1T4YA

Solution structure of the n-terminal domain of synechococcus elongatus sasa (average minimized structure)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
105
structure length
105
Chain Sequence
GSSLSPQALAQPLLLQLFVDTRPLSQHIVQRVKNILAAVEATVPISLQVINVADQPQLVEYYRLVVTPALVKIGPGSRQVLSGIDLTDQLANQLPQWLVQQEGIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Adaptive-response sensory-kinase sasA
publication title Structure of the N-terminal domain of the circadian clock-associated histidine kinase SasA.
pubmed doi rcsb
source organism Synechococcus elongatus
total genus 19
structure length 105
sequence length 105
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07689 KaiB KaiB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1t4yA01
4N11A 4N0ZA 1R7HA 3RPNA 5HFIA 1V40A 2VOCA 2GTUA 1ACVA 2ALBA 5B7CA 1ERWA 1TDIA 3M1GA 4BWQA 1V58A 4KW6A 3RAZA 4KB3A 1BQ7A 2YZHA 4ML1A 1MD4A 2LRTA 5G5FA 1O81A 1YDKA 3RDWA 4OO4A 4HUAA 5G30A 2RM5A 1IYIA 1ERUA 1AAZA 1ZMAA 2H6YA 2VCWA 2IMKA 5JCWA 2I4AA 5G1KA 1BYEA 3ME8A 3ZIJA 1ZGNA 4KSOA 4K7IA 3QMXA 3VLNA 5D96A 4EKZA 2V6KA 3IHQA 3FYGA 2FWHA 2WFCA 3L9UA 2QGVA 4ZB6A 3U5RE 1X0RA 2KHPA 5B8AA 2KP1A 2FD3A 2TRCP 1EV9A 3QFAC 3IR4A 3SWLA 4NHZA 2EC4A 1YF1A 4OMVA 4MH2A 3TRPA 3ZIVA 3WD6A 14GSA 1G0TA 3C7MA 2JSZA 4MCUA 4BL7A 3QAWA 2OKAA 4L8EA 2ZNMA 1K3OA 1GH2A 2DJ3A 5INYA 4JR4A 2H8LA 2RM6A 4TKYA 3UOMA 3WGXA 1BJXA 3RHBA 1QFNA 3IRAA 1ST9A 4ZB9A 2KOKA 3EURA 2H01A 3FZAA 4IW9A 1FAAA 1GTBA 2VCZA 4ECIA 19GSA 3F63A 4FYCA 3ZMLA 2QKEA 4KE3A 1AUCA 5C00A 4DEJA 5HR0A 3O3TA 1JLVA 2M46A 1B9YC 1M2DA 2H73A 4BWSA 4NHWA 1V2AA 5JCUA 4ULXA 2GQKA 4IVFA 4E8HA 2O89A 1GSDA 2VUPA 3LQ7A 2FWGA 3WGDA 3TUEA 3D22A 2X99A 1FB6A 2LNSA 3M8NA 4WETA 1E6BA 4F03A 5J9CA 1O7UA 5ECKB 3I9V2 3KXOA 1J0FA 3VWXA 1B9XC 2K8VA 4JZQA 1OAZA 3TJFA 1W89A 1FHEA 3TKSA 2ZUPA 1A24A 4MK3A 3IK7A 4RQXA 3HZ8A 5JWQB 3TOUA 5F05A 1GRXA 4PXOA 4V2NA 2PBJA 1WIKA 3ZITA 2OJLA 4K0GA 3F8UA 5IMAA 2CT6A 2IPAA 4Q5NA 1N8JA 3RBTA 3ZL5A 2OBIA 3KGKA 1JZWA 1FVKA 3V1WA 2N5AA 2CVBA 1GLQA 1TI1A 1A0FA 3D4TA 3IAS2 3CXGA 1SK0A 1PA3A 1DSBA 5DVBA 3FZ9A 3ZMKA 3W8SA 2YNXA 2R3XA 1E2YA 5JWOB 2B6MA 1WP0A 1R26A 1MDKA 3F3RA 1AC1A 1TRSA 1YZXA 2CZ3A 1U3IA 2I3YA 2WZ9A 1RW1A 2L57A 1O73A 5DCGA 3M9KA 2MMNA 4XRDA 4MJBA 2A4VA 2YZUA 3QDNA 5ECIB 2WRTA 4KA0A 1S3DA 1U3AA 4RUVA 1PGTA 2PERA 3L9VA 2AAWA 6GSUA 2GSTA 3KH9A 5ELAA 1M2BA 4QQ7A 1VF3A 5COHA 4TR4A 3M0FA 1OC8A 3KH7A 1SK1A 1PSQA 3TRQA 2FNOA 2V41A 4P3YB 4JBBA 1X9WB 5IMDA 1GSEA 5GAND 5AGYA 4FYUA 3D6IA 3ERWA 5C04A 4FO5A 2RLIA 3TJBA 4YAVA 2JZSA 4D73A 2IJYA 3FHKA 3RHCA 4DVCA 3KTLA 3G9BA 1VF2A 3IXRA 5G31A 1TRUA 9GSSA 1PN9A 1K0AA 1KTEA 1ZYQB 3ZVJD 3CTFA 4D73B 4IELA 2K18A 2PWJA 2QSIA 2DJ2A 2V2GA 3FEUA 5HFKA 3KP9A 1R5PA 1Z6MA 5F0GA 6GSWA 2F3MA 3LJRA 1PX6A 3KEBA 3W6GA 3N5OA 1SU9A 4PURA 2FLSA 3GN3A 3ISOA 4EF0A 1GUKA 2L6DA 3APOA 3EU3A 2B7KA 2H75A 5IMZA 1SYXA 1J9BA 1URMA 3UVHA 2GGTA 1SJIA 3HJOA 3KM6A 4NAXA 3NOFA 2H0HA 3TKQA 5D93A 1BX9A 4ZL7A 4GQCA 5H5SA 1FW1A 1XFLA 3O6TA 1HNCA 4HJ2A 2LSTA 3BOAA 3NZNA 2LV3A 1SENA 3HKRA 1YQ1A 3F4TA 2H74A 2FY6A 2C0FA 3P8WA 1TI3A 6GSYA 5HQPA 2EIQA 2HSHA 1JZDA 4K7OA 2HZEA 2YJHA 1K0CA 5J41A 2R37A 4HS1A 1U87A 3UAPA 5HR3A 1A23A 4N30A 1K0OA 2FGXA 4I2TA 5ECLB 2C80A 4TOPA 1G6WA 4GQFA 4WBRD 2YJ7A 3F3QA 4HDEA 5IM9A 2HZEB 3MDKA 3KZQA 5IPGA 1MTCA 4MZWA 2DMMA 2L5LA 2LQOA 2PN8A 2FHEA 3IPZA 2YWMA 5AIXA 1WRYA 1GSFA 4PUFC 3VWWA 1XWAA 1PKWA 1G6YA 5LNKe 3F0IA 4DSQA 3APSA 3CSHA 2P31A 3IDVA 1EP7A 1OC3A 1EEJA 2M80A 5IO0A 2EIRA 1HNBA 3ZREA 2IMEA 2I9HA 2P0GA 3FR6A 1EV4A 2YV9A 5D9TA 4NWYA 2AHEA 2B5EA 2L4CA 2CX4A 1GTAA 2YWOA 2XHFA 5D73A 5F06A 5CAXA 2GSQA 2NBSA 1WE0A 22GSA 1AQVA 4G2EA 4K2DA 2Z9SA 4XCSA 2DJJA 4Q5RA 1RK4A 5ECPB 4ECJA 4Q5QA 1XWGA 4L5OA 3GH9A 1WJKA 3GH6A 4TR1A 5E4WA 6GSVA 5IOXA 1FO5A 1ERVA 2C3QA 2C1YA 1V9WA 1EEMA 1TXXA 2JU5A 3EC3A 2HNLA 3IC4A 4V2MA 3QFBC 2VCXA 2YCDA 3GRXA 4DSSB 2CAQA 2VCVA 4MF5A 2NVLA 4AJ8A 4BVYA 1QK8A 2H1GA 1PX7A 4ZIJA 1VF4A 3MNGA 4TRXA 5DQYA 3IA1A 4MABA 4TR1B 2FUG2 2DC5A 1EGOA 2GT5A 4G19A 3W8JA 3H79A 4MMMA 1BEDA 2CZ2A 3L4NA 1GNWA 1GSYA 4GRFA 2F8AA 4WEYA 2H30A 1DUGA 2X8CA 5CRDA 2G0FA 1TKDB 3L9SA 3CBUA 1T00A 1NSWA 3A5WA 2XBIA 1SL0B 3HY2A 1EOHA 4TN8A 4GSSA 5DALA 3J7Yb 4K0NA 5KN2A 1HNAA 2X8GA 1M9BA 2YWIA 5G2ZA 2VL2A 2E0QA 3UVTA 5DAKA 2H72A 2XPEA 3KMOA 1VGLA 4I8BA 4MPFA 5DALB 2YANA 3H93A 1OKDA 3FKFA 3ZVJA 3A2WA 3HZ4A 4CW9A 3VURA 18GSA 4HQSA 3TKSE 5ECRB 2HXKA 4Q5FA 7GSSA 4KNDA 3DEXA 2HI7A 3ME7A 2PU9C 2JADA 2XPDA 1GTUA 2A2RA 2B1KA 2MMZA 2B3SA 2B5YA 4LL4B 2C4JA 2R6KA 3ZYWA 4TXVA 4K8MA 3M3MA 3HDCA 3DXBA 5IMCA 1JLWA 1M99A 1M0UA 4ISDA 2RUFA 2RUEA 3FR9A 5ELGA 2WULA 3ZFBA 3C1RA 5KN1A 2OADA 1M2AA 2VL9A 3EYTA 5KN0A 5CREA 4EC0A 5JCGA 3D0ZA 3KJYA 3DVXA 4RQRA 2OACA 4OCFA 4WR4A 3I69A 2K9FA 5GSTA 3UIWA 3F4RA 4WF4A 2CVKA 2N5FA 1EWXA 1PMTA 1TTZA 5ECMB 2WB9A 4YQVA 3J7Yk 2D2ZA 3EWLA 5IIZA 4X1UA 5ECHB 1JHBA 1XWCA 4O7HA 2P5RA 1TRVA 3UEMA 2TIRA 4LLRA 2AUVA 3A3TA 1TJDA 1YEPA 1T4YA 1Z9HA 2REMA 3BD2A 2B7JA 4H86A 2HRNA 3CYNA 4ECCA 4TR0A 4F9ZA 1THOA 4YAPA 3H8QA 2VM2A 5DQSA 5CP1A 4AGSA 4K7NA 4CDOA 3VPQA 3Q74A 3KIJA 3TJKA 2K6VA 2C0GA 4HEA2 3C8EA 4KCAA 3VI7A 4ZL9A 4KDXA 5B6NA 1XVWA 1B4QA 2HZFA 2LRCA 4MDCA 2PMTA 1S3AA 3EVIA 4IJ3A 4TXOA 3FR3A 2HRFA 2JL4A 1T1VA 1OC9A 1FB0A 4J57E 1T8EB 3MWHA 4N10A 4NMUA 3F4SA 3EU4A 1H75A 2GSRA 2WS2A 3HXSA 3BCIA 4I6XA 4WR5A 1CQGA 2C0DA 2E2MA 5D9WA 2L6CA 3ZTLA 12GSA 2LJRA 1HYUA 5F8BA 5CRHA 1ERTA 2EIOA 3C73A 1SL2B 3K8NA 4TXOB 3R2QA 4X0XA 5ECQB 6GSTA 1OC9B 2TRXA 1WPIA 3ED3A 4N0VA 2IFQA 2H0GA 3WGEA 3QOUA 1K3LA 2R2JA 3E9JB 3VFIA 1XIYA 4KH7A 1R5AA 1A2LA 1NHYA 1WOUA 1LJRA 3GFKA 4ZBDA 2FWEA 3P7XA 3IOSA 3PGTA 2HE3A 2IFQB 4MPGA 2GSSA 2VIMA 4MP4A 2V1MA 2PVOC 3CRTA 3QAVA 4F2IA 4NV5A 5J9BA 2HT9A 2H1AA 1FOVA 1QXHA 1EGRA 1A8LA 1F6MC 4IN0A 3Q18A 10GSA 4JR6A 1XWBA 5FT3A 4PQIA 4Z7XA 3A2VA 4L5LA 3BJ5A 1QGVA 4HQZA 2WDUA 4HZ4A 1OVNA 2DJ1A 4AJ7A 1M9AA 2DIYA 3C71A 1TRWA 3APQA 5HFGA 1TK0B 3Q6OA 3IK9A 3QCPA 3CSJA 4EDZA 4ZBAA 1T7PB 3C1SA 4QL7A 2LS5A 2GLRA 1SKWB 2IN3A 5J3RA 4GCIA 1AW9A 3FZ4A 2OA7A 4IS0A 5ECSA 5ID2A 3ZLPA 5CRWA 3DMLA 4MJEA 4PQ1A 4YH2A 3MAKA 2M72A 5AIVA 5ECOB 2FCHA 3LWAA 4OO5A 1K0DA 5CO3A 3TRXA 5DJLA 1JFUA 2YP6A 3FRCA 1F9MA 4I97A 5ID2B 1XW9A 2FWFA 11GSA 1AXDA 5B6MA 5EY6A 3GMFA 2PPTA 4V1Ag 1B8XA 1XW6A 2OE1A 4ILFA 2VLUA 2CQ9A 2LEGA 4GF0A 2ON7A 2ES7A 4ZL8A 2ON5A 2KLXA 4POLA 2J23A 4KAEA 3KP8A 1QQ2A 1A8YA 4IQ1A 4JU5A 2H66A 1WWJA 2JZTA 4RI7A 4L0WA 4NPBA 2PVQA 4ECBA 1KEBA 3HJPA 5B8BA 1GP1A 5G1LA 1UN2A 3WYWA 2BMXA 2F8FA 1ZOFA 2KUCA 1K0NA 3A2XA 4YQMA 2MMOA 3GSSA 2OBKA 1C72A 2XC2A 4KDYA 2DJ0A 5A4WA 3FZ5A 3TJGA 2HYXA 4WKWA 4NXIA 5IMFA 2E2GA 3RPPA 3KTBA 3GHAA 1T4ZA 1MDJA 2R5GA 1F37A 5DDLA 3CMIA 4HOJA 5IMVA 2YN1A 1JZRA 2DSAA 3ZFLA 2OE0A 4O5RA 2NPBA 3PINA 3CTGA 1X9MB 4I2UA 2WGRA 2E7PA 2MYGA 2AYTA 2AB6A 6GSXA 2JSYA 1UA5A 2IWTA 3GL3A 1GWCA 2DBCA 3HVVA 4MA9A 4OFTA 4WXTA 3DKSA 1X5DA 4ZBBA 2IMDA 1DE1A 2L4QA 2V32A 4QL9A 1MDIA 4IGJA 5CNWA 3KCMA 4G9HA 1I9DA 1X9SB 1XCCA 2CVDA 4ACSA 3BCKA 4ZXGA 2VCTA 1QMVA 4K1FA 2NTOA 1LBKA 4GTUA 2O7KA 3TOTA 1R4WA 2VL3A 1USBA 4MJCA 1EP8A 3GKMA 4O92A 1XPVA 2XBQA 1NM3A 5H5RA 2GDRA 1RQMA 1OE8A 4WF5A 3NIVA 3GL5A 3PR8A 2CV4A 1Y25A 1M7TA 3LGCA 3TB2A 3UARA 1TOFA 5JWRB 4PUAA 1YF0A 4BVXA 1I5GA 5D9VA 4G10A 2O87A 4V1Ap 2GQMA 2JZRA 1Q4JA 2G2QA 2FA4A 3HA9A 1Q98A 1PQNA 2GS3A 3QR6A 5IOWA 2P5QA 4JE1A 3HJMA 3VI5A 1ON4A 2LRNA 3F6DA 4KSMA 4XHMA 3DD3A 3EE2A 1TU7A 3DGQA 1X5EA 2IMFA 1LU4A 1FG4A 1GSUA 2NDOA 1Z7RA 5D9XA 5F07A 4V2LA 5EL8A 3VK9A 4GSNA 3GIXA 2B1LA 4LA1A 2LNTA 2A2SA 1U88A 4DSRA 4LMVA 2RIIA 1G7OA 3FW2A 1ZCPA 4ML6A 3G7YA 1G7EA 1B48A 1F2EA 1UC7A 4RI6A 1SJ6A 2X8HA 5D8IA 5GSSA 3ZZXA 4OCEA 3H4KA 1QUWA 4EVMA 2MBTA 1Z6NA 2BTOT 2IL3A 3I43A 5DAKB 3TKPA 1EZKA 2YWNA 3CSIA 1A0RP 2I1UA 5FHIA 2L5OA 1Y6EA 2MZCA 3GTUA 5FWGA 2HFDA 5LD0A 4MZBA 2VCQA 5A4VA 3GX0A 1WMJA 4FH8A 1DBYA 1AQWA 3HYPA 2H19A 1XOAA 1Z3EA 2HSYA 1GUMA 5E59A 4F0BA 3GTUB 1XZOA 4IQAA 1U6TA 1H4OA 2VLTA 3M9JA 1JZOA 1DE2A 3LSZA 3GKKA 2H6ZA 4XIHA 4BPYA 4PQHA 1GSQA 1SKRB 5CYYA 5IPHA 5ABRA 2H76A 4O32A 4E8EA 3DYRA 3BBYA 2VL2C 5AN1A 3KD0A 4AF2A 3HHVA 3TGZA 3P2AA 3Q19A 5HR2A 1YKCA 2H6XA 5KEJA 4CHSA 1A2JA 1NHOA 1XOBA 1B4PA 1PL2A 2LTKA 2CAIA 4FYBA 3G7JA 2ZCTA 3D21A 3DWVA 2VO4A 1K3YA 1ML6A 4EO3A 1XVQA 2GQLA 1TP9A 5L71A 1UVZA 2H71A 3GA4A 1O85A 4MF7A 2GVPA 2LUSA 4X43A 2PGTA 1OKTA 4HI7A 20GSA 5A5KA 4KDUA 1K0BA 4OWYA 1KBNA 3IV4A 1SD8A 1F3AA 1TU8A 3QD9A 1GULA 1W4VA 2VD1A 1EOGA 3UL3A 1O6JA 4POKA 3UBKA 4IP1A 1V98A 2HLSA 1OE7A 1GUHA 3ZRDA 4IJIA 2IIYA 1TW9A 3TDGA 3VWVA 4TVEA 2R4VA 2MBSA 3S9FA 2F9SA 1Z5YE 3EMXA 3TCOA 5J5NA 4EDYA 4OD7A 1YEXA 2N5BA 4EL1A 5GAPD 3FY7A 3GKNA 4I5QA 3IE3A 1ZZYA 4GWRA 4HJMA 2I81A 2DIZA 5KN3A 2B5XA 3TKSC 3TJJA 3LXTA 5DJMA 3L0HA 1O8XA 3PH9A 4J56E 2LQQA 1BAYA 1IYHA 3HVXA 2VD0A 3GYKA 4HZ2A 4L0UA 1ZL9A 4POMA 1YKAA 2H70A 5IQYA 2GZZA 4MZCA 3LYKA 3E0UA 3F9UA 2YV7A 4XS4A 4IKHA 4NV2A 2IMIA 5DCHA 5A4UA 3LEFA 1GSSA 3I6AA 3HCZA 1AIUA 2K8SA 1VRSD 4F0CA 1MEKA 4KGIA 3KMNA 4AJ6A 4EUYA 3CRUA 4TR3A 2CA8A 2V6OA 2PUKC 3ERFA 4XS4B 3GNJA 3P90A 1SYRA 1TK5B 4FIWA 1PD21 5GZZB 3WT2A 1BG5A 8GSSA 1V57A 2YOIA 1T3BA 4PNGA 3QAGA 3GV1A 5H5QA 3UMAA 1PRXA 2DLXA 4EE0A 3LYPA 1GTIA 4TW5A 3OR5A 2QC7A 1FVJA 3LG6A 1CQHA 1MD3A 2AV4A 4J2FA 2OE3A 1GNEA 2F51A 5EPFA 4XRAA 4PX1A 4BA7A 3FK8A 2KP2A 2O85A 1AQXA 3DIEA 2H1DA 3GX8A 4MLYA 1ABAA 1XBSA 3GUSA 1ILOA 5DBQA 1A2MA 2C3NA 4LL1B 3QPMA 3LORA 1KNGA 3EMPA 1N2AA 1VF1A 3O76A 2GT6A 4XS6A 4ZILA 1K0MA 4XTSA 4GXZA 1GL8A 5CRGA 3D5JA 2VAFA 3UJ1A 1OYJA 5J4UA 2MMAA 4LMWA 3H1NA 1HQOA 2WCIA 1XXUA 3HD5A 3N9JA 2YPMA 2H1BA 4JEDA 3AY8A 2BJXA 2H0IA 5ENUA 4ID0A 3IAM2 3WT1A 5LCZA 5G5EA 1O8WA 2LJAA 3TKRA 1TK8B 1SL1B 3F6FA 5AISA 1PKZA 3GKXA 3UBLA 2JACA 4PGTA 1SJZA 3L78A 2DMLA 3DRNA 1ZYEA 4OFMA 1YY7A 2DJKA 5EVOA 2O8VB 4WBJA 4PNFA 2X64A 2WJUA 4K9ZA 3GSTA 3G7IA 17GSA 3ERGA 1X5CA 4YQUA 2LJKA 5ECNB 13GSA 3US3A 3MSZA 1S3CA 3U6VA 2FA8A 4KX4A 4F82A 1F3BA 2L59A 4K6XA 4IHUA 2AJQB 3HVSA 6GSSA 2C8UA 3LFLA 4IBPA 1NW2A 4GSTA 3D4MA 1XW5A 1XWKA 4HU7A 5IO2A 3IBHA 1SKSB 3DVWA 5HR1A 4MF6A 4KUNA 3VWUA 1Z7PA 4EXJA 4MJAA 3LXZA 1GLPA 2GZYA 4DSSA 2VM1A 4XS1A 4KCEA 16GSA 1SD9A 2GZPA 4JRRA 4OFNA 3SBCA 2J9HA 3EINA 2C0EA 2CX3A 1HD2A 1THXA 2LKUA 1YJ6A 4HU9A 4IP6A 4POBA 3GURA 3E3EA 1J08A 1PL1A 4GLTA 3VPTA 3JCML 2VLVA 4ZB8A 2C3TA 4MH3A 1SK2A
chains in the Genus database with same CATH superfamily
4N11A 4N0ZA 1R7HA 3RPNA 5HFIA 1V40A 2VOCA 2GTUA 1ACVA 2ALBA 5B7CA 1ERWA 1TDIA 3M1GA 4BWQA 1V58A 4KW6A 3RAZA 4KB3A 1BQ7A 2YZHA 4ML1A 2UZ8A 1MD4A 2LRTA 5G5FA 1O81A 1YDKA 3RDWA 4OO4A 4HUAA 2QA1A 5G30A 2RM5A 1IYIA 1ERUA 1AAZA 1ZMAA 2H6YA 2VCWA 2IMKA 5JCWA 2I4AA 5G1KA 1BYEA 3ME8A 3ZIJA 1ZGNA 4KSOA 4K7IA 3QMXA 3VLNA 5D96A 4EKZA 2V6KA 3IHQA 3FYGA 2FWHA 2WFCA 3L9UA 2QGVA 4ZB6A 3U5RE 1X0RA 2KHPA 5B8AA 4X4JA 2KP1A 2FD3A 2TRCP 1EV9A 3QFAC 3IR4A 3SWLA 4NHZA 2EC4A 1YF1A 4OMVA 4MH2A 3TRPA 3ZIVA 3WD6A 14GSA 1G0TA 3C7MA 2JSZA 4MCUA 4BL7A 3QAWA 2OKAA 4L8EA 2ZNMA 1K3OA 1GH2A 2DJ3A 5INYA 4JR4A 2H8LA 2RM6A 4TKYA 3UOMA 3WGXA 1BJXA 3RHBA 1QFNA 3IRAA 1ST9A 4ZB9A 2KOKA 3EURA 2H01A 3FZAA 4IW9A 1FAAA 1GTBA 2VCZA 4ECIA 19GSA 3F63A 4FYCA 3ZMLA 2QKEA 4KE3A 1AUCA 5C00A 4DEJA 5HR0A 3O3TA 1JLVA 2M46A 1B9YC 1M2DA 1XG8A 2H73A 4BWSA 4NHWA 1V2AA 5JCUA 4ULXA 2GQKA 4IVFA 4E8HA 2O89A 1GSDA 2VUPA 3LQ7A 2FWGA 3WGDA 3TUEA 3D22A 2X99A 1FB6A 2LNSA 3M8NA 4WETA 1E6BA 2HRKA 4F03A 5J9CA 1O7UA 5ECKB 3I9V2 3KXOA 1J0FA 3VWXA 1B9XC 2K8VA 4JZQA 1OAZA 3TJFA 1W89A 1FHEA 3TKSA 2ZUPA 1A24A 4MK3A 3IK7A 4RQXA 3HZ8A 5JWQB 3TOUA 5F05A 1GRXA 4PXOA 4V2NA 2PBJA 1WIKA 3ZITA 2OJLA 4K0GA 3F8UA 5IMAA 2CT6A 2IPAA 4Q5NA 1N8JA 3RBTA 3ZL5A 2OBIA 3KGKA 1JZWA 1FVKA 3V1WA 2N5AA 2CVBA 1GLQA 1TI1A 1A0FA 3D4TA 3IAS2 3CXGA 1SK0A 1PA3A 1DSBA 5DVBA 3FZ9A 3ZMKA 4K5RA 3W8SA 2YNXA 2R3XA 1E2YA 5JWOB 2B6MA 1WP0A 1R26A 1MDKA 3F3RA 1AC1A 1TRSA 1YZXA 2CZ3A 1U3IA 2I3YA 2WZ9A 1RW1A 2L57A 1O73A 4HSCX 5DCGA 3M9KA 2MMNA 4XRDA 4MJBA 2A4VA 2YZUA 3QDNA 5ECIB 2WRTA 4KA0A 1S3DA 1U3AA 4RUVA 1PGTA 2PERA 3L9VA 2AAWA 6GSUA 2GSTA 3KH9A 5ELAA 1M2BA 4QQ7A 1VF3A 5COHA 4TR4A 3M0FA 1OC8A 3KH7A 1SK1A 1PSQA 3TRQA 2FNOA 2V41A 4P3YB 4JBBA 1X9WB 5IMDA 1GSEA 5GAND 5AGYA 4FYUA 3D6IA 3ERWA 5C04A 5KOWA 4FO5A 2RLIA 3TJBA 4YAVA 2JZSA 4D73A 2IJYA 3FHKA 3RHCA 4FQUA 4DVCA 3KTLA 3G9BA 1VF2A 3IXRA 5G31A 1TRUA 9GSSA 1PN9A 1K0AA 1KTEA 1ZYQB 3ZVJD 3CTFA 4D73B 4IELA 2K18A 2PWJA 2QSIA 2DJ2A 2V2GA 3FEUA 5HFKA 3KP9A 1R5PA 1Z6MA 5F0GA 6GSWA 2F3MA 3LJRA 1PX6A 3KEBA 3W6GA 3N5OA 1SU9A 4PURA 2FLSA 4G0KA 3GN3A 3ISOA 4EF0A 1GUKA 2L6DA 3APOA 3EU3A 2B7KA 2H75A 5IMZA 1SYXA 1J9BA 1URMA 3UVHA 2GGTA 1SJIA 3HJOA 3KM6A 4NAXA 3NOFA 2H0HA 4BIKA 3TKQA 5D93A 1BX9A 4ZL7A 4GQCA 5H5SA 1FW1A 1XFLA 4MNNA 4O5UA 3O6TA 1HNCA 4HJ2A 2LSTA 3BOAA 3NZNA 2LV3A 1SENA 3HKRA 1YQ1A 3F4TA 2H74A 2FY6A 2C0FA 3P8WA 1TI3A 6GSYA 5HQPA 2EIQA 2HSHA 1JZDA 4K7OA 4Z2TA 2HZEA 5BRTA 2YJHA 1K0CA 5J41A 2R37A 4HS1A 1U87A 3UAPA 5HR3A 1A23A 4N30A 1K0OA 2FGXA 4I2TA 5ECLB 2C80A 4TOPA 1G6WA 4GQFA 4WBRD 2YJ7A 3F3QA 4HDEA 5IM9A 2HZEB 3MDKA 3KZQA 5IPGA 1MTCA 4MZWA 2DMMA 2L5LA 2LQOA 2PN8A 2FHEA 3IPZA 2YWMA 5AIXA 1WRYA 1GSFA 4PUFC 3VWWA 1XWAA 1PKWA 1G6YA 5LNKe 3F0IA 4DSQA 3APSA 5BMUA 3CSHA 2P31A 3IDVA 1EP7A 1OC3A 1EEJA 2M80A 5IO0A 2EIRA 2A2PA 1HNBA 3ZREA 2IMEA 2I9HA 2P0GA 3FR6A 1EV4A 2YV9A 5D9TA 4NWYA 2AHEA 2B5EA 2L4CA 2CX4A 1GTAA 2YWOA 2XHFA 5D73A 5F06A 5CAXA 2GSQA 2NBSA 1WE0A 2A4HA 22GSA 1AQVA 4G2EA 4K2DA 3FMWA 2Z9SA 4XCSA 2DJJA 4Q5RA 1RK4A 5ECPB 4ECJA 4Q5QA 1XWGA 4L5OA 2DKIA 3GH9A 1WJKA 3GH6A 4TR1A 5E4WA 6GSVA 5IOXA 1FO5A 1ERVA 2C3QA 2C1YA 2R0GA 1V9WA 1EEMA 1TXXA 2JU5A 3EC3A 2HNLA 3MYDA 1M3JA 3IC4A 4V2MA 3QFBC 2VCXA 2YCDA 3GRXA 4DSSB 2CAQA 2VCVA 4MF5A 2NVLA 4AJ8A 4BVYA 1QK8A 2H1GA 1PX7A 4ZIJA 1VF4A 3LW9A 3MNGA 4TRXA 5DQYA 3IA1A 4MABA 4KF9A 4TR1B 2FUG2 2DC5A 1M3IA 1EGOA 1ZYNA 2GT5A 4G19A 4K2XA 3W8JA 3H79A 4MMMA 1BEDA 2CZ2A 3L4NA 1GNWA 1GSYA 4GRFA 2F8AA 4WEYA 2H30A 1DUGA 2X8CA 5CRDA 2G0FA 1TKDB 3L9SA 3CBUA 1T00A 1NSWA 3A5WA 2XBIA 1SL0B 3HY2A 1EOHA 4TN8A 4GSSA 5DALA 3J7Yb 4K0NA 4EIQA 5KN2A 1HNAA 2X8GA 1M9BA 2YWIA 5G2ZA 2VL2A 2E0QA 3UVTA 5DAKA 2H72A 2XPEA 3KMOA 1VGLA 4I8BA 4MPFA 5DALB 2YANA 3H93A 1OKDA 3FKFA 3ZVJA 3A2WA 3HZ4A 4CW9A 3VURA 18GSA 4HQSA 3TKSE 5ECRB 2HXKA 4Q5FA 7GSSA 4KNDA 3DEXA 2HI7A 3ME7A 2PU9C 2JADA 2XPDA 1GTUA 2A2RA 2B1KA 2MMZA 2B3SA 2B5YA 4LL4B 2C4JA 2R6KA 4BL7B 3ZYWA 4TXVA 4K8MA 3M3MA 3HDCA 3DXBA 5IMCA 1JLWA 1M99A 1M0UA 4ISDA 2RUFA 2RUEA 3FR9A 3HVNA 5ELGA 2WULA 3ZFBA 3C1RA 5KN1A 4EIPA 2OADA 1M2AA 2VL9A 3EYTA 5KN0A 5CREA 4EC0A 5JCGA 3D0ZA 3KJYA 3DVXA 4RQRA 2OACA 1S3RA 4OCFA 4WR4A 3I69A 2K9FA 5GSTA 3UIWA 3F4RA 4WF4A 2CVKA 2N5FA 1EWXA 1PMTA 1TTZA 5ECMB 2WB9A 4YQVA 3J7Yk 2D2ZA 3EWLA 5IIZA 4USSA 4X1UA 5ECHB 1JHBA 1XWCA 4O7HA 2P5RA 1TRVA 3UEMA 2TIRA 4LLRA 2AUVA 3A3TA 1TJDA 1YEPA 1T4YA 1Z9HA 2REMA 3BD2A 2B7JA 4H86A 2HRNA 3CYNA 4ECCA 4TR0A 4F9ZA 1THOA 4YAPA 3H8QA 2VM2A 5DQSA 5CP1A 4AGSA 4K7NA 4CDOA 3VPQA 3Q74A 3KIJA 3TJKA 3A5IA 2K6VA 2C0GA 4HEA2 3C8EA 4KCAA 3VI7A 4ZL9A 4KDXA 2HSMA 5B6NA 1XVWA 1B4QA 2HZFA 4PTSA 2LRCA 4MDCA 2PMTA 1S3AA 3IC8A 3EVIA 4IJ3A 4TXOA 3FR3A 2HRFA 2JL4A 1T1VA 1OC9A 1FB0A 4J57E 1T8EB 3MWHA 4N10A 4NMUA 3F4SA 3EU4A 1H75A 2GSRA 2WS2A 3HXSA 3BCIA 4I6XA 4WR5A 1CQGA 2C0DA 2E2MA 5D9WA 2L6CA 3ZTLA 12GSA 2LJRA 1HYUA 5F8BA 4Z2UA 5CRHA 1ERTA 2EIOA 3C73A 1SL2B 3K8NA 4TXOB 3R2QA 4X0XA 5ECQB 6GSTA 1OC9B 2TRXA 1WPIA 3ED3A 4N0VA 2IFQA 2H0GA 3WGEA 3QOUA 1K3LA 2R2JA 3E9JB 3VFIA 1XIYA 4KH7A 1R5AA 1A2LA 1NHYA 1WOUA 1LJRA 3GFKA 4ZBDA 2FWEA 3P7XA 3IOSA 3PGTA 2HE3A 2IFQB 4MPGA 2GSSA 2VIMA 4MP4A 2V1MA 2PVOC 3CRTA 3QAVA 4F2IA 4NV5A 5J9BA 2HT9A 2H1AA 1FOVA 1QXHA 1EGRA 1A8LA 1F6MC 4IN0A 3Q18A 10GSA 4JR6A 1XWBA 5FT3A 4PQIA 4Z7XA 3A2VA 4L5LA 3BJ5A 1QGVA 4HQZA 2WDUA 4HZ4A 1OVNA 2DJ1A 4AJ7A 1M9AA 2DIYA 3C71A 1ZYPA 1TRWA 3APQA 5HFGA 2X49A 1TK0B 3Q6OA 3IK9A 3QCPA 3CSJA 4EDZA 4ZBAA 1T7PB 3C1SA 4QL7A 4CY8A 2LS5A 2GLRA 1SKWB 2IN3A 5J3RA 4GCIA 1AW9A 3FZ4A 2OA7A 4IS0A 5ECSA 5ID2A 3ZLPA 5CRWA 3DMLA 4MJEA 4PQ1A 4YH2A 3MAKA 2M72A 5AIVA 5ECOB 3CQFA 2FCHA 3LWAA 4OO5A 1K0DA 5CO3A 3TRXA 5DJLA 1JFUA 2YP6A 3FRCA 1F9MA 4I97A 5ID2B 1XW9A 2FWFA 11GSA 1AXDA 5B6MA 5EY6A 3GMFA 2PPTA 4V1Ag 1B8XA 1XW6A 2OE1A 4ILFA 2VLUA 2CQ9A 2LEGA 4GF0A 2ON7A 2ES7A 4ZL8A 2ON5A 2KLXA 4POLA 2J23A 4KAEA 3KP8A 1QQ2A 1A8YA 4IQ1A 4JU5A 2H66A 1WWJA 2JZTA 4RI7A 4L0WA 4NPBA 2PVQA 4ECBA 1KEBA 3HJPA 5B8BA 1GP1A 5G1LA 4YKFA 1UN2A 4G0LA 3WYWA 2BMXA 2F8FA 1ZOFA 2KUCA 1K0NA 3A2XA 4YQMA 2MMOA 3GSSA 2OBKA 1C72A 2XC2A 4KDYA 2DJ0A 5A4WA 3FZ5A 3TJGA 2HYXA 4WKWA 4NXIA 5IMFA 2E2GA 3RPPA 3KTBA 3GHAA 1T4ZA 1FOHA 1MDJA 2R5GA 1F37A 5DDLA 3CMIA 4HOJA 5IMVA 2YN1A 1JZRA 2DSAA 3ZFLA 2OE0A 4O5RA 2NPBA 3PINA 3CTGA 1X9MB 4I2UA 2WGRA 2E7PA 2MYGA 2AYTA 2AB6A 6GSXA 2JSYA 1UA5A 2IWTA 3GL3A 1GWCA 2DBCA 3HVVA 4MA9A 4OFTA 4WXTA 3DKSA 1X5DA 4ZBBA 2IMDA 1DE1A 2L4QA 2V32A 4QL9A 1MDIA 4IGJA 5CNWA 3KCMA 4G9HA 1I9DA 1X9SB 1XCCA 2CVDA 4ACSA 3BCKA 4ZXGA 2VCTA 1QMVA 4K1FA 2NTOA 1LBKA 4GTUA 2O7KA 3TOTA 1R4WA 2VL3A 1USBA 4MJCA 1EP8A 3GKMA 4O92A 1XPVA 2XBQA 1NM3A 5H5RA 2GDRA 1RQMA 1OE8A 4WF5A 3NIVA 3GL5A 3PR8A 2CV4A 1Y25A 1M7TA 3LGCA 3TB2A 3UARA 1TOFA 5JWRB 4PUAA 1YF0A 4BVXA 4A5PA 1I5GA 5D9VA 4G10A 2O87A 4V1Ap 2GQMA 2JZRA 1Q4JA 1PN0A 2G2QA 2FA4A 3HA9A 1Q98A 1PQNA 2GS3A 3QR6A 5IOWA 2P5QA 4JE1A 4BVYB 3HJMA 3VI5A 1ON4A 4BVXB 2LRNA 3F6DA 4KSMA 4XHMA 3DD3A 3EE2A 1TU7A 3DGQA 1X5EA 2IMFA 1LU4A 1FG4A 1GSUA 2NDOA 1Z7RA 5D9XA 5F07A 4V2LA 5EL8A 3VK9A 4GSNA 3GIXA 2B1LA 4LA1A 2LNTA 2A2SA 1U88A 4DSRA 4LMVA 2RIIA 1G7OA 3FW2A 1ZCPA 4ML6A 3G7YA 5KOXA 1G7EA 1B48A 1F2EA 1UC7A 4RI6A 1SJ6A 2X8HA 5D8IA 5GSSA 3ZZXA 4OCEA 3H4KA 1QUWA 4EVMA 2MBTA 1Z6NA 2BTOT 2IL3A 3I43A 5DAKB 3TKPA 1EZKA 2YWNA 3CSIA 1A0RP 2I1UA 5FHIA 2L5OA 1Y6EA 2MZCA 3GTUA 5FWGA 2HFDA 5LD0A 4MZBA 2VCQA 5A4VA 3GX0A 1WMJA 4FH8A 1DBYA 1AQWA 3HYPA 2H19A 1XOAA 1Z3EA 2HSYA 1GUMA 5E59A 4F0BA 2X4AA 3GTUB 3MIXA 1XZOA 4IQAA 1U6TA 1H4OA 2VLTA 3M9JA 1JZOA 1DE2A 3LSZA 3GKKA 2H6ZA 4XIHA 4BPYA 4PQHA 2R0CA 1GSQA 1SKRB 5CYYA 5IPHA 5ABRA 2H76A 4O32A 4E8EA 3DYRA 3BBYA 2VL2C 5AN1A 3KD0A 4AF2A 3HHVA 3TGZA 3P2AA 3Q19A 5HR2A 1YKCA 2H6XA 5KEJA 4CHSA 1A2JA 1NHOA 1XOBA 1B4PA 1PL2A 2LTKA 2CAIA 4FYBA 3G7JA 2ZCTA 3D21A 3DWVA 2VO4A 1K3YA 1ML6A 4EO3A 1XVQA 2GQLA 1TP9A 5L71A 1UVZA 2H71A 3GA4A 4CY6A 1O85A 4MF7A 2GVPA 2LUSA 4X43A 2PGTA 1OKTA 4HI7A 20GSA 5A5KA 4KDUA 1K0BA 4OWYA 1KBNA 3IV4A 1SD8A 1F3AA 1TU8A 3QD9A 1GULA 1W4VA 2VD1A 1EOGA 3UL3A 4Z2RA 1O6JA 4POKA 3UBKA 4ICYA 4IP1A 1V98A 2HLSA 1OE7A 4YKGA 1GUHA 3ZRDA 4IJIA 2IIYA 1TW9A 3TDGA 3VWVA 4TVEA 2R4VA 2MBSA 3S9FA 2F9SA 1Z5YE 3EMXA 3TCOA 5J5NA 4EDYA 4OD7A 1YEXA 2N5BA 4EL1A 5GAPD 3FY7A 3GKNA 4I5QA 3IE3A 1ZZYA 4GWRA 4HJMA 2I81A 2DIZA 5KN3A 2B5XA 3TKSC 3TJJA 3LXTA 5DJMA 3L0HA 1O8XA 3PH9A 4J56E 2LQQA 1BAYA 1IYHA 3HVXA 2VD0A 3GYKA 4HZ2A 4L0UA 1ZL9A 4POMA 1YKAA 2H70A 5IQYA 2GZZA 4MZCA 3LYKA 3E0UA 3F9UA 2YV7A 4XS4A 4IKHA 4NV2A 2IMIA 5DCHA 5A4UA 3LEFA 1GSSA 3I6AA 3HCZA 1AIUA 2K8SA 1VRSD 4F0CA 1MEKA 4KGIA 3KMNA 4AJ6A 4EUYA 3CRUA 4TR3A 2CA8A 2V6OA 2PUKC 3ERFA 4XS4B 3GNJA 3P90A 1SYRA 1TK5B 4FIWA 1PD21 5GZZB 3WT2A 1BG5A 3IHGA 8GSSA 1V57A 2YOIA 4G0IA 1T3BA 4PNGA 3QAGA 3GV1A 5H5QA 3UMAA 1PRXA 2DLXA 4EE0A 3LYPA 1GTIA 4TW5A 3OR5A 2QC7A 1FVJA 3LG6A 1CQHA 1MD3A 2AV4A 4J2FA 2OE3A 1GNEA 2F51A 4O5QA 5EPFA 4XRAA 4PX1A 4BA7A 3FK8A 2KP2A 2O85A 1AQXA 3DIEA 2H1DA 3GX8A 4MLYA 1ABAA 1XBSA 3GUSA 1ILOA 3PPUA 5DBQA 2QA2A 1A2MA 2C3NA 4LL1B 3QPMA 3LORA 1KNGA 3EMPA 1N2AA 1VF1A 3O76A 2GT6A 4XS6A 4ZILA 1K0MA 4XTSA 4GXZA 1GL8A 5CRGA 3D5JA 2VAFA 3UJ1A 1OYJA 5J4UA 2MMAA 4LMWA 3R3EA 3H1NA 1HQOA 2WCIA 1XXUA 3HD5A 3N9JA 2YPMA 2H1BA 4JEDA 3AY8A 2BJXA 2H0IA 5ENUA 4ID0A 3IAM2 3WT1A 5LCZA 5G5EA 1O8WA 2LJAA 3TKRA 1TK8B 1SL1B 3F6FA 5AISA 1PKZA 3GKXA 3UBLA 2JACA 4PGTA 1SJZA 3L78A 2R0PA 2DMLA 4K5SA 3DRNA 1ZYEA 4OFMA 1YY7A 2DJKA 1PFOA 5EVOA 2O8VB 4WBJA 4PNFA 2X64A 2WJUA 4K9ZA 3GSTA 3G7IA 17GSA 3ERGA 1X5CA 4YQUA 2LJKA 5ECNB 13GSA 3US3A 3MSZA 1S3CA 3U6VA 2FA8A 4KX4A 4F82A 1F3BA 2L59A 4K6XA 4IHUA 2AJQB 3HVSA 6GSSA 2HRAA 2C8UA 3LFLA 4IBPA 1NW2A 4GSTA 3D4MA 1XW5A 1XWKA 3EPTA 4HU7A 5IO2A 2DKHA 3IBHA 1SKSB 3DVWA 5HR1A 4MF6A 4KUNA 3VWUA 1Z7PA 4EXJA 4MJAA 3LXZA 1GLPA 2GZYA 4DSSA 2VM1A 4XS1A 4KCEA 16GSA 1SD9A 2GZPA 4JRRA 4OFNA 3SBCA 2J9HA 3EINA 2C0EA 2CX3A 1HD2A 1THXA 2LKUA 1YJ6A 4HU9A 4IP6A 4POBA 3GURA 3E3EA 1J08A 1PL1A 4GLTA 3VPTA 3JCML 2VLVA 4ZB8A 2C3TA 4MH3A 1SK2A
chains in the Genus database with same CATH topology
4N11A 4N0ZA 1R7HA 3RPNA 5HFIA 1V40A 2VOCA 2GTUA 1ACVA 2ALBA 5B7CA 1ERWA 1TDIA 3M1GA 4BWQA 1V58A 4KW6A 3RAZA 4KB3A 1BQ7A 2YZHA 4ML1A 2UZ8A 1MD4A 2LRTA 5G5FA 1O81A 1YDKA 3RDWA 4OO4A 4HUAA 2QA1A 5G30A 2RM5A 1IYIA 1ERUA 1AAZA 1ZMAA 2H6YA 2VCWA 2IMKA 5JCWA 2I4AA 5G1KA 1BYEA 3ME8A 3ZIJA 1ZGNA 4KSOA 4K7IA 3QMXA 3VLNA 5D96A 4EKZA 2V6KA 3IHQA 3FYGA 2FWHA 2WFCA 3L9UA 2QGVA 4ZB6A 3U5RE 1X0RA 2KHPA 5B8AA 4X4JA 2KP1A 2FD3A 2TRCP 1EV9A 3QFAC 3IR4A 3SWLA 4NHZA 2EC4A 1YF1A 4OMVA 4MH2A 3TRPA 3ZIVA 3WD6A 14GSA 1G0TA 3C7MA 2JSZA 4MCUA 4BL7A 3QAWA 2OKAA 4L8EA 2ZNMA 1K3OA 1GH2A 2DJ3A 5INYA 4JR4A 2H8LA 2RM6A 4TKYA 3UOMA 3WGXA 1BJXA 3RHBA 1QFNA 3IRAA 1ST9A 4ZB9A 2KOKA 3EURA 2H01A 3FZAA 4IW9A 1FAAA 1GTBA 2VCZA 4ECIA 19GSA 3F63A 4FYCA 3ZMLA 2QKEA 4KE3A 1AUCA 5C00A 4DEJA 5HR0A 3O3TA 1JLVA 2M46A 1B9YC 1M2DA 2H73A 4BWSA 4NHWA 1V2AA 5JCUA 4ULXA 2GQKA 4IVFA 4E8HA 2O89A 1GSDA 2VUPA 3LQ7A 2FWGA 3WGDA 3TUEA 3D22A 2X99A 1FB6A 2LNSA 3M8NA 4WETA 1E6BA 2HRKA 4F03A 5J9CA 1O7UA 5ECKB 3I9V2 3KXOA 1J0FA 3VWXA 1B9XC 2K8VA 4JZQA 1OAZA 3TJFA 1W89A 1FHEA 3TKSA 2ZUPA 1A24A 4MK3A 3IK7A 4RQXA 3HZ8A 5JWQB 3TOUA 5F05A 1GRXA 4PXOA 4V2NA 2PBJA 1WIKA 3ZITA 2OJLA 4K0GA 3F8UA 5IMAA 2CT6A 2IPAA 4Q5NA 1N8JA 3RBTA 3ZL5A 2OBIA 3KGKA 1JZWA 1FVKA 3V1WA 2N5AA 2CVBA 1GLQA 1TI1A 1A0FA 3D4TA 3IAS2 3CXGA 1SK0A 1PA3A 1DSBA 5DVBA 3FZ9A 3ZMKA 4K5RA 3W8SA 2YNXA 2R3XA 1E2YA 5JWOB 2B6MA 1WP0A 1R26A 1MDKA 3F3RA 1AC1A 1TRSA 1YZXA 2CZ3A 1U3IA 2I3YA 2WZ9A 1RW1A 2L57A 1O73A 5DCGA 3M9KA 2MMNA 4XRDA 4MJBA 2A4VA 2YZUA 3QDNA 5ECIB 2WRTA 4KA0A 1S3DA 1U3AA 4RUVA 1PGTA 2PERA 3L9VA 2AAWA 6GSUA 2GSTA 3KH9A 5ELAA 1M2BA 4QQ7A 1VF3A 5COHA 4TR4A 3M0FA 1OC8A 3KH7A 1SK1A 1PSQA 3TRQA 2FNOA 2V41A 4P3YB 4JBBA 1X9WB 5IMDA 1GSEA 5GAND 5AGYA 4FYUA 3D6IA 3ERWA 5C04A 5KOWA 4FO5A 2RLIA 3TJBA 4YAVA 2JZSA 4D73A 2IJYA 3FHKA 3RHCA 4FQUA 4DVCA 3KTLA 3G9BA 1VF2A 3IXRA 5G31A 1TRUA 9GSSA 1PN9A 1K0AA 1KTEA 1ZYQB 3ZVJD 3CTFA 4D73B 4IELA 2K18A 2PWJA 2QSIA 2DJ2A 2V2GA 3FEUA 5HFKA 3KP9A 1R5PA 1Z6MA 5F0GA 6GSWA 2F3MA 3LJRA 1PX6A 3KEBA 3W6GA 3N5OA 1SU9A 4PURA 2FLSA 4G0KA 3GN3A 3ISOA 4EF0A 1GUKA 2L6DA 3APOA 3EU3A 2B7KA 2H75A 5IMZA 1SYXA 1J9BA 1URMA 3UVHA 2GGTA 1SJIA 3HJOA 3KM6A 4NAXA 3NOFA 2H0HA 3TKQA 5D93A 1BX9A 4ZL7A 4GQCA 5H5SA 1FW1A 1XFLA 4MNNA 4O5UA 3O6TA 1HNCA 4HJ2A 2LSTA 3BOAA 3NZNA 2LV3A 1SENA 3HKRA 1YQ1A 3F4TA 2H74A 2FY6A 2C0FA 3P8WA 1TI3A 6GSYA 5HQPA 2EIQA 2HSHA 1JZDA 4K7OA 4Z2TA 2HZEA 5BRTA 2YJHA 1K0CA 5J41A 2R37A 4HS1A 1U87A 3UAPA 5HR3A 1A23A 4N30A 1K0OA 2FGXA 4I2TA 5ECLB 2C80A 4TOPA 1G6WA 4GQFA 4WBRD 2YJ7A 3F3QA 4HDEA 5IM9A 2HZEB 3MDKA 3KZQA 5IPGA 1MTCA 4MZWA 2DMMA 2L5LA 2LQOA 2PN8A 2FHEA 3IPZA 2YWMA 5AIXA 1WRYA 1GSFA 4PUFC 3VWWA 1XWAA 1PKWA 1G6YA 5LNKe 3F0IA 4DSQA 3APSA 5BMUA 3CSHA 2P31A 3IDVA 1EP7A 1OC3A 1EEJA 2M80A 5IO0A 2EIRA 2A2PA 1HNBA 3ZREA 2IMEA 2I9HA 2P0GA 3FR6A 1EV4A 2YV9A 5D9TA 4NWYA 2AHEA 2B5EA 2L4CA 2CX4A 1GTAA 2YWOA 2XHFA 5D73A 5F06A 5CAXA 2GSQA 2NBSA 1WE0A 2A4HA 22GSA 1AQVA 4G2EA 4K2DA 3FMWA 2Z9SA 4XCSA 2DJJA 4Q5RA 1RK4A 5ECPB 4ECJA 4Q5QA 1XWGA 4L5OA 2DKIA 3GH9A 1WJKA 3GH6A 4TR1A 5E4WA 6GSVA 5IOXA 1FO5A 1ERVA 2C3QA 2C1YA 2R0GA 1V9WA 1EEMA 1TXXA 2JU5A 3EC3A 2HNLA 3MYDA 3IC4A 4V2MA 3QFBC 2VCXA 2YCDA 3GRXA 4DSSB 2CAQA 2VCVA 4MF5A 2NVLA 4AJ8A 4BVYA 1QK8A 2H1GA 1PX7A 4ZIJA 1VF4A 3LW9A 3MNGA 4TRXA 5DQYA 3IA1A 4MABA 4KF9A 4TR1B 2FUG2 2DC5A 1EGOA 1ZYNA 2GT5A 4G19A 4K2XA 3W8JA 3H79A 4MMMA 1BEDA 2CZ2A 3L4NA 1GNWA 1GSYA 4GRFA 2F8AA 4WEYA 2H30A 1DUGA 2X8CA 5CRDA 2G0FA 1TKDB 3L9SA 3CBUA 1T00A 1NSWA 3A5WA 2XBIA 1SL0B 3HY2A 1EOHA 4TN8A 4GSSA 5DALA 3J7Yb 4K0NA 4EIQA 5KN2A 1HNAA 2X8GA 1M9BA 2YWIA 5G2ZA 2VL2A 2E0QA 3UVTA 5DAKA 2H72A 2XPEA 3KMOA 1VGLA 4I8BA 4MPFA 5DALB 2YANA 3H93A 1OKDA 3FKFA 3ZVJA 3A2WA 3HZ4A 4CW9A 3VURA 18GSA 4HQSA 3TKSE 5ECRB 2HXKA 4Q5FA 7GSSA 4KNDA 3DEXA 2HI7A 3ME7A 2PU9C 2JADA 2XPDA 1GTUA 2A2RA 2B1KA 2MMZA 2B3SA 2B5YA 4LL4B 2C4JA 2R6KA 4BL7B 3ZYWA 4TXVA 4K8MA 3M3MA 3HDCA 3DXBA 5IMCA 1JLWA 1M99A 1M0UA 4ISDA 2RUFA 2RUEA 3FR9A 5ELGA 2WULA 3ZFBA 3C1RA 5KN1A 4EIPA 2OADA 1M2AA 2VL9A 3EYTA 5KN0A 5CREA 4EC0A 5JCGA 3D0ZA 3KJYA 3DVXA 4RQRA 2OACA 4OCFA 4WR4A 3I69A 2K9FA 5GSTA 3UIWA 3F4RA 4WF4A 2CVKA 2N5FA 1EWXA 1PMTA 1TTZA 5ECMB 2WB9A 4YQVA 3J7Yk 2D2ZA 3EWLA 5IIZA 4USSA 4X1UA 5ECHB 1JHBA 1XWCA 4O7HA 2P5RA 1TRVA 3UEMA 2TIRA 4LLRA 2AUVA 3A3TA 1TJDA 1YEPA 1T4YA 1Z9HA 2REMA 3BD2A 2B7JA 4H86A 2HRNA 3CYNA 4ECCA 4TR0A 4F9ZA 1THOA 4YAPA 3H8QA 2VM2A 5DQSA 5CP1A 4AGSA 4K7NA 4CDOA 3VPQA 3Q74A 3KIJA 3TJKA 3A5IA 2K6VA 2C0GA 4HEA2 3C8EA 4KCAA 3VI7A 4ZL9A 4KDXA 2HSMA 5B6NA 1XVWA 1B4QA 2HZFA 4PTSA 2LRCA 4MDCA 2PMTA 1S3AA 3IC8A 3EVIA 4IJ3A 4TXOA 3FR3A 2HRFA 2JL4A 1T1VA 1OC9A 1FB0A 4J57E 1T8EB 3MWHA 4N10A 4NMUA 3F4SA 3EU4A 1H75A 2GSRA 2WS2A 3HXSA 3BCIA 4I6XA 4WR5A 1CQGA 2C0DA 2E2MA 5D9WA 2L6CA 3ZTLA 12GSA 2LJRA 1HYUA 5F8BA 4Z2UA 5CRHA 1ERTA 2EIOA 3C73A 1SL2B 3K8NA 4TXOB 3R2QA 4X0XA 5ECQB 6GSTA 1OC9B 2TRXA 1WPIA 3ED3A 4N0VA 2IFQA 2H0GA 3WGEA 3QOUA 1K3LA 2R2JA 3E9JB 3VFIA 1XIYA 4KH7A 1R5AA 1A2LA 1NHYA 1WOUA 1LJRA 3GFKA 4ZBDA 2FWEA 3P7XA 3IOSA 3PGTA 2HE3A 2IFQB 4MPGA 2GSSA 2VIMA 4MP4A 2V1MA 2PVOC 3CRTA 3QAVA 4F2IA 4NV5A 5J9BA 2HT9A 2H1AA 1FOVA 1QXHA 1EGRA 1A8LA 1F6MC 4IN0A 3Q18A 10GSA 4JR6A 1XWBA 5FT3A 4PQIA 4Z7XA 3A2VA 4L5LA 3BJ5A 1QGVA 4HQZA 2WDUA 4HZ4A 1OVNA 2DJ1A 4AJ7A 1M9AA 2DIYA 3C71A 1ZYPA 1TRWA 3APQA 5HFGA 2X49A 1TK0B 3Q6OA 3IK9A 3QCPA 3CSJA 4EDZA 4ZBAA 1T7PB 3C1SA 4QL7A 4CY8A 2LS5A 2GLRA 1SKWB 2IN3A 5J3RA 4GCIA 1AW9A 3FZ4A 2OA7A 4IS0A 5ECSA 5ID2A 3ZLPA 5CRWA 3DMLA 4MJEA 4PQ1A 4YH2A 3MAKA 2M72A 5AIVA 5ECOB 2FCHA 3LWAA 4OO5A 1K0DA 5CO3A 3TRXA 5DJLA 1JFUA 2YP6A 3FRCA 1F9MA 4I97A 5ID2B 1XW9A 2FWFA 11GSA 1AXDA 5B6MA 5EY6A 3GMFA 2PPTA 4V1Ag 1B8XA 1XW6A 2OE1A 4ILFA 2VLUA 2CQ9A 2LEGA 4GF0A 2ON7A 2ES7A 4ZL8A 2ON5A 2KLXA 4POLA 2J23A 4KAEA 3KP8A 1QQ2A 1A8YA 4IQ1A 4JU5A 2H66A 1WWJA 2JZTA 4RI7A 4L0WA 4NPBA 2PVQA 4ECBA 1KEBA 3HJPA 5B8BA 1GP1A 5G1LA 4YKFA 1UN2A 4G0LA 3WYWA 2BMXA 2F8FA 1ZOFA 2KUCA 1K0NA 3A2XA 4YQMA 2MMOA 3GSSA 2OBKA 1C72A 2XC2A 4KDYA 2DJ0A 5A4WA 3FZ5A 3TJGA 2HYXA 4WKWA 4NXIA 5IMFA 2E2GA 3RPPA 3KTBA 3GHAA 1T4ZA 1FOHA 1MDJA 2R5GA 1F37A 5DDLA 3CMIA 4HOJA 5IMVA 2YN1A 1JZRA 2DSAA 3ZFLA 2OE0A 4O5RA 2NPBA 3PINA 3CTGA 1X9MB 4I2UA 2WGRA 2E7PA 2MYGA 2AYTA 2AB6A 6GSXA 2JSYA 1UA5A 2IWTA 3GL3A 1GWCA 2DBCA 3HVVA 4MA9A 4OFTA 4WXTA 3DKSA 1X5DA 4ZBBA 2IMDA 1DE1A 2L4QA 2V32A 4QL9A 1MDIA 4IGJA 5CNWA 3KCMA 4G9HA 1I9DA 1X9SB 1XCCA 2CVDA 4ACSA 3BCKA 4ZXGA 2VCTA 1QMVA 4K1FA 2NTOA 1LBKA 4GTUA 2O7KA 3TOTA 1R4WA 2VL3A 1USBA 4MJCA 1EP8A 3GKMA 4O92A 1XPVA 2XBQA 1NM3A 5H5RA 2GDRA 1RQMA 1OE8A 4WF5A 3NIVA 3GL5A 3PR8A 2CV4A 1Y25A 1M7TA 3LGCA 3TB2A 3UARA 1TOFA 5JWRB 4PUAA 1YF0A 4BVXA 4A5PA 1I5GA 5D9VA 4G10A 2O87A 4V1Ap 2GQMA 2JZRA 1Q4JA 1PN0A 2G2QA 2FA4A 3HA9A 1Q98A 1PQNA 2GS3A 3QR6A 5IOWA 2P5QA 4JE1A 4BVYB 3HJMA 3VI5A 1ON4A 4BVXB 2LRNA 3F6DA 4KSMA 4XHMA 3DD3A 3EE2A 1TU7A 3DGQA 1X5EA 2IMFA 1LU4A 1FG4A 1GSUA 2NDOA 1Z7RA 5D9XA 5F07A 4V2LA 5EL8A 3VK9A 4GSNA 3GIXA 2B1LA 4LA1A 2LNTA 2A2SA 1U88A 4DSRA 4LMVA 2RIIA 1G7OA 3FW2A 1ZCPA 4ML6A 3G7YA 5KOXA 1G7EA 1B48A 1F2EA 1UC7A 4RI6A 1SJ6A 2X8HA 5D8IA 5GSSA 3ZZXA 4OCEA 3H4KA 1QUWA 4EVMA 2MBTA 1Z6NA 2BTOT 2IL3A 3I43A 5DAKB 3TKPA 1EZKA 2YWNA 3CSIA 1A0RP 2I1UA 5FHIA 2L5OA 1Y6EA 2MZCA 3GTUA 5FWGA 2HFDA 5LD0A 4MZBA 2VCQA 5A4VA 3GX0A 1WMJA 4FH8A 1DBYA 1AQWA 3HYPA 2H19A 1XOAA 1Z3EA 2HSYA 1GUMA 5E59A 4F0BA 2X4AA 3GTUB 3MIXA 1XZOA 4IQAA 1U6TA 1H4OA 2VLTA 3M9JA 1JZOA 1DE2A 3LSZA 3GKKA 2H6ZA 4XIHA 4BPYA 4PQHA 2R0CA 1GSQA 1SKRB 5CYYA 5IPHA 5ABRA 2H76A 4O32A 4E8EA 3DYRA 3BBYA 2VL2C 5AN1A 3KD0A 4AF2A 3HHVA 3TGZA 3P2AA 3Q19A 5HR2A 1YKCA 2H6XA 5KEJA 4CHSA 1A2JA 1NHOA 1XOBA 1B4PA 1PL2A 2LTKA 2CAIA 4FYBA 3G7JA 2ZCTA 3D21A 3DWVA 2VO4A 1K3YA 1ML6A 4EO3A 1XVQA 2GQLA 1TP9A 5L71A 1UVZA 2H71A 3GA4A 4CY6A 1O85A 4MF7A 2GVPA 2LUSA 4X43A 2PGTA 1OKTA 4HI7A 20GSA 5A5KA 4KDUA 1K0BA 4OWYA 1KBNA 3IV4A 1SD8A 1F3AA 1TU8A 3QD9A 1GULA 1W4VA 2VD1A 1EOGA 3UL3A 4Z2RA 1O6JA 4POKA 3UBKA 4ICYA 4IP1A 1V98A 2HLSA 1OE7A 4YKGA 1GUHA 3ZRDA 4IJIA 2IIYA 1TW9A 3TDGA 3VWVA 4TVEA 2R4VA 2MBSA 3S9FA 2F9SA 1Z5YE 3EMXA 3TCOA 5J5NA 4EDYA 4OD7A 1YEXA 2N5BA 4EL1A 5GAPD 3FY7A 3GKNA 4I5QA 3IE3A 1ZZYA 4GWRA 4HJMA 2I81A 2DIZA 5KN3A 2B5XA 3TKSC 3TJJA 3LXTA 5DJMA 3L0HA 1O8XA 3PH9A 4J56E 2LQQA 1BAYA 1IYHA 3HVXA 2VD0A 3GYKA 4HZ2A 4L0UA 1ZL9A 4POMA 1YKAA 2H70A 5IQYA 2GZZA 4MZCA 3LYKA 3E0UA 3F9UA 2YV7A 4XS4A 4IKHA 4NV2A 2IMIA 5DCHA 5A4UA 3LEFA 1GSSA 3I6AA 3HCZA 1AIUA 2K8SA 1VRSD 4F0CA 1MEKA 4KGIA 3KMNA 4AJ6A 4EUYA 3CRUA 4TR3A 2CA8A 2V6OA 2PUKC 3ERFA 4XS4B 3GNJA 3P90A 1SYRA 1TK5B 4FIWA 1PD21 5GZZB 3WT2A 1BG5A 3IHGA 8GSSA 1V57A 2YOIA 4G0IA 1T3BA 4PNGA 3QAGA 3GV1A 5H5QA 3UMAA 1PRXA 2DLXA 4EE0A 3LYPA 1GTIA 4TW5A 3OR5A 2QC7A 1FVJA 3LG6A 1CQHA 1MD3A 2AV4A 4J2FA 2OE3A 1GNEA 2F51A 4O5QA 5EPFA 4XRAA 4PX1A 4BA7A 3FK8A 2KP2A 2O85A 1AQXA 3DIEA 2H1DA 3GX8A 4MLYA 1ABAA 1XBSA 3GUSA 1ILOA 3PPUA 5DBQA 2QA2A 1A2MA 2C3NA 4LL1B 3QPMA 3LORA 1KNGA 3EMPA 1N2AA 1VF1A 3O76A 2GT6A 4XS6A 4ZILA 1K0MA 4XTSA 4GXZA 1GL8A 5CRGA 3D5JA 2VAFA 3UJ1A 1OYJA 5J4UA 2MMAA 4LMWA 3R3EA 3H1NA 1HQOA 2WCIA 1XXUA 3HD5A 3N9JA 2YPMA 2H1BA 4JEDA 3AY8A 2BJXA 2H0IA 5ENUA 4ID0A 3IAM2 3WT1A 5LCZA 5G5EA 1O8WA 2LJAA 3TKRA 1TK8B 1SL1B 3F6FA 5AISA 1PKZA 3GKXA 3UBLA 2JACA 4PGTA 1SJZA 3L78A 2R0PA 2DMLA 4K5SA 3DRNA 1ZYEA 4OFMA 1YY7A 2DJKA 5EVOA 2O8VB 4WBJA 4PNFA 2X64A 2WJUA 4K9ZA 3GSTA 3G7IA 17GSA 3ERGA 1X5CA 4YQUA 2LJKA 5ECNB 13GSA 3US3A 3MSZA 1S3CA 3U6VA 2FA8A 4KX4A 4F82A 1F3BA 2L59A 4K6XA 4IHUA 2AJQB 3HVSA 6GSSA 2HRAA 2C8UA 3LFLA 4IBPA 1NW2A 4GSTA 3D4MA 1XW5A 1XWKA 3EPTA 4HU7A 5IO2A 2DKHA 3IBHA 1SKSB 3DVWA 5HR1A 4MF6A 4KUNA 3VWUA 1Z7PA 4EXJA 4MJAA 3LXZA 1GLPA 2GZYA 4DSSA 2VM1A 4XS1A 4KCEA 16GSA 1SD9A 2GZPA 4JRRA 4OFNA 3SBCA 2J9HA 3EINA 2C0EA 2CX3A 1HD2A 1THXA 2LKUA 1YJ6A 4HU9A 4IP6A 4POBA 3GURA 3E3EA 1J08A 1PL1A 4GLTA 3VPTA 3JCML 2VLVA 4ZB8A 2C3TA 4MH3A 1SK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N11 A;  4N0Z A;  1R7H A;  3RPN A;  5HFI A;  1V40 A;  2VOC A;  2GTU A;  1ACV A;  2ALB A;  5B7C A;  1ERW A;  1TDI A;  3M1G A;  4BWQ A;  1V58 A;  4KW6 A;  3RAZ A;  4KB3 A;  1BQ7 A;  2YZH A;  4ML1 A;  1MD4 A;  2LRT A;  5G5F A;  1O81 A;  1YDK A;  3RDW A;  4OO4 A;  4HUA A;  5G30 A;  2RM5 A;  1IYI A;  1ERU A;  1AAZ A;  1ZMA A;  2H6Y A;  2VCW A;  2IMK A;  5JCW A;  2I4A A;  5G1K A;  1BYE A;  3ME8 A;  3ZIJ A;  1ZGN A;  4KSO A;  4K7I A;  3QMX A;  3VLN A;  5D96 A;  4EKZ A;  2V6K A;  3IHQ A;  3FYG A;  2FWH A;  2WFC A;  3L9U A;  2QGV A;  4ZB6 A;  3U5R E;  1X0R A;  2KHP A;  5B8A A;  2KP1 A;  2FD3 A;  2TRC P;  1EV9 A;  3QFA C;  3IR4 A;  3SWL A;  4NHZ A;  2EC4 A;  1YF1 A;  4OMV A;  4MH2 A;  3TRP A;  3ZIV A;  3WD6 A;  14GS A;  1G0T A;  3C7M A;  2JSZ A;  4MCU A;  4BL7 A;  3QAW A;  2OKA A;  4L8E A;  2ZNM A;  1K3O A;  1GH2 A;  2DJ3 A;  5INY A;  4JR4 A;  2H8L A;  2RM6 A;  4TKY A;  3UOM A;  3WGX A;  1BJX A;  3RHB A;  1QFN A;  3IRA A;  1ST9 A;  4ZB9 A;  2KOK A;  3EUR A;  2H01 A;  3FZA A;  4IW9 A;  1FAA A;  1GTB A;  2VCZ A;  4ECI A;  19GS A;  3F63 A;  4FYC A;  3ZML A;  2QKE A;  4KE3 A;  1AUC A;  5C00 A;  4DEJ A;  5HR0 A;  3O3T A;  1JLV A;  2M46 A;  1B9Y C;  1M2D A;  2H73 A;  4BWS A;  4NHW A;  1V2A A;  5JCU A;  4ULX A;  2GQK A;  4IVF A;  4E8H A;  2O89 A;  1GSD A;  2VUP A;  3LQ7 A;  2FWG A;  3WGD A;  3TUE A;  3D22 A;  2X99 A;  1FB6 A;  2LNS A;  3M8N A;  4WET A;  1E6B A;  4F03 A;  5J9C A;  1O7U A;  5ECK B;  3I9V 2;  3KXO A;  1J0F A;  3VWX A;  1B9X C;  2K8V A;  4JZQ A;  1OAZ A;  3TJF A;  1W89 A;  1FHE A;  3TKS A;  2ZUP A;  1A24 A;  4MK3 A;  3IK7 A;  4RQX A;  3HZ8 A;  5JWQ B;  3TOU A;  5F05 A;  1GRX A;  4PXO A;  4V2N A;  2PBJ A;  1WIK A;  3ZIT A;  2OJL A;  4K0G A;  3F8U A;  5IMA A;  2CT6 A;  2IPA A;  4Q5N A;  1N8J A;  3RBT A;  3ZL5 A;  2OBI A;  3KGK A;  1JZW A;  1FVK A;  3V1W A;  2N5A A;  2CVB A;  1GLQ A;  1TI1 A;  1A0F A;  3D4T A;  3IAS 2;  3CXG A;  1SK0 A;  1PA3 A;  1DSB A;  5DVB A;  3FZ9 A;  3ZMK A;  3W8S A;  2YNX A;  2R3X A;  1E2Y A;  5JWO B;  2B6M A;  1WP0 A;  1R26 A;  1MDK A;  3F3R A;  1AC1 A;  1TRS A;  1YZX A;  2CZ3 A;  1U3I A;  2I3Y A;  2WZ9 A;  1RW1 A;  2L57 A;  1O73 A;  5DCG A;  3M9K A;  2MMN A;  4XRD A;  4MJB A;  2A4V A;  2YZU A;  3QDN A;  5ECI B;  2WRT A;  4KA0 A;  1S3D A;  1U3A A;  4RUV A;  1PGT A;  2PER A;  3L9V A;  2AAW A;  6GSU A;  2GST A;  3KH9 A;  5ELA A;  1M2B A;  4QQ7 A;  1VF3 A;  5COH A;  4TR4 A;  3M0F A;  1OC8 A;  3KH7 A;  1SK1 A;  1PSQ A;  3TRQ A;  2FNO A;  2V41 A;  4P3Y B;  4JBB A;  1X9W B;  5IMD A;  1GSE A;  5GAN D;  5AGY A;  4FYU A;  3D6I A;  3ERW A;  5C04 A;  4FO5 A;  2RLI A;  3TJB A;  4YAV A;  2JZS A;  4D73 A;  2IJY A;  3FHK A;  3RHC A;  4DVC A;  3KTL A;  3G9B A;  1VF2 A;  3IXR A;  5G31 A;  1TRU A;  9GSS A;  1PN9 A;  1K0A A;  1KTE A;  1ZYQ B;  3ZVJ D;  3CTF A;  4D73 B;  4IEL A;  2K18 A;  2PWJ A;  2QSI A;  2DJ2 A;  2V2G A;  3FEU A;  5HFK A;  3KP9 A;  1R5P A;  1Z6M A;  5F0G A;  6GSW A;  2F3M A;  3LJR A;  1PX6 A;  3KEB A;  3W6G A;  3N5O A;  1SU9 A;  4PUR A;  2FLS A;  3GN3 A;  3ISO A;  4EF0 A;  1GUK A;  2L6D A;  3APO A;  3EU3 A;  2B7K A;  2H75 A;  5IMZ A;  1SYX A;  1J9B A;  1URM A;  3UVH A;  2GGT A;  1SJI A;  3HJO A;  3KM6 A;  4NAX A;  3NOF A;  2H0H A;  3TKQ A;  5D93 A;  1BX9 A;  4ZL7 A;  4GQC A;  5H5S A;  1FW1 A;  1XFL A;  3O6T A;  1HNC A;  4HJ2 A;  2LST A;  3BOA A;  3NZN A;  2LV3 A;  1SEN A;  3HKR A;  1YQ1 A;  3F4T A;  2H74 A;  2FY6 A;  2C0F A;  3P8W A;  1TI3 A;  6GSY A;  5HQP A;  2EIQ A;  2HSH A;  1JZD A;  4K7O A;  2HZE A;  2YJH A;  1K0C A;  5J41 A;  2R37 A;  4HS1 A;  1U87 A;  3UAP A;  5HR3 A;  1A23 A;  4N30 A;  1K0O A;  2FGX A;  4I2T A;  5ECL B;  2C80 A;  4TOP A;  1G6W A;  4GQF A;  4WBR D;  2YJ7 A;  3F3Q A;  4HDE A;  5IM9 A;  2HZE B;  3MDK A;  3KZQ A;  5IPG A;  1MTC A;  4MZW A;  2DMM A;  2L5L A;  2LQO A;  2PN8 A;  2FHE A;  3IPZ A;  2YWM A;  5AIX A;  1WRY A;  1GSF A;  4PUF C;  3VWW A;  1XWA A;  1PKW A;  1G6Y A;  5LNK e;  3F0I A;  4DSQ A;  3APS A;  3CSH A;  2P31 A;  3IDV A;  1EP7 A;  1OC3 A;  1EEJ A;  2M80 A;  5IO0 A;  2EIR A;  1HNB A;  3ZRE A;  2IME A;  2I9H A;  2P0G A;  3FR6 A;  1EV4 A;  2YV9 A;  5D9T A;  4NWY A;  2AHE A;  2B5E A;  2L4C A;  2CX4 A;  1GTA A;  2YWO A;  2XHF A;  5D73 A;  5F06 A;  5CAX A;  2GSQ A;  2NBS A;  1WE0 A;  22GS A;  1AQV A;  4G2E A;  4K2D A;  2Z9S A;  4XCS A;  2DJJ A;  4Q5R A;  1RK4 A;  5ECP B;  4ECJ A;  4Q5Q A;  1XWG A;  4L5O A;  3GH9 A;  1WJK A;  3GH6 A;  4TR1 A;  5E4W A;  6GSV A;  5IOX A;  1FO5 A;  1ERV A;  2C3Q A;  2C1Y A;  1V9W A;  1EEM A;  1TXX A;  2JU5 A;  3EC3 A;  2HNL A;  3IC4 A;  4V2M A;  3QFB C;  2VCX A;  2YCD A;  3GRX A;  4DSS B;  2CAQ A;  2VCV A;  4MF5 A;  2NVL A;  4AJ8 A;  4BVY A;  1QK8 A;  2H1G A;  1PX7 A;  4ZIJ A;  1VF4 A;  3MNG A;  4TRX A;  5DQY A;  3IA1 A;  4MAB A;  4TR1 B;  2FUG 2;  2DC5 A;  1EGO A;  2GT5 A;  4G19 A;  3W8J A;  3H79 A;  4MMM A;  1BED A;  2CZ2 A;  3L4N A;  1GNW A;  1GSY A;  4GRF A;  2F8A A;  4WEY A;  2H30 A;  1DUG A;  2X8C A;  5CRD A;  2G0F A;  1TKD B;  3L9S A;  3CBU A;  1T00 A;  1NSW A;  3A5W A;  2XBI A;  1SL0 B;  3HY2 A;  1EOH A;  4TN8 A;  4GSS A;  5DAL A;  3J7Y b;  4K0N A;  5KN2 A;  1HNA A;  2X8G A;  1M9B A;  2YWI A;  5G2Z A;  2VL2 A;  2E0Q A;  3UVT A;  5DAK A;  2H72 A;  2XPE A;  3KMO A;  1VGL A;  4I8B A;  4MPF A;  5DAL B;  2YAN A;  3H93 A;  1OKD A;  3FKF A;  3ZVJ A;  3A2W A;  3HZ4 A;  4CW9 A;  3VUR A;  18GS A;  4HQS A;  3TKS E;  5ECR B;  2HXK A;  4Q5F A;  7GSS A;  4KND A;  3DEX A;  2HI7 A;  3ME7 A;  2PU9 C;  2JAD A;  2XPD A;  1GTU A;  2A2R A;  2B1K A;  2MMZ A;  2B3S A;  2B5Y A;  4LL4 B;  2C4J A;  2R6K A;  3ZYW A;  4TXV A;  4K8M A;  3M3M A;  3HDC A;  3DXB A;  5IMC A;  1JLW A;  1M99 A;  1M0U A;  4ISD A;  2RUF A;  2RUE A;  3FR9 A;  5ELG A;  2WUL A;  3ZFB A;  3C1R A;  5KN1 A;  2OAD A;  1M2A A;  2VL9 A;  3EYT A;  5KN0 A;  5CRE A;  4EC0 A;  5JCG A;  3D0Z A;  3KJY A;  3DVX A;  4RQR A;  2OAC A;  4OCF A;  4WR4 A;  3I69 A;  2K9F A;  5GST A;  3UIW A;  3F4R A;  4WF4 A;  2CVK A;  2N5F A;  1EWX A;  1PMT A;  1TTZ A;  5ECM B;  2WB9 A;  4YQV A;  3J7Y k;  2D2Z A;  3EWL A;  5IIZ A;  4X1U A;  5ECH B;  1JHB A;  1XWC A;  4O7H A;  2P5R A;  1TRV A;  3UEM A;  2TIR A;  4LLR A;  2AUV A;  3A3T A;  1TJD A;  1YEP A;  1T4Y A;  1Z9H A;  2REM A;  3BD2 A;  2B7J A;  4H86 A;  2HRN A;  3CYN A;  4ECC A;  4TR0 A;  4F9Z A;  1THO A;  4YAP A;  3H8Q A;  2VM2 A;  5DQS A;  5CP1 A;  4AGS A;  4K7N A;  4CDO A;  3VPQ A;  3Q74 A;  3KIJ A;  3TJK A;  2K6V A;  2C0G A;  4HEA 2;  3C8E A;  4KCA A;  3VI7 A;  4ZL9 A;  4KDX A;  5B6N A;  1XVW A;  1B4Q A;  2HZF A;  2LRC A;  4MDC A;  2PMT A;  1S3A A;  3EVI A;  4IJ3 A;  4TXO A;  3FR3 A;  2HRF A;  2JL4 A;  1T1V A;  1OC9 A;  1FB0 A;  4J57 E;  1T8E B;  3MWH A;  4N10 A;  4NMU A;  3F4S A;  3EU4 A;  1H75 A;  2GSR A;  2WS2 A;  3HXS A;  3BCI A;  4I6X A;  4WR5 A;  1CQG A;  2C0D A;  2E2M A;  5D9W A;  2L6C A;  3ZTL A;  12GS A;  2LJR A;  1HYU A;  5F8B A;  5CRH A;  1ERT A;  2EIO A;  3C73 A;  1SL2 B;  3K8N A;  4TXO B;  3R2Q A;  4X0X A;  5ECQ B;  6GST A;  1OC9 B;  2TRX A;  1WPI A;  3ED3 A;  4N0V A;  2IFQ A;  2H0G A;  3WGE A;  3QOU A;  1K3L A;  2R2J A;  3E9J B;  3VFI A;  1XIY A;  4KH7 A;  1R5A A;  1A2L A;  1NHY A;  1WOU A;  1LJR A;  3GFK A;  4ZBD A;  2FWE A;  3P7X A;  3IOS A;  3PGT A;  2HE3 A;  2IFQ B;  4MPG A;  2GSS A;  2VIM A;  4MP4 A;  2V1M A;  2PVO C;  3CRT A;  3QAV A;  4F2I A;  4NV5 A;  5J9B A;  2HT9 A;  2H1A A;  1FOV A;  1QXH A;  1EGR A;  1A8L A;  1F6M C;  4IN0 A;  3Q18 A;  10GS A;  4JR6 A;  1XWB A;  5FT3 A;  4PQI A;  4Z7X A;  3A2V A;  4L5L A;  3BJ5 A;  1QGV A;  4HQZ A;  2WDU A;  4HZ4 A;  1OVN A;  2DJ1 A;  4AJ7 A;  1M9A A;  2DIY A;  3C71 A;  1TRW A;  3APQ A;  5HFG A;  1TK0 B;  3Q6O A;  3IK9 A;  3QCP A;  3CSJ A;  4EDZ A;  4ZBA A;  1T7P B;  3C1S A;  4QL7 A;  2LS5 A;  2GLR A;  1SKW B;  2IN3 A;  5J3R A;  4GCI A;  1AW9 A;  3FZ4 A;  2OA7 A;  4IS0 A;  5ECS A;  5ID2 A;  3ZLP A;  5CRW A;  3DML A;  4MJE A;  4PQ1 A;  4YH2 A;  3MAK A;  2M72 A;  5AIV A;  5ECO B;  2FCH A;  3LWA A;  4OO5 A;  1K0D A;  5CO3 A;  3TRX A;  5DJL A;  1JFU A;  2YP6 A;  3FRC A;  1F9M A;  4I97 A;  5ID2 B;  1XW9 A;  2FWF A;  11GS A;  1AXD A;  5B6M A;  5EY6 A;  3GMF A;  2PPT A;  4V1A g;  1B8X A;  1XW6 A;  2OE1 A;  4ILF A;  2VLU A;  2CQ9 A;  2LEG A;  4GF0 A;  2ON7 A;  2ES7 A;  4ZL8 A;  2ON5 A;  2KLX A;  4POL A;  2J23 A;  4KAE A;  3KP8 A;  1QQ2 A;  1A8Y A;  4IQ1 A;  4JU5 A;  2H66 A;  1WWJ A;  2JZT A;  4RI7 A;  4L0W A;  4NPB A;  2PVQ A;  4ECB A;  1KEB A;  3HJP A;  5B8B A;  1GP1 A;  5G1L A;  1UN2 A;  3WYW A;  2BMX A;  2F8F A;  1ZOF A;  2KUC A;  1K0N A;  3A2X A;  4YQM A;  2MMO A;  3GSS A;  2OBK A;  1C72 A;  2XC2 A;  4KDY A;  2DJ0 A;  5A4W A;  3FZ5 A;  3TJG A;  2HYX A;  4WKW A;  4NXI A;  5IMF A;  2E2G A;  3RPP A;  3KTB A;  3GHA A;  1T4Z A;  1MDJ A;  2R5G A;  1F37 A;  5DDL A;  3CMI A;  4HOJ A;  5IMV A;  2YN1 A;  1JZR A;  2DSA A;  3ZFL A;  2OE0 A;  4O5R A;  2NPB A;  3PIN A;  3CTG A;  1X9M B;  4I2U A;  2WGR A;  2E7P A;  2MYG A;  2AYT A;  2AB6 A;  6GSX A;  2JSY A;  1UA5 A;  2IWT A;  3GL3 A;  1GWC A;  2DBC A;  3HVV A;  4MA9 A;  4OFT A;  4WXT A;  3DKS A;  1X5D A;  4ZBB A;  2IMD A;  1DE1 A;  2L4Q A;  2V32 A;  4QL9 A;  1MDI A;  4IGJ A;  5CNW A;  3KCM A;  4G9H A;  1I9D A;  1X9S B;  1XCC A;  2CVD A;  4ACS A;  3BCK A;  4ZXG A;  2VCT A;  1QMV A;  4K1F A;  2NTO A;  1LBK A;  4GTU A;  2O7K A;  3TOT A;  1R4W A;  2VL3 A;  1USB A;  4MJC A;  1EP8 A;  3GKM A;  4O92 A;  1XPV A;  2XBQ A;  1NM3 A;  5H5R A;  2GDR A;  1RQM A;  1OE8 A;  4WF5 A;  3NIV A;  3GL5 A;  3PR8 A;  2CV4 A;  1Y25 A;  1M7T A;  3LGC A;  3TB2 A;  3UAR A;  1TOF A;  5JWR B;  4PUA A;  1YF0 A;  4BVX A;  1I5G A;  5D9V A;  4G10 A;  2O87 A;  4V1A p;  2GQM A;  2JZR A;  1Q4J A;  2G2Q A;  2FA4 A;  3HA9 A;  1Q98 A;  1PQN A;  2GS3 A;  3QR6 A;  5IOW A;  2P5Q A;  4JE1 A;  3HJM A;  3VI5 A;  1ON4 A;  2LRN A;  3F6D A;  4KSM A;  4XHM A;  3DD3 A;  3EE2 A;  1TU7 A;  3DGQ A;  1X5E A;  2IMF A;  1LU4 A;  1FG4 A;  1GSU A;  2NDO A;  1Z7R A;  5D9X A;  5F07 A;  4V2L A;  5EL8 A;  3VK9 A;  4GSN A;  3GIX A;  2B1L A;  4LA1 A;  2LNT A;  2A2S A;  1U88 A;  4DSR A;  4LMV A;  2RII A;  1G7O A;  3FW2 A;  1ZCP A;  4ML6 A;  3G7Y A;  1G7E A;  1B48 A;  1F2E A;  1UC7 A;  4RI6 A;  1SJ6 A;  2X8H A;  5D8I A;  5GSS A;  3ZZX A;  4OCE A;  3H4K A;  1QUW A;  4EVM A;  2MBT A;  1Z6N A;  2BTO T;  2IL3 A;  3I43 A;  5DAK B;  3TKP A;  1EZK A;  2YWN A;  3CSI A;  1A0R P;  2I1U A;  5FHI A;  2L5O A;  1Y6E A;  2MZC A;  3GTU A;  5FWG A;  2HFD A;  5LD0 A;  4MZB A;  2VCQ A;  5A4V A;  3GX0 A;  1WMJ A;  4FH8 A;  1DBY A;  1AQW A;  3HYP A;  2H19 A;  1XOA A;  1Z3E A;  2HSY A;  1GUM A;  5E59 A;  4F0B A;  3GTU B;  1XZO A;  4IQA A;  1U6T A;  1H4O A;  2VLT A;  3M9J A;  1JZO A;  1DE2 A;  3LSZ A;  3GKK A;  2H6Z A;  4XIH A;  4BPY A;  4PQH A;  1GSQ A;  1SKR B;  5CYY A;  5IPH A;  5ABR A;  2H76 A;  4O32 A;  4E8E A;  3DYR A;  3BBY A;  2VL2 C;  5AN1 A;  3KD0 A;  4AF2 A;  3HHV A;  3TGZ A;  3P2A A;  3Q19 A;  5HR2 A;  1YKC A;  2H6X A;  5KEJ A;  4CHS A;  1A2J A;  1NHO A;  1XOB A;  1B4P A;  1PL2 A;  2LTK A;  2CAI A;  4FYB A;  3G7J A;  2ZCT A;  3D21 A;  3DWV A;  2VO4 A;  1K3Y A;  1ML6 A;  4EO3 A;  1XVQ A;  2GQL A;  1TP9 A;  5L71 A;  1UVZ A;  2H71 A;  3GA4 A;  1O85 A;  4MF7 A;  2GVP A;  2LUS A;  4X43 A;  2PGT A;  1OKT A;  4HI7 A;  20GS A;  5A5K A;  4KDU A;  1K0B A;  4OWY A;  1KBN A;  3IV4 A;  1SD8 A;  1F3A A;  1TU8 A;  3QD9 A;  1GUL A;  1W4V A;  2VD1 A;  1EOG A;  3UL3 A;  1O6J A;  4POK A;  3UBK A;  4IP1 A;  1V98 A;  2HLS A;  1OE7 A;  1GUH A;  3ZRD A;  4IJI A;  2IIY A;  1TW9 A;  3TDG A;  3VWV A;  4TVE A;  2R4V A;  2MBS A;  3S9F A;  2F9S A;  1Z5Y E;  3EMX A;  3TCO A;  5J5N A;  4EDY A;  4OD7 A;  1YEX A;  2N5B A;  4EL1 A;  5GAP D;  3FY7 A;  3GKN A;  4I5Q A;  3IE3 A;  1ZZY A;  4GWR A;  4HJM A;  2I81 A;  2DIZ A;  5KN3 A;  2B5X A;  3TKS C;  3TJJ A;  3LXT A;  5DJM A;  3L0H A;  1O8X A;  3PH9 A;  4J56 E;  2LQQ A;  1BAY A;  1IYH A;  3HVX A;  2VD0 A;  3GYK A;  4HZ2 A;  4L0U A;  1ZL9 A;  4POM A;  1YKA A;  2H70 A;  5IQY A;  2GZZ A;  4MZC A;  3LYK A;  3E0U A;  3F9U A;  2YV7 A;  4XS4 A;  4IKH A;  4NV2 A;  2IMI A;  5DCH A;  5A4U A;  3LEF A;  1GSS A;  3I6A A;  3HCZ A;  1AIU A;  2K8S A;  1VRS D;  4F0C A;  1MEK A;  4KGI A;  3KMN A;  4AJ6 A;  4EUY A;  3CRU A;  4TR3 A;  2CA8 A;  2V6O A;  2PUK C;  3ERF A;  4XS4 B;  3GNJ A;  3P90 A;  1SYR A;  1TK5 B;  4FIW A;  1PD2 1;  5GZZ B;  3WT2 A;  1BG5 A;  8GSS A;  1V57 A;  2YOI A;  1T3B A;  4PNG A;  3QAG A;  3GV1 A;  5H5Q A;  3UMA A;  1PRX A;  2DLX A;  4EE0 A;  3LYP A;  1GTI A;  4TW5 A;  3OR5 A;  2QC7 A;  1FVJ A;  3LG6 A;  1CQH A;  1MD3 A;  2AV4 A;  4J2F A;  2OE3 A;  1GNE A;  2F51 A;  5EPF A;  4XRA A;  4PX1 A;  4BA7 A;  3FK8 A;  2KP2 A;  2O85 A;  1AQX A;  3DIE A;  2H1D A;  3GX8 A;  4MLY A;  1ABA A;  1XBS A;  3GUS A;  1ILO A;  5DBQ A;  1A2M A;  2C3N A;  4LL1 B;  3QPM A;  3LOR A;  1KNG A;  3EMP A;  1N2A A;  1VF1 A;  3O76 A;  2GT6 A;  4XS6 A;  4ZIL A;  1K0M A;  4XTS A;  4GXZ A;  1GL8 A;  5CRG A;  3D5J A;  2VAF A;  3UJ1 A;  1OYJ A;  5J4U A;  2MMA A;  4LMW A;  3H1N A;  1HQO A;  2WCI A;  1XXU A;  3HD5 A;  3N9J A;  2YPM A;  2H1B A;  4JED A;  3AY8 A;  2BJX A;  2H0I A;  5ENU A;  4ID0 A;  3IAM 2;  3WT1 A;  5LCZ A;  5G5E A;  1O8W A;  2LJA A;  3TKR A;  1TK8 B;  1SL1 B;  3F6F A;  5AIS A;  1PKZ A;  3GKX A;  3UBL A;  2JAC A;  4PGT A;  1SJZ A;  3L78 A;  2DML A;  3DRN A;  1ZYE A;  4OFM A;  1YY7 A;  2DJK A;  5EVO A;  2O8V B;  4WBJ A;  4PNF A;  2X64 A;  2WJU A;  4K9Z A;  3GST A;  3G7I A;  17GS A;  3ERG A;  1X5C A;  4YQU A;  2LJK A;  5ECN B;  13GS A;  3US3 A;  3MSZ A;  1S3C A;  3U6V A;  2FA8 A;  4KX4 A;  4F82 A;  1F3B A;  2L59 A;  4K6X A;  4IHU A;  2AJQ B;  3HVS A;  6GSS A;  2C8U A;  3LFL A;  4IBP A;  1NW2 A;  4GST A;  3D4M A;  1XW5 A;  1XWK A;  4HU7 A;  5IO2 A;  3IBH A;  1SKS B;  3DVW A;  5HR1 A;  4MF6 A;  4KUN A;  3VWU A;  1Z7P A;  4EXJ A;  4MJA A;  3LXZ A;  1GLP A;  2GZY A;  4DSS A;  2VM1 A;  4XS1 A;  4KCE A;  16GS A;  1SD9 A;  2GZP A;  4JRR A;  4OFN A;  3SBC A;  2J9H A;  3EIN A;  2C0E A;  2CX3 A;  1HD2 A;  1THX A;  2LKU A;  1YJ6 A;  4HU9 A;  4IP6 A;  4POB A;  3GUR A;  3E3E A;  1J08 A;  1PL1 A;  4GLT A;  3VPT A;  3JCM L;  2VLV A;  4ZB8 A;  2C3T A;  4MH3 A;  1SK2 A; 
#chains in the Genus database with same CATH topology
 4N11 A;  4N0Z A;  1R7H A;  3RPN A;  5HFI A;  1V40 A;  2VOC A;  2GTU A;  1ACV A;  2ALB A;  5B7C A;  1ERW A;  1TDI A;  3M1G A;  4BWQ A;  1V58 A;  4KW6 A;  3RAZ A;  4KB3 A;  1BQ7 A;  2YZH A;  4ML1 A;  2UZ8 A;  1MD4 A;  2LRT A;  5G5F A;  1O81 A;  1YDK A;  3RDW A;  4OO4 A;  4HUA A;  2QA1 A;  5G30 A;  2RM5 A;  1IYI A;  1ERU A;  1AAZ A;  1ZMA A;  2H6Y A;  2VCW A;  2IMK A;  5JCW A;  2I4A A;  5G1K A;  1BYE A;  3ME8 A;  3ZIJ A;  1ZGN A;  4KSO A;  4K7I A;  3QMX A;  3VLN A;  5D96 A;  4EKZ A;  2V6K A;  3IHQ A;  3FYG A;  2FWH A;  2WFC A;  3L9U A;  2QGV A;  4ZB6 A;  3U5R E;  1X0R A;  2KHP A;  5B8A A;  4X4J A;  2KP1 A;  2FD3 A;  2TRC P;  1EV9 A;  3QFA C;  3IR4 A;  3SWL A;  4NHZ A;  2EC4 A;  1YF1 A;  4OMV A;  4MH2 A;  3TRP A;  3ZIV A;  3WD6 A;  14GS A;  1G0T A;  3C7M A;  2JSZ A;  4MCU A;  4BL7 A;  3QAW A;  2OKA A;  4L8E A;  2ZNM A;  1K3O A;  1GH2 A;  2DJ3 A;  5INY A;  4JR4 A;  2H8L A;  2RM6 A;  4TKY A;  3UOM A;  3WGX A;  1BJX A;  3RHB A;  1QFN A;  3IRA A;  1ST9 A;  4ZB9 A;  2KOK A;  3EUR A;  2H01 A;  3FZA A;  4IW9 A;  1FAA A;  1GTB A;  2VCZ A;  4ECI A;  19GS A;  3F63 A;  4FYC A;  3ZML A;  2QKE A;  4KE3 A;  1AUC A;  5C00 A;  4DEJ A;  5HR0 A;  3O3T A;  1JLV A;  2M46 A;  1B9Y C;  1M2D A;  1XG8 A;  2H73 A;  4BWS A;  4NHW A;  1V2A A;  5JCU A;  4ULX A;  2GQK A;  4IVF A;  4E8H A;  2O89 A;  1GSD A;  2VUP A;  3LQ7 A;  2FWG A;  3WGD A;  3TUE A;  3D22 A;  2X99 A;  1FB6 A;  2LNS A;  3M8N A;  4WET A;  1E6B A;  2HRK A;  4F03 A;  5J9C A;  1O7U A;  5ECK B;  3I9V 2;  3KXO A;  1J0F A;  3VWX A;  1B9X C;  2K8V A;  4JZQ A;  1OAZ A;  3TJF A;  1W89 A;  1FHE A;  3TKS A;  2ZUP A;  1A24 A;  4MK3 A;  3IK7 A;  4RQX A;  3HZ8 A;  5JWQ B;  3TOU A;  5F05 A;  1GRX A;  4PXO A;  4V2N A;  2PBJ A;  1WIK A;  3ZIT A;  2OJL A;  4K0G A;  3F8U A;  5IMA A;  2CT6 A;  2IPA A;  4Q5N A;  1N8J A;  3RBT A;  3ZL5 A;  2OBI A;  3KGK A;  1JZW A;  1FVK A;  3V1W A;  2N5A A;  2CVB A;  1GLQ A;  1TI1 A;  1A0F A;  3D4T A;  3IAS 2;  3CXG A;  1SK0 A;  1PA3 A;  1DSB A;  5DVB A;  3FZ9 A;  3ZMK A;  4K5R A;  3W8S A;  2YNX A;  2R3X A;  1E2Y A;  5JWO B;  2B6M A;  1WP0 A;  1R26 A;  1MDK A;  3F3R A;  1AC1 A;  1TRS A;  1YZX A;  2CZ3 A;  1U3I A;  2I3Y A;  2WZ9 A;  1RW1 A;  2L57 A;  1O73 A;  4HSC X;  5DCG A;  3M9K A;  2MMN A;  4XRD A;  4MJB A;  2A4V A;  2YZU A;  3QDN A;  5ECI B;  2WRT A;  4KA0 A;  1S3D A;  1U3A A;  4RUV A;  1PGT A;  2PER A;  3L9V A;  2AAW A;  6GSU A;  2GST A;  3KH9 A;  5ELA A;  1M2B A;  4QQ7 A;  1VF3 A;  5COH A;  4TR4 A;  3M0F A;  1OC8 A;  3KH7 A;  1SK1 A;  1PSQ A;  3TRQ A;  2FNO A;  2V41 A;  4P3Y B;  4JBB A;  1X9W B;  5IMD A;  1GSE A;  5GAN D;  5AGY A;  4FYU A;  3D6I A;  3ERW A;  5C04 A;  5KOW A;  4FO5 A;  2RLI A;  3TJB A;  4YAV A;  2JZS A;  4D73 A;  2IJY A;  3FHK A;  3RHC A;  4FQU A;  4DVC A;  3KTL A;  3G9B A;  1VF2 A;  3IXR A;  5G31 A;  1TRU A;  9GSS A;  1PN9 A;  1K0A A;  1KTE A;  1ZYQ B;  3ZVJ D;  3CTF A;  4D73 B;  4IEL A;  2K18 A;  2PWJ A;  2QSI A;  2DJ2 A;  2V2G A;  3FEU A;  5HFK A;  3KP9 A;  1R5P A;  1Z6M A;  5F0G A;  6GSW A;  2F3M A;  3LJR A;  1PX6 A;  3KEB A;  3W6G A;  3N5O A;  1SU9 A;  4PUR A;  2FLS A;  4G0K A;  3GN3 A;  3ISO A;  4EF0 A;  1GUK A;  2L6D A;  3APO A;  3EU3 A;  2B7K A;  2H75 A;  5IMZ A;  1SYX A;  1J9B A;  1URM A;  3UVH A;  2GGT A;  1SJI A;  3HJO A;  3KM6 A;  4NAX A;  3NOF A;  2H0H A;  4BIK A;  3TKQ A;  5D93 A;  1BX9 A;  4ZL7 A;  4GQC A;  5H5S A;  1FW1 A;  1XFL A;  4MNN A;  4O5U A;  3O6T A;  1HNC A;  4HJ2 A;  2LST A;  3BOA A;  3NZN A;  2LV3 A;  1SEN A;  3HKR A;  1YQ1 A;  3F4T A;  2H74 A;  2FY6 A;  2C0F A;  3P8W A;  1TI3 A;  6GSY A;  5HQP A;  2EIQ A;  2HSH A;  1JZD A;  4K7O A;  4Z2T A;  2HZE A;  5BRT A;  2YJH A;  1K0C A;  5J41 A;  2R37 A;  4HS1 A;  1U87 A;  3UAP A;  5HR3 A;  1A23 A;  4N30 A;  1K0O A;  2FGX A;  4I2T A;  5ECL B;  2C80 A;  4TOP A;  1G6W A;  4GQF A;  4WBR D;  2YJ7 A;  3F3Q A;  4HDE A;  5IM9 A;  2HZE B;  3MDK A;  3KZQ A;  5IPG A;  1MTC A;  4MZW A;  2DMM A;  2L5L A;  2LQO A;  2PN8 A;  2FHE A;  3IPZ A;  2YWM A;  5AIX A;  1WRY A;  1GSF A;  4PUF C;  3VWW A;  1XWA A;  1PKW A;  1G6Y A;  5LNK e;  3F0I A;  4DSQ A;  3APS A;  5BMU A;  3CSH A;  2P31 A;  3IDV A;  1EP7 A;  1OC3 A;  1EEJ A;  2M80 A;  5IO0 A;  2EIR A;  2A2P A;  1HNB A;  3ZRE A;  2IME A;  2I9H A;  2P0G A;  3FR6 A;  1EV4 A;  2YV9 A;  5D9T A;  4NWY A;  2AHE A;  2B5E A;  2L4C A;  2CX4 A;  1GTA A;  2YWO A;  2XHF A;  5D73 A;  5F06 A;  5CAX A;  2GSQ A;  2NBS A;  1WE0 A;  2A4H A;  22GS A;  1AQV A;  4G2E A;  4K2D A;  3FMW A;  2Z9S A;  4XCS A;  2DJJ A;  4Q5R A;  1RK4 A;  5ECP B;  4ECJ A;  4Q5Q A;  1XWG A;  4L5O A;  2DKI A;  3GH9 A;  1WJK A;  3GH6 A;  4TR1 A;  5E4W A;  6GSV A;  5IOX A;  1FO5 A;  1ERV A;  2C3Q A;  2C1Y A;  2R0G A;  1V9W A;  1EEM A;  1TXX A;  2JU5 A;  3EC3 A;  2HNL A;  3MYD A;  1M3J A;  3IC4 A;  4V2M A;  3QFB C;  2VCX A;  2YCD A;  3GRX A;  4DSS B;  2CAQ A;  2VCV A;  4MF5 A;  2NVL A;  4AJ8 A;  4BVY A;  1QK8 A;  2H1G A;  1PX7 A;  4ZIJ A;  1VF4 A;  3LW9 A;  3MNG A;  4TRX A;  5DQY A;  3IA1 A;  4MAB A;  4KF9 A;  4TR1 B;  2FUG 2;  2DC5 A;  1M3I A;  1EGO A;  1ZYN A;  2GT5 A;  4G19 A;  4K2X A;  3W8J A;  3H79 A;  4MMM A;  1BED A;  2CZ2 A;  3L4N A;  1GNW A;  1GSY A;  4GRF A;  2F8A A;  4WEY A;  2H30 A;  1DUG A;  2X8C A;  5CRD A;  2G0F A;  1TKD B;  3L9S A;  3CBU A;  1T00 A;  1NSW A;  3A5W A;  2XBI A;  1SL0 B;  3HY2 A;  1EOH A;  4TN8 A;  4GSS A;  5DAL A;  3J7Y b;  4K0N A;  4EIQ A;  5KN2 A;  1HNA A;  2X8G A;  1M9B A;  2YWI A;  5G2Z A;  2VL2 A;  2E0Q A;  3UVT A;  5DAK A;  2H72 A;  2XPE A;  3KMO A;  1VGL A;  4I8B A;  4MPF A;  5DAL B;  2YAN A;  3H93 A;  1OKD A;  3FKF A;  3ZVJ A;  3A2W A;  3HZ4 A;  4CW9 A;  3VUR A;  18GS A;  4HQS A;  3TKS E;  5ECR B;  2HXK A;  4Q5F A;  7GSS A;  4KND A;  3DEX A;  2HI7 A;  3ME7 A;  2PU9 C;  2JAD A;  2XPD A;  1GTU A;  2A2R A;  2B1K A;  2MMZ A;  2B3S A;  2B5Y A;  4LL4 B;  2C4J A;  2R6K A;  4BL7 B;  3ZYW A;  4TXV A;  4K8M A;  3M3M A;  3HDC A;  3DXB A;  5IMC A;  1JLW A;  1M99 A;  1M0U A;  4ISD A;  2RUF A;  2RUE A;  3FR9 A;  3HVN A;  5ELG A;  2WUL A;  3ZFB A;  3C1R A;  5KN1 A;  4EIP A;  2OAD A;  1M2A A;  2VL9 A;  3EYT A;  5KN0 A;  5CRE A;  4EC0 A;  5JCG A;  3D0Z A;  3KJY A;  3DVX A;  4RQR A;  2OAC A;  1S3R A;  4OCF A;  4WR4 A;  3I69 A;  2K9F A;  5GST A;  3UIW A;  3F4R A;  4WF4 A;  2CVK A;  2N5F A;  1EWX A;  1PMT A;  1TTZ A;  5ECM B;  2WB9 A;  4YQV A;  3J7Y k;  2D2Z A;  3EWL A;  5IIZ A;  4USS A;  4X1U A;  5ECH B;  1JHB A;  1XWC A;  4O7H A;  2P5R A;  1TRV A;  3UEM A;  2TIR A;  4LLR A;  2AUV A;  3A3T A;  1TJD A;  1YEP A;  1T4Y A;  1Z9H A;  2REM A;  3BD2 A;  2B7J A;  4H86 A;  2HRN A;  3CYN A;  4ECC A;  4TR0 A;  4F9Z A;  1THO A;  4YAP A;  3H8Q A;  2VM2 A;  5DQS A;  5CP1 A;  4AGS A;  4K7N A;  4CDO A;  3VPQ A;  3Q74 A;  3KIJ A;  3TJK A;  3A5I A;  2K6V A;  2C0G A;  4HEA 2;  3C8E A;  4KCA A;  3VI7 A;  4ZL9 A;  4KDX A;  2HSM A;  5B6N A;  1XVW A;  1B4Q A;  2HZF A;  4PTS A;  2LRC A;  4MDC A;  2PMT A;  1S3A A;  3IC8 A;  3EVI A;  4IJ3 A;  4TXO A;  3FR3 A;  2HRF A;  2JL4 A;  1T1V A;  1OC9 A;  1FB0 A;  4J57 E;  1T8E B;  3MWH A;  4N10 A;  4NMU A;  3F4S A;  3EU4 A;  1H75 A;  2GSR A;  2WS2 A;  3HXS A;  3BCI A;  4I6X A;  4WR5 A;  1CQG A;  2C0D A;  2E2M A;  5D9W A;  2L6C A;  3ZTL A;  12GS A;  2LJR A;  1HYU A;  5F8B A;  4Z2U A;  5CRH A;  1ERT A;  2EIO A;  3C73 A;  1SL2 B;  3K8N A;  4TXO B;  3R2Q A;  4X0X A;  5ECQ B;  6GST A;  1OC9 B;  2TRX A;  1WPI A;  3ED3 A;  4N0V A;  2IFQ A;  2H0G A;  3WGE A;  3QOU A;  1K3L A;  2R2J A;  3E9J B;  3VFI A;  1XIY A;  4KH7 A;  1R5A A;  1A2L A;  1NHY A;  1WOU A;  1LJR A;  3GFK A;  4ZBD A;  2FWE A;  3P7X A;  3IOS A;  3PGT A;  2HE3 A;  2IFQ B;  4MPG A;  2GSS A;  2VIM A;  4MP4 A;  2V1M A;  2PVO C;  3CRT A;  3QAV A;  4F2I A;  4NV5 A;  5J9B A;  2HT9 A;  2H1A A;  1FOV A;  1QXH A;  1EGR A;  1A8L A;  1F6M C;  4IN0 A;  3Q18 A;  10GS A;  4JR6 A;  1XWB A;  5FT3 A;  4PQI A;  4Z7X A;  3A2V A;  4L5L A;  3BJ5 A;  1QGV A;  4HQZ A;  2WDU A;  4HZ4 A;  1OVN A;  2DJ1 A;  4AJ7 A;  1M9A A;  2DIY A;  3C71 A;  1ZYP A;  1TRW A;  3APQ A;  5HFG A;  2X49 A;  1TK0 B;  3Q6O A;  3IK9 A;  3QCP A;  3CSJ A;  4EDZ A;  4ZBA A;  1T7P B;  3C1S A;  4QL7 A;  4CY8 A;  2LS5 A;  2GLR A;  1SKW B;  2IN3 A;  5J3R A;  4GCI A;  1AW9 A;  3FZ4 A;  2OA7 A;  4IS0 A;  5ECS A;  5ID2 A;  3ZLP A;  5CRW A;  3DML A;  4MJE A;  4PQ1 A;  4YH2 A;  3MAK A;  2M72 A;  5AIV A;  5ECO B;  3CQF A;  2FCH A;  3LWA A;  4OO5 A;  1K0D A;  5CO3 A;  3TRX A;  5DJL A;  1JFU A;  2YP6 A;  3FRC A;  1F9M A;  4I97 A;  5ID2 B;  1XW9 A;  2FWF A;  11GS A;  1AXD A;  5B6M A;  5EY6 A;  3GMF A;  2PPT A;  4V1A g;  1B8X A;  1XW6 A;  2OE1 A;  4ILF A;  2VLU A;  2CQ9 A;  2LEG A;  4GF0 A;  2ON7 A;  2ES7 A;  4ZL8 A;  2ON5 A;  2KLX A;  4POL A;  2J23 A;  4KAE A;  3KP8 A;  1QQ2 A;  1A8Y A;  4IQ1 A;  4JU5 A;  2H66 A;  1WWJ A;  2JZT A;  4RI7 A;  4L0W A;  4NPB A;  2PVQ A;  4ECB A;  1KEB A;  3HJP A;  5B8B A;  1GP1 A;  5G1L A;  4YKF A;  1UN2 A;  4G0L A;  3WYW A;  2BMX A;  2F8F A;  1ZOF A;  2KUC A;  1K0N A;  3A2X A;  4YQM A;  2MMO A;  3GSS A;  2OBK A;  1C72 A;  2XC2 A;  4KDY A;  2DJ0 A;  5A4W A;  3FZ5 A;  3TJG A;  2HYX A;  4WKW A;  4NXI A;  5IMF A;  2E2G A;  3RPP A;  3KTB A;  3GHA A;  1T4Z A;  1FOH A;  1MDJ A;  2R5G A;  1F37 A;  5DDL A;  3CMI A;  4HOJ A;  5IMV A;  2YN1 A;  1JZR A;  2DSA A;  3ZFL A;  2OE0 A;  4O5R A;  2NPB A;  3PIN A;  3CTG A;  1X9M B;  4I2U A;  2WGR A;  2E7P A;  2MYG A;  2AYT A;  2AB6 A;  6GSX A;  2JSY A;  1UA5 A;  2IWT A;  3GL3 A;  1GWC A;  2DBC A;  3HVV A;  4MA9 A;  4OFT A;  4WXT A;  3DKS A;  1X5D A;  4ZBB A;  2IMD A;  1DE1 A;  2L4Q A;  2V32 A;  4QL9 A;  1MDI A;  4IGJ A;  5CNW A;  3KCM A;  4G9H A;  1I9D A;  1X9S B;  1XCC A;  2CVD A;  4ACS A;  3BCK A;  4ZXG A;  2VCT A;  1QMV A;  4K1F A;  2NTO A;  1LBK A;  4GTU A;  2O7K A;  3TOT A;  1R4W A;  2VL3 A;  1USB A;  4MJC A;  1EP8 A;  3GKM A;  4O92 A;  1XPV A;  2XBQ A;  1NM3 A;  5H5R A;  2GDR A;  1RQM A;  1OE8 A;  4WF5 A;  3NIV A;  3GL5 A;  3PR8 A;  2CV4 A;  1Y25 A;  1M7T A;  3LGC A;  3TB2 A;  3UAR A;  1TOF A;  5JWR B;  4PUA A;  1YF0 A;  4BVX A;  4A5P A;  1I5G A;  5D9V A;  4G10 A;  2O87 A;  4V1A p;  2GQM A;  2JZR A;  1Q4J A;  1PN0 A;  2G2Q A;  2FA4 A;  3HA9 A;  1Q98 A;  1PQN A;  2GS3 A;  3QR6 A;  5IOW A;  2P5Q A;  4JE1 A;  4BVY B;  3HJM A;  3VI5 A;  1ON4 A;  4BVX B;  2LRN A;  3F6D A;  4KSM A;  4XHM A;  3DD3 A;  3EE2 A;  1TU7 A;  3DGQ A;  1X5E A;  2IMF A;  1LU4 A;  1FG4 A;  1GSU A;  2NDO A;  1Z7R A;  5D9X A;  5F07 A;  4V2L A;  5EL8 A;  3VK9 A;  4GSN A;  3GIX A;  2B1L A;  4LA1 A;  2LNT A;  2A2S A;  1U88 A;  4DSR A;  4LMV A;  2RII A;  1G7O A;  3FW2 A;  1ZCP A;  4ML6 A;  3G7Y A;  5KOX A;  1G7E A;  1B48 A;  1F2E A;  1UC7 A;  4RI6 A;  1SJ6 A;  2X8H A;  5D8I A;  5GSS A;  3ZZX A;  4OCE A;  3H4K A;  1QUW A;  4EVM A;  2MBT A;  1Z6N A;  2BTO T;  2IL3 A;  3I43 A;  5DAK B;  3TKP A;  1EZK A;  2YWN A;  3CSI A;  1A0R P;  2I1U A;  5FHI A;  2L5O A;  1Y6E A;  2MZC A;  3GTU A;  5FWG A;  2HFD A;  5LD0 A;  4MZB A;  2VCQ A;  5A4V A;  3GX0 A;  1WMJ A;  4FH8 A;  1DBY A;  1AQW A;  3HYP A;  2H19 A;  1XOA A;  1Z3E A;  2HSY A;  1GUM A;  5E59 A;  4F0B A;  2X4A A;  3GTU B;  3MIX A;  1XZO A;  4IQA A;  1U6T A;  1H4O A;  2VLT A;  3M9J A;  1JZO A;  1DE2 A;  3LSZ A;  3GKK A;  2H6Z A;  4XIH A;  4BPY A;  4PQH A;  2R0C A;  1GSQ A;  1SKR B;  5CYY A;  5IPH A;  5ABR A;  2H76 A;  4O32 A;  4E8E A;  3DYR A;  3BBY A;  2VL2 C;  5AN1 A;  3KD0 A;  4AF2 A;  3HHV A;  3TGZ A;  3P2A A;  3Q19 A;  5HR2 A;  1YKC A;  2H6X A;  5KEJ A;  4CHS A;  1A2J A;  1NHO A;  1XOB A;  1B4P A;  1PL2 A;  2LTK A;  2CAI A;  4FYB A;  3G7J A;  2ZCT A;  3D21 A;  3DWV A;  2VO4 A;  1K3Y A;  1ML6 A;  4EO3 A;  1XVQ A;  2GQL A;  1TP9 A;  5L71 A;  1UVZ A;  2H71 A;  3GA4 A;  4CY6 A;  1O85 A;  4MF7 A;  2GVP A;  2LUS A;  4X43 A;  2PGT A;  1OKT A;  4HI7 A;  20GS A;  5A5K A;  4KDU A;  1K0B A;  4OWY A;  1KBN A;  3IV4 A;  1SD8 A;  1F3A A;  1TU8 A;  3QD9 A;  1GUL A;  1W4V A;  2VD1 A;  1EOG A;  3UL3 A;  4Z2R A;  1O6J A;  4POK A;  3UBK A;  4ICY A;  4IP1 A;  1V98 A;  2HLS A;  1OE7 A;  4YKG A;  1GUH A;  3ZRD A;  4IJI A;  2IIY A;  1TW9 A;  3TDG A;  3VWV A;  4TVE A;  2R4V A;  2MBS A;  3S9F A;  2F9S A;  1Z5Y E;  3EMX A;  3TCO A;  5J5N A;  4EDY A;  4OD7 A;  1YEX A;  2N5B A;  4EL1 A;  5GAP D;  3FY7 A;  3GKN A;  4I5Q A;  3IE3 A;  1ZZY A;  4GWR A;  4HJM A;  2I81 A;  2DIZ A;  5KN3 A;  2B5X A;  3TKS C;  3TJJ A;  3LXT A;  5DJM A;  3L0H A;  1O8X A;  3PH9 A;  4J56 E;  2LQQ A;  1BAY A;  1IYH A;  3HVX A;  2VD0 A;  3GYK A;  4HZ2 A;  4L0U A;  1ZL9 A;  4POM A;  1YKA A;  2H70 A;  5IQY A;  2GZZ A;  4MZC A;  3LYK A;  3E0U A;  3F9U A;  2YV7 A;  4XS4 A;  4IKH A;  4NV2 A;  2IMI A;  5DCH A;  5A4U A;  3LEF A;  1GSS A;  3I6A A;  3HCZ A;  1AIU A;  2K8S A;  1VRS D;  4F0C A;  1MEK A;  4KGI A;  3KMN A;  4AJ6 A;  4EUY A;  3CRU A;  4TR3 A;  2CA8 A;  2V6O A;  2PUK C;  3ERF A;  4XS4 B;  3GNJ A;  3P90 A;  1SYR A;  1TK5 B;  4FIW A;  1PD2 1;  5GZZ B;  3WT2 A;  1BG5 A;  3IHG A;  8GSS A;  1V57 A;  2YOI A;  4G0I A;  1T3B A;  4PNG A;  3QAG A;  3GV1 A;  5H5Q A;  3UMA A;  1PRX A;  2DLX A;  4EE0 A;  3LYP A;  1GTI A;  4TW5 A;  3OR5 A;  2QC7 A;  1FVJ A;  3LG6 A;  1CQH A;  1MD3 A;  2AV4 A;  4J2F A;  2OE3 A;  1GNE A;  2F51 A;  4O5Q A;  5EPF A;  4XRA A;  4PX1 A;  4BA7 A;  3FK8 A;  2KP2 A;  2O85 A;  1AQX A;  3DIE A;  2H1D A;  3GX8 A;  4MLY A;  1ABA A;  1XBS A;  3GUS A;  1ILO A;  3PPU A;  5DBQ A;  2QA2 A;  1A2M A;  2C3N A;  4LL1 B;  3QPM A;  3LOR A;  1KNG A;  3EMP A;  1N2A A;  1VF1 A;  3O76 A;  2GT6 A;  4XS6 A;  4ZIL A;  1K0M A;  4XTS A;  4GXZ A;  1GL8 A;  5CRG A;  3D5J A;  2VAF A;  3UJ1 A;  1OYJ A;  5J4U A;  2MMA A;  4LMW A;  3R3E A;  3H1N A;  1HQO A;  2WCI A;  1XXU A;  3HD5 A;  3N9J A;  2YPM A;  2H1B A;  4JED A;  3AY8 A;  2BJX A;  2H0I A;  5ENU A;  4ID0 A;  3IAM 2;  3WT1 A;  5LCZ A;  5G5E A;  1O8W A;  2LJA A;  3TKR A;  1TK8 B;  1SL1 B;  3F6F A;  5AIS A;  1PKZ A;  3GKX A;  3UBL A;  2JAC A;  4PGT A;  1SJZ A;  3L78 A;  2R0P A;  2DML A;  4K5S A;  3DRN A;  1ZYE A;  4OFM A;  1YY7 A;  2DJK A;  1PFO A;  5EVO A;  2O8V B;  4WBJ A;  4PNF A;  2X64 A;  2WJU A;  4K9Z A;  3GST A;  3G7I A;  17GS A;  3ERG A;  1X5C A;  4YQU A;  2LJK A;  5ECN B;  13GS A;  3US3 A;  3MSZ A;  1S3C A;  3U6V A;  2FA8 A;  4KX4 A;  4F82 A;  1F3B A;  2L59 A;  4K6X A;  4IHU A;  2AJQ B;  3HVS A;  6GSS A;  2HRA A;  2C8U A;  3LFL A;  4IBP A;  1NW2 A;  4GST A;  3D4M A;  1XW5 A;  1XWK A;  3EPT A;  4HU7 A;  5IO2 A;  2DKH A;  3IBH A;  1SKS B;  3DVW A;  5HR1 A;  4MF6 A;  4KUN A;  3VWU A;  1Z7P A;  4EXJ A;  4MJA A;  3LXZ A;  1GLP A;  2GZY A;  4DSS A;  2VM1 A;  4XS1 A;  4KCE A;  16GS A;  1SD9 A;  2GZP A;  4JRR A;  4OFN A;  3SBC A;  2J9H A;  3EIN A;  2C0E A;  2CX3 A;  1HD2 A;  1THX A;  2LKU A;  1YJ6 A;  4HU9 A;  4IP6 A;  4POB A;  3GUR A;  3E3E A;  1J08 A;  1PL1 A;  4GLT A;  3VPT A;  3JCM L;  2VLV A;  4ZB8 A;  2C3T A;  4MH3 A;  1SK2 A; 
#chains in the Genus database with same CATH homology
 4N11 A;  4N0Z A;  1R7H A;  3RPN A;  5HFI A;  1V40 A;  2VOC A;  2GTU A;  1ACV A;  2ALB A;  5B7C A;  1ERW A;  1TDI A;  3M1G A;  4BWQ A;  1V58 A;  4KW6 A;  3RAZ A;  4KB3 A;  1BQ7 A;  2YZH A;  4ML1 A;  2UZ8 A;  1MD4 A;  2LRT A;  5G5F A;  1O81 A;  1YDK A;  3RDW A;  4OO4 A;  4HUA A;  2QA1 A;  5G30 A;  2RM5 A;  1IYI A;  1ERU A;  1AAZ A;  1ZMA A;  2H6Y A;  2VCW A;  2IMK A;  5JCW A;  2I4A A;  5G1K A;  1BYE A;  3ME8 A;  3ZIJ A;  1ZGN A;  4KSO A;  4K7I A;  3QMX A;  3VLN A;  5D96 A;  4EKZ A;  2V6K A;  3IHQ A;  3FYG A;  2FWH A;  2WFC A;  3L9U A;  2QGV A;  4ZB6 A;  3U5R E;  1X0R A;  2KHP A;  5B8A A;  4X4J A;  2KP1 A;  2FD3 A;  2TRC P;  1EV9 A;  3QFA C;  3IR4 A;  3SWL A;  4NHZ A;  2EC4 A;  1YF1 A;  4OMV A;  4MH2 A;  3TRP A;  3ZIV A;  3WD6 A;  14GS A;  1G0T A;  3C7M A;  2JSZ A;  4MCU A;  4BL7 A;  3QAW A;  2OKA A;  4L8E A;  2ZNM A;  1K3O A;  1GH2 A;  2DJ3 A;  5INY A;  4JR4 A;  2H8L A;  2RM6 A;  4TKY A;  3UOM A;  3WGX A;  1BJX A;  3RHB A;  1QFN A;  3IRA A;  1ST9 A;  4ZB9 A;  2KOK A;  3EUR A;  2H01 A;  3FZA A;  4IW9 A;  1FAA A;  1GTB A;  2VCZ A;  4ECI A;  19GS A;  3F63 A;  4FYC A;  3ZML A;  2QKE A;  4KE3 A;  1AUC A;  5C00 A;  4DEJ A;  5HR0 A;  3O3T A;  1JLV A;  2M46 A;  1B9Y C;  1M2D A;  2H73 A;  4BWS A;  4NHW A;  1V2A A;  5JCU A;  4ULX A;  2GQK A;  4IVF A;  4E8H A;  2O89 A;  1GSD A;  2VUP A;  3LQ7 A;  2FWG A;  3WGD A;  3TUE A;  3D22 A;  2X99 A;  1FB6 A;  2LNS A;  3M8N A;  4WET A;  1E6B A;  2HRK A;  4F03 A;  5J9C A;  1O7U A;  5ECK B;  3I9V 2;  3KXO A;  1J0F A;  3VWX A;  1B9X C;  2K8V A;  4JZQ A;  1OAZ A;  3TJF A;  1W89 A;  1FHE A;  3TKS A;  2ZUP A;  1A24 A;  4MK3 A;  3IK7 A;  4RQX A;  3HZ8 A;  5JWQ B;  3TOU A;  5F05 A;  1GRX A;  4PXO A;  4V2N A;  2PBJ A;  1WIK A;  3ZIT A;  2OJL A;  4K0G A;  3F8U A;  5IMA A;  2CT6 A;  2IPA A;  4Q5N A;  1N8J A;  3RBT A;  3ZL5 A;  2OBI A;  3KGK A;  1JZW A;  1FVK A;  3V1W A;  2N5A A;  2CVB A;  1GLQ A;  1TI1 A;  1A0F A;  3D4T A;  3IAS 2;  3CXG A;  1SK0 A;  1PA3 A;  1DSB A;  5DVB A;  3FZ9 A;  3ZMK A;  4K5R A;  3W8S A;  2YNX A;  2R3X A;  1E2Y A;  5JWO B;  2B6M A;  1WP0 A;  1R26 A;  1MDK A;  3F3R A;  1AC1 A;  1TRS A;  1YZX A;  2CZ3 A;  1U3I A;  2I3Y A;  2WZ9 A;  1RW1 A;  2L57 A;  1O73 A;  5DCG A;  3M9K A;  2MMN A;  4XRD A;  4MJB A;  2A4V A;  2YZU A;  3QDN A;  5ECI B;  2WRT A;  4KA0 A;  1S3D A;  1U3A A;  4RUV A;  1PGT A;  2PER A;  3L9V A;  2AAW A;  6GSU A;  2GST A;  3KH9 A;  5ELA A;  1M2B A;  4QQ7 A;  1VF3 A;  5COH A;  4TR4 A;  3M0F A;  1OC8 A;  3KH7 A;  1SK1 A;  1PSQ A;  3TRQ A;  2FNO A;  2V41 A;  4P3Y B;  4JBB A;  1X9W B;  5IMD A;  1GSE A;  5GAN D;  5AGY A;  4FYU A;  3D6I A;  3ERW A;  5C04 A;  5KOW A;  4FO5 A;  2RLI A;  3TJB A;  4YAV A;  2JZS A;  4D73 A;  2IJY A;  3FHK A;  3RHC A;  4FQU A;  4DVC A;  3KTL A;  3G9B A;  1VF2 A;  3IXR A;  5G31 A;  1TRU A;  9GSS A;  1PN9 A;  1K0A A;  1KTE A;  1ZYQ B;  3ZVJ D;  3CTF A;  4D73 B;  4IEL A;  2K18 A;  2PWJ A;  2QSI A;  2DJ2 A;  2V2G A;  3FEU A;  5HFK A;  3KP9 A;  1R5P A;  1Z6M A;  5F0G A;  6GSW A;  2F3M A;  3LJR A;  1PX6 A;  3KEB A;  3W6G A;  3N5O A;  1SU9 A;  4PUR A;  2FLS A;  4G0K A;  3GN3 A;  3ISO A;  4EF0 A;  1GUK A;  2L6D A;  3APO A;  3EU3 A;  2B7K A;  2H75 A;  5IMZ A;  1SYX A;  1J9B A;  1URM A;  3UVH A;  2GGT A;  1SJI A;  3HJO A;  3KM6 A;  4NAX A;  3NOF A;  2H0H A;  3TKQ A;  5D93 A;  1BX9 A;  4ZL7 A;  4GQC A;  5H5S A;  1FW1 A;  1XFL A;  4MNN A;  4O5U A;  3O6T A;  1HNC A;  4HJ2 A;  2LST A;  3BOA A;  3NZN A;  2LV3 A;  1SEN A;  3HKR A;  1YQ1 A;  3F4T A;  2H74 A;  2FY6 A;  2C0F A;  3P8W A;  1TI3 A;  6GSY A;  5HQP A;  2EIQ A;  2HSH A;  1JZD A;  4K7O A;  4Z2T A;  2HZE A;  5BRT A;  2YJH A;  1K0C A;  5J41 A;  2R37 A;  4HS1 A;  1U87 A;  3UAP A;  5HR3 A;  1A23 A;  4N30 A;  1K0O A;  2FGX A;  4I2T A;  5ECL B;  2C80 A;  4TOP A;  1G6W A;  4GQF A;  4WBR D;  2YJ7 A;  3F3Q A;  4HDE A;  5IM9 A;  2HZE B;  3MDK A;  3KZQ A;  5IPG A;  1MTC A;  4MZW A;  2DMM A;  2L5L A;  2LQO A;  2PN8 A;  2FHE A;  3IPZ A;  2YWM A;  5AIX A;  1WRY A;  1GSF A;  4PUF C;  3VWW A;  1XWA A;  1PKW A;  1G6Y A;  5LNK e;  3F0I A;  4DSQ A;  3APS A;  5BMU A;  3CSH A;  2P31 A;  3IDV A;  1EP7 A;  1OC3 A;  1EEJ A;  2M80 A;  5IO0 A;  2EIR A;  2A2P A;  1HNB A;  3ZRE A;  2IME A;  2I9H A;  2P0G A;  3FR6 A;  1EV4 A;  2YV9 A;  5D9T A;  4NWY A;  2AHE A;  2B5E A;  2L4C A;  2CX4 A;  1GTA A;  2YWO A;  2XHF A;  5D73 A;  5F06 A;  5CAX A;  2GSQ A;  2NBS A;  1WE0 A;  2A4H A;  22GS A;  1AQV A;  4G2E A;  4K2D A;  3FMW A;  2Z9S A;  4XCS A;  2DJJ A;  4Q5R A;  1RK4 A;  5ECP B;  4ECJ A;  4Q5Q A;  1XWG A;  4L5O A;  2DKI A;  3GH9 A;  1WJK A;  3GH6 A;  4TR1 A;  5E4W A;  6GSV A;  5IOX A;  1FO5 A;  1ERV A;  2C3Q A;  2C1Y A;  2R0G A;  1V9W A;  1EEM A;  1TXX A;  2JU5 A;  3EC3 A;  2HNL A;  3MYD A;  3IC4 A;  4V2M A;  3QFB C;  2VCX A;  2YCD A;  3GRX A;  4DSS B;  2CAQ A;  2VCV A;  4MF5 A;  2NVL A;  4AJ8 A;  4BVY A;  1QK8 A;  2H1G A;  1PX7 A;  4ZIJ A;  1VF4 A;  3LW9 A;  3MNG A;  4TRX A;  5DQY A;  3IA1 A;  4MAB A;  4KF9 A;  4TR1 B;  2FUG 2;  2DC5 A;  1EGO A;  1ZYN A;  2GT5 A;  4G19 A;  4K2X A;  3W8J A;  3H79 A;  4MMM A;  1BED A;  2CZ2 A;  3L4N A;  1GNW A;  1GSY A;  4GRF A;  2F8A A;  4WEY A;  2H30 A;  1DUG A;  2X8C A;  5CRD A;  2G0F A;  1TKD B;  3L9S A;  3CBU A;  1T00 A;  1NSW A;  3A5W A;  2XBI A;  1SL0 B;  3HY2 A;  1EOH A;  4TN8 A;  4GSS A;  5DAL A;  3J7Y b;  4K0N A;  4EIQ A;  5KN2 A;  1HNA A;  2X8G A;  1M9B A;  2YWI A;  5G2Z A;  2VL2 A;  2E0Q A;  3UVT A;  5DAK A;  2H72 A;  2XPE A;  3KMO A;  1VGL A;  4I8B A;  4MPF A;  5DAL B;  2YAN A;  3H93 A;  1OKD A;  3FKF A;  3ZVJ A;  3A2W A;  3HZ4 A;  4CW9 A;  3VUR A;  18GS A;  4HQS A;  3TKS E;  5ECR B;  2HXK A;  4Q5F A;  7GSS A;  4KND A;  3DEX A;  2HI7 A;  3ME7 A;  2PU9 C;  2JAD A;  2XPD A;  1GTU A;  2A2R A;  2B1K A;  2MMZ A;  2B3S A;  2B5Y A;  4LL4 B;  2C4J A;  2R6K A;  4BL7 B;  3ZYW A;  4TXV A;  4K8M A;  3M3M A;  3HDC A;  3DXB A;  5IMC A;  1JLW A;  1M99 A;  1M0U A;  4ISD A;  2RUF A;  2RUE A;  3FR9 A;  5ELG A;  2WUL A;  3ZFB A;  3C1R A;  5KN1 A;  4EIP A;  2OAD A;  1M2A A;  2VL9 A;  3EYT A;  5KN0 A;  5CRE A;  4EC0 A;  5JCG A;  3D0Z A;  3KJY A;  3DVX A;  4RQR A;  2OAC A;  4OCF A;  4WR4 A;  3I69 A;  2K9F A;  5GST A;  3UIW A;  3F4R A;  4WF4 A;  2CVK A;  2N5F A;  1EWX A;  1PMT A;  1TTZ A;  5ECM B;  2WB9 A;  4YQV A;  3J7Y k;  2D2Z A;  3EWL A;  5IIZ A;  4USS A;  4X1U A;  5ECH B;  1JHB A;  1XWC A;  4O7H A;  2P5R A;  1TRV A;  3UEM A;  2TIR A;  4LLR A;  2AUV A;  3A3T A;  1TJD A;  1YEP A;  1T4Y A;  1Z9H A;  2REM A;  3BD2 A;  2B7J A;  4H86 A;  2HRN A;  3CYN A;  4ECC A;  4TR0 A;  4F9Z A;  1THO A;  4YAP A;  3H8Q A;  2VM2 A;  5DQS A;  5CP1 A;  4AGS A;  4K7N A;  4CDO A;  3VPQ A;  3Q74 A;  3KIJ A;  3TJK A;  3A5I A;  2K6V A;  2C0G A;  4HEA 2;  3C8E A;  4KCA A;  3VI7 A;  4ZL9 A;  4KDX A;  2HSM A;  5B6N A;  1XVW A;  1B4Q A;  2HZF A;  4PTS A;  2LRC A;  4MDC A;  2PMT A;  1S3A A;  3IC8 A;  3EVI A;  4IJ3 A;  4TXO A;  3FR3 A;  2HRF A;  2JL4 A;  1T1V A;  1OC9 A;  1FB0 A;  4J57 E;  1T8E B;  3MWH A;  4N10 A;  4NMU A;  3F4S A;  3EU4 A;  1H75 A;  2GSR A;  2WS2 A;  3HXS A;  3BCI A;  4I6X A;  4WR5 A;  1CQG A;  2C0D A;  2E2M A;  5D9W A;  2L6C A;  3ZTL A;  12GS A;  2LJR A;  1HYU A;  5F8B A;  4Z2U A;  5CRH A;  1ERT A;  2EIO A;  3C73 A;  1SL2 B;  3K8N A;  4TXO B;  3R2Q A;  4X0X A;  5ECQ B;  6GST A;  1OC9 B;  2TRX A;  1WPI A;  3ED3 A;  4N0V A;  2IFQ A;  2H0G A;  3WGE A;  3QOU A;  1K3L A;  2R2J A;  3E9J B;  3VFI A;  1XIY A;  4KH7 A;  1R5A A;  1A2L A;  1NHY A;  1WOU A;  1LJR A;  3GFK A;  4ZBD A;  2FWE A;  3P7X A;  3IOS A;  3PGT A;  2HE3 A;  2IFQ B;  4MPG A;  2GSS A;  2VIM A;  4MP4 A;  2V1M A;  2PVO C;  3CRT A;  3QAV A;  4F2I A;  4NV5 A;  5J9B A;  2HT9 A;  2H1A A;  1FOV A;  1QXH A;  1EGR A;  1A8L A;  1F6M C;  4IN0 A;  3Q18 A;  10GS A;  4JR6 A;  1XWB A;  5FT3 A;  4PQI A;  4Z7X A;  3A2V A;  4L5L A;  3BJ5 A;  1QGV A;  4HQZ A;  2WDU A;  4HZ4 A;  1OVN A;  2DJ1 A;  4AJ7 A;  1M9A A;  2DIY A;  3C71 A;  1ZYP A;  1TRW A;  3APQ A;  5HFG A;  2X49 A;  1TK0 B;  3Q6O A;  3IK9 A;  3QCP A;  3CSJ A;  4EDZ A;  4ZBA A;  1T7P B;  3C1S A;  4QL7 A;  4CY8 A;  2LS5 A;  2GLR A;  1SKW B;  2IN3 A;  5J3R A;  4GCI A;  1AW9 A;  3FZ4 A;  2OA7 A;  4IS0 A;  5ECS A;  5ID2 A;  3ZLP A;  5CRW A;  3DML A;  4MJE A;  4PQ1 A;  4YH2 A;  3MAK A;  2M72 A;  5AIV A;  5ECO B;  2FCH A;  3LWA A;  4OO5 A;  1K0D A;  5CO3 A;  3TRX A;  5DJL A;  1JFU A;  2YP6 A;  3FRC A;  1F9M A;  4I97 A;  5ID2 B;  1XW9 A;  2FWF A;  11GS A;  1AXD A;  5B6M A;  5EY6 A;  3GMF A;  2PPT A;  4V1A g;  1B8X A;  1XW6 A;  2OE1 A;  4ILF A;  2VLU A;  2CQ9 A;  2LEG A;  4GF0 A;  2ON7 A;  2ES7 A;  4ZL8 A;  2ON5 A;  2KLX A;  4POL A;  2J23 A;  4KAE A;  3KP8 A;  1QQ2 A;  1A8Y A;  4IQ1 A;  4JU5 A;  2H66 A;  1WWJ A;  2JZT A;  4RI7 A;  4L0W A;  4NPB A;  2PVQ A;  4ECB A;  1KEB A;  3HJP A;  5B8B A;  1GP1 A;  5G1L A;  4YKF A;  1UN2 A;  4G0L A;  3WYW A;  2BMX A;  2F8F A;  1ZOF A;  2KUC A;  1K0N A;  3A2X A;  4YQM A;  2MMO A;  3GSS A;  2OBK A;  1C72 A;  2XC2 A;  4KDY A;  2DJ0 A;  5A4W A;  3FZ5 A;  3TJG A;  2HYX A;  4WKW A;  4NXI A;  5IMF A;  2E2G A;  3RPP A;  3KTB A;  3GHA A;  1T4Z A;  1FOH A;  1MDJ A;  2R5G A;  1F37 A;  5DDL A;  3CMI A;  4HOJ A;  5IMV A;  2YN1 A;  1JZR A;  2DSA A;  3ZFL A;  2OE0 A;  4O5R A;  2NPB A;  3PIN A;  3CTG A;  1X9M B;  4I2U A;  2WGR A;  2E7P A;  2MYG A;  2AYT A;  2AB6 A;  6GSX A;  2JSY A;  1UA5 A;  2IWT A;  3GL3 A;  1GWC A;  2DBC A;  3HVV A;  4MA9 A;  4OFT A;  4WXT A;  3DKS A;  1X5D A;  4ZBB A;  2IMD A;  1DE1 A;  2L4Q A;  2V32 A;  4QL9 A;  1MDI A;  4IGJ A;  5CNW A;  3KCM A;  4G9H A;  1I9D A;  1X9S B;  1XCC A;  2CVD A;  4ACS A;  3BCK A;  4ZXG A;  2VCT A;  1QMV A;  4K1F A;  2NTO A;  1LBK A;  4GTU A;  2O7K A;  3TOT A;  1R4W A;  2VL3 A;  1USB A;  4MJC A;  1EP8 A;  3GKM A;  4O92 A;  1XPV A;  2XBQ A;  1NM3 A;  5H5R A;  2GDR A;  1RQM A;  1OE8 A;  4WF5 A;  3NIV A;  3GL5 A;  3PR8 A;  2CV4 A;  1Y25 A;  1M7T A;  3LGC A;  3TB2 A;  3UAR A;  1TOF A;  5JWR B;  4PUA A;  1YF0 A;  4BVX A;  4A5P A;  1I5G A;  5D9V A;  4G10 A;  2O87 A;  4V1A p;  2GQM A;  2JZR A;  1Q4J A;  1PN0 A;  2G2Q A;  2FA4 A;  3HA9 A;  1Q98 A;  1PQN A;  2GS3 A;  3QR6 A;  5IOW A;  2P5Q A;  4JE1 A;  4BVY B;  3HJM A;  3VI5 A;  1ON4 A;  4BVX B;  2LRN A;  3F6D A;  4KSM A;  4XHM A;  3DD3 A;  3EE2 A;  1TU7 A;  3DGQ A;  1X5E A;  2IMF A;  1LU4 A;  1FG4 A;  1GSU A;  2NDO A;  1Z7R A;  5D9X A;  5F07 A;  4V2L A;  5EL8 A;  3VK9 A;  4GSN A;  3GIX A;  2B1L A;  4LA1 A;  2LNT A;  2A2S A;  1U88 A;  4DSR A;  4LMV A;  2RII A;  1G7O A;  3FW2 A;  1ZCP A;  4ML6 A;  3G7Y A;  5KOX A;  1G7E A;  1B48 A;  1F2E A;  1UC7 A;  4RI6 A;  1SJ6 A;  2X8H A;  5D8I A;  5GSS A;  3ZZX A;  4OCE A;  3H4K A;  1QUW A;  4EVM A;  2MBT A;  1Z6N A;  2BTO T;  2IL3 A;  3I43 A;  5DAK B;  3TKP A;  1EZK A;  2YWN A;  3CSI A;  1A0R P;  2I1U A;  5FHI A;  2L5O A;  1Y6E A;  2MZC A;  3GTU A;  5FWG A;  2HFD A;  5LD0 A;  4MZB A;  2VCQ A;  5A4V A;  3GX0 A;  1WMJ A;  4FH8 A;  1DBY A;  1AQW A;  3HYP A;  2H19 A;  1XOA A;  1Z3E A;  2HSY A;  1GUM A;  5E59 A;  4F0B A;  2X4A A;  3GTU B;  3MIX A;  1XZO A;  4IQA A;  1U6T A;  1H4O A;  2VLT A;  3M9J A;  1JZO A;  1DE2 A;  3LSZ A;  3GKK A;  2H6Z A;  4XIH A;  4BPY A;  4PQH A;  2R0C A;  1GSQ A;  1SKR B;  5CYY A;  5IPH A;  5ABR A;  2H76 A;  4O32 A;  4E8E A;  3DYR A;  3BBY A;  2VL2 C;  5AN1 A;  3KD0 A;  4AF2 A;  3HHV A;  3TGZ A;  3P2A A;  3Q19 A;  5HR2 A;  1YKC A;  2H6X A;  5KEJ A;  4CHS A;  1A2J A;  1NHO A;  1XOB A;  1B4P A;  1PL2 A;  2LTK A;  2CAI A;  4FYB A;  3G7J A;  2ZCT A;  3D21 A;  3DWV A;  2VO4 A;  1K3Y A;  1ML6 A;  4EO3 A;  1XVQ A;  2GQL A;  1TP9 A;  5L71 A;  1UVZ A;  2H71 A;  3GA4 A;  4CY6 A;  1O85 A;  4MF7 A;  2GVP A;  2LUS A;  4X43 A;  2PGT A;  1OKT A;  4HI7 A;  20GS A;  5A5K A;  4KDU A;  1K0B A;  4OWY A;  1KBN A;  3IV4 A;  1SD8 A;  1F3A A;  1TU8 A;  3QD9 A;  1GUL A;  1W4V A;  2VD1 A;  1EOG A;  3UL3 A;  4Z2R A;  1O6J A;  4POK A;  3UBK A;  4ICY A;  4IP1 A;  1V98 A;  2HLS A;  1OE7 A;  4YKG A;  1GUH A;  3ZRD A;  4IJI A;  2IIY A;  1TW9 A;  3TDG A;  3VWV A;  4TVE A;  2R4V A;  2MBS A;  3S9F A;  2F9S A;  1Z5Y E;  3EMX A;  3TCO A;  5J5N A;  4EDY A;  4OD7 A;  1YEX A;  2N5B A;  4EL1 A;  5GAP D;  3FY7 A;  3GKN A;  4I5Q A;  3IE3 A;  1ZZY A;  4GWR A;  4HJM A;  2I81 A;  2DIZ A;  5KN3 A;  2B5X A;  3TKS C;  3TJJ A;  3LXT A;  5DJM A;  3L0H A;  1O8X A;  3PH9 A;  4J56 E;  2LQQ A;  1BAY A;  1IYH A;  3HVX A;  2VD0 A;  3GYK A;  4HZ2 A;  4L0U A;  1ZL9 A;  4POM A;  1YKA A;  2H70 A;  5IQY A;  2GZZ A;  4MZC A;  3LYK A;  3E0U A;  3F9U A;  2YV7 A;  4XS4 A;  4IKH A;  4NV2 A;  2IMI A;  5DCH A;  5A4U A;  3LEF A;  1GSS A;  3I6A A;  3HCZ A;  1AIU A;  2K8S A;  1VRS D;  4F0C A;  1MEK A;  4KGI A;  3KMN A;  4AJ6 A;  4EUY A;  3CRU A;  4TR3 A;  2CA8 A;  2V6O A;  2PUK C;  3ERF A;  4XS4 B;  3GNJ A;  3P90 A;  1SYR A;  1TK5 B;  4FIW A;  1PD2 1;  5GZZ B;  3WT2 A;  1BG5 A;  3IHG A;  8GSS A;  1V57 A;  2YOI A;  4G0I A;  1T3B A;  4PNG A;  3QAG A;  3GV1 A;  5H5Q A;  3UMA A;  1PRX A;  2DLX A;  4EE0 A;  3LYP A;  1GTI A;  4TW5 A;  3OR5 A;  2QC7 A;  1FVJ A;  3LG6 A;  1CQH A;  1MD3 A;  2AV4 A;  4J2F A;  2OE3 A;  1GNE A;  2F51 A;  4O5Q A;  5EPF A;  4XRA A;  4PX1 A;  4BA7 A;  3FK8 A;  2KP2 A;  2O85 A;  1AQX A;  3DIE A;  2H1D A;  3GX8 A;  4MLY A;  1ABA A;  1XBS A;  3GUS A;  1ILO A;  3PPU A;  5DBQ A;  2QA2 A;  1A2M A;  2C3N A;  4LL1 B;  3QPM A;  3LOR A;  1KNG A;  3EMP A;  1N2A A;  1VF1 A;  3O76 A;  2GT6 A;  4XS6 A;  4ZIL A;  1K0M A;  4XTS A;  4GXZ A;  1GL8 A;  5CRG A;  3D5J A;  2VAF A;  3UJ1 A;  1OYJ A;  5J4U A;  2MMA A;  4LMW A;  3R3E A;  3H1N A;  1HQO A;  2WCI A;  1XXU A;  3HD5 A;  3N9J A;  2YPM A;  2H1B A;  4JED A;  3AY8 A;  2BJX A;  2H0I A;  5ENU A;  4ID0 A;  3IAM 2;  3WT1 A;  5LCZ A;  5G5E A;  1O8W A;  2LJA A;  3TKR A;  1TK8 B;  1SL1 B;  3F6F A;  5AIS A;  1PKZ A;  3GKX A;  3UBL A;  2JAC A;  4PGT A;  1SJZ A;  3L78 A;  2R0P A;  2DML A;  4K5S A;  3DRN A;  1ZYE A;  4OFM A;  1YY7 A;  2DJK A;  5EVO A;  2O8V B;  4WBJ A;  4PNF A;  2X64 A;  2WJU A;  4K9Z A;  3GST A;  3G7I A;  17GS A;  3ERG A;  1X5C A;  4YQU A;  2LJK A;  5ECN B;  13GS A;  3US3 A;  3MSZ A;  1S3C A;  3U6V A;  2FA8 A;  4KX4 A;  4F82 A;  1F3B A;  2L59 A;  4K6X A;  4IHU A;  2AJQ B;  3HVS A;  6GSS A;  2HRA A;  2C8U A;  3LFL A;  4IBP A;  1NW2 A;  4GST A;  3D4M A;  1XW5 A;  1XWK A;  3EPT A;  4HU7 A;  5IO2 A;  2DKH A;  3IBH A;  1SKS B;  3DVW A;  5HR1 A;  4MF6 A;  4KUN A;  3VWU A;  1Z7P A;  4EXJ A;  4MJA A;  3LXZ A;  1GLP A;  2GZY A;  4DSS A;  2VM1 A;  4XS1 A;  4KCE A;  16GS A;  1SD9 A;  2GZP A;  4JRR A;  4OFN A;  3SBC A;  2J9H A;  3EIN A;  2C0E A;  2CX3 A;  1HD2 A;  1THX A;  2LKU A;  1YJ6 A;  4HU9 A;  4IP6 A;  4POB A;  3GUR A;  3E3E A;  1J08 A;  1PL1 A;  4GLT A;  3VPT A;  3JCM L;  2VLV A;  4ZB8 A;  2C3T A;  4MH3 A;  1SK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...