5G31A

Crystallographic structure of mutant c73s of thioredoxin from litopenaeus vannamei
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
105
structure length
105
Chain Sequence
MVYQVKDQEDFTKQLNEAGNKLVVIDFYATWCGPCKMIAPKLEELSQSMSDVVFLKVDVDECEDIAQDNQIASMPTFLFMKNGQKLDSLSGANYDKLLELVEKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN
publication title Is dimerization a common feature in thioredoxins? The case of thioredoxin from Litopenaeus vannamei.
pubmed doi rcsb
source organism Litopenaeus vannamei
total genus 34
structure length 105
sequence length 105
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5g31A00
1PN9A 3HXSA 3GSTA 2B3SA 4LL4B 5F07A 4CDOA 1GH2A 1B9XC 4PQ1A 4MDCA 4HUAA 1USBA 1M7TA 3EINA 2CX4A 4XTSA 1LJRA 3IR4A 1F37A 4GSSA 1XOAA 3UEMA 5CRHA 2FWEA 3MSZA 3FEUA 2RLIA 1XWCA 1UN2A 2H30A 2IMFA 3I6AA 4K6XA 6GSXA 2WRTA 3DEXA 3IC4A 2X8CA 3ZFLA 2LV3A 1DE1A 2VIMA 1PX6A 4IJIA 1H4OA 1THOA 4F9ZA 4ZIJA 3Q6OA 2WFCA 2B5XA 4FO5A 3ZMLA 2AV4A 3WD6A 4D73B 1T7PB 2VLUA 2JSZA 3HJMA 5ECHB 1AUCA 2A2RA 3M9KA 1YDKA 3KCMA 2DMLA 2L59A 1TTZA 1A2MA 3TDGA 1K0CA 5ELGA 1T4YA 2E0QA 1R5PA 4DSSB 3LGCA 3DWVA 5HR0A 2LRNA 1X9WB 1J9BA 1FVJA 2MBTA 1NW2A 4EDYA 3QR6A 3L0HA 1G7OA 1Z7RA 2XHFA 4MZCA 2X64A 3GFKA 3M0FA 3UVTA 4MZWA 4EF0A 4IKHA 2GDRA 2V32A 3GKKA 1FB6A 4MF7A 2ES7A 3UBKA 2XBIA 1GUMA 3TKPA 4YH2A 2F51A 4F03A 1ERTA 3KMOA 1VGLA 5JCWA 5D8IA 1AQWA 4KDUA 4X0XA 4EDZA 4YAPA 1XVQA 3GMFA 3R2QA 2MBSA 2D2ZA 4YQUA 1A23A 3GX0A 4GLTA 3E9JB 2DBCA 1O81A 4P3YB 3RPNA 4F2IA 1PRXA 1OC3A 1YEPA 1J08A 3DRNA 4RQRA 2PVQA 3GH6A 4F0BA 4ZILA 1SL0B 2TIRA 1M2DA 4G19A 4MA9A 2YN1A 2VM2A 1GSQA 4N0ZA 4HZ2A 2R5GA 2DJ3A 2B7JA 3O6TA 3D6IA 1WJKA 2HZEA 5B7CA 1WOUA 1R4WA 1G6YA 2C0DA 2GS3A 1VRSD 1GSDA 3FZ9A 4GQCA 4PUAA 1SYRA 3ZITA 3ERWA 3ZMKA 2V6KA 2VCVA 2RUFA 4TXVA 3TJBA 4XHMA 2H19A 4MZBA 3GRXA 1I5GA 4I6XA 4XRDA 4EE0A 1PA3A 2GZYA 3VWVA 1M9AA 3ZREA 3L9SA 1TRVA 2WGRA 4RI7A 2VL9A 4EVMA 4POKA 2LQQA 1J0FA 1V58A 2H72A 1EWXA 1TOFA 1YKAA 5EVOA 2IMEA 1ZGNA 1VF2A 2YWOA 4HU7A 3E3EA 1QGVA 5E59A 5DQYA 2P0GA 2K8VA 1QQ2A 2HRNA 2R3XA 2JADA 2XC2A 1FB0A 2CA8A 1JHBA 4IN0A 2H8LA 3TRXA 5IQYA 3TKRA 1ABAA 2IPAA 3EC3A 2P5QA 4FYBA 4RI6A 3VI7A 3DGQA 1M2BA 4OFMA 3KGKA 1YQ1A 3UBLA 3WT2A 1QUWA 3FZ5A 1BYEA 4RUVA 5KEJA 5DCHA 3Q18A 3VFIA 1Z5YE 2VCXA 1K0MA 4ECCA 1U6TA 4LMWA 5DALB 1A8YA 2YZHA 3I9V2 5ECQB 1FOVA 1GTBA 2MYGA 5KN0A 5CO3A 3H1NA 2YWNA 1PMTA 3A2WA 5FT3A 1MD3A 2O7KA 2OADA 1TK5B 3RHCA 5JCGA 4I97A 4N0VA 3TOUA 4DEJA 5D73A 4K9ZA 5IMVA 4TR0A 4H86A 4TR4A 1EV4A 3IAM2 3P2AA 1JLVA 3FYGA 2H0GA 1F2EA 2CZ3A 5CREA 1AXDA 5LD0A 1QXHA 1UVZA 3P7XA 4OCFA 2KP1A 4OO4A 3WGDA 2GVPA 2O89A 3IE3A 2IFQB 3KH9A 3RHBA 2CQ9A 1AQXA 3KZQA 3RPPA 3VPQA 2C3NA 3QDNA 4AJ6A 4IELA 4MMMA 1FHEA 4MH2A 4WF4A 5GAPD 1A0FA 2ON7A 3F63A 2IL3A 4KUNA 2REMA 4JZQA 2J23A 4IW9A 5IMDA 4TN8A 1GLPA 3P90A 1EEMA 3I43A 4TR1A 3KM6A 3WGEA 4PQHA 3LYKA 2NTOA 3CBUA 5IOWA 5LNKe 1PSQA 1ZZYA 5DVBA 3VPTA 2KOKA 3MAKA 6GSWA 4J56E 4PUFC 1EGOA 1JZDA 1KBNA 3F3RA 6GSVA 1M9BA 2GTUA 3FR9A 5ECIB 4V1Ag 1TU7A 2DMMA 3C8EA 3BCKA 1FW1A 1TI3A 2YZUA 3HJPA 2PU9C 1GSSA 2L4QA 5A4WA 1UC7A 3NIVA 1EZKA 1SKSB 4ILFA 1X5CA 2H01A 3A3TA 4GRFA 3GKXA 2WCIA 2V1MA 1MEKA 2LTKA 2K8SA 4ECBA 4L5LA 4WETA 3I69A 5ECKB 4PXOA 1DSBA 2RUEA 3A2VA 5AIVA 1Z9HA 2LRTA 4KX4A 4TW5A 5B8BA 1GWCA 3CRUA 5HFGA 4DSRA 4ML1A 4E8HA 5EPFA 2VL3A 3KIJA 2I4AA 13GSA 2OKAA 5JWOB 5A4UA 2JACA 1T1VA 3GA4A 1GP1A 2JU5A 4NAXA 2L5LA 4KCAA 2BJXA 2IMKA 2LS5A 2C8UA 1MDJA 5KN3A 4ZBDA 2VCTA 3QAGA 2LQOA 2HT9A 5J5NA 4IHUA 3FY7A 2FWHA 3ZIJA 4XS1A 1SKRB 3DXBA 3LXTA 2HRFA 4BA7A 3GKNA 3GN3A 5JWRB 1OKTA 3HA9A 4TR3A 3C7MA 3CTGA 2XPEA 3GIXA 4TVEA 2YV7A 1SJZA 3TRPA 4JE1A 4MJAA 2DIZA 3IV4A 3LSZA 3GUSA 1FVKA 3F4SA 1YF0A 3MWHA 4KDYA 4J57E 4O5RA 2RIIA 5DCGA 4MPGA 2LNTA 5J9BA 4X43A 1XVWA 4EL1A 3D0ZA 4WKWA 6GSSA 1HNBA 3KTLA 4WR4A 1EP7A 2P31A 3D4TA 4MF6A 2YWIA 1KTEA 3GTUA 3FZAA 3HY2A 2DSAA 8GSSA 2EIRA 3IDVA 4Q5NA 1SD8A 4MABA 4TXOA 2V6OA 1DBYA 3CSJA 5ID2A 3ZZXA 3HKRA 2H75A 2HNLA 1Z6MA 3DVWA 2GQMA 1K0NA 5G5EA 3M8NA 2FCHA 3F3QA 3KJYA 3JCML 2H1AA 3E0UA 3TUEA 4PGTA 1Z3EA 2OA7A 4IJ3A 2R4VA 3IBHA 3CSIA 3APOA 4AGSA 4N30A 1XW5A 3DIEA 2CVBA 4HJMA 1XXUA 3GURA 4QL9A 1C72A 1AQVA 1ZOFA 2K9FA 3VWXA 1THXA 2H66A 3IK9A 2JL4A 1V40A 4FH8A 1TW9A 2OE0A 5F8BA 3W6GA 2OBIA 2B1LA 4GCIA 10GSA 1G0TA 3LFLA 2PMTA 3QOUA 1TRSA 4MP4A 2FY6A 2YP6A 4DVCA 2E2MA 2OE1A 4L8EA 3W8SA 4BL7A 4EC0A 3CRTA 1V9WA 2H71A 5JWQB 1CQGA 1GRXA 1QK8A 3QMXA 2Z9SA 1OE8A 5G1KA 3IOSA 3ZTLA 4GQFA 1JLWA 4K1FA 2QSIA 1KEBA 3HHVA 2KLXA 2C1YA 3KP9A 3F0IA 2FD3A 2LJKA 1A2LA 3LEFA 1T4ZA 2OACA 1TK0B 3RBTA 4OMVA 4K8MA 2OBKA 1HQOA 2HYXA 4G10A 1Q98A 5HR3A 1SK0A 4GSNA 3FR6A 3H4KA 3LWAA 5CRWA 1OE7A 1OC9A 2H74A 5G2ZA 5IM9A 4BWQA 5ENUA 1SKWB 2FUG2 2YCDA 1O6JA 4XS6A 2YWMA 2CAQA 2C0FA 2N5BA 2C0EA 3L78A 3GL5A 3GSSA 5J9CA 1B8XA 4ZL7A 4TOPA 3EU3A 5AN1A 2VD1A 5CYYA 3C1SA 5EL8A 17GSA 5ECPB 1JFUA 1BAYA 5IMFA 2HSHA 3HCZA 4IS0A 5A5KA 4OCEA 4CHSA 4FYUA 1FAAA 3MNGA 3M3MA 4I5QA 5C00A 2FA4A 2YOIA 2F8AA 1U88A 3QPMA 7GSSA 2A2SA 2X99A 5G30A 4JRRA 1NSWA 2G0FA 2B1KA 4HQZA 2BMXA 4ACSA 5ECRB 2BTOT 1RQMA 4K0GA 3O76A 3HVXA 2JZSA 4MJBA 4K7NA 4V2NA 4ZL9A 4I8BA 5G5FA 4I2TA 3F6DA 3TKSE 5B6NA 4PNFA 3D22A 1TXXA 2NDOA 1XPVA 4OO5A 2HLSA 3FZ4A 4F82A 1NM3A 4Q5QA 5F0GA 4MCUA 2ZCTA 3TKSA 4JEDA 1F6MC 4FYCA 3VK9A 4G9HA 2VUPA 2JZRA 1V98A 4LLRA 3TRQA 3LQ7A 1HNAA 1ON4A 5AGYA 2GSQA 5CNWA 1TRUA 2C0GA 2LUSA 3UMAA 2H1BA 1SL1B 3WGXA 5IO2A 3IXRA 3HVVA 1URMA 2I3YA 3CTFA 3RDWA 3S9FA 5KN1A 2GT6A 1GUHA 2L5OA 3HDCA 4WF5A 1PD21 3APSA 1M0UA 1PGTA 4IQ1A 1GSYA 1MTCA 3KTBA 5COHA 4XS4A 3FHKA 2FWGA 2ALBA 5ECOB 5F06A 2DLXA 1ACVA 3KP8A 1XWKA 1PL2A 2X8GA 5HFIA 1R26A 3A5WA 1ZCPA 2VL2A 4ZBBA 2E7PA 4V1Ap 1JZRA 3TJJA 1AIUA 2DJJA 2LSTA 4BVYA 1O85A 1K3YA 1K3LA 2YANA 2F3MA 4HJ2A 4F0CA 2ZNMA 1XW6A 2GZZA 1ERVA 1ZYEA 3GX8A 2L57A 18GSA 5IOXA 1TP9A 4ML6A 3EYTA 4LA1A 5ECSA 5J3RA 3A2XA 2HZFA 3IHQA 1K0BA 2N5AA 1B48A 3D4MA 5ECMB 3GTUB 5C04A 2CT6A 1CQHA 2ZUPA 3ME8A 12GSA 2MMOA 4TXOB 2O8VB 5ID2B 3GV1A 4HU9A 2WS2A 4E8EA 1EEJA 2H0HA 3KMNA 2N5FA 4KGIA 1PX7A 1IYIA 3FRCA 3LG6A 5GZZB 4MPFA 4OWYA 9GSSA 1E6BA 3H79A 1JZOA 4PNGA 3VLNA 1SJ6A 2OE3A 1M2AA 2FHEA 3HVSA 2CVKA 3F8UA 2H73A 5ECLB 1YEXA 2PUKC 2YJ7A 3K8NA 5GAND 2HSYA 3EWLA 2IWTA 1A8LA 2NPBA 3KD0A 4G2EA 4AF2A 2IJYA 5J41A 3G7JA 3C73A 4KAEA 2PBJA 2FGXA 3WYWA 3UVHA 2H70A 1Z6NA 2EIQA 1WRYA 4TRXA 1ST9A 2CZ2A 22GSA 2DJKA 3D21A 3ZVJA 3C1RA 5IO0A 1BX9A 1OVNA 2MMNA 1EOGA 2QGVA 5D9XA 5D96A 5FWGA 1TK8B 1HD2A 5LCZA 2X8HA 2WJUA 4J2FA 1XWBA 5H5QA 1GTAA 4ECJA 2VCQA 2CAIA 3ZLPA 1MDKA 1MDIA 1O8XA 2WULA 3Q19A 5DALA 1OYJA 4EUYA 1GUKA 3IA1A 4L5OA 4KW6A 5A4VA 3N5OA 11GSA 1YKCA 4HEA2 4BWSA 3VI5A 3WT1A 4NXIA 2R37A 3FW2A 3L9VA 5CRGA 3TCOA 3TKQA 1N2AA 2QKEA 1HNCA 4GTUA 2VAFA 5HR2A 3BOAA 3EMXA 3GH9A 6GSUA 5J4UA 1F3BA 1B4QA 2RM6A 3PH9A 1DE2A 2EIOA 1YZXA 4O92A 3HJOA 3SBCA 3ZRDA 2HZEB 3EE2A 5HFKA 1X5EA 3U6VA 1YY7A 1GLQA 2V41A 4IVFA 4POBA 4PX1A 3ZFBA 4JU5A 5D93A 3LJRA 1AAZA 5DAKA 2H76A 3APQA 5IPGA 1Z7PA 2KUCA 3QFBC 1GNEA 4HDEA 4L0WA 2EC4A 5ECNB 19GSA 2DJ1A 1PKWA 1BEDA 4KDXA 1GL8A 4MJEA 4KB3A 3KXOA 3DMLA 1KNGA 1S3AA 5IMCA 1PL1A 2HI7A 4GWRA 3UAPA 1F9MA 1WIKA 4KNDA 4PURA 1F3AA 4LL1B 2VLVA 2QC7A 4K0NA 3TGZA 2VM1A 1WE0A 2AYTA 4WEYA 2C3TA 3CSHA 3G7IA 2L6DA 3VWWA 20GSA 2AUVA 2IIYA 1K0DA 3IPZA 3GL3A 1A24A 1SJIA 4JBBA 1XZOA 4POMA 2YJHA 2MMAA 1O8WA 3QCPA 1RK4A 2B6MA 1O73A 2XBQA 2NBSA 3D5JA 3FKFA 5AIXA 2H6XA 4ZB9A 1SENA 5H5RA 3IAS2 3C71A 1WP0A 2GQKA 4NMUA 3SWLA 2MMZA 2DIYA 4GXZA 3KEBA 4KSOA 3QAWA 2O87A 3M9JA 4TKYA 1SYXA 1B4PA 1ERWA 4KA0A 1AC1A 2L6CA 5F05A 2VD0A 4IQAA 2H1DA 5L71A 3UIWA 1ZL9A 3EVIA 2VLTA 4XS4B 2TRCP 1K0OA 1IYHA 4ZL8A 2DJ0A 1VF1A 3ED3A 3DVXA 4MH3A 2NVLA 4IGJA 1WMJA 4DSQA 2R2JA 2F8FA 1SL2B 1U3AA 3F4TA 2PWJA 2KHPA 3UOMA 1X5DA 2V2GA 2YV9A 1ZMAA 4IBPA 3TJGA 1EP8A 1XWGA 3BCIA 4NV2A 1LU4A 2PERA 2M72A 2LRCA 1SK1A 3Q74A 1R5AA 2HXKA 4OFNA 4ECIA 5DQSA 5EY6A 3TB2A 4QQ7A 6GSTA 1OC8A 3TOTA 1NHYA 3GKMA 3TJFA 4TR1B 3DD3A 3DYRA 4NHWA 1TI1A 3ZVJD 5CP1A 1T00A 1FO5A 2FWFA 4NV5A 2I81A 4AJ7A 1V2AA 4HQSA 1GTUA 6GSYA 4KH7A 16GSA 3NZNA 4V2LA 5IMZA 4X1UA 3ZIVA 3DKSA 3LXZA 1GULA 3FR3A 5FHIA 5D9VA 2H6YA 3VWUA 1V57A 1ML6A 1B9YC 5KN2A 2FA8A 4QL7A 4V2MA 1I9DA 2LNSA 3QFAC 5GSTA 1OKDA 4IP6A 2R6KA 5DJLA 2CX3A 3US3A 5IMAA 2JZTA 4BPYA 4XCSA 4WBRD 3ME7A 4PQIA 2GZPA 4MK3A 1G7EA 1SU9A 4Z7XA 1T3BA 4D73A 3CMIA 2H0IA 3PINA 3OR5A 1X9SB 3HD5A 3IK7A 1DUGA 4OFTA 3KH7A 1GSUA 1GTIA 3F4RA 1VF3A 1VF4A 4MF5A 5G1LA 1G6WA 4DSSA 4YAVA 5D9TA 1S3DA 3VURA 3ZL5A 4ZB6A 3M1GA 3U5RE 2TRXA 4I2UA 1K0AA 1WPIA 2KP2A 4CW9A 3G9BA 1U3IA 4GSTA 4BVXA 2PVOC 1FG4A 2H6ZA 1BJXA 1XIYA 4N10A 2F9SA 1GNWA 2RM5A 2XPDA 4XIHA 1W4VA 4GF0A 3EU4A 1SD9A 2FNOA 1H75A 2I9HA 4ISDA 1ILOA 4ULXA 3CYNA 3ERGA 2FLSA 3NOFA 1XW9A 5DDLA 3PGTA 1ZYQB 3EMPA 2CV4A 1ERUA 4EO3A 4EKZA 4OD7A 2IMDA 1EGRA 3IRAA 5G31A 3CXGA 4K2DA 5HR1A 2O85A 3F6FA 1M99A 3HZ4A 5DAKB 2WB9A 1R7HA 1PKZA 3G7YA 1BQ7A 3HZ8A 1N8JA 5INYA 2GLRA 3UARA 2G2QA 4WR5A 2GSRA 2ON5A 4O32A 1NHOA 1E2YA 2L4CA 2JSYA 5B8AA 1TDIA 4ZBAA 1A2JA 3P8WA 4RQXA 4K7OA 1XCCA 2P5RA 4NHZA 5CRDA 4EXJA 4ID0A 2I1UA 1MD4A 2M80A 3QD9A 1XOBA 3MDKA 1QFNA 4JR4A 1EOHA 2AJQB 2HE3A 4L0UA 4HS1A 1RW1A 4HOJA 1A0RP 3W8JA 1U87A 2PPTA 5ELAA 14GSA 2VO4A 3J7Yb 3UL3A 5DBQA 2LJAA 1SK2A 2GSSA 1TU8A 4ZXGA 2WDUA 1Y25A 1PQNA 2AHEA 2PN8A 3LORA 1XFLA 3UJ1A 3GNJA 4JR6A 2OJLA 1EV9A 4MJCA 2IN3A 2GQLA 4WXTA 1X9MB 2K18A 5B6MA 1X0RA 2LEGA 2C4JA 3N9JA 1JZWA 2GGTA 1TRWA 2IMIA 4IP1A 3RAZA 3H8QA 5CAXA 5IIZA 3BD2A 5D9WA 1Q4JA 4NWYA 3FK8A 3TJKA 5HQPA 3F9UA 1XWAA 5H5SA 5DJMA 2VCZA 3L4NA 3V1WA 3BJ5A 4HI7A 4LMVA 4YQVA 2DJ2A 4Q5FA 5E4WA 1TJDA 2YPMA 1O7UA 2MZCA 2CVDA 4O7HA 1YJ6A 3TKSC 3HYPA 1TKDB 2K6VA 4AJ8A 2C3QA 3GYKA 3ERFA 3QAVA 3ISOA 2YNXA 3PR8A 1GSFA 4POLA 2AAWA 2B5EA 3J7Yk 2J9HA 5JCUA 1OAZA 4YQMA 1W89A 5ABRA 4XRAA 1BG5A 1K3OA 3ZYWA 3EURA 4NPBA 2B7KA 4FIWA 1WWJA 3H93A 1HYUA 2B5YA 1OC9B 1GSEA 1S3CA 2LJRA 5GSSA 4Q5RA 1UA5A 1QMVA 2AB6A 2DC5A 1LBKA 2WZ9A 2A4VA 3GHAA 4HZ4A 2VCWA 2HFDA 4K7IA 2E2GA 4KE3A 2VL2C 3L9UA 2GT5A 5IPHA 2LKUA 2H1GA 1AW9A 4ZB8A 2M46A 3O3TA 4KCEA 1Y6EA 3AY8A 4WBJA 2GSTA 3LYPA 4N11A 1XBSA 1YF1A 2C80A 5AISA 1T8EB 2IFQA 2PGTA 3BBYA 2VOCA 4MLYA 4KSMA
chains in the Genus database with same CATH superfamily
1PN9A 3HXSA 3GSTA 2B3SA 4LL4B 5F07A 4CDOA 1GH2A 1B9XC 4PQ1A 4MDCA 4HUAA 1USBA 1M7TA 3EINA 2CX4A 4XTSA 1LJRA 3IR4A 1F37A 4GSSA 1XOAA 3UEMA 5CRHA 2FWEA 3MSZA 4PTSA 3FEUA 4USSA 2RLIA 1XWCA 1UN2A 2H30A 2IMFA 3I6AA 4K6XA 6GSXA 2WRTA 3DEXA 3IC4A 2X8CA 3ZFLA 2LV3A 1DE1A 2VIMA 1PX6A 4IJIA 1H4OA 1THOA 4F9ZA 3FMWA 4ZIJA 3Q6OA 2WFCA 2B5XA 4FO5A 3ZMLA 3MIXA 4YKGA 2AV4A 3WD6A 5BRTA 4D73B 1T7PB 2VLUA 2JSZA 3HJMA 5ECHB 1AUCA 2A2RA 3M9KA 1YDKA 3KCMA 2DMLA 2L59A 1TTZA 1A2MA 3TDGA 4CY8A 1K0CA 5ELGA 1T4YA 2E0QA 1R5PA 4DSSB 3LGCA 3DWVA 5HR0A 2LRNA 1X9WB 1FOHA 1J9BA 1FVJA 2MBTA 1NW2A 4EDYA 3QR6A 3L0HA 1G7OA 1Z7RA 2XHFA 4MZCA 2X64A 3GFKA 3M0FA 3UVTA 4MZWA 4EF0A 4IKHA 2GDRA 2X4AA 2V32A 3GKKA 1XG8A 1FB6A 4MF7A 2ES7A 3UBKA 2XBIA 1GUMA 3TKPA 4YH2A 2F51A 4F03A 1ERTA 3KMOA 1VGLA 5JCWA 5D8IA 4BIKA 1AQWA 4KDUA 4X0XA 4EDZA 4YAPA 4FQUA 1XVQA 3GMFA 3R2QA 2MBSA 2D2ZA 4YQUA 1A23A 3GX0A 4GLTA 3E9JB 2DBCA 1O81A 4P3YB 3RPNA 4F2IA 1PRXA 1OC3A 1YEPA 1J08A 4Z2TA 3DRNA 4RQRA 2PVQA 3GH6A 4F0BA 4ZILA 1SL0B 2TIRA 1M2DA 4G19A 4MA9A 2YN1A 2VM2A 1GSQA 4N0ZA 4HZ2A 2R5GA 2DJ3A 2B7JA 3O6TA 3D6IA 1WJKA 2HZEA 5B7CA 1WOUA 1R4WA 1G6YA 2C0DA 2GS3A 1VRSD 1GSDA 3FZ9A 4GQCA 4PUAA 1SYRA 3ZITA 3ERWA 3ZMKA 2V6KA 4HSCX 2VCVA 2RUFA 4TXVA 3TJBA 4XHMA 2H19A 4MZBA 3GRXA 1I5GA 4I6XA 4XRDA 4EE0A 1PA3A 2GZYA 3VWVA 3A5IA 1M9AA 3ZREA 3L9SA 1TRVA 2WGRA 4RI7A 2VL9A 4EVMA 4POKA 2LQQA 1J0FA 1V58A 2H72A 1EWXA 1TOFA 1YKAA 5EVOA 2IMEA 1ZGNA 1VF2A 2YWOA 4HU7A 3E3EA 1QGVA 4G0KA 5E59A 5DQYA 2P0GA 2K8VA 1QQ2A 2HRNA 2R3XA 3LW9A 2JADA 2XC2A 1FB0A 2CA8A 1JHBA 4IN0A 2H8LA 3TRXA 5IQYA 3TKRA 1ABAA 2IPAA 3EC3A 2P5QA 4FYBA 4RI6A 3VI7A 3DGQA 1M2BA 4OFMA 3KGKA 1YQ1A 3UBLA 3WT2A 3IC8A 1QUWA 3FZ5A 1BYEA 4RUVA 5KEJA 5DCHA 3Q18A 3VFIA 1Z5YE 2VCXA 1K0MA 4ECCA 1U6TA 4LMWA 5DALB 1A8YA 2YZHA 3I9V2 5ECQB 1FOVA 1GTBA 2MYGA 5KN0A 2X49A 5CO3A 3H1NA 2YWNA 1PMTA 4O5QA 3A2WA 5FT3A 1MD3A 2O7KA 2OADA 1TK5B 3RHCA 5JCGA 4I97A 4N0VA 3TOUA 4DEJA 5D73A 4K9ZA 2DKIA 3CQFA 5IMVA 4TR0A 4H86A 4TR4A 1EV4A 3IAM2 3P2AA 1JLVA 3FYGA 2H0GA 1F2EA 2CZ3A 5CREA 1AXDA 5LD0A 1QXHA 1UVZA 3P7XA 4OCFA 2KP1A 4OO4A 3WGDA 2GVPA 2O89A 3IE3A 4CY6A 2IFQB 3KH9A 3RHBA 2CQ9A 2QA1A 1AQXA 3KZQA 3RPPA 3VPQA 2C3NA 3QDNA 4AJ6A 4IELA 4MMMA 1FHEA 4MH2A 4WF4A 5GAPD 1A0FA 2ON7A 3F63A 2IL3A 4KUNA 2REMA 4JZQA 2J23A 4IW9A 5IMDA 4TN8A 1GLPA 3P90A 1EEMA 3I43A 4TR1A 3KM6A 3WGEA 4PQHA 3LYKA 2NTOA 3CBUA 5IOWA 5LNKe 1PSQA 1ZZYA 5DVBA 3VPTA 2KOKA 3MAKA 6GSWA 4J56E 4PUFC 4KF9A 1EGOA 1JZDA 1KBNA 3F3RA 6GSVA 1M9BA 2GTUA 3FR9A 5ECIB 4V1Ag 1TU7A 2DMMA 3C8EA 3BCKA 1FW1A 1TI3A 2YZUA 3HJPA 2PU9C 1GSSA 2L4QA 5A4WA 1UC7A 3NIVA 1EZKA 1SKSB 4ILFA 1X5CA 2H01A 3A3TA 4GRFA 3GKXA 2WCIA 2V1MA 1MEKA 2LTKA 2K8SA 4ECBA 4L5LA 4WETA 3I69A 5ECKB 4PXOA 1DSBA 2RUEA 3A2VA 5AIVA 1Z9HA 2LRTA 4KX4A 4TW5A 5B8BA 1GWCA 3CRUA 5HFGA 4DSRA 4ML1A 4E8HA 5EPFA 2VL3A 3KIJA 2I4AA 13GSA 2OKAA 5JWOB 5A4UA 2JACA 2A4HA 1T1VA 3GA4A 1GP1A 2JU5A 4NAXA 2L5LA 4KCAA 2BJXA 2IMKA 2LS5A 2C8UA 1MDJA 5KN3A 4ZBDA 2VCTA 3QAGA 2LQOA 2HT9A 5J5NA 4IHUA 3FY7A 2FWHA 4MNNA 3ZIJA 4XS1A 1SKRB 3DXBA 3LXTA 2HRFA 4BA7A 3GKNA 3GN3A 1PFOA 5JWRB 1OKTA 1S3RA 3HA9A 4TR3A 3C7MA 3CTGA 2XPEA 4G0IA 3GIXA 4TVEA 2YV7A 1SJZA 3TRPA 4JE1A 4MJAA 2DIZA 3IHGA 3IV4A 3LSZA 3GUSA 1FVKA 3F4SA 4K5RA 1YF0A 3MWHA 4KDYA 4J57E 4O5RA 2RIIA 5DCGA 4MPGA 2LNTA 5J9BA 4X43A 1XVWA 4EL1A 3D0ZA 4WKWA 6GSSA 1HNBA 3KTLA 4WR4A 1EP7A 2P31A 3D4TA 4MF6A 2YWIA 1KTEA 3GTUA 3FZAA 3HY2A 2DSAA 8GSSA 2EIRA 3IDVA 4Q5NA 1SD8A 4MABA 4TXOA 2V6OA 1DBYA 3CSJA 5ID2A 3ZZXA 3HKRA 2H75A 2HNLA 1Z6MA 3DVWA 2GQMA 1K0NA 5G5EA 3M8NA 2FCHA 3F3QA 3KJYA 3JCML 2H1AA 3E0UA 3TUEA 4PGTA 1Z3EA 2OA7A 4IJ3A 2R4VA 3IBHA 3CSIA 4ICYA 3APOA 4AGSA 4N30A 1XW5A 3DIEA 2CVBA 4HJMA 1XXUA 3GURA 4QL9A 1C72A 1AQVA 1ZOFA 2K9FA 3VWXA 1THXA 2H66A 3IK9A 2JL4A 1V40A 4FH8A 4BVXB 1TW9A 2OE0A 5F8BA 3W6GA 2OBIA 2B1LA 4GCIA 10GSA 1G0TA 3LFLA 2PMTA 3QOUA 1TRSA 2HSMA 4MP4A 2FY6A 2YP6A 4DVCA 2E2MA 2OE1A 4L8EA 3W8SA 4BL7A 4EC0A 3CRTA 1V9WA 2H71A 5JWQB 1CQGA 1GRXA 1QK8A 3QMXA 2Z9SA 1OE8A 5G1KA 3IOSA 3ZTLA 2QA2A 4GQFA 1JLWA 4K1FA 2QSIA 4K2XA 1KEBA 3HHVA 2KLXA 1PN0A 2C1YA 3KP9A 3F0IA 2FD3A 2LJKA 1A2LA 3LEFA 1T4ZA 2OACA 1TK0B 3RBTA 4OMVA 4K8MA 2OBKA 1HQOA 2HYXA 4G10A 1Q98A 5HR3A 1SK0A 4GSNA 3FR6A 3H4KA 3LWAA 5CRWA 1OE7A 1OC9A 2H74A 5G2ZA 5IM9A 4BWQA 5ENUA 1SKWB 2FUG2 2YCDA 1O6JA 4XS6A 2YWMA 2CAQA 2C0FA 2N5BA 2C0EA 3L78A 3GL5A 3GSSA 5J9CA 1B8XA 4ZL7A 4TOPA 3EU3A 5AN1A 2VD1A 5CYYA 3C1SA 5EL8A 17GSA 5ECPB 1JFUA 1BAYA 5IMFA 2HSHA 3HCZA 4IS0A 5A5KA 4OCEA 4CHSA 4FYUA 1FAAA 3MNGA 3M3MA 4I5QA 5C00A 2FA4A 2YOIA 2F8AA 1U88A 3QPMA 7GSSA 2A2SA 2X99A 5G30A 4JRRA 1NSWA 2G0FA 2B1KA 4HQZA 2BMXA 4ACSA 5ECRB 2BTOT 1RQMA 4K0GA 3O76A 3HVXA 2JZSA 4MJBA 4K7NA 4V2NA 4ZL9A 4I8BA 5G5FA 4I2TA 3F6DA 3TKSE 5B6NA 4PNFA 3D22A 1TXXA 2NDOA 2HRAA 1XPVA 4OO5A 2HLSA 3FZ4A 4F82A 4Z2RA 1NM3A 4Q5QA 5F0GA 4MCUA 2R0PA 2ZCTA 3TKSA 4JEDA 1F6MC 4FYCA 3VK9A 4G9HA 2VUPA 2JZRA 1V98A 4LLRA 3TRQA 3LQ7A 1HNAA 1ON4A 5AGYA 2GSQA 5CNWA 1TRUA 2C0GA 2LUSA 3UMAA 2H1BA 1SL1B 3WGXA 5IO2A 3IXRA 3HVVA 1URMA 2I3YA 3CTFA 3RDWA 3S9FA 5KN1A 2GT6A 1GUHA 2L5OA 3HDCA 4WF5A 1PD21 3APSA 1M0UA 1PGTA 4IQ1A 1GSYA 2A2PA 1MTCA 3KTBA 5COHA 4XS4A 3FHKA 2FWGA 2ALBA 5ECOB 5F06A 2DLXA 1ACVA 3KP8A 1XWKA 1PL2A 2X8GA 5HFIA 2UZ8A 1R26A 3A5WA 1ZCPA 2VL2A 4ZBBA 2E7PA 4V1Ap 1JZRA 3TJJA 1AIUA 2DJJA 2LSTA 4BVYA 1O85A 1K3YA 1K3LA 2YANA 2F3MA 4HJ2A 4F0CA 2ZNMA 1XW6A 2GZZA 1ERVA 1ZYEA 3GX8A 2L57A 18GSA 5IOXA 1TP9A 4ML6A 3EYTA 4LA1A 5ECSA 5J3RA 3A2XA 2HZFA 3IHQA 1K0BA 2N5AA 1B48A 3D4MA 5ECMB 3GTUB 5C04A 2CT6A 1CQHA 2ZUPA 3ME8A 12GSA 2MMOA 4TXOB 2O8VB 5ID2B 3GV1A 4HU9A 2WS2A 4E8EA 1EEJA 2H0HA 3KMNA 2N5FA 4KGIA 1PX7A 1IYIA 3FRCA 3LG6A 5GZZB 4MPFA 4OWYA 9GSSA 1E6BA 1ZYPA 3H79A 1JZOA 4PNGA 3VLNA 1SJ6A 2OE3A 1M2AA 2FHEA 3HVSA 2CVKA 3F8UA 2H73A 5ECLB 1YEXA 2PUKC 2YJ7A 3K8NA 1ZYNA 5GAND 2HSYA 3EWLA 2IWTA 1A8LA 2NPBA 3KD0A 4G2EA 4AF2A 5KOXA 2IJYA 5J41A 3G7JA 3C73A 4KAEA 2PBJA 2FGXA 3WYWA 3UVHA 2H70A 1Z6NA 2EIQA 1WRYA 4TRXA 4A5PA 1ST9A 2CZ2A 22GSA 2DJKA 3D21A 3ZVJA 3C1RA 5IO0A 1BX9A 1OVNA 2MMNA 4BL7B 1EOGA 2QGVA 5D9XA 5D96A 2DKHA 5FWGA 1TK8B 1HD2A 5LCZA 2X8HA 2WJUA 4J2FA 1XWBA 5H5QA 1GTAA 4ECJA 2VCQA 2CAIA 3ZLPA 1MDKA 1MDIA 1O8XA 2WULA 3Q19A 5DALA 1OYJA 4EUYA 1GUKA 3IA1A 4L5OA 4KW6A 5A4VA 3N5OA 11GSA 1YKCA 4HEA2 4BWSA 3VI5A 3WT1A 4NXIA 2R37A 3FW2A 3L9VA 5CRGA 3TCOA 3TKQA 1N2AA 2QKEA 1HNCA 4GTUA 2VAFA 5HR2A 3BOAA 3EMXA 3GH9A 6GSUA 5J4UA 1F3BA 1B4QA 2RM6A 3PH9A 1DE2A 2EIOA 1YZXA 4O92A 3HJOA 3SBCA 3ZRDA 2HZEB 3EE2A 5HFKA 1X5EA 3U6VA 1YY7A 1GLQA 2V41A 4IVFA 4POBA 4PX1A 3ZFBA 4JU5A 5D93A 3LJRA 1AAZA 5DAKA 2H76A 3APQA 5IPGA 1Z7PA 2KUCA 3QFBC 1GNEA 4YKFA 4HDEA 4L0WA 2EC4A 5ECNB 19GSA 2DJ1A 1PKWA 1BEDA 4KDXA 1GL8A 4MJEA 4KB3A 3KXOA 3DMLA 1KNGA 1S3AA 5IMCA 1PL1A 2HI7A 4GWRA 3UAPA 1F9MA 1WIKA 4KNDA 4PURA 1F3AA 4LL1B 2VLVA 2QC7A 4K0NA 4Z2UA 3TGZA 2VM1A 1WE0A 2AYTA 4WEYA 2C3TA 3CSHA 3G7IA 4EIPA 2L6DA 3VWWA 20GSA 2AUVA 2IIYA 1K0DA 3IPZA 3GL3A 1A24A 1SJIA 4JBBA 1XZOA 2HRKA 4POMA 2YJHA 4X4JA 2MMAA 1O8WA 3QCPA 1RK4A 2B6MA 1O73A 2XBQA 2NBSA 3D5JA 3FKFA 5AIXA 2H6XA 4ZB9A 1SENA 5H5RA 3IAS2 3C71A 1WP0A 2GQKA 4NMUA 3SWLA 2MMZA 2DIYA 4GXZA 3KEBA 4KSOA 3QAWA 2O87A 3M9JA 4TKYA 1SYXA 1B4PA 1ERWA 4KA0A 1AC1A 2L6CA 5F05A 2VD0A 4IQAA 2H1DA 5L71A 3UIWA 1ZL9A 3EVIA 2VLTA 4XS4B 2TRCP 1K0OA 1IYHA 3PPUA 4ZL8A 2DJ0A 1VF1A 3ED3A 3DVXA 4MH3A 2NVLA 4IGJA 1WMJA 4DSQA 2R2JA 4BVYB 2F8FA 1SL2B 1U3AA 3F4TA 2PWJA 2KHPA 3UOMA 1X5DA 2V2GA 2YV9A 1ZMAA 4IBPA 1M3JA 3TJGA 1EP8A 1XWGA 3BCIA 4NV2A 1LU4A 2PERA 2M72A 2LRCA 1SK1A 3Q74A 1R5AA 2HXKA 4OFNA 4ECIA 5DQSA 5EY6A 3TB2A 4QQ7A 6GSTA 1OC8A 3TOTA 1NHYA 3GKMA 3TJFA 4TR1B 3DD3A 3DYRA 4NHWA 1TI1A 2R0CA 3ZVJD 5CP1A 1T00A 1FO5A 2FWFA 4NV5A 2I81A 4AJ7A 1V2AA 4HQSA 1GTUA 6GSYA 4KH7A 16GSA 3NZNA 4V2LA 5IMZA 4X1UA 3ZIVA 3DKSA 3LXZA 1GULA 3FR3A 5FHIA 5D9VA 4K5SA 2H6YA 3VWUA 1V57A 1ML6A 1B9YC 5KN2A 2FA8A 4QL7A 4V2MA 1I9DA 2LNSA 3QFAC 5GSTA 1OKDA 4IP6A 2R6KA 5DJLA 2CX3A 3US3A 5IMAA 2JZTA 4BPYA 4XCSA 4WBRD 3ME7A 4PQIA 2GZPA 4MK3A 1G7EA 1SU9A 4Z7XA 1T3BA 4D73A 3CMIA 2H0IA 3PINA 1M3IA 5KOWA 3OR5A 1X9SB 3HD5A 3IK7A 1DUGA 4OFTA 3KH7A 1GSUA 1GTIA 3F4RA 1VF3A 1VF4A 4MF5A 5G1LA 1G6WA 4DSSA 4YAVA 5D9TA 1S3DA 3VURA 3ZL5A 3R3EA 4ZB6A 3M1GA 3U5RE 2TRXA 4I2UA 1K0AA 1WPIA 2KP2A 4CW9A 3G9BA 1U3IA 4GSTA 4BVXA 2PVOC 1FG4A 2H6ZA 1BJXA 1XIYA 4N10A 2F9SA 1GNWA 2RM5A 2XPDA 4XIHA 1W4VA 4GF0A 3EU4A 1SD9A 2FNOA 1H75A 2I9HA 4ISDA 1ILOA 4ULXA 3CYNA 3ERGA 2FLSA 3NOFA 1XW9A 5DDLA 3PGTA 1ZYQB 3EMPA 2CV4A 1ERUA 4EO3A 4EKZA 4OD7A 2IMDA 1EGRA 3IRAA 5G31A 3CXGA 4K2DA 5HR1A 4G0LA 2O85A 3F6FA 1M99A 3HZ4A 5DAKB 2WB9A 1R7HA 1PKZA 3G7YA 1BQ7A 3HZ8A 1N8JA 5INYA 2GLRA 3UARA 2G2QA 4WR5A 2GSRA 2ON5A 4O32A 1NHOA 1E2YA 2L4CA 2JSYA 5B8AA 1TDIA 4ZBAA 1A2JA 3P8WA 4RQXA 4K7OA 1XCCA 2P5RA 4NHZA 5CRDA 4EXJA 4ID0A 2I1UA 1MD4A 2M80A 3QD9A 1XOBA 3MDKA 1QFNA 4JR4A 1EOHA 2AJQB 2HE3A 4L0UA 4HS1A 5BMUA 1RW1A 4HOJA 1A0RP 3W8JA 1U87A 2PPTA 5ELAA 14GSA 3MYDA 2VO4A 3J7Yb 3UL3A 5DBQA 2LJAA 1SK2A 2GSSA 1TU8A 4ZXGA 2WDUA 1Y25A 1PQNA 2AHEA 2PN8A 3LORA 1XFLA 3UJ1A 3GNJA 4JR6A 2OJLA 1EV9A 4MJCA 2IN3A 2GQLA 4WXTA 4O5UA 1X9MB 2K18A 5B6MA 1X0RA 3HVNA 2LEGA 2C4JA 3N9JA 1JZWA 2GGTA 1TRWA 2IMIA 4IP1A 3RAZA 3H8QA 5CAXA 5IIZA 3BD2A 5D9WA 1Q4JA 4NWYA 4EIQA 3FK8A 3TJKA 5HQPA 3F9UA 1XWAA 5H5SA 5DJMA 2VCZA 3L4NA 3V1WA 3BJ5A 4HI7A 4LMVA 4YQVA 2DJ2A 4Q5FA 5E4WA 1TJDA 2YPMA 1O7UA 2MZCA 2CVDA 4O7HA 1YJ6A 3TKSC 3HYPA 1TKDB 2K6VA 4AJ8A 2C3QA 3GYKA 3ERFA 3QAVA 3ISOA 2YNXA 3PR8A 1GSFA 4POLA 2AAWA 2B5EA 3J7Yk 2J9HA 5JCUA 1OAZA 4YQMA 1W89A 5ABRA 4XRAA 1BG5A 1K3OA 3ZYWA 3EURA 4NPBA 2B7KA 4FIWA 1WWJA 3H93A 1HYUA 3EPTA 2B5YA 1OC9B 1GSEA 1S3CA 2LJRA 5GSSA 4Q5RA 1UA5A 1QMVA 2AB6A 2DC5A 1LBKA 2WZ9A 2A4VA 3GHAA 4HZ4A 2VCWA 2HFDA 4K7IA 2E2GA 2R0GA 4KE3A 2VL2C 3L9UA 2GT5A 5IPHA 2LKUA 2H1GA 1AW9A 4ZB8A 2M46A 3O3TA 4KCEA 1Y6EA 3AY8A 4WBJA 2GSTA 3LYPA 4N11A 1XBSA 1YF1A 2C80A 5AISA 1T8EB 2IFQA 2PGTA 3BBYA 2VOCA 4MLYA 4KSMA
chains in the Genus database with same CATH topology
1PN9A 3HXSA 3GSTA 2B3SA 4LL4B 5F07A 4CDOA 1GH2A 1B9XC 4PQ1A 4MDCA 4HUAA 1USBA 1M7TA 3EINA 2CX4A 4XTSA 1LJRA 3IR4A 1F37A 4GSSA 1XOAA 3UEMA 5CRHA 2FWEA 3MSZA 4PTSA 3FEUA 4USSA 2RLIA 1XWCA 1UN2A 2H30A 2IMFA 3I6AA 4K6XA 6GSXA 2WRTA 3DEXA 3IC4A 2X8CA 3ZFLA 2LV3A 1DE1A 2VIMA 1PX6A 4IJIA 1H4OA 1THOA 4F9ZA 3FMWA 4ZIJA 3Q6OA 2WFCA 2B5XA 4FO5A 3ZMLA 3MIXA 4YKGA 2AV4A 3WD6A 5BRTA 4D73B 1T7PB 2VLUA 2JSZA 3HJMA 5ECHB 1AUCA 2A2RA 3M9KA 1YDKA 3KCMA 2DMLA 2L59A 1TTZA 1A2MA 3TDGA 4CY8A 1K0CA 5ELGA 1T4YA 2E0QA 1R5PA 4DSSB 3LGCA 3DWVA 5HR0A 2LRNA 1X9WB 1FOHA 1J9BA 1FVJA 2MBTA 1NW2A 4EDYA 3QR6A 3L0HA 1G7OA 1Z7RA 2XHFA 4MZCA 2X64A 3GFKA 3M0FA 3UVTA 4MZWA 4EF0A 4IKHA 2GDRA 2X4AA 2V32A 3GKKA 1FB6A 4MF7A 2ES7A 3UBKA 2XBIA 1GUMA 3TKPA 4YH2A 2F51A 4F03A 1ERTA 3KMOA 1VGLA 5JCWA 5D8IA 1AQWA 4KDUA 4X0XA 4EDZA 4YAPA 4FQUA 1XVQA 3GMFA 3R2QA 2MBSA 2D2ZA 4YQUA 1A23A 3GX0A 4GLTA 3E9JB 2DBCA 1O81A 4P3YB 3RPNA 4F2IA 1PRXA 1OC3A 1YEPA 1J08A 4Z2TA 3DRNA 4RQRA 2PVQA 3GH6A 4F0BA 4ZILA 1SL0B 2TIRA 1M2DA 4G19A 4MA9A 2YN1A 2VM2A 1GSQA 4N0ZA 4HZ2A 2R5GA 2DJ3A 2B7JA 3O6TA 3D6IA 1WJKA 2HZEA 5B7CA 1WOUA 1R4WA 1G6YA 2C0DA 2GS3A 1VRSD 1GSDA 3FZ9A 4GQCA 4PUAA 1SYRA 3ZITA 3ERWA 3ZMKA 2V6KA 2VCVA 2RUFA 4TXVA 3TJBA 4XHMA 2H19A 4MZBA 3GRXA 1I5GA 4I6XA 4XRDA 4EE0A 1PA3A 2GZYA 3VWVA 3A5IA 1M9AA 3ZREA 3L9SA 1TRVA 2WGRA 4RI7A 2VL9A 4EVMA 4POKA 2LQQA 1J0FA 1V58A 2H72A 1EWXA 1TOFA 1YKAA 5EVOA 2IMEA 1ZGNA 1VF2A 2YWOA 4HU7A 3E3EA 1QGVA 4G0KA 5E59A 5DQYA 2P0GA 2K8VA 1QQ2A 2HRNA 2R3XA 3LW9A 2JADA 2XC2A 1FB0A 2CA8A 1JHBA 4IN0A 2H8LA 3TRXA 5IQYA 3TKRA 1ABAA 2IPAA 3EC3A 2P5QA 4FYBA 4RI6A 3VI7A 3DGQA 1M2BA 4OFMA 3KGKA 1YQ1A 3UBLA 3WT2A 3IC8A 1QUWA 3FZ5A 1BYEA 4RUVA 5KEJA 5DCHA 3Q18A 3VFIA 1Z5YE 2VCXA 1K0MA 4ECCA 1U6TA 4LMWA 5DALB 1A8YA 2YZHA 3I9V2 5ECQB 1FOVA 1GTBA 2MYGA 5KN0A 2X49A 5CO3A 3H1NA 2YWNA 1PMTA 4O5QA 3A2WA 5FT3A 1MD3A 2O7KA 2OADA 1TK5B 3RHCA 5JCGA 4I97A 4N0VA 3TOUA 4DEJA 5D73A 4K9ZA 2DKIA 5IMVA 4TR0A 4H86A 4TR4A 1EV4A 3IAM2 3P2AA 1JLVA 3FYGA 2H0GA 1F2EA 2CZ3A 5CREA 1AXDA 5LD0A 1QXHA 1UVZA 3P7XA 4OCFA 2KP1A 4OO4A 3WGDA 2GVPA 2O89A 3IE3A 4CY6A 2IFQB 3KH9A 3RHBA 2CQ9A 2QA1A 1AQXA 3KZQA 3RPPA 3VPQA 2C3NA 3QDNA 4AJ6A 4IELA 4MMMA 1FHEA 4MH2A 4WF4A 5GAPD 1A0FA 2ON7A 3F63A 2IL3A 4KUNA 2REMA 4JZQA 2J23A 4IW9A 5IMDA 4TN8A 1GLPA 3P90A 1EEMA 3I43A 4TR1A 3KM6A 3WGEA 4PQHA 3LYKA 2NTOA 3CBUA 5IOWA 5LNKe 1PSQA 1ZZYA 5DVBA 3VPTA 2KOKA 3MAKA 6GSWA 4J56E 4PUFC 4KF9A 1EGOA 1JZDA 1KBNA 3F3RA 6GSVA 1M9BA 2GTUA 3FR9A 5ECIB 4V1Ag 1TU7A 2DMMA 3C8EA 3BCKA 1FW1A 1TI3A 2YZUA 3HJPA 2PU9C 1GSSA 2L4QA 5A4WA 1UC7A 3NIVA 1EZKA 1SKSB 4ILFA 1X5CA 2H01A 3A3TA 4GRFA 3GKXA 2WCIA 2V1MA 1MEKA 2LTKA 2K8SA 4ECBA 4L5LA 4WETA 3I69A 5ECKB 4PXOA 1DSBA 2RUEA 3A2VA 5AIVA 1Z9HA 2LRTA 4KX4A 4TW5A 5B8BA 1GWCA 3CRUA 5HFGA 4DSRA 4ML1A 4E8HA 5EPFA 2VL3A 3KIJA 2I4AA 13GSA 2OKAA 5JWOB 5A4UA 2JACA 2A4HA 1T1VA 3GA4A 1GP1A 2JU5A 4NAXA 2L5LA 4KCAA 2BJXA 2IMKA 2LS5A 2C8UA 1MDJA 5KN3A 4ZBDA 2VCTA 3QAGA 2LQOA 2HT9A 5J5NA 4IHUA 3FY7A 2FWHA 4MNNA 3ZIJA 4XS1A 1SKRB 3DXBA 3LXTA 2HRFA 4BA7A 3GKNA 3GN3A 5JWRB 1OKTA 3HA9A 4TR3A 3C7MA 3CTGA 2XPEA 4G0IA 3GIXA 4TVEA 2YV7A 1SJZA 3TRPA 4JE1A 4MJAA 2DIZA 3IHGA 3IV4A 3LSZA 3GUSA 1FVKA 3F4SA 4K5RA 1YF0A 3MWHA 4KDYA 4J57E 4O5RA 2RIIA 5DCGA 4MPGA 2LNTA 5J9BA 4X43A 1XVWA 4EL1A 3D0ZA 4WKWA 6GSSA 1HNBA 3KTLA 4WR4A 1EP7A 2P31A 3D4TA 4MF6A 2YWIA 1KTEA 3GTUA 3FZAA 3HY2A 2DSAA 8GSSA 2EIRA 3IDVA 4Q5NA 1SD8A 4MABA 4TXOA 2V6OA 1DBYA 3CSJA 5ID2A 3ZZXA 3HKRA 2H75A 2HNLA 1Z6MA 3DVWA 2GQMA 1K0NA 5G5EA 3M8NA 2FCHA 3F3QA 3KJYA 3JCML 2H1AA 3E0UA 3TUEA 4PGTA 1Z3EA 2OA7A 4IJ3A 2R4VA 3IBHA 3CSIA 4ICYA 3APOA 4AGSA 4N30A 1XW5A 3DIEA 2CVBA 4HJMA 1XXUA 3GURA 4QL9A 1C72A 1AQVA 1ZOFA 2K9FA 3VWXA 1THXA 2H66A 3IK9A 2JL4A 1V40A 4FH8A 4BVXB 1TW9A 2OE0A 5F8BA 3W6GA 2OBIA 2B1LA 4GCIA 10GSA 1G0TA 3LFLA 2PMTA 3QOUA 1TRSA 2HSMA 4MP4A 2FY6A 2YP6A 4DVCA 2E2MA 2OE1A 4L8EA 3W8SA 4BL7A 4EC0A 3CRTA 1V9WA 2H71A 5JWQB 1CQGA 1GRXA 1QK8A 3QMXA 2Z9SA 1OE8A 5G1KA 3IOSA 3ZTLA 2QA2A 4GQFA 1JLWA 4K1FA 2QSIA 4K2XA 1KEBA 3HHVA 2KLXA 1PN0A 2C1YA 3KP9A 3F0IA 2FD3A 2LJKA 1A2LA 3LEFA 1T4ZA 2OACA 1TK0B 3RBTA 4OMVA 4K8MA 2OBKA 1HQOA 2HYXA 4G10A 1Q98A 5HR3A 1SK0A 4GSNA 3FR6A 3H4KA 3LWAA 5CRWA 1OE7A 1OC9A 2H74A 5G2ZA 5IM9A 4BWQA 5ENUA 1SKWB 2FUG2 2YCDA 1O6JA 4XS6A 2YWMA 2CAQA 2C0FA 2N5BA 2C0EA 3L78A 3GL5A 3GSSA 5J9CA 1B8XA 4ZL7A 4TOPA 3EU3A 5AN1A 2VD1A 5CYYA 3C1SA 5EL8A 17GSA 5ECPB 1JFUA 1BAYA 5IMFA 2HSHA 3HCZA 4IS0A 5A5KA 4OCEA 4CHSA 4FYUA 1FAAA 3MNGA 3M3MA 4I5QA 5C00A 2FA4A 2YOIA 2F8AA 1U88A 3QPMA 7GSSA 2A2SA 2X99A 5G30A 4JRRA 1NSWA 2G0FA 2B1KA 4HQZA 2BMXA 4ACSA 5ECRB 2BTOT 1RQMA 4K0GA 3O76A 3HVXA 2JZSA 4MJBA 4K7NA 4V2NA 4ZL9A 4I8BA 5G5FA 4I2TA 3F6DA 3TKSE 5B6NA 4PNFA 3D22A 1TXXA 2NDOA 2HRAA 1XPVA 4OO5A 2HLSA 3FZ4A 4F82A 4Z2RA 1NM3A 4Q5QA 5F0GA 4MCUA 2R0PA 2ZCTA 3TKSA 4JEDA 1F6MC 4FYCA 3VK9A 4G9HA 2VUPA 2JZRA 1V98A 4LLRA 3TRQA 3LQ7A 1HNAA 1ON4A 5AGYA 2GSQA 5CNWA 1TRUA 2C0GA 2LUSA 3UMAA 2H1BA 1SL1B 3WGXA 5IO2A 3IXRA 3HVVA 1URMA 2I3YA 3CTFA 3RDWA 3S9FA 5KN1A 2GT6A 1GUHA 2L5OA 3HDCA 4WF5A 1PD21 3APSA 1M0UA 1PGTA 4IQ1A 1GSYA 2A2PA 1MTCA 3KTBA 5COHA 4XS4A 3FHKA 2FWGA 2ALBA 5ECOB 5F06A 2DLXA 1ACVA 3KP8A 1XWKA 1PL2A 2X8GA 5HFIA 2UZ8A 1R26A 3A5WA 1ZCPA 2VL2A 4ZBBA 2E7PA 4V1Ap 1JZRA 3TJJA 1AIUA 2DJJA 2LSTA 4BVYA 1O85A 1K3YA 1K3LA 2YANA 2F3MA 4HJ2A 4F0CA 2ZNMA 1XW6A 2GZZA 1ERVA 1ZYEA 3GX8A 2L57A 18GSA 5IOXA 1TP9A 4ML6A 3EYTA 4LA1A 5ECSA 5J3RA 3A2XA 2HZFA 3IHQA 1K0BA 2N5AA 1B48A 3D4MA 5ECMB 3GTUB 5C04A 2CT6A 1CQHA 2ZUPA 3ME8A 12GSA 2MMOA 4TXOB 2O8VB 5ID2B 3GV1A 4HU9A 2WS2A 4E8EA 1EEJA 2H0HA 3KMNA 2N5FA 4KGIA 1PX7A 1IYIA 3FRCA 3LG6A 5GZZB 4MPFA 4OWYA 9GSSA 1E6BA 1ZYPA 3H79A 1JZOA 4PNGA 3VLNA 1SJ6A 2OE3A 1M2AA 2FHEA 3HVSA 2CVKA 3F8UA 2H73A 5ECLB 1YEXA 2PUKC 2YJ7A 3K8NA 1ZYNA 5GAND 2HSYA 3EWLA 2IWTA 1A8LA 2NPBA 3KD0A 4G2EA 4AF2A 5KOXA 2IJYA 5J41A 3G7JA 3C73A 4KAEA 2PBJA 2FGXA 3WYWA 3UVHA 2H70A 1Z6NA 2EIQA 1WRYA 4TRXA 4A5PA 1ST9A 2CZ2A 22GSA 2DJKA 3D21A 3ZVJA 3C1RA 5IO0A 1BX9A 1OVNA 2MMNA 4BL7B 1EOGA 2QGVA 5D9XA 5D96A 2DKHA 5FWGA 1TK8B 1HD2A 5LCZA 2X8HA 2WJUA 4J2FA 1XWBA 5H5QA 1GTAA 4ECJA 2VCQA 2CAIA 3ZLPA 1MDKA 1MDIA 1O8XA 2WULA 3Q19A 5DALA 1OYJA 4EUYA 1GUKA 3IA1A 4L5OA 4KW6A 5A4VA 3N5OA 11GSA 1YKCA 4HEA2 4BWSA 3VI5A 3WT1A 4NXIA 2R37A 3FW2A 3L9VA 5CRGA 3TCOA 3TKQA 1N2AA 2QKEA 1HNCA 4GTUA 2VAFA 5HR2A 3BOAA 3EMXA 3GH9A 6GSUA 5J4UA 1F3BA 1B4QA 2RM6A 3PH9A 1DE2A 2EIOA 1YZXA 4O92A 3HJOA 3SBCA 3ZRDA 2HZEB 3EE2A 5HFKA 1X5EA 3U6VA 1YY7A 1GLQA 2V41A 4IVFA 4POBA 4PX1A 3ZFBA 4JU5A 5D93A 3LJRA 1AAZA 5DAKA 2H76A 3APQA 5IPGA 1Z7PA 2KUCA 3QFBC 1GNEA 4YKFA 4HDEA 4L0WA 2EC4A 5ECNB 19GSA 2DJ1A 1PKWA 1BEDA 4KDXA 1GL8A 4MJEA 4KB3A 3KXOA 3DMLA 1KNGA 1S3AA 5IMCA 1PL1A 2HI7A 4GWRA 3UAPA 1F9MA 1WIKA 4KNDA 4PURA 1F3AA 4LL1B 2VLVA 2QC7A 4K0NA 4Z2UA 3TGZA 2VM1A 1WE0A 2AYTA 4WEYA 2C3TA 3CSHA 3G7IA 4EIPA 2L6DA 3VWWA 20GSA 2AUVA 2IIYA 1K0DA 3IPZA 3GL3A 1A24A 1SJIA 4JBBA 1XZOA 2HRKA 4POMA 2YJHA 4X4JA 2MMAA 1O8WA 3QCPA 1RK4A 2B6MA 1O73A 2XBQA 2NBSA 3D5JA 3FKFA 5AIXA 2H6XA 4ZB9A 1SENA 5H5RA 3IAS2 3C71A 1WP0A 2GQKA 4NMUA 3SWLA 2MMZA 2DIYA 4GXZA 3KEBA 4KSOA 3QAWA 2O87A 3M9JA 4TKYA 1SYXA 1B4PA 1ERWA 4KA0A 1AC1A 2L6CA 5F05A 2VD0A 4IQAA 2H1DA 5L71A 3UIWA 1ZL9A 3EVIA 2VLTA 4XS4B 2TRCP 1K0OA 1IYHA 3PPUA 4ZL8A 2DJ0A 1VF1A 3ED3A 3DVXA 4MH3A 2NVLA 4IGJA 1WMJA 4DSQA 2R2JA 4BVYB 2F8FA 1SL2B 1U3AA 3F4TA 2PWJA 2KHPA 3UOMA 1X5DA 2V2GA 2YV9A 1ZMAA 4IBPA 3TJGA 1EP8A 1XWGA 3BCIA 4NV2A 1LU4A 2PERA 2M72A 2LRCA 1SK1A 3Q74A 1R5AA 2HXKA 4OFNA 4ECIA 5DQSA 5EY6A 3TB2A 4QQ7A 6GSTA 1OC8A 3TOTA 1NHYA 3GKMA 3TJFA 4TR1B 3DD3A 3DYRA 4NHWA 1TI1A 2R0CA 3ZVJD 5CP1A 1T00A 1FO5A 2FWFA 4NV5A 2I81A 4AJ7A 1V2AA 4HQSA 1GTUA 6GSYA 4KH7A 16GSA 3NZNA 4V2LA 5IMZA 4X1UA 3ZIVA 3DKSA 3LXZA 1GULA 3FR3A 5FHIA 5D9VA 4K5SA 2H6YA 3VWUA 1V57A 1ML6A 1B9YC 5KN2A 2FA8A 4QL7A 4V2MA 1I9DA 2LNSA 3QFAC 5GSTA 1OKDA 4IP6A 2R6KA 5DJLA 2CX3A 3US3A 5IMAA 2JZTA 4BPYA 4XCSA 4WBRD 3ME7A 4PQIA 2GZPA 4MK3A 1G7EA 1SU9A 4Z7XA 1T3BA 4D73A 3CMIA 2H0IA 3PINA 5KOWA 3OR5A 1X9SB 3HD5A 3IK7A 1DUGA 4OFTA 3KH7A 1GSUA 1GTIA 3F4RA 1VF3A 1VF4A 4MF5A 5G1LA 1G6WA 4DSSA 4YAVA 5D9TA 1S3DA 3VURA 3ZL5A 3R3EA 4ZB6A 3M1GA 3U5RE 2TRXA 4I2UA 1K0AA 1WPIA 2KP2A 4CW9A 3G9BA 1U3IA 4GSTA 4BVXA 2PVOC 1FG4A 2H6ZA 1BJXA 1XIYA 4N10A 2F9SA 1GNWA 2RM5A 2XPDA 4XIHA 1W4VA 4GF0A 3EU4A 1SD9A 2FNOA 1H75A 2I9HA 4ISDA 1ILOA 4ULXA 3CYNA 3ERGA 2FLSA 3NOFA 1XW9A 5DDLA 3PGTA 1ZYQB 3EMPA 2CV4A 1ERUA 4EO3A 4EKZA 4OD7A 2IMDA 1EGRA 3IRAA 5G31A 3CXGA 4K2DA 5HR1A 4G0LA 2O85A 3F6FA 1M99A 3HZ4A 5DAKB 2WB9A 1R7HA 1PKZA 3G7YA 1BQ7A 3HZ8A 1N8JA 5INYA 2GLRA 3UARA 2G2QA 4WR5A 2GSRA 2ON5A 4O32A 1NHOA 1E2YA 2L4CA 2JSYA 5B8AA 1TDIA 4ZBAA 1A2JA 3P8WA 4RQXA 4K7OA 1XCCA 2P5RA 4NHZA 5CRDA 4EXJA 4ID0A 2I1UA 1MD4A 2M80A 3QD9A 1XOBA 3MDKA 1QFNA 4JR4A 1EOHA 2AJQB 2HE3A 4L0UA 4HS1A 5BMUA 1RW1A 4HOJA 1A0RP 3W8JA 1U87A 2PPTA 5ELAA 14GSA 3MYDA 2VO4A 3J7Yb 3UL3A 5DBQA 2LJAA 1SK2A 2GSSA 1TU8A 4ZXGA 2WDUA 1Y25A 1PQNA 2AHEA 2PN8A 3LORA 1XFLA 3UJ1A 3GNJA 4JR6A 2OJLA 1EV9A 4MJCA 2IN3A 2GQLA 4WXTA 4O5UA 1X9MB 2K18A 5B6MA 1X0RA 2LEGA 2C4JA 3N9JA 1JZWA 2GGTA 1TRWA 2IMIA 4IP1A 3RAZA 3H8QA 5CAXA 5IIZA 3BD2A 5D9WA 1Q4JA 4NWYA 4EIQA 3FK8A 3TJKA 5HQPA 3F9UA 1XWAA 5H5SA 5DJMA 2VCZA 3L4NA 3V1WA 3BJ5A 4HI7A 4LMVA 4YQVA 2DJ2A 4Q5FA 5E4WA 1TJDA 2YPMA 1O7UA 2MZCA 2CVDA 4O7HA 1YJ6A 3TKSC 3HYPA 1TKDB 2K6VA 4AJ8A 2C3QA 3GYKA 3ERFA 3QAVA 3ISOA 2YNXA 3PR8A 1GSFA 4POLA 2AAWA 2B5EA 3J7Yk 2J9HA 5JCUA 1OAZA 4YQMA 1W89A 5ABRA 4XRAA 1BG5A 1K3OA 3ZYWA 3EURA 4NPBA 2B7KA 4FIWA 1WWJA 3H93A 1HYUA 3EPTA 2B5YA 1OC9B 1GSEA 1S3CA 2LJRA 5GSSA 4Q5RA 1UA5A 1QMVA 2AB6A 2DC5A 1LBKA 2WZ9A 2A4VA 3GHAA 4HZ4A 2VCWA 2HFDA 4K7IA 2E2GA 2R0GA 4KE3A 2VL2C 3L9UA 2GT5A 5IPHA 2LKUA 2H1GA 1AW9A 4ZB8A 2M46A 3O3TA 4KCEA 1Y6EA 3AY8A 4WBJA 2GSTA 3LYPA 4N11A 1XBSA 1YF1A 2C80A 5AISA 1T8EB 2IFQA 2PGTA 3BBYA 2VOCA 4MLYA 4KSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PN9 A;  3HXS A;  3GST A;  2B3S A;  4LL4 B;  5F07 A;  4CDO A;  1GH2 A;  1B9X C;  4PQ1 A;  4MDC A;  4HUA A;  1USB A;  1M7T A;  3EIN A;  2CX4 A;  4XTS A;  1LJR A;  3IR4 A;  1F37 A;  4GSS A;  1XOA A;  3UEM A;  5CRH A;  2FWE A;  3MSZ A;  3FEU A;  2RLI A;  1XWC A;  1UN2 A;  2H30 A;  2IMF A;  3I6A A;  4K6X A;  6GSX A;  2WRT A;  3DEX A;  3IC4 A;  2X8C A;  3ZFL A;  2LV3 A;  1DE1 A;  2VIM A;  1PX6 A;  4IJI A;  1H4O A;  1THO A;  4F9Z A;  4ZIJ A;  3Q6O A;  2WFC A;  2B5X A;  4FO5 A;  3ZML A;  2AV4 A;  3WD6 A;  4D73 B;  1T7P B;  2VLU A;  2JSZ A;  3HJM A;  5ECH B;  1AUC A;  2A2R A;  3M9K A;  1YDK A;  3KCM A;  2DML A;  2L59 A;  1TTZ A;  1A2M A;  3TDG A;  1K0C A;  5ELG A;  1T4Y A;  2E0Q A;  1R5P A;  4DSS B;  3LGC A;  3DWV A;  5HR0 A;  2LRN A;  1X9W B;  1J9B A;  1FVJ A;  2MBT A;  1NW2 A;  4EDY A;  3QR6 A;  3L0H A;  1G7O A;  1Z7R A;  2XHF A;  4MZC A;  2X64 A;  3GFK A;  3M0F A;  3UVT A;  4MZW A;  4EF0 A;  4IKH A;  2GDR A;  2V32 A;  3GKK A;  1FB6 A;  4MF7 A;  2ES7 A;  3UBK A;  2XBI A;  1GUM A;  3TKP A;  4YH2 A;  2F51 A;  4F03 A;  1ERT A;  3KMO A;  1VGL A;  5JCW A;  5D8I A;  1AQW A;  4KDU A;  4X0X A;  4EDZ A;  4YAP A;  1XVQ A;  3GMF A;  3R2Q A;  2MBS A;  2D2Z A;  4YQU A;  1A23 A;  3GX0 A;  4GLT A;  3E9J B;  2DBC A;  1O81 A;  4P3Y B;  3RPN A;  4F2I A;  1PRX A;  1OC3 A;  1YEP A;  1J08 A;  3DRN A;  4RQR A;  2PVQ A;  3GH6 A;  4F0B A;  4ZIL A;  1SL0 B;  2TIR A;  1M2D A;  4G19 A;  4MA9 A;  2YN1 A;  2VM2 A;  1GSQ A;  4N0Z A;  4HZ2 A;  2R5G A;  2DJ3 A;  2B7J A;  3O6T A;  3D6I A;  1WJK A;  2HZE A;  5B7C A;  1WOU A;  1R4W A;  1G6Y A;  2C0D A;  2GS3 A;  1VRS D;  1GSD A;  3FZ9 A;  4GQC A;  4PUA A;  1SYR A;  3ZIT A;  3ERW A;  3ZMK A;  2V6K A;  2VCV A;  2RUF A;  4TXV A;  3TJB A;  4XHM A;  2H19 A;  4MZB A;  3GRX A;  1I5G A;  4I6X A;  4XRD A;  4EE0 A;  1PA3 A;  2GZY A;  3VWV A;  1M9A A;  3ZRE A;  3L9S A;  1TRV A;  2WGR A;  4RI7 A;  2VL9 A;  4EVM A;  4POK A;  2LQQ A;  1J0F A;  1V58 A;  2H72 A;  1EWX A;  1TOF A;  1YKA A;  5EVO A;  2IME A;  1ZGN A;  1VF2 A;  2YWO A;  4HU7 A;  3E3E A;  1QGV A;  5E59 A;  5DQY A;  2P0G A;  2K8V A;  1QQ2 A;  2HRN A;  2R3X A;  2JAD A;  2XC2 A;  1FB0 A;  2CA8 A;  1JHB A;  4IN0 A;  2H8L A;  3TRX A;  5IQY A;  3TKR A;  1ABA A;  2IPA A;  3EC3 A;  2P5Q A;  4FYB A;  4RI6 A;  3VI7 A;  3DGQ A;  1M2B A;  4OFM A;  3KGK A;  1YQ1 A;  3UBL A;  3WT2 A;  1QUW A;  3FZ5 A;  1BYE A;  4RUV A;  5KEJ A;  5DCH A;  3Q18 A;  3VFI A;  1Z5Y E;  2VCX A;  1K0M A;  4ECC A;  1U6T A;  4LMW A;  5DAL B;  1A8Y A;  2YZH A;  3I9V 2;  5ECQ B;  1FOV A;  1GTB A;  2MYG A;  5KN0 A;  5CO3 A;  3H1N A;  2YWN A;  1PMT A;  3A2W A;  5FT3 A;  1MD3 A;  2O7K A;  2OAD A;  1TK5 B;  3RHC A;  5JCG A;  4I97 A;  4N0V A;  3TOU A;  4DEJ A;  5D73 A;  4K9Z A;  5IMV A;  4TR0 A;  4H86 A;  4TR4 A;  1EV4 A;  3IAM 2;  3P2A A;  1JLV A;  3FYG A;  2H0G A;  1F2E A;  2CZ3 A;  5CRE A;  1AXD A;  5LD0 A;  1QXH A;  1UVZ A;  3P7X A;  4OCF A;  2KP1 A;  4OO4 A;  3WGD A;  2GVP A;  2O89 A;  3IE3 A;  2IFQ B;  3KH9 A;  3RHB A;  2CQ9 A;  1AQX A;  3KZQ A;  3RPP A;  3VPQ A;  2C3N A;  3QDN A;  4AJ6 A;  4IEL A;  4MMM A;  1FHE A;  4MH2 A;  4WF4 A;  5GAP D;  1A0F A;  2ON7 A;  3F63 A;  2IL3 A;  4KUN A;  2REM A;  4JZQ A;  2J23 A;  4IW9 A;  5IMD A;  4TN8 A;  1GLP A;  3P90 A;  1EEM A;  3I43 A;  4TR1 A;  3KM6 A;  3WGE A;  4PQH A;  3LYK A;  2NTO A;  3CBU A;  5IOW A;  5LNK e;  1PSQ A;  1ZZY A;  5DVB A;  3VPT A;  2KOK A;  3MAK A;  6GSW A;  4J56 E;  4PUF C;  1EGO A;  1JZD A;  1KBN A;  3F3R A;  6GSV A;  1M9B A;  2GTU A;  3FR9 A;  5ECI B;  4V1A g;  1TU7 A;  2DMM A;  3C8E A;  3BCK A;  1FW1 A;  1TI3 A;  2YZU A;  3HJP A;  2PU9 C;  1GSS A;  2L4Q A;  5A4W A;  1UC7 A;  3NIV A;  1EZK A;  1SKS B;  4ILF A;  1X5C A;  2H01 A;  3A3T A;  4GRF A;  3GKX A;  2WCI A;  2V1M A;  1MEK A;  2LTK A;  2K8S A;  4ECB A;  4L5L A;  4WET A;  3I69 A;  5ECK B;  4PXO A;  1DSB A;  2RUE A;  3A2V A;  5AIV A;  1Z9H A;  2LRT A;  4KX4 A;  4TW5 A;  5B8B A;  1GWC A;  3CRU A;  5HFG A;  4DSR A;  4ML1 A;  4E8H A;  5EPF A;  2VL3 A;  3KIJ A;  2I4A A;  13GS A;  2OKA A;  5JWO B;  5A4U A;  2JAC A;  1T1V A;  3GA4 A;  1GP1 A;  2JU5 A;  4NAX A;  2L5L A;  4KCA A;  2BJX A;  2IMK A;  2LS5 A;  2C8U A;  1MDJ A;  5KN3 A;  4ZBD A;  2VCT A;  3QAG A;  2LQO A;  2HT9 A;  5J5N A;  4IHU A;  3FY7 A;  2FWH A;  3ZIJ A;  4XS1 A;  1SKR B;  3DXB A;  3LXT A;  2HRF A;  4BA7 A;  3GKN A;  3GN3 A;  5JWR B;  1OKT A;  3HA9 A;  4TR3 A;  3C7M A;  3CTG A;  2XPE A;  3GIX A;  4TVE A;  2YV7 A;  1SJZ A;  3TRP A;  4JE1 A;  4MJA A;  2DIZ A;  3IV4 A;  3LSZ A;  3GUS A;  1FVK A;  3F4S A;  1YF0 A;  3MWH A;  4KDY A;  4J57 E;  4O5R A;  2RII A;  5DCG A;  4MPG A;  2LNT A;  5J9B A;  4X43 A;  1XVW A;  4EL1 A;  3D0Z A;  4WKW A;  6GSS A;  1HNB A;  3KTL A;  4WR4 A;  1EP7 A;  2P31 A;  3D4T A;  4MF6 A;  2YWI A;  1KTE A;  3GTU A;  3FZA A;  3HY2 A;  2DSA A;  8GSS A;  2EIR A;  3IDV A;  4Q5N A;  1SD8 A;  4MAB A;  4TXO A;  2V6O A;  1DBY A;  3CSJ A;  5ID2 A;  3ZZX A;  3HKR A;  2H75 A;  2HNL A;  1Z6M A;  3DVW A;  2GQM A;  1K0N A;  5G5E A;  3M8N A;  2FCH A;  3F3Q A;  3KJY A;  3JCM L;  2H1A A;  3E0U A;  3TUE A;  4PGT A;  1Z3E A;  2OA7 A;  4IJ3 A;  2R4V A;  3IBH A;  3CSI A;  3APO A;  4AGS A;  4N30 A;  1XW5 A;  3DIE A;  2CVB A;  4HJM A;  1XXU A;  3GUR A;  4QL9 A;  1C72 A;  1AQV A;  1ZOF A;  2K9F A;  3VWX A;  1THX A;  2H66 A;  3IK9 A;  2JL4 A;  1V40 A;  4FH8 A;  1TW9 A;  2OE0 A;  5F8B A;  3W6G A;  2OBI A;  2B1L A;  4GCI A;  10GS A;  1G0T A;  3LFL A;  2PMT A;  3QOU A;  1TRS A;  4MP4 A;  2FY6 A;  2YP6 A;  4DVC A;  2E2M A;  2OE1 A;  4L8E A;  3W8S A;  4BL7 A;  4EC0 A;  3CRT A;  1V9W A;  2H71 A;  5JWQ B;  1CQG A;  1GRX A;  1QK8 A;  3QMX A;  2Z9S A;  1OE8 A;  5G1K A;  3IOS A;  3ZTL A;  4GQF A;  1JLW A;  4K1F A;  2QSI A;  1KEB A;  3HHV A;  2KLX A;  2C1Y A;  3KP9 A;  3F0I A;  2FD3 A;  2LJK A;  1A2L A;  3LEF A;  1T4Z A;  2OAC A;  1TK0 B;  3RBT A;  4OMV A;  4K8M A;  2OBK A;  1HQO A;  2HYX A;  4G10 A;  1Q98 A;  5HR3 A;  1SK0 A;  4GSN A;  3FR6 A;  3H4K A;  3LWA A;  5CRW A;  1OE7 A;  1OC9 A;  2H74 A;  5G2Z A;  5IM9 A;  4BWQ A;  5ENU A;  1SKW B;  2FUG 2;  2YCD A;  1O6J A;  4XS6 A;  2YWM A;  2CAQ A;  2C0F A;  2N5B A;  2C0E A;  3L78 A;  3GL5 A;  3GSS A;  5J9C A;  1B8X A;  4ZL7 A;  4TOP A;  3EU3 A;  5AN1 A;  2VD1 A;  5CYY A;  3C1S A;  5EL8 A;  17GS A;  5ECP B;  1JFU A;  1BAY A;  5IMF A;  2HSH A;  3HCZ A;  4IS0 A;  5A5K A;  4OCE A;  4CHS A;  4FYU A;  1FAA A;  3MNG A;  3M3M A;  4I5Q A;  5C00 A;  2FA4 A;  2YOI A;  2F8A A;  1U88 A;  3QPM A;  7GSS A;  2A2S A;  2X99 A;  5G30 A;  4JRR A;  1NSW A;  2G0F A;  2B1K A;  4HQZ A;  2BMX A;  4ACS A;  5ECR B;  2BTO T;  1RQM A;  4K0G A;  3O76 A;  3HVX A;  2JZS A;  4MJB A;  4K7N A;  4V2N A;  4ZL9 A;  4I8B A;  5G5F A;  4I2T A;  3F6D A;  3TKS E;  5B6N A;  4PNF A;  3D22 A;  1TXX A;  2NDO A;  1XPV A;  4OO5 A;  2HLS A;  3FZ4 A;  4F82 A;  1NM3 A;  4Q5Q A;  5F0G A;  4MCU A;  2ZCT A;  3TKS A;  4JED A;  1F6M C;  4FYC A;  3VK9 A;  4G9H A;  2VUP A;  2JZR A;  1V98 A;  4LLR A;  3TRQ A;  3LQ7 A;  1HNA A;  1ON4 A;  5AGY A;  2GSQ A;  5CNW A;  1TRU A;  2C0G A;  2LUS A;  3UMA A;  2H1B A;  1SL1 B;  3WGX A;  5IO2 A;  3IXR A;  3HVV A;  1URM A;  2I3Y A;  3CTF A;  3RDW A;  3S9F A;  5KN1 A;  2GT6 A;  1GUH A;  2L5O A;  3HDC A;  4WF5 A;  1PD2 1;  3APS A;  1M0U A;  1PGT A;  4IQ1 A;  1GSY A;  1MTC A;  3KTB A;  5COH A;  4XS4 A;  3FHK A;  2FWG A;  2ALB A;  5ECO B;  5F06 A;  2DLX A;  1ACV A;  3KP8 A;  1XWK A;  1PL2 A;  2X8G A;  5HFI A;  1R26 A;  3A5W A;  1ZCP A;  2VL2 A;  4ZBB A;  2E7P A;  4V1A p;  1JZR A;  3TJJ A;  1AIU A;  2DJJ A;  2LST A;  4BVY A;  1O85 A;  1K3Y A;  1K3L A;  2YAN A;  2F3M A;  4HJ2 A;  4F0C A;  2ZNM A;  1XW6 A;  2GZZ A;  1ERV A;  1ZYE A;  3GX8 A;  2L57 A;  18GS A;  5IOX A;  1TP9 A;  4ML6 A;  3EYT A;  4LA1 A;  5ECS A;  5J3R A;  3A2X A;  2HZF A;  3IHQ A;  1K0B A;  2N5A A;  1B48 A;  3D4M A;  5ECM B;  3GTU B;  5C04 A;  2CT6 A;  1CQH A;  2ZUP A;  3ME8 A;  12GS A;  2MMO A;  4TXO B;  2O8V B;  5ID2 B;  3GV1 A;  4HU9 A;  2WS2 A;  4E8E A;  1EEJ A;  2H0H A;  3KMN A;  2N5F A;  4KGI A;  1PX7 A;  1IYI A;  3FRC A;  3LG6 A;  5GZZ B;  4MPF A;  4OWY A;  9GSS A;  1E6B A;  3H79 A;  1JZO A;  4PNG A;  3VLN A;  1SJ6 A;  2OE3 A;  1M2A A;  2FHE A;  3HVS A;  2CVK A;  3F8U A;  2H73 A;  5ECL B;  1YEX A;  2PUK C;  2YJ7 A;  3K8N A;  5GAN D;  2HSY A;  3EWL A;  2IWT A;  1A8L A;  2NPB A;  3KD0 A;  4G2E A;  4AF2 A;  2IJY A;  5J41 A;  3G7J A;  3C73 A;  4KAE A;  2PBJ A;  2FGX A;  3WYW A;  3UVH A;  2H70 A;  1Z6N A;  2EIQ A;  1WRY A;  4TRX A;  1ST9 A;  2CZ2 A;  22GS A;  2DJK A;  3D21 A;  3ZVJ A;  3C1R A;  5IO0 A;  1BX9 A;  1OVN A;  2MMN A;  1EOG A;  2QGV A;  5D9X A;  5D96 A;  5FWG A;  1TK8 B;  1HD2 A;  5LCZ A;  2X8H A;  2WJU A;  4J2F A;  1XWB A;  5H5Q A;  1GTA A;  4ECJ A;  2VCQ A;  2CAI A;  3ZLP A;  1MDK A;  1MDI A;  1O8X A;  2WUL A;  3Q19 A;  5DAL A;  1OYJ A;  4EUY A;  1GUK A;  3IA1 A;  4L5O A;  4KW6 A;  5A4V A;  3N5O A;  11GS A;  1YKC A;  4HEA 2;  4BWS A;  3VI5 A;  3WT1 A;  4NXI A;  2R37 A;  3FW2 A;  3L9V A;  5CRG A;  3TCO A;  3TKQ A;  1N2A A;  2QKE A;  1HNC A;  4GTU A;  2VAF A;  5HR2 A;  3BOA A;  3EMX A;  3GH9 A;  6GSU A;  5J4U A;  1F3B A;  1B4Q A;  2RM6 A;  3PH9 A;  1DE2 A;  2EIO A;  1YZX A;  4O92 A;  3HJO A;  3SBC A;  3ZRD A;  2HZE B;  3EE2 A;  5HFK A;  1X5E A;  3U6V A;  1YY7 A;  1GLQ A;  2V41 A;  4IVF A;  4POB A;  4PX1 A;  3ZFB A;  4JU5 A;  5D93 A;  3LJR A;  1AAZ A;  5DAK A;  2H76 A;  3APQ A;  5IPG A;  1Z7P A;  2KUC A;  3QFB C;  1GNE A;  4HDE A;  4L0W A;  2EC4 A;  5ECN B;  19GS A;  2DJ1 A;  1PKW A;  1BED A;  4KDX A;  1GL8 A;  4MJE A;  4KB3 A;  3KXO A;  3DML A;  1KNG A;  1S3A A;  5IMC A;  1PL1 A;  2HI7 A;  4GWR A;  3UAP A;  1F9M A;  1WIK A;  4KND A;  4PUR A;  1F3A A;  4LL1 B;  2VLV A;  2QC7 A;  4K0N A;  3TGZ A;  2VM1 A;  1WE0 A;  2AYT A;  4WEY A;  2C3T A;  3CSH A;  3G7I A;  2L6D A;  3VWW A;  20GS A;  2AUV A;  2IIY A;  1K0D A;  3IPZ A;  3GL3 A;  1A24 A;  1SJI A;  4JBB A;  1XZO A;  4POM A;  2YJH A;  2MMA A;  1O8W A;  3QCP A;  1RK4 A;  2B6M A;  1O73 A;  2XBQ A;  2NBS A;  3D5J A;  3FKF A;  5AIX A;  2H6X A;  4ZB9 A;  1SEN A;  5H5R A;  3IAS 2;  3C71 A;  1WP0 A;  2GQK A;  4NMU A;  3SWL A;  2MMZ A;  2DIY A;  4GXZ A;  3KEB A;  4KSO A;  3QAW A;  2O87 A;  3M9J A;  4TKY A;  1SYX A;  1B4P A;  1ERW A;  4KA0 A;  1AC1 A;  2L6C A;  5F05 A;  2VD0 A;  4IQA A;  2H1D A;  5L71 A;  3UIW A;  1ZL9 A;  3EVI A;  2VLT A;  4XS4 B;  2TRC P;  1K0O A;  1IYH A;  4ZL8 A;  2DJ0 A;  1VF1 A;  3ED3 A;  3DVX A;  4MH3 A;  2NVL A;  4IGJ A;  1WMJ A;  4DSQ A;  2R2J A;  2F8F A;  1SL2 B;  1U3A A;  3F4T A;  2PWJ A;  2KHP A;  3UOM A;  1X5D A;  2V2G A;  2YV9 A;  1ZMA A;  4IBP A;  3TJG A;  1EP8 A;  1XWG A;  3BCI A;  4NV2 A;  1LU4 A;  2PER A;  2M72 A;  2LRC A;  1SK1 A;  3Q74 A;  1R5A A;  2HXK A;  4OFN A;  4ECI A;  5DQS A;  5EY6 A;  3TB2 A;  4QQ7 A;  6GST A;  1OC8 A;  3TOT A;  1NHY A;  3GKM A;  3TJF A;  4TR1 B;  3DD3 A;  3DYR A;  4NHW A;  1TI1 A;  3ZVJ D;  5CP1 A;  1T00 A;  1FO5 A;  2FWF A;  4NV5 A;  2I81 A;  4AJ7 A;  1V2A A;  4HQS A;  1GTU A;  6GSY A;  4KH7 A;  16GS A;  3NZN A;  4V2L A;  5IMZ A;  4X1U A;  3ZIV A;  3DKS A;  3LXZ A;  1GUL A;  3FR3 A;  5FHI A;  5D9V A;  2H6Y A;  3VWU A;  1V57 A;  1ML6 A;  1B9Y C;  5KN2 A;  2FA8 A;  4QL7 A;  4V2M A;  1I9D A;  2LNS A;  3QFA C;  5GST A;  1OKD A;  4IP6 A;  2R6K A;  5DJL A;  2CX3 A;  3US3 A;  5IMA A;  2JZT A;  4BPY A;  4XCS A;  4WBR D;  3ME7 A;  4PQI A;  2GZP A;  4MK3 A;  1G7E A;  1SU9 A;  4Z7X A;  1T3B A;  4D73 A;  3CMI A;  2H0I A;  3PIN A;  3OR5 A;  1X9S B;  3HD5 A;  3IK7 A;  1DUG A;  4OFT A;  3KH7 A;  1GSU A;  1GTI A;  3F4R A;  1VF3 A;  1VF4 A;  4MF5 A;  5G1L A;  1G6W A;  4DSS A;  4YAV A;  5D9T A;  1S3D A;  3VUR A;  3ZL5 A;  4ZB6 A;  3M1G A;  3U5R E;  2TRX A;  4I2U A;  1K0A A;  1WPI A;  2KP2 A;  4CW9 A;  3G9B A;  1U3I A;  4GST A;  4BVX A;  2PVO C;  1FG4 A;  2H6Z A;  1BJX A;  1XIY A;  4N10 A;  2F9S A;  1GNW A;  2RM5 A;  2XPD A;  4XIH A;  1W4V A;  4GF0 A;  3EU4 A;  1SD9 A;  2FNO A;  1H75 A;  2I9H A;  4ISD A;  1ILO A;  4ULX A;  3CYN A;  3ERG A;  2FLS A;  3NOF A;  1XW9 A;  5DDL A;  3PGT A;  1ZYQ B;  3EMP A;  2CV4 A;  1ERU A;  4EO3 A;  4EKZ A;  4OD7 A;  2IMD A;  1EGR A;  3IRA A;  5G31 A;  3CXG A;  4K2D A;  5HR1 A;  2O85 A;  3F6F A;  1M99 A;  3HZ4 A;  5DAK B;  2WB9 A;  1R7H A;  1PKZ A;  3G7Y A;  1BQ7 A;  3HZ8 A;  1N8J A;  5INY A;  2GLR A;  3UAR A;  2G2Q A;  4WR5 A;  2GSR A;  2ON5 A;  4O32 A;  1NHO A;  1E2Y A;  2L4C A;  2JSY A;  5B8A A;  1TDI A;  4ZBA A;  1A2J A;  3P8W A;  4RQX A;  4K7O A;  1XCC A;  2P5R A;  4NHZ A;  5CRD A;  4EXJ A;  4ID0 A;  2I1U A;  1MD4 A;  2M80 A;  3QD9 A;  1XOB A;  3MDK A;  1QFN A;  4JR4 A;  1EOH A;  2AJQ B;  2HE3 A;  4L0U A;  4HS1 A;  1RW1 A;  4HOJ A;  1A0R P;  3W8J A;  1U87 A;  2PPT A;  5ELA A;  14GS A;  2VO4 A;  3J7Y b;  3UL3 A;  5DBQ A;  2LJA A;  1SK2 A;  2GSS A;  1TU8 A;  4ZXG A;  2WDU A;  1Y25 A;  1PQN A;  2AHE A;  2PN8 A;  3LOR A;  1XFL A;  3UJ1 A;  3GNJ A;  4JR6 A;  2OJL A;  1EV9 A;  4MJC A;  2IN3 A;  2GQL A;  4WXT A;  1X9M B;  2K18 A;  5B6M A;  1X0R A;  2LEG A;  2C4J A;  3N9J A;  1JZW A;  2GGT A;  1TRW A;  2IMI A;  4IP1 A;  3RAZ A;  3H8Q A;  5CAX A;  5IIZ A;  3BD2 A;  5D9W A;  1Q4J A;  4NWY A;  3FK8 A;  3TJK A;  5HQP A;  3F9U A;  1XWA A;  5H5S A;  5DJM A;  2VCZ A;  3L4N A;  3V1W A;  3BJ5 A;  4HI7 A;  4LMV A;  4YQV A;  2DJ2 A;  4Q5F A;  5E4W A;  1TJD A;  2YPM A;  1O7U A;  2MZC A;  2CVD A;  4O7H A;  1YJ6 A;  3TKS C;  3HYP A;  1TKD B;  2K6V A;  4AJ8 A;  2C3Q A;  3GYK A;  3ERF A;  3QAV A;  3ISO A;  2YNX A;  3PR8 A;  1GSF A;  4POL A;  2AAW A;  2B5E A;  3J7Y k;  2J9H A;  5JCU A;  1OAZ A;  4YQM A;  1W89 A;  5ABR A;  4XRA A;  1BG5 A;  1K3O A;  3ZYW A;  3EUR A;  4NPB A;  2B7K A;  4FIW A;  1WWJ A;  3H93 A;  1HYU A;  2B5Y A;  1OC9 B;  1GSE A;  1S3C A;  2LJR A;  5GSS A;  4Q5R A;  1UA5 A;  1QMV A;  2AB6 A;  2DC5 A;  1LBK A;  2WZ9 A;  2A4V A;  3GHA A;  4HZ4 A;  2VCW A;  2HFD A;  4K7I A;  2E2G A;  4KE3 A;  2VL2 C;  3L9U A;  2GT5 A;  5IPH A;  2LKU A;  2H1G A;  1AW9 A;  4ZB8 A;  2M46 A;  3O3T A;  4KCE A;  1Y6E A;  3AY8 A;  4WBJ A;  2GST A;  3LYP A;  4N11 A;  1XBS A;  1YF1 A;  2C80 A;  5AIS A;  1T8E B;  2IFQ A;  2PGT A;  3BBY A;  2VOC A;  4MLY A;  4KSM A; 
#chains in the Genus database with same CATH topology
 1PN9 A;  3HXS A;  3GST A;  2B3S A;  4LL4 B;  5F07 A;  4CDO A;  1GH2 A;  1B9X C;  4PQ1 A;  4MDC A;  4HUA A;  1USB A;  1M7T A;  3EIN A;  2CX4 A;  4XTS A;  1LJR A;  3IR4 A;  1F37 A;  4GSS A;  1XOA A;  3UEM A;  5CRH A;  2FWE A;  3MSZ A;  4PTS A;  3FEU A;  4USS A;  2RLI A;  1XWC A;  1UN2 A;  2H30 A;  2IMF A;  3I6A A;  4K6X A;  6GSX A;  2WRT A;  3DEX A;  3IC4 A;  2X8C A;  3ZFL A;  2LV3 A;  1DE1 A;  2VIM A;  1PX6 A;  4IJI A;  1H4O A;  1THO A;  4F9Z A;  3FMW A;  4ZIJ A;  3Q6O A;  2WFC A;  2B5X A;  4FO5 A;  3ZML A;  3MIX A;  4YKG A;  2AV4 A;  3WD6 A;  5BRT A;  4D73 B;  1T7P B;  2VLU A;  2JSZ A;  3HJM A;  5ECH B;  1AUC A;  2A2R A;  3M9K A;  1YDK A;  3KCM A;  2DML A;  2L59 A;  1TTZ A;  1A2M A;  3TDG A;  4CY8 A;  1K0C A;  5ELG A;  1T4Y A;  2E0Q A;  1R5P A;  4DSS B;  3LGC A;  3DWV A;  5HR0 A;  2LRN A;  1X9W B;  1FOH A;  1J9B A;  1FVJ A;  2MBT A;  1NW2 A;  4EDY A;  3QR6 A;  3L0H A;  1G7O A;  1Z7R A;  2XHF A;  4MZC A;  2X64 A;  3GFK A;  3M0F A;  3UVT A;  4MZW A;  4EF0 A;  4IKH A;  2GDR A;  2X4A A;  2V32 A;  3GKK A;  1XG8 A;  1FB6 A;  4MF7 A;  2ES7 A;  3UBK A;  2XBI A;  1GUM A;  3TKP A;  4YH2 A;  2F51 A;  4F03 A;  1ERT A;  3KMO A;  1VGL A;  5JCW A;  5D8I A;  4BIK A;  1AQW A;  4KDU A;  4X0X A;  4EDZ A;  4YAP A;  4FQU A;  1XVQ A;  3GMF A;  3R2Q A;  2MBS A;  2D2Z A;  4YQU A;  1A23 A;  3GX0 A;  4GLT A;  3E9J B;  2DBC A;  1O81 A;  4P3Y B;  3RPN A;  4F2I A;  1PRX A;  1OC3 A;  1YEP A;  1J08 A;  4Z2T A;  3DRN A;  4RQR A;  2PVQ A;  3GH6 A;  4F0B A;  4ZIL A;  1SL0 B;  2TIR A;  1M2D A;  4G19 A;  4MA9 A;  2YN1 A;  2VM2 A;  1GSQ A;  4N0Z A;  4HZ2 A;  2R5G A;  2DJ3 A;  2B7J A;  3O6T A;  3D6I A;  1WJK A;  2HZE A;  5B7C A;  1WOU A;  1R4W A;  1G6Y A;  2C0D A;  2GS3 A;  1VRS D;  1GSD A;  3FZ9 A;  4GQC A;  4PUA A;  1SYR A;  3ZIT A;  3ERW A;  3ZMK A;  2V6K A;  4HSC X;  2VCV A;  2RUF A;  4TXV A;  3TJB A;  4XHM A;  2H19 A;  4MZB A;  3GRX A;  1I5G A;  4I6X A;  4XRD A;  4EE0 A;  1PA3 A;  2GZY A;  3VWV A;  3A5I A;  1M9A A;  3ZRE A;  3L9S A;  1TRV A;  2WGR A;  4RI7 A;  2VL9 A;  4EVM A;  4POK A;  2LQQ A;  1J0F A;  1V58 A;  2H72 A;  1EWX A;  1TOF A;  1YKA A;  5EVO A;  2IME A;  1ZGN A;  1VF2 A;  2YWO A;  4HU7 A;  3E3E A;  1QGV A;  4G0K A;  5E59 A;  5DQY A;  2P0G A;  2K8V A;  1QQ2 A;  2HRN A;  2R3X A;  3LW9 A;  2JAD A;  2XC2 A;  1FB0 A;  2CA8 A;  1JHB A;  4IN0 A;  2H8L A;  3TRX A;  5IQY A;  3TKR A;  1ABA A;  2IPA A;  3EC3 A;  2P5Q A;  4FYB A;  4RI6 A;  3VI7 A;  3DGQ A;  1M2B A;  4OFM A;  3KGK A;  1YQ1 A;  3UBL A;  3WT2 A;  3IC8 A;  1QUW A;  3FZ5 A;  1BYE A;  4RUV A;  5KEJ A;  5DCH A;  3Q18 A;  3VFI A;  1Z5Y E;  2VCX A;  1K0M A;  4ECC A;  1U6T A;  4LMW A;  5DAL B;  1A8Y A;  2YZH A;  3I9V 2;  5ECQ B;  1FOV A;  1GTB A;  2MYG A;  5KN0 A;  2X49 A;  5CO3 A;  3H1N A;  2YWN A;  1PMT A;  4O5Q A;  3A2W A;  5FT3 A;  1MD3 A;  2O7K A;  2OAD A;  1TK5 B;  3RHC A;  5JCG A;  4I97 A;  4N0V A;  3TOU A;  4DEJ A;  5D73 A;  4K9Z A;  2DKI A;  3CQF A;  5IMV A;  4TR0 A;  4H86 A;  4TR4 A;  1EV4 A;  3IAM 2;  3P2A A;  1JLV A;  3FYG A;  2H0G A;  1F2E A;  2CZ3 A;  5CRE A;  1AXD A;  5LD0 A;  1QXH A;  1UVZ A;  3P7X A;  4OCF A;  2KP1 A;  4OO4 A;  3WGD A;  2GVP A;  2O89 A;  3IE3 A;  4CY6 A;  2IFQ B;  3KH9 A;  3RHB A;  2CQ9 A;  2QA1 A;  1AQX A;  3KZQ A;  3RPP A;  3VPQ A;  2C3N A;  3QDN A;  4AJ6 A;  4IEL A;  4MMM A;  1FHE A;  4MH2 A;  4WF4 A;  5GAP D;  1A0F A;  2ON7 A;  3F63 A;  2IL3 A;  4KUN A;  2REM A;  4JZQ A;  2J23 A;  4IW9 A;  5IMD A;  4TN8 A;  1GLP A;  3P90 A;  1EEM A;  3I43 A;  4TR1 A;  3KM6 A;  3WGE A;  4PQH A;  3LYK A;  2NTO A;  3CBU A;  5IOW A;  5LNK e;  1PSQ A;  1ZZY A;  5DVB A;  3VPT A;  2KOK A;  3MAK A;  6GSW A;  4J56 E;  4PUF C;  4KF9 A;  1EGO A;  1JZD A;  1KBN A;  3F3R A;  6GSV A;  1M9B A;  2GTU A;  3FR9 A;  5ECI B;  4V1A g;  1TU7 A;  2DMM A;  3C8E A;  3BCK A;  1FW1 A;  1TI3 A;  2YZU A;  3HJP A;  2PU9 C;  1GSS A;  2L4Q A;  5A4W A;  1UC7 A;  3NIV A;  1EZK A;  1SKS B;  4ILF A;  1X5C A;  2H01 A;  3A3T A;  4GRF A;  3GKX A;  2WCI A;  2V1M A;  1MEK A;  2LTK A;  2K8S A;  4ECB A;  4L5L A;  4WET A;  3I69 A;  5ECK B;  4PXO A;  1DSB A;  2RUE A;  3A2V A;  5AIV A;  1Z9H A;  2LRT A;  4KX4 A;  4TW5 A;  5B8B A;  1GWC A;  3CRU A;  5HFG A;  4DSR A;  4ML1 A;  4E8H A;  5EPF A;  2VL3 A;  3KIJ A;  2I4A A;  13GS A;  2OKA A;  5JWO B;  5A4U A;  2JAC A;  2A4H A;  1T1V A;  3GA4 A;  1GP1 A;  2JU5 A;  4NAX A;  2L5L A;  4KCA A;  2BJX A;  2IMK A;  2LS5 A;  2C8U A;  1MDJ A;  5KN3 A;  4ZBD A;  2VCT A;  3QAG A;  2LQO A;  2HT9 A;  5J5N A;  4IHU A;  3FY7 A;  2FWH A;  4MNN A;  3ZIJ A;  4XS1 A;  1SKR B;  3DXB A;  3LXT A;  2HRF A;  4BA7 A;  3GKN A;  3GN3 A;  1PFO A;  5JWR B;  1OKT A;  1S3R A;  3HA9 A;  4TR3 A;  3C7M A;  3CTG A;  2XPE A;  4G0I A;  3GIX A;  4TVE A;  2YV7 A;  1SJZ A;  3TRP A;  4JE1 A;  4MJA A;  2DIZ A;  3IHG A;  3IV4 A;  3LSZ A;  3GUS A;  1FVK A;  3F4S A;  4K5R A;  1YF0 A;  3MWH A;  4KDY A;  4J57 E;  4O5R A;  2RII A;  5DCG A;  4MPG A;  2LNT A;  5J9B A;  4X43 A;  1XVW A;  4EL1 A;  3D0Z A;  4WKW A;  6GSS A;  1HNB A;  3KTL A;  4WR4 A;  1EP7 A;  2P31 A;  3D4T A;  4MF6 A;  2YWI A;  1KTE A;  3GTU A;  3FZA A;  3HY2 A;  2DSA A;  8GSS A;  2EIR A;  3IDV A;  4Q5N A;  1SD8 A;  4MAB A;  4TXO A;  2V6O A;  1DBY A;  3CSJ A;  5ID2 A;  3ZZX A;  3HKR A;  2H75 A;  2HNL A;  1Z6M A;  3DVW A;  2GQM A;  1K0N A;  5G5E A;  3M8N A;  2FCH A;  3F3Q A;  3KJY A;  3JCM L;  2H1A A;  3E0U A;  3TUE A;  4PGT A;  1Z3E A;  2OA7 A;  4IJ3 A;  2R4V A;  3IBH A;  3CSI A;  4ICY A;  3APO A;  4AGS A;  4N30 A;  1XW5 A;  3DIE A;  2CVB A;  4HJM A;  1XXU A;  3GUR A;  4QL9 A;  1C72 A;  1AQV A;  1ZOF A;  2K9F A;  3VWX A;  1THX A;  2H66 A;  3IK9 A;  2JL4 A;  1V40 A;  4FH8 A;  4BVX B;  1TW9 A;  2OE0 A;  5F8B A;  3W6G A;  2OBI A;  2B1L A;  4GCI A;  10GS A;  1G0T A;  3LFL A;  2PMT A;  3QOU A;  1TRS A;  2HSM A;  4MP4 A;  2FY6 A;  2YP6 A;  4DVC A;  2E2M A;  2OE1 A;  4L8E A;  3W8S A;  4BL7 A;  4EC0 A;  3CRT A;  1V9W A;  2H71 A;  5JWQ B;  1CQG A;  1GRX A;  1QK8 A;  3QMX A;  2Z9S A;  1OE8 A;  5G1K A;  3IOS A;  3ZTL A;  2QA2 A;  4GQF A;  1JLW A;  4K1F A;  2QSI A;  4K2X A;  1KEB A;  3HHV A;  2KLX A;  1PN0 A;  2C1Y A;  3KP9 A;  3F0I A;  2FD3 A;  2LJK A;  1A2L A;  3LEF A;  1T4Z A;  2OAC A;  1TK0 B;  3RBT A;  4OMV A;  4K8M A;  2OBK A;  1HQO A;  2HYX A;  4G10 A;  1Q98 A;  5HR3 A;  1SK0 A;  4GSN A;  3FR6 A;  3H4K A;  3LWA A;  5CRW A;  1OE7 A;  1OC9 A;  2H74 A;  5G2Z A;  5IM9 A;  4BWQ A;  5ENU A;  1SKW B;  2FUG 2;  2YCD A;  1O6J A;  4XS6 A;  2YWM A;  2CAQ A;  2C0F A;  2N5B A;  2C0E A;  3L78 A;  3GL5 A;  3GSS A;  5J9C A;  1B8X A;  4ZL7 A;  4TOP A;  3EU3 A;  5AN1 A;  2VD1 A;  5CYY A;  3C1S A;  5EL8 A;  17GS A;  5ECP B;  1JFU A;  1BAY A;  5IMF A;  2HSH A;  3HCZ A;  4IS0 A;  5A5K A;  4OCE A;  4CHS A;  4FYU A;  1FAA A;  3MNG A;  3M3M A;  4I5Q A;  5C00 A;  2FA4 A;  2YOI A;  2F8A A;  1U88 A;  3QPM A;  7GSS A;  2A2S A;  2X99 A;  5G30 A;  4JRR A;  1NSW A;  2G0F A;  2B1K A;  4HQZ A;  2BMX A;  4ACS A;  5ECR B;  2BTO T;  1RQM A;  4K0G A;  3O76 A;  3HVX A;  2JZS A;  4MJB A;  4K7N A;  4V2N A;  4ZL9 A;  4I8B A;  5G5F A;  4I2T A;  3F6D A;  3TKS E;  5B6N A;  4PNF A;  3D22 A;  1TXX A;  2NDO A;  2HRA A;  1XPV A;  4OO5 A;  2HLS A;  3FZ4 A;  4F82 A;  4Z2R A;  1NM3 A;  4Q5Q A;  5F0G A;  4MCU A;  2R0P A;  2ZCT A;  3TKS A;  4JED A;  1F6M C;  4FYC A;  3VK9 A;  4G9H A;  2VUP A;  2JZR A;  1V98 A;  4LLR A;  3TRQ A;  3LQ7 A;  1HNA A;  1ON4 A;  5AGY A;  2GSQ A;  5CNW A;  1TRU A;  2C0G A;  2LUS A;  3UMA A;  2H1B A;  1SL1 B;  3WGX A;  5IO2 A;  3IXR A;  3HVV A;  1URM A;  2I3Y A;  3CTF A;  3RDW A;  3S9F A;  5KN1 A;  2GT6 A;  1GUH A;  2L5O A;  3HDC A;  4WF5 A;  1PD2 1;  3APS A;  1M0U A;  1PGT A;  4IQ1 A;  1GSY A;  2A2P A;  1MTC A;  3KTB A;  5COH A;  4XS4 A;  3FHK A;  2FWG A;  2ALB A;  5ECO B;  5F06 A;  2DLX A;  1ACV A;  3KP8 A;  1XWK A;  1PL2 A;  2X8G A;  5HFI A;  2UZ8 A;  1R26 A;  3A5W A;  1ZCP A;  2VL2 A;  4ZBB A;  2E7P A;  4V1A p;  1JZR A;  3TJJ A;  1AIU A;  2DJJ A;  2LST A;  4BVY A;  1O85 A;  1K3Y A;  1K3L A;  2YAN A;  2F3M A;  4HJ2 A;  4F0C A;  2ZNM A;  1XW6 A;  2GZZ A;  1ERV A;  1ZYE A;  3GX8 A;  2L57 A;  18GS A;  5IOX A;  1TP9 A;  4ML6 A;  3EYT A;  4LA1 A;  5ECS A;  5J3R A;  3A2X A;  2HZF A;  3IHQ A;  1K0B A;  2N5A A;  1B48 A;  3D4M A;  5ECM B;  3GTU B;  5C04 A;  2CT6 A;  1CQH A;  2ZUP A;  3ME8 A;  12GS A;  2MMO A;  4TXO B;  2O8V B;  5ID2 B;  3GV1 A;  4HU9 A;  2WS2 A;  4E8E A;  1EEJ A;  2H0H A;  3KMN A;  2N5F A;  4KGI A;  1PX7 A;  1IYI A;  3FRC A;  3LG6 A;  5GZZ B;  4MPF A;  4OWY A;  9GSS A;  1E6B A;  1ZYP A;  3H79 A;  1JZO A;  4PNG A;  3VLN A;  1SJ6 A;  2OE3 A;  1M2A A;  2FHE A;  3HVS A;  2CVK A;  3F8U A;  2H73 A;  5ECL B;  1YEX A;  2PUK C;  2YJ7 A;  3K8N A;  1ZYN A;  5GAN D;  2HSY A;  3EWL A;  2IWT A;  1A8L A;  2NPB A;  3KD0 A;  4G2E A;  4AF2 A;  5KOX A;  2IJY A;  5J41 A;  3G7J A;  3C73 A;  4KAE A;  2PBJ A;  2FGX A;  3WYW A;  3UVH A;  2H70 A;  1Z6N A;  2EIQ A;  1WRY A;  4TRX A;  4A5P A;  1ST9 A;  2CZ2 A;  22GS A;  2DJK A;  3D21 A;  3ZVJ A;  3C1R A;  5IO0 A;  1BX9 A;  1OVN A;  2MMN A;  4BL7 B;  1EOG A;  2QGV A;  5D9X A;  5D96 A;  2DKH A;  5FWG A;  1TK8 B;  1HD2 A;  5LCZ A;  2X8H A;  2WJU A;  4J2F A;  1XWB A;  5H5Q A;  1GTA A;  4ECJ A;  2VCQ A;  2CAI A;  3ZLP A;  1MDK A;  1MDI A;  1O8X A;  2WUL A;  3Q19 A;  5DAL A;  1OYJ A;  4EUY A;  1GUK A;  3IA1 A;  4L5O A;  4KW6 A;  5A4V A;  3N5O A;  11GS A;  1YKC A;  4HEA 2;  4BWS A;  3VI5 A;  3WT1 A;  4NXI A;  2R37 A;  3FW2 A;  3L9V A;  5CRG A;  3TCO A;  3TKQ A;  1N2A A;  2QKE A;  1HNC A;  4GTU A;  2VAF A;  5HR2 A;  3BOA A;  3EMX A;  3GH9 A;  6GSU A;  5J4U A;  1F3B A;  1B4Q A;  2RM6 A;  3PH9 A;  1DE2 A;  2EIO A;  1YZX A;  4O92 A;  3HJO A;  3SBC A;  3ZRD A;  2HZE B;  3EE2 A;  5HFK A;  1X5E A;  3U6V A;  1YY7 A;  1GLQ A;  2V41 A;  4IVF A;  4POB A;  4PX1 A;  3ZFB A;  4JU5 A;  5D93 A;  3LJR A;  1AAZ A;  5DAK A;  2H76 A;  3APQ A;  5IPG A;  1Z7P A;  2KUC A;  3QFB C;  1GNE A;  4YKF A;  4HDE A;  4L0W A;  2EC4 A;  5ECN B;  19GS A;  2DJ1 A;  1PKW A;  1BED A;  4KDX A;  1GL8 A;  4MJE A;  4KB3 A;  3KXO A;  3DML A;  1KNG A;  1S3A A;  5IMC A;  1PL1 A;  2HI7 A;  4GWR A;  3UAP A;  1F9M A;  1WIK A;  4KND A;  4PUR A;  1F3A A;  4LL1 B;  2VLV A;  2QC7 A;  4K0N A;  4Z2U A;  3TGZ A;  2VM1 A;  1WE0 A;  2AYT A;  4WEY A;  2C3T A;  3CSH A;  3G7I A;  4EIP A;  2L6D A;  3VWW A;  20GS A;  2AUV A;  2IIY A;  1K0D A;  3IPZ A;  3GL3 A;  1A24 A;  1SJI A;  4JBB A;  1XZO A;  2HRK A;  4POM A;  2YJH A;  4X4J A;  2MMA A;  1O8W A;  3QCP A;  1RK4 A;  2B6M A;  1O73 A;  2XBQ A;  2NBS A;  3D5J A;  3FKF A;  5AIX A;  2H6X A;  4ZB9 A;  1SEN A;  5H5R A;  3IAS 2;  3C71 A;  1WP0 A;  2GQK A;  4NMU A;  3SWL A;  2MMZ A;  2DIY A;  4GXZ A;  3KEB A;  4KSO A;  3QAW A;  2O87 A;  3M9J A;  4TKY A;  1SYX A;  1B4P A;  1ERW A;  4KA0 A;  1AC1 A;  2L6C A;  5F05 A;  2VD0 A;  4IQA A;  2H1D A;  5L71 A;  3UIW A;  1ZL9 A;  3EVI A;  2VLT A;  4XS4 B;  2TRC P;  1K0O A;  1IYH A;  3PPU A;  4ZL8 A;  2DJ0 A;  1VF1 A;  3ED3 A;  3DVX A;  4MH3 A;  2NVL A;  4IGJ A;  1WMJ A;  4DSQ A;  2R2J A;  4BVY B;  2F8F A;  1SL2 B;  1U3A A;  3F4T A;  2PWJ A;  2KHP A;  3UOM A;  1X5D A;  2V2G A;  2YV9 A;  1ZMA A;  4IBP A;  1M3J A;  3TJG A;  1EP8 A;  1XWG A;  3BCI A;  4NV2 A;  1LU4 A;  2PER A;  2M72 A;  2LRC A;  1SK1 A;  3Q74 A;  1R5A A;  2HXK A;  4OFN A;  4ECI A;  5DQS A;  5EY6 A;  3TB2 A;  4QQ7 A;  6GST A;  1OC8 A;  3TOT A;  1NHY A;  3GKM A;  3TJF A;  4TR1 B;  3DD3 A;  3DYR A;  4NHW A;  1TI1 A;  2R0C A;  3ZVJ D;  5CP1 A;  1T00 A;  1FO5 A;  2FWF A;  4NV5 A;  2I81 A;  4AJ7 A;  1V2A A;  4HQS A;  1GTU A;  6GSY A;  4KH7 A;  16GS A;  3NZN A;  4V2L A;  5IMZ A;  4X1U A;  3ZIV A;  3DKS A;  3LXZ A;  1GUL A;  3FR3 A;  5FHI A;  5D9V A;  4K5S A;  2H6Y A;  3VWU A;  1V57 A;  1ML6 A;  1B9Y C;  5KN2 A;  2FA8 A;  4QL7 A;  4V2M A;  1I9D A;  2LNS A;  3QFA C;  5GST A;  1OKD A;  4IP6 A;  2R6K A;  5DJL A;  2CX3 A;  3US3 A;  5IMA A;  2JZT A;  4BPY A;  4XCS A;  4WBR D;  3ME7 A;  4PQI A;  2GZP A;  4MK3 A;  1G7E A;  1SU9 A;  4Z7X A;  1T3B A;  4D73 A;  3CMI A;  2H0I A;  3PIN A;  1M3I A;  5KOW A;  3OR5 A;  1X9S B;  3HD5 A;  3IK7 A;  1DUG A;  4OFT A;  3KH7 A;  1GSU A;  1GTI A;  3F4R A;  1VF3 A;  1VF4 A;  4MF5 A;  5G1L A;  1G6W A;  4DSS A;  4YAV A;  5D9T A;  1S3D A;  3VUR A;  3ZL5 A;  3R3E A;  4ZB6 A;  3M1G A;  3U5R E;  2TRX A;  4I2U A;  1K0A A;  1WPI A;  2KP2 A;  4CW9 A;  3G9B A;  1U3I A;  4GST A;  4BVX A;  2PVO C;  1FG4 A;  2H6Z A;  1BJX A;  1XIY A;  4N10 A;  2F9S A;  1GNW A;  2RM5 A;  2XPD A;  4XIH A;  1W4V A;  4GF0 A;  3EU4 A;  1SD9 A;  2FNO A;  1H75 A;  2I9H A;  4ISD A;  1ILO A;  4ULX A;  3CYN A;  3ERG A;  2FLS A;  3NOF A;  1XW9 A;  5DDL A;  3PGT A;  1ZYQ B;  3EMP A;  2CV4 A;  1ERU A;  4EO3 A;  4EKZ A;  4OD7 A;  2IMD A;  1EGR A;  3IRA A;  5G31 A;  3CXG A;  4K2D A;  5HR1 A;  4G0L A;  2O85 A;  3F6F A;  1M99 A;  3HZ4 A;  5DAK B;  2WB9 A;  1R7H A;  1PKZ A;  3G7Y A;  1BQ7 A;  3HZ8 A;  1N8J A;  5INY A;  2GLR A;  3UAR A;  2G2Q A;  4WR5 A;  2GSR A;  2ON5 A;  4O32 A;  1NHO A;  1E2Y A;  2L4C A;  2JSY A;  5B8A A;  1TDI A;  4ZBA A;  1A2J A;  3P8W A;  4RQX A;  4K7O A;  1XCC A;  2P5R A;  4NHZ A;  5CRD A;  4EXJ A;  4ID0 A;  2I1U A;  1MD4 A;  2M80 A;  3QD9 A;  1XOB A;  3MDK A;  1QFN A;  4JR4 A;  1EOH A;  2AJQ B;  2HE3 A;  4L0U A;  4HS1 A;  5BMU A;  1RW1 A;  4HOJ A;  1A0R P;  3W8J A;  1U87 A;  2PPT A;  5ELA A;  14GS A;  3MYD A;  2VO4 A;  3J7Y b;  3UL3 A;  5DBQ A;  2LJA A;  1SK2 A;  2GSS A;  1TU8 A;  4ZXG A;  2WDU A;  1Y25 A;  1PQN A;  2AHE A;  2PN8 A;  3LOR A;  1XFL A;  3UJ1 A;  3GNJ A;  4JR6 A;  2OJL A;  1EV9 A;  4MJC A;  2IN3 A;  2GQL A;  4WXT A;  4O5U A;  1X9M B;  2K18 A;  5B6M A;  1X0R A;  3HVN A;  2LEG A;  2C4J A;  3N9J A;  1JZW A;  2GGT A;  1TRW A;  2IMI A;  4IP1 A;  3RAZ A;  3H8Q A;  5CAX A;  5IIZ A;  3BD2 A;  5D9W A;  1Q4J A;  4NWY A;  4EIQ A;  3FK8 A;  3TJK A;  5HQP A;  3F9U A;  1XWA A;  5H5S A;  5DJM A;  2VCZ A;  3L4N A;  3V1W A;  3BJ5 A;  4HI7 A;  4LMV A;  4YQV A;  2DJ2 A;  4Q5F A;  5E4W A;  1TJD A;  2YPM A;  1O7U A;  2MZC A;  2CVD A;  4O7H A;  1YJ6 A;  3TKS C;  3HYP A;  1TKD B;  2K6V A;  4AJ8 A;  2C3Q A;  3GYK A;  3ERF A;  3QAV A;  3ISO A;  2YNX A;  3PR8 A;  1GSF A;  4POL A;  2AAW A;  2B5E A;  3J7Y k;  2J9H A;  5JCU A;  1OAZ A;  4YQM A;  1W89 A;  5ABR A;  4XRA A;  1BG5 A;  1K3O A;  3ZYW A;  3EUR A;  4NPB A;  2B7K A;  4FIW A;  1WWJ A;  3H93 A;  1HYU A;  3EPT A;  2B5Y A;  1OC9 B;  1GSE A;  1S3C A;  2LJR A;  5GSS A;  4Q5R A;  1UA5 A;  1QMV A;  2AB6 A;  2DC5 A;  1LBK A;  2WZ9 A;  2A4V A;  3GHA A;  4HZ4 A;  2VCW A;  2HFD A;  4K7I A;  2E2G A;  2R0G A;  4KE3 A;  2VL2 C;  3L9U A;  2GT5 A;  5IPH A;  2LKU A;  2H1G A;  1AW9 A;  4ZB8 A;  2M46 A;  3O3T A;  4KCE A;  1Y6E A;  3AY8 A;  4WBJ A;  2GST A;  3LYP A;  4N11 A;  1XBS A;  1YF1 A;  2C80 A;  5AIS A;  1T8E B;  2IFQ A;  2PGT A;  3BBY A;  2VOC A;  4MLY A;  4KSM A; 
#chains in the Genus database with same CATH homology
 1PN9 A;  3HXS A;  3GST A;  2B3S A;  4LL4 B;  5F07 A;  4CDO A;  1GH2 A;  1B9X C;  4PQ1 A;  4MDC A;  4HUA A;  1USB A;  1M7T A;  3EIN A;  2CX4 A;  4XTS A;  1LJR A;  3IR4 A;  1F37 A;  4GSS A;  1XOA A;  3UEM A;  5CRH A;  2FWE A;  3MSZ A;  4PTS A;  3FEU A;  4USS A;  2RLI A;  1XWC A;  1UN2 A;  2H30 A;  2IMF A;  3I6A A;  4K6X A;  6GSX A;  2WRT A;  3DEX A;  3IC4 A;  2X8C A;  3ZFL A;  2LV3 A;  1DE1 A;  2VIM A;  1PX6 A;  4IJI A;  1H4O A;  1THO A;  4F9Z A;  3FMW A;  4ZIJ A;  3Q6O A;  2WFC A;  2B5X A;  4FO5 A;  3ZML A;  3MIX A;  4YKG A;  2AV4 A;  3WD6 A;  5BRT A;  4D73 B;  1T7P B;  2VLU A;  2JSZ A;  3HJM A;  5ECH B;  1AUC A;  2A2R A;  3M9K A;  1YDK A;  3KCM A;  2DML A;  2L59 A;  1TTZ A;  1A2M A;  3TDG A;  4CY8 A;  1K0C A;  5ELG A;  1T4Y A;  2E0Q A;  1R5P A;  4DSS B;  3LGC A;  3DWV A;  5HR0 A;  2LRN A;  1X9W B;  1FOH A;  1J9B A;  1FVJ A;  2MBT A;  1NW2 A;  4EDY A;  3QR6 A;  3L0H A;  1G7O A;  1Z7R A;  2XHF A;  4MZC A;  2X64 A;  3GFK A;  3M0F A;  3UVT A;  4MZW A;  4EF0 A;  4IKH A;  2GDR A;  2X4A A;  2V32 A;  3GKK A;  1FB6 A;  4MF7 A;  2ES7 A;  3UBK A;  2XBI A;  1GUM A;  3TKP A;  4YH2 A;  2F51 A;  4F03 A;  1ERT A;  3KMO A;  1VGL A;  5JCW A;  5D8I A;  1AQW A;  4KDU A;  4X0X A;  4EDZ A;  4YAP A;  4FQU A;  1XVQ A;  3GMF A;  3R2Q A;  2MBS A;  2D2Z A;  4YQU A;  1A23 A;  3GX0 A;  4GLT A;  3E9J B;  2DBC A;  1O81 A;  4P3Y B;  3RPN A;  4F2I A;  1PRX A;  1OC3 A;  1YEP A;  1J08 A;  4Z2T A;  3DRN A;  4RQR A;  2PVQ A;  3GH6 A;  4F0B A;  4ZIL A;  1SL0 B;  2TIR A;  1M2D A;  4G19 A;  4MA9 A;  2YN1 A;  2VM2 A;  1GSQ A;  4N0Z A;  4HZ2 A;  2R5G A;  2DJ3 A;  2B7J A;  3O6T A;  3D6I A;  1WJK A;  2HZE A;  5B7C A;  1WOU A;  1R4W A;  1G6Y A;  2C0D A;  2GS3 A;  1VRS D;  1GSD A;  3FZ9 A;  4GQC A;  4PUA A;  1SYR A;  3ZIT A;  3ERW A;  3ZMK A;  2V6K A;  2VCV A;  2RUF A;  4TXV A;  3TJB A;  4XHM A;  2H19 A;  4MZB A;  3GRX A;  1I5G A;  4I6X A;  4XRD A;  4EE0 A;  1PA3 A;  2GZY A;  3VWV A;  3A5I A;  1M9A A;  3ZRE A;  3L9S A;  1TRV A;  2WGR A;  4RI7 A;  2VL9 A;  4EVM A;  4POK A;  2LQQ A;  1J0F A;  1V58 A;  2H72 A;  1EWX A;  1TOF A;  1YKA A;  5EVO A;  2IME A;  1ZGN A;  1VF2 A;  2YWO A;  4HU7 A;  3E3E A;  1QGV A;  4G0K A;  5E59 A;  5DQY A;  2P0G A;  2K8V A;  1QQ2 A;  2HRN A;  2R3X A;  3LW9 A;  2JAD A;  2XC2 A;  1FB0 A;  2CA8 A;  1JHB A;  4IN0 A;  2H8L A;  3TRX A;  5IQY A;  3TKR A;  1ABA A;  2IPA A;  3EC3 A;  2P5Q A;  4FYB A;  4RI6 A;  3VI7 A;  3DGQ A;  1M2B A;  4OFM A;  3KGK A;  1YQ1 A;  3UBL A;  3WT2 A;  3IC8 A;  1QUW A;  3FZ5 A;  1BYE A;  4RUV A;  5KEJ A;  5DCH A;  3Q18 A;  3VFI A;  1Z5Y E;  2VCX A;  1K0M A;  4ECC A;  1U6T A;  4LMW A;  5DAL B;  1A8Y A;  2YZH A;  3I9V 2;  5ECQ B;  1FOV A;  1GTB A;  2MYG A;  5KN0 A;  2X49 A;  5CO3 A;  3H1N A;  2YWN A;  1PMT A;  4O5Q A;  3A2W A;  5FT3 A;  1MD3 A;  2O7K A;  2OAD A;  1TK5 B;  3RHC A;  5JCG A;  4I97 A;  4N0V A;  3TOU A;  4DEJ A;  5D73 A;  4K9Z A;  2DKI A;  5IMV A;  4TR0 A;  4H86 A;  4TR4 A;  1EV4 A;  3IAM 2;  3P2A A;  1JLV A;  3FYG A;  2H0G A;  1F2E A;  2CZ3 A;  5CRE A;  1AXD A;  5LD0 A;  1QXH A;  1UVZ A;  3P7X A;  4OCF A;  2KP1 A;  4OO4 A;  3WGD A;  2GVP A;  2O89 A;  3IE3 A;  4CY6 A;  2IFQ B;  3KH9 A;  3RHB A;  2CQ9 A;  2QA1 A;  1AQX A;  3KZQ A;  3RPP A;  3VPQ A;  2C3N A;  3QDN A;  4AJ6 A;  4IEL A;  4MMM A;  1FHE A;  4MH2 A;  4WF4 A;  5GAP D;  1A0F A;  2ON7 A;  3F63 A;  2IL3 A;  4KUN A;  2REM A;  4JZQ A;  2J23 A;  4IW9 A;  5IMD A;  4TN8 A;  1GLP A;  3P90 A;  1EEM A;  3I43 A;  4TR1 A;  3KM6 A;  3WGE A;  4PQH A;  3LYK A;  2NTO A;  3CBU A;  5IOW A;  5LNK e;  1PSQ A;  1ZZY A;  5DVB A;  3VPT A;  2KOK A;  3MAK A;  6GSW A;  4J56 E;  4PUF C;  4KF9 A;  1EGO A;  1JZD A;  1KBN A;  3F3R A;  6GSV A;  1M9B A;  2GTU A;  3FR9 A;  5ECI B;  4V1A g;  1TU7 A;  2DMM A;  3C8E A;  3BCK A;  1FW1 A;  1TI3 A;  2YZU A;  3HJP A;  2PU9 C;  1GSS A;  2L4Q A;  5A4W A;  1UC7 A;  3NIV A;  1EZK A;  1SKS B;  4ILF A;  1X5C A;  2H01 A;  3A3T A;  4GRF A;  3GKX A;  2WCI A;  2V1M A;  1MEK A;  2LTK A;  2K8S A;  4ECB A;  4L5L A;  4WET A;  3I69 A;  5ECK B;  4PXO A;  1DSB A;  2RUE A;  3A2V A;  5AIV A;  1Z9H A;  2LRT A;  4KX4 A;  4TW5 A;  5B8B A;  1GWC A;  3CRU A;  5HFG A;  4DSR A;  4ML1 A;  4E8H A;  5EPF A;  2VL3 A;  3KIJ A;  2I4A A;  13GS A;  2OKA A;  5JWO B;  5A4U A;  2JAC A;  2A4H A;  1T1V A;  3GA4 A;  1GP1 A;  2JU5 A;  4NAX A;  2L5L A;  4KCA A;  2BJX A;  2IMK A;  2LS5 A;  2C8U A;  1MDJ A;  5KN3 A;  4ZBD A;  2VCT A;  3QAG A;  2LQO A;  2HT9 A;  5J5N A;  4IHU A;  3FY7 A;  2FWH A;  4MNN A;  3ZIJ A;  4XS1 A;  1SKR B;  3DXB A;  3LXT A;  2HRF A;  4BA7 A;  3GKN A;  3GN3 A;  5JWR B;  1OKT A;  3HA9 A;  4TR3 A;  3C7M A;  3CTG A;  2XPE A;  4G0I A;  3GIX A;  4TVE A;  2YV7 A;  1SJZ A;  3TRP A;  4JE1 A;  4MJA A;  2DIZ A;  3IHG A;  3IV4 A;  3LSZ A;  3GUS A;  1FVK A;  3F4S A;  4K5R A;  1YF0 A;  3MWH A;  4KDY A;  4J57 E;  4O5R A;  2RII A;  5DCG A;  4MPG A;  2LNT A;  5J9B A;  4X43 A;  1XVW A;  4EL1 A;  3D0Z A;  4WKW A;  6GSS A;  1HNB A;  3KTL A;  4WR4 A;  1EP7 A;  2P31 A;  3D4T A;  4MF6 A;  2YWI A;  1KTE A;  3GTU A;  3FZA A;  3HY2 A;  2DSA A;  8GSS A;  2EIR A;  3IDV A;  4Q5N A;  1SD8 A;  4MAB A;  4TXO A;  2V6O A;  1DBY A;  3CSJ A;  5ID2 A;  3ZZX A;  3HKR A;  2H75 A;  2HNL A;  1Z6M A;  3DVW A;  2GQM A;  1K0N A;  5G5E A;  3M8N A;  2FCH A;  3F3Q A;  3KJY A;  3JCM L;  2H1A A;  3E0U A;  3TUE A;  4PGT A;  1Z3E A;  2OA7 A;  4IJ3 A;  2R4V A;  3IBH A;  3CSI A;  4ICY A;  3APO A;  4AGS A;  4N30 A;  1XW5 A;  3DIE A;  2CVB A;  4HJM A;  1XXU A;  3GUR A;  4QL9 A;  1C72 A;  1AQV A;  1ZOF A;  2K9F A;  3VWX A;  1THX A;  2H66 A;  3IK9 A;  2JL4 A;  1V40 A;  4FH8 A;  4BVX B;  1TW9 A;  2OE0 A;  5F8B A;  3W6G A;  2OBI A;  2B1L A;  4GCI A;  10GS A;  1G0T A;  3LFL A;  2PMT A;  3QOU A;  1TRS A;  2HSM A;  4MP4 A;  2FY6 A;  2YP6 A;  4DVC A;  2E2M A;  2OE1 A;  4L8E A;  3W8S A;  4BL7 A;  4EC0 A;  3CRT A;  1V9W A;  2H71 A;  5JWQ B;  1CQG A;  1GRX A;  1QK8 A;  3QMX A;  2Z9S A;  1OE8 A;  5G1K A;  3IOS A;  3ZTL A;  2QA2 A;  4GQF A;  1JLW A;  4K1F A;  2QSI A;  4K2X A;  1KEB A;  3HHV A;  2KLX A;  1PN0 A;  2C1Y A;  3KP9 A;  3F0I A;  2FD3 A;  2LJK A;  1A2L A;  3LEF A;  1T4Z A;  2OAC A;  1TK0 B;  3RBT A;  4OMV A;  4K8M A;  2OBK A;  1HQO A;  2HYX A;  4G10 A;  1Q98 A;  5HR3 A;  1SK0 A;  4GSN A;  3FR6 A;  3H4K A;  3LWA A;  5CRW A;  1OE7 A;  1OC9 A;  2H74 A;  5G2Z A;  5IM9 A;  4BWQ A;  5ENU A;  1SKW B;  2FUG 2;  2YCD A;  1O6J A;  4XS6 A;  2YWM A;  2CAQ A;  2C0F A;  2N5B A;  2C0E A;  3L78 A;  3GL5 A;  3GSS A;  5J9C A;  1B8X A;  4ZL7 A;  4TOP A;  3EU3 A;  5AN1 A;  2VD1 A;  5CYY A;  3C1S A;  5EL8 A;  17GS A;  5ECP B;  1JFU A;  1BAY A;  5IMF A;  2HSH A;  3HCZ A;  4IS0 A;  5A5K A;  4OCE A;  4CHS A;  4FYU A;  1FAA A;  3MNG A;  3M3M A;  4I5Q A;  5C00 A;  2FA4 A;  2YOI A;  2F8A A;  1U88 A;  3QPM A;  7GSS A;  2A2S A;  2X99 A;  5G30 A;  4JRR A;  1NSW A;  2G0F A;  2B1K A;  4HQZ A;  2BMX A;  4ACS A;  5ECR B;  2BTO T;  1RQM A;  4K0G A;  3O76 A;  3HVX A;  2JZS A;  4MJB A;  4K7N A;  4V2N A;  4ZL9 A;  4I8B A;  5G5F A;  4I2T A;  3F6D A;  3TKS E;  5B6N A;  4PNF A;  3D22 A;  1TXX A;  2NDO A;  2HRA A;  1XPV A;  4OO5 A;  2HLS A;  3FZ4 A;  4F82 A;  4Z2R A;  1NM3 A;  4Q5Q A;  5F0G A;  4MCU A;  2R0P A;  2ZCT A;  3TKS A;  4JED A;  1F6M C;  4FYC A;  3VK9 A;  4G9H A;  2VUP A;  2JZR A;  1V98 A;  4LLR A;  3TRQ A;  3LQ7 A;  1HNA A;  1ON4 A;  5AGY A;  2GSQ A;  5CNW A;  1TRU A;  2C0G A;  2LUS A;  3UMA A;  2H1B A;  1SL1 B;  3WGX A;  5IO2 A;  3IXR A;  3HVV A;  1URM A;  2I3Y A;  3CTF A;  3RDW A;  3S9F A;  5KN1 A;  2GT6 A;  1GUH A;  2L5O A;  3HDC A;  4WF5 A;  1PD2 1;  3APS A;  1M0U A;  1PGT A;  4IQ1 A;  1GSY A;  2A2P A;  1MTC A;  3KTB A;  5COH A;  4XS4 A;  3FHK A;  2FWG A;  2ALB A;  5ECO B;  5F06 A;  2DLX A;  1ACV A;  3KP8 A;  1XWK A;  1PL2 A;  2X8G A;  5HFI A;  2UZ8 A;  1R26 A;  3A5W A;  1ZCP A;  2VL2 A;  4ZBB A;  2E7P A;  4V1A p;  1JZR A;  3TJJ A;  1AIU A;  2DJJ A;  2LST A;  4BVY A;  1O85 A;  1K3Y A;  1K3L A;  2YAN A;  2F3M A;  4HJ2 A;  4F0C A;  2ZNM A;  1XW6 A;  2GZZ A;  1ERV A;  1ZYE A;  3GX8 A;  2L57 A;  18GS A;  5IOX A;  1TP9 A;  4ML6 A;  3EYT A;  4LA1 A;  5ECS A;  5J3R A;  3A2X A;  2HZF A;  3IHQ A;  1K0B A;  2N5A A;  1B48 A;  3D4M A;  5ECM B;  3GTU B;  5C04 A;  2CT6 A;  1CQH A;  2ZUP A;  3ME8 A;  12GS A;  2MMO A;  4TXO B;  2O8V B;  5ID2 B;  3GV1 A;  4HU9 A;  2WS2 A;  4E8E A;  1EEJ A;  2H0H A;  3KMN A;  2N5F A;  4KGI A;  1PX7 A;  1IYI A;  3FRC A;  3LG6 A;  5GZZ B;  4MPF A;  4OWY A;  9GSS A;  1E6B A;  1ZYP A;  3H79 A;  1JZO A;  4PNG A;  3VLN A;  1SJ6 A;  2OE3 A;  1M2A A;  2FHE A;  3HVS A;  2CVK A;  3F8U A;  2H73 A;  5ECL B;  1YEX A;  2PUK C;  2YJ7 A;  3K8N A;  1ZYN A;  5GAN D;  2HSY A;  3EWL A;  2IWT A;  1A8L A;  2NPB A;  3KD0 A;  4G2E A;  4AF2 A;  5KOX A;  2IJY A;  5J41 A;  3G7J A;  3C73 A;  4KAE A;  2PBJ A;  2FGX A;  3WYW A;  3UVH A;  2H70 A;  1Z6N A;  2EIQ A;  1WRY A;  4TRX A;  4A5P A;  1ST9 A;  2CZ2 A;  22GS A;  2DJK A;  3D21 A;  3ZVJ A;  3C1R A;  5IO0 A;  1BX9 A;  1OVN A;  2MMN A;  4BL7 B;  1EOG A;  2QGV A;  5D9X A;  5D96 A;  2DKH A;  5FWG A;  1TK8 B;  1HD2 A;  5LCZ A;  2X8H A;  2WJU A;  4J2F A;  1XWB A;  5H5Q A;  1GTA A;  4ECJ A;  2VCQ A;  2CAI A;  3ZLP A;  1MDK A;  1MDI A;  1O8X A;  2WUL A;  3Q19 A;  5DAL A;  1OYJ A;  4EUY A;  1GUK A;  3IA1 A;  4L5O A;  4KW6 A;  5A4V A;  3N5O A;  11GS A;  1YKC A;  4HEA 2;  4BWS A;  3VI5 A;  3WT1 A;  4NXI A;  2R37 A;  3FW2 A;  3L9V A;  5CRG A;  3TCO A;  3TKQ A;  1N2A A;  2QKE A;  1HNC A;  4GTU A;  2VAF A;  5HR2 A;  3BOA A;  3EMX A;  3GH9 A;  6GSU A;  5J4U A;  1F3B A;  1B4Q A;  2RM6 A;  3PH9 A;  1DE2 A;  2EIO A;  1YZX A;  4O92 A;  3HJO A;  3SBC A;  3ZRD A;  2HZE B;  3EE2 A;  5HFK A;  1X5E A;  3U6V A;  1YY7 A;  1GLQ A;  2V41 A;  4IVF A;  4POB A;  4PX1 A;  3ZFB A;  4JU5 A;  5D93 A;  3LJR A;  1AAZ A;  5DAK A;  2H76 A;  3APQ A;  5IPG A;  1Z7P A;  2KUC A;  3QFB C;  1GNE A;  4YKF A;  4HDE A;  4L0W A;  2EC4 A;  5ECN B;  19GS A;  2DJ1 A;  1PKW A;  1BED A;  4KDX A;  1GL8 A;  4MJE A;  4KB3 A;  3KXO A;  3DML A;  1KNG A;  1S3A A;  5IMC A;  1PL1 A;  2HI7 A;  4GWR A;  3UAP A;  1F9M A;  1WIK A;  4KND A;  4PUR A;  1F3A A;  4LL1 B;  2VLV A;  2QC7 A;  4K0N A;  4Z2U A;  3TGZ A;  2VM1 A;  1WE0 A;  2AYT A;  4WEY A;  2C3T A;  3CSH A;  3G7I A;  4EIP A;  2L6D A;  3VWW A;  20GS A;  2AUV A;  2IIY A;  1K0D A;  3IPZ A;  3GL3 A;  1A24 A;  1SJI A;  4JBB A;  1XZO A;  2HRK A;  4POM A;  2YJH A;  4X4J A;  2MMA A;  1O8W A;  3QCP A;  1RK4 A;  2B6M A;  1O73 A;  2XBQ A;  2NBS A;  3D5J A;  3FKF A;  5AIX A;  2H6X A;  4ZB9 A;  1SEN A;  5H5R A;  3IAS 2;  3C71 A;  1WP0 A;  2GQK A;  4NMU A;  3SWL A;  2MMZ A;  2DIY A;  4GXZ A;  3KEB A;  4KSO A;  3QAW A;  2O87 A;  3M9J A;  4TKY A;  1SYX A;  1B4P A;  1ERW A;  4KA0 A;  1AC1 A;  2L6C A;  5F05 A;  2VD0 A;  4IQA A;  2H1D A;  5L71 A;  3UIW A;  1ZL9 A;  3EVI A;  2VLT A;  4XS4 B;  2TRC P;  1K0O A;  1IYH A;  3PPU A;  4ZL8 A;  2DJ0 A;  1VF1 A;  3ED3 A;  3DVX A;  4MH3 A;  2NVL A;  4IGJ A;  1WMJ A;  4DSQ A;  2R2J A;  4BVY B;  2F8F A;  1SL2 B;  1U3A A;  3F4T A;  2PWJ A;  2KHP A;  3UOM A;  1X5D A;  2V2G A;  2YV9 A;  1ZMA A;  4IBP A;  3TJG A;  1EP8 A;  1XWG A;  3BCI A;  4NV2 A;  1LU4 A;  2PER A;  2M72 A;  2LRC A;  1SK1 A;  3Q74 A;  1R5A A;  2HXK A;  4OFN A;  4ECI A;  5DQS A;  5EY6 A;  3TB2 A;  4QQ7 A;  6GST A;  1OC8 A;  3TOT A;  1NHY A;  3GKM A;  3TJF A;  4TR1 B;  3DD3 A;  3DYR A;  4NHW A;  1TI1 A;  2R0C A;  3ZVJ D;  5CP1 A;  1T00 A;  1FO5 A;  2FWF A;  4NV5 A;  2I81 A;  4AJ7 A;  1V2A A;  4HQS A;  1GTU A;  6GSY A;  4KH7 A;  16GS A;  3NZN A;  4V2L A;  5IMZ A;  4X1U A;  3ZIV A;  3DKS A;  3LXZ A;  1GUL A;  3FR3 A;  5FHI A;  5D9V A;  4K5S A;  2H6Y A;  3VWU A;  1V57 A;  1ML6 A;  1B9Y C;  5KN2 A;  2FA8 A;  4QL7 A;  4V2M A;  1I9D A;  2LNS A;  3QFA C;  5GST A;  1OKD A;  4IP6 A;  2R6K A;  5DJL A;  2CX3 A;  3US3 A;  5IMA A;  2JZT A;  4BPY A;  4XCS A;  4WBR D;  3ME7 A;  4PQI A;  2GZP A;  4MK3 A;  1G7E A;  1SU9 A;  4Z7X A;  1T3B A;  4D73 A;  3CMI A;  2H0I A;  3PIN A;  5KOW A;  3OR5 A;  1X9S B;  3HD5 A;  3IK7 A;  1DUG A;  4OFT A;  3KH7 A;  1GSU A;  1GTI A;  3F4R A;  1VF3 A;  1VF4 A;  4MF5 A;  5G1L A;  1G6W A;  4DSS A;  4YAV A;  5D9T A;  1S3D A;  3VUR A;  3ZL5 A;  3R3E A;  4ZB6 A;  3M1G A;  3U5R E;  2TRX A;  4I2U A;  1K0A A;  1WPI A;  2KP2 A;  4CW9 A;  3G9B A;  1U3I A;  4GST A;  4BVX A;  2PVO C;  1FG4 A;  2H6Z A;  1BJX A;  1XIY A;  4N10 A;  2F9S A;  1GNW A;  2RM5 A;  2XPD A;  4XIH A;  1W4V A;  4GF0 A;  3EU4 A;  1SD9 A;  2FNO A;  1H75 A;  2I9H A;  4ISD A;  1ILO A;  4ULX A;  3CYN A;  3ERG A;  2FLS A;  3NOF A;  1XW9 A;  5DDL A;  3PGT A;  1ZYQ B;  3EMP A;  2CV4 A;  1ERU A;  4EO3 A;  4EKZ A;  4OD7 A;  2IMD A;  1EGR A;  3IRA A;  5G31 A;  3CXG A;  4K2D A;  5HR1 A;  4G0L A;  2O85 A;  3F6F A;  1M99 A;  3HZ4 A;  5DAK B;  2WB9 A;  1R7H A;  1PKZ A;  3G7Y A;  1BQ7 A;  3HZ8 A;  1N8J A;  5INY A;  2GLR A;  3UAR A;  2G2Q A;  4WR5 A;  2GSR A;  2ON5 A;  4O32 A;  1NHO A;  1E2Y A;  2L4C A;  2JSY A;  5B8A A;  1TDI A;  4ZBA A;  1A2J A;  3P8W A;  4RQX A;  4K7O A;  1XCC A;  2P5R A;  4NHZ A;  5CRD A;  4EXJ A;  4ID0 A;  2I1U A;  1MD4 A;  2M80 A;  3QD9 A;  1XOB A;  3MDK A;  1QFN A;  4JR4 A;  1EOH A;  2AJQ B;  2HE3 A;  4L0U A;  4HS1 A;  5BMU A;  1RW1 A;  4HOJ A;  1A0R P;  3W8J A;  1U87 A;  2PPT A;  5ELA A;  14GS A;  3MYD A;  2VO4 A;  3J7Y b;  3UL3 A;  5DBQ A;  2LJA A;  1SK2 A;  2GSS A;  1TU8 A;  4ZXG A;  2WDU A;  1Y25 A;  1PQN A;  2AHE A;  2PN8 A;  3LOR A;  1XFL A;  3UJ1 A;  3GNJ A;  4JR6 A;  2OJL A;  1EV9 A;  4MJC A;  2IN3 A;  2GQL A;  4WXT A;  4O5U A;  1X9M B;  2K18 A;  5B6M A;  1X0R A;  2LEG A;  2C4J A;  3N9J A;  1JZW A;  2GGT A;  1TRW A;  2IMI A;  4IP1 A;  3RAZ A;  3H8Q A;  5CAX A;  5IIZ A;  3BD2 A;  5D9W A;  1Q4J A;  4NWY A;  4EIQ A;  3FK8 A;  3TJK A;  5HQP A;  3F9U A;  1XWA A;  5H5S A;  5DJM A;  2VCZ A;  3L4N A;  3V1W A;  3BJ5 A;  4HI7 A;  4LMV A;  4YQV A;  2DJ2 A;  4Q5F A;  5E4W A;  1TJD A;  2YPM A;  1O7U A;  2MZC A;  2CVD A;  4O7H A;  1YJ6 A;  3TKS C;  3HYP A;  1TKD B;  2K6V A;  4AJ8 A;  2C3Q A;  3GYK A;  3ERF A;  3QAV A;  3ISO A;  2YNX A;  3PR8 A;  1GSF A;  4POL A;  2AAW A;  2B5E A;  3J7Y k;  2J9H A;  5JCU A;  1OAZ A;  4YQM A;  1W89 A;  5ABR A;  4XRA A;  1BG5 A;  1K3O A;  3ZYW A;  3EUR A;  4NPB A;  2B7K A;  4FIW A;  1WWJ A;  3H93 A;  1HYU A;  3EPT A;  2B5Y A;  1OC9 B;  1GSE A;  1S3C A;  2LJR A;  5GSS A;  4Q5R A;  1UA5 A;  1QMV A;  2AB6 A;  2DC5 A;  1LBK A;  2WZ9 A;  2A4V A;  3GHA A;  4HZ4 A;  2VCW A;  2HFD A;  4K7I A;  2E2G A;  2R0G A;  4KE3 A;  2VL2 C;  3L9U A;  2GT5 A;  5IPH A;  2LKU A;  2H1G A;  1AW9 A;  4ZB8 A;  2M46 A;  3O3T A;  4KCE A;  1Y6E A;  3AY8 A;  4WBJ A;  2GST A;  3LYP A;  4N11 A;  1XBS A;  1YF1 A;  2C80 A;  5AIS A;  1T8E B;  2IFQ A;  2PGT A;  3BBY A;  2VOC A;  4MLY A;  4KSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...