1PKZ A;  5C00 A;  2YOI A;  1FVK A;  4Q5F A;  2V6K A;  2R4V A;  2GT5 A;  4TW5 A;  3M9J A;  4OMV A;  3TJK A;  4PQ1 A;  1V98 A;  3CBU A;  4LLR A;  1PMT A;  1GSD A;  1SJI A;  2VD0 A;  2K6V A;  1M2D A;  3UAP A;  1TI3 A;  3UOM A;  4ECJ A;  2KP2 A;  2X64 A;  4PUR A;  3F63 A;  1FB0 A;  3HVS A;  2O89 A;  4PUF C;  4DSQ A;  3ZVJ A;  16GS A;  5D9W A;  2RUF A;  4QL9 A;  4PNF A;  1K0N A;  2DMM A;  2REM A;  4PXO A;  2GZP A;  4Q5R A;  1EGR A;  2C80 A;  4MAB A;  3DWV A;  3OR5 A;  1ACV A;  1CQG A;  3J7Y b;  2YPM A;  1IYH A;  1DSB A;  1A8Y A;  4LL4 B;  4TXO A;  1EGO A;  1YF1 A;  2HZE A;  4IBP A;  1NW2 A;  1XOA A;  2OA7 A;  1TP9 A;  5AIV A;  3L78 A;  3IDV A;  5HR3 A;  2B7K A;  3VFI A;  4HZ2 A;  3D21 A;  6GSX A;  1DE1 A;  3ZRD A;  4I97 A;  4K0G A;  2HNL A;  3FR6 A;  4MF5 A;  2K8S A;  4L5O A;  1DUG A;  1JLW A;  4XS4 B;  4PGT A;  4LMW A;  2GZZ A;  5LD0 A;  1XVW A;  4EXJ A;  3D22 A;  5B8A A;  2VCT A;  5IOW A;  5IPG A;  3KXO A;  1OC9 B;  3ZRE A;  4G10 A;  3C1S A;  1JFU A;  5GST A;  4KCA A;  1PD2 1;  5D93 A;  1X0R A;  2X8G A;  2VD1 A;  3DKS A;  3LQ7 A;  4TR1 B;  5AGY A;  3H4K A;  5F06 A;  3BD2 A;  2H1G A;  2RUE A;  4ILF A;  4ID0 A;  1ZCP A;  3KP8 A;  5B7C A;  4ZB6 A;  3BBY A;  2GQK A;  1GUH A;  3ZIJ A;  2KUC A;  2R5G A;  3JCM L;  5IMF A;  5H5Q A;  3WT1 A;  5KN0 A;  2X8H A;  4POB A;  1C72 A;  3RPP A;  5JWQ B;  4KGI A;  4J2F A;  2V1M A;  3TJJ A;  1GTB A;  1UA5 A;  4POK A;  3A5W A;  3VI7 A;  1GTI A;  2CX4 A;  2NBS A;  3TKS A;  4HUA A;  5FWG A;  5J5N A;  3EVI A;  4AF2 A;  4DSS B;  5IMC A;  1T4Z A;  2VL3 A;  1GNE A;  3HJO A;  1SK2 A;  3KD0 A;  1MD3 A;  3WYW A;  1PSQ A;  4JR4 A;  2R6K A;  2L5L A;  1HNB A;  1O6J A;  1WIK A;  2LNT A;  2L6D A;  3ZFB A;  5HFI A;  2JAC A;  5E4W A;  2IIY A;  1U3A A;  1AXD A;  1U87 A;  1Z3E A;  2J9H A;  2XHF A;  4K7N A;  4YH2 A;  2QC7 A;  2FGX A;  3KEB A;  3KP9 A;  3IOS A;  1OE8 A;  3W8J A;  1YY7 A;  3KJY A;  1AIU A;  2V41 A;  1VF2 A;  1AUC A;  3C1R A;  2C0E A;  6GSY A;  1YZX A;  3CSI A;  2GT6 A;  4I2T A;  3MWH A;  1MDK A;  1TU7 A;  3EIN A;  5ECR B;  4OO4 A;  2AUV A;  2O85 A;  4GTU A;  1ZYQ B;  1MD4 A;  2MZC A;  1I9D A;  1GSF A;  3LWA A;  2HRF A;  4TR4 A;  4TVE A;  2PBJ A;  1V57 A;  2ON7 A;  1B8X A;  2FHE A;  3BCI A;  3FY7 A;  4MP4 A;  3VI5 A;  5L71 A;  1FOV A;  3GNJ A;  4BPY A;  3HYP A;  1TRU A;  3FRC A;  3GKX A;  3L9S A;  1BED A;  2E2M A;  2JSY A;  2V2G A;  1T3B A;  5CRG A;  3FZ4 A;  2H30 A;  3HHV A;  1SJ6 A;  3FK8 A;  3QFA C;  2O8V B;  2CZ3 A;  2KLX A;  2VLT A;  5J9B A;  4WEY A;  1TI1 A;  2YWO A;  4O7H A;  5IPH A;  1OKT A;  3DD3 A;  1XFL A;  4RUV A;  1HNC A;  2BMX A;  4ZBD A;  2VCV A;  3A2V A;  5AIX A;  12GS A;  4KND A;  3F6D A;  3BCK A;  3GMF A;  1IYI A;  1S3D A;  3GUR A;  5ID2 B;  5IMZ A;  2YN1 A;  1VF4 A;  4I2U A;  3KTL A;  4TRX A;  2CX3 A;  3NIV A;  4FYB A;  3ZVJ D;  1A2J A;  4OFT A;  1URM A;  2C8U A;  4EE0 A;  5LNK e;  4NV5 A;  4IQ1 A;  4MF7 A;  4TKY A;  5HFK A;  3IHQ A;  4J56 E;  2VCQ A;  4GLT A;  4ZL9 A;  4EKZ A;  2QGV A;  3MDK A;  4ECI A;  3WD6 A;  1GSU A;  3TOT A;  2E7P A;  2IMD A;  1FO5 A;  4HJ2 A;  5D8I A;  4D73 A;  1H75 A;  1WOU A;  3GTU B;  5IMV A;  4JRR A;  2FWG A;  2MBT A;  5ECP B;  2AB6 A;  5KN2 A;  3UBK A;  2H71 A;  1XWA A;  2QSI A;  4JED A;  5B6M A;  1SU9 A;  3F4T A;  2XBI A;  2XC2 A;  3GL5 A;  5G30 A;  4EO3 A;  2QKE A;  3QOU A;  3IAM 2;  4OO5 A;  2AYT A;  1BYE A;  2H6Y A;  3U6V A;  3GHA A;  3DML A;  1VF1 A;  5IOX A;  1GWC A;  1OC8 A;  4QL7 A;  2HSH A;  4EC0 A;  2H0H A;  4OFN A;  5ECN B;  2WGR A;  3VUR A;  1AQV A;  1HYU A;  4OWY A;  4XS1 A;  5COH A;  1A0F A;  2B3S A;  2G2Q A;  1S3A A;  4F82 A;  3VWX A;  1DBY A;  1GRX A;  1AQW A;  1TRV A;  4GQC A;  1PQN A;  4XS4 A;  2JU5 A;  2CT6 A;  1THO A;  1GUL A;  1TDI A;  3GST A;  1XWC A;  2H0G A;  4I8B A;  4WKW A;  3TCO A;  2C0F A;  2OAD A;  1YKA A;  1TTZ A;  4FYC A;  1A24 A;  2BJX A;  3KM6 A;  4PX1 A;  1TKD B;  1SKS B;  1THX A;  3ISO A;  5HQP A;  1B48 A;  3GFK A;  1JZD A;  4TR1 A;  4K1F A;  3TJG A;  1LJR A;  1OVN A;  3A2X A;  3A3T A;  1JLV A;  4XRD A;  3LXZ A;  3TB2 A;  2F51 A;  3IPZ A;  3O6T A;  2H73 A;  2E0Q A;  4EF0 A;  3KTB A;  2PWJ A;  1G0T A;  2GZY A;  2RM5 A;  2HZF A;  5ECH B;  1O81 A;  20GS A;  1ZOF A;  3G9B A;  4XTS A;  2H1A A;  3RPN A;  1XW5 A;  3VK9 A;  4HU7 A;  1WPI A;  3HCZ A;  1JZW A;  2VL2 A;  1M2B A;  2DC5 A;  5CRW A;  4V2N A;  4F0C A;  5IM9 A;  4O92 A;  2EIR A;  2OE0 A;  3L4N A;  5HR0 A;  3P8W A;  1U6T A;  5KN3 A;  2VO4 A;  4FH8 A;  4POL A;  4MA9 A;  3V1W A;  1TRW A;  2X99 A;  2LTK A;  3FEU A;  1EWX A;  1XVQ A;  3UJ1 A;  2RLI A;  4XCS A;  3HZ8 A;  1G6Y A;  3EU4 A;  4WBJ A;  2HRN A;  1UVZ A;  2IFQ B;  5J4U A;  5A4U A;  2N5A A;  2YZH A;  1GUK A;  14GS A;  4BVY A;  2B7J A;  1B9X C;  4HDE A;  5DCH A;  5ECO B;  1B9Y C;  1RW1 A;  1R4W A;  4IGJ A;  1ZMA A;  1GLP A;  4MMM A;  2ZUP A;  1SKW B;  3EMP A;  1X5C A;  1K3O A;  3I6A A;  6GSW A;  5EY6 A;  2R2J A;  2BTO T;  4MDC A;  3ZL5 A;  4ZIJ A;  1XBS A;  1H4O A;  1O8W A;  4NAX A;  4KAE A;  4JE1 A;  5AIS A;  3Q19 A;  4NV2 A;  2PVO C;  2IN3 A;  2JAD A;  1GLQ A;  5DQS A;  5JCU A;  3EU3 A;  4IN0 A;  2PVQ A;  1Z7P A;  2FLS A;  3UEM A;  1T4Y A;  1E6B A;  2CA8 A;  3D5J A;  5CRH A;  2GGT A;  2OAC A;  2L4C A;  1QGV A;  2GQM A;  1SL1 B;  2X8C A;  4ZB9 A;  3W8S A;  1SK0 A;  4ACS A;  1F6M C;  4PUA A;  4HI7 A;  2NVL A;  2NDO A;  3UIW A;  3HA9 A;  5LCZ A;  2HXK A;  4MH3 A;  1CQH A;  5IQY A;  5HR1 A;  2YJH A;  4IW9 A;  5ID2 A;  2OBK A;  2GS3 A;  5D9V A;  2LS5 A;  2H70 A;  3Q18 A;  4POM A;  3I69 A;  2K8V A;  1FAA A;  3GKN A;  3C7M A;  3F9U A;  2B1L A;  1GNW A;  1OKD A;  3MAK A;  5C04 A;  1VRS D;  2JZT A;  1K0O A;  4XIH A;  1K0B A;  3TOU A;  3CMI A;  4HOJ A;  3TRP A;  2F8F A;  1J0F A;  1XPV A;  3FW2 A;  4LL1 B;  3ME8 A;  1HD2 A;  2L59 A;  3ZMK A;  3M1G A;  5B8B A;  4O32 A;  3N9J A;  1RQM A;  3LFL A;  4KH7 A;  4V2L A;  10GS A;  1KNG A;  3UBL A;  3KMO A;  4F2I A;  4YAP A;  11GS A;  5A5K A;  2G0F A;  4MJA A;  2MMZ A;  2B5Y A;  2ALB A;  2CV4 A;  4G2E A;  4AJ6 A;  3PGT A;  4NPB A;  1PA3 A;  1PX7 A;  3EMX A;  4CHS A;  1U88 A;  3R2Q A;  4HQZ A;  3GKK A;  2OE1 A;  1R7H A;  1OYJ A;  4J57 E;  1A0R P;  2I9H A;  1M99 A;  3GKM A;  5J9C A;  3CTF A;  4CW9 A;  1HQO A;  3M3M A;  3EUR A;  5KN1 A;  2LJA A;  1FW1 A;  2YZU A;  2LJR A;  1K0A A;  3BJ5 A;  3LYK A;  2MYG A;  5EL8 A;  1NHY A;  2YAN A;  3ME7 A;  4EDY A;  5GSS A;  2EC4 A;  4HZ4 A;  1Y6E A;  3F4R A;  4X43 A;  4OCF A;  3TJF A;  5CYY A;  3ERW A;  4HS1 A;  4MZB A;  3KGK A;  2FA8 A;  4K7O A;  4KW6 A;  1J08 A;  2I81 A;  2I4A A;  5ECI B;  4KCE A;  3GH6 A;  1SJZ A;  3H1N A;  3G7I A;  1A2L A;  3RHB A;  4ML6 A;  3Q74 A;  2FWE A;  4GXZ A;  1F2E A;  2TIR A;  4WBR D;  5J41 A;  3F6F A;  5CO3 A;  3J7Y k;  3QFB C;  1V2A A;  3HZ4 A;  3DIE A;  3O3T A;  4X0X A;  5ELA A;  5J3R A;  2F9S A;  4EUY A;  3FZ9 A;  5ABR A;  2GSS A;  2IMK A;  2VM1 A;  1XWB A;  2H76 A;  1ERV A;  3HDC A;  2IME A;  4YQM A;  4GF0 A;  3IRA A;  2CQ9 A;  3QCP A;  4TR3 A;  3W6G A;  4XS6 A;  4HQS A;  3GYK A;  3VLN A;  5JWR B;  3UVH A;  1BAY A;  1AQX A;  1SD8 A;  5G1L A;  2PPT A;  3D6I A;  4YQV A;  2L5O A;  3KMN A;  3ZIT A;  1GH2 A;  4XHM A;  2B6M A;  2IFQ A;  3HKR A;  1EV9 A;  3GV1 A;  1SK1 A;  2H1D A;  1GSE A;  3QR6 A;  2VM2 A;  1ABA A;  2YWM A;  4PQI A;  4Q5N A;  1BQ7 A;  4L0W A;  6GSV A;  2VLU A;  1RK4 A;  3IA1 A;  1GSS A;  2XPD A;  2IJY A;  3H79 A;  2MMO A;  4GSN A;  2C4J A;  2YJ7 A;  2GSQ A;  3O76 A;  2PER A;  5HR2 A;  5HFG A;  5D73 A;  3PIN A;  4KUN A;  4TOP A;  1QFN A;  1X5E A;  5DVB A;  4H86 A;  1OC3 A;  2DML A;  4ZB8 A;  2FWH A;  4JBB A;  2DBC A;  1PL1 A;  4RQX A;  4ZL8 A;  2LKU A;  4BVX A;  3U5R E;  1YDK A;  1ON4 A;  2VLV A;  1B4P A;  1Z7R A;  2P5Q A;  2H1B A;  1PL2 A;  5KEJ A;  1T8E B;  1N2A A;  5G5E A;  1UC7 A;  5DCG A;  4F03 A;  4KE3 A;  4NMU A;  3UMA A;  3C73 A;  2HFD A;  3ZYW A;  1GTU A;  4ZBB A;  1U3I A;  2LST A;  2RII A;  4ZIL A;  4V2M A;  2WS2 A;  3LXT A;  3FHK A;  4L8E A;  1OC9 A;  1YKC A;  5G31 A;  2IL3 A;  1B4Q A;  6GST A;  3QDN A;  2LEG A;  4WXT A;  3MNG A;  3CSH A;  3L9V A;  3H93 A;  2LQO A;  2KHP A;  3DVW A;  2DIZ A;  1USB A;  4IJI A;  3ERG A;  1Q4J A;  2FNO A;  1Q98 A;  2H6Z A;  2FD3 A;  1ILO A;  2L4Q A;  2WZ9 A;  2AV4 A;  3QPM A;  5H5S A;  1X9M B;  3IV4 A;  4N11 A;  3WGX A;  5CP1 A;  2AAW A;  5D96 A;  1PGT A;  5ECM B;  4OCE A;  2VCW A;  5ECL B;  3CYN A;  2FY6 A;  3HY2 A;  3EE2 A;  3GL3 A;  4O5R A;  3DGQ A;  6GSS A;  2DJK A;  1K0D A;  4MJC A;  3DEX A;  1MDJ A;  2WRT A;  1KBN A;  4DSS A;  2NTO A;  2N5B A;  2GDR A;  4MPG A;  4NHZ A;  4IKH A;  2CAQ A;  2H0I A;  4KDX A;  4JU5 A;  1GUM A;  4N0Z A;  2N5F A;  2PU9 C;  3KH9 A;  3GX0 A;  1YEX A;  3IC4 A;  1BX9 A;  2M80 A;  1NSW A;  5ECS A;  2TRX A;  1R5A A;  5IMA A;  2YWI A;  5JWO B;  3GRX A;  1LBK A;  5CRE A;  5DDL A;  4JR6 A;  4YAV A;  1T7P B;  1V40 A;  1X5D A;  4I6X A;  4KDY A;  3F0I A;  4OD7 A;  3GA4 A;  2HI7 A;  1SKR B;  2C3N A;  2PUK C;  5INY A;  2GQL A;  1VF3 A;  4Z7X A;  3FR3 A;  4IHU A;  1TOF A;  3KIJ A;  1ML6 A;  3WT2 A;  3HJP A;  1M9A A;  1ST9 A;  1EZK A;  2VOC A;  1WWJ A;  1ZL9 A;  3GUS A;  2OJL A;  3CSJ A;  4HJM A;  5G2Z A;  2FWF A;  5G5F A;  1HNA A;  1XWK A;  3PH9 A;  4K9Z A;  4MZW A;  4ZL7 A;  5FT3 A;  3CRT A;  1EP7 A;  3KH7 A;  2WJU A;  3LGC A;  1BG5 A;  5G1K A;  2VCZ A;  4AGS A;  3QAV A;  2VAF A;  5H5R A;  3GN3 A;  4D73 B;  3L0H A;  5IO0 A;  2C0D A;  3DXB A;  1JZR A;  4K6X A;  3GX8 A;  2C0G A;  2ON5 A;  2H8L A;  4WF4 A;  2R3X A;  2LRN A;  5EPF A;  2FA4 A;  2FCH A;  1GL8 A;  2TRC P;  3G7J A;  2PN8 A;  3GIX A;  5ECK B;  2LRT A;  3ZTL A;  1OE7 A;  2B5E A;  4PNG A;  1E2Y A;  2R37 A;  4N30 A;  2M46 A;  2LNS A;  3LYP A;  5GAN D;  1EOG A;  1AW9 A;  3VWU A;  1ZGN A;  3I9V 2;  3N5O A;  5AN1 A;  3WGE A;  2O7K A;  2WDU A;  3FZ5 A;  1SD9 A;  1KEB A;  4DSR A;  4L0U A;  3QD9 A;  2CVB A;  5DAL B;  1TK8 B;  3EC3 A;  1EOH A;  2LJK A;  3HJM A;  1QK8 A;  2OKA A;  5DAK B;  13GS A;  3HXS A;  1QUW A;  2VL9 A;  4ECC A;  2H01 A;  4AJ8 A;  4WR4 A;  3RHC A;  1XW9 A;  3GTU A;  1G7O A;  1TU8 A;  1QMV A;  1KTE A;  2YP6 A;  2EIQ A;  5DQY A;  3TKR A;  3M8N A;  2MMN A;  4MPF A;  4GSS A;  9GSS A;  4BL7 A;  3DYR A;  3VWV A;  2MMA A;  1PKW A;  3FZA A;  4TN8 A;  2HYX A;  3VPT A;  3P90 A;  5D9X A;  1JHB A;  4IP6 A;  2XBQ A;  2GST A;  19GS A;  4F0B A;  3TRQ A;  1K0M A;  2YV9 A;  3P2A A;  1M2A A;  2ZCT A;  3ZIV A;  1JZO A;  4XRA A;  1ERT A;  1YF0 A;  1Y25 A;  1V9W A;  4MK3 A;  1PX6 A;  5ELG A;  3G7Y A;  2VCX A;  4NXI A;  3C71 A;  18GS A;  5JCW A;  5ECQ B;  1QXH A;  1M9B A;  2HSY A;  1SL2 B;  1FB6 A;  2H72 A;  2WFC A;  3ZZX A;  5IO2 A;  2H75 A;  3ZFL A;  1XOB A;  2LV3 A;  3TKS C;  2GLR A;  22GS A;  3M9K A;  3EYT A;  1WP0 A;  1GP1 A;  5D9T A;  4MCU A;  2HE3 A;  1YEP A;  4IP1 A;  2H66 A;  1I5G A;  1QQ2 A;  5F0G A;  17GS A;  3QAW A;  2JZR A;  2C1Y A;  4BA7 A;  3FKF A;  4IS0 A;  2CZ2 A;  1GTA A;  4MLY A;  3CXG A;  2OBI A;  4RI6 A;  3NZN A;  3IBH A;  3APQ A;  4V1A g;  1EV4 A;  2O87 A;  1XXU A;  3RBT A;  1F37 A;  4N0V A;  2L57 A;  3D4M A;  1M0U A;  2YNX A;  1J9B A;  4FIW A;  4BWQ A;  2LRC A;  1FHE A;  1O7U A;  4K7I A;  3GSS A;  2GSR A;  4N10 A;  1XIY A;  1S3C A;  4GWR A;  8GSS A;  3DVX A;  3US3 A;  5F07 A;  1WE0 A;  2CAI A;  3IR4 A;  1T00 A;  1WRY A;  3K8N A;  6GSU A;  2B1K A;  1PN9 A;  5F05 A;  3UVT A;  1MTC A;  1OAZ A;  1Z6N A;  2IMI A;  4KA0 A;  4K2D A;  4TXV A;  4FYU A;  3L9U A;  2P0G A;  4I5Q A;  2F3M A;  1TJD A;  5DJM A;  2Z9S A;  5IIZ A;  1Z9H A;  5IMD A;  3NOF A;  2CVD A;  4JZQ A;  1X9S B;  3LSZ A;  3TKQ A;  4GQF A;  3IXR A;  5E59 A;  4TXO B;  2DJ2 A;  2HZE B;  3SWL A;  2KP1 A;  4LA1 A;  1SL0 B;  1DE2 A;  4KSO A;  1XW6 A;  4OFM A;  2C3Q A;  4NHW A;  2VUP A;  4K8M A;  4DEJ A;  2I1U A;  3E0U A;  4RI7 A;  1EP8 A;  3IK9 A;  1K3Y A;  2CVK A;  2V6O A;  2ES7 A;  3MSZ A;  1NM3 A;  2HLS A;  4Q5Q A;  4ZXG A;  4MH2 A;  2YCD A;  1V58 A;  4EL1 A;  2YV7 A;  4CDO A;  5B6N A;  2WCI A;  1WMJ A;  1ERU A;  1TXX A;  3HVX A;  5A4W A;  1N8J A;  4IVF A;  2J23 A;  3ZML A;  1A23 A;  2RM6 A;  2V32 A;  4IEL A;  1F3B A;  3FYG A;  2JL4 A;  3H8Q A;  4G9H A;  2XPE A;  2L6C A;  4KSM A;  2H74 A;  1XWG A;  1BJX A;  1F3A A;  4KDU A;  4AJ7 A;  3TGZ A;  1R5P A;  4WR5 A;  3LJR A;  3DRN A;  2IPA A;  3ED3 A;  2H19 A;  2B5X A;  3FR9 A;  1TK0 B;  2IWT A;  5CAX A;  5EVO A;  3HD5 A;  1AAZ A;  4KB3 A;  1Z6M A;  1GSQ A;  5GAP D;  1XZO A;  3QMX A;  3EWL A;  3QAG A;  3F8U A;  1YJ6 A;  1A2M A;  1UN2 A;  1MEK A;  4QQ7 A;  2A2S A;  2YWN A;  4FO5 A;  4IQA A;  4MF6 A;  1ZYE A;  1LU4 A;  3KZQ A;  3P7X A;  5DJL A;  2GVP A;  3S9F A;  1VGL A;  2F8A A;  3LG6 A;  4F9Z A;  1G7E A;  2E2G A;  2OE3 A;  4MZC A;  3F4S A;  1X9W B;  2IMF A;  2ZNM A;  3Q6O A;  3TKP A;  3TRX A;  3APS A;  2VIM A;  1O73 A;  1YQ1 A;  1EEM A;  2DJJ A;  2KOK A;  1WJK A;  4GRF A;  2FUG 2;  4P3Y B;  5DAL A;  4ECB A;  3SBC A;  3KCM A;  1MDI A;  2GTU A;  3F3Q A;  3HVV A;  1EEJ A;  3TUE A;  1M7T A;  3CRU A;  3VPQ A;  4IJ3 A;  2HT9 A;  2JSZ A;  5DAK A;  2DLX A;  4MJB A;  2NPB A;  2P31 A;  1A8L A;  3PR8 A;  1F9M A;  3IK7 A;  5CNW A;  2M72 A;  1SYX A;  2DJ0 A;  4E8E A;  5DBQ A;  2LQQ A;  5GZZ B;  2A4V A;  7GSS A;  5F8B A;  3E9J B;  1XCC A;  4X1U A;  3BOA A;  4KX4 A;  2AHE A;  2C3T A;  2EIO A;  4PQH A;  1G6W A;  3ZLP A;  4V1A p;  3D0Z A;  2WUL A;  2D2Z A;  2LUS A;  4GST A;  5A4V A;  1GSY A;  1SEN A;  1K0C A;  1T1V A;  4ULX A;  4LMV A;  2MBS A;  4EVM A;  1FVJ A;  4YQU A;  1FG4 A;  1ZZY A;  2DJ1 A;  4E8H A;  4NWY A;  2DIY A;  1AC1 A;  1TRS A;  3TKS E;  1PRX A;  1O8X A;  1K3L A;  2K9F A;  3A2W A;  1W4V A;  1Z5Y E;  3C8E A;  3AY8 A;  2I3Y A;  4ZBA A;  3TJB A;  4HEA 2;  4WET A;  2JZS A;  3RDW A;  4TR0 A; 
#chains in the Genus database with same CATH topology
 4BWS A;  1ERW A;  1SYR A;  2DJ3 A;  3UL3 A;  1TW9 A;  4L5L A;  2H6X A;  2HSM A;  1R26 A;  2WB9 A;  4ISD A;  2DSA A;  2PGT A;  4HU9 A;  5ENU A;  2AJQ B;  4G19 A;  2A2R A;  3I43 A;  4MJE A;  3E3E A;  4DVC A;  3ERF A;  3CTG A;  4ICY A;  3RAZ A;  3M0F A;  3TDG A;  3UAR A;  3F3R A;  1W89 A;  4EDZ A;  1O85 A;  3WGD A;  4GCI A;  1TK5 B;  3LEF A;  2VL2 C;  5JCG A;  4Z2U A;  3D4T A;  2P5R A;  3IAS 2;  4RQR A;  2K18 A;  1NHO A;  5CRD A;  3VWW A;  4ML1 A;  2PMT A;  4K0N A;  3GH9 A;  3APO A;  5FHI A;  4WF5 A;  3IE3 A;  3LOR A;  1PKZ A;  5C00 A;  2YOI A;  1FVK A;  4Q5F A;  2V6K A;  3MIX A;  2R4V A;  4EIP A;  2GT5 A;  4TW5 A;  3M9J A;  4OMV A;  3TJK A;  4PQ1 A;  1V98 A;  3CBU A;  4LLR A;  1PMT A;  1GSD A;  1SJI A;  2VD0 A;  2K6V A;  1M2D A;  3UAP A;  2A4H A;  1TI3 A;  3UOM A;  4ECJ A;  2KP2 A;  2X64 A;  4PUR A;  3F63 A;  1PN0 A;  1FB0 A;  3HVS A;  2O89 A;  4PUF C;  4DSQ A;  3ZVJ A;  16GS A;  5D9W A;  2RUF A;  4QL9 A;  4PNF A;  1K0N A;  2DMM A;  2REM A;  4PXO A;  2GZP A;  4Q5R A;  1EGR A;  2C80 A;  4MAB A;  3DWV A;  3OR5 A;  1ACV A;  1CQG A;  3J7Y b;  2YPM A;  1IYH A;  1DSB A;  1A8Y A;  4LL4 B;  4TXO A;  1EGO A;  1YF1 A;  2HZE A;  4IBP A;  1NW2 A;  1XOA A;  2OA7 A;  1TP9 A;  5AIV A;  3L78 A;  3IDV A;  5HR3 A;  2B7K A;  3VFI A;  4HZ2 A;  3D21 A;  6GSX A;  1DE1 A;  3ZRD A;  4I97 A;  4K0G A;  2HNL A;  3FR6 A;  4MF5 A;  2K8S A;  4L5O A;  1DUG A;  1JLW A;  4XS4 B;  4PGT A;  4LMW A;  2GZZ A;  5LD0 A;  1XVW A;  4EXJ A;  3D22 A;  5B8A A;  2VCT A;  5IOW A;  5IPG A;  3KXO A;  1OC9 B;  3ZRE A;  4G10 A;  3C1S A;  1JFU A;  5GST A;  4KCA A;  1PD2 1;  5D93 A;  1X0R A;  2X8G A;  2VD1 A;  2UZ8 A;  3DKS A;  3LQ7 A;  4TR1 B;  5AGY A;  3H4K A;  5F06 A;  3BD2 A;  2H1G A;  2RUE A;  4ILF A;  4ID0 A;  1ZCP A;  3KP8 A;  5B7C A;  4ZB6 A;  3BBY A;  2GQK A;  4CY6 A;  1GUH A;  3ZIJ A;  2KUC A;  2R5G A;  3JCM L;  4K5R A;  5IMF A;  5H5Q A;  3WT1 A;  5KN0 A;  2X8H A;  4POB A;  1C72 A;  3RPP A;  5JWQ B;  4KGI A;  4J2F A;  2V1M A;  3TJJ A;  1GTB A;  1UA5 A;  4POK A;  3A5W A;  3VI7 A;  1GTI A;  2CX4 A;  2NBS A;  3TKS A;  4HUA A;  5FWG A;  5J5N A;  3EVI A;  4AF2 A;  4DSS B;  5IMC A;  1T4Z A;  2VL3 A;  1GNE A;  4X4J A;  3HJO A;  1SK2 A;  3KD0 A;  1MD3 A;  3WYW A;  1PSQ A;  4JR4 A;  2R6K A;  2L5L A;  1HNB A;  1O6J A;  2R0G A;  1WIK A;  2LNT A;  2L6D A;  3ZFB A;  5HFI A;  2JAC A;  2IIY A;  5E4W A;  1U3A A;  1AXD A;  1U87 A;  1Z3E A;  2J9H A;  2XHF A;  4K7N A;  4YH2 A;  2QC7 A;  2FGX A;  3KEB A;  3KP9 A;  3IOS A;  1OE8 A;  3W8J A;  1YY7 A;  3KJY A;  1AIU A;  2V41 A;  1VF2 A;  1AUC A;  3C1R A;  2C0E A;  6GSY A;  1YZX A;  3CSI A;  2GT6 A;  4I2T A;  3MWH A;  1MDK A;  1TU7 A;  3EIN A;  5ECR B;  4OO4 A;  2AUV A;  2O85 A;  4YKF A;  4GTU A;  1ZYQ B;  1MD4 A;  2MZC A;  1I9D A;  1GSF A;  3LWA A;  2HRF A;  4TR4 A;  4TVE A;  2PBJ A;  1V57 A;  2ON7 A;  1B8X A;  4G0K A;  2FHE A;  3BCI A;  3FY7 A;  4MP4 A;  3VI5 A;  5L71 A;  1FOV A;  3GNJ A;  4BPY A;  3HYP A;  1TRU A;  3FRC A;  3GKX A;  3L9S A;  1BED A;  2E2M A;  2JSY A;  2V2G A;  1T3B A;  5CRG A;  3FZ4 A;  2H30 A;  3HHV A;  1SJ6 A;  3FK8 A;  4KF9 A;  3QFA C;  2O8V B;  2CZ3 A;  2KLX A;  2VLT A;  5J9B A;  4WEY A;  1TI1 A;  2YWO A;  4O7H A;  5IPH A;  1OKT A;  3DD3 A;  1XFL A;  4RUV A;  1HNC A;  3R3E A;  2BMX A;  4ZBD A;  1M3J A;  2VCV A;  3A2V A;  5AIX A;  12GS A;  4KND A;  3F6D A;  3BCK A;  3GMF A;  1IYI A;  1S3D A;  3GUR A;  5ID2 B;  5IMZ A;  2YN1 A;  4EIQ A;  1VF4 A;  4I2U A;  3KTL A;  4TRX A;  2CX3 A;  3NIV A;  4FYB A;  3ZVJ D;  1A2J A;  4OFT A;  1URM A;  2C8U A;  4EE0 A;  5LNK e;  4NV5 A;  4IQ1 A;  4MF7 A;  4TKY A;  5HFK A;  4USS A;  3IHQ A;  4J56 E;  2VCQ A;  4GLT A;  4ZL9 A;  4EKZ A;  2QGV A;  3MDK A;  4ECI A;  3WD6 A;  1GSU A;  3TOT A;  2E7P A;  2IMD A;  1FO5 A;  4HJ2 A;  5D8I A;  4D73 A;  1H75 A;  1WOU A;  3GTU B;  5IMV A;  4JRR A;  2FWG A;  2MBT A;  5ECP B;  2AB6 A;  5KN2 A;  3UBK A;  2H71 A;  1XWA A;  2QSI A;  4JED A;  5B6M A;  1SU9 A;  3F4T A;  2XBI A;  2XC2 A;  3GL5 A;  5G30 A;  4EO3 A;  2QKE A;  3QOU A;  3IAM 2;  4OO5 A;  2AYT A;  1BYE A;  2H6Y A;  3U6V A;  3GHA A;  3DML A;  1VF1 A;  5IOX A;  1GWC A;  1OC8 A;  4QL7 A;  2HSH A;  4EC0 A;  2H0H A;  4OFN A;  5ECN B;  2WGR A;  3VUR A;  1AQV A;  1HYU A;  4OWY A;  4XS1 A;  5COH A;  1A0F A;  2B3S A;  2G2Q A;  1S3A A;  4F82 A;  3VWX A;  4Z2T A;  1DBY A;  1GRX A;  1AQW A;  1TRV A;  4GQC A;  1PQN A;  4XS4 A;  2JU5 A;  2CT6 A;  1THO A;  1GUL A;  1TDI A;  3GST A;  1XWC A;  2H0G A;  4I8B A;  4WKW A;  3TCO A;  2C0F A;  2OAD A;  1YKA A;  1TTZ A;  4FYC A;  1A24 A;  2BJX A;  3KM6 A;  4PX1 A;  2DKH A;  1TKD B;  1SKS B;  1THX A;  3ISO A;  5HQP A;  1B48 A;  3GFK A;  1JZD A;  4TR1 A;  4K1F A;  3TJG A;  1LJR A;  1OVN A;  3A2X A;  3A3T A;  1JLV A;  4XRD A;  3LXZ A;  3TB2 A;  1M3I A;  2F51 A;  3IPZ A;  3O6T A;  2H73 A;  2E0Q A;  4EF0 A;  3KTB A;  2PWJ A;  1G0T A;  2GZY A;  2RM5 A;  2HZF A;  5ECH B;  1O81 A;  20GS A;  1ZOF A;  3G9B A;  4XTS A;  2H1A A;  3RPN A;  1XW5 A;  3VK9 A;  4HU7 A;  1WPI A;  3HCZ A;  1JZW A;  4PTS A;  2VL2 A;  1M2B A;  2DC5 A;  5CRW A;  4V2N A;  4F0C A;  5IM9 A;  4O92 A;  2EIR A;  2OE0 A;  3L4N A;  5HR0 A;  3P8W A;  1U6T A;  5KN3 A;  2VO4 A;  4FH8 A;  4POL A;  4MA9 A;  3V1W A;  1TRW A;  2X99 A;  2LTK A;  3FEU A;  1EWX A;  1XVQ A;  3UJ1 A;  2RLI A;  4XCS A;  3HZ8 A;  1G6Y A;  3EU4 A;  4WBJ A;  2HRN A;  1UVZ A;  2IFQ B;  5J4U A;  5A4U A;  2N5A A;  2YZH A;  1GUK A;  14GS A;  4BVY A;  2B7J A;  1B9X C;  4HDE A;  5DCH A;  5ECO B;  1B9Y C;  1RW1 A;  1R4W A;  4IGJ A;  1ZMA A;  1GLP A;  4MMM A;  2ZUP A;  3FMW A;  1SKW B;  3EMP A;  1X5C A;  1K3O A;  3I6A A;  6GSW A;  5EY6 A;  2R2J A;  2BTO T;  4MDC A;  3ZL5 A;  4ZIJ A;  1XBS A;  1H4O A;  1O8W A;  4NAX A;  4KAE A;  4JE1 A;  5AIS A;  3Q19 A;  4NV2 A;  2PVO C;  3EPT A;  2IN3 A;  2JAD A;  1GLQ A;  5DQS A;  5JCU A;  3EU3 A;  4IN0 A;  2PVQ A;  4A5P A;  1Z7P A;  2FLS A;  3UEM A;  1T4Y A;  1E6B A;  2CA8 A;  3D5J A;  5CRH A;  2GGT A;  2OAC A;  2L4C A;  1QGV A;  4BVX B;  2GQM A;  1SL1 B;  2X8C A;  4ZB9 A;  3W8S A;  1SK0 A;  4ACS A;  1F6M C;  4PUA A;  4HI7 A;  2NVL A;  2NDO A;  3UIW A;  3HA9 A;  5LCZ A;  2HXK A;  4MH3 A;  1CQH A;  5IQY A;  5HR1 A;  2YJH A;  4IW9 A;  5ID2 A;  2OBK A;  2GS3 A;  2HRA A;  2HRK A;  5D9V A;  2LS5 A;  2H70 A;  3Q18 A;  4POM A;  3I69 A;  2K8V A;  1FAA A;  3GKN A;  3C7M A;  3F9U A;  2DKI A;  2B1L A;  1GNW A;  1OKD A;  3MAK A;  5C04 A;  1VRS D;  2JZT A;  1K0O A;  4XIH A;  1K0B A;  3TOU A;  1S3R A;  3CMI A;  4HOJ A;  3TRP A;  2F8F A;  1J0F A;  1XPV A;  3FW2 A;  4LL1 B;  3ME8 A;  1HD2 A;  2L59 A;  3ZMK A;  3M1G A;  5B8B A;  4O32 A;  3N9J A;  1RQM A;  3LFL A;  4KH7 A;  4V2L A;  10GS A;  1KNG A;  3UBL A;  3KMO A;  4F2I A;  1PFO A;  4YAP A;  11GS A;  5A5K A;  2G0F A;  4MJA A;  2MMZ A;  2B5Y A;  2ALB A;  2CV4 A;  4G2E A;  4AJ6 A;  3PGT A;  3IC8 A;  4NPB A;  1PA3 A;  1PX7 A;  3EMX A;  4CHS A;  1U88 A;  3R2Q A;  4HQZ A;  3GKK A;  2OE1 A;  1R7H A;  1OYJ A;  4J57 E;  1A0R P;  2I9H A;  1M99 A;  3GKM A;  5J9C A;  3CTF A;  4CW9 A;  1HQO A;  3M3M A;  3EUR A;  5KN1 A;  2LJA A;  1FW1 A;  2YZU A;  2X4A A;  2LJR A;  1ZYN A;  1K0A A;  3BJ5 A;  3LYK A;  2MYG A;  5EL8 A;  1NHY A;  2YAN A;  3ME7 A;  4EDY A;  5GSS A;  1ZYP A;  2EC4 A;  4HZ4 A;  1Y6E A;  3F4R A;  4X43 A;  4OCF A;  3TJF A;  5CYY A;  3ERW A;  4HS1 A;  4MZB A;  3KGK A;  2FA8 A;  4K7O A;  4KW6 A;  1J08 A;  2I81 A;  2I4A A;  5ECI B;  4KCE A;  3GH6 A;  1SJZ A;  3H1N A;  3G7I A;  1A2L A;  3RHB A;  4ML6 A;  3Q74 A;  2FWE A;  4GXZ A;  1F2E A;  2TIR A;  4WBR D;  5J41 A;  3F6F A;  5CO3 A;  3J7Y k;  3QFB C;  1V2A A;  3HZ4 A;  3DIE A;  3O3T A;  4X0X A;  5ELA A;  5J3R A;  2F9S A;  4EUY A;  3FZ9 A;  5ABR A;  2GSS A;  2IMK A;  2VM1 A;  1XWB A;  2H76 A;  1ERV A;  3HDC A;  2IME A;  4YQM A;  4GF0 A;  3IRA A;  2CQ9 A;  3QCP A;  4TR3 A;  3W6G A;  4XS6 A;  4HQS A;  3GYK A;  3VLN A;  5JWR B;  3UVH A;  1BAY A;  2R0C A;  1AQX A;  1SD8 A;  5G1L A;  2PPT A;  3D6I A;  4YQV A;  2L5O A;  3KMN A;  3ZIT A;  1GH2 A;  4XHM A;  2B6M A;  2IFQ A;  3HKR A;  1EV9 A;  3GV1 A;  1SK1 A;  2H1D A;  1GSE A;  3QR6 A;  2VM2 A;  1ABA A;  2YWM A;  4PQI A;  4Q5N A;  1BQ7 A;  4L0W A;  6GSV A;  2VLU A;  1RK4 A;  3IA1 A;  1GSS A;  2XPD A;  2IJY A;  3H79 A;  2MMO A;  4GSN A;  2C4J A;  2YJ7 A;  2GSQ A;  3O76 A;  2PER A;  5HR2 A;  5KOW A;  5HFG A;  5D73 A;  3PIN A;  4KUN A;  1FOH A;  4TOP A;  1QFN A;  1X5E A;  5DVB A;  4H86 A;  1OC3 A;  2DML A;  4ZB8 A;  2FWH A;  4JBB A;  2DBC A;  1PL1 A;  4RQX A;  4BL7 B;  4ZL8 A;  2LKU A;  4BVX A;  3U5R E;  1YDK A;  1ON4 A;  2VLV A;  1B4P A;  1Z7R A;  2P5Q A;  2H1B A;  1PL2 A;  5KEJ A;  1T8E B;  1N2A A;  3CQF A;  5G5E A;  1UC7 A;  5DCG A;  4F03 A;  4KE3 A;  4NMU A;  3UMA A;  3C73 A;  2HFD A;  3ZYW A;  1GTU A;  4ZBB A;  1U3I A;  2LST A;  2RII A;  4ZIL A;  4V2M A;  2WS2 A;  3LXT A;  3FHK A;  4L8E A;  1OC9 A;  1YKC A;  5G31 A;  4BIK A;  2IL3 A;  1B4Q A;  6GST A;  3QDN A;  2LEG A;  4WXT A;  3MNG A;  3CSH A;  3L9V A;  3H93 A;  2LQO A;  2KHP A;  3DVW A;  2DIZ A;  1USB A;  4IJI A;  3ERG A;  1Q4J A;  2FNO A;  1Q98 A;  2H6Z A;  2FD3 A;  1ILO A;  2L4Q A;  2WZ9 A;  2AV4 A;  3QPM A;  5H5S A;  1X9M B;  3IV4 A;  4N11 A;  3WGX A;  5CP1 A;  2AAW A;  5D96 A;  1PGT A;  5ECM B;  4OCE A;  2VCW A;  5ECL B;  3CYN A;  2FY6 A;  3HY2 A;  3EE2 A;  3GL3 A;  4O5R A;  3DGQ A;  6GSS A;  2DJK A;  1K0D A;  4MJC A;  3DEX A;  1MDJ A;  2WRT A;  3A5I A;  1KBN A;  4DSS A;  2NTO A;  2N5B A;  2GDR A;  4MPG A;  4NHZ A;  4IKH A;  2CAQ A;  2H0I A;  4KDX A;  4JU5 A;  1GUM A;  4N0Z A;  2N5F A;  2PU9 C;  3KH9 A;  3GX0 A;  1YEX A;  3IC4 A;  1BX9 A;  2M80 A;  1NSW A;  5ECS A;  2TRX A;  1R5A A;  5IMA A;  2YWI A;  5JWO B;  2QA1 A;  3GRX A;  1LBK A;  5CRE A;  5DDL A;  4JR6 A;  4YAV A;  1T7P B;  1V40 A;  1X5D A;  4I6X A;  4KDY A;  3F0I A;  4OD7 A;  3GA4 A;  2HI7 A;  1SKR B;  2C3N A;  2PUK C;  5INY A;  2GQL A;  1VF3 A;  4Z7X A;  3FR3 A;  4IHU A;  1TOF A;  3KIJ A;  1ML6 A;  3WT2 A;  2A2P A;  3HJP A;  1M9A A;  1ST9 A;  1EZK A;  2VOC A;  1WWJ A;  1ZL9 A;  3GUS A;  2OJL A;  3CSJ A;  4HJM A;  3MYD A;  5G2Z A;  2FWF A;  5G5F A;  1HNA A;  1XWK A;  3PH9 A;  4K9Z A;  4MZW A;  4ZL7 A;  5FT3 A;  3CRT A;  1EP7 A;  2X49 A;  3KH7 A;  2WJU A;  3LGC A;  1BG5 A;  5G1K A;  2VCZ A;  4AGS A;  3QAV A;  2VAF A;  5H5R A;  3GN3 A;  4D73 B;  3L0H A;  5IO0 A;  2C0D A;  3DXB A;  1JZR A;  4K6X A;  3GX8 A;  2C0G A;  2ON5 A;  2H8L A;  4WF4 A;  2R3X A;  2LRN A;  5EPF A;  2FA4 A;  2FCH A;  1GL8 A;  2TRC P;  3G7J A;  2PN8 A;  3GIX A;  5ECK B;  2LRT A;  3ZTL A;  1OE7 A;  2B5E A;  4PNG A;  1E2Y A;  2R37 A;  4N30 A;  2M46 A;  2LNS A;  3LYP A;  5GAN D;  1EOG A;  1AW9 A;  3VWU A;  1ZGN A;  3I9V 2;  5BMU A;  3N5O A;  5AN1 A;  3WGE A;  2O7K A;  2WDU A;  3FZ5 A;  1SD9 A;  1KEB A;  4DSR A;  4L0U A;  3QD9 A;  2CVB A;  5DAL B;  1TK8 B;  3EC3 A;  1EOH A;  2LJK A;  3HJM A;  1QK8 A;  2OKA A;  5DAK B;  13GS A;  3HXS A;  1QUW A;  2VL9 A;  4ECC A;  2H01 A;  4AJ8 A;  4WR4 A;  3RHC A;  1XW9 A;  3GTU A;  1G7O A;  4K2X A;  1TU8 A;  1QMV A;  1KTE A;  2YP6 A;  2EIQ A;  5DQY A;  3TKR A;  3M8N A;  2MMN A;  4MPF A;  4GSS A;  9GSS A;  4O5U A;  4BL7 A;  3DYR A;  3VWV A;  2MMA A;  1PKW A;  3FZA A;  4TN8 A;  2HYX A;  3VPT A;  3P90 A;  5D9X A;  1JHB A;  4IP6 A;  2XBQ A;  2GST A;  19GS A;  4F0B A;  3TRQ A;  1K0M A;  2YV9 A;  4FQU A;  3P2A A;  1M2A A;  2ZCT A;  3ZIV A;  1JZO A;  4XRA A;  1ERT A;  1YF0 A;  1Y25 A;  1V9W A;  4HSC X;  4MK3 A;  1PX6 A;  5ELG A;  3G7Y A;  2VCX A;  4NXI A;  3C71 A;  18GS A;  5JCW A;  1QXH A;  5ECQ B;  1M9B A;  2HSY A;  3LW9 A;  1SL2 B;  1FB6 A;  2H72 A;  2WFC A;  3ZZX A;  5IO2 A;  2H75 A;  3ZFL A;  1XOB A;  2LV3 A;  3TKS C;  2GLR A;  22GS A;  3M9K A;  3EYT A;  1WP0 A;  3HVN A;  1GP1 A;  5D9T A;  4MCU A;  2HE3 A;  1YEP A;  4IP1 A;  5KOX A;  2H66 A;  1I5G A;  1QQ2 A;  5F0G A;  17GS A;  3QAW A;  2JZR A;  2R0P A;  2C1Y A;  4BA7 A;  3FKF A;  4IS0 A;  2CZ2 A;  1GTA A;  4MLY A;  3CXG A;  2OBI A;  4RI6 A;  3NZN A;  3IBH A;  3APQ A;  4V1A g;  1EV4 A;  1XG8 A;  2O87 A;  1XXU A;  3RBT A;  1F37 A;  4N0V A;  2L57 A;  3D4M A;  1M0U A;  2YNX A;  1J9B A;  4FIW A;  4BWQ A;  2LRC A;  1FHE A;  1O7U A;  4K7I A;  3GSS A;  2GSR A;  4N10 A;  1XIY A;  1S3C A;  4GWR A;  4BVY B;  8GSS A;  3DVX A;  3US3 A;  5F07 A;  1WE0 A;  2CAI A;  3IR4 A;  3IHG A;  1T00 A;  1WRY A;  3K8N A;  6GSU A;  2B1K A;  1PN9 A;  5F05 A;  3UVT A;  1MTC A;  1OAZ A;  1Z6N A;  2IMI A;  4KA0 A;  4K2D A;  4TXV A;  4FYU A;  3L9U A;  2P0G A;  4I5Q A;  2F3M A;  1TJD A;  5DJM A;  4K5S A;  2Z9S A;  5IIZ A;  1Z9H A;  5IMD A;  3NOF A;  2CVD A;  4JZQ A;  1X9S B;  3LSZ A;  3TKQ A;  4GQF A;  3IXR A;  5E59 A;  4TXO B;  2DJ2 A;  2HZE B;  3SWL A;  2KP1 A;  4LA1 A;  1SL0 B;  1DE2 A;  4KSO A;  1XW6 A;  4OFM A;  2C3Q A;  4NHW A;  2VUP A;  5BRT A;  4K8M A;  4DEJ A;  2I1U A;  3E0U A;  4CY8 A;  4RI7 A;  1EP8 A;  3IK9 A;  1K3Y A;  2CVK A;  2V6O A;  4MNN A;  2ES7 A;  3MSZ A;  4G0L A;  1NM3 A;  2HLS A;  4Q5Q A;  4ZXG A;  4G0I A;  2YCD A;  4MH2 A;  1V58 A;  4EL1 A;  2YV7 A;  4CDO A;  5B6N A;  2WCI A;  1WMJ A;  4O5Q A;  1ERU A;  1TXX A;  3HVX A;  5A4W A;  1N8J A;  4IVF A;  2J23 A;  3ZML A;  1A23 A;  2RM6 A;  2V32 A;  4IEL A;  1F3B A;  3FYG A;  2QA2 A;  2JL4 A;  3H8Q A;  4G9H A;  2XPE A;  2L6C A;  4KSM A;  2H74 A;  1XWG A;  1BJX A;  1F3A A;  4KDU A;  4AJ7 A;  3TGZ A;  1R5P A;  4WR5 A;  3LJR A;  3DRN A;  2IPA A;  3ED3 A;  2H19 A;  2B5X A;  3FR9 A;  1TK0 B;  2IWT A;  5CAX A;  5EVO A;  3HD5 A;  1AAZ A;  4KB3 A;  1Z6M A;  1GSQ A;  5GAP D;  1XZO A;  3QMX A;  3EWL A;  3QAG A;  3F8U A;  1YJ6 A;  1A2M A;  1UN2 A;  1MEK A;  4QQ7 A;  2A2S A;  2YWN A;  4FO5 A;  4IQA A;  4MF6 A;  1ZYE A;  1LU4 A;  3KZQ A;  3P7X A;  5DJL A;  2GVP A;  3S9F A;  1VGL A;  2F8A A;  3LG6 A;  4F9Z A;  1G7E A;  2E2G A;  2OE3 A;  4MZC A;  3F4S A;  1X9W B;  2IMF A;  2ZNM A;  3Q6O A;  3TKP A;  3TRX A;  3APS A;  2VIM A;  1O73 A;  1YQ1 A;  1EEM A;  2DJJ A;  2KOK A;  1WJK A;  4Z2R A;  4GRF A;  2FUG 2;  4P3Y B;  5DAL A;  4ECB A;  3SBC A;  3KCM A;  1MDI A;  2GTU A;  3F3Q A;  3HVV A;  1EEJ A;  3TUE A;  1M7T A;  3CRU A;  3VPQ A;  4IJ3 A;  2HT9 A;  2JSZ A;  5DAK A;  2DLX A;  4MJB A;  2NPB A;  2P31 A;  1A8L A;  3PR8 A;  1F9M A;  3IK7 A;  5CNW A;  2M72 A;  1SYX A;  2DJ0 A;  4E8E A;  5DBQ A;  2LQQ A;  5GZZ B;  2A4V A;  7GSS A;  5F8B A;  3E9J B;  1XCC A;  4X1U A;  3PPU A;  3BOA A;  4KX4 A;  2AHE A;  2C3T A;  2EIO A;  4PQH A;  1G6W A;  3ZLP A;  4V1A p;  3D0Z A;  2WUL A;  2D2Z A;  2LUS A;  4GST A;  5A4V A;  1GSY A;  1SEN A;  1K0C A;  1T1V A;  4YKG A;  4ULX A;  4LMV A;  2MBS A;  4EVM A;  1FVJ A;  4YQU A;  1FG4 A;  1ZZY A;  2DJ1 A;  4E8H A;  4NWY A;  2DIY A;  1AC1 A;  1TRS A;  3TKS E;  1PRX A;  1O8X A;  1K3L A;  2K9F A;  3A2W A;  1W4V A;  1Z5Y E;  3C8E A;  3AY8 A;  2I3Y A;  4ZBA A;  3TJB A;  4HEA 2;  4WET A;  2JZS A;  3RDW A;  4TR0 A; 
#chains in the Genus database with same CATH homology
 4BWS A;  1ERW A;  1SYR A;  2DJ3 A;  3UL3 A;  1TW9 A;  4L5L A;  2H6X A;  2HSM A;  1R26 A;  2WB9 A;  4ISD A;  2DSA A;  2PGT A;  4HU9 A;  5ENU A;  2AJQ B;  4G19 A;  2A2R A;  3I43 A;  4MJE A;  3E3E A;  4DVC A;  3ERF A;  3CTG A;  4ICY A;  3RAZ A;  3M0F A;  3TDG A;  3UAR A;  3F3R A;  1W89 A;  4EDZ A;  1O85 A;  3WGD A;  4GCI A;  1TK5 B;  3LEF A;  2VL2 C;  5JCG A;  4Z2U A;  3D4T A;  2P5R A;  3IAS 2;  4RQR A;  2K18 A;  1NHO A;  5CRD A;  3VWW A;  4ML1 A;  2PMT A;  4K0N A;  3GH9 A;  3APO A;  5FHI A;  4WF5 A;  3IE3 A;  3LOR A;  1PKZ A;  5C00 A;  2YOI A;  1FVK A;  4Q5F A;  2V6K A;  3MIX A;  2R4V A;  4EIP A;  2GT5 A;  4TW5 A;  3M9J A;  4OMV A;  3TJK A;  4PQ1 A;  1V98 A;  3CBU A;  4LLR A;  1PMT A;  1GSD A;  1SJI A;  2VD0 A;  2K6V A;  1M2D A;  3UAP A;  2A4H A;  1TI3 A;  3UOM A;  4ECJ A;  2KP2 A;  2X64 A;  4PUR A;  3F63 A;  1PN0 A;  1FB0 A;  3HVS A;  2O89 A;  4PUF C;  4DSQ A;  3ZVJ A;  16GS A;  5D9W A;  2RUF A;  4QL9 A;  4PNF A;  1K0N A;  2DMM A;  2REM A;  4PXO A;  2GZP A;  4Q5R A;  1EGR A;  2C80 A;  4MAB A;  3DWV A;  3OR5 A;  1ACV A;  1CQG A;  3J7Y b;  2YPM A;  1IYH A;  1DSB A;  1A8Y A;  4LL4 B;  4TXO A;  1EGO A;  1YF1 A;  2HZE A;  4IBP A;  1NW2 A;  1XOA A;  2OA7 A;  1TP9 A;  5AIV A;  3L78 A;  3IDV A;  5HR3 A;  2B7K A;  3VFI A;  4HZ2 A;  3D21 A;  6GSX A;  1DE1 A;  3ZRD A;  4I97 A;  4K0G A;  2HNL A;  3FR6 A;  4MF5 A;  2K8S A;  4L5O A;  1DUG A;  1JLW A;  4XS4 B;  4PGT A;  4LMW A;  2GZZ A;  5LD0 A;  1XVW A;  4EXJ A;  3D22 A;  5B8A A;  2VCT A;  5IOW A;  5IPG A;  3KXO A;  1OC9 B;  3ZRE A;  4G10 A;  3C1S A;  1JFU A;  5GST A;  4KCA A;  1PD2 1;  5D93 A;  1X0R A;  2X8G A;  2VD1 A;  2UZ8 A;  3DKS A;  3LQ7 A;  4TR1 B;  5AGY A;  3H4K A;  5F06 A;  3BD2 A;  2H1G A;  2RUE A;  4ILF A;  4ID0 A;  1ZCP A;  3KP8 A;  5B7C A;  4ZB6 A;  3BBY A;  2GQK A;  4CY6 A;  1GUH A;  3ZIJ A;  2KUC A;  2R5G A;  3JCM L;  4K5R A;  5IMF A;  5H5Q A;  3WT1 A;  5KN0 A;  2X8H A;  4POB A;  1C72 A;  3RPP A;  5JWQ B;  4KGI A;  4J2F A;  2V1M A;  3TJJ A;  1GTB A;  1UA5 A;  4POK A;  3A5W A;  3VI7 A;  1GTI A;  2CX4 A;  2NBS A;  3TKS A;  4HUA A;  5FWG A;  5J5N A;  3EVI A;  4AF2 A;  4DSS B;  5IMC A;  1T4Z A;  2VL3 A;  1GNE A;  4X4J A;  3HJO A;  1SK2 A;  3KD0 A;  1MD3 A;  3WYW A;  1PSQ A;  4JR4 A;  2R6K A;  2L5L A;  1HNB A;  1O6J A;  2R0G A;  1WIK A;  2LNT A;  2L6D A;  3ZFB A;  5HFI A;  2JAC A;  2IIY A;  5E4W A;  1U3A A;  1AXD A;  1U87 A;  1Z3E A;  2J9H A;  2XHF A;  4K7N A;  4YH2 A;  2QC7 A;  2FGX A;  3KEB A;  3KP9 A;  3IOS A;  1OE8 A;  3W8J A;  1YY7 A;  3KJY A;  1AIU A;  2V41 A;  1VF2 A;  1AUC A;  3C1R A;  2C0E A;  6GSY A;  1YZX A;  3CSI A;  2GT6 A;  4I2T A;  3MWH A;  1MDK A;  1TU7 A;  3EIN A;  5ECR B;  4OO4 A;  2AUV A;  2O85 A;  4YKF A;  4GTU A;  1ZYQ B;  1MD4 A;  2MZC A;  1I9D A;  1GSF A;  3LWA A;  2HRF A;  4TR4 A;  4TVE A;  2PBJ A;  1V57 A;  2ON7 A;  1B8X A;  4G0K A;  2FHE A;  3BCI A;  3FY7 A;  4MP4 A;  3VI5 A;  5L71 A;  1FOV A;  3GNJ A;  4BPY A;  3HYP A;  1TRU A;  3FRC A;  3GKX A;  3L9S A;  1BED A;  2E2M A;  2JSY A;  2V2G A;  1T3B A;  5CRG A;  3FZ4 A;  2H30 A;  3HHV A;  1SJ6 A;  3FK8 A;  4KF9 A;  3QFA C;  2O8V B;  2CZ3 A;  2KLX A;  2VLT A;  5J9B A;  4WEY A;  1TI1 A;  2YWO A;  4O7H A;  5IPH A;  1OKT A;  3DD3 A;  1XFL A;  4RUV A;  1HNC A;  3R3E A;  2BMX A;  4ZBD A;  2VCV A;  3A2V A;  5AIX A;  12GS A;  4KND A;  3F6D A;  3BCK A;  3GMF A;  1IYI A;  1S3D A;  3GUR A;  5ID2 B;  5IMZ A;  2YN1 A;  4EIQ A;  1VF4 A;  4I2U A;  3KTL A;  4TRX A;  2CX3 A;  3NIV A;  4FYB A;  3ZVJ D;  1A2J A;  4OFT A;  1URM A;  2C8U A;  4EE0 A;  5LNK e;  4NV5 A;  4IQ1 A;  4MF7 A;  4TKY A;  5HFK A;  4USS A;  3IHQ A;  4J56 E;  2VCQ A;  4GLT A;  4ZL9 A;  4EKZ A;  2QGV A;  3MDK A;  4ECI A;  3WD6 A;  1GSU A;  3TOT A;  2E7P A;  2IMD A;  1FO5 A;  4HJ2 A;  5D8I A;  4D73 A;  1H75 A;  1WOU A;  3GTU B;  5IMV A;  4JRR A;  2FWG A;  2MBT A;  5ECP B;  2AB6 A;  5KN2 A;  3UBK A;  2H71 A;  1XWA A;  2QSI A;  4JED A;  5B6M A;  1SU9 A;  3F4T A;  2XBI A;  2XC2 A;  3GL5 A;  5G30 A;  4EO3 A;  2QKE A;  3QOU A;  3IAM 2;  4OO5 A;  2AYT A;  1BYE A;  2H6Y A;  3U6V A;  3GHA A;  3DML A;  1VF1 A;  5IOX A;  1GWC A;  1OC8 A;  4QL7 A;  2HSH A;  4EC0 A;  2H0H A;  4OFN A;  5ECN B;  2WGR A;  3VUR A;  1AQV A;  1HYU A;  4OWY A;  4XS1 A;  5COH A;  1A0F A;  2B3S A;  2G2Q A;  1S3A A;  4F82 A;  3VWX A;  4Z2T A;  1DBY A;  1GRX A;  1AQW A;  1TRV A;  4GQC A;  1PQN A;  4XS4 A;  2JU5 A;  2CT6 A;  1THO A;  1GUL A;  1TDI A;  3GST A;  1XWC A;  2H0G A;  4I8B A;  4WKW A;  3TCO A;  2C0F A;  2OAD A;  1YKA A;  1TTZ A;  4FYC A;  1A24 A;  2BJX A;  3KM6 A;  4PX1 A;  2DKH A;  1TKD B;  1SKS B;  1THX A;  3ISO A;  5HQP A;  1B48 A;  3GFK A;  1JZD A;  4TR1 A;  4K1F A;  3TJG A;  1LJR A;  1OVN A;  3A2X A;  3A3T A;  1JLV A;  4XRD A;  3LXZ A;  3TB2 A;  2F51 A;  3IPZ A;  3O6T A;  2H73 A;  2E0Q A;  4EF0 A;  3KTB A;  2PWJ A;  1G0T A;  2GZY A;  2RM5 A;  2HZF A;  5ECH B;  1O81 A;  20GS A;  1ZOF A;  3G9B A;  4XTS A;  2H1A A;  3RPN A;  1XW5 A;  3VK9 A;  4HU7 A;  1WPI A;  3HCZ A;  1JZW A;  4PTS A;  2VL2 A;  1M2B A;  2DC5 A;  5CRW A;  4V2N A;  4F0C A;  5IM9 A;  4O92 A;  2EIR A;  2OE0 A;  3L4N A;  5HR0 A;  3P8W A;  1U6T A;  5KN3 A;  2VO4 A;  4FH8 A;  4POL A;  4MA9 A;  3V1W A;  1TRW A;  2X99 A;  2LTK A;  3FEU A;  1EWX A;  1XVQ A;  3UJ1 A;  2RLI A;  4XCS A;  3HZ8 A;  1G6Y A;  3EU4 A;  4WBJ A;  2HRN A;  1UVZ A;  2IFQ B;  5J4U A;  5A4U A;  2N5A A;  2YZH A;  1GUK A;  14GS A;  4BVY A;  2B7J A;  1B9X C;  4HDE A;  5DCH A;  5ECO B;  1B9Y C;  1RW1 A;  1R4W A;  4IGJ A;  1ZMA A;  1GLP A;  4MMM A;  2ZUP A;  3FMW A;  1SKW B;  3EMP A;  1X5C A;  1K3O A;  3I6A A;  6GSW A;  5EY6 A;  2R2J A;  2BTO T;  4MDC A;  3ZL5 A;  4ZIJ A;  1XBS A;  1H4O A;  1O8W A;  4NAX A;  4KAE A;  4JE1 A;  5AIS A;  3Q19 A;  4NV2 A;  2PVO C;  3EPT A;  2IN3 A;  2JAD A;  1GLQ A;  5DQS A;  5JCU A;  3EU3 A;  4IN0 A;  2PVQ A;  4A5P A;  1Z7P A;  2FLS A;  3UEM A;  1T4Y A;  1E6B A;  2CA8 A;  3D5J A;  5CRH A;  2GGT A;  2OAC A;  2L4C A;  1QGV A;  4BVX B;  2GQM A;  1SL1 B;  2X8C A;  4ZB9 A;  3W8S A;  1SK0 A;  4ACS A;  1F6M C;  4PUA A;  4HI7 A;  2NVL A;  2NDO A;  3UIW A;  3HA9 A;  5LCZ A;  2HXK A;  4MH3 A;  1CQH A;  5IQY A;  5HR1 A;  2YJH A;  4IW9 A;  5ID2 A;  2OBK A;  2GS3 A;  2HRA A;  2HRK A;  5D9V A;  2LS5 A;  2H70 A;  3Q18 A;  4POM A;  3I69 A;  2K8V A;  1FAA A;  3GKN A;  3C7M A;  3F9U A;  2DKI A;  2B1L A;  1GNW A;  1OKD A;  3MAK A;  5C04 A;  1VRS D;  2JZT A;  1K0O A;  4XIH A;  1K0B A;  3TOU A;  3CMI A;  4HOJ A;  3TRP A;  2F8F A;  1J0F A;  1XPV A;  3FW2 A;  4LL1 B;  3ME8 A;  1HD2 A;  2L59 A;  3ZMK A;  3M1G A;  5B8B A;  4O32 A;  3N9J A;  1RQM A;  3LFL A;  4KH7 A;  4V2L A;  10GS A;  1KNG A;  3UBL A;  3KMO A;  4F2I A;  4YAP A;  11GS A;  5A5K A;  2G0F A;  4MJA A;  2MMZ A;  2B5Y A;  2ALB A;  2CV4 A;  4G2E A;  4AJ6 A;  3PGT A;  3IC8 A;  4NPB A;  1PA3 A;  1PX7 A;  3EMX A;  4CHS A;  1U88 A;  3R2Q A;  4HQZ A;  3GKK A;  2OE1 A;  1R7H A;  1OYJ A;  4J57 E;  1A0R P;  2I9H A;  1M99 A;  3GKM A;  5J9C A;  3CTF A;  4CW9 A;  1HQO A;  3M3M A;  3EUR A;  5KN1 A;  2LJA A;  1FW1 A;  2YZU A;  2X4A A;  2LJR A;  1ZYN A;  1K0A A;  3BJ5 A;  3LYK A;  2MYG A;  5EL8 A;  1NHY A;  2YAN A;  3ME7 A;  4EDY A;  5GSS A;  1ZYP A;  2EC4 A;  4HZ4 A;  1Y6E A;  3F4R A;  4X43 A;  4OCF A;  3TJF A;  5CYY A;  3ERW A;  4HS1 A;  4MZB A;  3KGK A;  2FA8 A;  4K7O A;  4KW6 A;  1J08 A;  2I81 A;  2I4A A;  5ECI B;  4KCE A;  3GH6 A;  1SJZ A;  3H1N A;  3G7I A;  1A2L A;  3RHB A;  4ML6 A;  3Q74 A;  2FWE A;  4GXZ A;  1F2E A;  2TIR A;  4WBR D;  5J41 A;  3F6F A;  5CO3 A;  3J7Y k;  3QFB C;  1V2A A;  3HZ4 A;  3DIE A;  3O3T A;  4X0X A;  5ELA A;  5J3R A;  2F9S A;  4EUY A;  3FZ9 A;  5ABR A;  2GSS A;  2IMK A;  2VM1 A;  1XWB A;  2H76 A;  1ERV A;  3HDC A;  2IME A;  4YQM A;  4GF0 A;  3IRA A;  2CQ9 A;  3QCP A;  4TR3 A;  3W6G A;  4XS6 A;  4HQS A;  3GYK A;  3VLN A;  5JWR B;  3UVH A;  1BAY A;  2R0C A;  1AQX A;  1SD8 A;  5G1L A;  2PPT A;  3D6I A;  4YQV A;  2L5O A;  3KMN A;  3ZIT A;  1GH2 A;  4XHM A;  2B6M A;  2IFQ A;  3HKR A;  1EV9 A;  3GV1 A;  1SK1 A;  2H1D A;  1GSE A;  3QR6 A;  2VM2 A;  1ABA A;  2YWM A;  4PQI A;  4Q5N A;  1BQ7 A;  4L0W A;  6GSV A;  2VLU A;  1RK4 A;  3IA1 A;  1GSS A;  2XPD A;  2IJY A;  3H79 A;  2MMO A;  4GSN A;  2C4J A;  2YJ7 A;  2GSQ A;  3O76 A;  2PER A;  5HR2 A;  5KOW A;  5HFG A;  5D73 A;  3PIN A;  4KUN A;  1FOH A;  4TOP A;  1QFN A;  1X5E A;  5DVB A;  4H86 A;  1OC3 A;  2DML A;  4ZB8 A;  2FWH A;  4JBB A;  2DBC A;  1PL1 A;  4RQX A;  4BL7 B;  4ZL8 A;  2LKU A;  4BVX A;  3U5R E;  1YDK A;  1ON4 A;  2VLV A;  1B4P A;  1Z7R A;  2P5Q A;  2H1B A;  1PL2 A;  5KEJ A;  1T8E B;  1N2A A;  5G5E A;  1UC7 A;  5DCG A;  4F03 A;  4KE3 A;  4NMU A;  3UMA A;  3C73 A;  2HFD A;  3ZYW A;  1GTU A;  4ZBB A;  1U3I A;  2LST A;  2RII A;  4ZIL A;  4V2M A;  2WS2 A;  3LXT A;  3FHK A;  4L8E A;  1OC9 A;  1YKC A;  5G31 A;  2IL3 A;  1B4Q A;  6GST A;  3QDN A;  2LEG A;  4WXT A;  3MNG A;  3CSH A;  3L9V A;  3H93 A;  2LQO A;  2KHP A;  3DVW A;  2DIZ A;  1USB A;  4IJI A;  3ERG A;  1Q4J A;  2FNO A;  1Q98 A;  2H6Z A;  2FD3 A;  1ILO A;  2L4Q A;  2WZ9 A;  2AV4 A;  3QPM A;  5H5S A;  1X9M B;  3IV4 A;  4N11 A;  3WGX A;  5CP1 A;  2AAW A;  5D96 A;  1PGT A;  5ECM B;  4OCE A;  2VCW A;  5ECL B;  3CYN A;  2FY6 A;  3HY2 A;  3EE2 A;  3GL3 A;  4O5R A;  3DGQ A;  6GSS A;  2DJK A;  1K0D A;  4MJC A;  3DEX A;  1MDJ A;  2WRT A;  3A5I A;  1KBN A;  4DSS A;  2NTO A;  2N5B A;  2GDR A;  4MPG A;  4NHZ A;  4IKH A;  2CAQ A;  2H0I A;  4KDX A;  4JU5 A;  1GUM A;  4N0Z A;  2N5F A;  2PU9 C;  3KH9 A;  3GX0 A;  1YEX A;  3IC4 A;  1BX9 A;  2M80 A;  1NSW A;  5ECS A;  2TRX A;  1R5A A;  5IMA A;  2YWI A;  5JWO B;  2QA1 A;  3GRX A;  1LBK A;  5CRE A;  5DDL A;  4JR6 A;  4YAV A;  1T7P B;  1V40 A;  1X5D A;  4I6X A;  4KDY A;  3F0I A;  4OD7 A;  3GA4 A;  2HI7 A;  1SKR B;  2C3N A;  2PUK C;  5INY A;  2GQL A;  1VF3 A;  4Z7X A;  3FR3 A;  4IHU A;  1TOF A;  3KIJ A;  1ML6 A;  3WT2 A;  2A2P A;  3HJP A;  1M9A A;  1ST9 A;  1EZK A;  2VOC A;  1WWJ A;  1ZL9 A;  3GUS A;  2OJL A;  3CSJ A;  4HJM A;  3MYD A;  5G2Z A;  2FWF A;  5G5F A;  1HNA A;  1XWK A;  3PH9 A;  4K9Z A;  4MZW A;  4ZL7 A;  5FT3 A;  3CRT A;  1EP7 A;  2X49 A;  3KH7 A;  2WJU A;  3LGC A;  1BG5 A;  5G1K A;  2VCZ A;  4AGS A;  3QAV A;  2VAF A;  5H5R A;  3GN3 A;  4D73 B;  3L0H A;  5IO0 A;  2C0D A;  3DXB A;  1JZR A;  4K6X A;  3GX8 A;  2C0G A;  2ON5 A;  2H8L A;  4WF4 A;  2R3X A;  2LRN A;  5EPF A;  2FA4 A;  2FCH A;  1GL8 A;  2TRC P;  3G7J A;  2PN8 A;  3GIX A;  5ECK B;  2LRT A;  3ZTL A;  1OE7 A;  2B5E A;  4PNG A;  1E2Y A;  2R37 A;  4N30 A;  2M46 A;  2LNS A;  3LYP A;  5GAN D;  1EOG A;  1AW9 A;  3VWU A;  1ZGN A;  3I9V 2;  5BMU A;  3N5O A;  5AN1 A;  3WGE A;  2O7K A;  2WDU A;  3FZ5 A;  1SD9 A;  1KEB A;  4DSR A;  4L0U A;  3QD9 A;  2CVB A;  5DAL B;  1TK8 B;  3EC3 A;  1EOH A;  2LJK A;  3HJM A;  1QK8 A;  2OKA A;  5DAK B;  13GS A;  3HXS A;  1QUW A;  2VL9 A;  4ECC A;  2H01 A;  4AJ8 A;  4WR4 A;  3RHC A;  1XW9 A;  3GTU A;  1G7O A;  4K2X A;  1TU8 A;  1QMV A;  1KTE A;  2YP6 A;  2EIQ A;  5DQY A;  3TKR A;  3M8N A;  2MMN A;  4MPF A;  4GSS A;  9GSS A;  4O5U A;  4BL7 A;  3DYR A;  3VWV A;  2MMA A;  1PKW A;  3FZA A;  4TN8 A;  2HYX A;  3VPT A;  3P90 A;  5D9X A;  1JHB A;  4IP6 A;  2XBQ A;  2GST A;  19GS A;  4F0B A;  3TRQ A;  1K0M A;  2YV9 A;  4FQU A;  3P2A A;  1M2A A;  2ZCT A;  3ZIV A;  1JZO A;  4XRA A;  1ERT A;  1YF0 A;  1Y25 A;  1V9W A;  4MK3 A;  1PX6 A;  5ELG A;  3G7Y A;  2VCX A;  4NXI A;  3C71 A;  18GS A;  5JCW A;  1QXH A;  5ECQ B;  1M9B A;  2HSY A;  3LW9 A;  1SL2 B;  1FB6 A;  2H72 A;  2WFC A;  3ZZX A;  5IO2 A;  2H75 A;  3ZFL A;  1XOB A;  2LV3 A;  3TKS C;  2GLR A;  22GS A;  3M9K A;  3EYT A;  1WP0 A;  1GP1 A;  5D9T A;  4MCU A;  2HE3 A;  1YEP A;  4IP1 A;  5KOX A;  2H66 A;  1I5G A;  1QQ2 A;  5F0G A;  17GS A;  3QAW A;  2JZR A;  2R0P A;  2C1Y A;  4BA7 A;  3FKF A;  4IS0 A;  2CZ2 A;  1GTA A;  4MLY A;  3CXG A;  2OBI A;  4RI6 A;  3NZN A;  3IBH A;  3APQ A;  4V1A g;  1EV4 A;  2O87 A;  1XXU A;  3RBT A;  1F37 A;  4N0V A;  2L57 A;  3D4M A;  1M0U A;  2YNX A;  1J9B A;  4FIW A;  4BWQ A;  2LRC A;  1FHE A;  1O7U A;  4K7I A;  3GSS A;  2GSR A;  4N10 A;  1XIY A;  1S3C A;  4GWR A;  4BVY B;  8GSS A;  3DVX A;  3US3 A;  5F07 A;  1WE0 A;  2CAI A;  3IR4 A;  3IHG A;  1T00 A;  1WRY A;  3K8N A;  6GSU A;  2B1K A;  1PN9 A;  5F05 A;  3UVT A;  1MTC A;  1OAZ A;  1Z6N A;  2IMI A;  4KA0 A;  4K2D A;  4TXV A;  4FYU A;  3L9U A;  2P0G A;  4I5Q A;  2F3M A;  1TJD A;  5DJM A;  4K5S A;  2Z9S A;  5IIZ A;  1Z9H A;  5IMD A;  3NOF A;  2CVD A;  4JZQ A;  1X9S B;  3LSZ A;  3TKQ A;  4GQF A;  3IXR A;  5E59 A;  4TXO B;  2DJ2 A;  2HZE B;  3SWL A;  2KP1 A;  4LA1 A;  1SL0 B;  1DE2 A;  4KSO A;  1XW6 A;  4OFM A;  2C3Q A;  4NHW A;  2VUP A;  5BRT A;  4K8M A;  4DEJ A;  2I1U A;  3E0U A;  4CY8 A;  4RI7 A;  1EP8 A;  3IK9 A;  1K3Y A;  2CVK A;  2V6O A;  4MNN A;  2ES7 A;  3MSZ A;  4G0L A;  1NM3 A;  2HLS A;  4Q5Q A;  4ZXG A;  4G0I A;  2YCD A;  4MH2 A;  1V58 A;  4EL1 A;  2YV7 A;  4CDO A;  5B6N A;  2WCI A;  1WMJ A;  4O5Q A;  1ERU A;  1TXX A;  3HVX A;  5A4W A;  1N8J A;  4IVF A;  2J23 A;  3ZML A;  1A23 A;  2RM6 A;  2V32 A;  4IEL A;  1F3B A;  3FYG A;  2QA2 A;  2JL4 A;  3H8Q A;  4G9H A;  2XPE A;  2L6C A;  4KSM A;  2H74 A;  1XWG A;  1BJX A;  1F3A A;  4KDU A;  4AJ7 A;  3TGZ A;  1R5P A;  4WR5 A;  3LJR A;  3DRN A;  2IPA A;  3ED3 A;  2H19 A;  2B5X A;  3FR9 A;  1TK0 B;  2IWT A;  5CAX A;  5EVO A;  3HD5 A;  1AAZ A;  4KB3 A;  1Z6M A;  1GSQ A;  5GAP D;  1XZO A;  3QMX A;  3EWL A;  3QAG A;  3F8U A;  1YJ6 A;  1A2M A;  1UN2 A;  1MEK A;  4QQ7 A;  2A2S A;  2YWN A;  4FO5 A;  4IQA A;  4MF6 A;  1ZYE A;  1LU4 A;  3KZQ A;  3P7X A;  5DJL A;  2GVP A;  3S9F A;  1VGL A;  2F8A A;  3LG6 A;  4F9Z A;  1G7E A;  2E2G A;  2OE3 A;  4MZC A;  3F4S A;  1X9W B;  2IMF A;  2ZNM A;  3Q6O A;  3TKP A;  3TRX A;  3APS A;  2VIM A;  1O73 A;  1YQ1 A;  1EEM A;  2DJJ A;  2KOK A;  1WJK A;  4Z2R A;  4GRF A;  2FUG 2;  4P3Y B;  5DAL A;  4ECB A;  3SBC A;  3KCM A;  1MDI A;  2GTU A;  3F3Q A;  3HVV A;  1EEJ A;  3TUE A;  1M7T A;  3CRU A;  3VPQ A;  4IJ3 A;  2HT9 A;  2JSZ A;  5DAK A;  2DLX A;  4MJB A;  2NPB A;  2P31 A;  1A8L A;  3PR8 A;  1F9M A;  3IK7 A;  5CNW A;  2M72 A;  1SYX A;  2DJ0 A;  4E8E A;  5DBQ A;  2LQQ A;  5GZZ B;  2A4V A;  7GSS A;  5F8B A;  3E9J B;  1XCC A;  4X1U A;  3PPU A;  3BOA A;  4KX4 A;  2AHE A;  2C3T A;  2EIO A;  4PQH A;  1G6W A;  3ZLP A;  4V1A p;  3D0Z A;  2WUL A;  2D2Z A;  2LUS A;  4GST A;  5A4V A;  1GSY A;  1SEN A;  1K0C A;  1T1V A;  4YKG A;  4ULX A;  4LMV A;  2MBS A;  4EVM A;  1FVJ A;  4YQU A;  1FG4 A;  1ZZY A;  2DJ1 A;  4E8H A;  4NWY A;  2DIY A;  1AC1 A;  1TRS A;  3TKS E;  1PRX A;  1O8X A;  1K3L A;  2K9F A;  3A2W A;  1W4V A;  1Z5Y E;  3C8E A;  3AY8 A;  2I3Y A;  4ZBA A;  3TJB A;  4HEA 2;  4WET A;  2JZS A;  3RDW A;  4TR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...