1T4YA

Solution structure of the n-terminal domain of synechococcus elongatus sasa (average minimized structure)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
105
structure length
105
Chain Sequence
GSSLSPQALAQPLLLQLFVDTRPLSQHIVQRVKNILAAVEATVPISLQVINVADQPQLVEYYRLVVTPALVKIGPGSRQVLSGIDLTDQLANQLPQWLVQQEGIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adaptive-response sensory-kinase sasA
publication title Structure of the N-terminal domain of the circadian clock-associated histidine kinase SasA.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Transferase
total genus 19
structure length 105
sequence length 105
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07689 KaiB KaiB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1t4yA01
2LRCA 3BOAA 2DBCA 4TKYA 1ERVA 3LYPA 3LQ7A 2C4JA 1ST9A 1U3IA 4KCAA 4MJAA 2TRXA 1G7EA 4OO5A 2YN1A 1AIUA 4V1Ag 1VF1A 3TRPA 3L9VA 3TCOA 2HLSA 2AYTA 5DCHA 2LJRA 1BQ7A 4IP6A 4QL9A 2LTKA 3J7Yk 4GWRA 3FZ9A 1U3AA 1T00A 5JCGA 2N5FA 1Z7RA 2JSYA 5DALB 2GDRA 2XPDA 3O6TA 1AQWA 5EPFA 3ZL5A 2IMDA 2JZSA 1EP7A 3W8SA 1XOBA 5G31A 3IRAA 2H01A 2VUPA 2AHEA 5JCUA 3KTBA 1GTAA 5ECOB 1TRSA 2MZCA 3NOFA 14GSA 4PURA 5CRHA 4YAVA 4IGJA 4BL7A 1BEDA 2Z9SA 3BBYA 3E9JB 5DCGA 1R7HA 5ECRB 4IW9A 3QPMA 1OC8A 3HD5A 5LCZA 2YZUA 1YY7A 2HT9A 5A5KA 1YF0A 3BD2A 3CMIA 3AY8A 1EWXA 3CXGA 3ISOA 2HFDA 2D2ZA 4KX4A 3IHQA 2R5GA 1TK5B 4XHMA 4GRFA 4HZ2A 3RAZA 4XRAA 3DD3A 4WBJA 2DJKA 4KSOA 1GTBA 1ZMAA 5LD0A 1GSYA 3GTUB 1GL8A 3TJFA 1ABAA 1X9MB 3KGKA 4EVMA 1M9BA 2FCHA 3E3EA 4I8BA 2MMAA 5ECNB 3L78A 3F6FA 4LL1B 2VL3A 3SWLA 2HZEA 4MMMA 1O7UA 3UVHA 3HJMA 2E2GA 3F4RA 5IQYA 2GQMA 1OKTA 3DYRA 1OC3A 2R4VA 2FUG2 2R2JA 2YWOA 4XCSA 2CX4A 2PWJA 4QQ7A 1OC9B 5GSTA 4FYUA 5B8AA 1TDIA 2NTOA 2F8AA 1SL2B 5ID2A 4WR4A 1PL1A 3O3TA 4GTUA 3A3TA 4ZL8A 1TI3A 1SK2A 3G9BA 3ZMKA 5D9VA 3GRXA 3VPQA 1UA5A 2PVQA 1NM3A 1XWCA 2DSAA 6GSUA 3L0HA 2YV9A 2AV4A 3CTGA 5DBQA 1EGRA 3IXRA 2JSZA 4X43A 2VCZA 3QD9A 5D9TA 3GKKA 1ZOFA 2FNOA 4MJEA 4I2UA 1KEBA 3I9V2 3FEUA 3D4TA 4TW5A 3IK9A 5HR3A 4KW6A 4I6XA 2N5BA 2OKAA 1ERTA 2E2MA 2GSSA 1KTEA 2KLXA 4EKZA 1VF3A 1J08A 1ERWA 4ZXGA 1F6MC 2VIMA 3DMLA 4GSSA 4K7IA 2X8CA 2EIRA 4BVXA 3C7MA 2M72A 2YWNA 2HE3A 4WF4A 2DJ2A 3E0UA 4EC0A 4NV2A 1TU7A 2H76A 1T4YA 2OJLA 4OCFA 2HYXA 1R26A 5HQPA 2LS5A 1SKSB 2O89A 1E6BA 4ML6A 1ACVA 1O85A 3IC4A 6GSXA 5F8BA 4OCEA 3VWVA 2C3TA 2GS3A 2H73A 1S3AA 6GSSA 1B4QA 3TOTA 3GV1A 2GSTA 1HNCA 1THOA 1F3AA 2OADA 4XTSA 1JLVA 4I5QA 2VLVA 4KDUA 1SL0B 4MPFA 3M9KA 2RM5A 5ENUA 4OFMA 1QFNA 4PQIA 3EYTA 4X1UA 5IMDA 3LJRA 1UVZA 4CHSA 2M46A 4ACSA 1SD8A 2OBKA 1FB6A 3F9UA 5AGYA 3ZTLA 1B48A 1H4OA 3MSZA 5G5EA 4D73B 3ZZXA 4WXTA 2LQQA 3VWWA 2K9FA 1F37A 3HZ4A 5COHA 2XC2A 2C8UA 4J2FA 1PD21 5G30A 3ZVJD 3H1NA 2WGRA 5IO0A 4KDYA 5ELGA 3WYWA 1MTCA 3KMNA 2HI7A 2GZZA 4HDEA 5G5FA 5GZZB 3TRQA 5CREA 3FR3A 3F63A 5ECMB 3EURA 3QAGA 4ISDA 4LLRA 4IQAA 1WE0A 9GSSA 2H74A 1U88A 2R3XA 4EO3A 5EL8A 1V57A 3GTUA 4EL1A 2LEGA 4RQRA 1HQOA 2V41A 5HFIA 2LSTA 2K8SA 5F06A 4HQZA 3ME7A 3EVIA 1XPVA 1V98A 4ZB9A 4L0WA 4HJMA 4DSSA 1OKDA 3UBKA 1NW2A 4PUFC 3KD0A 5HR2A 1FHEA 1RW1A 1M7TA 4V2NA 3KM6A 3QFAC 3C73A 5JCWA 4MABA 3TJGA 3A2XA 1UC7A 1XWKA 4JR6A 2H6ZA 3BCKA 3ERWA 5H5QA 1XWAA 2GSRA 4IBPA 3KZQA 4ZILA 1Q4JA 1SD9A 2E7PA 3WD6A 4OD7A 2ZNMA 2P5RA 3U6VA 5IMZA 6GSTA 2YOIA 1TRVA 1JLWA 5CAXA 5E4WA 4OO4A 1WPIA 5JWOB 2MBSA 3LXZA 4HEA2 3VWXA 3FR6A 3UARA 1TXXA 17GSA 1B8XA 4BWSA 3UVTA 4RI7A 2H0GA 3FYGA 2RUEA 3IDVA 4TXVA 2JU5A 2DMLA 2O87A 2ON5A 3GURA 5FT3A 2LUSA 3GHAA 3ZITA 6GSVA 3TKSC 1NHOA 5ECKB 2H70A 5CRGA 1AW9A 1SKRB 2GLRA 5G1KA 1M2DA 4MLYA 2X99A 2CQ9A 2X64A 4JEDA 2QKEA 1K0DA 1PX6A 4YAPA 2CZ2A 3IAM2 3FZ5A 3IPZA 2H0HA 2ES7A 1QXHA 3TJJA 2O8VB 4POLA 2IL3A 4MDCA 3P90A 5GSSA 1X9WB 3Q74A 5DAKB 3APOA 4POKA 4V2MA 3DWVA 1JZWA 4XS4A 3IAS2 18GSA 20GSA 4IHUA 4KB3A 1PKZA 4HJ2A 1XW6A 3V1WA 1OE7A 5ECQB 5IMAA 10GSA 1VGLA 3GSTA 4MP4A 3WGXA 3HXSA 2EIOA 3GL3A 2YNXA 4IN0A 3CTFA 3GX0A 2NVLA 5IM9A 1EEJA 5H5RA 3HY2A 2H72A 5F05A 1G7OA 1A2JA 1YZXA 1B9XC 2G0FA 2AUVA 3F8UA 3DXBA 1H75A 3RBTA 22GSA 1XW5A 4L0UA 3VLNA 1I5GA 4F0CA 2YWIA 2IN3A 3KH7A 2A4VA 3HCZA 1PRXA 2VM1A 4E8HA 2OE0A 2HRFA 2DJJA 2WDUA 2EC4A 2DJ0A 4TN8A 5HR1A 3M1GA 3DRNA 4NWYA 5EVOA 4H86A 4N30A 1E2YA 2C3NA 1XWBA 3M0FA 2CX3A 4TXOB 3QCPA 1Z9HA 2GQLA 3KCMA 3W6GA 4PX1A 4GQCA 2A2RA 1TJDA 3G7JA 3IV4A 3QR6A 2L4QA 3FW2A 4POBA 4OFNA 2IIYA 4YH2A 1GUHA 2B3SA 5G2ZA 5B8BA 3FRCA 1A2LA 1MDIA 1O81A 1SJZA 2NBSA 2FWEA 3HYPA 4TR0A 4ECIA 3LEFA 2B6MA 1O8WA 5J9CA 2CAIA 1F9MA 1R4WA 5IOXA 3FY7A 2I1UA 1EOGA 3ZREA 1Q98A 3QOUA 2HSHA 2L5OA 2IFQB 1SKWB 4TRXA 5IMFA 3EMXA 1CQHA 3D22A 3QAWA 3UEMA 3FK8A 3TKSE 1AUCA 4HU7A 4Q5QA 5ABRA 3S9FA 1NHYA 4KCEA 3ME8A 3UBLA 1TRWA 1XCCA 4CDOA 4MJCA 3VI7A 3GNJA 3VWUA 4O5RA 1G0TA 2V1MA 3EMPA 3IA1A 2IJYA 1V40A 2H6YA 4AGSA 4Z7XA 1BAYA 1KNGA 3FR9A 1PL2A 4L8EA 1XXUA 2WZ9A 4X0XA 3Q19A 4ULXA 1URMA 4TVEA 1WIKA 1GULA 5D9WA 3GKMA 1GLQA 1ZCPA 1JHBA 1M99A 2R37A 5H5SA 1CQGA 3EC3A 2L59A 2PVOC 2J23A 5ECPB 11GSA 3VI5A 3KMOA 3F4SA 2FA8A 5IMCA 1FOVA 7GSSA 4WEYA 2L4CA 2H1AA 5E59A 1UN2A 1K0AA 4P3YB 4EDZA 3RHCA 3TKPA 2C0FA 5ELAA 1K3YA 2XHFA 1NSWA 3UMAA 2OE1A 1T7PB 1A0RP 4K9ZA 3H79A 5AIVA 1XFLA 2AB6A 3QDNA 1JZOA 1ILOA 3A5WA 4ML1A 2KP1A 1YJ6A 1I9DA 3LYKA 1T8EB 3GN3A 2MMOA 5F0GA 2B7JA 3H4KA 2PERA 3LWAA 3EWLA 3GMFA 4G19A 1Z5YE 3MWHA 2VAFA 2GVPA 2YJHA 2ZUPA 2YPMA 3VK9A 1VF2A 4GQFA 5IMVA 3D4MA 2KP2A 3HJOA 3GIXA 2RIIA 4FYCA 4ZIJA 3HVSA 1G6YA 3G7YA 1Z3EA 4KE3A 2JZTA 1C72A 3LSZA 1DE1A 3F0IA 5D96A 5HR0A 3WT2A 1SU9A 2DLXA 4Q5NA 2PU9C 3F3RA 1B4PA 1TKDB 2FD3A 4FO5A 1A23A 1XIYA 3SBCA 1MD3A 1EP8A 3CBUA 1A8YA 2FA4A 3LXTA 2K6VA 1K3LA 4WF5A 1V2AA 3UL3A 1HYUA 5DALA 2DJ1A 2K8VA 4DSQA 3PR8A 5GAND 4ZB8A 1WP0A 3WT1A 2G2QA 1TRUA 2BJXA 2OE3A 4GCIA 5AIXA 4MK3A 4KA0A 3TKSA 2V6OA 4KSMA 3HA9A 1AQVA 3KTLA 3A2WA 2GQKA 3HVXA 4HQSA 4TR1B 4HU9A 4PNGA 2XBIA 1OAZA 3M3MA 2E0QA 3ZLPA 1GTUA 5IPHA 2AAWA 3EU3A 1GLPA 5B6MA 2H66A 1QUWA 1ML6A 2GT6A 1A2MA 2LJAA 3W8JA 4NHWA 3Q18A 2FY6A 2L6DA 3M8NA 2VCVA 3I69A 3HVVA 2XBQA 1ON4A 4K0NA 1GNWA 2I3YA 3TB2A 4L5OA 5HFGA 3IOSA 1BX9A 1K0MA 1MEKA 1WRYA 2YZHA 1DSBA 2B5YA 1B9YC 4EE0A 1T1VA 2HSYA 4KGIA 3IBHA 4G9HA 1S3CA 4MZWA 4HZ4A 1K3OA 2HZFA 2VM2A 4XS1A 5KEJA 4I97A 4MH3A 5DVBA 2KOKA 2CVDA 1Y25A 4ZB6A 3DIEA 4MPGA 2LV3A 1YQ1A 2TRCP 3H93A 3C1RA 1OC9A 2V2GA 5IO2A 5KN3A 4Q5FA 1EGOA 5J4UA 1KBNA 5DQSA 3BJ5A 1LJRA 4HOJA 2B5EA 4K2DA 4MA9A 1XWGA 4LA1A 1EV9A 1FVKA 2H75A 5CP1A 1O8XA 2MBTA 1BG5A 2P0GA 5JWQB 2VL9A 2F8FA 3TJKA 4E8EA 2PMTA 2DIZA 2WCIA 1VRSD 3HJPA 3L9UA 3PGTA 5D93A 2FGXA 2C1YA 3KP8A 2KHPA 1ZZYA 1WWJA 4WKWA 4ECCA 4ZBAA 6GSWA 2KUCA 3GUSA 1T4ZA 3Q6OA 2H8LA 4PQHA 3TUEA 2I81A 3RPPA 4N0ZA 1M2BA 1N2AA 3G7IA 1X9SB 1V58A 2C0GA 1GSSA 3ZYWA 1U87A 1AQXA 3L4NA 4MJBA 5ECHB 4EUYA 1BJXA 19GSA 3RDWA 2L57A 3ERFA 1AAZA 5ID2B 3HKRA 1FW1A 4K6XA 3LG6A 3MAKA 3APSA 3HDCA 1EZKA 3MDKA 1FAAA 4ZBDA 4G2EA 2YP6A 3I43A 3GX8A 1YF1A 4PNFA 2YCDA 2B1LA 4RQXA 2DMMA 1LU4A 2LQOA 3KP9A 4YQMA 4ILFA 3TKRA 5LNKe 1TK0B 1TOFA 1DBYA 4NV5A 2F9SA 3TJBA 4FYBA 4PQ1A 2GTUA 4KUNA 5D73A 1GTIA 2IMEA 4EXJA 1GSQA 3DVWA 13GSA 3RHBA 5KN0A 3KEBA 4QL7A 5CNWA 1TK8B 3ZMLA 2PPTA 2LJKA 4BPYA 5IIZA 3EE2A 5J3RA 4N10A 3A2VA 3N9JA 2QSIA 5GAPD 1IYHA 1JFUA 4AJ6A 1EOHA 1X0RA 3CRTA 1Z6NA 1ZYQB 4YQVA 3D0ZA 4D73A 2L6CA 4IP1A 1GNEA 2RM6A 3EINA 1K0OA 1GUMA 3DKSA 1SYXA 3IE3A 5B7CA 4DSRA 2PUKC 3TGZA 5DJLA 2FLSA 5A4UA 1XW9A 3GA4A 4EF0A 4GSNA 3FKFA 4K8MA 2NDOA 4WBRD 1X5CA 5F07A 1R5AA 4PUAA 1M9AA 1K0NA 1SL1B 1Z6MA 4IJ3A 3GFKA 4MZBA 4TR3A 1HNAA 4IJIA 1R5PA 2GGTA 2HNLA 2NPBA 3PINA 4NMUA 4TR4A 1RK4A 4NHZA 2MMNA 1QQ2A 5KN1A 2B5XA 4KNDA 5ECIB 4JE1A 1GRXA 2VL2A 2YWMA 5KN2A 3GYKA 1K0CA 3U5RE 3P7XA 1TU8A 4CW9A 2C3QA 1FG4A 5EY6A 1Y6EA 4PGTA 4ZBBA 1EEMA 3GL5A 1SENA 1OYJA 1O73A 4GF0A 1GSDA 5C04A 5FWGA 2IWTA 4N0VA 2YV7A 1JZRA 1SJIA 2H30A 4LMVA 1PSQA 2H0IA 5AN1A 2VD0A 4IVFA 3ZRDA 5AISA 2CT6A 1DUGA 2V32A 5B6NA 2TIRA 1LBKA 3D21A 4MH2A 4I2TA 4LL4B 2P31A 3CSIA 3LGCA 4ID0A 1WOUA 3RPNA 3P2AA 2C80A 1Z7PA 3WGDA 2LRTA 1BYEA 4BVYA 1QMVA 3C71A 2RLIA 1MDJA 2CAQA 3F3QA 4IKHA 2DC5A 4HI7A 1THXA 2F51A 3QAVA 5J9BA 2C0DA 4XS6A 1PA3A 1FO5A 2F3MA 4DSSB 1W89A 1X5DA 2OACA 4J57E 2ZCTA 2X8HA 1FB0A 3PH9A 2PGTA 4LMWA 12GSA 2O7KA 2ALBA 2BMXA 3UJ1A 3I6AA 3OR5A 4L5LA 4NPBA 3US3A 3LFLA 1ZGNA 4J56E 3F6DA 1SK1A 1PGTA 2JACA 5DAKA 1F3BA 1G6WA 2JADA 3FZ4A 3NIVA 5JWRB 2X8GA 5G1LA 2AJQB 2VCWA 3WGEA 5CO3A 2H1DA 4AF2A 2FWHA 2VO4A 2H19A 2L5LA 3QFBC 1AXDA 3IR4A 4JZQA 2C0EA 3CSHA 2VLTA 2HXKA 2LNTA 3NZNA 8GSSA 4F0BA 2A2SA 4OMVA 5A4WA 2QC7A 3F4TA 4HS1A 5CRWA 2VL2C 2V6KA 3ED3A 3VURA 3GH9A 1PN9A 1MD4A 2PBJA 2OA7A 3ZFBA 3GKXA 4MF6A 2JL4A 3J7Yb 4BWQA 4EDYA 5J5NA 3N5OA 2GZPA 2DIYA 4JU5A 4V1Ap 4TOPA 4JRRA 3ERGA 1PKWA 2P5QA 1GWCA 3K8NA 4XIHA 3UOMA 3R2QA 4MZCA 4TXOA 4XS4B 2BTOT 3JCML 1TP9A 4KH7A 1XVWA 2ON7A 3L9SA 4RUVA 4GSTA 2VLUA 2B1KA 5D9XA 2K18A 3TKQA 3ZIJA 4GLTA 1HNBA 1N8JA 5CYYA 3D6IA 2H71A 4N11A 2WJUA 5INYA 2H6XA 3ZIVA 1SYRA 2VCXA 3TOUA 2FWGA 5DJMA 4DEJA 1PX7A 2WB9A 1YKCA 3APQA 2R6KA 1OVNA 3FHKA 4K7NA 4O7HA 1PMTA 2IFQA 3HZ8A 2I9HA 1GP1A 5D8IA 1A24A 2CA8A 2CVKA 4F2IA 2OBIA 5J41A 1YKAA 1A0FA 3DGQA 4K0GA 2YANA 4O32A 1TTZA 1GSFA 4MCUA 3KIJA 4RI6A 4V2LA 3UIWA 2FHEA 3TRXA 1J9BA 1X5EA 1TI1A 3DVXA 2GZYA 2J9HA 1V9WA 2CVBA 1U6TA 3P8WA 2IMIA 3EU4A 1YDKA 4WETA 1W4VA 5IOWA 1JZDA 2DJ3A 3GSSA 1SK0A 2WS2A 2REMA 3ZVJA 3KXOA 4AJ7A 2VCQA 4KDXA 2B7KA 2M80A 4WR5A 4KAEA 1HD2A 3KH9A 4ECJA 5C00A 2CZ3A 4OWYA 1O6JA 4XRDA 1S3DA 16GSA 3HHVA 2QGVA 4ECBA 3C1SA 4HUAA 5L71A 2WFCA 2IPAA 4FH8A 5DDLA 4MF7A 4K7OA 2IMFA 2EIQA 1GSEA 4IELA 1WMJA 4FIWA 2FWFA 6GSYA 2XPEA 3VFIA 1T3BA 3D5JA 3CYNA 4F03A 2LRNA 1ERUA 1YEPA 1QK8A 3UAPA 3LORA 2HRNA 3KJYA 4IQ1A 3H8QA 1GUKA 2WRTA 3O76A 3M9JA 2VOCA 2GSQA 1M2AA 3MNGA 4Q5RA 1QGVA 1ZYEA 4MF5A 4F82A 1AC1A 2HZEB 5FHIA 4PXOA 1USBA 2VD1A 4ZL9A 4O92A 4NAXA 3GKNA 5ECLB 5DQYA 3C8EA 4JBBA 2MYGA 3TDGA 4YQUA 2IMKA 2WULA 2LNSA 1XZOA 3BCIA 4JR4A 1OE8A 3IK7A 1SJ6A 5ECSA 3FZAA 4DVCA 1M0UA 4BA7A 4K1FA 1XVQA 1ZL9A 1J0FA 5IPGA 2PN8A 3QMXA 2H1BA 1GSUA 2O85A 3CSJA 1K0BA 2I4AA 4IS0A 2CV4A 1PQNA 2RUFA 1GH2A 1XOAA 3CRUA 2VCTA 3GH6A 1IYIA 3ZFLA 4OFTA 5A4VA 2LKUA 2N5AA 4POMA 1VF4A 2YJ7A 1WJKA 1EV4A 4F9ZA 3VPTA 5HFKA 4NXIA 1YEXA 1DE2A 1XBSA 1TW9A 2JZRA 4AJ8A 2H1GA 2GT5A 1RQMA 1F2EA 5CRDA 4G10A 1MDKA 1A8LA 4TR1A 4GXZA 3DEXA 4ZL7A 2MMZA 1FVJA
chains in the Genus database with same CATH superfamily
4YKGA 2LRCA 3BOAA 2DBCA 4TKYA 1ERVA 3LYPA 3LQ7A 2C4JA 1ST9A 1U3IA 4KCAA 4MJAA 4BVXB 2TRXA 1G7EA 4OO5A 2YN1A 1AIUA 4V1Ag 1VF1A 3TRPA 3L9VA 3TCOA 2HLSA 2AYTA 5DCHA 2LJRA 1BQ7A 4IP6A 4QL9A 2LTKA 3J7Yk 4GWRA 3FZ9A 1U3AA 1T00A 5KOWA 5JCGA 2N5FA 1Z7RA 2JSYA 5DALB 2GDRA 2XPDA 3O6TA 1AQWA 5EPFA 3ZL5A 2IMDA 2JZSA 1EP7A 3W8SA 1XOBA 5G31A 3IRAA 2H01A 2VUPA 2AHEA 5JCUA 3R3EA 3KTBA 1GTAA 5ECOB 1TRSA 2MZCA 3NOFA 14GSA 4PURA 5CRHA 4YAVA 4IGJA 4BL7A 1BEDA 2Z9SA 3BBYA 3E9JB 5DCGA 1R7HA 5ECRB 4IW9A 3QPMA 1OC8A 3HD5A 5LCZA 2YZUA 1YY7A 2HT9A 5A5KA 1YF0A 3BD2A 3CMIA 3AY8A 4X4JA 1EWXA 3CXGA 3ISOA 2HFDA 2D2ZA 4KX4A 3IHQA 2R5GA 1TK5B 4XHMA 4GRFA 4HZ2A 5BMUA 3RAZA 4XRAA 3DD3A 4WBJA 2DJKA 4KSOA 1GTBA 1ZMAA 5LD0A 1GSYA 3GTUB 1GL8A 3TJFA 1ABAA 1X9MB 3KGKA 4EVMA 1M9BA 2FCHA 3E3EA 4I8BA 2MMAA 5ECNB 3L78A 3F6FA 4LL1B 2VL3A 3SWLA 2HZEA 4MMMA 1O7UA 3UVHA 3HJMA 2E2GA 3F4RA 5IQYA 2GQMA 1OKTA 3DYRA 1OC3A 2R4VA 2FUG2 2R2JA 2YWOA 4XCSA 2CX4A 2PWJA 4QQ7A 1OC9B 5GSTA 4FYUA 5B8AA 1TDIA 2NTOA 2F8AA 1SL2B 3MIXA 5ID2A 4WR4A 1ZYNA 1PL1A 3O3TA 4GTUA 3A3TA 4ZL8A 3MYDA 1TI3A 1SK2A 3G9BA 3ZMKA 5D9VA 3GRXA 3VPQA 1UA5A 2PVQA 1NM3A 1XWCA 2DSAA 6GSUA 3L0HA 2YV9A 2AV4A 3CTGA 5DBQA 1EGRA 3IXRA 2JSZA 4X43A 2VCZA 3QD9A 5D9TA 3GKKA 1ZOFA 2FNOA 4MJEA 4I2UA 1KEBA 3I9V2 4FQUA 3FEUA 3D4TA 4TW5A 3IK9A 5HR3A 4KW6A 4I6XA 2N5BA 2OKAA 1ERTA 2E2MA 2GSSA 1KTEA 2KLXA 4EKZA 1VF3A 1J08A 1ERWA 4ZXGA 1F6MC 2VIMA 3DMLA 4GSSA 4K7IA 2X8CA 2EIRA 4BVXA 3C7MA 2M72A 2YWNA 2HE3A 4WF4A 2DJ2A 3E0UA 4EC0A 4NV2A 1TU7A 2H76A 1T4YA 2OJLA 4OCFA 2HYXA 1R26A 5HQPA 2LS5A 1SKSB 2O89A 1E6BA 4BIKA 4ML6A 1ACVA 1O85A 3IC4A 6GSXA 5F8BA 4OCEA 3VWVA 2C3TA 2GS3A 2H73A 1S3AA 6GSSA 1B4QA 3TOTA 3GV1A 2GSTA 1HNCA 1THOA 1F3AA 2OADA 4XTSA 1JLVA 4I5QA 4O5QA 2VLVA 4KDUA 1SL0B 4MPFA 3M9KA 2RM5A 5ENUA 4OFMA 1QFNA 4PQIA 3EYTA 4X1UA 5IMDA 3LJRA 1UVZA 4CHSA 2M46A 4ACSA 4Z2TA 1SD8A 2OBKA 1FB6A 3F9UA 5AGYA 3ZTLA 1B48A 1H4OA 3MSZA 5G5EA 4D73B 3ZZXA 4WXTA 2LQQA 3VWWA 2K9FA 1F37A 3HZ4A 5COHA 2XC2A 2C8UA 4J2FA 1PD21 5G30A 3ZVJD 3H1NA 2WGRA 1FOHA 5IO0A 4KDYA 5ELGA 3WYWA 1MTCA 3KMNA 2HI7A 2GZZA 4HDEA 5G5FA 5GZZB 3TRQA 5CREA 3FR3A 3F63A 5ECMB 3EURA 3QAGA 4ISDA 4HSCX 4LLRA 4IQAA 1WE0A 9GSSA 2H74A 1U88A 2R3XA 4EO3A 5EL8A 1V57A 3GTUA 4EL1A 2LEGA 1PN0A 4RQRA 1HQOA 2V41A 5HFIA 2LSTA 2K8SA 5F06A 4HQZA 3ME7A 3EVIA 1XPVA 2A4HA 1V98A 4ZB9A 4L0WA 4HJMA 4DSSA 1OKDA 3UBKA 1NW2A 4PUFC 3KD0A 5HR2A 1FHEA 1RW1A 1M7TA 4V2NA 3KM6A 3QFAC 3C73A 5JCWA 4MABA 3TJGA 3A2XA 1UC7A 1XWKA 4JR6A 2H6ZA 3BCKA 3ERWA 5H5QA 1XWAA 2GSRA 4IBPA 3KZQA 4ZILA 4CY8A 1Q4JA 1SD9A 2E7PA 3WD6A 4OD7A 2ZNMA 2P5RA 3U6VA 5IMZA 6GSTA 2YOIA 1TRVA 1JLWA 5CAXA 5E4WA 4OO4A 1WPIA 5JWOB 2MBSA 3LXZA 4BVYB 4HEA2 3VWXA 3FR6A 3UARA 1TXXA 17GSA 1B8XA 4BWSA 3LW9A 3UVTA 4RI7A 2H0GA 3FYGA 1M3IA 2RUEA 3IDVA 4TXVA 2JU5A 2DMLA 2O87A 2ON5A 3GURA 5FT3A 2LUSA 3GHAA 3ZITA 6GSVA 3TKSC 1NHOA 5ECKB 2H70A 5CRGA 1AW9A 4K2XA 1SKRB 2GLRA 5G1KA 1M2DA 4MLYA 2X99A 2CQ9A 2X64A 4EIPA 4JEDA 4A5PA 2QKEA 1K0DA 1PX6A 4YAPA 2CZ2A 3IAM2 3FZ5A 3IPZA 2H0HA 2ES7A 1QXHA 3TJJA 2O8VB 4POLA 2IL3A 4MDCA 3P90A 5GSSA 4KF9A 1X9WB 3Q74A 5DAKB 3APOA 4POKA 4V2MA 3DWVA 1JZWA 4XS4A 3IAS2 2X49A 18GSA 20GSA 4IHUA 4KB3A 1PKZA 4HJ2A 1XW6A 3V1WA 1OE7A 5ECQB 5IMAA 10GSA 1VGLA 3GSTA 4MP4A 3WGXA 3HXSA 2EIOA 3GL3A 2YNXA 4IN0A 3CTFA 3GX0A 2NVLA 5IM9A 1EEJA 5H5RA 3HY2A 2H72A 5F05A 1G7OA 1A2JA 1YZXA 1B9XC 2G0FA 2AUVA 3A5IA 3F8UA 3DXBA 1H75A 3RBTA 22GSA 1XW5A 4L0UA 3VLNA 1I5GA 4F0CA 3PPUA 2YWIA 2IN3A 3KH7A 2A4VA 3HCZA 1PRXA 2VM1A 4E8HA 2OE0A 2HRFA 2DJJA 2WDUA 2EC4A 2DJ0A 4PTSA 4TN8A 5HR1A 3M1GA 3DRNA 4NWYA 5EVOA 4H86A 4N30A 1E2YA 2C3NA 4G0LA 1XWBA 4Z2UA 3M0FA 2CX3A 4TXOB 3QCPA 1Z9HA 2GQLA 3KCMA 3W6GA 4PX1A 4GQCA 2A2RA 1TJDA 3G7JA 3IV4A 3QR6A 2L4QA 3FW2A 4POBA 4OFNA 2IIYA 4K5SA 4YH2A 1GUHA 2B3SA 5G2ZA 5B8BA 3FRCA 1A2LA 1MDIA 1O81A 1SJZA 2NBSA 2FWEA 3HYPA 4TR0A 4ECIA 3LEFA 2B6MA 1O8WA 5J9CA 2CAIA 1F9MA 1R4WA 5IOXA 3FY7A 2I1UA 1EOGA 3ZREA 1Q98A 3QOUA 2HSHA 3IHGA 2L5OA 2IFQB 1SKWB 4TRXA 5IMFA 3EMXA 1CQHA 3D22A 3QAWA 3UEMA 3FK8A 3TKSE 4EIQA 1AUCA 4HU7A 4Q5QA 5ABRA 3S9FA 1NHYA 4KCEA 3ME8A 3UBLA 1TRWA 1XCCA 4CDOA 4MJCA 3VI7A 3GNJA 3VWUA 4O5RA 1G0TA 2V1MA 3EMPA 3IA1A 2IJYA 1V40A 2H6YA 4AGSA 4Z7XA 1BAYA 1KNGA 3FR9A 1PL2A 4L8EA 1XXUA 2WZ9A 4X0XA 3Q19A 4ULXA 1URMA 4TVEA 1WIKA 1GULA 5D9WA 3GKMA 5BRTA 1GLQA 1ZCPA 1JHBA 1M99A 2R37A 5H5SA 1CQGA 3EC3A 2L59A 2PVOC 2J23A 5ECPB 11GSA 3VI5A 3KMOA 3F4SA 2FA8A 5IMCA 1FOVA 7GSSA 4WEYA 2L4CA 2H1AA 5E59A 1UN2A 1K0AA 4P3YB 4EDZA 3RHCA 3TKPA 2C0FA 5ELAA 1K3YA 2XHFA 1NSWA 3UMAA 2OE1A 1T7PB 4MNNA 1A0RP 4K9ZA 3H79A 5AIVA 1XFLA 2AB6A 3QDNA 1JZOA 1ILOA 3A5WA 4ML1A 2KP1A 1YJ6A 1I9DA 3LYKA 1T8EB 3GN3A 2MMOA 5F0GA 2B7JA 3H4KA 2PERA 3LWAA 3EWLA 3GMFA 4G19A 1Z5YE 3MWHA 2VAFA 2GVPA 2YJHA 2ZUPA 2YPMA 2HRKA 3VK9A 1VF2A 4GQFA 5IMVA 3D4MA 2KP2A 3HJOA 3GIXA 2RIIA 4FYCA 3HVNA 4ZIJA 3HVSA 1G6YA 3G7YA 1Z3EA 4KE3A 2JZTA 1C72A 3LSZA 1DE1A 3F0IA 5D96A 5HR0A 3WT2A 1SU9A 2DLXA 4Q5NA 2PU9C 3F3RA 1B4PA 1TKDB 2FD3A 4FO5A 1A23A 1XIYA 3SBCA 1MD3A 1EP8A 3CBUA 1A8YA 2FA4A 3LXTA 2K6VA 1K3LA 4WF5A 1V2AA 3UL3A 1HYUA 5DALA 2DJ1A 2K8VA 4DSQA 3PR8A 5GAND 4ZB8A 1WP0A 3WT1A 2G2QA 1TRUA 2BJXA 2OE3A 4GCIA 5AIXA 4MK3A 4KA0A 3TKSA 2V6OA 4KSMA 3HA9A 1AQVA 3KTLA 3A2WA 2GQKA 3HVXA 4HQSA 4TR1B 4HU9A 4PNGA 2XBIA 1PFOA 1OAZA 3M3MA 2E0QA 3ZLPA 1GTUA 5IPHA 2AAWA 3EU3A 1GLPA 5B6MA 2H66A 1QUWA 1ML6A 2GT6A 1A2MA 2LJAA 3W8JA 4NHWA 3Q18A 2FY6A 2L6DA 3M8NA 2VCVA 3I69A 3HVVA 2XBQA 1ON4A 4K0NA 1GNWA 2I3YA 3TB2A 4L5OA 3IC8A 5HFGA 3IOSA 1BX9A 1K0MA 1MEKA 1WRYA 2YZHA 1DSBA 2B5YA 1B9YC 2DKIA 4EE0A 1T1VA 2HSYA 4KGIA 3IBHA 4G9HA 1S3CA 4MZWA 4HZ4A 1K3OA 2HZFA 2VM2A 4XS1A 5KEJA 4I97A 4MH3A 5DVBA 2KOKA 4YKFA 2CVDA 4BL7B 1Y25A 4ZB6A 3DIEA 4MPGA 1M3JA 2LV3A 1YQ1A 2TRCP 3H93A 3C1RA 1OC9A 2V2GA 5IO2A 5KN3A 4Q5FA 1EGOA 5J4UA 1KBNA 5DQSA 3BJ5A 1LJRA 4HOJA 2B5EA 4K2DA 4MA9A 1XWGA 4LA1A 1EV9A 1FVKA 2R0CA 2H75A 2QA2A 5CP1A 1O8XA 2MBTA 1BG5A 2P0GA 4K5RA 5JWQB 2VL9A 2F8FA 3TJKA 4E8EA 2PMTA 2DIZA 2WCIA 1VRSD 3HJPA 3L9UA 3PGTA 5D93A 2FGXA 2C1YA 3KP8A 4Z2RA 2KHPA 1ZZYA 1WWJA 4WKWA 4ECCA 4ZBAA 6GSWA 2KUCA 3GUSA 1T4ZA 3Q6OA 2H8LA 4PQHA 3TUEA 2I81A 3RPPA 4G0KA 4N0ZA 1M2BA 1N2AA 3G7IA 1X9SB 1V58A 2C0GA 1GSSA 3ZYWA 4ICYA 1U87A 1AQXA 3L4NA 4MJBA 5ECHB 4EUYA 1BJXA 19GSA 3RDWA 2QA1A 2L57A 3ERFA 1AAZA 5ID2B 3HKRA 1FW1A 4K6XA 3LG6A 3MAKA 3APSA 3HDCA 1EZKA 3MDKA 1FAAA 4ZBDA 4G2EA 2YP6A 3I43A 3GX8A 1YF1A 4PNFA 2YCDA 2B1LA 4RQXA 2DMMA 1LU4A 2LQOA 3KP9A 4YQMA 4ILFA 3TKRA 5LNKe 1TK0B 1TOFA 1DBYA 4NV5A 2F9SA 3TJBA 4FYBA 4PQ1A 2GTUA 4KUNA 1GTIA 5D73A 2IMEA 4EXJA 1GSQA 3DVWA 13GSA 3RHBA 5KN0A 3KEBA 4QL7A 5CNWA 1TK8B 3ZMLA 2PPTA 2LJKA 4BPYA 5IIZA 3EE2A 5J3RA 4N10A 3A2VA 3N9JA 2QSIA 5GAPD 1IYHA 1JFUA 4AJ6A 1EOHA 1X0RA 3CRTA 1Z6NA 1ZYQB 4YQVA 3D0ZA 4D73A 2L6CA 4IP1A 1GNEA 2RM6A 3EINA 1K0OA 1GUMA 3DKSA 1SYXA 3IE3A 5B7CA 4DSRA 2PUKC 3TGZA 5DJLA 2FLSA 5A4UA 1XW9A 3GA4A 4EF0A 4GSNA 3FKFA 4K8MA 2NDOA 4WBRD 1X5CA 5F07A 1R5AA 4PUAA 1M9AA 1K0NA 1SL1B 1Z6MA 4IJ3A 3GFKA 4MZBA 4TR3A 1HNAA 4IJIA 1R5PA 2GGTA 2HNLA 2NPBA 3PINA 4NMUA 4TR4A 1RK4A 4NHZA 2MMNA 1QQ2A 5KN1A 2B5XA 4KNDA 5ECIB 4JE1A 1GRXA 2VL2A 2YWMA 5KN2A 3GYKA 1K0CA 3U5RE 3P7XA 1TU8A 4CW9A 2C3QA 1FG4A 5EY6A 1Y6EA 4PGTA 4ZBBA 1EEMA 3GL5A 1SENA 1OYJA 1O73A 4GF0A 1GSDA 5C04A 5FWGA 2IWTA 4N0VA 2YV7A 1JZRA 2A2PA 1SJIA 2H30A 4LMVA 4CY6A 1PSQA 2H0IA 5AN1A 2VD0A 4IVFA 3ZRDA 5AISA 2CT6A 1DUGA 2V32A 5B6NA 2TIRA 1LBKA 3D21A 2HRAA 4MH2A 4I2TA 4LL4B 2P31A 3CSIA 3LGCA 4ID0A 1WOUA 3RPNA 3P2AA 2C80A 1Z7PA 3WGDA 2LRTA 1BYEA 4BVYA 1QMVA 3C71A 2RLIA 1MDJA 2CAQA 3F3QA 4USSA 4IKHA 2DC5A 4HI7A 1THXA 2F51A 3QAVA 5J9BA 2C0DA 4XS6A 1PA3A 1FO5A 2F3MA 4DSSB 1W89A 1X5DA 2OACA 4J57E 2ZCTA 2X8HA 1FB0A 3PH9A 2PGTA 4LMWA 12GSA 2O7KA 2ALBA 2BMXA 3UJ1A 3I6AA 3OR5A 4L5LA 5KOXA 4NPBA 3US3A 3LFLA 1ZGNA 4J56E 3F6DA 1SK1A 1PGTA 2JACA 5DAKA 1F3BA 1G6WA 2JADA 3FZ4A 3NIVA 5JWRB 2X8GA 5G1LA 2AJQB 2VCWA 2R0GA 3WGEA 5CO3A 2H1DA 4AF2A 2FWHA 2VO4A 2H19A 2L5LA 3QFBC 1AXDA 3IR4A 4JZQA 2C0EA 3CSHA 2VLTA 2HXKA 2LNTA 3NZNA 8GSSA 4F0BA 2A2SA 4OMVA 5A4WA 2QC7A 3F4TA 4HS1A 5CRWA 2VL2C 2V6KA 3ED3A 3VURA 3GH9A 1PN9A 1MD4A 2PBJA 2OA7A 3ZFBA 3GKXA 4MF6A 2JL4A 3J7Yb 4BWQA 4EDYA 5J5NA 3N5OA 2GZPA 2DIYA 4JU5A 4V1Ap 4TOPA 4JRRA 3ERGA 1PKWA 2P5QA 1GWCA 3K8NA 4XIHA 3UOMA 3R2QA 4MZCA 4TXOA 4XS4B 2BTOT 3JCML 1TP9A 4KH7A 1XVWA 2ON7A 1S3RA 3L9SA 4RUVA 4GSTA 2VLUA 2B1KA 5D9XA 2K18A 3TKQA 3ZIJA 4GLTA 1HNBA 1N8JA 5CYYA 2R0PA 3D6IA 2H71A 4N11A 2WJUA 5INYA 2H6XA 3ZIVA 1SYRA 2VCXA 3CQFA 3TOUA 2FWGA 5DJMA 4DEJA 1PX7A 2WB9A 1YKCA 2X4AA 3APQA 2R6KA 1OVNA 3FHKA 4G0IA 4K7NA 4O7HA 1PMTA 2IFQA 3HZ8A 2I9HA 1GP1A 5D8IA 1A24A 2CA8A 2CVKA 4F2IA 2OBIA 5J41A 1YKAA 1A0FA 3DGQA 4K0GA 2YANA 4O32A 1TTZA 1GSFA 4MCUA 3KIJA 4RI6A 4V2LA 3UIWA 2FHEA 3TRXA 1J9BA 1X5EA 1TI1A 3DVXA 2GZYA 2J9HA 1V9WA 2HSMA 2CVBA 1U6TA 3P8WA 2IMIA 3EU4A 1YDKA 4WETA 1W4VA 5IOWA 1JZDA 2DJ3A 3GSSA 1SK0A 2WS2A 2REMA 3ZVJA 3KXOA 4AJ7A 2VCQA 4KDXA 2B7KA 2M80A 4WR5A 4KAEA 1HD2A 3KH9A 4ECJA 5C00A 2CZ3A 2UZ8A 4OWYA 1O6JA 4XRDA 1S3DA 16GSA 3HHVA 2QGVA 4ECBA 3C1SA 4HUAA 5L71A 2WFCA 2IPAA 4FH8A 5DDLA 4MF7A 4K7OA 2IMFA 4O5UA 2EIQA 1GSEA 4IELA 1WMJA 4FIWA 2FWFA 6GSYA 2XPEA 3VFIA 1T3BA 3D5JA 3CYNA 4F03A 1ZYPA 2LRNA 1ERUA 1YEPA 1QK8A 3UAPA 3LORA 2HRNA 3KJYA 4IQ1A 3H8QA 1GUKA 3EPTA 2WRTA 3O76A 3M9JA 2VOCA 2GSQA 1M2AA 3MNGA 4Q5RA 1QGVA 1ZYEA 4MF5A 4F82A 1AC1A 2HZEB 5FHIA 4PXOA 1USBA 2VD1A 4ZL9A 4O92A 4NAXA 3GKNA 5ECLB 5DQYA 2DKHA 3C8EA 4JBBA 2MYGA 3TDGA 4YQUA 2IMKA 2WULA 2LNSA 1XZOA 3BCIA 4JR4A 1OE8A 3IK7A 1SJ6A 5ECSA 3FZAA 4DVCA 1M0UA 4BA7A 4K1FA 1XVQA 1XG8A 1ZL9A 1J0FA 5IPGA 2PN8A 3QMXA 2H1BA 1GSUA 2O85A 3CSJA 1K0BA 2I4AA 4IS0A 2CV4A 1PQNA 2RUFA 1GH2A 1XOAA 3CRUA 2VCTA 3GH6A 1IYIA 3ZFLA 4OFTA 5A4VA 2LKUA 2N5AA 4POMA 1VF4A 2YJ7A 1WJKA 1EV4A 4F9ZA 3VPTA 5HFKA 4NXIA 1YEXA 1DE2A 1XBSA 1TW9A 2JZRA 4AJ8A 2H1GA 2GT5A 1RQMA 3FMWA 1F2EA 5CRDA 4G10A 1MDKA 1A8LA 4TR1A 4GXZA 3DEXA 4ZL7A 2MMZA 1FVJA
chains in the Genus database with same CATH topology
4YKGA 2LRCA 3BOAA 2DBCA 4TKYA 1ERVA 3LYPA 3LQ7A 2C4JA 1ST9A 1U3IA 4KCAA 4MJAA 4BVXB 2TRXA 1G7EA 4OO5A 2YN1A 1AIUA 4V1Ag 1VF1A 3TRPA 3L9VA 3TCOA 2HLSA 2AYTA 5DCHA 2LJRA 1BQ7A 4IP6A 4QL9A 2LTKA 3J7Yk 4GWRA 3FZ9A 1U3AA 1T00A 5KOWA 5JCGA 2N5FA 1Z7RA 2JSYA 5DALB 2GDRA 2XPDA 3O6TA 1AQWA 5EPFA 3ZL5A 2IMDA 2JZSA 1EP7A 3W8SA 1XOBA 5G31A 3IRAA 2H01A 2VUPA 2AHEA 5JCUA 3R3EA 3KTBA 1GTAA 5ECOB 1TRSA 2MZCA 3NOFA 14GSA 4PURA 5CRHA 4YAVA 4IGJA 4BL7A 1BEDA 2Z9SA 3BBYA 3E9JB 5DCGA 1R7HA 5ECRB 4IW9A 3QPMA 1OC8A 3HD5A 5LCZA 2YZUA 1YY7A 2HT9A 5A5KA 1YF0A 3BD2A 3CMIA 3AY8A 4X4JA 1EWXA 3CXGA 3ISOA 2HFDA 2D2ZA 4KX4A 3IHQA 2R5GA 1TK5B 4XHMA 4GRFA 4HZ2A 5BMUA 3RAZA 4XRAA 3DD3A 4WBJA 2DJKA 4KSOA 1GTBA 1ZMAA 5LD0A 1GSYA 3GTUB 1GL8A 3TJFA 1ABAA 1X9MB 3KGKA 4EVMA 1M9BA 2FCHA 3E3EA 4I8BA 2MMAA 5ECNB 3L78A 3F6FA 4LL1B 2VL3A 3SWLA 2HZEA 4MMMA 1O7UA 3UVHA 3HJMA 2E2GA 3F4RA 5IQYA 2GQMA 1OKTA 3DYRA 1OC3A 2R4VA 2FUG2 2R2JA 2YWOA 4XCSA 2CX4A 2PWJA 4QQ7A 1OC9B 5GSTA 4FYUA 5B8AA 1TDIA 2NTOA 2F8AA 1SL2B 3MIXA 5ID2A 4WR4A 1ZYNA 1PL1A 3O3TA 4GTUA 3A3TA 4ZL8A 3MYDA 1TI3A 1SK2A 3G9BA 3ZMKA 5D9VA 3GRXA 3VPQA 1UA5A 2PVQA 1NM3A 1XWCA 2DSAA 6GSUA 3L0HA 2YV9A 2AV4A 3CTGA 5DBQA 1EGRA 3IXRA 2JSZA 4X43A 2VCZA 3QD9A 5D9TA 3GKKA 1ZOFA 2FNOA 4MJEA 4I2UA 1KEBA 3I9V2 4FQUA 3FEUA 3D4TA 4TW5A 3IK9A 5HR3A 4KW6A 4I6XA 2N5BA 2OKAA 1ERTA 2E2MA 2GSSA 1KTEA 2KLXA 4EKZA 1VF3A 1J08A 1ERWA 4ZXGA 1F6MC 2VIMA 3DMLA 4GSSA 4K7IA 2X8CA 2EIRA 4BVXA 3C7MA 2M72A 2YWNA 2HE3A 4WF4A 2DJ2A 3E0UA 4EC0A 4NV2A 1TU7A 2H76A 1T4YA 2OJLA 4OCFA 2HYXA 1R26A 5HQPA 2LS5A 1SKSB 2O89A 1E6BA 4ML6A 1ACVA 1O85A 3IC4A 6GSXA 5F8BA 4OCEA 3VWVA 2C3TA 2GS3A 2H73A 1S3AA 6GSSA 1B4QA 3TOTA 3GV1A 2GSTA 1HNCA 1THOA 1F3AA 2OADA 4XTSA 1JLVA 4I5QA 4O5QA 2VLVA 4KDUA 1SL0B 4MPFA 3M9KA 2RM5A 5ENUA 4OFMA 1QFNA 4PQIA 3EYTA 4X1UA 5IMDA 3LJRA 1UVZA 4CHSA 2M46A 4ACSA 4Z2TA 1SD8A 2OBKA 1FB6A 3F9UA 5AGYA 3ZTLA 1B48A 1H4OA 3MSZA 5G5EA 4D73B 3ZZXA 4WXTA 2LQQA 3VWWA 2K9FA 1F37A 3HZ4A 5COHA 2XC2A 2C8UA 4J2FA 1PD21 5G30A 3ZVJD 3H1NA 2WGRA 1FOHA 5IO0A 4KDYA 5ELGA 3WYWA 1MTCA 3KMNA 2HI7A 2GZZA 4HDEA 5G5FA 5GZZB 3TRQA 5CREA 3FR3A 3F63A 5ECMB 3EURA 3QAGA 4ISDA 4LLRA 4IQAA 1WE0A 9GSSA 2H74A 1U88A 2R3XA 4EO3A 5EL8A 1V57A 3GTUA 4EL1A 2LEGA 1PN0A 4RQRA 1HQOA 2V41A 5HFIA 2LSTA 2K8SA 5F06A 4HQZA 3ME7A 3EVIA 1XPVA 2A4HA 1V98A 4ZB9A 4L0WA 4HJMA 4DSSA 1OKDA 3UBKA 1NW2A 4PUFC 3KD0A 5HR2A 1FHEA 1RW1A 1M7TA 4V2NA 3KM6A 3QFAC 3C73A 5JCWA 4MABA 3TJGA 3A2XA 1UC7A 1XWKA 4JR6A 2H6ZA 3BCKA 3ERWA 5H5QA 1XWAA 2GSRA 4IBPA 3KZQA 4ZILA 4CY8A 1Q4JA 1SD9A 2E7PA 3WD6A 4OD7A 2ZNMA 2P5RA 3U6VA 5IMZA 6GSTA 2YOIA 1TRVA 1JLWA 5CAXA 5E4WA 4OO4A 1WPIA 5JWOB 2MBSA 3LXZA 4BVYB 4HEA2 3VWXA 3FR6A 3UARA 1TXXA 17GSA 1B8XA 4BWSA 3LW9A 3UVTA 4RI7A 2H0GA 3FYGA 2RUEA 3IDVA 4TXVA 2JU5A 2DMLA 2O87A 2ON5A 3GURA 5FT3A 2LUSA 3GHAA 3ZITA 6GSVA 3TKSC 1NHOA 5ECKB 2H70A 5CRGA 1AW9A 4K2XA 1SKRB 2GLRA 5G1KA 1M2DA 4MLYA 2X99A 2CQ9A 2X64A 4EIPA 4JEDA 4A5PA 2QKEA 1K0DA 1PX6A 4YAPA 2CZ2A 3IAM2 3FZ5A 3IPZA 2H0HA 2ES7A 1QXHA 3TJJA 2O8VB 4POLA 2IL3A 4MDCA 3P90A 5GSSA 4KF9A 1X9WB 3Q74A 5DAKB 3APOA 4POKA 4V2MA 3DWVA 1JZWA 4XS4A 3IAS2 2X49A 18GSA 20GSA 4IHUA 4KB3A 1PKZA 4HJ2A 1XW6A 3V1WA 1OE7A 5ECQB 5IMAA 10GSA 1VGLA 3GSTA 4MP4A 3WGXA 3HXSA 2EIOA 3GL3A 2YNXA 4IN0A 3CTFA 3GX0A 2NVLA 5IM9A 1EEJA 5H5RA 3HY2A 2H72A 5F05A 1G7OA 1A2JA 1YZXA 1B9XC 2G0FA 2AUVA 3A5IA 3F8UA 3DXBA 1H75A 3RBTA 22GSA 1XW5A 4L0UA 3VLNA 1I5GA 4F0CA 3PPUA 2YWIA 2IN3A 3KH7A 2A4VA 3HCZA 1PRXA 2VM1A 4E8HA 2OE0A 2HRFA 2DJJA 2WDUA 2EC4A 2DJ0A 4PTSA 4TN8A 5HR1A 3M1GA 3DRNA 4NWYA 5EVOA 4H86A 4N30A 1E2YA 2C3NA 4G0LA 1XWBA 4Z2UA 3M0FA 2CX3A 4TXOB 3QCPA 1Z9HA 2GQLA 3KCMA 3W6GA 4PX1A 4GQCA 2A2RA 1TJDA 3G7JA 3IV4A 3QR6A 2L4QA 3FW2A 4POBA 4OFNA 2IIYA 4K5SA 4YH2A 1GUHA 2B3SA 5G2ZA 5B8BA 3FRCA 1A2LA 1MDIA 1O81A 1SJZA 2NBSA 2FWEA 3HYPA 4TR0A 4ECIA 3LEFA 2B6MA 1O8WA 5J9CA 2CAIA 1F9MA 1R4WA 5IOXA 3FY7A 2I1UA 1EOGA 3ZREA 1Q98A 3QOUA 2HSHA 3IHGA 2L5OA 2IFQB 1SKWB 4TRXA 5IMFA 3EMXA 1CQHA 3D22A 3QAWA 3UEMA 3FK8A 3TKSE 4EIQA 1AUCA 4HU7A 4Q5QA 5ABRA 3S9FA 1NHYA 4KCEA 3ME8A 3UBLA 1TRWA 1XCCA 4CDOA 4MJCA 3VI7A 3GNJA 3VWUA 4O5RA 1G0TA 2V1MA 3EMPA 3IA1A 2IJYA 1V40A 2H6YA 4AGSA 4Z7XA 1BAYA 1KNGA 3FR9A 1PL2A 4L8EA 1XXUA 2WZ9A 4X0XA 3Q19A 4ULXA 1URMA 4TVEA 1WIKA 1GULA 5D9WA 3GKMA 5BRTA 1GLQA 1ZCPA 1JHBA 1M99A 2R37A 5H5SA 1CQGA 3EC3A 2L59A 2PVOC 2J23A 5ECPB 11GSA 3VI5A 3KMOA 3F4SA 2FA8A 5IMCA 1FOVA 7GSSA 4WEYA 2L4CA 2H1AA 5E59A 1UN2A 1K0AA 4P3YB 4EDZA 3RHCA 3TKPA 2C0FA 5ELAA 1K3YA 2XHFA 1NSWA 3UMAA 2OE1A 1T7PB 4MNNA 1A0RP 4K9ZA 3H79A 5AIVA 1XFLA 2AB6A 3QDNA 1JZOA 1ILOA 3A5WA 4ML1A 2KP1A 1YJ6A 1I9DA 3LYKA 1T8EB 3GN3A 2MMOA 5F0GA 2B7JA 3H4KA 2PERA 3LWAA 3EWLA 3GMFA 4G19A 1Z5YE 3MWHA 2VAFA 2GVPA 2YJHA 2ZUPA 2YPMA 2HRKA 3VK9A 1VF2A 4GQFA 5IMVA 3D4MA 2KP2A 3HJOA 3GIXA 2RIIA 4FYCA 4ZIJA 3HVSA 1G6YA 3G7YA 1Z3EA 4KE3A 2JZTA 1C72A 3LSZA 1DE1A 3F0IA 5D96A 5HR0A 3WT2A 1SU9A 2DLXA 4Q5NA 2PU9C 3F3RA 1B4PA 1TKDB 2FD3A 4FO5A 1A23A 1XIYA 3SBCA 1MD3A 1EP8A 3CBUA 1A8YA 2FA4A 3LXTA 2K6VA 1K3LA 4WF5A 1V2AA 3UL3A 1HYUA 5DALA 2DJ1A 2K8VA 4DSQA 3PR8A 5GAND 4ZB8A 1WP0A 3WT1A 2G2QA 1TRUA 2BJXA 2OE3A 4GCIA 5AIXA 4MK3A 4KA0A 3TKSA 2V6OA 4KSMA 3HA9A 1AQVA 3KTLA 3A2WA 2GQKA 3HVXA 4HQSA 4TR1B 4HU9A 4PNGA 2XBIA 1OAZA 3M3MA 2E0QA 3ZLPA 1GTUA 5IPHA 2AAWA 3EU3A 1GLPA 5B6MA 2H66A 1QUWA 1ML6A 2GT6A 1A2MA 2LJAA 3W8JA 4NHWA 3Q18A 2FY6A 2L6DA 3M8NA 2VCVA 3I69A 3HVVA 2XBQA 1ON4A 4K0NA 1GNWA 2I3YA 3TB2A 4L5OA 3IC8A 5HFGA 3IOSA 1BX9A 1K0MA 1MEKA 1WRYA 2YZHA 1DSBA 2B5YA 1B9YC 2DKIA 4EE0A 1T1VA 2HSYA 4KGIA 3IBHA 4G9HA 1S3CA 4MZWA 4HZ4A 1K3OA 2HZFA 2VM2A 4XS1A 5KEJA 4I97A 4MH3A 5DVBA 2KOKA 4YKFA 2CVDA 4BL7B 1Y25A 4ZB6A 3DIEA 4MPGA 2LV3A 1YQ1A 2TRCP 3H93A 3C1RA 1OC9A 2V2GA 5IO2A 5KN3A 4Q5FA 1EGOA 5J4UA 1KBNA 5DQSA 3BJ5A 1LJRA 4HOJA 2B5EA 4K2DA 4MA9A 1XWGA 4LA1A 1EV9A 1FVKA 2R0CA 2H75A 2QA2A 5CP1A 1O8XA 2MBTA 1BG5A 2P0GA 4K5RA 5JWQB 2VL9A 2F8FA 3TJKA 4E8EA 2PMTA 2DIZA 2WCIA 1VRSD 3HJPA 3L9UA 3PGTA 5D93A 2FGXA 2C1YA 3KP8A 4Z2RA 2KHPA 1ZZYA 1WWJA 4WKWA 4ECCA 4ZBAA 6GSWA 2KUCA 3GUSA 1T4ZA 3Q6OA 2H8LA 4PQHA 3TUEA 2I81A 3RPPA 4G0KA 4N0ZA 1M2BA 1N2AA 3G7IA 1X9SB 1V58A 2C0GA 1GSSA 3ZYWA 4ICYA 1U87A 1AQXA 3L4NA 4MJBA 5ECHB 4EUYA 1BJXA 19GSA 3RDWA 2QA1A 2L57A 3ERFA 1AAZA 5ID2B 3HKRA 1FW1A 4K6XA 3LG6A 3MAKA 3APSA 3HDCA 1EZKA 3MDKA 1FAAA 4ZBDA 4G2EA 2YP6A 3I43A 3GX8A 1YF1A 4PNFA 2YCDA 2B1LA 4RQXA 2DMMA 1LU4A 2LQOA 3KP9A 4YQMA 4ILFA 3TKRA 5LNKe 1TK0B 1TOFA 1DBYA 4NV5A 2F9SA 3TJBA 4FYBA 4PQ1A 2GTUA 4KUNA 5D73A 1GTIA 2IMEA 4EXJA 1GSQA 3DVWA 13GSA 3RHBA 5KN0A 3KEBA 4QL7A 5CNWA 1TK8B 3ZMLA 2PPTA 2LJKA 4BPYA 5IIZA 3EE2A 5J3RA 4N10A 3A2VA 3N9JA 2QSIA 5GAPD 1IYHA 1JFUA 4AJ6A 1EOHA 1X0RA 3CRTA 1Z6NA 1ZYQB 4YQVA 3D0ZA 4D73A 2L6CA 4IP1A 1GNEA 2RM6A 3EINA 1K0OA 1GUMA 3DKSA 1SYXA 3IE3A 5B7CA 4DSRA 2PUKC 3TGZA 5DJLA 2FLSA 5A4UA 1XW9A 3GA4A 4EF0A 4GSNA 3FKFA 4K8MA 2NDOA 4WBRD 1X5CA 5F07A 1R5AA 4PUAA 1M9AA 1K0NA 1SL1B 1Z6MA 4IJ3A 3GFKA 4MZBA 4TR3A 1HNAA 4IJIA 1R5PA 2GGTA 2HNLA 2NPBA 3PINA 4NMUA 4TR4A 1RK4A 4NHZA 2MMNA 1QQ2A 5KN1A 2B5XA 4KNDA 5ECIB 4JE1A 1GRXA 2VL2A 2YWMA 5KN2A 3GYKA 1K0CA 3U5RE 3P7XA 1TU8A 4CW9A 2C3QA 1FG4A 5EY6A 1Y6EA 4PGTA 4ZBBA 1EEMA 3GL5A 1SENA 1OYJA 1O73A 4GF0A 1GSDA 5C04A 5FWGA 2IWTA 4N0VA 2YV7A 1JZRA 2A2PA 1SJIA 2H30A 4LMVA 4CY6A 1PSQA 2H0IA 5AN1A 2VD0A 4IVFA 3ZRDA 5AISA 2CT6A 1DUGA 2V32A 5B6NA 2TIRA 1LBKA 3D21A 2HRAA 4MH2A 4I2TA 4LL4B 2P31A 3CSIA 3LGCA 4ID0A 1WOUA 3RPNA 3P2AA 2C80A 1Z7PA 3WGDA 2LRTA 1BYEA 4BVYA 1QMVA 3C71A 2RLIA 1MDJA 2CAQA 3F3QA 4USSA 4IKHA 2DC5A 4HI7A 1THXA 2F51A 3QAVA 5J9BA 2C0DA 4XS6A 1PA3A 1FO5A 2F3MA 4DSSB 1W89A 1X5DA 2OACA 4J57E 2ZCTA 2X8HA 1FB0A 3PH9A 2PGTA 4LMWA 12GSA 2O7KA 2ALBA 2BMXA 3UJ1A 3I6AA 3OR5A 4L5LA 5KOXA 4NPBA 3US3A 3LFLA 1ZGNA 4J56E 3F6DA 1SK1A 1PGTA 2JACA 5DAKA 1F3BA 1G6WA 2JADA 3FZ4A 3NIVA 5JWRB 2X8GA 5G1LA 2AJQB 2VCWA 2R0GA 3WGEA 5CO3A 2H1DA 4AF2A 2FWHA 2VO4A 2H19A 2L5LA 3QFBC 1AXDA 3IR4A 4JZQA 2C0EA 3CSHA 2VLTA 2HXKA 2LNTA 3NZNA 8GSSA 4F0BA 2A2SA 4OMVA 5A4WA 2QC7A 3F4TA 4HS1A 5CRWA 2VL2C 2V6KA 3ED3A 3VURA 3GH9A 1PN9A 1MD4A 2PBJA 2OA7A 3ZFBA 3GKXA 4MF6A 2JL4A 3J7Yb 4BWQA 4EDYA 5J5NA 3N5OA 2GZPA 2DIYA 4JU5A 4V1Ap 4TOPA 4JRRA 3ERGA 1PKWA 2P5QA 1GWCA 3K8NA 4XIHA 3UOMA 3R2QA 4MZCA 4TXOA 4XS4B 2BTOT 3JCML 1TP9A 4KH7A 1XVWA 2ON7A 3L9SA 4RUVA 4GSTA 2VLUA 2B1KA 5D9XA 2K18A 3TKQA 3ZIJA 4GLTA 1HNBA 1N8JA 5CYYA 2R0PA 3D6IA 2H71A 4N11A 2WJUA 5INYA 2H6XA 3ZIVA 1SYRA 2VCXA 3TOUA 2FWGA 5DJMA 4DEJA 1PX7A 2WB9A 1YKCA 2X4AA 3APQA 2R6KA 1OVNA 3FHKA 4G0IA 4K7NA 4O7HA 1PMTA 2IFQA 3HZ8A 2I9HA 1GP1A 5D8IA 1A24A 2CA8A 2CVKA 4F2IA 2OBIA 5J41A 1YKAA 1A0FA 3DGQA 4K0GA 2YANA 4O32A 1TTZA 1GSFA 4MCUA 3KIJA 4RI6A 4V2LA 3UIWA 2FHEA 3TRXA 1J9BA 1X5EA 1TI1A 3DVXA 2GZYA 2J9HA 1V9WA 2HSMA 2CVBA 1U6TA 3P8WA 2IMIA 3EU4A 1YDKA 4WETA 1W4VA 5IOWA 1JZDA 2DJ3A 3GSSA 1SK0A 2WS2A 2REMA 3ZVJA 3KXOA 4AJ7A 2VCQA 4KDXA 2B7KA 2M80A 4WR5A 4KAEA 1HD2A 3KH9A 4ECJA 5C00A 2CZ3A 2UZ8A 4OWYA 1O6JA 4XRDA 1S3DA 16GSA 3HHVA 2QGVA 4ECBA 3C1SA 4HUAA 5L71A 2WFCA 2IPAA 4FH8A 5DDLA 4MF7A 4K7OA 2IMFA 4O5UA 2EIQA 1GSEA 4IELA 1WMJA 4FIWA 2FWFA 6GSYA 2XPEA 3VFIA 1T3BA 3D5JA 3CYNA 4F03A 1ZYPA 2LRNA 1ERUA 1YEPA 1QK8A 3UAPA 3LORA 2HRNA 3KJYA 4IQ1A 3H8QA 1GUKA 3EPTA 2WRTA 3O76A 3M9JA 2VOCA 2GSQA 1M2AA 3MNGA 4Q5RA 1QGVA 1ZYEA 4MF5A 4F82A 1AC1A 2HZEB 5FHIA 4PXOA 1USBA 2VD1A 4ZL9A 4O92A 4NAXA 3GKNA 5ECLB 5DQYA 2DKHA 3C8EA 4JBBA 2MYGA 3TDGA 4YQUA 2IMKA 2WULA 2LNSA 1XZOA 3BCIA 4JR4A 1OE8A 3IK7A 1SJ6A 5ECSA 3FZAA 4DVCA 1M0UA 4BA7A 4K1FA 1XVQA 1ZL9A 1J0FA 5IPGA 2PN8A 3QMXA 2H1BA 1GSUA 2O85A 3CSJA 1K0BA 2I4AA 4IS0A 2CV4A 1PQNA 2RUFA 1GH2A 1XOAA 3CRUA 2VCTA 3GH6A 1IYIA 3ZFLA 4OFTA 5A4VA 2LKUA 2N5AA 4POMA 1VF4A 2YJ7A 1WJKA 1EV4A 4F9ZA 3VPTA 5HFKA 4NXIA 1YEXA 1DE2A 1XBSA 1TW9A 2JZRA 4AJ8A 2H1GA 2GT5A 1RQMA 3FMWA 1F2EA 5CRDA 4G10A 1MDKA 1A8LA 4TR1A 4GXZA 3DEXA 4ZL7A 2MMZA 1FVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRC A;  3BOA A;  2DBC A;  4TKY A;  1ERV A;  3LYP A;  3LQ7 A;  2C4J A;  1ST9 A;  1U3I A;  4KCA A;  4MJA A;  2TRX A;  1G7E A;  4OO5 A;  2YN1 A;  1AIU A;  4V1A g;  1VF1 A;  3TRP A;  3L9V A;  3TCO A;  2HLS A;  2AYT A;  5DCH A;  2LJR A;  1BQ7 A;  4IP6 A;  4QL9 A;  2LTK A;  3J7Y k;  4GWR A;  3FZ9 A;  1U3A A;  1T00 A;  5JCG A;  2N5F A;  1Z7R A;  2JSY A;  5DAL B;  2GDR A;  2XPD A;  3O6T A;  1AQW A;  5EPF A;  3ZL5 A;  2IMD A;  2JZS A;  1EP7 A;  3W8S A;  1XOB A;  5G31 A;  3IRA A;  2H01 A;  2VUP A;  2AHE A;  5JCU A;  3KTB A;  1GTA A;  5ECO B;  1TRS A;  2MZC A;  3NOF A;  14GS A;  4PUR A;  5CRH A;  4YAV A;  4IGJ A;  4BL7 A;  1BED A;  2Z9S A;  3BBY A;  3E9J B;  5DCG A;  1R7H A;  5ECR B;  4IW9 A;  3QPM A;  1OC8 A;  3HD5 A;  5LCZ A;  2YZU A;  1YY7 A;  2HT9 A;  5A5K A;  1YF0 A;  3BD2 A;  3CMI A;  3AY8 A;  1EWX A;  3CXG A;  3ISO A;  2HFD A;  2D2Z A;  4KX4 A;  3IHQ A;  2R5G A;  1TK5 B;  4XHM A;  4GRF A;  4HZ2 A;  3RAZ A;  4XRA A;  3DD3 A;  4WBJ A;  2DJK A;  4KSO A;  1GTB A;  1ZMA A;  5LD0 A;  1GSY A;  3GTU B;  1GL8 A;  3TJF A;  1ABA A;  1X9M B;  3KGK A;  4EVM A;  1M9B A;  2FCH A;  3E3E A;  4I8B A;  2MMA A;  5ECN B;  3L78 A;  3F6F A;  4LL1 B;  2VL3 A;  3SWL A;  2HZE A;  4MMM A;  1O7U A;  3UVH A;  3HJM A;  2E2G A;  3F4R A;  5IQY A;  2GQM A;  1OKT A;  3DYR A;  1OC3 A;  2R4V A;  2FUG 2;  2R2J A;  2YWO A;  4XCS A;  2CX4 A;  2PWJ A;  4QQ7 A;  1OC9 B;  5GST A;  4FYU A;  5B8A A;  1TDI A;  2NTO A;  2F8A A;  1SL2 B;  5ID2 A;  4WR4 A;  1PL1 A;  3O3T A;  4GTU A;  3A3T A;  4ZL8 A;  1TI3 A;  1SK2 A;  3G9B A;  3ZMK A;  5D9V A;  3GRX A;  3VPQ A;  1UA5 A;  2PVQ A;  1NM3 A;  1XWC A;  2DSA A;  6GSU A;  3L0H A;  2YV9 A;  2AV4 A;  3CTG A;  5DBQ A;  1EGR A;  3IXR A;  2JSZ A;  4X43 A;  2VCZ A;  3QD9 A;  5D9T A;  3GKK A;  1ZOF A;  2FNO A;  4MJE A;  4I2U A;  1KEB A;  3I9V 2;  3FEU A;  3D4T A;  4TW5 A;  3IK9 A;  5HR3 A;  4KW6 A;  4I6X A;  2N5B A;  2OKA A;  1ERT A;  2E2M A;  2GSS A;  1KTE A;  2KLX A;  4EKZ A;  1VF3 A;  1J08 A;  1ERW A;  4ZXG A;  1F6M C;  2VIM A;  3DML A;  4GSS A;  4K7I A;  2X8C A;  2EIR A;  4BVX A;  3C7M A;  2M72 A;  2YWN A;  2HE3 A;  4WF4 A;  2DJ2 A;  3E0U A;  4EC0 A;  4NV2 A;  1TU7 A;  2H76 A;  1T4Y A;  2OJL A;  4OCF A;  2HYX A;  1R26 A;  5HQP A;  2LS5 A;  1SKS B;  2O89 A;  1E6B A;  4ML6 A;  1ACV A;  1O85 A;  3IC4 A;  6GSX A;  5F8B A;  4OCE A;  3VWV A;  2C3T A;  2GS3 A;  2H73 A;  1S3A A;  6GSS A;  1B4Q A;  3TOT A;  3GV1 A;  2GST A;  1HNC A;  1THO A;  1F3A A;  2OAD A;  4XTS A;  1JLV A;  4I5Q A;  2VLV A;  4KDU A;  1SL0 B;  4MPF A;  3M9K A;  2RM5 A;  5ENU A;  4OFM A;  1QFN A;  4PQI A;  3EYT A;  4X1U A;  5IMD A;  3LJR A;  1UVZ A;  4CHS A;  2M46 A;  4ACS A;  1SD8 A;  2OBK A;  1FB6 A;  3F9U A;  5AGY A;  3ZTL A;  1B48 A;  1H4O A;  3MSZ A;  5G5E A;  4D73 B;  3ZZX A;  4WXT A;  2LQQ A;  3VWW A;  2K9F A;  1F37 A;  3HZ4 A;  5COH A;  2XC2 A;  2C8U A;  4J2F A;  1PD2 1;  5G30 A;  3ZVJ D;  3H1N A;  2WGR A;  5IO0 A;  4KDY A;  5ELG A;  3WYW A;  1MTC A;  3KMN A;  2HI7 A;  2GZZ A;  4HDE A;  5G5F A;  5GZZ B;  3TRQ A;  5CRE A;  3FR3 A;  3F63 A;  5ECM B;  3EUR A;  3QAG A;  4ISD A;  4LLR A;  4IQA A;  1WE0 A;  9GSS A;  2H74 A;  1U88 A;  2R3X A;  4EO3 A;  5EL8 A;  1V57 A;  3GTU A;  4EL1 A;  2LEG A;  4RQR A;  1HQO A;  2V41 A;  5HFI A;  2LST A;  2K8S A;  5F06 A;  4HQZ A;  3ME7 A;  3EVI A;  1XPV A;  1V98 A;  4ZB9 A;  4L0W A;  4HJM A;  4DSS A;  1OKD A;  3UBK A;  1NW2 A;  4PUF C;  3KD0 A;  5HR2 A;  1FHE A;  1RW1 A;  1M7T A;  4V2N A;  3KM6 A;  3QFA C;  3C73 A;  5JCW A;  4MAB A;  3TJG A;  3A2X A;  1UC7 A;  1XWK A;  4JR6 A;  2H6Z A;  3BCK A;  3ERW A;  5H5Q A;  1XWA A;  2GSR A;  4IBP A;  3KZQ A;  4ZIL A;  1Q4J A;  1SD9 A;  2E7P A;  3WD6 A;  4OD7 A;  2ZNM A;  2P5R A;  3U6V A;  5IMZ A;  6GST A;  2YOI A;  1TRV A;  1JLW A;  5CAX A;  5E4W A;  4OO4 A;  1WPI A;  5JWO B;  2MBS A;  3LXZ A;  4HEA 2;  3VWX A;  3FR6 A;  3UAR A;  1TXX A;  17GS A;  1B8X A;  4BWS A;  3UVT A;  4RI7 A;  2H0G A;  3FYG A;  2RUE A;  3IDV A;  4TXV A;  2JU5 A;  2DML A;  2O87 A;  2ON5 A;  3GUR A;  5FT3 A;  2LUS A;  3GHA A;  3ZIT A;  6GSV A;  3TKS C;  1NHO A;  5ECK B;  2H70 A;  5CRG A;  1AW9 A;  1SKR B;  2GLR A;  5G1K A;  1M2D A;  4MLY A;  2X99 A;  2CQ9 A;  2X64 A;  4JED A;  2QKE A;  1K0D A;  1PX6 A;  4YAP A;  2CZ2 A;  3IAM 2;  3FZ5 A;  3IPZ A;  2H0H A;  2ES7 A;  1QXH A;  3TJJ A;  2O8V B;  4POL A;  2IL3 A;  4MDC A;  3P90 A;  5GSS A;  1X9W B;  3Q74 A;  5DAK B;  3APO A;  4POK A;  4V2M A;  3DWV A;  1JZW A;  4XS4 A;  3IAS 2;  18GS A;  20GS A;  4IHU A;  4KB3 A;  1PKZ A;  4HJ2 A;  1XW6 A;  3V1W A;  1OE7 A;  5ECQ B;  5IMA A;  10GS A;  1VGL A;  3GST A;  4MP4 A;  3WGX A;  3HXS A;  2EIO A;  3GL3 A;  2YNX A;  4IN0 A;  3CTF A;  3GX0 A;  2NVL A;  5IM9 A;  1EEJ A;  5H5R A;  3HY2 A;  2H72 A;  5F05 A;  1G7O A;  1A2J A;  1YZX A;  1B9X C;  2G0F A;  2AUV A;  3F8U A;  3DXB A;  1H75 A;  3RBT A;  22GS A;  1XW5 A;  4L0U A;  3VLN A;  1I5G A;  4F0C A;  2YWI A;  2IN3 A;  3KH7 A;  2A4V A;  3HCZ A;  1PRX A;  2VM1 A;  4E8H A;  2OE0 A;  2HRF A;  2DJJ A;  2WDU A;  2EC4 A;  2DJ0 A;  4TN8 A;  5HR1 A;  3M1G A;  3DRN A;  4NWY A;  5EVO A;  4H86 A;  4N30 A;  1E2Y A;  2C3N A;  1XWB A;  3M0F A;  2CX3 A;  4TXO B;  3QCP A;  1Z9H A;  2GQL A;  3KCM A;  3W6G A;  4PX1 A;  4GQC A;  2A2R A;  1TJD A;  3G7J A;  3IV4 A;  3QR6 A;  2L4Q A;  3FW2 A;  4POB A;  4OFN A;  2IIY A;  4YH2 A;  1GUH A;  2B3S A;  5G2Z A;  5B8B A;  3FRC A;  1A2L A;  1MDI A;  1O81 A;  1SJZ A;  2NBS A;  2FWE A;  3HYP A;  4TR0 A;  4ECI A;  3LEF A;  2B6M A;  1O8W A;  5J9C A;  2CAI A;  1F9M A;  1R4W A;  5IOX A;  3FY7 A;  2I1U A;  1EOG A;  3ZRE A;  1Q98 A;  3QOU A;  2HSH A;  2L5O A;  2IFQ B;  1SKW B;  4TRX A;  5IMF A;  3EMX A;  1CQH A;  3D22 A;  3QAW A;  3UEM A;  3FK8 A;  3TKS E;  1AUC A;  4HU7 A;  4Q5Q A;  5ABR A;  3S9F A;  1NHY A;  4KCE A;  3ME8 A;  3UBL A;  1TRW A;  1XCC A;  4CDO A;  4MJC A;  3VI7 A;  3GNJ A;  3VWU A;  4O5R A;  1G0T A;  2V1M A;  3EMP A;  3IA1 A;  2IJY A;  1V40 A;  2H6Y A;  4AGS A;  4Z7X A;  1BAY A;  1KNG A;  3FR9 A;  1PL2 A;  4L8E A;  1XXU A;  2WZ9 A;  4X0X A;  3Q19 A;  4ULX A;  1URM A;  4TVE A;  1WIK A;  1GUL A;  5D9W A;  3GKM A;  1GLQ A;  1ZCP A;  1JHB A;  1M99 A;  2R37 A;  5H5S A;  1CQG A;  3EC3 A;  2L59 A;  2PVO C;  2J23 A;  5ECP B;  11GS A;  3VI5 A;  3KMO A;  3F4S A;  2FA8 A;  5IMC A;  1FOV A;  7GSS A;  4WEY A;  2L4C A;  2H1A A;  5E59 A;  1UN2 A;  1K0A A;  4P3Y B;  4EDZ A;  3RHC A;  3TKP A;  2C0F A;  5ELA A;  1K3Y A;  2XHF A;  1NSW A;  3UMA A;  2OE1 A;  1T7P B;  1A0R P;  4K9Z A;  3H79 A;  5AIV A;  1XFL A;  2AB6 A;  3QDN A;  1JZO A;  1ILO A;  3A5W A;  4ML1 A;  2KP1 A;  1YJ6 A;  1I9D A;  3LYK A;  1T8E B;  3GN3 A;  2MMO A;  5F0G A;  2B7J A;  3H4K A;  2PER A;  3LWA A;  3EWL A;  3GMF A;  4G19 A;  1Z5Y E;  3MWH A;  2VAF A;  2GVP A;  2YJH A;  2ZUP A;  2YPM A;  3VK9 A;  1VF2 A;  4GQF A;  5IMV A;  3D4M A;  2KP2 A;  3HJO A;  3GIX A;  2RII A;  4FYC A;  4ZIJ A;  3HVS A;  1G6Y A;  3G7Y A;  1Z3E A;  4KE3 A;  2JZT A;  1C72 A;  3LSZ A;  1DE1 A;  3F0I A;  5D96 A;  5HR0 A;  3WT2 A;  1SU9 A;  2DLX A;  4Q5N A;  2PU9 C;  3F3R A;  1B4P A;  1TKD B;  2FD3 A;  4FO5 A;  1A23 A;  1XIY A;  3SBC A;  1MD3 A;  1EP8 A;  3CBU A;  1A8Y A;  2FA4 A;  3LXT A;  2K6V A;  1K3L A;  4WF5 A;  1V2A A;  3UL3 A;  1HYU A;  5DAL A;  2DJ1 A;  2K8V A;  4DSQ A;  3PR8 A;  5GAN D;  4ZB8 A;  1WP0 A;  3WT1 A;  2G2Q A;  1TRU A;  2BJX A;  2OE3 A;  4GCI A;  5AIX A;  4MK3 A;  4KA0 A;  3TKS A;  2V6O A;  4KSM A;  3HA9 A;  1AQV A;  3KTL A;  3A2W A;  2GQK A;  3HVX A;  4HQS A;  4TR1 B;  4HU9 A;  4PNG A;  2XBI A;  1OAZ A;  3M3M A;  2E0Q A;  3ZLP A;  1GTU A;  5IPH A;  2AAW A;  3EU3 A;  1GLP A;  5B6M A;  2H66 A;  1QUW A;  1ML6 A;  2GT6 A;  1A2M A;  2LJA A;  3W8J A;  4NHW A;  3Q18 A;  2FY6 A;  2L6D A;  3M8N A;  2VCV A;  3I69 A;  3HVV A;  2XBQ A;  1ON4 A;  4K0N A;  1GNW A;  2I3Y A;  3TB2 A;  4L5O A;  5HFG A;  3IOS A;  1BX9 A;  1K0M A;  1MEK A;  1WRY A;  2YZH A;  1DSB A;  2B5Y A;  1B9Y C;  4EE0 A;  1T1V A;  2HSY A;  4KGI A;  3IBH A;  4G9H A;  1S3C A;  4MZW A;  4HZ4 A;  1K3O A;  2HZF A;  2VM2 A;  4XS1 A;  5KEJ A;  4I97 A;  4MH3 A;  5DVB A;  2KOK A;  2CVD A;  1Y25 A;  4ZB6 A;  3DIE A;  4MPG A;  2LV3 A;  1YQ1 A;  2TRC P;  3H93 A;  3C1R A;  1OC9 A;  2V2G A;  5IO2 A;  5KN3 A;  4Q5F A;  1EGO A;  5J4U A;  1KBN A;  5DQS A;  3BJ5 A;  1LJR A;  4HOJ A;  2B5E A;  4K2D A;  4MA9 A;  1XWG A;  4LA1 A;  1EV9 A;  1FVK A;  2H75 A;  5CP1 A;  1O8X A;  2MBT A;  1BG5 A;  2P0G A;  5JWQ B;  2VL9 A;  2F8F A;  3TJK A;  4E8E A;  2PMT A;  2DIZ A;  2WCI A;  1VRS D;  3HJP A;  3L9U A;  3PGT A;  5D93 A;  2FGX A;  2C1Y A;  3KP8 A;  2KHP A;  1ZZY A;  1WWJ A;  4WKW A;  4ECC A;  4ZBA A;  6GSW A;  2KUC A;  3GUS A;  1T4Z A;  3Q6O A;  2H8L A;  4PQH A;  3TUE A;  2I81 A;  3RPP A;  4N0Z A;  1M2B A;  1N2A A;  3G7I A;  1X9S B;  1V58 A;  2C0G A;  1GSS A;  3ZYW A;  1U87 A;  1AQX A;  3L4N A;  4MJB A;  5ECH B;  4EUY A;  1BJX A;  19GS A;  3RDW A;  2L57 A;  3ERF A;  1AAZ A;  5ID2 B;  3HKR A;  1FW1 A;  4K6X A;  3LG6 A;  3MAK A;  3APS A;  3HDC A;  1EZK A;  3MDK A;  1FAA A;  4ZBD A;  4G2E A;  2YP6 A;  3I43 A;  3GX8 A;  1YF1 A;  4PNF A;  2YCD A;  2B1L A;  4RQX A;  2DMM A;  1LU4 A;  2LQO A;  3KP9 A;  4YQM A;  4ILF A;  3TKR A;  5LNK e;  1TK0 B;  1TOF A;  1DBY A;  4NV5 A;  2F9S A;  3TJB A;  4FYB A;  4PQ1 A;  2GTU A;  4KUN A;  5D73 A;  1GTI A;  2IME A;  4EXJ A;  1GSQ A;  3DVW A;  13GS A;  3RHB A;  5KN0 A;  3KEB A;  4QL7 A;  5CNW A;  1TK8 B;  3ZML A;  2PPT A;  2LJK A;  4BPY A;  5IIZ A;  3EE2 A;  5J3R A;  4N10 A;  3A2V A;  3N9J A;  2QSI A;  5GAP D;  1IYH A;  1JFU A;  4AJ6 A;  1EOH A;  1X0R A;  3CRT A;  1Z6N A;  1ZYQ B;  4YQV A;  3D0Z A;  4D73 A;  2L6C A;  4IP1 A;  1GNE A;  2RM6 A;  3EIN A;  1K0O A;  1GUM A;  3DKS A;  1SYX A;  3IE3 A;  5B7C A;  4DSR A;  2PUK C;  3TGZ A;  5DJL A;  2FLS A;  5A4U A;  1XW9 A;  3GA4 A;  4EF0 A;  4GSN A;  3FKF A;  4K8M A;  2NDO A;  4WBR D;  1X5C A;  5F07 A;  1R5A A;  4PUA A;  1M9A A;  1K0N A;  1SL1 B;  1Z6M A;  4IJ3 A;  3GFK A;  4MZB A;  4TR3 A;  1HNA A;  4IJI A;  1R5P A;  2GGT A;  2HNL A;  2NPB A;  3PIN A;  4NMU A;  4TR4 A;  1RK4 A;  4NHZ A;  2MMN A;  1QQ2 A;  5KN1 A;  2B5X A;  4KND A;  5ECI B;  4JE1 A;  1GRX A;  2VL2 A;  2YWM A;  5KN2 A;  3GYK A;  1K0C A;  3U5R E;  3P7X A;  1TU8 A;  4CW9 A;  2C3Q A;  1FG4 A;  5EY6 A;  1Y6E A;  4PGT A;  4ZBB A;  1EEM A;  3GL5 A;  1SEN A;  1OYJ A;  1O73 A;  4GF0 A;  1GSD A;  5C04 A;  5FWG A;  2IWT A;  4N0V A;  2YV7 A;  1JZR A;  1SJI A;  2H30 A;  4LMV A;  1PSQ A;  2H0I A;  5AN1 A;  2VD0 A;  4IVF A;  3ZRD A;  5AIS A;  2CT6 A;  1DUG A;  2V32 A;  5B6N A;  2TIR A;  1LBK A;  3D21 A;  4MH2 A;  4I2T A;  4LL4 B;  2P31 A;  3CSI A;  3LGC A;  4ID0 A;  1WOU A;  3RPN A;  3P2A A;  2C80 A;  1Z7P A;  3WGD A;  2LRT A;  1BYE A;  4BVY A;  1QMV A;  3C71 A;  2RLI A;  1MDJ A;  2CAQ A;  3F3Q A;  4IKH A;  2DC5 A;  4HI7 A;  1THX A;  2F51 A;  3QAV A;  5J9B A;  2C0D A;  4XS6 A;  1PA3 A;  1FO5 A;  2F3M A;  4DSS B;  1W89 A;  1X5D A;  2OAC A;  4J57 E;  2ZCT A;  2X8H A;  1FB0 A;  3PH9 A;  2PGT A;  4LMW A;  12GS A;  2O7K A;  2ALB A;  2BMX A;  3UJ1 A;  3I6A A;  3OR5 A;  4L5L A;  4NPB A;  3US3 A;  3LFL A;  1ZGN A;  4J56 E;  3F6D A;  1SK1 A;  1PGT A;  2JAC A;  5DAK A;  1F3B A;  1G6W A;  2JAD A;  3FZ4 A;  3NIV A;  5JWR B;  2X8G A;  5G1L A;  2AJQ B;  2VCW A;  3WGE A;  5CO3 A;  2H1D A;  4AF2 A;  2FWH A;  2VO4 A;  2H19 A;  2L5L A;  3QFB C;  1AXD A;  3IR4 A;  4JZQ A;  2C0E A;  3CSH A;  2VLT A;  2HXK A;  2LNT A;  3NZN A;  8GSS A;  4F0B A;  2A2S A;  4OMV A;  5A4W A;  2QC7 A;  3F4T A;  4HS1 A;  5CRW A;  2VL2 C;  2V6K A;  3ED3 A;  3VUR A;  3GH9 A;  1PN9 A;  1MD4 A;  2PBJ A;  2OA7 A;  3ZFB A;  3GKX A;  4MF6 A;  2JL4 A;  3J7Y b;  4BWQ A;  4EDY A;  5J5N A;  3N5O A;  2GZP A;  2DIY A;  4JU5 A;  4V1A p;  4TOP A;  4JRR A;  3ERG A;  1PKW A;  2P5Q A;  1GWC A;  3K8N A;  4XIH A;  3UOM A;  3R2Q A;  4MZC A;  4TXO A;  4XS4 B;  2BTO T;  3JCM L;  1TP9 A;  4KH7 A;  1XVW A;  2ON7 A;  3L9S A;  4RUV A;  4GST A;  2VLU A;  2B1K A;  5D9X A;  2K18 A;  3TKQ A;  3ZIJ A;  4GLT A;  1HNB A;  1N8J A;  5CYY A;  3D6I A;  2H71 A;  4N11 A;  2WJU A;  5INY A;  2H6X A;  3ZIV A;  1SYR A;  2VCX A;  3TOU A;  2FWG A;  5DJM A;  4DEJ A;  1PX7 A;  2WB9 A;  1YKC A;  3APQ A;  2R6K A;  1OVN A;  3FHK A;  4K7N A;  4O7H A;  1PMT A;  2IFQ A;  3HZ8 A;  2I9H A;  1GP1 A;  5D8I A;  1A24 A;  2CA8 A;  2CVK A;  4F2I A;  2OBI A;  5J41 A;  1YKA A;  1A0F A;  3DGQ A;  4K0G A;  2YAN A;  4O32 A;  1TTZ A;  1GSF A;  4MCU A;  3KIJ A;  4RI6 A;  4V2L A;  3UIW A;  2FHE A;  3TRX A;  1J9B A;  1X5E A;  1TI1 A;  3DVX A;  2GZY A;  2J9H A;  1V9W A;  2CVB A;  1U6T A;  3P8W A;  2IMI A;  3EU4 A;  1YDK A;  4WET A;  1W4V A;  5IOW A;  1JZD A;  2DJ3 A;  3GSS A;  1SK0 A;  2WS2 A;  2REM A;  3ZVJ A;  3KXO A;  4AJ7 A;  2VCQ A;  4KDX A;  2B7K A;  2M80 A;  4WR5 A;  4KAE A;  1HD2 A;  3KH9 A;  4ECJ A;  5C00 A;  2CZ3 A;  4OWY A;  1O6J A;  4XRD A;  1S3D A;  16GS A;  3HHV A;  2QGV A;  4ECB A;  3C1S A;  4HUA A;  5L71 A;  2WFC A;  2IPA A;  4FH8 A;  5DDL A;  4MF7 A;  4K7O A;  2IMF A;  2EIQ A;  1GSE A;  4IEL A;  1WMJ A;  4FIW A;  2FWF A;  6GSY A;  2XPE A;  3VFI A;  1T3B A;  3D5J A;  3CYN A;  4F03 A;  2LRN A;  1ERU A;  1YEP A;  1QK8 A;  3UAP A;  3LOR A;  2HRN A;  3KJY A;  4IQ1 A;  3H8Q A;  1GUK A;  2WRT A;  3O76 A;  3M9J A;  2VOC A;  2GSQ A;  1M2A A;  3MNG A;  4Q5R A;  1QGV A;  1ZYE A;  4MF5 A;  4F82 A;  1AC1 A;  2HZE B;  5FHI A;  4PXO A;  1USB A;  2VD1 A;  4ZL9 A;  4O92 A;  4NAX A;  3GKN A;  5ECL B;  5DQY A;  3C8E A;  4JBB A;  2MYG A;  3TDG A;  4YQU A;  2IMK A;  2WUL A;  2LNS A;  1XZO A;  3BCI A;  4JR4 A;  1OE8 A;  3IK7 A;  1SJ6 A;  5ECS A;  3FZA A;  4DVC A;  1M0U A;  4BA7 A;  4K1F A;  1XVQ A;  1ZL9 A;  1J0F A;  5IPG A;  2PN8 A;  3QMX A;  2H1B A;  1GSU A;  2O85 A;  3CSJ A;  1K0B A;  2I4A A;  4IS0 A;  2CV4 A;  1PQN A;  2RUF A;  1GH2 A;  1XOA A;  3CRU A;  2VCT A;  3GH6 A;  1IYI A;  3ZFL A;  4OFT A;  5A4V A;  2LKU A;  2N5A A;  4POM A;  1VF4 A;  2YJ7 A;  1WJK A;  1EV4 A;  4F9Z A;  3VPT A;  5HFK A;  4NXI A;  1YEX A;  1DE2 A;  1XBS A;  1TW9 A;  2JZR A;  4AJ8 A;  2H1G A;  2GT5 A;  1RQM A;  1F2E A;  5CRD A;  4G10 A;  1MDK A;  1A8L A;  4TR1 A;  4GXZ A;  3DEX A;  4ZL7 A;  2MMZ A;  1FVJ A; 
#chains in the Genus database with same CATH topology
 4YKG A;  2LRC A;  3BOA A;  2DBC A;  4TKY A;  1ERV A;  3LYP A;  3LQ7 A;  2C4J A;  1ST9 A;  1U3I A;  4KCA A;  4MJA A;  4BVX B;  2TRX A;  1G7E A;  4OO5 A;  2YN1 A;  1AIU A;  4V1A g;  1VF1 A;  3TRP A;  3L9V A;  3TCO A;  2HLS A;  2AYT A;  5DCH A;  2LJR A;  1BQ7 A;  4IP6 A;  4QL9 A;  2LTK A;  3J7Y k;  4GWR A;  3FZ9 A;  1U3A A;  1T00 A;  5KOW A;  5JCG A;  2N5F A;  1Z7R A;  2JSY A;  5DAL B;  2GDR A;  2XPD A;  3O6T A;  1AQW A;  5EPF A;  3ZL5 A;  2IMD A;  2JZS A;  1EP7 A;  3W8S A;  1XOB A;  5G31 A;  3IRA A;  2H01 A;  2VUP A;  2AHE A;  5JCU A;  3R3E A;  3KTB A;  1GTA A;  5ECO B;  1TRS A;  2MZC A;  3NOF A;  14GS A;  4PUR A;  5CRH A;  4YAV A;  4IGJ A;  4BL7 A;  1BED A;  2Z9S A;  3BBY A;  3E9J B;  5DCG A;  1R7H A;  5ECR B;  4IW9 A;  3QPM A;  1OC8 A;  3HD5 A;  5LCZ A;  2YZU A;  1YY7 A;  2HT9 A;  5A5K A;  1YF0 A;  3BD2 A;  3CMI A;  3AY8 A;  4X4J A;  1EWX A;  3CXG A;  3ISO A;  2HFD A;  2D2Z A;  4KX4 A;  3IHQ A;  2R5G A;  1TK5 B;  4XHM A;  4GRF A;  4HZ2 A;  5BMU A;  3RAZ A;  4XRA A;  3DD3 A;  4WBJ A;  2DJK A;  4KSO A;  1GTB A;  1ZMA A;  5LD0 A;  1GSY A;  3GTU B;  1GL8 A;  3TJF A;  1ABA A;  1X9M B;  3KGK A;  4EVM A;  1M9B A;  2FCH A;  3E3E A;  4I8B A;  2MMA A;  5ECN B;  3L78 A;  3F6F A;  4LL1 B;  2VL3 A;  3SWL A;  2HZE A;  4MMM A;  1O7U A;  3UVH A;  3HJM A;  2E2G A;  3F4R A;  5IQY A;  2GQM A;  1OKT A;  3DYR A;  1OC3 A;  2R4V A;  2FUG 2;  2R2J A;  2YWO A;  4XCS A;  2CX4 A;  2PWJ A;  4QQ7 A;  1OC9 B;  5GST A;  4FYU A;  5B8A A;  1TDI A;  2NTO A;  2F8A A;  1SL2 B;  3MIX A;  5ID2 A;  4WR4 A;  1ZYN A;  1PL1 A;  3O3T A;  4GTU A;  3A3T A;  4ZL8 A;  3MYD A;  1TI3 A;  1SK2 A;  3G9B A;  3ZMK A;  5D9V A;  3GRX A;  3VPQ A;  1UA5 A;  2PVQ A;  1NM3 A;  1XWC A;  2DSA A;  6GSU A;  3L0H A;  2YV9 A;  2AV4 A;  3CTG A;  5DBQ A;  1EGR A;  3IXR A;  2JSZ A;  4X43 A;  2VCZ A;  3QD9 A;  5D9T A;  3GKK A;  1ZOF A;  2FNO A;  4MJE A;  4I2U A;  1KEB A;  3I9V 2;  4FQU A;  3FEU A;  3D4T A;  4TW5 A;  3IK9 A;  5HR3 A;  4KW6 A;  4I6X A;  2N5B A;  2OKA A;  1ERT A;  2E2M A;  2GSS A;  1KTE A;  2KLX A;  4EKZ A;  1VF3 A;  1J08 A;  1ERW A;  4ZXG A;  1F6M C;  2VIM A;  3DML A;  4GSS A;  4K7I A;  2X8C A;  2EIR A;  4BVX A;  3C7M A;  2M72 A;  2YWN A;  2HE3 A;  4WF4 A;  2DJ2 A;  3E0U A;  4EC0 A;  4NV2 A;  1TU7 A;  2H76 A;  1T4Y A;  2OJL A;  4OCF A;  2HYX A;  1R26 A;  5HQP A;  2LS5 A;  1SKS B;  2O89 A;  1E6B A;  4BIK A;  4ML6 A;  1ACV A;  1O85 A;  3IC4 A;  6GSX A;  5F8B A;  4OCE A;  3VWV A;  2C3T A;  2GS3 A;  2H73 A;  1S3A A;  6GSS A;  1B4Q A;  3TOT A;  3GV1 A;  2GST A;  1HNC A;  1THO A;  1F3A A;  2OAD A;  4XTS A;  1JLV A;  4I5Q A;  4O5Q A;  2VLV A;  4KDU A;  1SL0 B;  4MPF A;  3M9K A;  2RM5 A;  5ENU A;  4OFM A;  1QFN A;  4PQI A;  3EYT A;  4X1U A;  5IMD A;  3LJR A;  1UVZ A;  4CHS A;  2M46 A;  4ACS A;  4Z2T A;  1SD8 A;  2OBK A;  1FB6 A;  3F9U A;  5AGY A;  3ZTL A;  1B48 A;  1H4O A;  3MSZ A;  5G5E A;  4D73 B;  3ZZX A;  4WXT A;  2LQQ A;  3VWW A;  2K9F A;  1F37 A;  3HZ4 A;  5COH A;  2XC2 A;  2C8U A;  4J2F A;  1PD2 1;  5G30 A;  3ZVJ D;  3H1N A;  2WGR A;  1FOH A;  5IO0 A;  4KDY A;  5ELG A;  3WYW A;  1MTC A;  3KMN A;  2HI7 A;  2GZZ A;  4HDE A;  5G5F A;  5GZZ B;  3TRQ A;  5CRE A;  3FR3 A;  3F63 A;  5ECM B;  3EUR A;  3QAG A;  4ISD A;  4HSC X;  4LLR A;  4IQA A;  1WE0 A;  9GSS A;  2H74 A;  1U88 A;  2R3X A;  4EO3 A;  5EL8 A;  1V57 A;  3GTU A;  4EL1 A;  2LEG A;  1PN0 A;  4RQR A;  1HQO A;  2V41 A;  5HFI A;  2LST A;  2K8S A;  5F06 A;  4HQZ A;  3ME7 A;  3EVI A;  1XPV A;  2A4H A;  1V98 A;  4ZB9 A;  4L0W A;  4HJM A;  4DSS A;  1OKD A;  3UBK A;  1NW2 A;  4PUF C;  3KD0 A;  5HR2 A;  1FHE A;  1RW1 A;  1M7T A;  4V2N A;  3KM6 A;  3QFA C;  3C73 A;  5JCW A;  4MAB A;  3TJG A;  3A2X A;  1UC7 A;  1XWK A;  4JR6 A;  2H6Z A;  3BCK A;  3ERW A;  5H5Q A;  1XWA A;  2GSR A;  4IBP A;  3KZQ A;  4ZIL A;  4CY8 A;  1Q4J A;  1SD9 A;  2E7P A;  3WD6 A;  4OD7 A;  2ZNM A;  2P5R A;  3U6V A;  5IMZ A;  6GST A;  2YOI A;  1TRV A;  1JLW A;  5CAX A;  5E4W A;  4OO4 A;  1WPI A;  5JWO B;  2MBS A;  3LXZ A;  4BVY B;  4HEA 2;  3VWX A;  3FR6 A;  3UAR A;  1TXX A;  17GS A;  1B8X A;  4BWS A;  3LW9 A;  3UVT A;  4RI7 A;  2H0G A;  3FYG A;  1M3I A;  2RUE A;  3IDV A;  4TXV A;  2JU5 A;  2DML A;  2O87 A;  2ON5 A;  3GUR A;  5FT3 A;  2LUS A;  3GHA A;  3ZIT A;  6GSV A;  3TKS C;  1NHO A;  5ECK B;  2H70 A;  5CRG A;  1AW9 A;  4K2X A;  1SKR B;  2GLR A;  5G1K A;  1M2D A;  4MLY A;  2X99 A;  2CQ9 A;  2X64 A;  4EIP A;  4JED A;  4A5P A;  2QKE A;  1K0D A;  1PX6 A;  4YAP A;  2CZ2 A;  3IAM 2;  3FZ5 A;  3IPZ A;  2H0H A;  2ES7 A;  1QXH A;  3TJJ A;  2O8V B;  4POL A;  2IL3 A;  4MDC A;  3P90 A;  5GSS A;  4KF9 A;  1X9W B;  3Q74 A;  5DAK B;  3APO A;  4POK A;  4V2M A;  3DWV A;  1JZW A;  4XS4 A;  3IAS 2;  2X49 A;  18GS A;  20GS A;  4IHU A;  4KB3 A;  1PKZ A;  4HJ2 A;  1XW6 A;  3V1W A;  1OE7 A;  5ECQ B;  5IMA A;  10GS A;  1VGL A;  3GST A;  4MP4 A;  3WGX A;  3HXS A;  2EIO A;  3GL3 A;  2YNX A;  4IN0 A;  3CTF A;  3GX0 A;  2NVL A;  5IM9 A;  1EEJ A;  5H5R A;  3HY2 A;  2H72 A;  5F05 A;  1G7O A;  1A2J A;  1YZX A;  1B9X C;  2G0F A;  2AUV A;  3A5I A;  3F8U A;  3DXB A;  1H75 A;  3RBT A;  22GS A;  1XW5 A;  4L0U A;  3VLN A;  1I5G A;  4F0C A;  3PPU A;  2YWI A;  2IN3 A;  3KH7 A;  2A4V A;  3HCZ A;  1PRX A;  2VM1 A;  4E8H A;  2OE0 A;  2HRF A;  2DJJ A;  2WDU A;  2EC4 A;  2DJ0 A;  4PTS A;  4TN8 A;  5HR1 A;  3M1G A;  3DRN A;  4NWY A;  5EVO A;  4H86 A;  4N30 A;  1E2Y A;  2C3N A;  4G0L A;  1XWB A;  4Z2U A;  3M0F A;  2CX3 A;  4TXO B;  3QCP A;  1Z9H A;  2GQL A;  3KCM A;  3W6G A;  4PX1 A;  4GQC A;  2A2R A;  1TJD A;  3G7J A;  3IV4 A;  3QR6 A;  2L4Q A;  3FW2 A;  4POB A;  4OFN A;  2IIY A;  4K5S A;  4YH2 A;  1GUH A;  2B3S A;  5G2Z A;  5B8B A;  3FRC A;  1A2L A;  1MDI A;  1O81 A;  1SJZ A;  2NBS A;  2FWE A;  3HYP A;  4TR0 A;  4ECI A;  3LEF A;  2B6M A;  1O8W A;  5J9C A;  2CAI A;  1F9M A;  1R4W A;  5IOX A;  3FY7 A;  2I1U A;  1EOG A;  3ZRE A;  1Q98 A;  3QOU A;  2HSH A;  3IHG A;  2L5O A;  2IFQ B;  1SKW B;  4TRX A;  5IMF A;  3EMX A;  1CQH A;  3D22 A;  3QAW A;  3UEM A;  3FK8 A;  3TKS E;  4EIQ A;  1AUC A;  4HU7 A;  4Q5Q A;  5ABR A;  3S9F A;  1NHY A;  4KCE A;  3ME8 A;  3UBL A;  1TRW A;  1XCC A;  4CDO A;  4MJC A;  3VI7 A;  3GNJ A;  3VWU A;  4O5R A;  1G0T A;  2V1M A;  3EMP A;  3IA1 A;  2IJY A;  1V40 A;  2H6Y A;  4AGS A;  4Z7X A;  1BAY A;  1KNG A;  3FR9 A;  1PL2 A;  4L8E A;  1XXU A;  2WZ9 A;  4X0X A;  3Q19 A;  4ULX A;  1URM A;  4TVE A;  1WIK A;  1GUL A;  5D9W A;  3GKM A;  5BRT A;  1GLQ A;  1ZCP A;  1JHB A;  1M99 A;  2R37 A;  5H5S A;  1CQG A;  3EC3 A;  2L59 A;  2PVO C;  2J23 A;  5ECP B;  11GS A;  3VI5 A;  3KMO A;  3F4S A;  2FA8 A;  5IMC A;  1FOV A;  7GSS A;  4WEY A;  2L4C A;  2H1A A;  5E59 A;  1UN2 A;  1K0A A;  4P3Y B;  4EDZ A;  3RHC A;  3TKP A;  2C0F A;  5ELA A;  1K3Y A;  2XHF A;  1NSW A;  3UMA A;  2OE1 A;  1T7P B;  4MNN A;  1A0R P;  4K9Z A;  3H79 A;  5AIV A;  1XFL A;  2AB6 A;  3QDN A;  1JZO A;  1ILO A;  3A5W A;  4ML1 A;  2KP1 A;  1YJ6 A;  1I9D A;  3LYK A;  1T8E B;  3GN3 A;  2MMO A;  5F0G A;  2B7J A;  3H4K A;  2PER A;  3LWA A;  3EWL A;  3GMF A;  4G19 A;  1Z5Y E;  3MWH A;  2VAF A;  2GVP A;  2YJH A;  2ZUP A;  2YPM A;  2HRK A;  3VK9 A;  1VF2 A;  4GQF A;  5IMV A;  3D4M A;  2KP2 A;  3HJO A;  3GIX A;  2RII A;  4FYC A;  3HVN A;  4ZIJ A;  3HVS A;  1G6Y A;  3G7Y A;  1Z3E A;  4KE3 A;  2JZT A;  1C72 A;  3LSZ A;  1DE1 A;  3F0I A;  5D96 A;  5HR0 A;  3WT2 A;  1SU9 A;  2DLX A;  4Q5N A;  2PU9 C;  3F3R A;  1B4P A;  1TKD B;  2FD3 A;  4FO5 A;  1A23 A;  1XIY A;  3SBC A;  1MD3 A;  1EP8 A;  3CBU A;  1A8Y A;  2FA4 A;  3LXT A;  2K6V A;  1K3L A;  4WF5 A;  1V2A A;  3UL3 A;  1HYU A;  5DAL A;  2DJ1 A;  2K8V A;  4DSQ A;  3PR8 A;  5GAN D;  4ZB8 A;  1WP0 A;  3WT1 A;  2G2Q A;  1TRU A;  2BJX A;  2OE3 A;  4GCI A;  5AIX A;  4MK3 A;  4KA0 A;  3TKS A;  2V6O A;  4KSM A;  3HA9 A;  1AQV A;  3KTL A;  3A2W A;  2GQK A;  3HVX A;  4HQS A;  4TR1 B;  4HU9 A;  4PNG A;  2XBI A;  1PFO A;  1OAZ A;  3M3M A;  2E0Q A;  3ZLP A;  1GTU A;  5IPH A;  2AAW A;  3EU3 A;  1GLP A;  5B6M A;  2H66 A;  1QUW A;  1ML6 A;  2GT6 A;  1A2M A;  2LJA A;  3W8J A;  4NHW A;  3Q18 A;  2FY6 A;  2L6D A;  3M8N A;  2VCV A;  3I69 A;  3HVV A;  2XBQ A;  1ON4 A;  4K0N A;  1GNW A;  2I3Y A;  3TB2 A;  4L5O A;  3IC8 A;  5HFG A;  3IOS A;  1BX9 A;  1K0M A;  1MEK A;  1WRY A;  2YZH A;  1DSB A;  2B5Y A;  1B9Y C;  2DKI A;  4EE0 A;  1T1V A;  2HSY A;  4KGI A;  3IBH A;  4G9H A;  1S3C A;  4MZW A;  4HZ4 A;  1K3O A;  2HZF A;  2VM2 A;  4XS1 A;  5KEJ A;  4I97 A;  4MH3 A;  5DVB A;  2KOK A;  4YKF A;  2CVD A;  4BL7 B;  1Y25 A;  4ZB6 A;  3DIE A;  4MPG A;  1M3J A;  2LV3 A;  1YQ1 A;  2TRC P;  3H93 A;  3C1R A;  1OC9 A;  2V2G A;  5IO2 A;  5KN3 A;  4Q5F A;  1EGO A;  5J4U A;  1KBN A;  5DQS A;  3BJ5 A;  1LJR A;  4HOJ A;  2B5E A;  4K2D A;  4MA9 A;  1XWG A;  4LA1 A;  1EV9 A;  1FVK A;  2R0C A;  2H75 A;  2QA2 A;  5CP1 A;  1O8X A;  2MBT A;  1BG5 A;  2P0G A;  4K5R A;  5JWQ B;  2VL9 A;  2F8F A;  3TJK A;  4E8E A;  2PMT A;  2DIZ A;  2WCI A;  1VRS D;  3HJP A;  3L9U A;  3PGT A;  5D93 A;  2FGX A;  2C1Y A;  3KP8 A;  4Z2R A;  2KHP A;  1ZZY A;  1WWJ A;  4WKW A;  4ECC A;  4ZBA A;  6GSW A;  2KUC A;  3GUS A;  1T4Z A;  3Q6O A;  2H8L A;  4PQH A;  3TUE A;  2I81 A;  3RPP A;  4G0K A;  4N0Z A;  1M2B A;  1N2A A;  3G7I A;  1X9S B;  1V58 A;  2C0G A;  1GSS A;  3ZYW A;  4ICY A;  1U87 A;  1AQX A;  3L4N A;  4MJB A;  5ECH B;  4EUY A;  1BJX A;  19GS A;  3RDW A;  2QA1 A;  2L57 A;  3ERF A;  1AAZ A;  5ID2 B;  3HKR A;  1FW1 A;  4K6X A;  3LG6 A;  3MAK A;  3APS A;  3HDC A;  1EZK A;  3MDK A;  1FAA A;  4ZBD A;  4G2E A;  2YP6 A;  3I43 A;  3GX8 A;  1YF1 A;  4PNF A;  2YCD A;  2B1L A;  4RQX A;  2DMM A;  1LU4 A;  2LQO A;  3KP9 A;  4YQM A;  4ILF A;  3TKR A;  5LNK e;  1TK0 B;  1TOF A;  1DBY A;  4NV5 A;  2F9S A;  3TJB A;  4FYB A;  4PQ1 A;  2GTU A;  4KUN A;  1GTI A;  5D73 A;  2IME A;  4EXJ A;  1GSQ A;  3DVW A;  13GS A;  3RHB A;  5KN0 A;  3KEB A;  4QL7 A;  5CNW A;  1TK8 B;  3ZML A;  2PPT A;  2LJK A;  4BPY A;  5IIZ A;  3EE2 A;  5J3R A;  4N10 A;  3A2V A;  3N9J A;  2QSI A;  5GAP D;  1IYH A;  1JFU A;  4AJ6 A;  1EOH A;  1X0R A;  3CRT A;  1Z6N A;  1ZYQ B;  4YQV A;  3D0Z A;  4D73 A;  2L6C A;  4IP1 A;  1GNE A;  2RM6 A;  3EIN A;  1K0O A;  1GUM A;  3DKS A;  1SYX A;  3IE3 A;  5B7C A;  4DSR A;  2PUK C;  3TGZ A;  5DJL A;  2FLS A;  5A4U A;  1XW9 A;  3GA4 A;  4EF0 A;  4GSN A;  3FKF A;  4K8M A;  2NDO A;  4WBR D;  1X5C A;  5F07 A;  1R5A A;  4PUA A;  1M9A A;  1K0N A;  1SL1 B;  1Z6M A;  4IJ3 A;  3GFK A;  4MZB A;  4TR3 A;  1HNA A;  4IJI A;  1R5P A;  2GGT A;  2HNL A;  2NPB A;  3PIN A;  4NMU A;  4TR4 A;  1RK4 A;  4NHZ A;  2MMN A;  1QQ2 A;  5KN1 A;  2B5X A;  4KND A;  5ECI B;  4JE1 A;  1GRX A;  2VL2 A;  2YWM A;  5KN2 A;  3GYK A;  1K0C A;  3U5R E;  3P7X A;  1TU8 A;  4CW9 A;  2C3Q A;  1FG4 A;  5EY6 A;  1Y6E A;  4PGT A;  4ZBB A;  1EEM A;  3GL5 A;  1SEN A;  1OYJ A;  1O73 A;  4GF0 A;  1GSD A;  5C04 A;  5FWG A;  2IWT A;  4N0V A;  2YV7 A;  1JZR A;  2A2P A;  1SJI A;  2H30 A;  4LMV A;  4CY6 A;  1PSQ A;  2H0I A;  5AN1 A;  2VD0 A;  4IVF A;  3ZRD A;  5AIS A;  2CT6 A;  1DUG A;  2V32 A;  5B6N A;  2TIR A;  1LBK A;  3D21 A;  2HRA A;  4MH2 A;  4I2T A;  4LL4 B;  2P31 A;  3CSI A;  3LGC A;  4ID0 A;  1WOU A;  3RPN A;  3P2A A;  2C80 A;  1Z7P A;  3WGD A;  2LRT A;  1BYE A;  4BVY A;  1QMV A;  3C71 A;  2RLI A;  1MDJ A;  2CAQ A;  3F3Q A;  4USS A;  4IKH A;  2DC5 A;  4HI7 A;  1THX A;  2F51 A;  3QAV A;  5J9B A;  2C0D A;  4XS6 A;  1PA3 A;  1FO5 A;  2F3M A;  4DSS B;  1W89 A;  1X5D A;  2OAC A;  4J57 E;  2ZCT A;  2X8H A;  1FB0 A;  3PH9 A;  2PGT A;  4LMW A;  12GS A;  2O7K A;  2ALB A;  2BMX A;  3UJ1 A;  3I6A A;  3OR5 A;  4L5L A;  5KOX A;  4NPB A;  3US3 A;  3LFL A;  1ZGN A;  4J56 E;  3F6D A;  1SK1 A;  1PGT A;  2JAC A;  5DAK A;  1F3B A;  1G6W A;  2JAD A;  3FZ4 A;  3NIV A;  5JWR B;  2X8G A;  5G1L A;  2AJQ B;  2VCW A;  2R0G A;  3WGE A;  5CO3 A;  2H1D A;  4AF2 A;  2FWH A;  2VO4 A;  2H19 A;  2L5L A;  3QFB C;  1AXD A;  3IR4 A;  4JZQ A;  2C0E A;  3CSH A;  2VLT A;  2HXK A;  2LNT A;  3NZN A;  8GSS A;  4F0B A;  2A2S A;  4OMV A;  5A4W A;  2QC7 A;  3F4T A;  4HS1 A;  5CRW A;  2VL2 C;  2V6K A;  3ED3 A;  3VUR A;  3GH9 A;  1PN9 A;  1MD4 A;  2PBJ A;  2OA7 A;  3ZFB A;  3GKX A;  4MF6 A;  2JL4 A;  3J7Y b;  4BWQ A;  4EDY A;  5J5N A;  3N5O A;  2GZP A;  2DIY A;  4JU5 A;  4V1A p;  4TOP A;  4JRR A;  3ERG A;  1PKW A;  2P5Q A;  1GWC A;  3K8N A;  4XIH A;  3UOM A;  3R2Q A;  4MZC A;  4TXO A;  4XS4 B;  2BTO T;  3JCM L;  1TP9 A;  4KH7 A;  1XVW A;  2ON7 A;  1S3R A;  3L9S A;  4RUV A;  4GST A;  2VLU A;  2B1K A;  5D9X A;  2K18 A;  3TKQ A;  3ZIJ A;  4GLT A;  1HNB A;  1N8J A;  5CYY A;  2R0P A;  3D6I A;  2H71 A;  4N11 A;  2WJU A;  5INY A;  2H6X A;  3ZIV A;  1SYR A;  2VCX A;  3CQF A;  3TOU A;  2FWG A;  5DJM A;  4DEJ A;  1PX7 A;  2WB9 A;  1YKC A;  2X4A A;  3APQ A;  2R6K A;  1OVN A;  3FHK A;  4G0I A;  4K7N A;  4O7H A;  1PMT A;  2IFQ A;  3HZ8 A;  2I9H A;  1GP1 A;  5D8I A;  1A24 A;  2CA8 A;  2CVK A;  4F2I A;  2OBI A;  5J41 A;  1YKA A;  1A0F A;  3DGQ A;  4K0G A;  2YAN A;  4O32 A;  1TTZ A;  1GSF A;  4MCU A;  3KIJ A;  4RI6 A;  4V2L A;  3UIW A;  2FHE A;  3TRX A;  1J9B A;  1X5E A;  1TI1 A;  3DVX A;  2GZY A;  2J9H A;  1V9W A;  2HSM A;  2CVB A;  1U6T A;  3P8W A;  2IMI A;  3EU4 A;  1YDK A;  4WET A;  1W4V A;  5IOW A;  1JZD A;  2DJ3 A;  3GSS A;  1SK0 A;  2WS2 A;  2REM A;  3ZVJ A;  3KXO A;  4AJ7 A;  2VCQ A;  4KDX A;  2B7K A;  2M80 A;  4WR5 A;  4KAE A;  1HD2 A;  3KH9 A;  4ECJ A;  5C00 A;  2CZ3 A;  2UZ8 A;  4OWY A;  1O6J A;  4XRD A;  1S3D A;  16GS A;  3HHV A;  2QGV A;  4ECB A;  3C1S A;  4HUA A;  5L71 A;  2WFC A;  2IPA A;  4FH8 A;  5DDL A;  4MF7 A;  4K7O A;  2IMF A;  4O5U A;  2EIQ A;  1GSE A;  4IEL A;  1WMJ A;  4FIW A;  2FWF A;  6GSY A;  2XPE A;  3VFI A;  1T3B A;  3D5J A;  3CYN A;  4F03 A;  1ZYP A;  2LRN A;  1ERU A;  1YEP A;  1QK8 A;  3UAP A;  3LOR A;  2HRN A;  3KJY A;  4IQ1 A;  3H8Q A;  1GUK A;  3EPT A;  2WRT A;  3O76 A;  3M9J A;  2VOC A;  2GSQ A;  1M2A A;  3MNG A;  4Q5R A;  1QGV A;  1ZYE A;  4MF5 A;  4F82 A;  1AC1 A;  2HZE B;  5FHI A;  4PXO A;  1USB A;  2VD1 A;  4ZL9 A;  4O92 A;  4NAX A;  3GKN A;  5ECL B;  5DQY A;  2DKH A;  3C8E A;  4JBB A;  2MYG A;  3TDG A;  4YQU A;  2IMK A;  2WUL A;  2LNS A;  1XZO A;  3BCI A;  4JR4 A;  1OE8 A;  3IK7 A;  1SJ6 A;  5ECS A;  3FZA A;  4DVC A;  1M0U A;  4BA7 A;  4K1F A;  1XVQ A;  1XG8 A;  1ZL9 A;  1J0F A;  5IPG A;  2PN8 A;  3QMX A;  2H1B A;  1GSU A;  2O85 A;  3CSJ A;  1K0B A;  2I4A A;  4IS0 A;  2CV4 A;  1PQN A;  2RUF A;  1GH2 A;  1XOA A;  3CRU A;  2VCT A;  3GH6 A;  1IYI A;  3ZFL A;  4OFT A;  5A4V A;  2LKU A;  2N5A A;  4POM A;  1VF4 A;  2YJ7 A;  1WJK A;  1EV4 A;  4F9Z A;  3VPT A;  5HFK A;  4NXI A;  1YEX A;  1DE2 A;  1XBS A;  1TW9 A;  2JZR A;  4AJ8 A;  2H1G A;  2GT5 A;  1RQM A;  3FMW A;  1F2E A;  5CRD A;  4G10 A;  1MDK A;  1A8L A;  4TR1 A;  4GXZ A;  3DEX A;  4ZL7 A;  2MMZ A;  1FVJ A; 
#chains in the Genus database with same CATH homology
 4YKG A;  2LRC A;  3BOA A;  2DBC A;  4TKY A;  1ERV A;  3LYP A;  3LQ7 A;  2C4J A;  1ST9 A;  1U3I A;  4KCA A;  4MJA A;  4BVX B;  2TRX A;  1G7E A;  4OO5 A;  2YN1 A;  1AIU A;  4V1A g;  1VF1 A;  3TRP A;  3L9V A;  3TCO A;  2HLS A;  2AYT A;  5DCH A;  2LJR A;  1BQ7 A;  4IP6 A;  4QL9 A;  2LTK A;  3J7Y k;  4GWR A;  3FZ9 A;  1U3A A;  1T00 A;  5KOW A;  5JCG A;  2N5F A;  1Z7R A;  2JSY A;  5DAL B;  2GDR A;  2XPD A;  3O6T A;  1AQW A;  5EPF A;  3ZL5 A;  2IMD A;  2JZS A;  1EP7 A;  3W8S A;  1XOB A;  5G31 A;  3IRA A;  2H01 A;  2VUP A;  2AHE A;  5JCU A;  3R3E A;  3KTB A;  1GTA A;  5ECO B;  1TRS A;  2MZC A;  3NOF A;  14GS A;  4PUR A;  5CRH A;  4YAV A;  4IGJ A;  4BL7 A;  1BED A;  2Z9S A;  3BBY A;  3E9J B;  5DCG A;  1R7H A;  5ECR B;  4IW9 A;  3QPM A;  1OC8 A;  3HD5 A;  5LCZ A;  2YZU A;  1YY7 A;  2HT9 A;  5A5K A;  1YF0 A;  3BD2 A;  3CMI A;  3AY8 A;  4X4J A;  1EWX A;  3CXG A;  3ISO A;  2HFD A;  2D2Z A;  4KX4 A;  3IHQ A;  2R5G A;  1TK5 B;  4XHM A;  4GRF A;  4HZ2 A;  5BMU A;  3RAZ A;  4XRA A;  3DD3 A;  4WBJ A;  2DJK A;  4KSO A;  1GTB A;  1ZMA A;  5LD0 A;  1GSY A;  3GTU B;  1GL8 A;  3TJF A;  1ABA A;  1X9M B;  3KGK A;  4EVM A;  1M9B A;  2FCH A;  3E3E A;  4I8B A;  2MMA A;  5ECN B;  3L78 A;  3F6F A;  4LL1 B;  2VL3 A;  3SWL A;  2HZE A;  4MMM A;  1O7U A;  3UVH A;  3HJM A;  2E2G A;  3F4R A;  5IQY A;  2GQM A;  1OKT A;  3DYR A;  1OC3 A;  2R4V A;  2FUG 2;  2R2J A;  2YWO A;  4XCS A;  2CX4 A;  2PWJ A;  4QQ7 A;  1OC9 B;  5GST A;  4FYU A;  5B8A A;  1TDI A;  2NTO A;  2F8A A;  1SL2 B;  3MIX A;  5ID2 A;  4WR4 A;  1ZYN A;  1PL1 A;  3O3T A;  4GTU A;  3A3T A;  4ZL8 A;  3MYD A;  1TI3 A;  1SK2 A;  3G9B A;  3ZMK A;  5D9V A;  3GRX A;  3VPQ A;  1UA5 A;  2PVQ A;  1NM3 A;  1XWC A;  2DSA A;  6GSU A;  3L0H A;  2YV9 A;  2AV4 A;  3CTG A;  5DBQ A;  1EGR A;  3IXR A;  2JSZ A;  4X43 A;  2VCZ A;  3QD9 A;  5D9T A;  3GKK A;  1ZOF A;  2FNO A;  4MJE A;  4I2U A;  1KEB A;  3I9V 2;  4FQU A;  3FEU A;  3D4T A;  4TW5 A;  3IK9 A;  5HR3 A;  4KW6 A;  4I6X A;  2N5B A;  2OKA A;  1ERT A;  2E2M A;  2GSS A;  1KTE A;  2KLX A;  4EKZ A;  1VF3 A;  1J08 A;  1ERW A;  4ZXG A;  1F6M C;  2VIM A;  3DML A;  4GSS A;  4K7I A;  2X8C A;  2EIR A;  4BVX A;  3C7M A;  2M72 A;  2YWN A;  2HE3 A;  4WF4 A;  2DJ2 A;  3E0U A;  4EC0 A;  4NV2 A;  1TU7 A;  2H76 A;  1T4Y A;  2OJL A;  4OCF A;  2HYX A;  1R26 A;  5HQP A;  2LS5 A;  1SKS B;  2O89 A;  1E6B A;  4ML6 A;  1ACV A;  1O85 A;  3IC4 A;  6GSX A;  5F8B A;  4OCE A;  3VWV A;  2C3T A;  2GS3 A;  2H73 A;  1S3A A;  6GSS A;  1B4Q A;  3TOT A;  3GV1 A;  2GST A;  1HNC A;  1THO A;  1F3A A;  2OAD A;  4XTS A;  1JLV A;  4I5Q A;  4O5Q A;  2VLV A;  4KDU A;  1SL0 B;  4MPF A;  3M9K A;  2RM5 A;  5ENU A;  4OFM A;  1QFN A;  4PQI A;  3EYT A;  4X1U A;  5IMD A;  3LJR A;  1UVZ A;  4CHS A;  2M46 A;  4ACS A;  4Z2T A;  1SD8 A;  2OBK A;  1FB6 A;  3F9U A;  5AGY A;  3ZTL A;  1B48 A;  1H4O A;  3MSZ A;  5G5E A;  4D73 B;  3ZZX A;  4WXT A;  2LQQ A;  3VWW A;  2K9F A;  1F37 A;  3HZ4 A;  5COH A;  2XC2 A;  2C8U A;  4J2F A;  1PD2 1;  5G30 A;  3ZVJ D;  3H1N A;  2WGR A;  1FOH A;  5IO0 A;  4KDY A;  5ELG A;  3WYW A;  1MTC A;  3KMN A;  2HI7 A;  2GZZ A;  4HDE A;  5G5F A;  5GZZ B;  3TRQ A;  5CRE A;  3FR3 A;  3F63 A;  5ECM B;  3EUR A;  3QAG A;  4ISD A;  4LLR A;  4IQA A;  1WE0 A;  9GSS A;  2H74 A;  1U88 A;  2R3X A;  4EO3 A;  5EL8 A;  1V57 A;  3GTU A;  4EL1 A;  2LEG A;  1PN0 A;  4RQR A;  1HQO A;  2V41 A;  5HFI A;  2LST A;  2K8S A;  5F06 A;  4HQZ A;  3ME7 A;  3EVI A;  1XPV A;  2A4H A;  1V98 A;  4ZB9 A;  4L0W A;  4HJM A;  4DSS A;  1OKD A;  3UBK A;  1NW2 A;  4PUF C;  3KD0 A;  5HR2 A;  1FHE A;  1RW1 A;  1M7T A;  4V2N A;  3KM6 A;  3QFA C;  3C73 A;  5JCW A;  4MAB A;  3TJG A;  3A2X A;  1UC7 A;  1XWK A;  4JR6 A;  2H6Z A;  3BCK A;  3ERW A;  5H5Q A;  1XWA A;  2GSR A;  4IBP A;  3KZQ A;  4ZIL A;  4CY8 A;  1Q4J A;  1SD9 A;  2E7P A;  3WD6 A;  4OD7 A;  2ZNM A;  2P5R A;  3U6V A;  5IMZ A;  6GST A;  2YOI A;  1TRV A;  1JLW A;  5CAX A;  5E4W A;  4OO4 A;  1WPI A;  5JWO B;  2MBS A;  3LXZ A;  4BVY B;  4HEA 2;  3VWX A;  3FR6 A;  3UAR A;  1TXX A;  17GS A;  1B8X A;  4BWS A;  3LW9 A;  3UVT A;  4RI7 A;  2H0G A;  3FYG A;  2RUE A;  3IDV A;  4TXV A;  2JU5 A;  2DML A;  2O87 A;  2ON5 A;  3GUR A;  5FT3 A;  2LUS A;  3GHA A;  3ZIT A;  6GSV A;  3TKS C;  1NHO A;  5ECK B;  2H70 A;  5CRG A;  1AW9 A;  4K2X A;  1SKR B;  2GLR A;  5G1K A;  1M2D A;  4MLY A;  2X99 A;  2CQ9 A;  2X64 A;  4EIP A;  4JED A;  4A5P A;  2QKE A;  1K0D A;  1PX6 A;  4YAP A;  2CZ2 A;  3IAM 2;  3FZ5 A;  3IPZ A;  2H0H A;  2ES7 A;  1QXH A;  3TJJ A;  2O8V B;  4POL A;  2IL3 A;  4MDC A;  3P90 A;  5GSS A;  4KF9 A;  1X9W B;  3Q74 A;  5DAK B;  3APO A;  4POK A;  4V2M A;  3DWV A;  1JZW A;  4XS4 A;  3IAS 2;  2X49 A;  18GS A;  20GS A;  4IHU A;  4KB3 A;  1PKZ A;  4HJ2 A;  1XW6 A;  3V1W A;  1OE7 A;  5ECQ B;  5IMA A;  10GS A;  1VGL A;  3GST A;  4MP4 A;  3WGX A;  3HXS A;  2EIO A;  3GL3 A;  2YNX A;  4IN0 A;  3CTF A;  3GX0 A;  2NVL A;  5IM9 A;  1EEJ A;  5H5R A;  3HY2 A;  2H72 A;  5F05 A;  1G7O A;  1A2J A;  1YZX A;  1B9X C;  2G0F A;  2AUV A;  3A5I A;  3F8U A;  3DXB A;  1H75 A;  3RBT A;  22GS A;  1XW5 A;  4L0U A;  3VLN A;  1I5G A;  4F0C A;  3PPU A;  2YWI A;  2IN3 A;  3KH7 A;  2A4V A;  3HCZ A;  1PRX A;  2VM1 A;  4E8H A;  2OE0 A;  2HRF A;  2DJJ A;  2WDU A;  2EC4 A;  2DJ0 A;  4PTS A;  4TN8 A;  5HR1 A;  3M1G A;  3DRN A;  4NWY A;  5EVO A;  4H86 A;  4N30 A;  1E2Y A;  2C3N A;  4G0L A;  1XWB A;  4Z2U A;  3M0F A;  2CX3 A;  4TXO B;  3QCP A;  1Z9H A;  2GQL A;  3KCM A;  3W6G A;  4PX1 A;  4GQC A;  2A2R A;  1TJD A;  3G7J A;  3IV4 A;  3QR6 A;  2L4Q A;  3FW2 A;  4POB A;  4OFN A;  2IIY A;  4K5S A;  4YH2 A;  1GUH A;  2B3S A;  5G2Z A;  5B8B A;  3FRC A;  1A2L A;  1MDI A;  1O81 A;  1SJZ A;  2NBS A;  2FWE A;  3HYP A;  4TR0 A;  4ECI A;  3LEF A;  2B6M A;  1O8W A;  5J9C A;  2CAI A;  1F9M A;  1R4W A;  5IOX A;  3FY7 A;  2I1U A;  1EOG A;  3ZRE A;  1Q98 A;  3QOU A;  2HSH A;  3IHG A;  2L5O A;  2IFQ B;  1SKW B;  4TRX A;  5IMF A;  3EMX A;  1CQH A;  3D22 A;  3QAW A;  3UEM A;  3FK8 A;  3TKS E;  4EIQ A;  1AUC A;  4HU7 A;  4Q5Q A;  5ABR A;  3S9F A;  1NHY A;  4KCE A;  3ME8 A;  3UBL A;  1TRW A;  1XCC A;  4CDO A;  4MJC A;  3VI7 A;  3GNJ A;  3VWU A;  4O5R A;  1G0T A;  2V1M A;  3EMP A;  3IA1 A;  2IJY A;  1V40 A;  2H6Y A;  4AGS A;  4Z7X A;  1BAY A;  1KNG A;  3FR9 A;  1PL2 A;  4L8E A;  1XXU A;  2WZ9 A;  4X0X A;  3Q19 A;  4ULX A;  1URM A;  4TVE A;  1WIK A;  1GUL A;  5D9W A;  3GKM A;  5BRT A;  1GLQ A;  1ZCP A;  1JHB A;  1M99 A;  2R37 A;  5H5S A;  1CQG A;  3EC3 A;  2L59 A;  2PVO C;  2J23 A;  5ECP B;  11GS A;  3VI5 A;  3KMO A;  3F4S A;  2FA8 A;  5IMC A;  1FOV A;  7GSS A;  4WEY A;  2L4C A;  2H1A A;  5E59 A;  1UN2 A;  1K0A A;  4P3Y B;  4EDZ A;  3RHC A;  3TKP A;  2C0F A;  5ELA A;  1K3Y A;  2XHF A;  1NSW A;  3UMA A;  2OE1 A;  1T7P B;  4MNN A;  1A0R P;  4K9Z A;  3H79 A;  5AIV A;  1XFL A;  2AB6 A;  3QDN A;  1JZO A;  1ILO A;  3A5W A;  4ML1 A;  2KP1 A;  1YJ6 A;  1I9D A;  3LYK A;  1T8E B;  3GN3 A;  2MMO A;  5F0G A;  2B7J A;  3H4K A;  2PER A;  3LWA A;  3EWL A;  3GMF A;  4G19 A;  1Z5Y E;  3MWH A;  2VAF A;  2GVP A;  2YJH A;  2ZUP A;  2YPM A;  2HRK A;  3VK9 A;  1VF2 A;  4GQF A;  5IMV A;  3D4M A;  2KP2 A;  3HJO A;  3GIX A;  2RII A;  4FYC A;  4ZIJ A;  3HVS A;  1G6Y A;  3G7Y A;  1Z3E A;  4KE3 A;  2JZT A;  1C72 A;  3LSZ A;  1DE1 A;  3F0I A;  5D96 A;  5HR0 A;  3WT2 A;  1SU9 A;  2DLX A;  4Q5N A;  2PU9 C;  3F3R A;  1B4P A;  1TKD B;  2FD3 A;  4FO5 A;  1A23 A;  1XIY A;  3SBC A;  1MD3 A;  1EP8 A;  3CBU A;  1A8Y A;  2FA4 A;  3LXT A;  2K6V A;  1K3L A;  4WF5 A;  1V2A A;  3UL3 A;  1HYU A;  5DAL A;  2DJ1 A;  2K8V A;  4DSQ A;  3PR8 A;  5GAN D;  4ZB8 A;  1WP0 A;  3WT1 A;  2G2Q A;  1TRU A;  2BJX A;  2OE3 A;  4GCI A;  5AIX A;  4MK3 A;  4KA0 A;  3TKS A;  2V6O A;  4KSM A;  3HA9 A;  1AQV A;  3KTL A;  3A2W A;  2GQK A;  3HVX A;  4HQS A;  4TR1 B;  4HU9 A;  4PNG A;  2XBI A;  1OAZ A;  3M3M A;  2E0Q A;  3ZLP A;  1GTU A;  5IPH A;  2AAW A;  3EU3 A;  1GLP A;  5B6M A;  2H66 A;  1QUW A;  1ML6 A;  2GT6 A;  1A2M A;  2LJA A;  3W8J A;  4NHW A;  3Q18 A;  2FY6 A;  2L6D A;  3M8N A;  2VCV A;  3I69 A;  3HVV A;  2XBQ A;  1ON4 A;  4K0N A;  1GNW A;  2I3Y A;  3TB2 A;  4L5O A;  3IC8 A;  5HFG A;  3IOS A;  1BX9 A;  1K0M A;  1MEK A;  1WRY A;  2YZH A;  1DSB A;  2B5Y A;  1B9Y C;  2DKI A;  4EE0 A;  1T1V A;  2HSY A;  4KGI A;  3IBH A;  4G9H A;  1S3C A;  4MZW A;  4HZ4 A;  1K3O A;  2HZF A;  2VM2 A;  4XS1 A;  5KEJ A;  4I97 A;  4MH3 A;  5DVB A;  2KOK A;  4YKF A;  2CVD A;  4BL7 B;  1Y25 A;  4ZB6 A;  3DIE A;  4MPG A;  2LV3 A;  1YQ1 A;  2TRC P;  3H93 A;  3C1R A;  1OC9 A;  2V2G A;  5IO2 A;  5KN3 A;  4Q5F A;  1EGO A;  5J4U A;  1KBN A;  5DQS A;  3BJ5 A;  1LJR A;  4HOJ A;  2B5E A;  4K2D A;  4MA9 A;  1XWG A;  4LA1 A;  1EV9 A;  1FVK A;  2R0C A;  2H75 A;  2QA2 A;  5CP1 A;  1O8X A;  2MBT A;  1BG5 A;  2P0G A;  4K5R A;  5JWQ B;  2VL9 A;  2F8F A;  3TJK A;  4E8E A;  2PMT A;  2DIZ A;  2WCI A;  1VRS D;  3HJP A;  3L9U A;  3PGT A;  5D93 A;  2FGX A;  2C1Y A;  3KP8 A;  4Z2R A;  2KHP A;  1ZZY A;  1WWJ A;  4WKW A;  4ECC A;  4ZBA A;  6GSW A;  2KUC A;  3GUS A;  1T4Z A;  3Q6O A;  2H8L A;  4PQH A;  3TUE A;  2I81 A;  3RPP A;  4G0K A;  4N0Z A;  1M2B A;  1N2A A;  3G7I A;  1X9S B;  1V58 A;  2C0G A;  1GSS A;  3ZYW A;  4ICY A;  1U87 A;  1AQX A;  3L4N A;  4MJB A;  5ECH B;  4EUY A;  1BJX A;  19GS A;  3RDW A;  2QA1 A;  2L57 A;  3ERF A;  1AAZ A;  5ID2 B;  3HKR A;  1FW1 A;  4K6X A;  3LG6 A;  3MAK A;  3APS A;  3HDC A;  1EZK A;  3MDK A;  1FAA A;  4ZBD A;  4G2E A;  2YP6 A;  3I43 A;  3GX8 A;  1YF1 A;  4PNF A;  2YCD A;  2B1L A;  4RQX A;  2DMM A;  1LU4 A;  2LQO A;  3KP9 A;  4YQM A;  4ILF A;  3TKR A;  5LNK e;  1TK0 B;  1TOF A;  1DBY A;  4NV5 A;  2F9S A;  3TJB A;  4FYB A;  4PQ1 A;  2GTU A;  4KUN A;  5D73 A;  1GTI A;  2IME A;  4EXJ A;  1GSQ A;  3DVW A;  13GS A;  3RHB A;  5KN0 A;  3KEB A;  4QL7 A;  5CNW A;  1TK8 B;  3ZML A;  2PPT A;  2LJK A;  4BPY A;  5IIZ A;  3EE2 A;  5J3R A;  4N10 A;  3A2V A;  3N9J A;  2QSI A;  5GAP D;  1IYH A;  1JFU A;  4AJ6 A;  1EOH A;  1X0R A;  3CRT A;  1Z6N A;  1ZYQ B;  4YQV A;  3D0Z A;  4D73 A;  2L6C A;  4IP1 A;  1GNE A;  2RM6 A;  3EIN A;  1K0O A;  1GUM A;  3DKS A;  1SYX A;  3IE3 A;  5B7C A;  4DSR A;  2PUK C;  3TGZ A;  5DJL A;  2FLS A;  5A4U A;  1XW9 A;  3GA4 A;  4EF0 A;  4GSN A;  3FKF A;  4K8M A;  2NDO A;  4WBR D;  1X5C A;  5F07 A;  1R5A A;  4PUA A;  1M9A A;  1K0N A;  1SL1 B;  1Z6M A;  4IJ3 A;  3GFK A;  4MZB A;  4TR3 A;  1HNA A;  4IJI A;  1R5P A;  2GGT A;  2HNL A;  2NPB A;  3PIN A;  4NMU A;  4TR4 A;  1RK4 A;  4NHZ A;  2MMN A;  1QQ2 A;  5KN1 A;  2B5X A;  4KND A;  5ECI B;  4JE1 A;  1GRX A;  2VL2 A;  2YWM A;  5KN2 A;  3GYK A;  1K0C A;  3U5R E;  3P7X A;  1TU8 A;  4CW9 A;  2C3Q A;  1FG4 A;  5EY6 A;  1Y6E A;  4PGT A;  4ZBB A;  1EEM A;  3GL5 A;  1SEN A;  1OYJ A;  1O73 A;  4GF0 A;  1GSD A;  5C04 A;  5FWG A;  2IWT A;  4N0V A;  2YV7 A;  1JZR A;  2A2P A;  1SJI A;  2H30 A;  4LMV A;  4CY6 A;  1PSQ A;  2H0I A;  5AN1 A;  2VD0 A;  4IVF A;  3ZRD A;  5AIS A;  2CT6 A;  1DUG A;  2V32 A;  5B6N A;  2TIR A;  1LBK A;  3D21 A;  2HRA A;  4MH2 A;  4I2T A;  4LL4 B;  2P31 A;  3CSI A;  3LGC A;  4ID0 A;  1WOU A;  3RPN A;  3P2A A;  2C80 A;  1Z7P A;  3WGD A;  2LRT A;  1BYE A;  4BVY A;  1QMV A;  3C71 A;  2RLI A;  1MDJ A;  2CAQ A;  3F3Q A;  4USS A;  4IKH A;  2DC5 A;  4HI7 A;  1THX A;  2F51 A;  3QAV A;  5J9B A;  2C0D A;  4XS6 A;  1PA3 A;  1FO5 A;  2F3M A;  4DSS B;  1W89 A;  1X5D A;  2OAC A;  4J57 E;  2ZCT A;  2X8H A;  1FB0 A;  3PH9 A;  2PGT A;  4LMW A;  12GS A;  2O7K A;  2ALB A;  2BMX A;  3UJ1 A;  3I6A A;  3OR5 A;  4L5L A;  5KOX A;  4NPB A;  3US3 A;  3LFL A;  1ZGN A;  4J56 E;  3F6D A;  1SK1 A;  1PGT A;  2JAC A;  5DAK A;  1F3B A;  1G6W A;  2JAD A;  3FZ4 A;  3NIV A;  5JWR B;  2X8G A;  5G1L A;  2AJQ B;  2VCW A;  2R0G A;  3WGE A;  5CO3 A;  2H1D A;  4AF2 A;  2FWH A;  2VO4 A;  2H19 A;  2L5L A;  3QFB C;  1AXD A;  3IR4 A;  4JZQ A;  2C0E A;  3CSH A;  2VLT A;  2HXK A;  2LNT A;  3NZN A;  8GSS A;  4F0B A;  2A2S A;  4OMV A;  5A4W A;  2QC7 A;  3F4T A;  4HS1 A;  5CRW A;  2VL2 C;  2V6K A;  3ED3 A;  3VUR A;  3GH9 A;  1PN9 A;  1MD4 A;  2PBJ A;  2OA7 A;  3ZFB A;  3GKX A;  4MF6 A;  2JL4 A;  3J7Y b;  4BWQ A;  4EDY A;  5J5N A;  3N5O A;  2GZP A;  2DIY A;  4JU5 A;  4V1A p;  4TOP A;  4JRR A;  3ERG A;  1PKW A;  2P5Q A;  1GWC A;  3K8N A;  4XIH A;  3UOM A;  3R2Q A;  4MZC A;  4TXO A;  4XS4 B;  2BTO T;  3JCM L;  1TP9 A;  4KH7 A;  1XVW A;  2ON7 A;  3L9S A;  4RUV A;  4GST A;  2VLU A;  2B1K A;  5D9X A;  2K18 A;  3TKQ A;  3ZIJ A;  4GLT A;  1HNB A;  1N8J A;  5CYY A;  2R0P A;  3D6I A;  2H71 A;  4N11 A;  2WJU A;  5INY A;  2H6X A;  3ZIV A;  1SYR A;  2VCX A;  3TOU A;  2FWG A;  5DJM A;  4DEJ A;  1PX7 A;  2WB9 A;  1YKC A;  2X4A A;  3APQ A;  2R6K A;  1OVN A;  3FHK A;  4G0I A;  4K7N A;  4O7H A;  1PMT A;  2IFQ A;  3HZ8 A;  2I9H A;  1GP1 A;  5D8I A;  1A24 A;  2CA8 A;  2CVK A;  4F2I A;  2OBI A;  5J41 A;  1YKA A;  1A0F A;  3DGQ A;  4K0G A;  2YAN A;  4O32 A;  1TTZ A;  1GSF A;  4MCU A;  3KIJ A;  4RI6 A;  4V2L A;  3UIW A;  2FHE A;  3TRX A;  1J9B A;  1X5E A;  1TI1 A;  3DVX A;  2GZY A;  2J9H A;  1V9W A;  2HSM A;  2CVB A;  1U6T A;  3P8W A;  2IMI A;  3EU4 A;  1YDK A;  4WET A;  1W4V A;  5IOW A;  1JZD A;  2DJ3 A;  3GSS A;  1SK0 A;  2WS2 A;  2REM A;  3ZVJ A;  3KXO A;  4AJ7 A;  2VCQ A;  4KDX A;  2B7K A;  2M80 A;  4WR5 A;  4KAE A;  1HD2 A;  3KH9 A;  4ECJ A;  5C00 A;  2CZ3 A;  2UZ8 A;  4OWY A;  1O6J A;  4XRD A;  1S3D A;  16GS A;  3HHV A;  2QGV A;  4ECB A;  3C1S A;  4HUA A;  5L71 A;  2WFC A;  2IPA A;  4FH8 A;  5DDL A;  4MF7 A;  4K7O A;  2IMF A;  4O5U A;  2EIQ A;  1GSE A;  4IEL A;  1WMJ A;  4FIW A;  2FWF A;  6GSY A;  2XPE A;  3VFI A;  1T3B A;  3D5J A;  3CYN A;  4F03 A;  1ZYP A;  2LRN A;  1ERU A;  1YEP A;  1QK8 A;  3UAP A;  3LOR A;  2HRN A;  3KJY A;  4IQ1 A;  3H8Q A;  1GUK A;  3EPT A;  2WRT A;  3O76 A;  3M9J A;  2VOC A;  2GSQ A;  1M2A A;  3MNG A;  4Q5R A;  1QGV A;  1ZYE A;  4MF5 A;  4F82 A;  1AC1 A;  2HZE B;  5FHI A;  4PXO A;  1USB A;  2VD1 A;  4ZL9 A;  4O92 A;  4NAX A;  3GKN A;  5ECL B;  5DQY A;  2DKH A;  3C8E A;  4JBB A;  2MYG A;  3TDG A;  4YQU A;  2IMK A;  2WUL A;  2LNS A;  1XZO A;  3BCI A;  4JR4 A;  1OE8 A;  3IK7 A;  1SJ6 A;  5ECS A;  3FZA A;  4DVC A;  1M0U A;  4BA7 A;  4K1F A;  1XVQ A;  1ZL9 A;  1J0F A;  5IPG A;  2PN8 A;  3QMX A;  2H1B A;  1GSU A;  2O85 A;  3CSJ A;  1K0B A;  2I4A A;  4IS0 A;  2CV4 A;  1PQN A;  2RUF A;  1GH2 A;  1XOA A;  3CRU A;  2VCT A;  3GH6 A;  1IYI A;  3ZFL A;  4OFT A;  5A4V A;  2LKU A;  2N5A A;  4POM A;  1VF4 A;  2YJ7 A;  1WJK A;  1EV4 A;  4F9Z A;  3VPT A;  5HFK A;  4NXI A;  1YEX A;  1DE2 A;  1XBS A;  1TW9 A;  2JZR A;  4AJ8 A;  2H1G A;  2GT5 A;  1RQM A;  3FMW A;  1F2E A;  5CRD A;  4G10 A;  1MDK A;  1A8L A;  4TR1 A;  4GXZ A;  3DEX A;  4ZL7 A;  2MMZ A;  1FVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...