5G31A

Crystallographic structure of mutant c73s of thioredoxin from litopenaeus vannamei
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
105
structure length
105
Chain Sequence
b'MVYQVKDQEDFTKQLNEAGNKLVVIDFYATWCGPCKMIAPKLEELSQSMSDVVFLKVDVDECEDIAQDNQIASMPTFLFMKNGQKLDSLSGANYDKLLELVEKNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title Is dimerization a common feature in thioredoxins? The case of thioredoxin from Litopenaeus vannamei.
pubmed doi rcsb
source organism Litopenaeus vannamei
molecule tags Oxidoreductase
total genus 34
structure length 105
sequence length 105
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5g31A00
2YP6A 17GSA 1N8JA 2FA8A 2H30A 4ECIA 2Z9SA 1Z5YE 2H74A 3MWHA 2WCIA 2MBSA 5ECHB 3GN3A 2WRTA 3HDCA 6GSYA 4HJ2A 2YNXA 2E2GA 1XW5A 3H8QA 2PU9C 3WGEA 2K9FA 1FOVA 3EVIA 4DVCA 1GNEA 2H1DA 2DMLA 2PVQA 3KZQA 2REMA 4NXIA 3VPQA 3IOSA 2LRCA 5L71A 1M7TA 2I3YA 1SENA 1GL8A 2GZPA 1S3AA 5AIVA 2IMDA 3EYTA 1XXUA 4K2DA 2R3XA 3GYKA 2GDRA 5INYA 2FWGA 1ZGNA 22GSA 4F0BA 4RQXA 1OE7A 1YQ1A 2O89A 3L78A 2WGRA 1JZWA 1OKDA 1WWJA 2P31A 5A5KA 1M2BA 4PX1A 1FB0A 2V41A 4Q5FA 4TVEA 1XOAA 1SKWB 1M2AA 3VWWA 4HOJA 1NHOA 3W8SA 2AAWA 2DBCA 4KDXA 4RI7A 5D8IA 2F8FA 4L5OA 3FR3A 2P5RA 2HNLA 2VCZA 4L0WA 1THXA 2GZYA 2YJHA 1TI3A 3L9VA 4TR1A 1HQOA 1Z9HA 2C3QA 5F07A 3DIEA 4IP1A 1Z6NA 2FUG2 4G9HA 1TRWA 2G0FA 1U87A 1QGVA 5CRGA 4J56E 1WOUA 1SL2B 2CZ2A 1QXHA 5FHIA 1SL1B 3F8UA 4WBJA 4MZWA 5CYYA 1THOA 1SL0B 4F2IA 1T4ZA 3CRTA 1WPIA 6GSSA 1GUMA 3KD0A 4BL7A 3V1WA 1SKRB 1Z7PA 4IGJA 1VF1A 4K7NA 2XPDA 3SBCA 3EE2A 1OC9A 5HFKA 1A23A 4YH2A 1I5GA 5KEJA 2VLVA 2NTOA 2J9HA 1WRYA 2DIYA 1K0BA 3G7JA 4PQHA 1GSQA 2PPTA 1DSBA 1XFLA 3ERGA 1NSWA 4LLRA 4HU7A 2H0GA 3GFKA 4I6XA 2AB6A 4BPYA 1G6WA 1XVWA 1XWBA 4K1FA 5A4WA 1YF1A 2JZTA 4BVYA 4DSSA 3TUEA 1VGLA 1XWAA 3BD2A 4Z7XA 4E8EA 3TRXA 1S3CA 4JR4A 3L9SA 1K3OA 2A4VA 4AF2A 3ZITA 2GQKA 2F8AA 5G2ZA 4TR1B 5IQYA 3FR6A 1J0FA 1PL2A 2VL2C 5JWQB 4KDUA 5HR3A 20GSA 2H0IA 5IO0A 3CXGA 1GH2A 2GVPA 2YZUA 3KMNA 1SJIA 2K18A 4MK3A 1QMVA 4XS6A 4LMVA 3WT2A 3IHQA 3QD9A 3WD6A 5LNKe 5D9VA 1JZDA 2H6ZA 4L8EA 3E9JB 4GF0A 2GZZA 4IJIA 5JCWA 1YDKA 5DBQA 3CSHA 2FCHA 4NWYA 3KEBA 4DSRA 3F0IA 1OC9B 5DJMA 5KN1A 2PBJA 2V6KA 1H4OA 3RPNA 5IMDA 4ZIJA 4MPGA 2B5XA 1V9WA 1ABAA 4MF6A 3L0HA 1TJDA 2YOIA 5IOXA 1AC1A 4GTUA 5F0GA 4K0GA 3LG6A 2KP1A 4MF7A 5JWRB 1IYHA 2ZUPA 4V1Ag 5D9TA 4FIWA 4MH3A 1SJZA 3GKMA 4MF5A 1GTAA 4IN0A 2I4AA 4GSNA 1TU7A 1VF2A 4OFTA 3C1SA 3KTLA 2I9HA 4ILFA 3SWLA 4TR3A 1JLWA 4KUNA 4PXOA 4AJ6A 3FZ5A 3E0UA 2VIMA 4PNFA 1TK0B 4D73B 3LYKA 1V2AA 2DC5A 5DCGA 3VLNA 4JEDA 4YAVA 1M0UA 3O6TA 4MZBA 4N11A 4EF0A 1ZOFA 4IBPA 3IRAA 3KJYA 3TGZA 1AXDA 3G7YA 4E8HA 1BG5A 3EINA 2WS2A 3HJPA 1TDIA 4QL9A 3F3RA 1GLPA 1O81A 1WE0A 3HHVA 4H86A 5GSTA 5HR1A 4L0UA 1GRXA 1IYIA 2OE3A 4RQRA 5JWOB 3EWLA 2C0FA 1Q98A 2CQ9A 2IJYA 2CAIA 1HNBA 2H8LA 1M99A 1U3IA 2DJJA 2N5FA 3HJOA 2BTOT 1E6BA 5F8BA 2JZSA 1ZYQB 1FO5A 3E3EA 2C0GA 2VD1A 3Q18A 1WJKA 3Q6OA 3ZVJA 4K9ZA 1CQHA 2C4JA 8GSSA 4FH8A 2M46A 1GTBA 4KA0A 4IJ3A 5IMFA 4IELA 1XBSA 2I81A 2B7JA 5DAKA 3GURA 2H70A 1EGRA 3H1NA 3PGTA 2QC7A 1Y6EA 5G1KA 4NPBA 1X5CA 1G6YA 2C0DA 3DVWA 4OO4A 4BWQA 1PX6A 2VUPA 1AQVA 2L6CA 1ACVA 4WF4A 1ERVA 3ZZXA 1TW9A 1O8WA 1YEXA 4F03A 5JCGA 3FK8A 4BA7A 1USBA 4JE1A 1BQ7A 1XOBA 2H1GA 5CNWA 4ZB6A 3LWAA 4ZBAA 2C0EA 2PVOC 2IL3A 3HCZA 4KB3A 2QSIA 5AN1A 2FGXA 3UIWA 3TJBA 3ZL5A 2HFDA 2YCDA 4I8BA 5IIZA 2FWEA 3ZTLA 1U3AA 2H19A 3KM6A 3RDWA 5FT3A 1GSSA 3IE3A 2L5LA 5J9BA 5B7CA 2HE3A 3JCML 1KEBA 2CT6A 2CZ3A 3EURA 2V32A 5E59A 4FYUA 4HJMA 1PGTA 1PKWA 1XWKA 4IQ1A 4NHWA 4WKWA 1XWCA 2HSHA 4G2EA 11GSA 4IKHA 4GLTA 5ECSA 4LMWA 1B4PA 1PD21 2H71A 1XZOA 3DD3A 3GA4A 1U6TA 3QMXA 5IPGA 4PUAA 3C71A 4NMUA 1A2MA 1V58A 5CRWA 1K3LA 1XWGA 5DAKB 2PN8A 5ELGA 1TRUA 4QL7A 2DJ0A 2FD3A 5GZZB 4KSMA 4K6XA 2K8VA 3TKSA 4MZCA 3TB2A 3P90A 2L5OA 4AJ7A 5ELAA 4O32A 3DKSA 3VI5A 2YPMA 3GL3A 4N30A 1GSDA 5ECQB 1T7PB 2LNTA 3GKKA 4ID0A 1GUKA 4YQVA 4ZILA 2VCXA 3VWXA 1EV4A 1X9MB 1RQMA 2A2SA 2CVBA 5J5NA 1NM3A 3APQA 1WP0A 1R7HA 2DSAA 3VFIA 3F6DA 1GSYA 3D21A 3QR6A 4GCIA 3TOTA 4NHZA 5D9XA 2I1UA 5A4UA 2F9SA 3F3QA 4PUFC 1LU4A 4K8MA 4KNDA 2AJQB 1JFUA 3KH7A 3PH9A 1PKZA 1A0RP 1J9BA 1B9XC 4TN8A 5J3RA 2PWJA 3KCMA 5DQYA 3QFAC 1EV9A 3VWUA 1TXXA 12GSA 1A8LA 3TOUA 3WT1A 1WIKA 4ZB8A 2L57A 4OO5A 4OMVA 1HNCA 3GV1A 3GH6A 1JHBA 2YWIA 4KW6A 4EKZA 3VWVA 2F3MA 4ZL7A 3LFLA 4HS1A 2VM1A 1SU9A 1J08A 2IPAA 4KGIA 3A2XA 3UBKA 2FLSA 1G7OA 1SYRA 4HDEA 1OAZA 3C73A 2IN3A 4PQIA 3TKPA 2LRTA 5ID2B 4YQUA 2M72A 3I6AA 3CSJA 4GSSA 1SD8A 1TK5B 2VCVA 1GNWA 2EIRA 3A2WA 2NVLA 3TRPA 2RUEA 5ECLB 2MMAA 2VCWA 2O87A 2C1YA 1X5EA 2QGVA 1F3BA 2GQLA 2JZRA 3BCIA 3FYGA 4EL1A 3TJJA 5B6MA 1O6JA 4KE3A 2B5YA 4HEA2 1SD9A 2L4QA 3M1GA 1GTUA 2CX3A 6GSUA 5G30A 1SKSB 2LUSA 1A24A 2GQMA 3A2VA 2ON5A 2ZCTA 1PQNA 1AUCA 3IBHA 2CVDA 1M9BA 2FY6A 3LEFA 5ECNB 5GSSA 2GT6A 5EVOA 5AISA 2IMKA 3FZ9A 1GSFA 3TKSC 4MCUA 2YANA 1K0MA 3ZLPA 4JZQA 3ZRDA 3UMAA 3F6FA 3D0ZA 2KHPA 4WBRD 5H5QA 3CMIA 1R5AA 3DEXA 3IV4A 1PX7A 1R26A 2HT9A 2R4VA 3DMLA 2X8GA 4POLA 2D2ZA 3L4NA 3ISOA 3FR9A 1B48A 2M80A 2GSQA 1K0OA 4IQAA 5IMAA 3ZFLA 4N0VA 2VLUA 3MSZA 2XPEA 19GSA 4EO3A 3KXOA 1MTCA 2OBKA 2MZCA 3UEMA 3IK9A 1TP9A 3O3TA 1F37A 4MP4A 4D73A 3FZAA 1KTEA 2P5QA 1HD2A 5B6NA 2R37A 1Z3EA 1X0RA 5HFIA 5ECPB 3EC3A 5E4WA 1OKTA 1MD4A 2GSSA 1Z7RA 4KAEA 2CX4A 1UN2A 2XHFA 5IOWA 1AW9A 5J4UA 3GX0A 4WF5A 2H76A 2E0QA 2N5BA 2AV4A 3QFBC 3DGQA 1M9AA 4K7IA 3C1RA 2LQOA 4EVMA 2K8SA 2L59A 4MH2A 3EU3A 1RK4A 5ECKB 1VF4A 2OE1A 2C3NA 3VURA 5C00A 3KTBA 1SK1A 1QFNA 1K0AA 1LJRA 2IMIA 4K0NA 4X43A 5LD0A 3US3A 5COHA 1EEJA 1ST9A 2B3SA 1K0NA 3N9JA 2RIIA 2FA4A 5DALB 3KIJA 1ILOA 5ECIB 2R2JA 3ZMKA 1YZXA 3F63A 2LJRA 4ML6A 3S9FA 4LL1B 1B8XA 3UARA 4IP6A 3TKSE 4GQCA 2HYXA 4GWRA 3UOMA 2H1AA 1V40A 2VCQA 4JBBA 3FRCA 2GS3A 3GKXA 3HZ4A 3LYPA 3APOA 5HQPA 4PQ1A 5CRDA 3LORA 3LJRA 5D96A 3ZFBA 3J7Yk 5DJLA 4OCEA 3GTUB 4GQFA 4P3YB 2HRFA 1MDKA 3R2QA 2XBQA 1N2AA 2BMXA 1GLQA 4EDZA 4F9ZA 3FHKA 1OE8A 4KCEA 2CA8A 1TU8A 1SK2A 2ALBA 2H0HA 3TRQA 2KOKA 1PSQA 1SK0A 3D4MA 1GSEA 2C3TA 4IVFA 16GSA 4MA9A 3ME8A 1FG4A 1H75A 2ES7A 2WJUA 2KUCA 1GSUA 1FVKA 4GXZA 3RHBA 1PMTA 3HXSA 3F4RA 1QUWA 1JLVA 4JRRA 3BJ5A 2HI7A 5AIXA 2NDOA 2IIYA 3H93A 9GSSA 1DUGA 3HVVA 4ZB9A 4X1UA 4OFMA 2RM6A 4TKYA 1UVZA 3H4KA 2KP2A 3PR8A 2DJ1A 1F2EA 1BYEA 1PA3A 3QAGA 3UL3A 4CHSA 1ZCPA 3D5JA 4QQ7A 2LQQA 3UAPA 4HUAA 1C72A 2R6KA 2YV9A 2GSRA 5CO3A 1TOFA 3QPMA 4TXOB 4EUYA 4RI6A 5HR0A 5F06A 3MAKA 2HSYA 4MABA 3GH9A 1XVQA 4MLYA 1PRXA 4F82A 2X99A 2G2QA 1T1VA 2V6OA 3RHCA 3BBYA 3OR5A 3ZREA 3U6VA 2XBIA 1EEMA 2JACA 1AIUA 1BAYA 5D9WA 4I2UA 4POKA 3D6IA 4ZL8A 2PERA 2AHEA 4HZ4A 3O76A 5IMCA 1LBKA 3W6GA 4AJ8A 2XC2A 3Q74A 4I2TA 1A8YA 5EY6A 3W8JA 4HU9A 4GSTA 1TKDB 2O7KA 4WXTA 3TKRA 1GP1A 2N5AA 2LV3A 2YWNA 2GTUA 2F51A 2WZ9A 2OE0A 4ZBBA 2VAFA 3KP8A 4L5LA 5H5RA 4EXJA 1AAZA 1OYJA 4O7HA 3FZ4A 2IFQB 1AQXA 4CDOA 4NV5A 4WETA 2FWHA 2MMZA 2AUVA 3IDVA 1ON4A 4YQMA 2MBTA 2JSYA 1MDIA 3LGCA 1T4YA 2YZHA 4LL4B 3WGXA 5ID2A 3IXRA 5ECRB 4TRXA 2B7KA 3IAS2 4N0ZA 2DLXA 5J9CA 3GSTA 4MJBA 3UJ1A 3FY7A 3TJGA 3TKQA 1F3AA 2H6XA 3HYPA 3IC4A 2B1KA 3F4SA 1G0TA 1ERUA 1ERWA 1O8XA 1O73A 3CYNA 2H1BA 4PGTA 5D73A 2LTKA 1M2DA 4ISDA 4FO5A 3CTGA 1MD3A 2B5EA 3MDKA 3IR4A 2HZEA 3FEUA 1PN9A 2K6VA 3M3MA 5ENUA 3ZIVA 4PURA 3VPTA 3IA1A 2PUKC 3HA9A 5D93A 5CRHA 5ABRA 1K0CA 1OVNA 2PGTA 2QKEA 1Z6MA 3CTFA 6GSVA 1V98A 3ZIJA 2PMTA 5IO2A 4WR4A 3GHAA 3UVTA 4K7OA 4MJCA 4POMA 1YKAA 4OCFA 1ZL9A 1K0DA 3TDGA 1KNGA 2EC4A 1FB6A 2VL2A 1E2YA 2VL9A 3F9UA 2R5GA 4NAXA 4TOPA 3QDNA 3BOAA 2LSTA 14GSA 5ECMB 2DIZA 1A2LA 3EU4A 5H5SA 4EC0A 3BCKA 4KDYA 2YJ7A 1A0FA 1T3BA 1R4WA 5G5EA 3LXTA 3AY8A 1TK8B 1W4VA 1VF3A 4YAPA 5CREA 3GRXA 4FYBA 2FHEA 4FYCA 2E2MA 1EOHA 2HLSA 4XIHA 4RUVA 4ECCA 1TI1A 4XS4A 5CP1A 1W89A 2WFCA 2CVKA 4CW9A 4BWSA 1CQGA 1F6MC 4V2MA 2B6MA 2HZEB 2DJKA 3D22A 5F05A 2TRXA 3RAZA 1QQ2A 2CAQA 4I97A 1ERTA 3DRNA 4HI7A 2X8CA 2H6YA 1I9DA 2E7PA 3ME7A 3EMPA 4HQZA 3I9V2 3PINA 2X64A 7GSSA 3LQ7A 5EL8A 3GIXA 4PNGA 1WMJA 3J7Yb 5B8BA 1PL1A 1ZYEA 2HXKA 1T00A 4KSOA 2P0GA 5EPFA 3DWVA 5J41A 4LA1A 3P8WA 3EMXA 3WGDA 2HZFA 13GSA 3M8NA 1R5PA 2ON7A 1X5DA 2L6DA 4XHMA 5G1LA 3IAM2 2WULA 5KN2A 5KN3A 4Q5RA 5B8AA 1XPVA 2OJLA 5DVBA 5GAND 1O7UA 4IW9A 2FNOA 1KBNA 2YN1A 3G9BA 2GGTA 1EZKA 1NHYA 5DALA 3VI7A 2J23A 2H66A 1YY7A 3LSZA 3U5RE 2OA7A 1BEDA 2VO4A 5CAXA 1UC7A 4DSQA 1BX9A 3Q19A 1MDJA 5C04A 4XS4B 1EGOA 4ECJA 2KLXA 3LXZA 3CBUA 5G5FA 3F4TA 2JL4A 3ZMLA 1F9MA 3GTUA 1DBYA 1GWCA 1HYUA 4KCAA 4POBA 2H72A 2FWFA 2VL3A 3FKFA 3QCPA 1SYXA 3ZYWA 3HZ8A 2C8UA 5AGYA 2DJ2A 3TJKA 4TR4A 1EOGA 3UVHA 1XCCA 1URMA 3H79A 2DJ3A 3HVSA 3UBLA 3DYRA 4HQSA 3HD5A 2JADA 3KH9A 3RBTA 4ZL9A 2NBSA 1T8EB 1EP7A 1X9WB 2GLRA 4F0CA 3GX8A 1JZOA 5HR2A 2DMMA 3I69A 3FW2A 4Q5QA 6GSWA 3M9KA 3GL5A 1RW1A 2CV4A 4ACSA 1FAAA 4DSSB 2ZNMA 3HVXA 2RLIA 4O92A 1VRSD 3VK9A 4NV2A 1B4QA 1Q4JA 2OKAA 3M0FA 2LEGA 3NIVA 3NZNA 1XW9A 2V1MA 1OC3A 1FW1A 3DVXA 4WR5A 2LRNA 4MDCA 4XTSA 4ML1A 2C80A 4TXOA 1YKCA 1BJXA 5GAPD 1UA5A 4GRFA 5KN0A 3I43A 2V2GA 2LJAA 4KX4A 1GTIA 4X0XA 4OD7A 3D4TA 2O8VB 1TRSA 2TIRA 4HZ2A 4Q5NA 4JR6A 3KGKA 4G10A 1S3DA 4MMMA 1V57A 2MMNA 1FVJA 1QK8A 2EIOA 4OWYA 2LJKA 1FHEA 3C8EA 1TRVA 2WB9A 3CRUA 2IMEA 1HNAA 2H01A 3P2AA 1EP8A 3N5OA 1X9SB 4TXVA 3NOFA 2RM5A 3MNGA 1U88A 5JCUA 3HKRA 1ZZYA 4TR0A 1NW2A 2IFQA 2NPBA 2L4CA 1B9YC 1Y25A 4XRAA 2JSZA 4MPFA 4DEJA 1SJ6A 3IPZA 5IM9A 4IS0A 2IMFA 4EDYA 1AQWA 4KH7A 2A2RA 3G7IA 4J2FA 5ECOB 4J57E 3CSIA 3A5WA 4XRDA 4WEYA 3KP9A 1YF0A 3RPPA 3HY2A 1DE1A 4ZBDA 1G7EA 5DCHA 2OACA 1ZMAA 5A4VA 2LS5A 18GSA 3IK7A 3ED3A 5IMVA 1O85A 2B1LA 1MEKA 4MJEA 3TJFA 3DXBA 2WDUA 3APSA 5DQSA 2EIQA 5IPHA 4ECBA 5HFGA 3ERFA 4V2NA 5LCZA 1XW6A 2IWTA 5DDLA 10GSA 1JZRA 2X8HA 1K3YA 2VCTA 4EE0A 1GUHA 4AGSA 3QAVA 5FWGA 4V1Ap 3C7MA 1GULA 4TW5A 4XS1A 2VM2A 3GSSA 2RUFA 2JU5A 1A2JA 4JU5A 4I5QA 4V2LA 2OBIA 3GMFA 3QAWA 4MJAA 3P7XA 3ERWA 2YV7A 6GSXA 2YWOA 2GT5A 3TCOA 2VOCA 1TTZA 4G19A 4N10A 1OC8A 1ML6A 2LNSA 2MYGA 2MMOA 3GKNA 2VLTA 2OADA 4ULXA 4XCSA 2AYTA 2TRCP 2H73A 2LKUA 4IHUA 3QOUA 3HJMA 2GSTA 1DE2A 1EWXA 3KMOA 3L9UA 2H75A 2BJXA 1YJ6A 4OFNA 3K8NA 6GSTA 3GNJA 2O85A 4ZXGA 3M9JA 1YEPA 5G31A 4BVXA 3GUSA 2YWMA 3ZVJD 1XIYA 3WYWA 5IMZA 4O5RA 2HRNA 2VD0A 3A3TA
chains in the Genus database with same CATH superfamily
2YP6A 17GSA 1N8JA 2FA8A 2H30A 2X49A 4ECIA 2Z9SA 1Z5YE 2H74A 3MWHA 2WCIA 2MBSA 5ECHB 3GN3A 2WRTA 3HDCA 6GSYA 4HJ2A 2YNXA 2E2GA 1XW5A 3H8QA 2PU9C 3WGEA 2K9FA 1FOVA 3EVIA 4DVCA 1GNEA 2H1DA 2DMLA 2PVQA 3KZQA 2REMA 4NXIA 3VPQA 3IOSA 2LRCA 5L71A 1M7TA 2I3YA 1SENA 1GL8A 2GZPA 1S3AA 5AIVA 3R3EA 2IMDA 3EYTA 1XXUA 4K2DA 2R3XA 3GYKA 2GDRA 5INYA 2FWGA 1ZGNA 22GSA 4F0BA 4RQXA 1OE7A 1YQ1A 2O89A 3L78A 2WGRA 1JZWA 1OKDA 1WWJA 2P31A 5A5KA 1M2BA 4PX1A 1FB0A 2V41A 4Q5FA 2DKHA 4TVEA 1XOAA 1SKWB 1M2AA 3HVNA 3VWWA 4HOJA 1NHOA 3W8SA 2AAWA 2DBCA 4KDXA 4RI7A 5D8IA 2F8FA 4L5OA 3FR3A 4HSCX 2P5RA 2HNLA 2VCZA 4L0WA 1THXA 2GZYA 2YJHA 1TI3A 3L9VA 4TR1A 1HQOA 1Z9HA 2C3QA 5F07A 3DIEA 4IP1A 1Z6NA 2FUG2 4G9HA 1TRWA 2G0FA 1U87A 1QGVA 5CRGA 4J56E 1WOUA 1SL2B 2CZ2A 1QXHA 5FHIA 1SL1B 3F8UA 4WBJA 4MZWA 5CYYA 1THOA 1SL0B 4F2IA 1T4ZA 3CRTA 1WPIA 6GSSA 1GUMA 3KD0A 5BMUA 4BL7A 3V1WA 1SKRB 1Z7PA 4IGJA 1VF1A 4K7NA 2XPDA 3SBCA 3EE2A 1OC9A 5HFKA 1A23A 4YH2A 1I5GA 5KEJA 2VLVA 2NTOA 2J9HA 1WRYA 2DIYA 1K0BA 3G7JA 4PQHA 1GSQA 2PPTA 1DSBA 1XFLA 3ERGA 2HRKA 1NSWA 4LLRA 4HU7A 2H0GA 3GFKA 4I6XA 2AB6A 4BPYA 1G6WA 1XVWA 1XWBA 4K1FA 5A4WA 1YF1A 2JZTA 4BVYA 4DSSA 3TUEA 1VGLA 1XWAA 3BD2A 4Z7XA 4E8EA 3TRXA 1S3CA 4JR4A 3L9SA 1K3OA 2A4VA 4AF2A 4Z2TA 3ZITA 2GQKA 2F8AA 5G2ZA 4TR1B 5IQYA 1PFOA 3FR6A 1J0FA 1PL2A 2VL2C 5JWQB 4KDUA 5HR3A 20GSA 2H0IA 5IO0A 3CXGA 3PPUA 1GH2A 2GVPA 2YZUA 3KMNA 1SJIA 2K18A 4MK3A 1QMVA 4XS6A 4LMVA 3WT2A 3IHQA 3QD9A 3WD6A 3A5IA 5LNKe 5D9VA 1JZDA 2H6ZA 4L8EA 3E9JB 4GF0A 2GZZA 4IJIA 5JCWA 1YDKA 5DBQA 3CSHA 2FCHA 4NWYA 3KEBA 4DSRA 3F0IA 1OC9B 5DJMA 5KN1A 2PBJA 2V6KA 1H4OA 3RPNA 5IMDA 4ZIJA 4MPGA 2B5XA 1V9WA 1ABAA 4MF6A 3L0HA 1TJDA 2YOIA 5IOXA 1AC1A 4GTUA 5F0GA 4K0GA 3LG6A 2KP1A 4MF7A 5JWRB 1IYHA 2ZUPA 4V1Ag 5D9TA 4FIWA 4MH3A 1SJZA 3GKMA 4MF5A 1GTAA 4IN0A 2I4AA 1S3RA 4GSNA 1TU7A 1VF2A 4OFTA 3C1SA 3KTLA 2I9HA 4ILFA 3SWLA 4TR3A 1JLWA 4KUNA 4PXOA 2R0PA 4O5UA 4AJ6A 3FZ5A 3E0UA 2VIMA 4PNFA 1TK0B 4D73B 3LYKA 1V2AA 2DC5A 5DCGA 3EPTA 3VLNA 4JEDA 4YAVA 1M0UA 3O6TA 4MZBA 4N11A 4EF0A 1ZOFA 4IBPA 3IRAA 3KJYA 3TGZA 1AXDA 3G7YA 4E8HA 1BG5A 3EINA 2WS2A 3HJPA 1TDIA 4QL9A 3F3RA 1GLPA 1O81A 1WE0A 3HHVA 4H86A 5GSTA 5HR1A 2R0CA 4L0UA 1GRXA 1IYIA 2OE3A 4RQRA 5JWOB 4G0KA 3EWLA 2C0FA 1Q98A 2CQ9A 2IJYA 2CAIA 1HNBA 2H8LA 2QA1A 1M99A 1U3IA 2DJJA 2N5FA 3HJOA 2BTOT 1E6BA 5F8BA 2JZSA 1ZYQB 1FO5A 3E3EA 2C0GA 2VD1A 3Q18A 1WJKA 3Q6OA 3ZVJA 4K9ZA 1CQHA 2C4JA 8GSSA 4FH8A 2M46A 1GTBA 4KA0A 4IJ3A 5IMFA 4IELA 1XBSA 2I81A 2B7JA 5DAKA 3GURA 2H70A 1EGRA 3H1NA 3PGTA 2QC7A 1Y6EA 5G1KA 4NPBA 1X5CA 1G6YA 2C0DA 3DVWA 4OO4A 4BWQA 1PX6A 2VUPA 1AQVA 2L6CA 1ACVA 4WF4A 1ERVA 3ZZXA 1TW9A 1O8WA 1YEXA 4F03A 2DKIA 5JCGA 3FK8A 4BA7A 1USBA 4JE1A 1BQ7A 1XOBA 2H1GA 5CNWA 4ZB6A 3LWAA 4ZBAA 2C0EA 2PVOC 2IL3A 3HCZA 4KB3A 2QSIA 5AN1A 2FGXA 3UIWA 3TJBA 3ZL5A 2HFDA 2YCDA 4I8BA 5IIZA 2FWEA 3ZTLA 1U3AA 2H19A 3KM6A 3RDWA 4BIKA 2A4HA 5FT3A 1GSSA 3IE3A 2L5LA 5J9BA 5B7CA 2HE3A 3JCML 1KEBA 2CT6A 2CZ3A 3EURA 2V32A 5E59A 4FYUA 4HJMA 1PGTA 1PKWA 1XWKA 4IQ1A 4NHWA 4WKWA 1XWCA 2HSHA 3IC8A 4G2EA 11GSA 4IKHA 4GLTA 5ECSA 4LMWA 1B4PA 1PD21 2H71A 1XZOA 3DD3A 3GA4A 1U6TA 3QMXA 5IPGA 4PUAA 3C71A 4NMUA 1A2MA 1V58A 5CRWA 1K3LA 1XWGA 5DAKB 2PN8A 5ELGA 1TRUA 4QL7A 2DJ0A 2FD3A 5GZZB 4KSMA 2QA2A 4K6XA 2K8VA 3TKSA 4MZCA 3TB2A 3P90A 2L5OA 4AJ7A 5ELAA 4O32A 3DKSA 3VI5A 2YPMA 3GL3A 4N30A 1GSDA 5ECQB 1T7PB 2LNTA 3GKKA 4ID0A 1GUKA 4YQVA 4ZILA 2VCXA 3VWXA 1EV4A 1X9MB 1RQMA 2A2SA 2CVBA 5J5NA 1NM3A 3APQA 1WP0A 1R7HA 2DSAA 3VFIA 3F6DA 1GSYA 3D21A 3QR6A 4GCIA 3TOTA 4NHZA 5D9XA 2I1UA 5A4UA 2F9SA 3F3QA 4PUFC 1LU4A 4K8MA 4KNDA 2AJQB 1JFUA 3KH7A 2X4AA 3PH9A 1PKZA 1A0RP 1J9BA 1B9XC 4TN8A 5J3RA 2PWJA 3KCMA 5DQYA 3QFAC 1EV9A 3VWUA 1TXXA 12GSA 1A8LA 3TOUA 3WT1A 1WIKA 4ZB8A 2L57A 4OO5A 4OMVA 1M3JA 1ZYPA 1HNCA 3GV1A 3GH6A 1JHBA 2YWIA 4KW6A 4EKZA 3VWVA 2F3MA 4ZL7A 3LFLA 4HS1A 2VM1A 1SU9A 1J08A 2IPAA 4KGIA 3A2XA 3UBKA 2FLSA 1G7OA 1SYRA 4HDEA 1OAZA 3C73A 2IN3A 3MIXA 4PQIA 2LRTA 3TKPA 5ID2B 4YQUA 2M72A 3I6AA 3CSJA 4GSSA 1SD8A 1TK5B 2VCVA 1GNWA 2EIRA 3A2WA 2NVLA 3TRPA 2RUEA 5ECLB 2MMAA 2VCWA 4CY6A 2O87A 2C1YA 1X5EA 2QGVA 1F3BA 2GQLA 2JZRA 3BCIA 3FYGA 4EL1A 3TJJA 5B6MA 1O6JA 4KE3A 2B5YA 4HEA2 1SD9A 2L4QA 3M1GA 1GTUA 2CX3A 6GSUA 5G30A 1SKSB 2LUSA 1A24A 2GQMA 3A2VA 2ON5A 2ZCTA 1PQNA 1AUCA 3IBHA 2CVDA 1M9BA 2FY6A 3LEFA 5ECNB 5GSSA 2GT6A 5EVOA 5AISA 2IMKA 3FZ9A 1GSFA 3TKSC 4MCUA 2YANA 1K0MA 3ZLPA 4JZQA 3ZRDA 3UMAA 3F6FA 3D0ZA 2KHPA 4WBRD 5H5QA 3CMIA 1R5AA 3DEXA 3IV4A 1PX7A 1R26A 2HT9A 2R4VA 3DMLA 2X8GA 4POLA 2D2ZA 3L4NA 4ICYA 3ISOA 3FR9A 1B48A 2M80A 2GSQA 1K0OA 4IQAA 5IMAA 3ZFLA 4N0VA 2VLUA 3MSZA 2XPEA 19GSA 4EO3A 3KXOA 1MTCA 2OBKA 4K2XA 2MZCA 3UEMA 3IK9A 1TP9A 3O3TA 1F37A 4MP4A 4D73A 3FZAA 1KTEA 2P5QA 1HD2A 5B6NA 2R37A 1Z3EA 1X0RA 5HFIA 5ECPB 3EC3A 5E4WA 1OKTA 1MD4A 2GSSA 1Z7RA 4KAEA 2CX4A 1UN2A 2XHFA 5IOWA 1AW9A 5J4UA 4FQUA 3GX0A 4WF5A 2H76A 2E0QA 2N5BA 2AV4A 3QFBC 3DGQA 1M9AA 4K7IA 3C1RA 2LQOA 4EVMA 2K8SA 2L59A 4MH2A 3EU3A 1RK4A 5ECKB 1VF4A 2OE1A 2C3NA 3VURA 5C00A 3KTBA 1SK1A 1QFNA 1K0AA 1LJRA 2IMIA 4K0NA 4X43A 5LD0A 3US3A 5COHA 1EEJA 1ST9A 2B3SA 1K0NA 3N9JA 2RIIA 2FA4A 5DALB 3KIJA 1ILOA 5ECIB 2R2JA 3ZMKA 1YZXA 3F63A 2LJRA 4ML6A 3S9FA 4LL1B 1B8XA 3UARA 4IP6A 3TKSE 4GQCA 2HYXA 4GWRA 3UOMA 2H1AA 1V40A 2VCQA 4JBBA 3FRCA 2GS3A 3GKXA 3HZ4A 3LYPA 3APOA 5HQPA 4PQ1A 4MNNA 5CRDA 3LORA 3LJRA 4USSA 5D96A 3ZFBA 3J7Yk 5DJLA 4OCEA 3GTUB 4GQFA 4P3YB 2HRFA 1MDKA 3R2QA 4A5PA 2XBQA 1N2AA 2BMXA 1GLQA 4EDZA 3MYDA 4F9ZA 3FHKA 1OE8A 4KCEA 2CA8A 1TU8A 1SK2A 2ALBA 2H0HA 4Z2RA 3TRQA 2KOKA 1PSQA 1SK0A 3D4MA 1GSEA 2C3TA 4IVFA 16GSA 4MA9A 3ME8A 1FG4A 1H75A 2ES7A 2WJUA 2KUCA 1GSUA 1FVKA 4GXZA 3RHBA 1PMTA 3HXSA 3F4RA 4PTSA 1QUWA 1JLVA 4JRRA 3BJ5A 2HI7A 5AIXA 2NDOA 2IIYA 3H93A 9GSSA 1DUGA 3HVVA 4ZB9A 4X1UA 4OFMA 2RM6A 4TKYA 1UVZA 3H4KA 4YKFA 2KP2A 2HSMA 3PR8A 2DJ1A 1F2EA 1BYEA 1PA3A 3QAGA 3CQFA 3UL3A 4CHSA 1ZCPA 3D5JA 4QQ7A 2LQQA 3UAPA 4HUAA 1C72A 2R6KA 2YV9A 2GSRA 5CO3A 1TOFA 3QPMA 4TXOB 4EUYA 4RI6A 1XG8A 5HR0A 5F06A 3MAKA 2HSYA 4MABA 3GH9A 1XVQA 4MLYA 1PRXA 4F82A 2X99A 2G2QA 1T1VA 2V6OA 3RHCA 3BBYA 3OR5A 3ZREA 5KOXA 3U6VA 2XBIA 1EEMA 2JACA 1AIUA 1BAYA 5D9WA 4I2UA 4POKA 3D6IA 4ZL8A 2PERA 2AHEA 4HZ4A 3O76A 5IMCA 1LBKA 3W6GA 4AJ8A 2XC2A 3Q74A 4I2TA 1A8YA 5EY6A 3W8JA 4HU9A 4GSTA 1TKDB 2O7KA 4WXTA 3TKRA 1GP1A 2N5AA 2LV3A 2YWNA 2GTUA 2F51A 2WZ9A 2OE0A 2HRAA 4ZBBA 2VAFA 3KP8A 4L5LA 5H5RA 4EXJA 1AAZA 1OYJA 4O7HA 3FZ4A 2IFQB 1AQXA 4CDOA 4NV5A 4WETA 2FWHA 2MMZA 2AUVA 3IDVA 1ON4A 3LW9A 4YQMA 2MBTA 4X4JA 2JSYA 1MDIA 3LGCA 1T4YA 2YZHA 4LL4B 3WGXA 5ID2A 3IXRA 5ECRB 4TRXA 2B7KA 3IAS2 4N0ZA 2DLXA 5J9CA 3GSTA 4MJBA 3UJ1A 3FY7A 3TJGA 3TKQA 1F3AA 2H6XA 3HYPA 3IC4A 2B1KA 3F4SA 1G0TA 1ERUA 1ERWA 1FOHA 1O8XA 1O73A 3CYNA 2H1BA 4PGTA 5D73A 2LTKA 1M2DA 4ISDA 4FO5A 3CTGA 1MD3A 2B5EA 3MDKA 3IR4A 2HZEA 3FEUA 1PN9A 2K6VA 3M3MA 5ENUA 3ZIVA 4Z2UA 4G0LA 4PURA 3VPTA 3IA1A 2PUKC 3HA9A 5D93A 4K5RA 4K5SA 5CRHA 5ABRA 1K0CA 1OVNA 2PGTA 2QKEA 1Z6MA 3CTFA 6GSVA 1V98A 3ZIJA 2PMTA 5IO2A 4WR4A 3GHAA 3UVTA 4K7OA 4MJCA 4POMA 1YKAA 4OCFA 1ZL9A 1K0DA 3TDGA 1KNGA 2EC4A 1FB6A 2VL2A 5BRTA 4G0IA 1E2YA 2VL9A 3F9UA 2R5GA 4NAXA 4TOPA 3QDNA 3BOAA 2LSTA 14GSA 5ECMB 2DIZA 1A2LA 3EU4A 5H5SA 4EC0A 3BCKA 4KDYA 2YJ7A 1A0FA 1T3BA 1R4WA 5G5EA 3LXTA 3AY8A 1TK8B 1W4VA 1VF3A 4YAPA 5CREA 3GRXA 4FYBA 2FHEA 4FYCA 2E2MA 4BVXB 1EOHA 2HLSA 4XIHA 4RUVA 4ECCA 1TI1A 4XS4A 5CP1A 3FMWA 1W89A 2WFCA 2CVKA 4CW9A 4BWSA 1CQGA 1F6MC 4V2MA 2B6MA 2HZEB 2DJKA 3D22A 5F05A 2TRXA 3RAZA 1QQ2A 2CAQA 4I97A 1ERTA 3DRNA 4HI7A 2X8CA 2H6YA 1I9DA 2E7PA 3ME7A 3EMPA 4HQZA 3I9V2 3PINA 2X64A 7GSSA 3LQ7A 5EL8A 3GIXA 4PNGA 1WMJA 3J7Yb 5B8BA 1PL1A 1ZYEA 2HXKA 1T00A 4KSOA 2P0GA 5EPFA 3DWVA 5J41A 4LA1A 3P8WA 3EMXA 3WGDA 2HZFA 13GSA 3M8NA 1R5PA 2ON7A 1X5DA 2L6DA 4XHMA 5G1LA 3IAM2 2WULA 5KN2A 5KN3A 4Q5RA 5B8AA 1XPVA 2OJLA 5DVBA 5GAND 1O7UA 4IW9A 2FNOA 1KBNA 2YN1A 3G9BA 2GGTA 1EZKA 1NHYA 5DALA 3VI7A 2J23A 2A2PA 2H66A 1YY7A 3LSZA 3U5RE 2OA7A 1BEDA 2VO4A 5CAXA 1UC7A 2UZ8A 4DSQA 1BX9A 3Q19A 1MDJA 5C04A 4XS4B 1EGOA 4ECJA 2KLXA 3LXZA 3CBUA 5G5FA 3F4TA 2JL4A 3ZMLA 1F9MA 3GTUA 1DBYA 1GWCA 1HYUA 4KCAA 4POBA 2H72A 2FWFA 4EIPA 2VL3A 3FKFA 3QCPA 1SYXA 3ZYWA 3HZ8A 2C8UA 5AGYA 2DJ2A 3TJKA 4O5QA 4TR4A 4BL7B 1EOGA 3UVHA 1XCCA 1URMA 3H79A 2DJ3A 3HVSA 3UBLA 3DYRA 4HQSA 3HD5A 2JADA 3KH9A 3RBTA 4ZL9A 2NBSA 1T8EB 1EP7A 1X9WB 2GLRA 4F0CA 3GX8A 1JZOA 5HR2A 2DMMA 3I69A 3FW2A 4Q5QA 6GSWA 4KF9A 3M9KA 3GL5A 1RW1A 2CV4A 4ACSA 1FAAA 4YKGA 4BVYB 4DSSB 2ZNMA 3HVXA 2RLIA 4O92A 1VRSD 3VK9A 4NV2A 1B4QA 1Q4JA 2OKAA 3M0FA 2LEGA 3NIVA 3NZNA 1XW9A 1M3IA 4CY8A 2V1MA 1OC3A 1FW1A 3DVXA 4WR5A 2LRNA 4MDCA 4XTSA 4ML1A 2C80A 4TXOA 1YKCA 1BJXA 5GAPD 1UA5A 4GRFA 5KN0A 3I43A 2V2GA 2LJAA 4KX4A 1GTIA 4X0XA 4OD7A 1ZYNA 3D4TA 2O8VB 1TRSA 2TIRA 4HZ2A 5KOWA 4Q5NA 4JR6A 3KGKA 4G10A 1S3DA 4MMMA 1V57A 2MMNA 1FVJA 1QK8A 2EIOA 4OWYA 2LJKA 1FHEA 3C8EA 1TRVA 2WB9A 3CRUA 2IMEA 1HNAA 2H01A 3P2AA 1EP8A 3N5OA 1X9SB 4TXVA 3NOFA 2RM5A 3MNGA 1U88A 5JCUA 3HKRA 1ZZYA 4TR0A 4EIQA 1NW2A 2IFQA 2NPBA 2L4CA 1B9YC 1Y25A 4XRAA 2JSZA 4MPFA 4DEJA 1SJ6A 3IPZA 5IM9A 4IS0A 2IMFA 4EDYA 1AQWA 4KH7A 2A2RA 3G7IA 4J2FA 5ECOB 4J57E 3CSIA 3A5WA 4XRDA 4WEYA 3KP9A 1YF0A 3RPPA 3HY2A 1DE1A 4ZBDA 1G7EA 5DCHA 2OACA 1ZMAA 5A4VA 2LS5A 18GSA 3IK7A 3ED3A 5IMVA 1O85A 2B1LA 1MEKA 4MJEA 3TJFA 3DXBA 2WDUA 3APSA 5DQSA 2EIQA 5IPHA 4ECBA 5HFGA 3ERFA 4V2NA 1PN0A 5LCZA 1XW6A 2IWTA 5DDLA 10GSA 1JZRA 2X8HA 1K3YA 2VCTA 4EE0A 1GUHA 4AGSA 3QAVA 5FWGA 4V1Ap 3C7MA 1GULA 4TW5A 4XS1A 2VM2A 3GSSA 2RUFA 2JU5A 1A2JA 4JU5A 4I5QA 4V2LA 2OBIA 3GMFA 3QAWA 4MJAA 3P7XA 3ERWA 2YV7A 6GSXA 2YWOA 2GT5A 3TCOA 2VOCA 1TTZA 4G19A 4N10A 1OC8A 1ML6A 2LNSA 2MYGA 2MMOA 3GKNA 2VLTA 2OADA 4ULXA 4XCSA 2AYTA 2TRCP 2H73A 2LKUA 4IHUA 3QOUA 3HJMA 2GSTA 1DE2A 1EWXA 3KMOA 3L9UA 2H75A 2BJXA 1YJ6A 4OFNA 3K8NA 6GSTA 3GNJA 2R0GA 3IHGA 2O85A 4ZXGA 3M9JA 1YEPA 5G31A 4BVXA 3GUSA 2YWMA 3ZVJD 1XIYA 3WYWA 5IMZA 4O5RA 2HRNA 2VD0A 3A3TA
chains in the Genus database with same CATH topology
2YP6A 17GSA 1N8JA 2FA8A 2H30A 2X49A 4ECIA 2Z9SA 1Z5YE 2H74A 3MWHA 2WCIA 2MBSA 5ECHB 3GN3A 2WRTA 3HDCA 6GSYA 4HJ2A 2YNXA 2E2GA 1XW5A 3H8QA 2PU9C 3WGEA 2K9FA 1FOVA 3EVIA 4DVCA 1GNEA 2H1DA 2DMLA 2PVQA 3KZQA 2REMA 4NXIA 3VPQA 3IOSA 2LRCA 5L71A 1M7TA 2I3YA 1SENA 1GL8A 2GZPA 1S3AA 5AIVA 3R3EA 2IMDA 3EYTA 1XXUA 4K2DA 2R3XA 3GYKA 2GDRA 5INYA 2FWGA 1ZGNA 22GSA 4F0BA 4RQXA 1OE7A 1YQ1A 2O89A 3L78A 2WGRA 1JZWA 1OKDA 1WWJA 2P31A 5A5KA 1M2BA 4PX1A 1FB0A 2V41A 4Q5FA 2DKHA 4TVEA 1XOAA 1SKWB 1M2AA 3VWWA 4HOJA 1NHOA 3W8SA 2AAWA 2DBCA 4KDXA 4RI7A 5D8IA 2F8FA 4L5OA 3FR3A 2P5RA 2HNLA 2VCZA 4L0WA 1THXA 2GZYA 2YJHA 1TI3A 3L9VA 4TR1A 1HQOA 1Z9HA 2C3QA 5F07A 3DIEA 4IP1A 1Z6NA 2FUG2 4G9HA 1TRWA 2G0FA 1U87A 1QGVA 5CRGA 4J56E 1WOUA 1SL2B 2CZ2A 1QXHA 5FHIA 1SL1B 3F8UA 4WBJA 4MZWA 5CYYA 1THOA 1SL0B 4F2IA 1T4ZA 3CRTA 1WPIA 6GSSA 1GUMA 3KD0A 5BMUA 4BL7A 3V1WA 1SKRB 1Z7PA 4IGJA 1VF1A 4K7NA 2XPDA 3SBCA 3EE2A 1OC9A 5HFKA 1A23A 4YH2A 1I5GA 5KEJA 2VLVA 2NTOA 2J9HA 1WRYA 2DIYA 1K0BA 3G7JA 4PQHA 1GSQA 2PPTA 1DSBA 1XFLA 3ERGA 2HRKA 1NSWA 4LLRA 4HU7A 2H0GA 3GFKA 4I6XA 2AB6A 4BPYA 1G6WA 1XVWA 1XWBA 4K1FA 5A4WA 1YF1A 2JZTA 4BVYA 4DSSA 3TUEA 1VGLA 1XWAA 3BD2A 4Z7XA 4E8EA 3TRXA 1S3CA 4JR4A 3L9SA 1K3OA 2A4VA 4AF2A 4Z2TA 3ZITA 2GQKA 2F8AA 5G2ZA 4TR1B 5IQYA 3FR6A 1J0FA 1PL2A 2VL2C 5JWQB 4KDUA 5HR3A 20GSA 2H0IA 5IO0A 3CXGA 3PPUA 1GH2A 2GVPA 2YZUA 3KMNA 1SJIA 2K18A 4MK3A 1QMVA 4XS6A 4LMVA 3WT2A 3IHQA 3QD9A 3WD6A 3A5IA 5LNKe 5D9VA 1JZDA 2H6ZA 4L8EA 3E9JB 4GF0A 2GZZA 4IJIA 5JCWA 1YDKA 5DBQA 3CSHA 2FCHA 4NWYA 3KEBA 4DSRA 3F0IA 1OC9B 5DJMA 5KN1A 2PBJA 2V6KA 1H4OA 3RPNA 5IMDA 4ZIJA 4MPGA 2B5XA 1V9WA 1ABAA 4MF6A 3L0HA 1TJDA 2YOIA 5IOXA 1AC1A 4GTUA 5F0GA 4K0GA 3LG6A 2KP1A 4MF7A 5JWRB 1IYHA 2ZUPA 4V1Ag 5D9TA 4FIWA 4MH3A 1SJZA 3GKMA 4MF5A 1GTAA 4IN0A 2I4AA 4GSNA 1TU7A 1VF2A 4OFTA 3C1SA 3KTLA 2I9HA 4ILFA 3SWLA 4TR3A 1JLWA 4KUNA 4PXOA 2R0PA 4O5UA 4AJ6A 3FZ5A 3E0UA 2VIMA 4PNFA 1TK0B 4D73B 3LYKA 1V2AA 2DC5A 5DCGA 3EPTA 3VLNA 4JEDA 4YAVA 1M0UA 3O6TA 4MZBA 4N11A 4EF0A 1ZOFA 4IBPA 3IRAA 3KJYA 3TGZA 1AXDA 3G7YA 4E8HA 1BG5A 3EINA 2WS2A 3HJPA 1TDIA 4QL9A 3F3RA 1GLPA 1O81A 1WE0A 3HHVA 4H86A 5GSTA 5HR1A 2R0CA 4L0UA 1GRXA 1IYIA 2OE3A 4RQRA 5JWOB 4G0KA 3EWLA 2C0FA 1Q98A 2CQ9A 2IJYA 2CAIA 1HNBA 2H8LA 2QA1A 1M99A 1U3IA 2DJJA 2N5FA 3HJOA 2BTOT 1E6BA 5F8BA 2JZSA 1ZYQB 1FO5A 3E3EA 2C0GA 2VD1A 3Q18A 1WJKA 3Q6OA 3ZVJA 4K9ZA 1CQHA 2C4JA 8GSSA 4FH8A 2M46A 1GTBA 4KA0A 4IJ3A 5IMFA 4IELA 1XBSA 2I81A 2B7JA 5DAKA 3GURA 2H70A 1EGRA 3H1NA 3PGTA 2QC7A 1Y6EA 5G1KA 4NPBA 1X5CA 1G6YA 2C0DA 3DVWA 4OO4A 4BWQA 1PX6A 2VUPA 1AQVA 2L6CA 1ACVA 4WF4A 1ERVA 3ZZXA 1TW9A 1O8WA 1YEXA 4F03A 2DKIA 5JCGA 3FK8A 4BA7A 1USBA 4JE1A 1BQ7A 1XOBA 2H1GA 5CNWA 4ZB6A 3LWAA 4ZBAA 2C0EA 2PVOC 2IL3A 3HCZA 4KB3A 2QSIA 5AN1A 2FGXA 3UIWA 3TJBA 3ZL5A 2HFDA 2YCDA 4I8BA 5IIZA 2FWEA 3ZTLA 1U3AA 2H19A 3KM6A 3RDWA 2A4HA 5FT3A 1GSSA 3IE3A 2L5LA 5J9BA 5B7CA 2HE3A 3JCML 1KEBA 2CT6A 2CZ3A 3EURA 2V32A 5E59A 4FYUA 4HJMA 1PGTA 1PKWA 1XWKA 4IQ1A 4NHWA 4WKWA 1XWCA 2HSHA 3IC8A 4G2EA 11GSA 4IKHA 4GLTA 5ECSA 4LMWA 1B4PA 1PD21 2H71A 1XZOA 3DD3A 3GA4A 1U6TA 3QMXA 5IPGA 4PUAA 3C71A 4NMUA 1A2MA 1V58A 5CRWA 1K3LA 1XWGA 5DAKB 2PN8A 5ELGA 1TRUA 4QL7A 2DJ0A 2FD3A 5GZZB 4KSMA 2QA2A 4K6XA 2K8VA 3TKSA 4MZCA 3TB2A 3P90A 2L5OA 4AJ7A 5ELAA 4O32A 3DKSA 3VI5A 2YPMA 3GL3A 4N30A 1GSDA 5ECQB 1T7PB 2LNTA 3GKKA 4ID0A 1GUKA 4YQVA 4ZILA 2VCXA 3VWXA 1EV4A 1X9MB 1RQMA 2A2SA 2CVBA 5J5NA 1NM3A 3APQA 1WP0A 1R7HA 2DSAA 3VFIA 3F6DA 1GSYA 3D21A 3QR6A 4GCIA 3TOTA 4NHZA 5D9XA 2I1UA 5A4UA 2F9SA 3F3QA 4PUFC 1LU4A 4K8MA 4KNDA 2AJQB 1JFUA 3KH7A 2X4AA 3PH9A 1PKZA 1A0RP 1J9BA 1B9XC 4TN8A 5J3RA 2PWJA 3KCMA 5DQYA 3QFAC 1EV9A 3VWUA 1TXXA 12GSA 1A8LA 3TOUA 3WT1A 1WIKA 4ZB8A 2L57A 4OO5A 4OMVA 1ZYPA 1HNCA 3GV1A 3GH6A 1JHBA 2YWIA 4KW6A 4EKZA 3VWVA 2F3MA 4ZL7A 3LFLA 4HS1A 2VM1A 1SU9A 1J08A 2IPAA 4KGIA 3A2XA 3UBKA 2FLSA 1G7OA 1SYRA 4HDEA 1OAZA 3C73A 2IN3A 3MIXA 4PQIA 2LRTA 3TKPA 5ID2B 4YQUA 2M72A 3I6AA 3CSJA 4GSSA 1SD8A 1TK5B 2VCVA 1GNWA 2EIRA 3A2WA 2NVLA 3TRPA 2RUEA 5ECLB 2MMAA 2VCWA 4CY6A 2O87A 2C1YA 1X5EA 2QGVA 1F3BA 2GQLA 2JZRA 3BCIA 3FYGA 4EL1A 3TJJA 5B6MA 1O6JA 4KE3A 2B5YA 4HEA2 1SD9A 2L4QA 3M1GA 1GTUA 2CX3A 6GSUA 5G30A 1SKSB 2LUSA 1A24A 2GQMA 3A2VA 2ON5A 2ZCTA 1PQNA 1AUCA 3IBHA 2CVDA 1M9BA 2FY6A 3LEFA 5ECNB 5GSSA 2GT6A 5EVOA 5AISA 2IMKA 3FZ9A 1GSFA 3TKSC 4MCUA 2YANA 1K0MA 3ZLPA 4JZQA 3ZRDA 3UMAA 3F6FA 3D0ZA 2KHPA 4WBRD 5H5QA 3CMIA 1R5AA 3DEXA 3IV4A 1PX7A 1R26A 2HT9A 2R4VA 3DMLA 2X8GA 4POLA 2D2ZA 3L4NA 4ICYA 3ISOA 3FR9A 1B48A 2M80A 2GSQA 1K0OA 4IQAA 5IMAA 3ZFLA 4N0VA 2VLUA 3MSZA 2XPEA 19GSA 4EO3A 3KXOA 1MTCA 2OBKA 4K2XA 2MZCA 3UEMA 3IK9A 1TP9A 3O3TA 1F37A 4MP4A 4D73A 3FZAA 1KTEA 2P5QA 1HD2A 5B6NA 2R37A 1Z3EA 1X0RA 5HFIA 5ECPB 3EC3A 5E4WA 1OKTA 1MD4A 2GSSA 1Z7RA 4KAEA 2CX4A 1UN2A 2XHFA 5IOWA 1AW9A 5J4UA 4FQUA 3GX0A 4WF5A 2H76A 2E0QA 2N5BA 2AV4A 3QFBC 3DGQA 1M9AA 4K7IA 3C1RA 2LQOA 4EVMA 2K8SA 2L59A 4MH2A 3EU3A 1RK4A 5ECKB 1VF4A 2OE1A 2C3NA 3VURA 5C00A 3KTBA 1SK1A 1QFNA 1K0AA 1LJRA 2IMIA 4K0NA 4X43A 5LD0A 3US3A 5COHA 1EEJA 1ST9A 2B3SA 1K0NA 3N9JA 2RIIA 2FA4A 5DALB 3KIJA 1ILOA 5ECIB 2R2JA 3ZMKA 1YZXA 3F63A 2LJRA 4ML6A 3S9FA 4LL1B 1B8XA 3UARA 4IP6A 3TKSE 4GQCA 2HYXA 4GWRA 3UOMA 2H1AA 1V40A 2VCQA 4JBBA 3FRCA 2GS3A 3GKXA 3HZ4A 3LYPA 3APOA 5HQPA 4PQ1A 4MNNA 5CRDA 3LORA 3LJRA 4USSA 5D96A 3ZFBA 3J7Yk 5DJLA 4OCEA 3GTUB 4GQFA 4P3YB 2HRFA 1MDKA 3R2QA 4A5PA 2XBQA 1N2AA 2BMXA 1GLQA 4EDZA 3MYDA 4F9ZA 3FHKA 1OE8A 4KCEA 2CA8A 1TU8A 1SK2A 2ALBA 2H0HA 4Z2RA 3TRQA 2KOKA 1PSQA 1SK0A 3D4MA 1GSEA 2C3TA 4IVFA 16GSA 4MA9A 3ME8A 1FG4A 1H75A 2ES7A 2WJUA 2KUCA 1GSUA 1FVKA 4GXZA 3RHBA 1PMTA 3HXSA 3F4RA 4PTSA 1QUWA 1JLVA 4JRRA 3BJ5A 2HI7A 5AIXA 2NDOA 2IIYA 3H93A 9GSSA 1DUGA 3HVVA 4ZB9A 4X1UA 4OFMA 2RM6A 4TKYA 1UVZA 3H4KA 4YKFA 2KP2A 2HSMA 3PR8A 2DJ1A 1F2EA 1BYEA 1PA3A 3QAGA 3UL3A 4CHSA 1ZCPA 3D5JA 4QQ7A 2LQQA 3UAPA 4HUAA 1C72A 2R6KA 2YV9A 2GSRA 5CO3A 1TOFA 3QPMA 4TXOB 4EUYA 4RI6A 5HR0A 5F06A 3MAKA 2HSYA 4MABA 3GH9A 1XVQA 4MLYA 1PRXA 4F82A 2X99A 2G2QA 1T1VA 2V6OA 3RHCA 3BBYA 3OR5A 3ZREA 5KOXA 3U6VA 2XBIA 1EEMA 2JACA 1AIUA 1BAYA 5D9WA 4I2UA 4POKA 3D6IA 4ZL8A 2PERA 2AHEA 4HZ4A 3O76A 5IMCA 1LBKA 3W6GA 4AJ8A 2XC2A 3Q74A 4I2TA 1A8YA 5EY6A 3W8JA 4HU9A 4GSTA 1TKDB 2O7KA 4WXTA 3TKRA 1GP1A 2N5AA 2LV3A 2YWNA 2GTUA 2F51A 2WZ9A 2OE0A 2HRAA 4ZBBA 2VAFA 3KP8A 4L5LA 5H5RA 4EXJA 1AAZA 1OYJA 4O7HA 3FZ4A 2IFQB 1AQXA 4CDOA 4NV5A 4WETA 2FWHA 2MMZA 2AUVA 3IDVA 1ON4A 3LW9A 4YQMA 2MBTA 4X4JA 2JSYA 1MDIA 3LGCA 1T4YA 2YZHA 4LL4B 3WGXA 5ID2A 3IXRA 5ECRB 4TRXA 2B7KA 3IAS2 4N0ZA 2DLXA 5J9CA 3GSTA 4MJBA 3UJ1A 3FY7A 3TJGA 3TKQA 1F3AA 2H6XA 3HYPA 3IC4A 2B1KA 3F4SA 1G0TA 1ERUA 1ERWA 1FOHA 1O8XA 1O73A 3CYNA 2H1BA 4PGTA 5D73A 2LTKA 1M2DA 4ISDA 4FO5A 3CTGA 1MD3A 2B5EA 3MDKA 3IR4A 2HZEA 3FEUA 1PN9A 2K6VA 3M3MA 5ENUA 3ZIVA 4Z2UA 4G0LA 4PURA 3VPTA 3IA1A 2PUKC 3HA9A 5D93A 4K5RA 4K5SA 5CRHA 5ABRA 1K0CA 1OVNA 2PGTA 2QKEA 1Z6MA 3CTFA 6GSVA 1V98A 3ZIJA 2PMTA 5IO2A 4WR4A 3GHAA 3UVTA 4K7OA 4MJCA 4POMA 1YKAA 4OCFA 1ZL9A 1K0DA 3TDGA 1KNGA 2EC4A 1FB6A 2VL2A 5BRTA 4G0IA 1E2YA 2VL9A 3F9UA 2R5GA 4NAXA 4TOPA 3QDNA 3BOAA 2LSTA 14GSA 5ECMB 2DIZA 1A2LA 3EU4A 5H5SA 4EC0A 3BCKA 4KDYA 2YJ7A 1A0FA 1T3BA 1R4WA 5G5EA 3LXTA 3AY8A 1TK8B 1W4VA 1VF3A 4YAPA 5CREA 3GRXA 4FYBA 2FHEA 4FYCA 2E2MA 4BVXB 1EOHA 2HLSA 4XIHA 4RUVA 4ECCA 1TI1A 4XS4A 5CP1A 3FMWA 1W89A 2WFCA 2CVKA 4CW9A 4BWSA 1CQGA 1F6MC 4V2MA 2B6MA 2HZEB 2DJKA 3D22A 5F05A 2TRXA 3RAZA 1QQ2A 2CAQA 4I97A 1ERTA 3DRNA 4HI7A 2X8CA 2H6YA 1I9DA 2E7PA 3ME7A 3EMPA 4HQZA 3I9V2 3PINA 2X64A 7GSSA 3LQ7A 5EL8A 3GIXA 4PNGA 1WMJA 3J7Yb 5B8BA 1PL1A 1ZYEA 2HXKA 1T00A 4KSOA 2P0GA 5EPFA 3DWVA 5J41A 4LA1A 3P8WA 3EMXA 3WGDA 2HZFA 13GSA 3M8NA 1R5PA 2ON7A 1X5DA 2L6DA 4XHMA 5G1LA 3IAM2 2WULA 5KN2A 5KN3A 4Q5RA 5B8AA 1XPVA 2OJLA 5DVBA 5GAND 1O7UA 4IW9A 2FNOA 1KBNA 2YN1A 3G9BA 2GGTA 1EZKA 1NHYA 5DALA 3VI7A 2J23A 2A2PA 2H66A 1YY7A 3LSZA 3U5RE 2OA7A 1BEDA 2VO4A 5CAXA 1UC7A 2UZ8A 4DSQA 1BX9A 3Q19A 1MDJA 5C04A 4XS4B 1EGOA 4ECJA 2KLXA 3LXZA 3CBUA 5G5FA 3F4TA 2JL4A 3ZMLA 1F9MA 3GTUA 1DBYA 1GWCA 1HYUA 4KCAA 4POBA 2H72A 2FWFA 4EIPA 2VL3A 3FKFA 3QCPA 1SYXA 3ZYWA 3HZ8A 2C8UA 5AGYA 2DJ2A 3TJKA 4O5QA 4TR4A 4BL7B 1EOGA 3UVHA 1XCCA 1URMA 3H79A 2DJ3A 3HVSA 3UBLA 3DYRA 4HQSA 3HD5A 2JADA 3KH9A 3RBTA 4ZL9A 2NBSA 1T8EB 1EP7A 1X9WB 2GLRA 4F0CA 3GX8A 1JZOA 5HR2A 2DMMA 3I69A 3FW2A 4Q5QA 6GSWA 4KF9A 3M9KA 3GL5A 1RW1A 2CV4A 4ACSA 1FAAA 4YKGA 4BVYB 4DSSB 2ZNMA 3HVXA 2RLIA 4O92A 1VRSD 3VK9A 4NV2A 1B4QA 1Q4JA 2OKAA 3M0FA 2LEGA 3NIVA 3NZNA 1XW9A 4CY8A 2V1MA 1OC3A 1FW1A 3DVXA 4WR5A 2LRNA 4MDCA 4XTSA 4ML1A 2C80A 4TXOA 1YKCA 1BJXA 5GAPD 1UA5A 4GRFA 5KN0A 3I43A 2V2GA 2LJAA 4KX4A 1GTIA 4X0XA 4OD7A 1ZYNA 3D4TA 2O8VB 1TRSA 2TIRA 4HZ2A 5KOWA 4Q5NA 4JR6A 3KGKA 4G10A 1S3DA 4MMMA 1V57A 2MMNA 1FVJA 1QK8A 2EIOA 4OWYA 2LJKA 1FHEA 3C8EA 1TRVA 2WB9A 3CRUA 2IMEA 1HNAA 2H01A 3P2AA 1EP8A 3N5OA 1X9SB 4TXVA 3NOFA 2RM5A 3MNGA 1U88A 5JCUA 3HKRA 1ZZYA 4TR0A 4EIQA 1NW2A 2IFQA 2NPBA 2L4CA 1B9YC 1Y25A 4XRAA 2JSZA 4MPFA 4DEJA 1SJ6A 3IPZA 5IM9A 4IS0A 2IMFA 4EDYA 1AQWA 4KH7A 2A2RA 3G7IA 4J2FA 5ECOB 4J57E 3CSIA 3A5WA 4XRDA 4WEYA 3KP9A 1YF0A 3RPPA 3HY2A 1DE1A 4ZBDA 1G7EA 5DCHA 2OACA 1ZMAA 5A4VA 2LS5A 18GSA 3IK7A 3ED3A 5IMVA 1O85A 2B1LA 1MEKA 4MJEA 3TJFA 3DXBA 2WDUA 3APSA 5DQSA 2EIQA 5IPHA 4ECBA 5HFGA 3ERFA 4V2NA 1PN0A 5LCZA 1XW6A 2IWTA 5DDLA 10GSA 1JZRA 2X8HA 1K3YA 2VCTA 4EE0A 1GUHA 4AGSA 3QAVA 5FWGA 4V1Ap 3C7MA 1GULA 4TW5A 4XS1A 2VM2A 3GSSA 2RUFA 2JU5A 1A2JA 4JU5A 4I5QA 4V2LA 2OBIA 3GMFA 3QAWA 4MJAA 3P7XA 3ERWA 2YV7A 6GSXA 2YWOA 2GT5A 3TCOA 2VOCA 1TTZA 4G19A 4N10A 1OC8A 1ML6A 2LNSA 2MYGA 2MMOA 3GKNA 2VLTA 2OADA 4ULXA 4XCSA 2AYTA 2TRCP 2H73A 2LKUA 4IHUA 3QOUA 3HJMA 2GSTA 1DE2A 1EWXA 3KMOA 3L9UA 2H75A 2BJXA 1YJ6A 4OFNA 3K8NA 6GSTA 3GNJA 2R0GA 3IHGA 2O85A 4ZXGA 3M9JA 1YEPA 5G31A 4BVXA 3GUSA 2YWMA 3ZVJD 1XIYA 3WYWA 5IMZA 4O5RA 2HRNA 2VD0A 3A3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YP6 A;  17GS A;  1N8J A;  2FA8 A;  2H30 A;  4ECI A;  2Z9S A;  1Z5Y E;  2H74 A;  3MWH A;  2WCI A;  2MBS A;  5ECH B;  3GN3 A;  2WRT A;  3HDC A;  6GSY A;  4HJ2 A;  2YNX A;  2E2G A;  1XW5 A;  3H8Q A;  2PU9 C;  3WGE A;  2K9F A;  1FOV A;  3EVI A;  4DVC A;  1GNE A;  2H1D A;  2DML A;  2PVQ A;  3KZQ A;  2REM A;  4NXI A;  3VPQ A;  3IOS A;  2LRC A;  5L71 A;  1M7T A;  2I3Y A;  1SEN A;  1GL8 A;  2GZP A;  1S3A A;  5AIV A;  2IMD A;  3EYT A;  1XXU A;  4K2D A;  2R3X A;  3GYK A;  2GDR A;  5INY A;  2FWG A;  1ZGN A;  22GS A;  4F0B A;  4RQX A;  1OE7 A;  1YQ1 A;  2O89 A;  3L78 A;  2WGR A;  1JZW A;  1OKD A;  1WWJ A;  2P31 A;  5A5K A;  1M2B A;  4PX1 A;  1FB0 A;  2V41 A;  4Q5F A;  4TVE A;  1XOA A;  1SKW B;  1M2A A;  3VWW A;  4HOJ A;  1NHO A;  3W8S A;  2AAW A;  2DBC A;  4KDX A;  4RI7 A;  5D8I A;  2F8F A;  4L5O A;  3FR3 A;  2P5R A;  2HNL A;  2VCZ A;  4L0W A;  1THX A;  2GZY A;  2YJH A;  1TI3 A;  3L9V A;  4TR1 A;  1HQO A;  1Z9H A;  2C3Q A;  5F07 A;  3DIE A;  4IP1 A;  1Z6N A;  2FUG 2;  4G9H A;  1TRW A;  2G0F A;  1U87 A;  1QGV A;  5CRG A;  4J56 E;  1WOU A;  1SL2 B;  2CZ2 A;  1QXH A;  5FHI A;  1SL1 B;  3F8U A;  4WBJ A;  4MZW A;  5CYY A;  1THO A;  1SL0 B;  4F2I A;  1T4Z A;  3CRT A;  1WPI A;  6GSS A;  1GUM A;  3KD0 A;  4BL7 A;  3V1W A;  1SKR B;  1Z7P A;  4IGJ A;  1VF1 A;  4K7N A;  2XPD A;  3SBC A;  3EE2 A;  1OC9 A;  5HFK A;  1A23 A;  4YH2 A;  1I5G A;  5KEJ A;  2VLV A;  2NTO A;  2J9H A;  1WRY A;  2DIY A;  1K0B A;  3G7J A;  4PQH A;  1GSQ A;  2PPT A;  1DSB A;  1XFL A;  3ERG A;  1NSW A;  4LLR A;  4HU7 A;  2H0G A;  3GFK A;  4I6X A;  2AB6 A;  4BPY A;  1G6W A;  1XVW A;  1XWB A;  4K1F A;  5A4W A;  1YF1 A;  2JZT A;  4BVY A;  4DSS A;  3TUE A;  1VGL A;  1XWA A;  3BD2 A;  4Z7X A;  4E8E A;  3TRX A;  1S3C A;  4JR4 A;  3L9S A;  1K3O A;  2A4V A;  4AF2 A;  3ZIT A;  2GQK A;  2F8A A;  5G2Z A;  4TR1 B;  5IQY A;  3FR6 A;  1J0F A;  1PL2 A;  2VL2 C;  5JWQ B;  4KDU A;  5HR3 A;  20GS A;  2H0I A;  5IO0 A;  3CXG A;  1GH2 A;  2GVP A;  2YZU A;  3KMN A;  1SJI A;  2K18 A;  4MK3 A;  1QMV A;  4XS6 A;  4LMV A;  3WT2 A;  3IHQ A;  3QD9 A;  3WD6 A;  5LNK e;  5D9V A;  1JZD A;  2H6Z A;  4L8E A;  3E9J B;  4GF0 A;  2GZZ A;  4IJI A;  5JCW A;  1YDK A;  5DBQ A;  3CSH A;  2FCH A;  4NWY A;  3KEB A;  4DSR A;  3F0I A;  1OC9 B;  5DJM A;  5KN1 A;  2PBJ A;  2V6K A;  1H4O A;  3RPN A;  5IMD A;  4ZIJ A;  4MPG A;  2B5X A;  1V9W A;  1ABA A;  4MF6 A;  3L0H A;  1TJD A;  2YOI A;  5IOX A;  1AC1 A;  4GTU A;  5F0G A;  4K0G A;  3LG6 A;  2KP1 A;  4MF7 A;  5JWR B;  1IYH A;  2ZUP A;  4V1A g;  5D9T A;  4FIW A;  4MH3 A;  1SJZ A;  3GKM A;  4MF5 A;  1GTA A;  4IN0 A;  2I4A A;  4GSN A;  1TU7 A;  1VF2 A;  4OFT A;  3C1S A;  3KTL A;  2I9H A;  4ILF A;  3SWL A;  4TR3 A;  1JLW A;  4KUN A;  4PXO A;  4AJ6 A;  3FZ5 A;  3E0U A;  2VIM A;  4PNF A;  1TK0 B;  4D73 B;  3LYK A;  1V2A A;  2DC5 A;  5DCG A;  3VLN A;  4JED A;  4YAV A;  1M0U A;  3O6T A;  4MZB A;  4N11 A;  4EF0 A;  1ZOF A;  4IBP A;  3IRA A;  3KJY A;  3TGZ A;  1AXD A;  3G7Y A;  4E8H A;  1BG5 A;  3EIN A;  2WS2 A;  3HJP A;  1TDI A;  4QL9 A;  3F3R A;  1GLP A;  1O81 A;  1WE0 A;  3HHV A;  4H86 A;  5GST A;  5HR1 A;  4L0U A;  1GRX A;  1IYI A;  2OE3 A;  4RQR A;  5JWO B;  3EWL A;  2C0F A;  1Q98 A;  2CQ9 A;  2IJY A;  2CAI A;  1HNB A;  2H8L A;  1M99 A;  1U3I A;  2DJJ A;  2N5F A;  3HJO A;  2BTO T;  1E6B A;  5F8B A;  2JZS A;  1ZYQ B;  1FO5 A;  3E3E A;  2C0G A;  2VD1 A;  3Q18 A;  1WJK A;  3Q6O A;  3ZVJ A;  4K9Z A;  1CQH A;  2C4J A;  8GSS A;  4FH8 A;  2M46 A;  1GTB A;  4KA0 A;  4IJ3 A;  5IMF A;  4IEL A;  1XBS A;  2I81 A;  2B7J A;  5DAK A;  3GUR A;  2H70 A;  1EGR A;  3H1N A;  3PGT A;  2QC7 A;  1Y6E A;  5G1K A;  4NPB A;  1X5C A;  1G6Y A;  2C0D A;  3DVW A;  4OO4 A;  4BWQ A;  1PX6 A;  2VUP A;  1AQV A;  2L6C A;  1ACV A;  4WF4 A;  1ERV A;  3ZZX A;  1TW9 A;  1O8W A;  1YEX A;  4F03 A;  5JCG A;  3FK8 A;  4BA7 A;  1USB A;  4JE1 A;  1BQ7 A;  1XOB A;  2H1G A;  5CNW A;  4ZB6 A;  3LWA A;  4ZBA A;  2C0E A;  2PVO C;  2IL3 A;  3HCZ A;  4KB3 A;  2QSI A;  5AN1 A;  2FGX A;  3UIW A;  3TJB A;  3ZL5 A;  2HFD A;  2YCD A;  4I8B A;  5IIZ A;  2FWE A;  3ZTL A;  1U3A A;  2H19 A;  3KM6 A;  3RDW A;  5FT3 A;  1GSS A;  3IE3 A;  2L5L A;  5J9B A;  5B7C A;  2HE3 A;  3JCM L;  1KEB A;  2CT6 A;  2CZ3 A;  3EUR A;  2V32 A;  5E59 A;  4FYU A;  4HJM A;  1PGT A;  1PKW A;  1XWK A;  4IQ1 A;  4NHW A;  4WKW A;  1XWC A;  2HSH A;  4G2E A;  11GS A;  4IKH A;  4GLT A;  5ECS A;  4LMW A;  1B4P A;  1PD2 1;  2H71 A;  1XZO A;  3DD3 A;  3GA4 A;  1U6T A;  3QMX A;  5IPG A;  4PUA A;  3C71 A;  4NMU A;  1A2M A;  1V58 A;  5CRW A;  1K3L A;  1XWG A;  5DAK B;  2PN8 A;  5ELG A;  1TRU A;  4QL7 A;  2DJ0 A;  2FD3 A;  5GZZ B;  4KSM A;  4K6X A;  2K8V A;  3TKS A;  4MZC A;  3TB2 A;  3P90 A;  2L5O A;  4AJ7 A;  5ELA A;  4O32 A;  3DKS A;  3VI5 A;  2YPM A;  3GL3 A;  4N30 A;  1GSD A;  5ECQ B;  1T7P B;  2LNT A;  3GKK A;  4ID0 A;  1GUK A;  4YQV A;  4ZIL A;  2VCX A;  3VWX A;  1EV4 A;  1X9M B;  1RQM A;  2A2S A;  2CVB A;  5J5N A;  1NM3 A;  3APQ A;  1WP0 A;  1R7H A;  2DSA A;  3VFI A;  3F6D A;  1GSY A;  3D21 A;  3QR6 A;  4GCI A;  3TOT A;  4NHZ A;  5D9X A;  2I1U A;  5A4U A;  2F9S A;  3F3Q A;  4PUF C;  1LU4 A;  4K8M A;  4KND A;  2AJQ B;  1JFU A;  3KH7 A;  3PH9 A;  1PKZ A;  1A0R P;  1J9B A;  1B9X C;  4TN8 A;  5J3R A;  2PWJ A;  3KCM A;  5DQY A;  3QFA C;  1EV9 A;  3VWU A;  1TXX A;  12GS A;  1A8L A;  3TOU A;  3WT1 A;  1WIK A;  4ZB8 A;  2L57 A;  4OO5 A;  4OMV A;  1HNC A;  3GV1 A;  3GH6 A;  1JHB A;  2YWI A;  4KW6 A;  4EKZ A;  3VWV A;  2F3M A;  4ZL7 A;  3LFL A;  4HS1 A;  2VM1 A;  1SU9 A;  1J08 A;  2IPA A;  4KGI A;  3A2X A;  3UBK A;  2FLS A;  1G7O A;  1SYR A;  4HDE A;  1OAZ A;  3C73 A;  2IN3 A;  4PQI A;  3TKP A;  2LRT A;  5ID2 B;  4YQU A;  2M72 A;  3I6A A;  3CSJ A;  4GSS A;  1SD8 A;  1TK5 B;  2VCV A;  1GNW A;  2EIR A;  3A2W A;  2NVL A;  3TRP A;  2RUE A;  5ECL B;  2MMA A;  2VCW A;  2O87 A;  2C1Y A;  1X5E A;  2QGV A;  1F3B A;  2GQL A;  2JZR A;  3BCI A;  3FYG A;  4EL1 A;  3TJJ A;  5B6M A;  1O6J A;  4KE3 A;  2B5Y A;  4HEA 2;  1SD9 A;  2L4Q A;  3M1G A;  1GTU A;  2CX3 A;  6GSU A;  5G30 A;  1SKS B;  2LUS A;  1A24 A;  2GQM A;  3A2V A;  2ON5 A;  2ZCT A;  1PQN A;  1AUC A;  3IBH A;  2CVD A;  1M9B A;  2FY6 A;  3LEF A;  5ECN B;  5GSS A;  2GT6 A;  5EVO A;  5AIS A;  2IMK A;  3FZ9 A;  1GSF A;  3TKS C;  4MCU A;  2YAN A;  1K0M A;  3ZLP A;  4JZQ A;  3ZRD A;  3UMA A;  3F6F A;  3D0Z A;  2KHP A;  4WBR D;  5H5Q A;  3CMI A;  1R5A A;  3DEX A;  3IV4 A;  1PX7 A;  1R26 A;  2HT9 A;  2R4V A;  3DML A;  2X8G A;  4POL A;  2D2Z A;  3L4N A;  3ISO A;  3FR9 A;  1B48 A;  2M80 A;  2GSQ A;  1K0O A;  4IQA A;  5IMA A;  3ZFL A;  4N0V A;  2VLU A;  3MSZ A;  2XPE A;  19GS A;  4EO3 A;  3KXO A;  1MTC A;  2OBK A;  2MZC A;  3UEM A;  3IK9 A;  1TP9 A;  3O3T A;  1F37 A;  4MP4 A;  4D73 A;  3FZA A;  1KTE A;  2P5Q A;  1HD2 A;  5B6N A;  2R37 A;  1Z3E A;  1X0R A;  5HFI A;  5ECP B;  3EC3 A;  5E4W A;  1OKT A;  1MD4 A;  2GSS A;  1Z7R A;  4KAE A;  2CX4 A;  1UN2 A;  2XHF A;  5IOW A;  1AW9 A;  5J4U A;  3GX0 A;  4WF5 A;  2H76 A;  2E0Q A;  2N5B A;  2AV4 A;  3QFB C;  3DGQ A;  1M9A A;  4K7I A;  3C1R A;  2LQO A;  4EVM A;  2K8S A;  2L59 A;  4MH2 A;  3EU3 A;  1RK4 A;  5ECK B;  1VF4 A;  2OE1 A;  2C3N A;  3VUR A;  5C00 A;  3KTB A;  1SK1 A;  1QFN A;  1K0A A;  1LJR A;  2IMI A;  4K0N A;  4X43 A;  5LD0 A;  3US3 A;  5COH A;  1EEJ A;  1ST9 A;  2B3S A;  1K0N A;  3N9J A;  2RII A;  2FA4 A;  5DAL B;  3KIJ A;  1ILO A;  5ECI B;  2R2J A;  3ZMK A;  1YZX A;  3F63 A;  2LJR A;  4ML6 A;  3S9F A;  4LL1 B;  1B8X A;  3UAR A;  4IP6 A;  3TKS E;  4GQC A;  2HYX A;  4GWR A;  3UOM A;  2H1A A;  1V40 A;  2VCQ A;  4JBB A;  3FRC A;  2GS3 A;  3GKX A;  3HZ4 A;  3LYP A;  3APO A;  5HQP A;  4PQ1 A;  5CRD A;  3LOR A;  3LJR A;  5D96 A;  3ZFB A;  3J7Y k;  5DJL A;  4OCE A;  3GTU B;  4GQF A;  4P3Y B;  2HRF A;  1MDK A;  3R2Q A;  2XBQ A;  1N2A A;  2BMX A;  1GLQ A;  4EDZ A;  4F9Z A;  3FHK A;  1OE8 A;  4KCE A;  2CA8 A;  1TU8 A;  1SK2 A;  2ALB A;  2H0H A;  3TRQ A;  2KOK A;  1PSQ A;  1SK0 A;  3D4M A;  1GSE A;  2C3T A;  4IVF A;  16GS A;  4MA9 A;  3ME8 A;  1FG4 A;  1H75 A;  2ES7 A;  2WJU A;  2KUC A;  1GSU A;  1FVK A;  4GXZ A;  3RHB A;  1PMT A;  3HXS A;  3F4R A;  1QUW A;  1JLV A;  4JRR A;  3BJ5 A;  2HI7 A;  5AIX A;  2NDO A;  2IIY A;  3H93 A;  9GSS A;  1DUG A;  3HVV A;  4ZB9 A;  4X1U A;  4OFM A;  2RM6 A;  4TKY A;  1UVZ A;  3H4K A;  2KP2 A;  3PR8 A;  2DJ1 A;  1F2E A;  1BYE A;  1PA3 A;  3QAG A;  3UL3 A;  4CHS A;  1ZCP A;  3D5J A;  4QQ7 A;  2LQQ A;  3UAP A;  4HUA A;  1C72 A;  2R6K A;  2YV9 A;  2GSR A;  5CO3 A;  1TOF A;  3QPM A;  4TXO B;  4EUY A;  4RI6 A;  5HR0 A;  5F06 A;  3MAK A;  2HSY A;  4MAB A;  3GH9 A;  1XVQ A;  4MLY A;  1PRX A;  4F82 A;  2X99 A;  2G2Q A;  1T1V A;  2V6O A;  3RHC A;  3BBY A;  3OR5 A;  3ZRE A;  3U6V A;  2XBI A;  1EEM A;  2JAC A;  1AIU A;  1BAY A;  5D9W A;  4I2U A;  4POK A;  3D6I A;  4ZL8 A;  2PER A;  2AHE A;  4HZ4 A;  3O76 A;  5IMC A;  1LBK A;  3W6G A;  4AJ8 A;  2XC2 A;  3Q74 A;  4I2T A;  1A8Y A;  5EY6 A;  3W8J A;  4HU9 A;  4GST A;  1TKD B;  2O7K A;  4WXT A;  3TKR A;  1GP1 A;  2N5A A;  2LV3 A;  2YWN A;  2GTU A;  2F51 A;  2WZ9 A;  2OE0 A;  4ZBB A;  2VAF A;  3KP8 A;  4L5L A;  5H5R A;  4EXJ A;  1AAZ A;  1OYJ A;  4O7H A;  3FZ4 A;  2IFQ B;  1AQX A;  4CDO A;  4NV5 A;  4WET A;  2FWH A;  2MMZ A;  2AUV A;  3IDV A;  1ON4 A;  4YQM A;  2MBT A;  2JSY A;  1MDI A;  3LGC A;  1T4Y A;  2YZH A;  4LL4 B;  3WGX A;  5ID2 A;  3IXR A;  5ECR B;  4TRX A;  2B7K A;  3IAS 2;  4N0Z A;  2DLX A;  5J9C A;  3GST A;  4MJB A;  3UJ1 A;  3FY7 A;  3TJG A;  3TKQ A;  1F3A A;  2H6X A;  3HYP A;  3IC4 A;  2B1K A;  3F4S A;  1G0T A;  1ERU A;  1ERW A;  1O8X A;  1O73 A;  3CYN A;  2H1B A;  4PGT A;  5D73 A;  2LTK A;  1M2D A;  4ISD A;  4FO5 A;  3CTG A;  1MD3 A;  2B5E A;  3MDK A;  3IR4 A;  2HZE A;  3FEU A;  1PN9 A;  2K6V A;  3M3M A;  5ENU A;  3ZIV A;  4PUR A;  3VPT A;  3IA1 A;  2PUK C;  3HA9 A;  5D93 A;  5CRH A;  5ABR A;  1K0C A;  1OVN A;  2PGT A;  2QKE A;  1Z6M A;  3CTF A;  6GSV A;  1V98 A;  3ZIJ A;  2PMT A;  5IO2 A;  4WR4 A;  3GHA A;  3UVT A;  4K7O A;  4MJC A;  4POM A;  1YKA A;  4OCF A;  1ZL9 A;  1K0D A;  3TDG A;  1KNG A;  2EC4 A;  1FB6 A;  2VL2 A;  1E2Y A;  2VL9 A;  3F9U A;  2R5G A;  4NAX A;  4TOP A;  3QDN A;  3BOA A;  2LST A;  14GS A;  5ECM B;  2DIZ A;  1A2L A;  3EU4 A;  5H5S A;  4EC0 A;  3BCK A;  4KDY A;  2YJ7 A;  1A0F A;  1T3B A;  1R4W A;  5G5E A;  3LXT A;  3AY8 A;  1TK8 B;  1W4V A;  1VF3 A;  4YAP A;  5CRE A;  3GRX A;  4FYB A;  2FHE A;  4FYC A;  2E2M A;  1EOH A;  2HLS A;  4XIH A;  4RUV A;  4ECC A;  1TI1 A;  4XS4 A;  5CP1 A;  1W89 A;  2WFC A;  2CVK A;  4CW9 A;  4BWS A;  1CQG A;  1F6M C;  4V2M A;  2B6M A;  2HZE B;  2DJK A;  3D22 A;  5F05 A;  2TRX A;  3RAZ A;  1QQ2 A;  2CAQ A;  4I97 A;  1ERT A;  3DRN A;  4HI7 A;  2X8C A;  2H6Y A;  1I9D A;  2E7P A;  3ME7 A;  3EMP A;  4HQZ A;  3I9V 2;  3PIN A;  2X64 A;  7GSS A;  3LQ7 A;  5EL8 A;  3GIX A;  4PNG A;  1WMJ A;  3J7Y b;  5B8B A;  1PL1 A;  1ZYE A;  2HXK A;  1T00 A;  4KSO A;  2P0G A;  5EPF A;  3DWV A;  5J41 A;  4LA1 A;  3P8W A;  3EMX A;  3WGD A;  2HZF A;  13GS A;  3M8N A;  1R5P A;  2ON7 A;  1X5D A;  2L6D A;  4XHM A;  5G1L A;  3IAM 2;  2WUL A;  5KN2 A;  5KN3 A;  4Q5R A;  5B8A A;  1XPV A;  2OJL A;  5DVB A;  5GAN D;  1O7U A;  4IW9 A;  2FNO A;  1KBN A;  2YN1 A;  3G9B A;  2GGT A;  1EZK A;  1NHY A;  5DAL A;  3VI7 A;  2J23 A;  2H66 A;  1YY7 A;  3LSZ A;  3U5R E;  2OA7 A;  1BED A;  2VO4 A;  5CAX A;  1UC7 A;  4DSQ A;  1BX9 A;  3Q19 A;  1MDJ A;  5C04 A;  4XS4 B;  1EGO A;  4ECJ A;  2KLX A;  3LXZ A;  3CBU A;  5G5F A;  3F4T A;  2JL4 A;  3ZML A;  1F9M A;  3GTU A;  1DBY A;  1GWC A;  1HYU A;  4KCA A;  4POB A;  2H72 A;  2FWF A;  2VL3 A;  3FKF A;  3QCP A;  1SYX A;  3ZYW A;  3HZ8 A;  2C8U A;  5AGY A;  2DJ2 A;  3TJK A;  4TR4 A;  1EOG A;  3UVH A;  1XCC A;  1URM A;  3H79 A;  2DJ3 A;  3HVS A;  3UBL A;  3DYR A;  4HQS A;  3HD5 A;  2JAD A;  3KH9 A;  3RBT A;  4ZL9 A;  2NBS A;  1T8E B;  1EP7 A;  1X9W B;  2GLR A;  4F0C A;  3GX8 A;  1JZO A;  5HR2 A;  2DMM A;  3I69 A;  3FW2 A;  4Q5Q A;  6GSW A;  3M9K A;  3GL5 A;  1RW1 A;  2CV4 A;  4ACS A;  1FAA A;  4DSS B;  2ZNM A;  3HVX A;  2RLI A;  4O92 A;  1VRS D;  3VK9 A;  4NV2 A;  1B4Q A;  1Q4J A;  2OKA A;  3M0F A;  2LEG A;  3NIV A;  3NZN A;  1XW9 A;  2V1M A;  1OC3 A;  1FW1 A;  3DVX A;  4WR5 A;  2LRN A;  4MDC A;  4XTS A;  4ML1 A;  2C80 A;  4TXO A;  1YKC A;  1BJX A;  5GAP D;  1UA5 A;  4GRF A;  5KN0 A;  3I43 A;  2V2G A;  2LJA A;  4KX4 A;  1GTI A;  4X0X A;  4OD7 A;  3D4T A;  2O8V B;  1TRS A;  2TIR A;  4HZ2 A;  4Q5N A;  4JR6 A;  3KGK A;  4G10 A;  1S3D A;  4MMM A;  1V57 A;  2MMN A;  1FVJ A;  1QK8 A;  2EIO A;  4OWY A;  2LJK A;  1FHE A;  3C8E A;  1TRV A;  2WB9 A;  3CRU A;  2IME A;  1HNA A;  2H01 A;  3P2A A;  1EP8 A;  3N5O A;  1X9S B;  4TXV A;  3NOF A;  2RM5 A;  3MNG A;  1U88 A;  5JCU A;  3HKR A;  1ZZY A;  4TR0 A;  1NW2 A;  2IFQ A;  2NPB A;  2L4C A;  1B9Y C;  1Y25 A;  4XRA A;  2JSZ A;  4MPF A;  4DEJ A;  1SJ6 A;  3IPZ A;  5IM9 A;  4IS0 A;  2IMF A;  4EDY A;  1AQW A;  4KH7 A;  2A2R A;  3G7I A;  4J2F A;  5ECO B;  4J57 E;  3CSI A;  3A5W A;  4XRD A;  4WEY A;  3KP9 A;  1YF0 A;  3RPP A;  3HY2 A;  1DE1 A;  4ZBD A;  1G7E A;  5DCH A;  2OAC A;  1ZMA A;  5A4V A;  2LS5 A;  18GS A;  3IK7 A;  3ED3 A;  5IMV A;  1O85 A;  2B1L A;  1MEK A;  4MJE A;  3TJF A;  3DXB A;  2WDU A;  3APS A;  5DQS A;  2EIQ A;  5IPH A;  4ECB A;  5HFG A;  3ERF A;  4V2N A;  5LCZ A;  1XW6 A;  2IWT A;  5DDL A;  10GS A;  1JZR A;  2X8H A;  1K3Y A;  2VCT A;  4EE0 A;  1GUH A;  4AGS A;  3QAV A;  5FWG A;  4V1A p;  3C7M A;  1GUL A;  4TW5 A;  4XS1 A;  2VM2 A;  3GSS A;  2RUF A;  2JU5 A;  1A2J A;  4JU5 A;  4I5Q A;  4V2L A;  2OBI A;  3GMF A;  3QAW A;  4MJA A;  3P7X A;  3ERW A;  2YV7 A;  6GSX A;  2YWO A;  2GT5 A;  3TCO A;  2VOC A;  1TTZ A;  4G19 A;  4N10 A;  1OC8 A;  1ML6 A;  2LNS A;  2MYG A;  2MMO A;  3GKN A;  2VLT A;  2OAD A;  4ULX A;  4XCS A;  2AYT A;  2TRC P;  2H73 A;  2LKU A;  4IHU A;  3QOU A;  3HJM A;  2GST A;  1DE2 A;  1EWX A;  3KMO A;  3L9U A;  2H75 A;  2BJX A;  1YJ6 A;  4OFN A;  3K8N A;  6GST A;  3GNJ A;  2O85 A;  4ZXG A;  3M9J A;  1YEP A;  5G31 A;  4BVX A;  3GUS A;  2YWM A;  3ZVJ D;  1XIY A;  3WYW A;  5IMZ A;  4O5R A;  2HRN A;  2VD0 A;  3A3T A; 
#chains in the Genus database with same CATH topology
 2YP6 A;  17GS A;  1N8J A;  2FA8 A;  2H30 A;  2X49 A;  4ECI A;  2Z9S A;  1Z5Y E;  2H74 A;  3MWH A;  2WCI A;  2MBS A;  5ECH B;  3GN3 A;  2WRT A;  3HDC A;  6GSY A;  4HJ2 A;  2YNX A;  2E2G A;  1XW5 A;  3H8Q A;  2PU9 C;  3WGE A;  2K9F A;  1FOV A;  3EVI A;  4DVC A;  1GNE A;  2H1D A;  2DML A;  2PVQ A;  3KZQ A;  2REM A;  4NXI A;  3VPQ A;  3IOS A;  2LRC A;  5L71 A;  1M7T A;  2I3Y A;  1SEN A;  1GL8 A;  2GZP A;  1S3A A;  5AIV A;  3R3E A;  2IMD A;  3EYT A;  1XXU A;  4K2D A;  2R3X A;  3GYK A;  2GDR A;  5INY A;  2FWG A;  1ZGN A;  22GS A;  4F0B A;  4RQX A;  1OE7 A;  1YQ1 A;  2O89 A;  3L78 A;  2WGR A;  1JZW A;  1OKD A;  1WWJ A;  2P31 A;  5A5K A;  1M2B A;  4PX1 A;  1FB0 A;  2V41 A;  4Q5F A;  2DKH A;  4TVE A;  1XOA A;  1SKW B;  1M2A A;  3HVN A;  3VWW A;  4HOJ A;  1NHO A;  3W8S A;  2AAW A;  2DBC A;  4KDX A;  4RI7 A;  5D8I A;  2F8F A;  4L5O A;  3FR3 A;  4HSC X;  2P5R A;  2HNL A;  2VCZ A;  4L0W A;  1THX A;  2GZY A;  2YJH A;  1TI3 A;  3L9V A;  4TR1 A;  1HQO A;  1Z9H A;  2C3Q A;  5F07 A;  3DIE A;  4IP1 A;  1Z6N A;  2FUG 2;  4G9H A;  1TRW A;  2G0F A;  1U87 A;  1QGV A;  5CRG A;  4J56 E;  1WOU A;  1SL2 B;  2CZ2 A;  1QXH A;  5FHI A;  1SL1 B;  3F8U A;  4WBJ A;  4MZW A;  5CYY A;  1THO A;  1SL0 B;  4F2I A;  1T4Z A;  3CRT A;  1WPI A;  6GSS A;  1GUM A;  3KD0 A;  5BMU A;  4BL7 A;  3V1W A;  1SKR B;  1Z7P A;  4IGJ A;  1VF1 A;  4K7N A;  2XPD A;  3SBC A;  3EE2 A;  1OC9 A;  5HFK A;  1A23 A;  4YH2 A;  1I5G A;  5KEJ A;  2VLV A;  2NTO A;  2J9H A;  1WRY A;  2DIY A;  1K0B A;  3G7J A;  4PQH A;  1GSQ A;  2PPT A;  1DSB A;  1XFL A;  3ERG A;  2HRK A;  1NSW A;  4LLR A;  4HU7 A;  2H0G A;  3GFK A;  4I6X A;  2AB6 A;  4BPY A;  1G6W A;  1XVW A;  1XWB A;  4K1F A;  5A4W A;  1YF1 A;  2JZT A;  4BVY A;  4DSS A;  3TUE A;  1VGL A;  1XWA A;  3BD2 A;  4Z7X A;  4E8E A;  3TRX A;  1S3C A;  4JR4 A;  3L9S A;  1K3O A;  2A4V A;  4AF2 A;  4Z2T A;  3ZIT A;  2GQK A;  2F8A A;  5G2Z A;  4TR1 B;  5IQY A;  1PFO A;  3FR6 A;  1J0F A;  1PL2 A;  2VL2 C;  5JWQ B;  4KDU A;  5HR3 A;  20GS A;  2H0I A;  5IO0 A;  3CXG A;  3PPU A;  1GH2 A;  2GVP A;  2YZU A;  3KMN A;  1SJI A;  2K18 A;  4MK3 A;  1QMV A;  4XS6 A;  4LMV A;  3WT2 A;  3IHQ A;  3QD9 A;  3WD6 A;  3A5I A;  5LNK e;  5D9V A;  1JZD A;  2H6Z A;  4L8E A;  3E9J B;  4GF0 A;  2GZZ A;  4IJI A;  5JCW A;  1YDK A;  5DBQ A;  3CSH A;  2FCH A;  4NWY A;  3KEB A;  4DSR A;  3F0I A;  1OC9 B;  5DJM A;  5KN1 A;  2PBJ A;  2V6K A;  1H4O A;  3RPN A;  5IMD A;  4ZIJ A;  4MPG A;  2B5X A;  1V9W A;  1ABA A;  4MF6 A;  3L0H A;  1TJD A;  2YOI A;  5IOX A;  1AC1 A;  4GTU A;  5F0G A;  4K0G A;  3LG6 A;  2KP1 A;  4MF7 A;  5JWR B;  1IYH A;  2ZUP A;  4V1A g;  5D9T A;  4FIW A;  4MH3 A;  1SJZ A;  3GKM A;  4MF5 A;  1GTA A;  4IN0 A;  2I4A A;  1S3R A;  4GSN A;  1TU7 A;  1VF2 A;  4OFT A;  3C1S A;  3KTL A;  2I9H A;  4ILF A;  3SWL A;  4TR3 A;  1JLW A;  4KUN A;  4PXO A;  2R0P A;  4O5U A;  4AJ6 A;  3FZ5 A;  3E0U A;  2VIM A;  4PNF A;  1TK0 B;  4D73 B;  3LYK A;  1V2A A;  2DC5 A;  5DCG A;  3EPT A;  3VLN A;  4JED A;  4YAV A;  1M0U A;  3O6T A;  4MZB A;  4N11 A;  4EF0 A;  1ZOF A;  4IBP A;  3IRA A;  3KJY A;  3TGZ A;  1AXD A;  3G7Y A;  4E8H A;  1BG5 A;  3EIN A;  2WS2 A;  3HJP A;  1TDI A;  4QL9 A;  3F3R A;  1GLP A;  1O81 A;  1WE0 A;  3HHV A;  4H86 A;  5GST A;  5HR1 A;  2R0C A;  4L0U A;  1GRX A;  1IYI A;  2OE3 A;  4RQR A;  5JWO B;  4G0K A;  3EWL A;  2C0F A;  1Q98 A;  2CQ9 A;  2IJY A;  2CAI A;  1HNB A;  2H8L A;  2QA1 A;  1M99 A;  1U3I A;  2DJJ A;  2N5F A;  3HJO A;  2BTO T;  1E6B A;  5F8B A;  2JZS A;  1ZYQ B;  1FO5 A;  3E3E A;  2C0G A;  2VD1 A;  3Q18 A;  1WJK A;  3Q6O A;  3ZVJ A;  4K9Z A;  1CQH A;  2C4J A;  8GSS A;  4FH8 A;  2M46 A;  1GTB A;  4KA0 A;  4IJ3 A;  5IMF A;  4IEL A;  1XBS A;  2I81 A;  2B7J A;  5DAK A;  3GUR A;  2H70 A;  1EGR A;  3H1N A;  3PGT A;  2QC7 A;  1Y6E A;  5G1K A;  4NPB A;  1X5C A;  1G6Y A;  2C0D A;  3DVW A;  4OO4 A;  4BWQ A;  1PX6 A;  2VUP A;  1AQV A;  2L6C A;  1ACV A;  4WF4 A;  1ERV A;  3ZZX A;  1TW9 A;  1O8W A;  1YEX A;  4F03 A;  2DKI A;  5JCG A;  3FK8 A;  4BA7 A;  1USB A;  4JE1 A;  1BQ7 A;  1XOB A;  2H1G A;  5CNW A;  4ZB6 A;  3LWA A;  4ZBA A;  2C0E A;  2PVO C;  2IL3 A;  3HCZ A;  4KB3 A;  2QSI A;  5AN1 A;  2FGX A;  3UIW A;  3TJB A;  3ZL5 A;  2HFD A;  2YCD A;  4I8B A;  5IIZ A;  2FWE A;  3ZTL A;  1U3A A;  2H19 A;  3KM6 A;  3RDW A;  4BIK A;  2A4H A;  5FT3 A;  1GSS A;  3IE3 A;  2L5L A;  5J9B A;  5B7C A;  2HE3 A;  3JCM L;  1KEB A;  2CT6 A;  2CZ3 A;  3EUR A;  2V32 A;  5E59 A;  4FYU A;  4HJM A;  1PGT A;  1PKW A;  1XWK A;  4IQ1 A;  4NHW A;  4WKW A;  1XWC A;  2HSH A;  3IC8 A;  4G2E A;  11GS A;  4IKH A;  4GLT A;  5ECS A;  4LMW A;  1B4P A;  1PD2 1;  2H71 A;  1XZO A;  3DD3 A;  3GA4 A;  1U6T A;  3QMX A;  5IPG A;  4PUA A;  3C71 A;  4NMU A;  1A2M A;  1V58 A;  5CRW A;  1K3L A;  1XWG A;  5DAK B;  2PN8 A;  5ELG A;  1TRU A;  4QL7 A;  2DJ0 A;  2FD3 A;  5GZZ B;  4KSM A;  2QA2 A;  4K6X A;  2K8V A;  3TKS A;  4MZC A;  3TB2 A;  3P90 A;  2L5O A;  4AJ7 A;  5ELA A;  4O32 A;  3DKS A;  3VI5 A;  2YPM A;  3GL3 A;  4N30 A;  1GSD A;  5ECQ B;  1T7P B;  2LNT A;  3GKK A;  4ID0 A;  1GUK A;  4YQV A;  4ZIL A;  2VCX A;  3VWX A;  1EV4 A;  1X9M B;  1RQM A;  2A2S A;  2CVB A;  5J5N A;  1NM3 A;  3APQ A;  1WP0 A;  1R7H A;  2DSA A;  3VFI A;  3F6D A;  1GSY A;  3D21 A;  3QR6 A;  4GCI A;  3TOT A;  4NHZ A;  5D9X A;  2I1U A;  5A4U A;  2F9S A;  3F3Q A;  4PUF C;  1LU4 A;  4K8M A;  4KND A;  2AJQ B;  1JFU A;  3KH7 A;  2X4A A;  3PH9 A;  1PKZ A;  1A0R P;  1J9B A;  1B9X C;  4TN8 A;  5J3R A;  2PWJ A;  3KCM A;  5DQY A;  3QFA C;  1EV9 A;  3VWU A;  1TXX A;  12GS A;  1A8L A;  3TOU A;  3WT1 A;  1WIK A;  4ZB8 A;  2L57 A;  4OO5 A;  4OMV A;  1M3J A;  1ZYP A;  1HNC A;  3GV1 A;  3GH6 A;  1JHB A;  2YWI A;  4KW6 A;  4EKZ A;  3VWV A;  2F3M A;  4ZL7 A;  3LFL A;  4HS1 A;  2VM1 A;  1SU9 A;  1J08 A;  2IPA A;  4KGI A;  3A2X A;  3UBK A;  2FLS A;  1G7O A;  1SYR A;  4HDE A;  1OAZ A;  3C73 A;  2IN3 A;  3MIX A;  4PQI A;  2LRT A;  3TKP A;  5ID2 B;  4YQU A;  2M72 A;  3I6A A;  3CSJ A;  4GSS A;  1SD8 A;  1TK5 B;  2VCV A;  1GNW A;  2EIR A;  3A2W A;  2NVL A;  3TRP A;  2RUE A;  5ECL B;  2MMA A;  2VCW A;  4CY6 A;  2O87 A;  2C1Y A;  1X5E A;  2QGV A;  1F3B A;  2GQL A;  2JZR A;  3BCI A;  3FYG A;  4EL1 A;  3TJJ A;  5B6M A;  1O6J A;  4KE3 A;  2B5Y A;  4HEA 2;  1SD9 A;  2L4Q A;  3M1G A;  1GTU A;  2CX3 A;  6GSU A;  5G30 A;  1SKS B;  2LUS A;  1A24 A;  2GQM A;  3A2V A;  2ON5 A;  2ZCT A;  1PQN A;  1AUC A;  3IBH A;  2CVD A;  1M9B A;  2FY6 A;  3LEF A;  5ECN B;  5GSS A;  2GT6 A;  5EVO A;  5AIS A;  2IMK A;  3FZ9 A;  1GSF A;  3TKS C;  4MCU A;  2YAN A;  1K0M A;  3ZLP A;  4JZQ A;  3ZRD A;  3UMA A;  3F6F A;  3D0Z A;  2KHP A;  4WBR D;  5H5Q A;  3CMI A;  1R5A A;  3DEX A;  3IV4 A;  1PX7 A;  1R26 A;  2HT9 A;  2R4V A;  3DML A;  2X8G A;  4POL A;  2D2Z A;  3L4N A;  4ICY A;  3ISO A;  3FR9 A;  1B48 A;  2M80 A;  2GSQ A;  1K0O A;  4IQA A;  5IMA A;  3ZFL A;  4N0V A;  2VLU A;  3MSZ A;  2XPE A;  19GS A;  4EO3 A;  3KXO A;  1MTC A;  2OBK A;  4K2X A;  2MZC A;  3UEM A;  3IK9 A;  1TP9 A;  3O3T A;  1F37 A;  4MP4 A;  4D73 A;  3FZA A;  1KTE A;  2P5Q A;  1HD2 A;  5B6N A;  2R37 A;  1Z3E A;  1X0R A;  5HFI A;  5ECP B;  3EC3 A;  5E4W A;  1OKT A;  1MD4 A;  2GSS A;  1Z7R A;  4KAE A;  2CX4 A;  1UN2 A;  2XHF A;  5IOW A;  1AW9 A;  5J4U A;  4FQU A;  3GX0 A;  4WF5 A;  2H76 A;  2E0Q A;  2N5B A;  2AV4 A;  3QFB C;  3DGQ A;  1M9A A;  4K7I A;  3C1R A;  2LQO A;  4EVM A;  2K8S A;  2L59 A;  4MH2 A;  3EU3 A;  1RK4 A;  5ECK B;  1VF4 A;  2OE1 A;  2C3N A;  3VUR A;  5C00 A;  3KTB A;  1SK1 A;  1QFN A;  1K0A A;  1LJR A;  2IMI A;  4K0N A;  4X43 A;  5LD0 A;  3US3 A;  5COH A;  1EEJ A;  1ST9 A;  2B3S A;  1K0N A;  3N9J A;  2RII A;  2FA4 A;  5DAL B;  3KIJ A;  1ILO A;  5ECI B;  2R2J A;  3ZMK A;  1YZX A;  3F63 A;  2LJR A;  4ML6 A;  3S9F A;  4LL1 B;  1B8X A;  3UAR A;  4IP6 A;  3TKS E;  4GQC A;  2HYX A;  4GWR A;  3UOM A;  2H1A A;  1V40 A;  2VCQ A;  4JBB A;  3FRC A;  2GS3 A;  3GKX A;  3HZ4 A;  3LYP A;  3APO A;  5HQP A;  4PQ1 A;  4MNN A;  5CRD A;  3LOR A;  3LJR A;  4USS A;  5D96 A;  3ZFB A;  3J7Y k;  5DJL A;  4OCE A;  3GTU B;  4GQF A;  4P3Y B;  2HRF A;  1MDK A;  3R2Q A;  4A5P A;  2XBQ A;  1N2A A;  2BMX A;  1GLQ A;  4EDZ A;  3MYD A;  4F9Z A;  3FHK A;  1OE8 A;  4KCE A;  2CA8 A;  1TU8 A;  1SK2 A;  2ALB A;  2H0H A;  4Z2R A;  3TRQ A;  2KOK A;  1PSQ A;  1SK0 A;  3D4M A;  1GSE A;  2C3T A;  4IVF A;  16GS A;  4MA9 A;  3ME8 A;  1FG4 A;  1H75 A;  2ES7 A;  2WJU A;  2KUC A;  1GSU A;  1FVK A;  4GXZ A;  3RHB A;  1PMT A;  3HXS A;  3F4R A;  4PTS A;  1QUW A;  1JLV A;  4JRR A;  3BJ5 A;  2HI7 A;  5AIX A;  2NDO A;  2IIY A;  3H93 A;  9GSS A;  1DUG A;  3HVV A;  4ZB9 A;  4X1U A;  4OFM A;  2RM6 A;  4TKY A;  1UVZ A;  3H4K A;  4YKF A;  2KP2 A;  2HSM A;  3PR8 A;  2DJ1 A;  1F2E A;  1BYE A;  1PA3 A;  3QAG A;  3CQF A;  3UL3 A;  4CHS A;  1ZCP A;  3D5J A;  4QQ7 A;  2LQQ A;  3UAP A;  4HUA A;  1C72 A;  2R6K A;  2YV9 A;  2GSR A;  5CO3 A;  1TOF A;  3QPM A;  4TXO B;  4EUY A;  4RI6 A;  1XG8 A;  5HR0 A;  5F06 A;  3MAK A;  2HSY A;  4MAB A;  3GH9 A;  1XVQ A;  4MLY A;  1PRX A;  4F82 A;  2X99 A;  2G2Q A;  1T1V A;  2V6O A;  3RHC A;  3BBY A;  3OR5 A;  3ZRE A;  5KOX A;  3U6V A;  2XBI A;  1EEM A;  2JAC A;  1AIU A;  1BAY A;  5D9W A;  4I2U A;  4POK A;  3D6I A;  4ZL8 A;  2PER A;  2AHE A;  4HZ4 A;  3O76 A;  5IMC A;  1LBK A;  3W6G A;  4AJ8 A;  2XC2 A;  3Q74 A;  4I2T A;  1A8Y A;  5EY6 A;  3W8J A;  4HU9 A;  4GST A;  1TKD B;  2O7K A;  4WXT A;  3TKR A;  1GP1 A;  2N5A A;  2LV3 A;  2YWN A;  2GTU A;  2F51 A;  2WZ9 A;  2OE0 A;  2HRA A;  4ZBB A;  2VAF A;  3KP8 A;  4L5L A;  5H5R A;  4EXJ A;  1AAZ A;  1OYJ A;  4O7H A;  3FZ4 A;  2IFQ B;  1AQX A;  4CDO A;  4NV5 A;  4WET A;  2FWH A;  2MMZ A;  2AUV A;  3IDV A;  1ON4 A;  3LW9 A;  4YQM A;  2MBT A;  4X4J A;  2JSY A;  1MDI A;  3LGC A;  1T4Y A;  2YZH A;  4LL4 B;  3WGX A;  5ID2 A;  3IXR A;  5ECR B;  4TRX A;  2B7K A;  3IAS 2;  4N0Z A;  2DLX A;  5J9C A;  3GST A;  4MJB A;  3UJ1 A;  3FY7 A;  3TJG A;  3TKQ A;  1F3A A;  2H6X A;  3HYP A;  3IC4 A;  2B1K A;  3F4S A;  1G0T A;  1ERU A;  1ERW A;  1FOH A;  1O8X A;  1O73 A;  3CYN A;  2H1B A;  4PGT A;  5D73 A;  2LTK A;  1M2D A;  4ISD A;  4FO5 A;  3CTG A;  1MD3 A;  2B5E A;  3MDK A;  3IR4 A;  2HZE A;  3FEU A;  1PN9 A;  2K6V A;  3M3M A;  5ENU A;  3ZIV A;  4Z2U A;  4G0L A;  4PUR A;  3VPT A;  3IA1 A;  2PUK C;  3HA9 A;  5D93 A;  4K5R A;  4K5S A;  5CRH A;  5ABR A;  1K0C A;  1OVN A;  2PGT A;  2QKE A;  1Z6M A;  3CTF A;  6GSV A;  1V98 A;  3ZIJ A;  2PMT A;  5IO2 A;  4WR4 A;  3GHA A;  3UVT A;  4K7O A;  4MJC A;  4POM A;  1YKA A;  4OCF A;  1ZL9 A;  1K0D A;  3TDG A;  1KNG A;  2EC4 A;  1FB6 A;  2VL2 A;  5BRT A;  4G0I A;  1E2Y A;  2VL9 A;  3F9U A;  2R5G A;  4NAX A;  4TOP A;  3QDN A;  3BOA A;  2LST A;  14GS A;  5ECM B;  2DIZ A;  1A2L A;  3EU4 A;  5H5S A;  4EC0 A;  3BCK A;  4KDY A;  2YJ7 A;  1A0F A;  1T3B A;  1R4W A;  5G5E A;  3LXT A;  3AY8 A;  1TK8 B;  1W4V A;  1VF3 A;  4YAP A;  5CRE A;  3GRX A;  4FYB A;  2FHE A;  4FYC A;  2E2M A;  4BVX B;  1EOH A;  2HLS A;  4XIH A;  4RUV A;  4ECC A;  1TI1 A;  4XS4 A;  5CP1 A;  3FMW A;  1W89 A;  2WFC A;  2CVK A;  4CW9 A;  4BWS A;  1CQG A;  1F6M C;  4V2M A;  2B6M A;  2HZE B;  2DJK A;  3D22 A;  5F05 A;  2TRX A;  3RAZ A;  1QQ2 A;  2CAQ A;  4I97 A;  1ERT A;  3DRN A;  4HI7 A;  2X8C A;  2H6Y A;  1I9D A;  2E7P A;  3ME7 A;  3EMP A;  4HQZ A;  3I9V 2;  3PIN A;  2X64 A;  7GSS A;  3LQ7 A;  5EL8 A;  3GIX A;  4PNG A;  1WMJ A;  3J7Y b;  5B8B A;  1PL1 A;  1ZYE A;  2HXK A;  1T00 A;  4KSO A;  2P0G A;  5EPF A;  3DWV A;  5J41 A;  4LA1 A;  3P8W A;  3EMX A;  3WGD A;  2HZF A;  13GS A;  3M8N A;  1R5P A;  2ON7 A;  1X5D A;  2L6D A;  4XHM A;  5G1L A;  3IAM 2;  2WUL A;  5KN2 A;  5KN3 A;  4Q5R A;  5B8A A;  1XPV A;  2OJL A;  5DVB A;  5GAN D;  1O7U A;  4IW9 A;  2FNO A;  1KBN A;  2YN1 A;  3G9B A;  2GGT A;  1EZK A;  1NHY A;  5DAL A;  3VI7 A;  2J23 A;  2A2P A;  2H66 A;  1YY7 A;  3LSZ A;  3U5R E;  2OA7 A;  1BED A;  2VO4 A;  5CAX A;  1UC7 A;  2UZ8 A;  4DSQ A;  1BX9 A;  3Q19 A;  1MDJ A;  5C04 A;  4XS4 B;  1EGO A;  4ECJ A;  2KLX A;  3LXZ A;  3CBU A;  5G5F A;  3F4T A;  2JL4 A;  3ZML A;  1F9M A;  3GTU A;  1DBY A;  1GWC A;  1HYU A;  4KCA A;  4POB A;  2H72 A;  2FWF A;  4EIP A;  2VL3 A;  3FKF A;  3QCP A;  1SYX A;  3ZYW A;  3HZ8 A;  2C8U A;  5AGY A;  2DJ2 A;  3TJK A;  4O5Q A;  4TR4 A;  4BL7 B;  1EOG A;  3UVH A;  1XCC A;  1URM A;  3H79 A;  2DJ3 A;  3HVS A;  3UBL A;  3DYR A;  4HQS A;  3HD5 A;  2JAD A;  3KH9 A;  3RBT A;  4ZL9 A;  2NBS A;  1T8E B;  1EP7 A;  1X9W B;  2GLR A;  4F0C A;  3GX8 A;  1JZO A;  5HR2 A;  2DMM A;  3I69 A;  3FW2 A;  4Q5Q A;  6GSW A;  4KF9 A;  3M9K A;  3GL5 A;  1RW1 A;  2CV4 A;  4ACS A;  1FAA A;  4YKG A;  4BVY B;  4DSS B;  2ZNM A;  3HVX A;  2RLI A;  4O92 A;  1VRS D;  3VK9 A;  4NV2 A;  1B4Q A;  1Q4J A;  2OKA A;  3M0F A;  2LEG A;  3NIV A;  3NZN A;  1XW9 A;  1M3I A;  4CY8 A;  2V1M A;  1OC3 A;  1FW1 A;  3DVX A;  4WR5 A;  2LRN A;  4MDC A;  4XTS A;  4ML1 A;  2C80 A;  4TXO A;  1YKC A;  1BJX A;  5GAP D;  1UA5 A;  4GRF A;  5KN0 A;  3I43 A;  2V2G A;  2LJA A;  4KX4 A;  1GTI A;  4X0X A;  4OD7 A;  1ZYN A;  3D4T A;  2O8V B;  1TRS A;  2TIR A;  4HZ2 A;  5KOW A;  4Q5N A;  4JR6 A;  3KGK A;  4G10 A;  1S3D A;  4MMM A;  1V57 A;  2MMN A;  1FVJ A;  1QK8 A;  2EIO A;  4OWY A;  2LJK A;  1FHE A;  3C8E A;  1TRV A;  2WB9 A;  3CRU A;  2IME A;  1HNA A;  2H01 A;  3P2A A;  1EP8 A;  3N5O A;  1X9S B;  4TXV A;  3NOF A;  2RM5 A;  3MNG A;  1U88 A;  5JCU A;  3HKR A;  1ZZY A;  4TR0 A;  4EIQ A;  1NW2 A;  2IFQ A;  2NPB A;  2L4C A;  1B9Y C;  1Y25 A;  4XRA A;  2JSZ A;  4MPF A;  4DEJ A;  1SJ6 A;  3IPZ A;  5IM9 A;  4IS0 A;  2IMF A;  4EDY A;  1AQW A;  4KH7 A;  2A2R A;  3G7I A;  4J2F A;  5ECO B;  4J57 E;  3CSI A;  3A5W A;  4XRD A;  4WEY A;  3KP9 A;  1YF0 A;  3RPP A;  3HY2 A;  1DE1 A;  4ZBD A;  1G7E A;  5DCH A;  2OAC A;  1ZMA A;  5A4V A;  2LS5 A;  18GS A;  3IK7 A;  3ED3 A;  5IMV A;  1O85 A;  2B1L A;  1MEK A;  4MJE A;  3TJF A;  3DXB A;  2WDU A;  3APS A;  5DQS A;  2EIQ A;  5IPH A;  4ECB A;  5HFG A;  3ERF A;  4V2N A;  1PN0 A;  5LCZ A;  1XW6 A;  2IWT A;  5DDL A;  10GS A;  1JZR A;  2X8H A;  1K3Y A;  2VCT A;  4EE0 A;  1GUH A;  4AGS A;  3QAV A;  5FWG A;  4V1A p;  3C7M A;  1GUL A;  4TW5 A;  4XS1 A;  2VM2 A;  3GSS A;  2RUF A;  2JU5 A;  1A2J A;  4JU5 A;  4I5Q A;  4V2L A;  2OBI A;  3GMF A;  3QAW A;  4MJA A;  3P7X A;  3ERW A;  2YV7 A;  6GSX A;  2YWO A;  2GT5 A;  3TCO A;  2VOC A;  1TTZ A;  4G19 A;  4N10 A;  1OC8 A;  1ML6 A;  2LNS A;  2MYG A;  2MMO A;  3GKN A;  2VLT A;  2OAD A;  4ULX A;  4XCS A;  2AYT A;  2TRC P;  2H73 A;  2LKU A;  4IHU A;  3QOU A;  3HJM A;  2GST A;  1DE2 A;  1EWX A;  3KMO A;  3L9U A;  2H75 A;  2BJX A;  1YJ6 A;  4OFN A;  3K8N A;  6GST A;  3GNJ A;  2R0G A;  3IHG A;  2O85 A;  4ZXG A;  3M9J A;  1YEP A;  5G31 A;  4BVX A;  3GUS A;  2YWM A;  3ZVJ D;  1XIY A;  3WYW A;  5IMZ A;  4O5R A;  2HRN A;  2VD0 A;  3A3T A; 
#chains in the Genus database with same CATH homology
 2YP6 A;  17GS A;  1N8J A;  2FA8 A;  2H30 A;  2X49 A;  4ECI A;  2Z9S A;  1Z5Y E;  2H74 A;  3MWH A;  2WCI A;  2MBS A;  5ECH B;  3GN3 A;  2WRT A;  3HDC A;  6GSY A;  4HJ2 A;  2YNX A;  2E2G A;  1XW5 A;  3H8Q A;  2PU9 C;  3WGE A;  2K9F A;  1FOV A;  3EVI A;  4DVC A;  1GNE A;  2H1D A;  2DML A;  2PVQ A;  3KZQ A;  2REM A;  4NXI A;  3VPQ A;  3IOS A;  2LRC A;  5L71 A;  1M7T A;  2I3Y A;  1SEN A;  1GL8 A;  2GZP A;  1S3A A;  5AIV A;  3R3E A;  2IMD A;  3EYT A;  1XXU A;  4K2D A;  2R3X A;  3GYK A;  2GDR A;  5INY A;  2FWG A;  1ZGN A;  22GS A;  4F0B A;  4RQX A;  1OE7 A;  1YQ1 A;  2O89 A;  3L78 A;  2WGR A;  1JZW A;  1OKD A;  1WWJ A;  2P31 A;  5A5K A;  1M2B A;  4PX1 A;  1FB0 A;  2V41 A;  4Q5F A;  2DKH A;  4TVE A;  1XOA A;  1SKW B;  1M2A A;  3VWW A;  4HOJ A;  1NHO A;  3W8S A;  2AAW A;  2DBC A;  4KDX A;  4RI7 A;  5D8I A;  2F8F A;  4L5O A;  3FR3 A;  2P5R A;  2HNL A;  2VCZ A;  4L0W A;  1THX A;  2GZY A;  2YJH A;  1TI3 A;  3L9V A;  4TR1 A;  1HQO A;  1Z9H A;  2C3Q A;  5F07 A;  3DIE A;  4IP1 A;  1Z6N A;  2FUG 2;  4G9H A;  1TRW A;  2G0F A;  1U87 A;  1QGV A;  5CRG A;  4J56 E;  1WOU A;  1SL2 B;  2CZ2 A;  1QXH A;  5FHI A;  1SL1 B;  3F8U A;  4WBJ A;  4MZW A;  5CYY A;  1THO A;  1SL0 B;  4F2I A;  1T4Z A;  3CRT A;  1WPI A;  6GSS A;  1GUM A;  3KD0 A;  5BMU A;  4BL7 A;  3V1W A;  1SKR B;  1Z7P A;  4IGJ A;  1VF1 A;  4K7N A;  2XPD A;  3SBC A;  3EE2 A;  1OC9 A;  5HFK A;  1A23 A;  4YH2 A;  1I5G A;  5KEJ A;  2VLV A;  2NTO A;  2J9H A;  1WRY A;  2DIY A;  1K0B A;  3G7J A;  4PQH A;  1GSQ A;  2PPT A;  1DSB A;  1XFL A;  3ERG A;  2HRK A;  1NSW A;  4LLR A;  4HU7 A;  2H0G A;  3GFK A;  4I6X A;  2AB6 A;  4BPY A;  1G6W A;  1XVW A;  1XWB A;  4K1F A;  5A4W A;  1YF1 A;  2JZT A;  4BVY A;  4DSS A;  3TUE A;  1VGL A;  1XWA A;  3BD2 A;  4Z7X A;  4E8E A;  3TRX A;  1S3C A;  4JR4 A;  3L9S A;  1K3O A;  2A4V A;  4AF2 A;  4Z2T A;  3ZIT A;  2GQK A;  2F8A A;  5G2Z A;  4TR1 B;  5IQY A;  3FR6 A;  1J0F A;  1PL2 A;  2VL2 C;  5JWQ B;  4KDU A;  5HR3 A;  20GS A;  2H0I A;  5IO0 A;  3CXG A;  3PPU A;  1GH2 A;  2GVP A;  2YZU A;  3KMN A;  1SJI A;  2K18 A;  4MK3 A;  1QMV A;  4XS6 A;  4LMV A;  3WT2 A;  3IHQ A;  3QD9 A;  3WD6 A;  3A5I A;  5LNK e;  5D9V A;  1JZD A;  2H6Z A;  4L8E A;  3E9J B;  4GF0 A;  2GZZ A;  4IJI A;  5JCW A;  1YDK A;  5DBQ A;  3CSH A;  2FCH A;  4NWY A;  3KEB A;  4DSR A;  3F0I A;  1OC9 B;  5DJM A;  5KN1 A;  2PBJ A;  2V6K A;  1H4O A;  3RPN A;  5IMD A;  4ZIJ A;  4MPG A;  2B5X A;  1V9W A;  1ABA A;  4MF6 A;  3L0H A;  1TJD A;  2YOI A;  5IOX A;  1AC1 A;  4GTU A;  5F0G A;  4K0G A;  3LG6 A;  2KP1 A;  4MF7 A;  5JWR B;  1IYH A;  2ZUP A;  4V1A g;  5D9T A;  4FIW A;  4MH3 A;  1SJZ A;  3GKM A;  4MF5 A;  1GTA A;  4IN0 A;  2I4A A;  4GSN A;  1TU7 A;  1VF2 A;  4OFT A;  3C1S A;  3KTL A;  2I9H A;  4ILF A;  3SWL A;  4TR3 A;  1JLW A;  4KUN A;  4PXO A;  2R0P A;  4O5U A;  4AJ6 A;  3FZ5 A;  3E0U A;  2VIM A;  4PNF A;  1TK0 B;  4D73 B;  3LYK A;  1V2A A;  2DC5 A;  5DCG A;  3EPT A;  3VLN A;  4JED A;  4YAV A;  1M0U A;  3O6T A;  4MZB A;  4N11 A;  4EF0 A;  1ZOF A;  4IBP A;  3IRA A;  3KJY A;  3TGZ A;  1AXD A;  3G7Y A;  4E8H A;  1BG5 A;  3EIN A;  2WS2 A;  3HJP A;  1TDI A;  4QL9 A;  3F3R A;  1GLP A;  1O81 A;  1WE0 A;  3HHV A;  4H86 A;  5GST A;  5HR1 A;  2R0C A;  4L0U A;  1GRX A;  1IYI A;  2OE3 A;  4RQR A;  5JWO B;  4G0K A;  3EWL A;  2C0F A;  1Q98 A;  2CQ9 A;  2IJY A;  2CAI A;  1HNB A;  2H8L A;  2QA1 A;  1M99 A;  1U3I A;  2DJJ A;  2N5F A;  3HJO A;  2BTO T;  1E6B A;  5F8B A;  2JZS A;  1ZYQ B;  1FO5 A;  3E3E A;  2C0G A;  2VD1 A;  3Q18 A;  1WJK A;  3Q6O A;  3ZVJ A;  4K9Z A;  1CQH A;  2C4J A;  8GSS A;  4FH8 A;  2M46 A;  1GTB A;  4KA0 A;  4IJ3 A;  5IMF A;  4IEL A;  1XBS A;  2I81 A;  2B7J A;  5DAK A;  3GUR A;  2H70 A;  1EGR A;  3H1N A;  3PGT A;  2QC7 A;  1Y6E A;  5G1K A;  4NPB A;  1X5C A;  1G6Y A;  2C0D A;  3DVW A;  4OO4 A;  4BWQ A;  1PX6 A;  2VUP A;  1AQV A;  2L6C A;  1ACV A;  4WF4 A;  1ERV A;  3ZZX A;  1TW9 A;  1O8W A;  1YEX A;  4F03 A;  2DKI A;  5JCG A;  3FK8 A;  4BA7 A;  1USB A;  4JE1 A;  1BQ7 A;  1XOB A;  2H1G A;  5CNW A;  4ZB6 A;  3LWA A;  4ZBA A;  2C0E A;  2PVO C;  2IL3 A;  3HCZ A;  4KB3 A;  2QSI A;  5AN1 A;  2FGX A;  3UIW A;  3TJB A;  3ZL5 A;  2HFD A;  2YCD A;  4I8B A;  5IIZ A;  2FWE A;  3ZTL A;  1U3A A;  2H19 A;  3KM6 A;  3RDW A;  2A4H A;  5FT3 A;  1GSS A;  3IE3 A;  2L5L A;  5J9B A;  5B7C A;  2HE3 A;  3JCM L;  1KEB A;  2CT6 A;  2CZ3 A;  3EUR A;  2V32 A;  5E59 A;  4FYU A;  4HJM A;  1PGT A;  1PKW A;  1XWK A;  4IQ1 A;  4NHW A;  4WKW A;  1XWC A;  2HSH A;  3IC8 A;  4G2E A;  11GS A;  4IKH A;  4GLT A;  5ECS A;  4LMW A;  1B4P A;  1PD2 1;  2H71 A;  1XZO A;  3DD3 A;  3GA4 A;  1U6T A;  3QMX A;  5IPG A;  4PUA A;  3C71 A;  4NMU A;  1A2M A;  1V58 A;  5CRW A;  1K3L A;  1XWG A;  5DAK B;  2PN8 A;  5ELG A;  1TRU A;  4QL7 A;  2DJ0 A;  2FD3 A;  5GZZ B;  4KSM A;  2QA2 A;  4K6X A;  2K8V A;  3TKS A;  4MZC A;  3TB2 A;  3P90 A;  2L5O A;  4AJ7 A;  5ELA A;  4O32 A;  3DKS A;  3VI5 A;  2YPM A;  3GL3 A;  4N30 A;  1GSD A;  5ECQ B;  1T7P B;  2LNT A;  3GKK A;  4ID0 A;  1GUK A;  4YQV A;  4ZIL A;  2VCX A;  3VWX A;  1EV4 A;  1X9M B;  1RQM A;  2A2S A;  2CVB A;  5J5N A;  1NM3 A;  3APQ A;  1WP0 A;  1R7H A;  2DSA A;  3VFI A;  3F6D A;  1GSY A;  3D21 A;  3QR6 A;  4GCI A;  3TOT A;  4NHZ A;  5D9X A;  2I1U A;  5A4U A;  2F9S A;  3F3Q A;  4PUF C;  1LU4 A;  4K8M A;  4KND A;  2AJQ B;  1JFU A;  3KH7 A;  2X4A A;  3PH9 A;  1PKZ A;  1A0R P;  1J9B A;  1B9X C;  4TN8 A;  5J3R A;  2PWJ A;  3KCM A;  5DQY A;  3QFA C;  1EV9 A;  3VWU A;  1TXX A;  12GS A;  1A8L A;  3TOU A;  3WT1 A;  1WIK A;  4ZB8 A;  2L57 A;  4OO5 A;  4OMV A;  1ZYP A;  1HNC A;  3GV1 A;  3GH6 A;  1JHB A;  2YWI A;  4KW6 A;  4EKZ A;  3VWV A;  2F3M A;  4ZL7 A;  3LFL A;  4HS1 A;  2VM1 A;  1SU9 A;  1J08 A;  2IPA A;  4KGI A;  3A2X A;  3UBK A;  2FLS A;  1G7O A;  1SYR A;  4HDE A;  1OAZ A;  3C73 A;  2IN3 A;  3MIX A;  4PQI A;  2LRT A;  3TKP A;  5ID2 B;  4YQU A;  2M72 A;  3I6A A;  3CSJ A;  4GSS A;  1SD8 A;  1TK5 B;  2VCV A;  1GNW A;  2EIR A;  3A2W A;  2NVL A;  3TRP A;  2RUE A;  5ECL B;  2MMA A;  2VCW A;  4CY6 A;  2O87 A;  2C1Y A;  1X5E A;  2QGV A;  1F3B A;  2GQL A;  2JZR A;  3BCI A;  3FYG A;  4EL1 A;  3TJJ A;  5B6M A;  1O6J A;  4KE3 A;  2B5Y A;  4HEA 2;  1SD9 A;  2L4Q A;  3M1G A;  1GTU A;  2CX3 A;  6GSU A;  5G30 A;  1SKS B;  2LUS A;  1A24 A;  2GQM A;  3A2V A;  2ON5 A;  2ZCT A;  1PQN A;  1AUC A;  3IBH A;  2CVD A;  1M9B A;  2FY6 A;  3LEF A;  5ECN B;  5GSS A;  2GT6 A;  5EVO A;  5AIS A;  2IMK A;  3FZ9 A;  1GSF A;  3TKS C;  4MCU A;  2YAN A;  1K0M A;  3ZLP A;  4JZQ A;  3ZRD A;  3UMA A;  3F6F A;  3D0Z A;  2KHP A;  4WBR D;  5H5Q A;  3CMI A;  1R5A A;  3DEX A;  3IV4 A;  1PX7 A;  1R26 A;  2HT9 A;  2R4V A;  3DML A;  2X8G A;  4POL A;  2D2Z A;  3L4N A;  4ICY A;  3ISO A;  3FR9 A;  1B48 A;  2M80 A;  2GSQ A;  1K0O A;  4IQA A;  5IMA A;  3ZFL A;  4N0V A;  2VLU A;  3MSZ A;  2XPE A;  19GS A;  4EO3 A;  3KXO A;  1MTC A;  2OBK A;  4K2X A;  2MZC A;  3UEM A;  3IK9 A;  1TP9 A;  3O3T A;  1F37 A;  4MP4 A;  4D73 A;  3FZA A;  1KTE A;  2P5Q A;  1HD2 A;  5B6N A;  2R37 A;  1Z3E A;  1X0R A;  5HFI A;  5ECP B;  3EC3 A;  5E4W A;  1OKT A;  1MD4 A;  2GSS A;  1Z7R A;  4KAE A;  2CX4 A;  1UN2 A;  2XHF A;  5IOW A;  1AW9 A;  5J4U A;  4FQU A;  3GX0 A;  4WF5 A;  2H76 A;  2E0Q A;  2N5B A;  2AV4 A;  3QFB C;  3DGQ A;  1M9A A;  4K7I A;  3C1R A;  2LQO A;  4EVM A;  2K8S A;  2L59 A;  4MH2 A;  3EU3 A;  1RK4 A;  5ECK B;  1VF4 A;  2OE1 A;  2C3N A;  3VUR A;  5C00 A;  3KTB A;  1SK1 A;  1QFN A;  1K0A A;  1LJR A;  2IMI A;  4K0N A;  4X43 A;  5LD0 A;  3US3 A;  5COH A;  1EEJ A;  1ST9 A;  2B3S A;  1K0N A;  3N9J A;  2RII A;  2FA4 A;  5DAL B;  3KIJ A;  1ILO A;  5ECI B;  2R2J A;  3ZMK A;  1YZX A;  3F63 A;  2LJR A;  4ML6 A;  3S9F A;  4LL1 B;  1B8X A;  3UAR A;  4IP6 A;  3TKS E;  4GQC A;  2HYX A;  4GWR A;  3UOM A;  2H1A A;  1V40 A;  2VCQ A;  4JBB A;  3FRC A;  2GS3 A;  3GKX A;  3HZ4 A;  3LYP A;  3APO A;  5HQP A;  4PQ1 A;  4MNN A;  5CRD A;  3LOR A;  3LJR A;  4USS A;  5D96 A;  3ZFB A;  3J7Y k;  5DJL A;  4OCE A;  3GTU B;  4GQF A;  4P3Y B;  2HRF A;  1MDK A;  3R2Q A;  4A5P A;  2XBQ A;  1N2A A;  2BMX A;  1GLQ A;  4EDZ A;  3MYD A;  4F9Z A;  3FHK A;  1OE8 A;  4KCE A;  2CA8 A;  1TU8 A;  1SK2 A;  2ALB A;  2H0H A;  4Z2R A;  3TRQ A;  2KOK A;  1PSQ A;  1SK0 A;  3D4M A;  1GSE A;  2C3T A;  4IVF A;  16GS A;  4MA9 A;  3ME8 A;  1FG4 A;  1H75 A;  2ES7 A;  2WJU A;  2KUC A;  1GSU A;  1FVK A;  4GXZ A;  3RHB A;  1PMT A;  3HXS A;  3F4R A;  4PTS A;  1QUW A;  1JLV A;  4JRR A;  3BJ5 A;  2HI7 A;  5AIX A;  2NDO A;  2IIY A;  3H93 A;  9GSS A;  1DUG A;  3HVV A;  4ZB9 A;  4X1U A;  4OFM A;  2RM6 A;  4TKY A;  1UVZ A;  3H4K A;  4YKF A;  2KP2 A;  2HSM A;  3PR8 A;  2DJ1 A;  1F2E A;  1BYE A;  1PA3 A;  3QAG A;  3UL3 A;  4CHS A;  1ZCP A;  3D5J A;  4QQ7 A;  2LQQ A;  3UAP A;  4HUA A;  1C72 A;  2R6K A;  2YV9 A;  2GSR A;  5CO3 A;  1TOF A;  3QPM A;  4TXO B;  4EUY A;  4RI6 A;  5HR0 A;  5F06 A;  3MAK A;  2HSY A;  4MAB A;  3GH9 A;  1XVQ A;  4MLY A;  1PRX A;  4F82 A;  2X99 A;  2G2Q A;  1T1V A;  2V6O A;  3RHC A;  3BBY A;  3OR5 A;  3ZRE A;  5KOX A;  3U6V A;  2XBI A;  1EEM A;  2JAC A;  1AIU A;  1BAY A;  5D9W A;  4I2U A;  4POK A;  3D6I A;  4ZL8 A;  2PER A;  2AHE A;  4HZ4 A;  3O76 A;  5IMC A;  1LBK A;  3W6G A;  4AJ8 A;  2XC2 A;  3Q74 A;  4I2T A;  1A8Y A;  5EY6 A;  3W8J A;  4HU9 A;  4GST A;  1TKD B;  2O7K A;  4WXT A;  3TKR A;  1GP1 A;  2N5A A;  2LV3 A;  2YWN A;  2GTU A;  2F51 A;  2WZ9 A;  2OE0 A;  2HRA A;  4ZBB A;  2VAF A;  3KP8 A;  4L5L A;  5H5R A;  4EXJ A;  1AAZ A;  1OYJ A;  4O7H A;  3FZ4 A;  2IFQ B;  1AQX A;  4CDO A;  4NV5 A;  4WET A;  2FWH A;  2MMZ A;  2AUV A;  3IDV A;  1ON4 A;  3LW9 A;  4YQM A;  2MBT A;  4X4J A;  2JSY A;  1MDI A;  3LGC A;  1T4Y A;  2YZH A;  4LL4 B;  3WGX A;  5ID2 A;  3IXR A;  5ECR B;  4TRX A;  2B7K A;  3IAS 2;  4N0Z A;  2DLX A;  5J9C A;  3GST A;  4MJB A;  3UJ1 A;  3FY7 A;  3TJG A;  3TKQ A;  1F3A A;  2H6X A;  3HYP A;  3IC4 A;  2B1K A;  3F4S A;  1G0T A;  1ERU A;  1ERW A;  1FOH A;  1O8X A;  1O73 A;  3CYN A;  2H1B A;  4PGT A;  5D73 A;  2LTK A;  1M2D A;  4ISD A;  4FO5 A;  3CTG A;  1MD3 A;  2B5E A;  3MDK A;  3IR4 A;  2HZE A;  3FEU A;  1PN9 A;  2K6V A;  3M3M A;  5ENU A;  3ZIV A;  4Z2U A;  4G0L A;  4PUR A;  3VPT A;  3IA1 A;  2PUK C;  3HA9 A;  5D93 A;  4K5R A;  4K5S A;  5CRH A;  5ABR A;  1K0C A;  1OVN A;  2PGT A;  2QKE A;  1Z6M A;  3CTF A;  6GSV A;  1V98 A;  3ZIJ A;  2PMT A;  5IO2 A;  4WR4 A;  3GHA A;  3UVT A;  4K7O A;  4MJC A;  4POM A;  1YKA A;  4OCF A;  1ZL9 A;  1K0D A;  3TDG A;  1KNG A;  2EC4 A;  1FB6 A;  2VL2 A;  5BRT A;  4G0I A;  1E2Y A;  2VL9 A;  3F9U A;  2R5G A;  4NAX A;  4TOP A;  3QDN A;  3BOA A;  2LST A;  14GS A;  5ECM B;  2DIZ A;  1A2L A;  3EU4 A;  5H5S A;  4EC0 A;  3BCK A;  4KDY A;  2YJ7 A;  1A0F A;  1T3B A;  1R4W A;  5G5E A;  3LXT A;  3AY8 A;  1TK8 B;  1W4V A;  1VF3 A;  4YAP A;  5CRE A;  3GRX A;  4FYB A;  2FHE A;  4FYC A;  2E2M A;  4BVX B;  1EOH A;  2HLS A;  4XIH A;  4RUV A;  4ECC A;  1TI1 A;  4XS4 A;  5CP1 A;  3FMW A;  1W89 A;  2WFC A;  2CVK A;  4CW9 A;  4BWS A;  1CQG A;  1F6M C;  4V2M A;  2B6M A;  2HZE B;  2DJK A;  3D22 A;  5F05 A;  2TRX A;  3RAZ A;  1QQ2 A;  2CAQ A;  4I97 A;  1ERT A;  3DRN A;  4HI7 A;  2X8C A;  2H6Y A;  1I9D A;  2E7P A;  3ME7 A;  3EMP A;  4HQZ A;  3I9V 2;  3PIN A;  2X64 A;  7GSS A;  3LQ7 A;  5EL8 A;  3GIX A;  4PNG A;  1WMJ A;  3J7Y b;  5B8B A;  1PL1 A;  1ZYE A;  2HXK A;  1T00 A;  4KSO A;  2P0G A;  5EPF A;  3DWV A;  5J41 A;  4LA1 A;  3P8W A;  3EMX A;  3WGD A;  2HZF A;  13GS A;  3M8N A;  1R5P A;  2ON7 A;  1X5D A;  2L6D A;  4XHM A;  5G1L A;  3IAM 2;  2WUL A;  5KN2 A;  5KN3 A;  4Q5R A;  5B8A A;  1XPV A;  2OJL A;  5DVB A;  5GAN D;  1O7U A;  4IW9 A;  2FNO A;  1KBN A;  2YN1 A;  3G9B A;  2GGT A;  1EZK A;  1NHY A;  5DAL A;  3VI7 A;  2J23 A;  2A2P A;  2H66 A;  1YY7 A;  3LSZ A;  3U5R E;  2OA7 A;  1BED A;  2VO4 A;  5CAX A;  1UC7 A;  2UZ8 A;  4DSQ A;  1BX9 A;  3Q19 A;  1MDJ A;  5C04 A;  4XS4 B;  1EGO A;  4ECJ A;  2KLX A;  3LXZ A;  3CBU A;  5G5F A;  3F4T A;  2JL4 A;  3ZML A;  1F9M A;  3GTU A;  1DBY A;  1GWC A;  1HYU A;  4KCA A;  4POB A;  2H72 A;  2FWF A;  4EIP A;  2VL3 A;  3FKF A;  3QCP A;  1SYX A;  3ZYW A;  3HZ8 A;  2C8U A;  5AGY A;  2DJ2 A;  3TJK A;  4O5Q A;  4TR4 A;  4BL7 B;  1EOG A;  3UVH A;  1XCC A;  1URM A;  3H79 A;  2DJ3 A;  3HVS A;  3UBL A;  3DYR A;  4HQS A;  3HD5 A;  2JAD A;  3KH9 A;  3RBT A;  4ZL9 A;  2NBS A;  1T8E B;  1EP7 A;  1X9W B;  2GLR A;  4F0C A;  3GX8 A;  1JZO A;  5HR2 A;  2DMM A;  3I69 A;  3FW2 A;  4Q5Q A;  6GSW A;  4KF9 A;  3M9K A;  3GL5 A;  1RW1 A;  2CV4 A;  4ACS A;  1FAA A;  4YKG A;  4BVY B;  4DSS B;  2ZNM A;  3HVX A;  2RLI A;  4O92 A;  1VRS D;  3VK9 A;  4NV2 A;  1B4Q A;  1Q4J A;  2OKA A;  3M0F A;  2LEG A;  3NIV A;  3NZN A;  1XW9 A;  4CY8 A;  2V1M A;  1OC3 A;  1FW1 A;  3DVX A;  4WR5 A;  2LRN A;  4MDC A;  4XTS A;  4ML1 A;  2C80 A;  4TXO A;  1YKC A;  1BJX A;  5GAP D;  1UA5 A;  4GRF A;  5KN0 A;  3I43 A;  2V2G A;  2LJA A;  4KX4 A;  1GTI A;  4X0X A;  4OD7 A;  1ZYN A;  3D4T A;  2O8V B;  1TRS A;  2TIR A;  4HZ2 A;  5KOW A;  4Q5N A;  4JR6 A;  3KGK A;  4G10 A;  1S3D A;  4MMM A;  1V57 A;  2MMN A;  1FVJ A;  1QK8 A;  2EIO A;  4OWY A;  2LJK A;  1FHE A;  3C8E A;  1TRV A;  2WB9 A;  3CRU A;  2IME A;  1HNA A;  2H01 A;  3P2A A;  1EP8 A;  3N5O A;  1X9S B;  4TXV A;  3NOF A;  2RM5 A;  3MNG A;  1U88 A;  5JCU A;  3HKR A;  1ZZY A;  4TR0 A;  4EIQ A;  1NW2 A;  2IFQ A;  2NPB A;  2L4C A;  1B9Y C;  1Y25 A;  4XRA A;  2JSZ A;  4MPF A;  4DEJ A;  1SJ6 A;  3IPZ A;  5IM9 A;  4IS0 A;  2IMF A;  4EDY A;  1AQW A;  4KH7 A;  2A2R A;  3G7I A;  4J2F A;  5ECO B;  4J57 E;  3CSI A;  3A5W A;  4XRD A;  4WEY A;  3KP9 A;  1YF0 A;  3RPP A;  3HY2 A;  1DE1 A;  4ZBD A;  1G7E A;  5DCH A;  2OAC A;  1ZMA A;  5A4V A;  2LS5 A;  18GS A;  3IK7 A;  3ED3 A;  5IMV A;  1O85 A;  2B1L A;  1MEK A;  4MJE A;  3TJF A;  3DXB A;  2WDU A;  3APS A;  5DQS A;  2EIQ A;  5IPH A;  4ECB A;  5HFG A;  3ERF A;  4V2N A;  1PN0 A;  5LCZ A;  1XW6 A;  2IWT A;  5DDL A;  10GS A;  1JZR A;  2X8H A;  1K3Y A;  2VCT A;  4EE0 A;  1GUH A;  4AGS A;  3QAV A;  5FWG A;  4V1A p;  3C7M A;  1GUL A;  4TW5 A;  4XS1 A;  2VM2 A;  3GSS A;  2RUF A;  2JU5 A;  1A2J A;  4JU5 A;  4I5Q A;  4V2L A;  2OBI A;  3GMF A;  3QAW A;  4MJA A;  3P7X A;  3ERW A;  2YV7 A;  6GSX A;  2YWO A;  2GT5 A;  3TCO A;  2VOC A;  1TTZ A;  4G19 A;  4N10 A;  1OC8 A;  1ML6 A;  2LNS A;  2MYG A;  2MMO A;  3GKN A;  2VLT A;  2OAD A;  4ULX A;  4XCS A;  2AYT A;  2TRC P;  2H73 A;  2LKU A;  4IHU A;  3QOU A;  3HJM A;  2GST A;  1DE2 A;  1EWX A;  3KMO A;  3L9U A;  2H75 A;  2BJX A;  1YJ6 A;  4OFN A;  3K8N A;  6GST A;  3GNJ A;  2R0G A;  3IHG A;  2O85 A;  4ZXG A;  3M9J A;  1YEP A;  5G31 A;  4BVX A;  3GUS A;  2YWM A;  3ZVJ D;  1XIY A;  3WYW A;  5IMZ A;  4O5R A;  2HRN A;  2VD0 A;  3A3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...