4EF0A

Crystal structure of the first catalytic domain of protein disulfide isomerase p5
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
115
structure length
115
Chain Sequence
MVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein disulfide-isomerase A6
publication title Crystal Structure of the first catalytic domain of protein disulfide isomerase P5
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 37
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2012-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ef0A01
1Q98A 4MMMA 4BVXA 3J7Yk 2LRTA 2V41A 2DIZA 2H0IA 5JCWA 5HR3A 2H1DA 4FO5A 3I69A 1HYUA 4ECBA 16GSA 1U3IA 1R7HA 1T1VA 2KLXA 2P5RA 3GL5A 4WXTA 3FHKA 1TK5B 1NM3A 4QL9A 3HYPA 1K3OA 2AJQB 3VPQA 4JEDA 5IMDA 4KH7A 3WT1A 3FYGA 4TR1B 3RPNA 3APOA 3VI5A 1YQ1A 2QGVA 5LNKe 2GVPA 1R26A 1WJKA 1SYRA 4IJIA 3TKPA 3I9V2 4HQZA 2G0FA 2VL2C 1SJ6A 4FIWA 1FHEA 5GZZB 4CHSA 5COHA 5DBQA 1SKSB 2PUKC 4K2DA 5CRDA 5ECSA 3GV1A 2IMDA 3TRQA 4BVYA 1O8WA 2JZRA 4AF2A 5DQYA 2L57A 2H6ZA 1YKAA 2GSRA 2YV7A 1YZXA 2LJAA 19GSA 1EOHA 4MDCA 3CYNA 2NDOA 5ECMB 1LU4A 1WP0A 2CVKA 3A5WA 4NAXA 2HSYA 4MA9A 4N10A 2LEGA 3KMNA 1PL2A 1R4WA 3D4TA 4NPBA 4K9ZA 3UOMA 4E8EA 1GUHA 1JZOA 4JE1A 4PUFC 3IK7A 5ELAA 3G9BA 3WD6A 1YY7A 1IYIA 3EE2A 5EVOA 1UC7A 1WRYA 5C04A 2DSAA 4ZIJA 4G10A 5DAKB 3DEXA 4MZBA 2VOCA 3UEMA 1GLPA 3F0IA 4H86A 2CX4A 3ME7A 4PUAA 2L6DA 1OKDA 4NWYA 3U5RE 5J3RA 1R5PA 5IO0A 3TJFA 3P8WA 5D9VA 1R5AA 3E9JB 2IWTA 2K8VA 4EL1A 2KP2A 1A24A 2C4JA 3GTUA 4IBPA 1QMVA 1ZOFA 1GUKA 3F63A 4PNFA 4IJ3A 2OADA 4EXJA 1A2MA 1GP1A 4HS1A 1EP7A 2FA4A 1YJ6A 3VWWA 4NHZA 3PGTA 1VF1A 3H1NA 3IK9A 2LKUA 2GT6A 2PPTA 2JZSA 5ECOB 22GSA 4N30A 3WGEA 3GKXA 3ISOA 3O6TA 1UVZA 3TJJA 2MMOA 1WIKA 4XS1A 2N5AA 4BA7A 1EV4A 3GKKA 4AGSA 4JRRA 3HZ4A 4MZWA 4OWYA 3DMLA 7GSSA 1ST9A 4GSTA 2CZ2A 5B8AA 2VIMA 4FYCA 2B1KA 3RHCA 4QL7A 2H8LA 2VO4A 1UA5A 2LTKA 4G2EA 4V2LA 4K6XA 1B9YC 5CRHA 2O87A 1OE8A 3HY2A 2JZTA 3LXTA 2GTUA 3LORA 4KE3A 1SYXA 2MMNA 2IMIA 3QAWA 2K8SA 2HXKA 1V57A 4XRDA 1TW9A 5D73A 2LS5A 3BBYA 2H1BA 4GRFA 1EP8A 2BTOT 1GUMA 3D5JA 2H75A 4YQUA 1X9MB 3GNJA 2KOKA 3PR8A 3GKMA 3HZ8A 3PH9A 2L5LA 2B7JA 2FY6A 2IL3A 1Y6EA 3H93A 4MF7A 5CYYA 4GXZA 4L0UA 1VF2A 2AYTA 1ACVA 4RQXA 4I2UA 5FWGA 4V2MA 3FY7A 3ZLPA 3CBUA 2B5XA 3UJ1A 6GSXA 2J23A 3QPMA 3RPPA 2DMLA 1B9XC 5IOXA 4ZL8A 2VCZA 1JLVA 3VWUA 1XVWA 6GSWA 1K0CA 2H0HA 4ZB6A 2C0FA 2WGRA 4P3YB 3AY8A 4IVFA 1KEBA 1QUWA 4FYBA 1FO5A 3F4TA 4POBA 2FA8A 2C0DA 4LA1A 4AJ6A 3MAKA 5H5RA 4WBJA 1TI1A 3TRXA 2PWJA 2JL4A 3Q74A 5ECKB 4TRXA 3M0FA 1TTZA 2FGXA 3QDNA 4K8MA 2H01A 3UVTA 3IOSA 2PMTA 3N5OA 4TN8A 2JU5A 3DWVA 5DALA 2LUSA 3HXSA 2HZEB 3QD9A 2VM1A 2MMAA 1XFLA 4MPFA 4HEA2 5DCGA 3V1WA 1T3BA 4IKHA 1TP9A 3ZITA 4BPYA 2K18A 3IE3A 3A2WA 2KUCA 3UVHA 3ZTLA 4OFMA 1YF1A 2DC5A 5E59A 1FVKA 4I2TA 3Q18A 2FHEA 2JACA 2F8AA 3KZQA 6GSSA 5A4WA 4QQ7A 3MNGA 4OO5A 2VLTA 2EIRA 2MBTA 1AQWA 3ERFA 4EE0A 1O81A 2ALBA 1B4PA 2FWHA 4WKWA 5ECPB 4HOJA 1C72A 1SJZA 3KJYA 1M99A 5HFGA 2GZYA 1GTBA 1SD8A 2K6VA 3LQ7A 4EDYA 1FOVA 4MPGA 1XZOA 1GRXA 3F4RA 1A2LA 4XS4A 2F51A 1XWCA 1S3AA 4EKZA 1HD2A 4TKYA 3KH9A 2HRNA 1HQOA 4IP1A 3HJMA 4ACSA 2LQQA 4MK3A 2GQLA 3ZMLA 2X8HA 1F3AA 2R6KA 6GSUA 2F8FA 2H19A 3IPZA 2C0EA 4KDYA 2CT6A 2GSTA 1AAZA 4KGIA 1M9BA 1KTEA 1G7OA 4V2NA 2H1GA 2RUEA 1ZZYA 3DXBA 1OC9A 5ENUA 2A2SA 5KN0A 4MJBA 1V9WA 4F0BA 5C00A 2PN8A 2CVDA 1GH2A 3ZFLA 1O8XA 4HQSA 4WBRD 5D8IA 1O73A 4HJ2A 3JCML 2X8GA 4KCAA 3I43A 3C1RA 1G6YA 4J2FA 1PKWA 1ON4A 1SU9A 3H79A 2B3SA 5IQYA 1AIUA 4DVCA 3FK8A 2C8UA 2VL3A 2PBJA 3IXRA 3G7JA 3H4KA 3TKSA 2MBSA 3IBHA 1O85A 2YWMA 3F3QA 1DUGA 4ZBBA 5CO3A 5G5FA 3UARA 5HR2A 4YQMA 1K0AA 2DJKA 5IMFA 4XCSA 3GA4A 2A4VA 1PX6A 4DSQA 4G19A 4KDUA 2E7PA 4BWQA 3KEBA 5B6MA 1AQXA 3U6VA 3FEUA 3LWAA 5HFIA 1U6TA 1V2AA 1XWAA 2VL9A 2IFQB 3FRCA 3UIWA 1EWXA 1J9BA 3LYKA 4KDXA 5EL8A 2X99A 1TKDB 3IRAA 4WR5A 3HD5A 2V6KA 4E8HA 3KM6A 2IMKA 3HCZA 3E0UA 4FH8A 2REMA 2RLIA 1ZGNA 3RDWA 4O5RA 2H30A 1Z9HA 1MDJA 5DJLA 3HDCA 5L71A 1A23A 2E2MA 2FWEA 2H71A 2FLSA 3P7XA 5AGYA 2AB6A 1B48A 3SWLA 1Q4JA 3QFBC 4KSMA 1M2BA 3TJGA 5ID2B 5ECIB 18GSA 3KTLA 1AXDA 3GUSA 4GWRA 3SBCA 2N5FA 2VD1A 1X5EA 5IMAA 1URMA 2XPDA 3GRXA 1GSUA 4X43A 1W89A 3TGZA 2NVLA 6GSYA 5DQSA 2NBSA 3GFKA 3VI7A 3G7YA 4IHUA 2GDRA 4LMVA 1NHOA 2BMXA 2VM2A 2PVQA 3L4NA 5GAPD 3E3EA 1BQ7A 2Z9SA 2P31A 1VGLA 1A8YA 1MDIA 4Z7XA 4KAEA 4PQIA 2PVOC 4OO4A 2H6XA 4K7IA 1Z7PA 4K0NA 5F06A 3GYKA 4O92A 2WDUA 4ULXA 1TI3A 3KCMA 4MJAA 2LSTA 4TXVA 14GSA 3IC4A 2JADA 3IR4A 3ZFBA 3KXOA 1OC8A 5AISA 4MH2A 5AIXA 3F9UA 1NSWA 2DBCA 5G1LA 3M8NA 4I5QA 4HI7A 2A2RA 4RUVA 4POKA 1M0UA 3LYPA 1XIYA 3EYTA 1DE2A 2CV4A 2WRTA 4K1FA 4DSRA 4O7HA 4IN0A 4POLA 4L0WA 4YAVA 4OFNA 3M9KA 2IPAA 2LRNA 3P2AA 1GWCA 3DKSA 1WMJA 5ECHB 1GULA 4ZXGA 1B4QA 4EVMA 2YWNA 2YNXA 2FWGA 1THOA 4MJCA 2YJ7A 3BOAA 1G0TA 2R2JA 4AJ8A 2XPEA 3OR5A 3M9JA 1ILOA 3C1SA 3KIJA 2LNSA 5IMCA 2VCTA 2O85A 2B5YA 2IN3A 5G2ZA 1AQVA 5ABRA 2C3NA 5ECLB 3C7MA 1G7EA 2L6CA 4NV2A 1XXUA 4ZILA 2LNTA 5G5EA 1GNWA 2WULA 3APSA 1GSEA 2FNOA 2EIQA 3F6DA 4D73B 2IMEA 1O7UA 3TJBA 2YOIA 2OE3A 1SKRB 3VURA 3S9FA 2R4VA 2YZHA 4KSOA 4XHMA 4ZL9A 5D96A 4OD7A 5JCUA 3KP8A 1GSSA 4TR0A 1N2AA 5KEJA 1LBKA 1JHBA 4NMUA 1ZYEA 4TR1A 4EUYA 2DMMA 2HZFA 2GQKA 2VCWA 3KMOA 3KTBA 1TXXA 4DSSB 4I8BA 2E2GA 2F9SA 4IELA 1K0OA 3ZIVA 5KN2A 1QQ2A 2FWFA 1JZRA 1MD3A 3WT2A 4KUNA 3LG6A 4OCEA 1VRSD 2H74A 4TXOA 4BWSA 1EGRA 2ZUPA 3BCIA 4FYUA 1XW9A 2DJJA 2DLXA 5B6NA 4GSSA 4RI7A 2VD0A 1BYEA 3WGXA 1GSYA 3LEFA 4ML6A 3GH6A 4GCIA 2CQ9A 4HZ2A 3TOUA 6GSTA 3HVSA 1K0MA 4GSNA 2VUPA 3DRNA 1THXA 4JBBA 3MDKA 4XTSA 4PXOA 2KP1A 5G30A 20GSA 2D2ZA 4K7OA 4X1UA 1DSBA 1EZKA 2H72A 2HI7A 1ERTA 3FW2A 1EV9A 3BD2A 1XWBA 2XBQA 3L9VA 2LQOA 2FUG2 1SJIA 4NXIA 2VCXA 1A0RP 4LMWA 3GIXA 2TIRA 4N0VA 4PNGA 5IMZA 3BCKA 2HSHA 1KBNA 1RK4A 2OJLA 1G6WA 3Q6OA 5DAKA 5AIVA 2AAWA 3M1GA 5HFKA 3CTFA 4KCEA 4MZCA 1GTIA 5A5KA 1TK0B 3L9UA 3FR3A 4RI6A 2G2QA 1XWGA 3MWHA 3ZVJD 1KNGA 3GN3A 1SK0A 3QCPA 1PL1A 2B1LA 5DJMA 3ZREA 1SK1A 2L5OA 3ZL5A 4ECIA 2RUFA 3EMXA 5B8BA 3TKSC 5EPFA 2MMZA 5IMVA 2WZ9A 4MCUA 1AUCA 4KA0A 2I9HA 4ECCA 3FZAA 4IQAA 5D9TA 5DCHA 5INYA 4BL7A 1OC3A 4ISDA 4AJ7A 1V98A 3FR6A 1BG5A 4KNDA 5F8BA 4K7NA 3RAZA 2AV4A 5JWQB 4L5OA 1JLWA 1SK2A 4V1Ap 1QFNA 2WFCA 2YCDA 1VF4A 6GSVA 4N0ZA 1TU7A 5A4UA 4POMA 1ZCPA 2GSSA 1F2EA 3WYWA 1BEDA 3FZ9A 2LJRA 4YAPA 1ERUA 4EF0A 5F0GA 2OBKA 1RW1A 1T4YA 1OVNA 3FKFA 2R3XA 1GSDA 3PINA 1U88A 1DBYA 3W8JA 3HJOA 2GZZA 4XS6A 2M46A 3O76A 2H6YA 2TRCP 2H70A 1XOBA 3GHAA 1A0FA 1K0NA 3EWLA 3IHQA 5LCZA 1FW1A 1LJRA 2WJUA 3GTUB 1EEMA 3FZ4A 4ECJA 2GZPA 1S3DA 2IMFA 2OA7A 3VLNA 1K0DA 3GSTA 3HHVA 3N9JA 4PURA 1YF0A 1SD9A 2WS2A 3I6AA 2L4CA 2OE1A 1I5GA 2B6MA 3H8QA 1F9MA 2YANA 4F82A 5FT3A 1AC1A 2C3QA 2WB9A 2AHEA 2LV3A 1M2DA 3CSHA 5HR0A 1EEJA 4XRAA 2ON5A 2VCQA 5CRWA 4CW9A 2ZNMA 3IAM2 3US3A 5G31A 1WOUA 2BJXA 2ES7A 2DJ3A 4ZB8A 4PQHA 1RQMA 2X8CA 5ECNB 1USBA 3TOTA 2E0QA 3NOFA 1M9AA 3VFIA 1F6MC 4LL1B 1TRVA 1FB0A 4HU7A 2HZEA 1M2AA 3QAGA 4WETA 5LD0A 3J7Yb 1QXHA 3RBTA 3KP9A 1T7PB 4WF5A 1XPVA 2AUVA 4I6XA 1Z6NA 3EMPA 2QSIA 3GX0A 4HU9A 3VPTA 2V2GA 4CDOA 3ME8A 2GQMA 4ZL7A 5KN3A 4ILFA 3D21A 2QC7A 1E2YA 1F3BA 1OYJA 4TVEA 5J5NA 3TJKA 2YJHA 1FG4A 5A4VA 2ON7A 4ZBAA 1XCCA 5CAXA 3QAVA 2OKAA 3UBLA 1Z5YE 3HVVA 2C80A 4MH3A 3LXZA 4TXOB 1N8JA 1UN2A 3LSZA 4Q5RA 4N11A 2PU9C 4JU5A 3HJPA 1SENA 2I1UA 4EC0A 2RIIA 4WR4A 2JSZA 1SL1B 1MTCA 2P0GA 3VWVA 1JZDA 3ZYWA 3RHBA 1Z6MA 2IJYA 4G9HA 4XIHA 4JZQA 1K0BA 5J9CA 2GLRA 3F4SA 1XWKA 2HE3A 2XHFA 3A3TA 1H4OA 4TR3A 4MF6A 1J0FA 2V6OA 1T4ZA 5DALB 1T8EB 3FR9A 2WCIA 2I81A 1AW9A 3ZZXA 1GLQA 2GSQA 4TR4A 1TRUA 4F2IA 3GURA 3APQA 2EC4A 2C3TA 1PA3A 1TU8A 5CREA 2OBIA 1K3YA 2GS3A 3NIVA 1GSFA 2L59A 2NTOA 5J9BA 2GGTA 2HLSA 2VL2A 2FD3A 2I3YA 1JZWA 1MEKA 4EDZA 4OMVA 1FAAA 3CMIA 8GSSA 1TRSA 4Q5QA 1M7TA 1PSQA 1WWJA 3GH9A 5IOWA 4IW9A 3CTGA 4O32A 1TK8B 1CQGA 3M3MA 2DIYA 3DD3A 3LJRA 3WGDA 3HVXA 4F03A 3ZIJA 3L9SA 4ZB9A 3DIEA 4KW6A 2HNLA 5D93A 1A8LA 1BJXA 12GSA 4KB3A 1WPIA 5DDLA 3LFLA 5JWRB 4ML1A 1Z3EA 2RM5A 2YWOA 4XS4B 2N5BA 3TB2A 3O3TA 4J57E 3GSSA 2V32A 4YH2A 2YV9A 3CSIA 13GSA 3TUEA 1XVQA 3CSJA 4IS0A 2IFQA 2YP6A 1QGVA 3CXGA 5HQPA 1YDKA 3IV4A 2K9FA 1A2JA 2XC2A 1J08A 5H5SA 1U3AA 1X0RA 4I97A 2CAIA 2I4AA 2R37A 5CNWA 5CP1A 1PKZA 4HUAA 1OE7A 1OC9B 1FVJA 1TDIA 3TKQA 2RM6A 2B7KA 4Q5NA 1XBSA 1Y25A 5FHIA 3L0HA 3ED3A 1ABAA 3DVWA 4HJMA 4MLYA 5IIZA 2B5EA 5IPGA 2R5GA 1PGTA 4PX1A 1MDKA 5ID2A 5ECQB 1VF3A 1X5DA 3TKSE 5B7CA 3CRUA 1XW5A 2VLUA 5DVBA 2VCVA 2HRFA 4L5LA 3QMXA 17GSA 3EU4A 2O8VB 3ZRDA 2TRXA 2CZ3A 1IYHA 1XW6A 3GL3A 1PD21 1YEXA 3CRTA 2FCHA 2H76A 2KHPA 2JSYA 3Q19A 3GMFA 4GF0A 3IA1A 1K3LA 2IIYA 3EINA 1MD4A 5KN1A 1GNEA 4YQVA 2M80A 5J4UA 4TW5A 1HNAA 5F05A 3EURA 4IGJA 3IAS2 5GAND 4GLTA 3KH7A 5H5QA 4F9ZA 3VWXA 3NZNA 5JCGA 2HFDA 1ZMAA 4PQ1A 4OFTA 1OKTA 1GL8A 4OCFA 2P5QA 1XOAA 4HZ4A 1X5CA 1DE1A 1X9WB 2MZCA 4GTUA 3ERGA 3C73A 3L78A 1WE0A 1QK8A 2PERA 1OAZA 3R2QA 1YEPA 2OACA 1PRXA 4DEJA 2OE0A 5E4WA 5J41A 2CVBA 4K0GA 2YZUA 4MP4A 3VK9A 4GQFA 1FB6A 3UL3A 3UMAA 3P90A 1TRWA 5D9WA 3TDGA 3QFAC 3DGQA 1S3CA 4IP6A 3HA9A 4LL4B 1GTUA 5IM9A 1V40A 4F0CA 3HKRA 4V1Ag 3UAPA 1NW2A 4RQRA 2L4QA 10GSA 4MJEA 2C1YA 1CQHA 2H0GA 1I9DA 5GSTA 5IO2A 4TOPA 1TJDA 2YPMA 2GT5A 2CA8A 2XBIA 5ECRB 3ERWA 4MABA 4KX4A 2F3MA 2M72A 2H66A 3BJ5A 4NV5A 4X0XA 1ML6A 1O6JA 4ID0A 1BAYA 5GSSA 4L8EA 2C0GA 2LJKA 3DYRA 2YN1A 3K8NA 2O7KA 3EC3A 3LGCA 5G1KA 3F6FA 5CRGA 3IDVA 3A2VA 3MSZA 2HT9A 3TCOA 3W8SA 3ZVJA 1W4VA 3F3RA 5AN1A 4JR6A 1PQNA 4Q5FA 2DJ1A 1SKWB 2CX3A 3D22A 1HNCA 1V58A 5EY6A 5IPHA 3TKRA 4WF4A 2MYGA 4JR4A 4D73A 1U87A 2QKEA 1PMTA 2LRCA 2VAFA 1ZL9A 1PX7A 9GSSA 4EO3A 2H73A 3F8UA 3D4MA 3G7IA 1SL2B 4J56E 2VLVA 5D9XA 1B8XA 3A2XA 5HR1A 2X64A 1BX9A 4MF5A 2DJ0A 5F07A 2EIOA 1SL0B 11GSA 1Z7RA 3W6GA 5ELGA 3GKNA 1T00A 3D6IA 1GSQA 4HDEA 1YKCA 3QR6A 5JWOB 1ZYQB 1ERVA 1TOFA 2H1AA 1PN9A 2DJ2A 3DVXA 3KD0A 3EVIA 1NHYA 4PGTA 4DSSA 3UBKA 3D0ZA 1EOGA 2HYXA 3FZ5A 2O89A 1EGOA 2J9HA 3TRPA 4IQ1A 1X9SB 1F37A 2ZCTA 2YWIA 3EU3A 3GX8A 3KGKA 2CAQA 2NPBA 3C8EA 2V1MA 1ERWA 4LLRA 4ZBDA 1GTAA 1JFUA 3C71A 4NHWA 3ZMKA 2PGTA 4WEYA 1HNBA 3QOUA 1E6BA 1H75A 4GQCA
chains in the Genus database with same CATH superfamily
1Q98A 4MMMA 4BVXA 3J7Yk 2LRTA 2V41A 2DIZA 2H0IA 5JCWA 5HR3A 2H1DA 4FO5A 3I69A 1HYUA 4ECBA 16GSA 1U3IA 1R7HA 1T1VA 2KLXA 2P5RA 3GL5A 4WXTA 3FHKA 2X4AA 1ZYNA 1TK5B 1NM3A 4QL9A 3HYPA 1K3OA 2AJQB 3VPQA 4JEDA 5IMDA 4KH7A 3WT1A 3FYGA 4TR1B 3RPNA 3APOA 3VI5A 1YQ1A 3PPUA 2QGVA 5LNKe 2GVPA 1R26A 1WJKA 1SYRA 4IJIA 3TKPA 3I9V2 4HQZA 2G0FA 2VL2C 1SJ6A 4FIWA 1FHEA 4YKFA 2DKIA 5GZZB 4CHSA 5COHA 3A5IA 5DBQA 1SKSB 2QA2A 2PUKC 4K2DA 2A2PA 5CRDA 5ECSA 3GV1A 2IMDA 3TRQA 4BVYA 1O8WA 2JZRA 4AF2A 5DQYA 2L57A 2H6ZA 1YKAA 2GSRA 2YV7A 1YZXA 2LJAA 19GSA 1EOHA 4MDCA 3CYNA 5KOWA 2NDOA 5ECMB 1LU4A 1WP0A 2CVKA 3A5WA 4NAXA 2HSYA 4MA9A 4N10A 2LEGA 3KMNA 1PL2A 1R4WA 3D4TA 4NPBA 4K9ZA 3UOMA 4E8EA 1GUHA 1JZOA 4JE1A 4PUFC 3IK7A 5ELAA 3G9BA 3WD6A 1YY7A 1IYIA 3EE2A 5EVOA 1UC7A 1WRYA 5C04A 2DSAA 4ZIJA 4G10A 5DAKB 3DEXA 4MZBA 2VOCA 3UEMA 1GLPA 3F0IA 4H86A 2CX4A 3ME7A 4PUAA 2L6DA 1OKDA 4NWYA 3U5RE 5J3RA 1R5PA 5IO0A 3TJFA 3P8WA 5D9VA 1R5AA 3E9JB 2IWTA 2K8VA 4EL1A 2KP2A 1A24A 2C4JA 3GTUA 4IBPA 1QMVA 1ZOFA 1GUKA 3F63A 4PNFA 4IJ3A 2OADA 4EXJA 1A2MA 1GP1A 4HS1A 1EP7A 2FA4A 1YJ6A 3VWWA 4NHZA 3PGTA 4BL7B 1VF1A 3H1NA 3IK9A 2LKUA 2GT6A 2PPTA 2JZSA 5ECOB 22GSA 4N30A 3WGEA 3GKXA 3ISOA 3O6TA 1UVZA 3TJJA 2MMOA 1WIKA 4XS1A 2N5AA 4BA7A 1EV4A 3GKKA 4AGSA 4JRRA 4ICYA 3HZ4A 4MZWA 4OWYA 3DMLA 7GSSA 1ST9A 4GSTA 2CZ2A 5B8AA 2VIMA 4FYCA 2B1KA 3RHCA 4QL7A 2H8LA 2VO4A 1UA5A 2LTKA 4G2EA 4V2LA 4K6XA 1B9YC 5CRHA 2O87A 1OE8A 3LW9A 3HY2A 2JZTA 3LXTA 2GTUA 3LORA 4KE3A 1SYXA 2MMNA 2IMIA 3QAWA 2K8SA 2HXKA 1V57A 4XRDA 1TW9A 5D73A 2X49A 2LS5A 3BBYA 2H1BA 4GRFA 1EP8A 2BTOT 1GUMA 3D5JA 2H75A 4YQUA 1X9MB 4A5PA 3GNJA 2KOKA 3PR8A 3GKMA 3HZ8A 3PH9A 4EIPA 2L5LA 2B7JA 2FY6A 2IL3A 1Y6EA 3H93A 4MF7A 5CYYA 4GXZA 3EPTA 4L0UA 1VF2A 2AYTA 1ACVA 4RQXA 4I2UA 5FWGA 4PTSA 4V2MA 3FY7A 3ZLPA 3CBUA 2B5XA 3UJ1A 3IC8A 6GSXA 2J23A 3QPMA 3RPPA 2DMLA 1B9XC 5IOXA 4ZL8A 2VCZA 1JLVA 3VWUA 1XVWA 6GSWA 1K0CA 2H0HA 4ZB6A 2C0FA 2WGRA 4P3YB 3AY8A 4IVFA 1KEBA 1QUWA 4FYBA 1FO5A 3F4TA 4POBA 2FA8A 2C0DA 4LA1A 4AJ6A 3MAKA 5H5RA 4WBJA 1TI1A 3TRXA 2PWJA 2JL4A 3Q74A 5ECKB 4TRXA 3M0FA 1TTZA 2FGXA 3QDNA 4K8MA 2H01A 3UVTA 3IOSA 2PMTA 3N5OA 4TN8A 2JU5A 3DWVA 5DALA 2LUSA 3HXSA 2HZEB 3QD9A 2VM1A 2MMAA 1XFLA 4MPFA 4HEA2 5DCGA 3V1WA 1T3BA 4IKHA 1TP9A 3ZITA 4BPYA 2K18A 3IE3A 3A2WA 2KUCA 3UVHA 3ZTLA 4OFMA 1YF1A 2DC5A 3IHGA 5E59A 1FVKA 4I2TA 3Q18A 2FHEA 2JACA 2F8AA 3KZQA 6GSSA 5A4WA 4QQ7A 3MNGA 4OO5A 2VLTA 2EIRA 2MBTA 1AQWA 3ERFA 4EE0A 1O81A 2ALBA 1B4PA 2FWHA 4WKWA 4K5SA 5ECPB 5BMUA 4HOJA 1C72A 1SJZA 3KJYA 1M99A 5HFGA 2GZYA 1GTBA 1SD8A 2K6VA 3LQ7A 4EDYA 1FOVA 4MPGA 1XZOA 1GRXA 3F4RA 1A2LA 4XS4A 2F51A 1XWCA 1S3AA 4EKZA 1HD2A 4TKYA 3KH9A 2HRNA 1HQOA 4IP1A 3HJMA 4ACSA 2LQQA 4MK3A 2GQLA 3ZMLA 2X8HA 1F3AA 2R6KA 6GSUA 2F8FA 2H19A 3IPZA 2C0EA 4KDYA 2CT6A 2GSTA 1AAZA 4KGIA 1M9BA 1KTEA 1G7OA 4V2NA 2H1GA 2RUEA 1ZZYA 3DXBA 1OC9A 5ENUA 2A2SA 5KN0A 4MJBA 1V9WA 4F0BA 5C00A 2PN8A 2CVDA 1GH2A 3ZFLA 1O8XA 4HQSA 4WBRD 5D8IA 1O73A 4HJ2A 3JCML 2X8GA 4KCAA 1PN0A 3I43A 3C1RA 1G6YA 4J2FA 1PKWA 1ON4A 1SU9A 3H79A 2B3SA 5IQYA 1AIUA 4DVCA 3FK8A 2C8UA 2VL3A 2PBJA 3IXRA 3G7JA 3H4KA 3TKSA 2MBSA 3IBHA 1O85A 2YWMA 3F3QA 2R0PA 1DUGA 4ZBBA 5CO3A 5G5FA 3UARA 5HR2A 4YQMA 1K0AA 2DJKA 5IMFA 4XCSA 3GA4A 2A4VA 1PX6A 4DSQA 4G19A 4KDUA 2E7PA 4BWQA 3KEBA 5B6MA 1AQXA 3U6VA 3FEUA 3LWAA 5HFIA 1U6TA 1V2AA 1XWAA 4K5RA 2VL9A 2IFQB 3FRCA 3UIWA 1EWXA 1J9BA 3LYKA 4KDXA 5EL8A 2X99A 4Z2RA 1TKDB 3IRAA 4WR5A 3HD5A 2V6KA 4E8HA 3KM6A 2IMKA 3HCZA 3E0UA 4FH8A 2REMA 2RLIA 1ZGNA 3RDWA 4O5RA 2H30A 1Z9HA 1MDJA 5DJLA 3HDCA 4EIQA 5L71A 1A23A 2E2MA 2FWEA 2H71A 2FLSA 3P7XA 5AGYA 2AB6A 1B48A 3SWLA 1Q4JA 3QFBC 4KSMA 1M2BA 3TJGA 5ID2B 5ECIB 4X4JA 18GSA 3KTLA 1AXDA 3GUSA 4GWRA 3SBCA 1ZYPA 2N5FA 2VD1A 1X5EA 5IMAA 1URMA 2XPDA 3GRXA 1GSUA 4X43A 1W89A 4G0LA 3TGZA 2NVLA 6GSYA 5DQSA 2NBSA 3GFKA 3VI7A 3G7YA 4IHUA 2GDRA 4LMVA 1NHOA 2BMXA 2VM2A 2PVQA 3L4NA 5GAPD 3E3EA 1BQ7A 2Z9SA 2P31A 1VGLA 1A8YA 1MDIA 4Z7XA 4KAEA 4PQIA 2PVOC 4OO4A 2H6XA 4K7IA 1Z7PA 4K0NA 5F06A 3GYKA 4O92A 2WDUA 4ULXA 1TI3A 3KCMA 4G0IA 4MJAA 2LSTA 4TXVA 14GSA 3IC4A 2JADA 2HRAA 3IR4A 3ZFBA 3KXOA 1OC8A 5AISA 4MH2A 5AIXA 3F9UA 1NSWA 2DBCA 5G1LA 3M8NA 4Z2TA 4I5QA 4HI7A 2A2RA 4RUVA 4POKA 2R0GA 1M0UA 3LYPA 1XIYA 3EYTA 1DE2A 2CV4A 2WRTA 4K1FA 4DSRA 4O7HA 4IN0A 4POLA 4MNNA 4L0WA 4YAVA 4OFNA 3M9KA 2IPAA 2LRNA 3P2AA 1GWCA 3DKSA 1WMJA 5ECHB 1GULA 4YKGA 4ZXGA 1B4QA 4EVMA 2YWNA 2YNXA 2FWGA 1THOA 4MJCA 2YJ7A 3BOAA 1G0TA 2R2JA 4AJ8A 2XPEA 3OR5A 3M9JA 1ILOA 3C1SA 3KIJA 2LNSA 5IMCA 2VCTA 2O85A 2B5YA 2IN3A 5G2ZA 1AQVA 5ABRA 2C3NA 5ECLB 3C7MA 1G7EA 2L6CA 4NV2A 1XXUA 4ZILA 4O5UA 4FQUA 2LNTA 5G5EA 1GNWA 2WULA 3APSA 1GSEA 2FNOA 2EIQA 3F6DA 4D73B 2IMEA 1O7UA 3TJBA 2YOIA 2OE3A 1SKRB 3VURA 3S9FA 2R4VA 2YZHA 4KSOA 4XHMA 4ZL9A 5D96A 4OD7A 5JCUA 3KP8A 1GSSA 4TR0A 1N2AA 5KEJA 1LBKA 1JHBA 4NMUA 2UZ8A 1ZYEA 4TR1A 4EUYA 2DMMA 2HZFA 2GQKA 2VCWA 3KMOA 3KTBA 1TXXA 4DSSB 4I8BA 2E2GA 2F9SA 4IELA 1K0OA 3ZIVA 5KN2A 1QQ2A 2FWFA 3CQFA 1JZRA 1MD3A 1M3IA 3WT2A 4KUNA 3LG6A 4OCEA 1VRSD 5BRTA 2H74A 4TXOA 4BWSA 1EGRA 2ZUPA 3BCIA 4FYUA 1XW9A 2DJJA 2DLXA 5B6NA 4GSSA 4RI7A 2VD0A 1BYEA 3WGXA 1GSYA 3LEFA 4ML6A 3GH6A 4GCIA 1XG8A 2CQ9A 4HZ2A 3TOUA 6GSTA 4BVXB 3HVSA 1K0MA 4GSNA 2VUPA 3DRNA 1THXA 4JBBA 4Z2UA 3MDKA 4XTSA 4PXOA 2KP1A 5G30A 20GSA 2D2ZA 4K7OA 4X1UA 1DSBA 1EZKA 2H72A 2HI7A 1ERTA 3FW2A 1EV9A 3BD2A 1XWBA 2XBQA 3L9VA 2LQOA 2FUG2 1SJIA 4NXIA 2VCXA 1A0RP 4LMWA 3GIXA 2TIRA 4N0VA 4PNGA 5IMZA 3BCKA 2HSHA 1KBNA 1RK4A 2OJLA 1G6WA 3Q6OA 5DAKA 5AIVA 2AAWA 3M1GA 5HFKA 3MYDA 3CTFA 4KCEA 4MZCA 1GTIA 5A5KA 1TK0B 3L9UA 3FR3A 4RI6A 2G2QA 1XWGA 3MWHA 3ZVJD 1KNGA 3GN3A 3R3EA 1SK0A 3QCPA 1PL1A 2B1LA 5DJMA 3ZREA 1SK1A 2L5OA 3ZL5A 4ECIA 2RUFA 3EMXA 5B8BA 3TKSC 5EPFA 2MMZA 4BVYB 5IMVA 2WZ9A 4MCUA 1AUCA 4KA0A 2I9HA 4ECCA 3FZAA 4IQAA 5D9TA 5DCHA 5INYA 4BL7A 1OC3A 4ISDA 4AJ7A 1V98A 3FR6A 1BG5A 4KNDA 2HSMA 5F8BA 4K7NA 2A4HA 3RAZA 2AV4A 5JWQB 4L5OA 1JLWA 1SK2A 4V1Ap 1QFNA 2WFCA 2YCDA 1VF4A 6GSVA 4N0ZA 1TU7A 5A4UA 4POMA 1ZCPA 2GSSA 1F2EA 3WYWA 1BEDA 3FZ9A 2LJRA 4YAPA 1ERUA 4EF0A 5F0GA 2OBKA 1RW1A 1T4YA 1OVNA 3FKFA 2R3XA 1GSDA 3PINA 1U88A 1DBYA 3W8JA 3HJOA 2GZZA 4XS6A 2M46A 3O76A 2H6YA 2TRCP 2H70A 1XOBA 3GHAA 1A0FA 1K0NA 3EWLA 3IHQA 5LCZA 1FW1A 1LJRA 2WJUA 3GTUB 2QA1A 1EEMA 3FZ4A 4ECJA 2GZPA 1S3DA 2IMFA 2OA7A 3VLNA 1K0DA 4CY8A 3GSTA 3HHVA 3N9JA 4PURA 1YF0A 1SD9A 2WS2A 3I6AA 2L4CA 2HRKA 2OE1A 1I5GA 2B6MA 3H8QA 1F9MA 2YANA 4F82A 5FT3A 2R0CA 1AC1A 2C3QA 2WB9A 2AHEA 2LV3A 1M2DA 3CSHA 5HR0A 1EEJA 4XRAA 2ON5A 2VCQA 5CRWA 4CW9A 2ZNMA 3IAM2 3US3A 5G31A 1WOUA 2BJXA 2ES7A 2DJ3A 4ZB8A 4PQHA 1RQMA 2X8CA 5ECNB 1USBA 3TOTA 2E0QA 3NOFA 1M9AA 3VFIA 1F6MC 4USSA 4LL1B 1TRVA 1FB0A 4HU7A 2HZEA 1M2AA 3QAGA 4WETA 5LD0A 3J7Yb 1QXHA 3RBTA 3KP9A 1T7PB 4WF5A 1XPVA 2AUVA 4I6XA 1Z6NA 3EMPA 2QSIA 3GX0A 4HU9A 3VPTA 2V2GA 4CDOA 3ME8A 2GQMA 4ZL7A 5KN3A 4ILFA 3D21A 4CY6A 2QC7A 1E2YA 1F3BA 1OYJA 4TVEA 5J5NA 3TJKA 2YJHA 1FG4A 5A4VA 5KOXA 2ON7A 4ZBAA 1XCCA 4KF9A 3QAVA 5CAXA 2OKAA 3UBLA 1Z5YE 3HVVA 2C80A 4MH3A 3LXZA 4TXOB 1N8JA 1UN2A 3LSZA 4Q5RA 4N11A 2PU9C 4JU5A 3HJPA 1SENA 2I1UA 4EC0A 2RIIA 4WR4A 2JSZA 3HVNA 1SL1B 1MTCA 2P0GA 1M3JA 3VWVA 1JZDA 3ZYWA 3RHBA 1Z6MA 2IJYA 4HSCX 4G9HA 4XIHA 4JZQA 1K0BA 5J9CA 2GLRA 3F4SA 1XWKA 2HE3A 2XHFA 4K2XA 3A3TA 1H4OA 4TR3A 4MF6A 1J0FA 2V6OA 1T4ZA 5DALB 1T8EB 3FR9A 2WCIA 2I81A 1AW9A 1FOHA 3ZZXA 1GLQA 2GSQA 4TR4A 1TRUA 4F2IA 3GURA 3APQA 2EC4A 2C3TA 1PA3A 1TU8A 5CREA 2OBIA 1K3YA 2GS3A 3NIVA 1GSFA 2L59A 2NTOA 5J9BA 2GGTA 2HLSA 2VL2A 2FD3A 2I3YA 1JZWA 1MEKA 4EDZA 4OMVA 1FAAA 3CMIA 8GSSA 1TRSA 4Q5QA 1M7TA 1PSQA 1WWJA 3GH9A 5IOWA 4IW9A 3CTGA 4O32A 1TK8B 2DKHA 1CQGA 3M3MA 2DIYA 3DD3A 3LJRA 3WGDA 3HVXA 4F03A 3ZIJA 3L9SA 4ZB9A 3DIEA 4KW6A 2HNLA 5D93A 1A8LA 1BJXA 12GSA 4KB3A 1WPIA 5DDLA 3LFLA 5JWRB 4ML1A 1Z3EA 2RM5A 2YWOA 4XS4B 2N5BA 3TB2A 3O3TA 4J57E 3GSSA 2V32A 4YH2A 2YV9A 3CSIA 13GSA 3TUEA 1XVQA 3CSJA 4IS0A 2IFQA 2YP6A 1QGVA 3CXGA 3FMWA 5HQPA 1YDKA 3IV4A 2K9FA 1A2JA 2XC2A 1J08A 5H5SA 1U3AA 1X0RA 4I97A 2CAIA 2I4AA 2R37A 5CNWA 5CP1A 1PKZA 4HUAA 1OE7A 1OC9B 1FVJA 1TDIA 3TKQA 2RM6A 2B7KA 4Q5NA 1XBSA 1Y25A 5FHIA 3L0HA 3MIXA 3ED3A 4G0KA 1ABAA 3DVWA 4HJMA 4MLYA 5IIZA 2B5EA 5IPGA 2R5GA 1PGTA 4PX1A 1MDKA 5ID2A 5ECQB 1VF3A 1X5DA 3TKSE 5B7CA 3CRUA 1XW5A 2VLUA 5DVBA 2VCVA 2HRFA 4L5LA 3QMXA 17GSA 3EU4A 2O8VB 3ZRDA 2TRXA 2CZ3A 1IYHA 1XW6A 3GL3A 1PD21 1YEXA 3CRTA 2FCHA 2H76A 2KHPA 2JSYA 3Q19A 3GMFA 4GF0A 3IA1A 1K3LA 2IIYA 3EINA 1MD4A 5KN1A 1GNEA 4YQVA 2M80A 5J4UA 4TW5A 1HNAA 5F05A 3EURA 4IGJA 3IAS2 5GAND 4GLTA 3KH7A 5H5QA 4F9ZA 3VWXA 3NZNA 5JCGA 2HFDA 1ZMAA 4PQ1A 4OFTA 1OKTA 1GL8A 4OCFA 2P5QA 1XOAA 4HZ4A 1X5CA 1DE1A 1X9WB 2MZCA 4GTUA 3ERGA 3C73A 3L78A 1WE0A 1QK8A 2PERA 1OAZA 3R2QA 1YEPA 2OACA 1PRXA 4DEJA 2OE0A 5E4WA 5J41A 2CVBA 4K0GA 2YZUA 4MP4A 3VK9A 4GQFA 1FB6A 3UL3A 3UMAA 3P90A 1TRWA 5D9WA 3TDGA 3QFAC 3DGQA 1S3CA 4IP6A 3HA9A 4LL4B 1GTUA 5IM9A 1V40A 4F0CA 3HKRA 1PFOA 4V1Ag 3UAPA 1NW2A 4RQRA 2L4QA 10GSA 4MJEA 2C1YA 1CQHA 2H0GA 1I9DA 5GSTA 5IO2A 4TOPA 1TJDA 2YPMA 2GT5A 2CA8A 2XBIA 5ECRB 3ERWA 4MABA 4KX4A 2F3MA 2M72A 2H66A 3BJ5A 4NV5A 4X0XA 1ML6A 1O6JA 4ID0A 1BAYA 5GSSA 4L8EA 2C0GA 2LJKA 3DYRA 2YN1A 3K8NA 2O7KA 3EC3A 3LGCA 5G1KA 3F6FA 5CRGA 3IDVA 3A2VA 3MSZA 2HT9A 3TCOA 3W8SA 3ZVJA 1W4VA 3F3RA 5AN1A 4JR6A 1PQNA 4Q5FA 2DJ1A 1SKWB 2CX3A 3D22A 1HNCA 1V58A 5EY6A 5IPHA 3TKRA 4O5QA 4WF4A 2MYGA 4JR4A 4D73A 1U87A 2QKEA 1PMTA 2LRCA 2VAFA 4BIKA 1ZL9A 1PX7A 9GSSA 4EO3A 2H73A 3F8UA 3D4MA 3G7IA 1SL2B 4J56E 2VLVA 5D9XA 1B8XA 3A2XA 5HR1A 2X64A 1BX9A 4MF5A 2DJ0A 5F07A 2EIOA 1SL0B 11GSA 1Z7RA 3W6GA 5ELGA 3GKNA 1T00A 3D6IA 1GSQA 4HDEA 1YKCA 3QR6A 5JWOB 1ZYQB 1ERVA 1TOFA 2H1AA 1PN9A 2DJ2A 3DVXA 3KD0A 3EVIA 1NHYA 4PGTA 4DSSA 3UBKA 3D0ZA 1EOGA 1S3RA 2HYXA 3FZ5A 2O89A 1EGOA 2J9HA 3TRPA 4IQ1A 1X9SB 1F37A 2ZCTA 2YWIA 3EU3A 3GX8A 3KGKA 2CAQA 2NPBA 3C8EA 2V1MA 1ERWA 4LLRA 4ZBDA 1GTAA 1JFUA 3C71A 4NHWA 3ZMKA 2PGTA 4WEYA 1HNBA 3QOUA 1E6BA 1H75A 4GQCA
chains in the Genus database with same CATH topology
1Q98A 4MMMA 4BVXA 3J7Yk 2LRTA 2V41A 2DIZA 2H0IA 5JCWA 5HR3A 2H1DA 4FO5A 3I69A 1HYUA 4ECBA 16GSA 1U3IA 1R7HA 1T1VA 2KLXA 2P5RA 3GL5A 4WXTA 3FHKA 2X4AA 1ZYNA 1TK5B 1NM3A 4QL9A 3HYPA 1K3OA 2AJQB 3VPQA 4JEDA 5IMDA 4KH7A 3WT1A 3FYGA 4TR1B 3RPNA 3APOA 3VI5A 1YQ1A 3PPUA 2QGVA 5LNKe 2GVPA 1R26A 1WJKA 1SYRA 4IJIA 3TKPA 3I9V2 4HQZA 2G0FA 2VL2C 1SJ6A 4FIWA 1FHEA 4YKFA 2DKIA 5GZZB 4CHSA 5COHA 3A5IA 5DBQA 1SKSB 2QA2A 2PUKC 4K2DA 2A2PA 5CRDA 5ECSA 3GV1A 2IMDA 3TRQA 4BVYA 1O8WA 2JZRA 4AF2A 5DQYA 2L57A 2H6ZA 1YKAA 2GSRA 2YV7A 1YZXA 2LJAA 19GSA 1EOHA 4MDCA 3CYNA 5KOWA 2NDOA 5ECMB 1LU4A 1WP0A 2CVKA 3A5WA 4NAXA 2HSYA 4MA9A 4N10A 2LEGA 3KMNA 1PL2A 1R4WA 3D4TA 4NPBA 4K9ZA 3UOMA 4E8EA 1GUHA 1JZOA 4JE1A 4PUFC 3IK7A 5ELAA 3G9BA 3WD6A 1YY7A 1IYIA 3EE2A 5EVOA 1UC7A 1WRYA 5C04A 2DSAA 4ZIJA 4G10A 5DAKB 3DEXA 4MZBA 2VOCA 3UEMA 1GLPA 3F0IA 4H86A 2CX4A 3ME7A 4PUAA 2L6DA 1OKDA 4NWYA 3U5RE 5J3RA 1R5PA 5IO0A 3TJFA 3P8WA 5D9VA 1R5AA 3E9JB 2IWTA 2K8VA 4EL1A 2KP2A 1A24A 2C4JA 3GTUA 4IBPA 1QMVA 1ZOFA 1GUKA 3F63A 4PNFA 4IJ3A 2OADA 4EXJA 1A2MA 1GP1A 4HS1A 1EP7A 2FA4A 1YJ6A 3VWWA 4NHZA 3PGTA 4BL7B 1VF1A 3H1NA 3IK9A 2LKUA 2GT6A 2PPTA 2JZSA 5ECOB 22GSA 4N30A 3WGEA 3GKXA 3ISOA 3O6TA 1UVZA 3TJJA 2MMOA 1WIKA 4XS1A 2N5AA 4BA7A 1EV4A 3GKKA 4AGSA 4JRRA 4ICYA 3HZ4A 4MZWA 4OWYA 3DMLA 7GSSA 1ST9A 4GSTA 2CZ2A 5B8AA 2VIMA 4FYCA 2B1KA 3RHCA 4QL7A 2H8LA 2VO4A 1UA5A 2LTKA 4G2EA 4V2LA 4K6XA 1B9YC 5CRHA 2O87A 1OE8A 3LW9A 3HY2A 2JZTA 3LXTA 2GTUA 3LORA 4KE3A 1SYXA 2MMNA 2IMIA 3QAWA 2K8SA 2HXKA 1V57A 4XRDA 1TW9A 5D73A 2X49A 2LS5A 3BBYA 2H1BA 4GRFA 1EP8A 2BTOT 1GUMA 3D5JA 2H75A 4YQUA 1X9MB 4A5PA 3GNJA 2KOKA 3PR8A 3GKMA 3HZ8A 3PH9A 4EIPA 2L5LA 2B7JA 2FY6A 2IL3A 1Y6EA 3H93A 4MF7A 5CYYA 4GXZA 3EPTA 4L0UA 1VF2A 2AYTA 1ACVA 4RQXA 4I2UA 5FWGA 4PTSA 4V2MA 3FY7A 3ZLPA 3CBUA 2B5XA 3UJ1A 3IC8A 6GSXA 2J23A 3QPMA 3RPPA 2DMLA 1B9XC 5IOXA 4ZL8A 2VCZA 1JLVA 3VWUA 1XVWA 6GSWA 1K0CA 2H0HA 4ZB6A 2C0FA 2WGRA 4P3YB 3AY8A 4IVFA 1KEBA 1QUWA 4FYBA 1FO5A 3F4TA 4POBA 2FA8A 2C0DA 4LA1A 4AJ6A 3MAKA 5H5RA 4WBJA 1TI1A 3TRXA 2PWJA 2JL4A 3Q74A 5ECKB 4TRXA 3M0FA 1TTZA 2FGXA 3QDNA 4K8MA 2H01A 3UVTA 3IOSA 2PMTA 3N5OA 4TN8A 2JU5A 3DWVA 5DALA 2LUSA 3HXSA 2HZEB 3QD9A 2VM1A 2MMAA 1XFLA 4MPFA 4HEA2 5DCGA 3V1WA 1T3BA 4IKHA 1TP9A 3ZITA 4BPYA 2K18A 3IE3A 3A2WA 2KUCA 3UVHA 3ZTLA 4OFMA 1YF1A 2DC5A 3IHGA 5E59A 1FVKA 4I2TA 3Q18A 2FHEA 2JACA 2F8AA 3KZQA 6GSSA 5A4WA 4QQ7A 3MNGA 4OO5A 2VLTA 2EIRA 2MBTA 1AQWA 3ERFA 4EE0A 1O81A 2ALBA 1B4PA 2FWHA 4WKWA 4K5SA 5ECPB 5BMUA 4HOJA 1C72A 1SJZA 3KJYA 1M99A 5HFGA 2GZYA 1GTBA 1SD8A 2K6VA 3LQ7A 4EDYA 1FOVA 4MPGA 1XZOA 1GRXA 3F4RA 1A2LA 4XS4A 2F51A 1XWCA 1S3AA 4EKZA 1HD2A 4TKYA 3KH9A 2HRNA 1HQOA 4IP1A 3HJMA 4ACSA 2LQQA 4MK3A 2GQLA 3ZMLA 2X8HA 1F3AA 2R6KA 6GSUA 2F8FA 2H19A 3IPZA 2C0EA 4KDYA 2CT6A 2GSTA 1AAZA 4KGIA 1M9BA 1KTEA 1G7OA 4V2NA 2H1GA 2RUEA 1ZZYA 3DXBA 1OC9A 5ENUA 2A2SA 5KN0A 4MJBA 1V9WA 4F0BA 5C00A 2PN8A 2CVDA 1GH2A 3ZFLA 1O8XA 4HQSA 4WBRD 5D8IA 1O73A 4HJ2A 3JCML 2X8GA 4KCAA 1PN0A 3I43A 3C1RA 1G6YA 4J2FA 1PKWA 1ON4A 1SU9A 3H79A 2B3SA 5IQYA 1AIUA 4DVCA 3FK8A 2C8UA 2VL3A 2PBJA 3IXRA 3G7JA 3H4KA 3TKSA 2MBSA 3IBHA 1O85A 2YWMA 3F3QA 2R0PA 1DUGA 4ZBBA 5CO3A 5G5FA 3UARA 5HR2A 4YQMA 1K0AA 2DJKA 5IMFA 4XCSA 3GA4A 2A4VA 1PX6A 4DSQA 4G19A 4KDUA 2E7PA 4BWQA 3KEBA 5B6MA 1AQXA 3U6VA 3FEUA 3LWAA 5HFIA 1U6TA 1V2AA 1XWAA 4K5RA 2VL9A 2IFQB 3FRCA 3UIWA 1EWXA 1J9BA 3LYKA 4KDXA 5EL8A 2X99A 4Z2RA 1TKDB 3IRAA 4WR5A 3HD5A 2V6KA 4E8HA 3KM6A 2IMKA 3HCZA 3E0UA 4FH8A 2REMA 2RLIA 1ZGNA 3RDWA 4O5RA 2H30A 1Z9HA 1MDJA 5DJLA 3HDCA 4EIQA 5L71A 1A23A 2E2MA 2FWEA 2H71A 2FLSA 3P7XA 5AGYA 2AB6A 1B48A 3SWLA 1Q4JA 3QFBC 4KSMA 1M2BA 3TJGA 5ID2B 5ECIB 4X4JA 18GSA 3KTLA 1AXDA 3GUSA 4GWRA 3SBCA 1ZYPA 2N5FA 2VD1A 1X5EA 5IMAA 1URMA 2XPDA 3GRXA 1GSUA 4X43A 1W89A 4G0LA 3TGZA 2NVLA 6GSYA 5DQSA 2NBSA 3GFKA 3VI7A 3G7YA 4IHUA 2GDRA 4LMVA 1NHOA 2BMXA 2VM2A 2PVQA 3L4NA 5GAPD 3E3EA 1BQ7A 2Z9SA 2P31A 1VGLA 1A8YA 1MDIA 4Z7XA 4KAEA 4PQIA 2PVOC 4OO4A 2H6XA 4K7IA 1Z7PA 4K0NA 5F06A 3GYKA 4O92A 2WDUA 4ULXA 1TI3A 3KCMA 4G0IA 4MJAA 2LSTA 4TXVA 14GSA 3IC4A 2JADA 2HRAA 3IR4A 3ZFBA 3KXOA 1OC8A 5AISA 4MH2A 5AIXA 3F9UA 1NSWA 2DBCA 5G1LA 3M8NA 4Z2TA 4I5QA 4HI7A 2A2RA 4RUVA 4POKA 2R0GA 1M0UA 3LYPA 1XIYA 3EYTA 1DE2A 2CV4A 2WRTA 4K1FA 4DSRA 4O7HA 4IN0A 4POLA 4MNNA 4L0WA 4YAVA 4OFNA 3M9KA 2IPAA 2LRNA 3P2AA 1GWCA 3DKSA 1WMJA 5ECHB 1GULA 4YKGA 4ZXGA 1B4QA 4EVMA 2YWNA 2YNXA 2FWGA 1THOA 4MJCA 2YJ7A 3BOAA 1G0TA 2R2JA 4AJ8A 2XPEA 3OR5A 3M9JA 1ILOA 3C1SA 3KIJA 2LNSA 5IMCA 2VCTA 2O85A 2B5YA 2IN3A 5G2ZA 1AQVA 5ABRA 2C3NA 5ECLB 3C7MA 1G7EA 2L6CA 4NV2A 1XXUA 4ZILA 4O5UA 4FQUA 2LNTA 5G5EA 1GNWA 2WULA 3APSA 1GSEA 2FNOA 2EIQA 3F6DA 4D73B 2IMEA 1O7UA 3TJBA 2YOIA 2OE3A 1SKRB 3VURA 3S9FA 2R4VA 2YZHA 4KSOA 4XHMA 4ZL9A 5D96A 4OD7A 5JCUA 3KP8A 1GSSA 4TR0A 1N2AA 5KEJA 1LBKA 1JHBA 4NMUA 2UZ8A 1ZYEA 4TR1A 4EUYA 2DMMA 2HZFA 2GQKA 2VCWA 3KMOA 3KTBA 1TXXA 4DSSB 4I8BA 2E2GA 2F9SA 4IELA 1K0OA 3ZIVA 5KN2A 1QQ2A 2FWFA 1JZRA 1MD3A 3WT2A 4KUNA 3LG6A 4OCEA 1VRSD 5BRTA 2H74A 4TXOA 4BWSA 1EGRA 2ZUPA 3BCIA 4FYUA 1XW9A 2DJJA 2DLXA 5B6NA 4GSSA 4RI7A 2VD0A 1BYEA 3WGXA 1GSYA 3LEFA 4ML6A 3GH6A 4GCIA 2CQ9A 4HZ2A 3TOUA 6GSTA 4BVXB 3HVSA 1K0MA 4GSNA 2VUPA 3DRNA 1THXA 4JBBA 4Z2UA 3MDKA 4XTSA 4PXOA 2KP1A 5G30A 20GSA 2D2ZA 4K7OA 4X1UA 1DSBA 1EZKA 2H72A 2HI7A 1ERTA 3FW2A 1EV9A 3BD2A 1XWBA 2XBQA 3L9VA 2LQOA 2FUG2 1SJIA 4NXIA 2VCXA 1A0RP 4LMWA 3GIXA 2TIRA 4N0VA 4PNGA 5IMZA 3BCKA 2HSHA 1KBNA 1RK4A 2OJLA 1G6WA 3Q6OA 5DAKA 5AIVA 2AAWA 3M1GA 5HFKA 3MYDA 3CTFA 4KCEA 4MZCA 1GTIA 5A5KA 1TK0B 3L9UA 3FR3A 4RI6A 2G2QA 1XWGA 3MWHA 3ZVJD 1KNGA 3GN3A 3R3EA 1SK0A 3QCPA 1PL1A 2B1LA 5DJMA 3ZREA 1SK1A 2L5OA 3ZL5A 4ECIA 2RUFA 3EMXA 5B8BA 3TKSC 5EPFA 2MMZA 4BVYB 5IMVA 2WZ9A 4MCUA 1AUCA 4KA0A 2I9HA 4ECCA 3FZAA 4IQAA 5D9TA 5DCHA 5INYA 4BL7A 1OC3A 4ISDA 4AJ7A 1V98A 3FR6A 1BG5A 4KNDA 2HSMA 5F8BA 4K7NA 2A4HA 3RAZA 2AV4A 5JWQB 4L5OA 1JLWA 1SK2A 4V1Ap 1QFNA 2WFCA 2YCDA 1VF4A 6GSVA 4N0ZA 1TU7A 5A4UA 4POMA 1ZCPA 2GSSA 1F2EA 3WYWA 1BEDA 3FZ9A 2LJRA 4YAPA 1ERUA 4EF0A 5F0GA 2OBKA 1RW1A 1T4YA 1OVNA 3FKFA 2R3XA 1GSDA 3PINA 1U88A 1DBYA 3W8JA 3HJOA 2GZZA 4XS6A 2M46A 3O76A 2H6YA 2TRCP 2H70A 1XOBA 3GHAA 1A0FA 1K0NA 3EWLA 3IHQA 5LCZA 1FW1A 1LJRA 2WJUA 3GTUB 2QA1A 1EEMA 3FZ4A 4ECJA 2GZPA 1S3DA 2IMFA 2OA7A 3VLNA 1K0DA 4CY8A 3GSTA 3HHVA 3N9JA 4PURA 1YF0A 1SD9A 2WS2A 3I6AA 2L4CA 2HRKA 2OE1A 1I5GA 2B6MA 3H8QA 1F9MA 2YANA 4F82A 5FT3A 2R0CA 1AC1A 2C3QA 2WB9A 2AHEA 2LV3A 1M2DA 3CSHA 5HR0A 1EEJA 4XRAA 2ON5A 2VCQA 5CRWA 4CW9A 2ZNMA 3IAM2 3US3A 5G31A 1WOUA 2BJXA 2ES7A 2DJ3A 4ZB8A 4PQHA 1RQMA 2X8CA 5ECNB 1USBA 3TOTA 2E0QA 3NOFA 1M9AA 3VFIA 1F6MC 4USSA 4LL1B 1TRVA 1FB0A 4HU7A 2HZEA 1M2AA 3QAGA 4WETA 5LD0A 3J7Yb 1QXHA 3RBTA 3KP9A 1T7PB 4WF5A 1XPVA 2AUVA 4I6XA 1Z6NA 3EMPA 2QSIA 3GX0A 4HU9A 3VPTA 2V2GA 4CDOA 3ME8A 2GQMA 4ZL7A 5KN3A 4ILFA 3D21A 4CY6A 2QC7A 1E2YA 1F3BA 1OYJA 4TVEA 5J5NA 3TJKA 2YJHA 1FG4A 5A4VA 5KOXA 2ON7A 4ZBAA 1XCCA 4KF9A 3QAVA 5CAXA 2OKAA 3UBLA 1Z5YE 3HVVA 2C80A 4MH3A 3LXZA 4TXOB 1N8JA 1UN2A 3LSZA 4Q5RA 4N11A 2PU9C 4JU5A 3HJPA 1SENA 2I1UA 4EC0A 2RIIA 4WR4A 2JSZA 1SL1B 1MTCA 2P0GA 3VWVA 1JZDA 3ZYWA 3RHBA 1Z6MA 2IJYA 4G9HA 4XIHA 4JZQA 1K0BA 5J9CA 2GLRA 3F4SA 1XWKA 2HE3A 2XHFA 4K2XA 3A3TA 1H4OA 4TR3A 4MF6A 1J0FA 2V6OA 1T4ZA 5DALB 1T8EB 3FR9A 2WCIA 2I81A 1AW9A 1FOHA 3ZZXA 1GLQA 2GSQA 4TR4A 1TRUA 4F2IA 3GURA 3APQA 2EC4A 2C3TA 1PA3A 1TU8A 5CREA 2OBIA 1K3YA 2GS3A 3NIVA 1GSFA 2L59A 2NTOA 5J9BA 2GGTA 2HLSA 2VL2A 2FD3A 2I3YA 1JZWA 1MEKA 4EDZA 4OMVA 1FAAA 3CMIA 8GSSA 1TRSA 4Q5QA 1M7TA 1PSQA 1WWJA 3GH9A 5IOWA 4IW9A 3CTGA 4O32A 1TK8B 2DKHA 1CQGA 3M3MA 2DIYA 3DD3A 3LJRA 3WGDA 3HVXA 4F03A 3ZIJA 3L9SA 4ZB9A 3DIEA 4KW6A 2HNLA 5D93A 1A8LA 1BJXA 12GSA 4KB3A 1WPIA 5DDLA 3LFLA 5JWRB 4ML1A 1Z3EA 2RM5A 2YWOA 4XS4B 2N5BA 3TB2A 3O3TA 4J57E 3GSSA 2V32A 4YH2A 2YV9A 3CSIA 13GSA 3TUEA 1XVQA 3CSJA 4IS0A 2IFQA 2YP6A 1QGVA 3CXGA 3FMWA 5HQPA 1YDKA 3IV4A 2K9FA 1A2JA 2XC2A 1J08A 5H5SA 1U3AA 1X0RA 4I97A 2CAIA 2I4AA 2R37A 5CNWA 5CP1A 1PKZA 4HUAA 1OE7A 1OC9B 1FVJA 1TDIA 3TKQA 2RM6A 2B7KA 4Q5NA 1XBSA 1Y25A 5FHIA 3L0HA 3MIXA 3ED3A 4G0KA 1ABAA 3DVWA 4HJMA 4MLYA 5IIZA 2B5EA 5IPGA 2R5GA 1PGTA 4PX1A 1MDKA 5ID2A 5ECQB 1VF3A 1X5DA 3TKSE 5B7CA 3CRUA 1XW5A 2VLUA 5DVBA 2VCVA 2HRFA 4L5LA 3QMXA 17GSA 3EU4A 2O8VB 3ZRDA 2TRXA 2CZ3A 1IYHA 1XW6A 3GL3A 1PD21 1YEXA 3CRTA 2FCHA 2H76A 2KHPA 2JSYA 3Q19A 3GMFA 4GF0A 3IA1A 1K3LA 2IIYA 3EINA 1MD4A 5KN1A 1GNEA 4YQVA 2M80A 5J4UA 4TW5A 1HNAA 5F05A 3EURA 4IGJA 3IAS2 5GAND 4GLTA 3KH7A 5H5QA 4F9ZA 3VWXA 3NZNA 5JCGA 2HFDA 1ZMAA 4PQ1A 4OFTA 1OKTA 1GL8A 4OCFA 2P5QA 1XOAA 4HZ4A 1X5CA 1DE1A 1X9WB 2MZCA 4GTUA 3ERGA 3C73A 3L78A 1WE0A 1QK8A 2PERA 1OAZA 3R2QA 1YEPA 2OACA 1PRXA 4DEJA 2OE0A 5E4WA 5J41A 2CVBA 4K0GA 2YZUA 4MP4A 3VK9A 4GQFA 1FB6A 3UL3A 3UMAA 3P90A 1TRWA 5D9WA 3TDGA 3QFAC 3DGQA 1S3CA 4IP6A 3HA9A 4LL4B 1GTUA 5IM9A 1V40A 4F0CA 3HKRA 4V1Ag 3UAPA 1NW2A 4RQRA 2L4QA 10GSA 4MJEA 2C1YA 1CQHA 2H0GA 1I9DA 5GSTA 5IO2A 4TOPA 1TJDA 2YPMA 2GT5A 2CA8A 2XBIA 5ECRB 3ERWA 4MABA 4KX4A 2F3MA 2M72A 2H66A 3BJ5A 4NV5A 4X0XA 1ML6A 1O6JA 4ID0A 1BAYA 5GSSA 4L8EA 2C0GA 2LJKA 3DYRA 2YN1A 3K8NA 2O7KA 3EC3A 3LGCA 5G1KA 3F6FA 5CRGA 3IDVA 3A2VA 3MSZA 2HT9A 3TCOA 3W8SA 3ZVJA 1W4VA 3F3RA 5AN1A 4JR6A 1PQNA 4Q5FA 2DJ1A 1SKWB 2CX3A 3D22A 1HNCA 1V58A 5EY6A 5IPHA 3TKRA 4O5QA 4WF4A 2MYGA 4JR4A 4D73A 1U87A 2QKEA 1PMTA 2LRCA 2VAFA 1ZL9A 1PX7A 9GSSA 4EO3A 2H73A 3F8UA 3D4MA 3G7IA 1SL2B 4J56E 2VLVA 5D9XA 1B8XA 3A2XA 5HR1A 2X64A 1BX9A 4MF5A 2DJ0A 5F07A 2EIOA 1SL0B 11GSA 1Z7RA 3W6GA 5ELGA 3GKNA 1T00A 3D6IA 1GSQA 4HDEA 1YKCA 3QR6A 5JWOB 1ZYQB 1ERVA 1TOFA 2H1AA 1PN9A 2DJ2A 3DVXA 3KD0A 3EVIA 1NHYA 4PGTA 4DSSA 3UBKA 3D0ZA 1EOGA 2HYXA 3FZ5A 2O89A 1EGOA 2J9HA 3TRPA 4IQ1A 1X9SB 1F37A 2ZCTA 2YWIA 3EU3A 3GX8A 3KGKA 2CAQA 2NPBA 3C8EA 2V1MA 1ERWA 4LLRA 4ZBDA 1GTAA 1JFUA 3C71A 4NHWA 3ZMKA 2PGTA 4WEYA 1HNBA 3QOUA 1E6BA 1H75A 4GQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q98 A;  4MMM A;  4BVX A;  3J7Y k;  2LRT A;  2V41 A;  2DIZ A;  2H0I A;  5JCW A;  5HR3 A;  2H1D A;  4FO5 A;  3I69 A;  1HYU A;  4ECB A;  16GS A;  1U3I A;  1R7H A;  1T1V A;  2KLX A;  2P5R A;  3GL5 A;  4WXT A;  3FHK A;  1TK5 B;  1NM3 A;  4QL9 A;  3HYP A;  1K3O A;  2AJQ B;  3VPQ A;  4JED A;  5IMD A;  4KH7 A;  3WT1 A;  3FYG A;  4TR1 B;  3RPN A;  3APO A;  3VI5 A;  1YQ1 A;  2QGV A;  5LNK e;  2GVP A;  1R26 A;  1WJK A;  1SYR A;  4IJI A;  3TKP A;  3I9V 2;  4HQZ A;  2G0F A;  2VL2 C;  1SJ6 A;  4FIW A;  1FHE A;  5GZZ B;  4CHS A;  5COH A;  5DBQ A;  1SKS B;  2PUK C;  4K2D A;  5CRD A;  5ECS A;  3GV1 A;  2IMD A;  3TRQ A;  4BVY A;  1O8W A;  2JZR A;  4AF2 A;  5DQY A;  2L57 A;  2H6Z A;  1YKA A;  2GSR A;  2YV7 A;  1YZX A;  2LJA A;  19GS A;  1EOH A;  4MDC A;  3CYN A;  2NDO A;  5ECM B;  1LU4 A;  1WP0 A;  2CVK A;  3A5W A;  4NAX A;  2HSY A;  4MA9 A;  4N10 A;  2LEG A;  3KMN A;  1PL2 A;  1R4W A;  3D4T A;  4NPB A;  4K9Z A;  3UOM A;  4E8E A;  1GUH A;  1JZO A;  4JE1 A;  4PUF C;  3IK7 A;  5ELA A;  3G9B A;  3WD6 A;  1YY7 A;  1IYI A;  3EE2 A;  5EVO A;  1UC7 A;  1WRY A;  5C04 A;  2DSA A;  4ZIJ A;  4G10 A;  5DAK B;  3DEX A;  4MZB A;  2VOC A;  3UEM A;  1GLP A;  3F0I A;  4H86 A;  2CX4 A;  3ME7 A;  4PUA A;  2L6D A;  1OKD A;  4NWY A;  3U5R E;  5J3R A;  1R5P A;  5IO0 A;  3TJF A;  3P8W A;  5D9V A;  1R5A A;  3E9J B;  2IWT A;  2K8V A;  4EL1 A;  2KP2 A;  1A24 A;  2C4J A;  3GTU A;  4IBP A;  1QMV A;  1ZOF A;  1GUK A;  3F63 A;  4PNF A;  4IJ3 A;  2OAD A;  4EXJ A;  1A2M A;  1GP1 A;  4HS1 A;  1EP7 A;  2FA4 A;  1YJ6 A;  3VWW A;  4NHZ A;  3PGT A;  1VF1 A;  3H1N A;  3IK9 A;  2LKU A;  2GT6 A;  2PPT A;  2JZS A;  5ECO B;  22GS A;  4N30 A;  3WGE A;  3GKX A;  3ISO A;  3O6T A;  1UVZ A;  3TJJ A;  2MMO A;  1WIK A;  4XS1 A;  2N5A A;  4BA7 A;  1EV4 A;  3GKK A;  4AGS A;  4JRR A;  3HZ4 A;  4MZW A;  4OWY A;  3DML A;  7GSS A;  1ST9 A;  4GST A;  2CZ2 A;  5B8A A;  2VIM A;  4FYC A;  2B1K A;  3RHC A;  4QL7 A;  2H8L A;  2VO4 A;  1UA5 A;  2LTK A;  4G2E A;  4V2L A;  4K6X A;  1B9Y C;  5CRH A;  2O87 A;  1OE8 A;  3HY2 A;  2JZT A;  3LXT A;  2GTU A;  3LOR A;  4KE3 A;  1SYX A;  2MMN A;  2IMI A;  3QAW A;  2K8S A;  2HXK A;  1V57 A;  4XRD A;  1TW9 A;  5D73 A;  2LS5 A;  3BBY A;  2H1B A;  4GRF A;  1EP8 A;  2BTO T;  1GUM A;  3D5J A;  2H75 A;  4YQU A;  1X9M B;  3GNJ A;  2KOK A;  3PR8 A;  3GKM A;  3HZ8 A;  3PH9 A;  2L5L A;  2B7J A;  2FY6 A;  2IL3 A;  1Y6E A;  3H93 A;  4MF7 A;  5CYY A;  4GXZ A;  4L0U A;  1VF2 A;  2AYT A;  1ACV A;  4RQX A;  4I2U A;  5FWG A;  4V2M A;  3FY7 A;  3ZLP A;  3CBU A;  2B5X A;  3UJ1 A;  6GSX A;  2J23 A;  3QPM A;  3RPP A;  2DML A;  1B9X C;  5IOX A;  4ZL8 A;  2VCZ A;  1JLV A;  3VWU A;  1XVW A;  6GSW A;  1K0C A;  2H0H A;  4ZB6 A;  2C0F A;  2WGR A;  4P3Y B;  3AY8 A;  4IVF A;  1KEB A;  1QUW A;  4FYB A;  1FO5 A;  3F4T A;  4POB A;  2FA8 A;  2C0D A;  4LA1 A;  4AJ6 A;  3MAK A;  5H5R A;  4WBJ A;  1TI1 A;  3TRX A;  2PWJ A;  2JL4 A;  3Q74 A;  5ECK B;  4TRX A;  3M0F A;  1TTZ A;  2FGX A;  3QDN A;  4K8M A;  2H01 A;  3UVT A;  3IOS A;  2PMT A;  3N5O A;  4TN8 A;  2JU5 A;  3DWV A;  5DAL A;  2LUS A;  3HXS A;  2HZE B;  3QD9 A;  2VM1 A;  2MMA A;  1XFL A;  4MPF A;  4HEA 2;  5DCG A;  3V1W A;  1T3B A;  4IKH A;  1TP9 A;  3ZIT A;  4BPY A;  2K18 A;  3IE3 A;  3A2W A;  2KUC A;  3UVH A;  3ZTL A;  4OFM A;  1YF1 A;  2DC5 A;  5E59 A;  1FVK A;  4I2T A;  3Q18 A;  2FHE A;  2JAC A;  2F8A A;  3KZQ A;  6GSS A;  5A4W A;  4QQ7 A;  3MNG A;  4OO5 A;  2VLT A;  2EIR A;  2MBT A;  1AQW A;  3ERF A;  4EE0 A;  1O81 A;  2ALB A;  1B4P A;  2FWH A;  4WKW A;  5ECP B;  4HOJ A;  1C72 A;  1SJZ A;  3KJY A;  1M99 A;  5HFG A;  2GZY A;  1GTB A;  1SD8 A;  2K6V A;  3LQ7 A;  4EDY A;  1FOV A;  4MPG A;  1XZO A;  1GRX A;  3F4R A;  1A2L A;  4XS4 A;  2F51 A;  1XWC A;  1S3A A;  4EKZ A;  1HD2 A;  4TKY A;  3KH9 A;  2HRN A;  1HQO A;  4IP1 A;  3HJM A;  4ACS A;  2LQQ A;  4MK3 A;  2GQL A;  3ZML A;  2X8H A;  1F3A A;  2R6K A;  6GSU A;  2F8F A;  2H19 A;  3IPZ A;  2C0E A;  4KDY A;  2CT6 A;  2GST A;  1AAZ A;  4KGI A;  1M9B A;  1KTE A;  1G7O A;  4V2N A;  2H1G A;  2RUE A;  1ZZY A;  3DXB A;  1OC9 A;  5ENU A;  2A2S A;  5KN0 A;  4MJB A;  1V9W A;  4F0B A;  5C00 A;  2PN8 A;  2CVD A;  1GH2 A;  3ZFL A;  1O8X A;  4HQS A;  4WBR D;  5D8I A;  1O73 A;  4HJ2 A;  3JCM L;  2X8G A;  4KCA A;  3I43 A;  3C1R A;  1G6Y A;  4J2F A;  1PKW A;  1ON4 A;  1SU9 A;  3H79 A;  2B3S A;  5IQY A;  1AIU A;  4DVC A;  3FK8 A;  2C8U A;  2VL3 A;  2PBJ A;  3IXR A;  3G7J A;  3H4K A;  3TKS A;  2MBS A;  3IBH A;  1O85 A;  2YWM A;  3F3Q A;  1DUG A;  4ZBB A;  5CO3 A;  5G5F A;  3UAR A;  5HR2 A;  4YQM A;  1K0A A;  2DJK A;  5IMF A;  4XCS A;  3GA4 A;  2A4V A;  1PX6 A;  4DSQ A;  4G19 A;  4KDU A;  2E7P A;  4BWQ A;  3KEB A;  5B6M A;  1AQX A;  3U6V A;  3FEU A;  3LWA A;  5HFI A;  1U6T A;  1V2A A;  1XWA A;  2VL9 A;  2IFQ B;  3FRC A;  3UIW A;  1EWX A;  1J9B A;  3LYK A;  4KDX A;  5EL8 A;  2X99 A;  1TKD B;  3IRA A;  4WR5 A;  3HD5 A;  2V6K A;  4E8H A;  3KM6 A;  2IMK A;  3HCZ A;  3E0U A;  4FH8 A;  2REM A;  2RLI A;  1ZGN A;  3RDW A;  4O5R A;  2H30 A;  1Z9H A;  1MDJ A;  5DJL A;  3HDC A;  5L71 A;  1A23 A;  2E2M A;  2FWE A;  2H71 A;  2FLS A;  3P7X A;  5AGY A;  2AB6 A;  1B48 A;  3SWL A;  1Q4J A;  3QFB C;  4KSM A;  1M2B A;  3TJG A;  5ID2 B;  5ECI B;  18GS A;  3KTL A;  1AXD A;  3GUS A;  4GWR A;  3SBC A;  2N5F A;  2VD1 A;  1X5E A;  5IMA A;  1URM A;  2XPD A;  3GRX A;  1GSU A;  4X43 A;  1W89 A;  3TGZ A;  2NVL A;  6GSY A;  5DQS A;  2NBS A;  3GFK A;  3VI7 A;  3G7Y A;  4IHU A;  2GDR A;  4LMV A;  1NHO A;  2BMX A;  2VM2 A;  2PVQ A;  3L4N A;  5GAP D;  3E3E A;  1BQ7 A;  2Z9S A;  2P31 A;  1VGL A;  1A8Y A;  1MDI A;  4Z7X A;  4KAE A;  4PQI A;  2PVO C;  4OO4 A;  2H6X A;  4K7I A;  1Z7P A;  4K0N A;  5F06 A;  3GYK A;  4O92 A;  2WDU A;  4ULX A;  1TI3 A;  3KCM A;  4MJA A;  2LST A;  4TXV A;  14GS A;  3IC4 A;  2JAD A;  3IR4 A;  3ZFB A;  3KXO A;  1OC8 A;  5AIS A;  4MH2 A;  5AIX A;  3F9U A;  1NSW A;  2DBC A;  5G1L A;  3M8N A;  4I5Q A;  4HI7 A;  2A2R A;  4RUV A;  4POK A;  1M0U A;  3LYP A;  1XIY A;  3EYT A;  1DE2 A;  2CV4 A;  2WRT A;  4K1F A;  4DSR A;  4O7H A;  4IN0 A;  4POL A;  4L0W A;  4YAV A;  4OFN A;  3M9K A;  2IPA A;  2LRN A;  3P2A A;  1GWC A;  3DKS A;  1WMJ A;  5ECH B;  1GUL A;  4ZXG A;  1B4Q A;  4EVM A;  2YWN A;  2YNX A;  2FWG A;  1THO A;  4MJC A;  2YJ7 A;  3BOA A;  1G0T A;  2R2J A;  4AJ8 A;  2XPE A;  3OR5 A;  3M9J A;  1ILO A;  3C1S A;  3KIJ A;  2LNS A;  5IMC A;  2VCT A;  2O85 A;  2B5Y A;  2IN3 A;  5G2Z A;  1AQV A;  5ABR A;  2C3N A;  5ECL B;  3C7M A;  1G7E A;  2L6C A;  4NV2 A;  1XXU A;  4ZIL A;  2LNT A;  5G5E A;  1GNW A;  2WUL A;  3APS A;  1GSE A;  2FNO A;  2EIQ A;  3F6D A;  4D73 B;  2IME A;  1O7U A;  3TJB A;  2YOI A;  2OE3 A;  1SKR B;  3VUR A;  3S9F A;  2R4V A;  2YZH A;  4KSO A;  4XHM A;  4ZL9 A;  5D96 A;  4OD7 A;  5JCU A;  3KP8 A;  1GSS A;  4TR0 A;  1N2A A;  5KEJ A;  1LBK A;  1JHB A;  4NMU A;  1ZYE A;  4TR1 A;  4EUY A;  2DMM A;  2HZF A;  2GQK A;  2VCW A;  3KMO A;  3KTB A;  1TXX A;  4DSS B;  4I8B A;  2E2G A;  2F9S A;  4IEL A;  1K0O A;  3ZIV A;  5KN2 A;  1QQ2 A;  2FWF A;  1JZR A;  1MD3 A;  3WT2 A;  4KUN A;  3LG6 A;  4OCE A;  1VRS D;  2H74 A;  4TXO A;  4BWS A;  1EGR A;  2ZUP A;  3BCI A;  4FYU A;  1XW9 A;  2DJJ A;  2DLX A;  5B6N A;  4GSS A;  4RI7 A;  2VD0 A;  1BYE A;  3WGX A;  1GSY A;  3LEF A;  4ML6 A;  3GH6 A;  4GCI A;  2CQ9 A;  4HZ2 A;  3TOU A;  6GST A;  3HVS A;  1K0M A;  4GSN A;  2VUP A;  3DRN A;  1THX A;  4JBB A;  3MDK A;  4XTS A;  4PXO A;  2KP1 A;  5G30 A;  20GS A;  2D2Z A;  4K7O A;  4X1U A;  1DSB A;  1EZK A;  2H72 A;  2HI7 A;  1ERT A;  3FW2 A;  1EV9 A;  3BD2 A;  1XWB A;  2XBQ A;  3L9V A;  2LQO A;  2FUG 2;  1SJI A;  4NXI A;  2VCX A;  1A0R P;  4LMW A;  3GIX A;  2TIR A;  4N0V A;  4PNG A;  5IMZ A;  3BCK A;  2HSH A;  1KBN A;  1RK4 A;  2OJL A;  1G6W A;  3Q6O A;  5DAK A;  5AIV A;  2AAW A;  3M1G A;  5HFK A;  3CTF A;  4KCE A;  4MZC A;  1GTI A;  5A5K A;  1TK0 B;  3L9U A;  3FR3 A;  4RI6 A;  2G2Q A;  1XWG A;  3MWH A;  3ZVJ D;  1KNG A;  3GN3 A;  1SK0 A;  3QCP A;  1PL1 A;  2B1L A;  5DJM A;  3ZRE A;  1SK1 A;  2L5O A;  3ZL5 A;  4ECI A;  2RUF A;  3EMX A;  5B8B A;  3TKS C;  5EPF A;  2MMZ A;  5IMV A;  2WZ9 A;  4MCU A;  1AUC A;  4KA0 A;  2I9H A;  4ECC A;  3FZA A;  4IQA A;  5D9T A;  5DCH A;  5INY A;  4BL7 A;  1OC3 A;  4ISD A;  4AJ7 A;  1V98 A;  3FR6 A;  1BG5 A;  4KND A;  5F8B A;  4K7N A;  3RAZ A;  2AV4 A;  5JWQ B;  4L5O A;  1JLW A;  1SK2 A;  4V1A p;  1QFN A;  2WFC A;  2YCD A;  1VF4 A;  6GSV A;  4N0Z A;  1TU7 A;  5A4U A;  4POM A;  1ZCP A;  2GSS A;  1F2E A;  3WYW A;  1BED A;  3FZ9 A;  2LJR A;  4YAP A;  1ERU A;  4EF0 A;  5F0G A;  2OBK A;  1RW1 A;  1T4Y A;  1OVN A;  3FKF A;  2R3X A;  1GSD A;  3PIN A;  1U88 A;  1DBY A;  3W8J A;  3HJO A;  2GZZ A;  4XS6 A;  2M46 A;  3O76 A;  2H6Y A;  2TRC P;  2H70 A;  1XOB A;  3GHA A;  1A0F A;  1K0N A;  3EWL A;  3IHQ A;  5LCZ A;  1FW1 A;  1LJR A;  2WJU A;  3GTU B;  1EEM A;  3FZ4 A;  4ECJ A;  2GZP A;  1S3D A;  2IMF A;  2OA7 A;  3VLN A;  1K0D A;  3GST A;  3HHV A;  3N9J A;  4PUR A;  1YF0 A;  1SD9 A;  2WS2 A;  3I6A A;  2L4C A;  2OE1 A;  1I5G A;  2B6M A;  3H8Q A;  1F9M A;  2YAN A;  4F82 A;  5FT3 A;  1AC1 A;  2C3Q A;  2WB9 A;  2AHE A;  2LV3 A;  1M2D A;  3CSH A;  5HR0 A;  1EEJ A;  4XRA A;  2ON5 A;  2VCQ A;  5CRW A;  4CW9 A;  2ZNM A;  3IAM 2;  3US3 A;  5G31 A;  1WOU A;  2BJX A;  2ES7 A;  2DJ3 A;  4ZB8 A;  4PQH A;  1RQM A;  2X8C A;  5ECN B;  1USB A;  3TOT A;  2E0Q A;  3NOF A;  1M9A A;  3VFI A;  1F6M C;  4LL1 B;  1TRV A;  1FB0 A;  4HU7 A;  2HZE A;  1M2A A;  3QAG A;  4WET A;  5LD0 A;  3J7Y b;  1QXH A;  3RBT A;  3KP9 A;  1T7P B;  4WF5 A;  1XPV A;  2AUV A;  4I6X A;  1Z6N A;  3EMP A;  2QSI A;  3GX0 A;  4HU9 A;  3VPT A;  2V2G A;  4CDO A;  3ME8 A;  2GQM A;  4ZL7 A;  5KN3 A;  4ILF A;  3D21 A;  2QC7 A;  1E2Y A;  1F3B A;  1OYJ A;  4TVE A;  5J5N A;  3TJK A;  2YJH A;  1FG4 A;  5A4V A;  2ON7 A;  4ZBA A;  1XCC A;  5CAX A;  3QAV A;  2OKA A;  3UBL A;  1Z5Y E;  3HVV A;  2C80 A;  4MH3 A;  3LXZ A;  4TXO B;  1N8J A;  1UN2 A;  3LSZ A;  4Q5R A;  4N11 A;  2PU9 C;  4JU5 A;  3HJP A;  1SEN A;  2I1U A;  4EC0 A;  2RII A;  4WR4 A;  2JSZ A;  1SL1 B;  1MTC A;  2P0G A;  3VWV A;  1JZD A;  3ZYW A;  3RHB A;  1Z6M A;  2IJY A;  4G9H A;  4XIH A;  4JZQ A;  1K0B A;  5J9C A;  2GLR A;  3F4S A;  1XWK A;  2HE3 A;  2XHF A;  3A3T A;  1H4O A;  4TR3 A;  4MF6 A;  1J0F A;  2V6O A;  1T4Z A;  5DAL B;  1T8E B;  3FR9 A;  2WCI A;  2I81 A;  1AW9 A;  3ZZX A;  1GLQ A;  2GSQ A;  4TR4 A;  1TRU A;  4F2I A;  3GUR A;  3APQ A;  2EC4 A;  2C3T A;  1PA3 A;  1TU8 A;  5CRE A;  2OBI A;  1K3Y A;  2GS3 A;  3NIV A;  1GSF A;  2L59 A;  2NTO A;  5J9B A;  2GGT A;  2HLS A;  2VL2 A;  2FD3 A;  2I3Y A;  1JZW A;  1MEK A;  4EDZ A;  4OMV A;  1FAA A;  3CMI A;  8GSS A;  1TRS A;  4Q5Q A;  1M7T A;  1PSQ A;  1WWJ A;  3GH9 A;  5IOW A;  4IW9 A;  3CTG A;  4O32 A;  1TK8 B;  1CQG A;  3M3M A;  2DIY A;  3DD3 A;  3LJR A;  3WGD A;  3HVX A;  4F03 A;  3ZIJ A;  3L9S A;  4ZB9 A;  3DIE A;  4KW6 A;  2HNL A;  5D93 A;  1A8L A;  1BJX A;  12GS A;  4KB3 A;  1WPI A;  5DDL A;  3LFL A;  5JWR B;  4ML1 A;  1Z3E A;  2RM5 A;  2YWO A;  4XS4 B;  2N5B A;  3TB2 A;  3O3T A;  4J57 E;  3GSS A;  2V32 A;  4YH2 A;  2YV9 A;  3CSI A;  13GS A;  3TUE A;  1XVQ A;  3CSJ A;  4IS0 A;  2IFQ A;  2YP6 A;  1QGV A;  3CXG A;  5HQP A;  1YDK A;  3IV4 A;  2K9F A;  1A2J A;  2XC2 A;  1J08 A;  5H5S A;  1U3A A;  1X0R A;  4I97 A;  2CAI A;  2I4A A;  2R37 A;  5CNW A;  5CP1 A;  1PKZ A;  4HUA A;  1OE7 A;  1OC9 B;  1FVJ A;  1TDI A;  3TKQ A;  2RM6 A;  2B7K A;  4Q5N A;  1XBS A;  1Y25 A;  5FHI A;  3L0H A;  3ED3 A;  1ABA A;  3DVW A;  4HJM A;  4MLY A;  5IIZ A;  2B5E A;  5IPG A;  2R5G A;  1PGT A;  4PX1 A;  1MDK A;  5ID2 A;  5ECQ B;  1VF3 A;  1X5D A;  3TKS E;  5B7C A;  3CRU A;  1XW5 A;  2VLU A;  5DVB A;  2VCV A;  2HRF A;  4L5L A;  3QMX A;  17GS A;  3EU4 A;  2O8V B;  3ZRD A;  2TRX A;  2CZ3 A;  1IYH A;  1XW6 A;  3GL3 A;  1PD2 1;  1YEX A;  3CRT A;  2FCH A;  2H76 A;  2KHP A;  2JSY A;  3Q19 A;  3GMF A;  4GF0 A;  3IA1 A;  1K3L A;  2IIY A;  3EIN A;  1MD4 A;  5KN1 A;  1GNE A;  4YQV A;  2M80 A;  5J4U A;  4TW5 A;  1HNA A;  5F05 A;  3EUR A;  4IGJ A;  3IAS 2;  5GAN D;  4GLT A;  3KH7 A;  5H5Q A;  4F9Z A;  3VWX A;  3NZN A;  5JCG A;  2HFD A;  1ZMA A;  4PQ1 A;  4OFT A;  1OKT A;  1GL8 A;  4OCF A;  2P5Q A;  1XOA A;  4HZ4 A;  1X5C A;  1DE1 A;  1X9W B;  2MZC A;  4GTU A;  3ERG A;  3C73 A;  3L78 A;  1WE0 A;  1QK8 A;  2PER A;  1OAZ A;  3R2Q A;  1YEP A;  2OAC A;  1PRX A;  4DEJ A;  2OE0 A;  5E4W A;  5J41 A;  2CVB A;  4K0G A;  2YZU A;  4MP4 A;  3VK9 A;  4GQF A;  1FB6 A;  3UL3 A;  3UMA A;  3P90 A;  1TRW A;  5D9W A;  3TDG A;  3QFA C;  3DGQ A;  1S3C A;  4IP6 A;  3HA9 A;  4LL4 B;  1GTU A;  5IM9 A;  1V40 A;  4F0C A;  3HKR A;  4V1A g;  3UAP A;  1NW2 A;  4RQR A;  2L4Q A;  10GS A;  4MJE A;  2C1Y A;  1CQH A;  2H0G A;  1I9D A;  5GST A;  5IO2 A;  4TOP A;  1TJD A;  2YPM A;  2GT5 A;  2CA8 A;  2XBI A;  5ECR B;  3ERW A;  4MAB A;  4KX4 A;  2F3M A;  2M72 A;  2H66 A;  3BJ5 A;  4NV5 A;  4X0X A;  1ML6 A;  1O6J A;  4ID0 A;  1BAY A;  5GSS A;  4L8E A;  2C0G A;  2LJK A;  3DYR A;  2YN1 A;  3K8N A;  2O7K A;  3EC3 A;  3LGC A;  5G1K A;  3F6F A;  5CRG A;  3IDV A;  3A2V A;  3MSZ A;  2HT9 A;  3TCO A;  3W8S A;  3ZVJ A;  1W4V A;  3F3R A;  5AN1 A;  4JR6 A;  1PQN A;  4Q5F A;  2DJ1 A;  1SKW B;  2CX3 A;  3D22 A;  1HNC A;  1V58 A;  5EY6 A;  5IPH A;  3TKR A;  4WF4 A;  2MYG A;  4JR4 A;  4D73 A;  1U87 A;  2QKE A;  1PMT A;  2LRC A;  2VAF A;  1ZL9 A;  1PX7 A;  9GSS A;  4EO3 A;  2H73 A;  3F8U A;  3D4M A;  3G7I A;  1SL2 B;  4J56 E;  2VLV A;  5D9X A;  1B8X A;  3A2X A;  5HR1 A;  2X64 A;  1BX9 A;  4MF5 A;  2DJ0 A;  5F07 A;  2EIO A;  1SL0 B;  11GS A;  1Z7R A;  3W6G A;  5ELG A;  3GKN A;  1T00 A;  3D6I A;  1GSQ A;  4HDE A;  1YKC A;  3QR6 A;  5JWO B;  1ZYQ B;  1ERV A;  1TOF A;  2H1A A;  1PN9 A;  2DJ2 A;  3DVX A;  3KD0 A;  3EVI A;  1NHY A;  4PGT A;  4DSS A;  3UBK A;  3D0Z A;  1EOG A;  2HYX A;  3FZ5 A;  2O89 A;  1EGO A;  2J9H A;  3TRP A;  4IQ1 A;  1X9S B;  1F37 A;  2ZCT A;  2YWI A;  3EU3 A;  3GX8 A;  3KGK A;  2CAQ A;  2NPB A;  3C8E A;  2V1M A;  1ERW A;  4LLR A;  4ZBD A;  1GTA A;  1JFU A;  3C71 A;  4NHW A;  3ZMK A;  2PGT A;  4WEY A;  1HNB A;  3QOU A;  1E6B A;  1H75 A;  4GQC A; 
#chains in the Genus database with same CATH topology
 1Q98 A;  4MMM A;  4BVX A;  3J7Y k;  2LRT A;  2V41 A;  2DIZ A;  2H0I A;  5JCW A;  5HR3 A;  2H1D A;  4FO5 A;  3I69 A;  1HYU A;  4ECB A;  16GS A;  1U3I A;  1R7H A;  1T1V A;  2KLX A;  2P5R A;  3GL5 A;  4WXT A;  3FHK A;  2X4A A;  1ZYN A;  1TK5 B;  1NM3 A;  4QL9 A;  3HYP A;  1K3O A;  2AJQ B;  3VPQ A;  4JED A;  5IMD A;  4KH7 A;  3WT1 A;  3FYG A;  4TR1 B;  3RPN A;  3APO A;  3VI5 A;  1YQ1 A;  3PPU A;  2QGV A;  5LNK e;  2GVP A;  1R26 A;  1WJK A;  1SYR A;  4IJI A;  3TKP A;  3I9V 2;  4HQZ A;  2G0F A;  2VL2 C;  1SJ6 A;  4FIW A;  1FHE A;  4YKF A;  2DKI A;  5GZZ B;  4CHS A;  5COH A;  3A5I A;  5DBQ A;  1SKS B;  2QA2 A;  2PUK C;  4K2D A;  2A2P A;  5CRD A;  5ECS A;  3GV1 A;  2IMD A;  3TRQ A;  4BVY A;  1O8W A;  2JZR A;  4AF2 A;  5DQY A;  2L57 A;  2H6Z A;  1YKA A;  2GSR A;  2YV7 A;  1YZX A;  2LJA A;  19GS A;  1EOH A;  4MDC A;  3CYN A;  5KOW A;  2NDO A;  5ECM B;  1LU4 A;  1WP0 A;  2CVK A;  3A5W A;  4NAX A;  2HSY A;  4MA9 A;  4N10 A;  2LEG A;  3KMN A;  1PL2 A;  1R4W A;  3D4T A;  4NPB A;  4K9Z A;  3UOM A;  4E8E A;  1GUH A;  1JZO A;  4JE1 A;  4PUF C;  3IK7 A;  5ELA A;  3G9B A;  3WD6 A;  1YY7 A;  1IYI A;  3EE2 A;  5EVO A;  1UC7 A;  1WRY A;  5C04 A;  2DSA A;  4ZIJ A;  4G10 A;  5DAK B;  3DEX A;  4MZB A;  2VOC A;  3UEM A;  1GLP A;  3F0I A;  4H86 A;  2CX4 A;  3ME7 A;  4PUA A;  2L6D A;  1OKD A;  4NWY A;  3U5R E;  5J3R A;  1R5P A;  5IO0 A;  3TJF A;  3P8W A;  5D9V A;  1R5A A;  3E9J B;  2IWT A;  2K8V A;  4EL1 A;  2KP2 A;  1A24 A;  2C4J A;  3GTU A;  4IBP A;  1QMV A;  1ZOF A;  1GUK A;  3F63 A;  4PNF A;  4IJ3 A;  2OAD A;  4EXJ A;  1A2M A;  1GP1 A;  4HS1 A;  1EP7 A;  2FA4 A;  1YJ6 A;  3VWW A;  4NHZ A;  3PGT A;  4BL7 B;  1VF1 A;  3H1N A;  3IK9 A;  2LKU A;  2GT6 A;  2PPT A;  2JZS A;  5ECO B;  22GS A;  4N30 A;  3WGE A;  3GKX A;  3ISO A;  3O6T A;  1UVZ A;  3TJJ A;  2MMO A;  1WIK A;  4XS1 A;  2N5A A;  4BA7 A;  1EV4 A;  3GKK A;  4AGS A;  4JRR A;  4ICY A;  3HZ4 A;  4MZW A;  4OWY A;  3DML A;  7GSS A;  1ST9 A;  4GST A;  2CZ2 A;  5B8A A;  2VIM A;  4FYC A;  2B1K A;  3RHC A;  4QL7 A;  2H8L A;  2VO4 A;  1UA5 A;  2LTK A;  4G2E A;  4V2L A;  4K6X A;  1B9Y C;  5CRH A;  2O87 A;  1OE8 A;  3LW9 A;  3HY2 A;  2JZT A;  3LXT A;  2GTU A;  3LOR A;  4KE3 A;  1SYX A;  2MMN A;  2IMI A;  3QAW A;  2K8S A;  2HXK A;  1V57 A;  4XRD A;  1TW9 A;  5D73 A;  2X49 A;  2LS5 A;  3BBY A;  2H1B A;  4GRF A;  1EP8 A;  2BTO T;  1GUM A;  3D5J A;  2H75 A;  4YQU A;  1X9M B;  4A5P A;  3GNJ A;  2KOK A;  3PR8 A;  3GKM A;  3HZ8 A;  3PH9 A;  4EIP A;  2L5L A;  2B7J A;  2FY6 A;  2IL3 A;  1Y6E A;  3H93 A;  4MF7 A;  5CYY A;  4GXZ A;  3EPT A;  4L0U A;  1VF2 A;  2AYT A;  1ACV A;  4RQX A;  4I2U A;  5FWG A;  4PTS A;  4V2M A;  3FY7 A;  3ZLP A;  3CBU A;  2B5X A;  3UJ1 A;  3IC8 A;  6GSX A;  2J23 A;  3QPM A;  3RPP A;  2DML A;  1B9X C;  5IOX A;  4ZL8 A;  2VCZ A;  1JLV A;  3VWU A;  1XVW A;  6GSW A;  1K0C A;  2H0H A;  4ZB6 A;  2C0F A;  2WGR A;  4P3Y B;  3AY8 A;  4IVF A;  1KEB A;  1QUW A;  4FYB A;  1FO5 A;  3F4T A;  4POB A;  2FA8 A;  2C0D A;  4LA1 A;  4AJ6 A;  3MAK A;  5H5R A;  4WBJ A;  1TI1 A;  3TRX A;  2PWJ A;  2JL4 A;  3Q74 A;  5ECK B;  4TRX A;  3M0F A;  1TTZ A;  2FGX A;  3QDN A;  4K8M A;  2H01 A;  3UVT A;  3IOS A;  2PMT A;  3N5O A;  4TN8 A;  2JU5 A;  3DWV A;  5DAL A;  2LUS A;  3HXS A;  2HZE B;  3QD9 A;  2VM1 A;  2MMA A;  1XFL A;  4MPF A;  4HEA 2;  5DCG A;  3V1W A;  1T3B A;  4IKH A;  1TP9 A;  3ZIT A;  4BPY A;  2K18 A;  3IE3 A;  3A2W A;  2KUC A;  3UVH A;  3ZTL A;  4OFM A;  1YF1 A;  2DC5 A;  3IHG A;  5E59 A;  1FVK A;  4I2T A;  3Q18 A;  2FHE A;  2JAC A;  2F8A A;  3KZQ A;  6GSS A;  5A4W A;  4QQ7 A;  3MNG A;  4OO5 A;  2VLT A;  2EIR A;  2MBT A;  1AQW A;  3ERF A;  4EE0 A;  1O81 A;  2ALB A;  1B4P A;  2FWH A;  4WKW A;  4K5S A;  5ECP B;  5BMU A;  4HOJ A;  1C72 A;  1SJZ A;  3KJY A;  1M99 A;  5HFG A;  2GZY A;  1GTB A;  1SD8 A;  2K6V A;  3LQ7 A;  4EDY A;  1FOV A;  4MPG A;  1XZO A;  1GRX A;  3F4R A;  1A2L A;  4XS4 A;  2F51 A;  1XWC A;  1S3A A;  4EKZ A;  1HD2 A;  4TKY A;  3KH9 A;  2HRN A;  1HQO A;  4IP1 A;  3HJM A;  4ACS A;  2LQQ A;  4MK3 A;  2GQL A;  3ZML A;  2X8H A;  1F3A A;  2R6K A;  6GSU A;  2F8F A;  2H19 A;  3IPZ A;  2C0E A;  4KDY A;  2CT6 A;  2GST A;  1AAZ A;  4KGI A;  1M9B A;  1KTE A;  1G7O A;  4V2N A;  2H1G A;  2RUE A;  1ZZY A;  3DXB A;  1OC9 A;  5ENU A;  2A2S A;  5KN0 A;  4MJB A;  1V9W A;  4F0B A;  5C00 A;  2PN8 A;  2CVD A;  1GH2 A;  3ZFL A;  1O8X A;  4HQS A;  4WBR D;  5D8I A;  1O73 A;  4HJ2 A;  3JCM L;  2X8G A;  4KCA A;  1PN0 A;  3I43 A;  3C1R A;  1G6Y A;  4J2F A;  1PKW A;  1ON4 A;  1SU9 A;  3H79 A;  2B3S A;  5IQY A;  1AIU A;  4DVC A;  3FK8 A;  2C8U A;  2VL3 A;  2PBJ A;  3IXR A;  3G7J A;  3H4K A;  3TKS A;  2MBS A;  3IBH A;  1O85 A;  2YWM A;  3F3Q A;  2R0P A;  1DUG A;  4ZBB A;  5CO3 A;  5G5F A;  3UAR A;  5HR2 A;  4YQM A;  1K0A A;  2DJK A;  5IMF A;  4XCS A;  3GA4 A;  2A4V A;  1PX6 A;  4DSQ A;  4G19 A;  4KDU A;  2E7P A;  4BWQ A;  3KEB A;  5B6M A;  1AQX A;  3U6V A;  3FEU A;  3LWA A;  5HFI A;  1U6T A;  1V2A A;  1XWA A;  4K5R A;  2VL9 A;  2IFQ B;  3FRC A;  3UIW A;  1EWX A;  1J9B A;  3LYK A;  4KDX A;  5EL8 A;  2X99 A;  4Z2R A;  1TKD B;  3IRA A;  4WR5 A;  3HD5 A;  2V6K A;  4E8H A;  3KM6 A;  2IMK A;  3HCZ A;  3E0U A;  4FH8 A;  2REM A;  2RLI A;  1ZGN A;  3RDW A;  4O5R A;  2H30 A;  1Z9H A;  1MDJ A;  5DJL A;  3HDC A;  4EIQ A;  5L71 A;  1A23 A;  2E2M A;  2FWE A;  2H71 A;  2FLS A;  3P7X A;  5AGY A;  2AB6 A;  1B48 A;  3SWL A;  1Q4J A;  3QFB C;  4KSM A;  1M2B A;  3TJG A;  5ID2 B;  5ECI B;  4X4J A;  18GS A;  3KTL A;  1AXD A;  3GUS A;  4GWR A;  3SBC A;  1ZYP A;  2N5F A;  2VD1 A;  1X5E A;  5IMA A;  1URM A;  2XPD A;  3GRX A;  1GSU A;  4X43 A;  1W89 A;  4G0L A;  3TGZ A;  2NVL A;  6GSY A;  5DQS A;  2NBS A;  3GFK A;  3VI7 A;  3G7Y A;  4IHU A;  2GDR A;  4LMV A;  1NHO A;  2BMX A;  2VM2 A;  2PVQ A;  3L4N A;  5GAP D;  3E3E A;  1BQ7 A;  2Z9S A;  2P31 A;  1VGL A;  1A8Y A;  1MDI A;  4Z7X A;  4KAE A;  4PQI A;  2PVO C;  4OO4 A;  2H6X A;  4K7I A;  1Z7P A;  4K0N A;  5F06 A;  3GYK A;  4O92 A;  2WDU A;  4ULX A;  1TI3 A;  3KCM A;  4G0I A;  4MJA A;  2LST A;  4TXV A;  14GS A;  3IC4 A;  2JAD A;  2HRA A;  3IR4 A;  3ZFB A;  3KXO A;  1OC8 A;  5AIS A;  4MH2 A;  5AIX A;  3F9U A;  1NSW A;  2DBC A;  5G1L A;  3M8N A;  4Z2T A;  4I5Q A;  4HI7 A;  2A2R A;  4RUV A;  4POK A;  2R0G A;  1M0U A;  3LYP A;  1XIY A;  3EYT A;  1DE2 A;  2CV4 A;  2WRT A;  4K1F A;  4DSR A;  4O7H A;  4IN0 A;  4POL A;  4MNN A;  4L0W A;  4YAV A;  4OFN A;  3M9K A;  2IPA A;  2LRN A;  3P2A A;  1GWC A;  3DKS A;  1WMJ A;  5ECH B;  1GUL A;  4YKG A;  4ZXG A;  1B4Q A;  4EVM A;  2YWN A;  2YNX A;  2FWG A;  1THO A;  4MJC A;  2YJ7 A;  3BOA A;  1G0T A;  2R2J A;  4AJ8 A;  2XPE A;  3OR5 A;  3M9J A;  1ILO A;  3C1S A;  3KIJ A;  2LNS A;  5IMC A;  2VCT A;  2O85 A;  2B5Y A;  2IN3 A;  5G2Z A;  1AQV A;  5ABR A;  2C3N A;  5ECL B;  3C7M A;  1G7E A;  2L6C A;  4NV2 A;  1XXU A;  4ZIL A;  4O5U A;  4FQU A;  2LNT A;  5G5E A;  1GNW A;  2WUL A;  3APS A;  1GSE A;  2FNO A;  2EIQ A;  3F6D A;  4D73 B;  2IME A;  1O7U A;  3TJB A;  2YOI A;  2OE3 A;  1SKR B;  3VUR A;  3S9F A;  2R4V A;  2YZH A;  4KSO A;  4XHM A;  4ZL9 A;  5D96 A;  4OD7 A;  5JCU A;  3KP8 A;  1GSS A;  4TR0 A;  1N2A A;  5KEJ A;  1LBK A;  1JHB A;  4NMU A;  2UZ8 A;  1ZYE A;  4TR1 A;  4EUY A;  2DMM A;  2HZF A;  2GQK A;  2VCW A;  3KMO A;  3KTB A;  1TXX A;  4DSS B;  4I8B A;  2E2G A;  2F9S A;  4IEL A;  1K0O A;  3ZIV A;  5KN2 A;  1QQ2 A;  2FWF A;  3CQF A;  1JZR A;  1MD3 A;  1M3I A;  3WT2 A;  4KUN A;  3LG6 A;  4OCE A;  1VRS D;  5BRT A;  2H74 A;  4TXO A;  4BWS A;  1EGR A;  2ZUP A;  3BCI A;  4FYU A;  1XW9 A;  2DJJ A;  2DLX A;  5B6N A;  4GSS A;  4RI7 A;  2VD0 A;  1BYE A;  3WGX A;  1GSY A;  3LEF A;  4ML6 A;  3GH6 A;  4GCI A;  1XG8 A;  2CQ9 A;  4HZ2 A;  3TOU A;  6GST A;  4BVX B;  3HVS A;  1K0M A;  4GSN A;  2VUP A;  3DRN A;  1THX A;  4JBB A;  4Z2U A;  3MDK A;  4XTS A;  4PXO A;  2KP1 A;  5G30 A;  20GS A;  2D2Z A;  4K7O A;  4X1U A;  1DSB A;  1EZK A;  2H72 A;  2HI7 A;  1ERT A;  3FW2 A;  1EV9 A;  3BD2 A;  1XWB A;  2XBQ A;  3L9V A;  2LQO A;  2FUG 2;  1SJI A;  4NXI A;  2VCX A;  1A0R P;  4LMW A;  3GIX A;  2TIR A;  4N0V A;  4PNG A;  5IMZ A;  3BCK A;  2HSH A;  1KBN A;  1RK4 A;  2OJL A;  1G6W A;  3Q6O A;  5DAK A;  5AIV A;  2AAW A;  3M1G A;  5HFK A;  3MYD A;  3CTF A;  4KCE A;  4MZC A;  1GTI A;  5A5K A;  1TK0 B;  3L9U A;  3FR3 A;  4RI6 A;  2G2Q A;  1XWG A;  3MWH A;  3ZVJ D;  1KNG A;  3GN3 A;  3R3E A;  1SK0 A;  3QCP A;  1PL1 A;  2B1L A;  5DJM A;  3ZRE A;  1SK1 A;  2L5O A;  3ZL5 A;  4ECI A;  2RUF A;  3EMX A;  5B8B A;  3TKS C;  5EPF A;  2MMZ A;  4BVY B;  5IMV A;  2WZ9 A;  4MCU A;  1AUC A;  4KA0 A;  2I9H A;  4ECC A;  3FZA A;  4IQA A;  5D9T A;  5DCH A;  5INY A;  4BL7 A;  1OC3 A;  4ISD A;  4AJ7 A;  1V98 A;  3FR6 A;  1BG5 A;  4KND A;  2HSM A;  5F8B A;  4K7N A;  2A4H A;  3RAZ A;  2AV4 A;  5JWQ B;  4L5O A;  1JLW A;  1SK2 A;  4V1A p;  1QFN A;  2WFC A;  2YCD A;  1VF4 A;  6GSV A;  4N0Z A;  1TU7 A;  5A4U A;  4POM A;  1ZCP A;  2GSS A;  1F2E A;  3WYW A;  1BED A;  3FZ9 A;  2LJR A;  4YAP A;  1ERU A;  4EF0 A;  5F0G A;  2OBK A;  1RW1 A;  1T4Y A;  1OVN A;  3FKF A;  2R3X A;  1GSD A;  3PIN A;  1U88 A;  1DBY A;  3W8J A;  3HJO A;  2GZZ A;  4XS6 A;  2M46 A;  3O76 A;  2H6Y A;  2TRC P;  2H70 A;  1XOB A;  3GHA A;  1A0F A;  1K0N A;  3EWL A;  3IHQ A;  5LCZ A;  1FW1 A;  1LJR A;  2WJU A;  3GTU B;  2QA1 A;  1EEM A;  3FZ4 A;  4ECJ A;  2GZP A;  1S3D A;  2IMF A;  2OA7 A;  3VLN A;  1K0D A;  4CY8 A;  3GST A;  3HHV A;  3N9J A;  4PUR A;  1YF0 A;  1SD9 A;  2WS2 A;  3I6A A;  2L4C A;  2HRK A;  2OE1 A;  1I5G A;  2B6M A;  3H8Q A;  1F9M A;  2YAN A;  4F82 A;  5FT3 A;  2R0C A;  1AC1 A;  2C3Q A;  2WB9 A;  2AHE A;  2LV3 A;  1M2D A;  3CSH A;  5HR0 A;  1EEJ A;  4XRA A;  2ON5 A;  2VCQ A;  5CRW A;  4CW9 A;  2ZNM A;  3IAM 2;  3US3 A;  5G31 A;  1WOU A;  2BJX A;  2ES7 A;  2DJ3 A;  4ZB8 A;  4PQH A;  1RQM A;  2X8C A;  5ECN B;  1USB A;  3TOT A;  2E0Q A;  3NOF A;  1M9A A;  3VFI A;  1F6M C;  4USS A;  4LL1 B;  1TRV A;  1FB0 A;  4HU7 A;  2HZE A;  1M2A A;  3QAG A;  4WET A;  5LD0 A;  3J7Y b;  1QXH A;  3RBT A;  3KP9 A;  1T7P B;  4WF5 A;  1XPV A;  2AUV A;  4I6X A;  1Z6N A;  3EMP A;  2QSI A;  3GX0 A;  4HU9 A;  3VPT A;  2V2G A;  4CDO A;  3ME8 A;  2GQM A;  4ZL7 A;  5KN3 A;  4ILF A;  3D21 A;  4CY6 A;  2QC7 A;  1E2Y A;  1F3B A;  1OYJ A;  4TVE A;  5J5N A;  3TJK A;  2YJH A;  1FG4 A;  5A4V A;  5KOX A;  2ON7 A;  4ZBA A;  1XCC A;  4KF9 A;  3QAV A;  5CAX A;  2OKA A;  3UBL A;  1Z5Y E;  3HVV A;  2C80 A;  4MH3 A;  3LXZ A;  4TXO B;  1N8J A;  1UN2 A;  3LSZ A;  4Q5R A;  4N11 A;  2PU9 C;  4JU5 A;  3HJP A;  1SEN A;  2I1U A;  4EC0 A;  2RII A;  4WR4 A;  2JSZ A;  3HVN A;  1SL1 B;  1MTC A;  2P0G A;  1M3J A;  3VWV A;  1JZD A;  3ZYW A;  3RHB A;  1Z6M A;  2IJY A;  4HSC X;  4G9H A;  4XIH A;  4JZQ A;  1K0B A;  5J9C A;  2GLR A;  3F4S A;  1XWK A;  2HE3 A;  2XHF A;  4K2X A;  3A3T A;  1H4O A;  4TR3 A;  4MF6 A;  1J0F A;  2V6O A;  1T4Z A;  5DAL B;  1T8E B;  3FR9 A;  2WCI A;  2I81 A;  1AW9 A;  1FOH A;  3ZZX A;  1GLQ A;  2GSQ A;  4TR4 A;  1TRU A;  4F2I A;  3GUR A;  3APQ A;  2EC4 A;  2C3T A;  1PA3 A;  1TU8 A;  5CRE A;  2OBI A;  1K3Y A;  2GS3 A;  3NIV A;  1GSF A;  2L59 A;  2NTO A;  5J9B A;  2GGT A;  2HLS A;  2VL2 A;  2FD3 A;  2I3Y A;  1JZW A;  1MEK A;  4EDZ A;  4OMV A;  1FAA A;  3CMI A;  8GSS A;  1TRS A;  4Q5Q A;  1M7T A;  1PSQ A;  1WWJ A;  3GH9 A;  5IOW A;  4IW9 A;  3CTG A;  4O32 A;  1TK8 B;  2DKH A;  1CQG A;  3M3M A;  2DIY A;  3DD3 A;  3LJR A;  3WGD A;  3HVX A;  4F03 A;  3ZIJ A;  3L9S A;  4ZB9 A;  3DIE A;  4KW6 A;  2HNL A;  5D93 A;  1A8L A;  1BJX A;  12GS A;  4KB3 A;  1WPI A;  5DDL A;  3LFL A;  5JWR B;  4ML1 A;  1Z3E A;  2RM5 A;  2YWO A;  4XS4 B;  2N5B A;  3TB2 A;  3O3T A;  4J57 E;  3GSS A;  2V32 A;  4YH2 A;  2YV9 A;  3CSI A;  13GS A;  3TUE A;  1XVQ A;  3CSJ A;  4IS0 A;  2IFQ A;  2YP6 A;  1QGV A;  3CXG A;  3FMW A;  5HQP A;  1YDK A;  3IV4 A;  2K9F A;  1A2J A;  2XC2 A;  1J08 A;  5H5S A;  1U3A A;  1X0R A;  4I97 A;  2CAI A;  2I4A A;  2R37 A;  5CNW A;  5CP1 A;  1PKZ A;  4HUA A;  1OE7 A;  1OC9 B;  1FVJ A;  1TDI A;  3TKQ A;  2RM6 A;  2B7K A;  4Q5N A;  1XBS A;  1Y25 A;  5FHI A;  3L0H A;  3MIX A;  3ED3 A;  4G0K A;  1ABA A;  3DVW A;  4HJM A;  4MLY A;  5IIZ A;  2B5E A;  5IPG A;  2R5G A;  1PGT A;  4PX1 A;  1MDK A;  5ID2 A;  5ECQ B;  1VF3 A;  1X5D A;  3TKS E;  5B7C A;  3CRU A;  1XW5 A;  2VLU A;  5DVB A;  2VCV A;  2HRF A;  4L5L A;  3QMX A;  17GS A;  3EU4 A;  2O8V B;  3ZRD A;  2TRX A;  2CZ3 A;  1IYH A;  1XW6 A;  3GL3 A;  1PD2 1;  1YEX A;  3CRT A;  2FCH A;  2H76 A;  2KHP A;  2JSY A;  3Q19 A;  3GMF A;  4GF0 A;  3IA1 A;  1K3L A;  2IIY A;  3EIN A;  1MD4 A;  5KN1 A;  1GNE A;  4YQV A;  2M80 A;  5J4U A;  4TW5 A;  1HNA A;  5F05 A;  3EUR A;  4IGJ A;  3IAS 2;  5GAN D;  4GLT A;  3KH7 A;  5H5Q A;  4F9Z A;  3VWX A;  3NZN A;  5JCG A;  2HFD A;  1ZMA A;  4PQ1 A;  4OFT A;  1OKT A;  1GL8 A;  4OCF A;  2P5Q A;  1XOA A;  4HZ4 A;  1X5C A;  1DE1 A;  1X9W B;  2MZC A;  4GTU A;  3ERG A;  3C73 A;  3L78 A;  1WE0 A;  1QK8 A;  2PER A;  1OAZ A;  3R2Q A;  1YEP A;  2OAC A;  1PRX A;  4DEJ A;  2OE0 A;  5E4W A;  5J41 A;  2CVB A;  4K0G A;  2YZU A;  4MP4 A;  3VK9 A;  4GQF A;  1FB6 A;  3UL3 A;  3UMA A;  3P90 A;  1TRW A;  5D9W A;  3TDG A;  3QFA C;  3DGQ A;  1S3C A;  4IP6 A;  3HA9 A;  4LL4 B;  1GTU A;  5IM9 A;  1V40 A;  4F0C A;  3HKR A;  1PFO A;  4V1A g;  3UAP A;  1NW2 A;  4RQR A;  2L4Q A;  10GS A;  4MJE A;  2C1Y A;  1CQH A;  2H0G A;  1I9D A;  5GST A;  5IO2 A;  4TOP A;  1TJD A;  2YPM A;  2GT5 A;  2CA8 A;  2XBI A;  5ECR B;  3ERW A;  4MAB A;  4KX4 A;  2F3M A;  2M72 A;  2H66 A;  3BJ5 A;  4NV5 A;  4X0X A;  1ML6 A;  1O6J A;  4ID0 A;  1BAY A;  5GSS A;  4L8E A;  2C0G A;  2LJK A;  3DYR A;  2YN1 A;  3K8N A;  2O7K A;  3EC3 A;  3LGC A;  5G1K A;  3F6F A;  5CRG A;  3IDV A;  3A2V A;  3MSZ A;  2HT9 A;  3TCO A;  3W8S A;  3ZVJ A;  1W4V A;  3F3R A;  5AN1 A;  4JR6 A;  1PQN A;  4Q5F A;  2DJ1 A;  1SKW B;  2CX3 A;  3D22 A;  1HNC A;  1V58 A;  5EY6 A;  5IPH A;  3TKR A;  4O5Q A;  4WF4 A;  2MYG A;  4JR4 A;  4D73 A;  1U87 A;  2QKE A;  1PMT A;  2LRC A;  2VAF A;  4BIK A;  1ZL9 A;  1PX7 A;  9GSS A;  4EO3 A;  2H73 A;  3F8U A;  3D4M A;  3G7I A;  1SL2 B;  4J56 E;  2VLV A;  5D9X A;  1B8X A;  3A2X A;  5HR1 A;  2X64 A;  1BX9 A;  4MF5 A;  2DJ0 A;  5F07 A;  2EIO A;  1SL0 B;  11GS A;  1Z7R A;  3W6G A;  5ELG A;  3GKN A;  1T00 A;  3D6I A;  1GSQ A;  4HDE A;  1YKC A;  3QR6 A;  5JWO B;  1ZYQ B;  1ERV A;  1TOF A;  2H1A A;  1PN9 A;  2DJ2 A;  3DVX A;  3KD0 A;  3EVI A;  1NHY A;  4PGT A;  4DSS A;  3UBK A;  3D0Z A;  1EOG A;  1S3R A;  2HYX A;  3FZ5 A;  2O89 A;  1EGO A;  2J9H A;  3TRP A;  4IQ1 A;  1X9S B;  1F37 A;  2ZCT A;  2YWI A;  3EU3 A;  3GX8 A;  3KGK A;  2CAQ A;  2NPB A;  3C8E A;  2V1M A;  1ERW A;  4LLR A;  4ZBD A;  1GTA A;  1JFU A;  3C71 A;  4NHW A;  3ZMK A;  2PGT A;  4WEY A;  1HNB A;  3QOU A;  1E6B A;  1H75 A;  4GQC A; 
#chains in the Genus database with same CATH homology
 1Q98 A;  4MMM A;  4BVX A;  3J7Y k;  2LRT A;  2V41 A;  2DIZ A;  2H0I A;  5JCW A;  5HR3 A;  2H1D A;  4FO5 A;  3I69 A;  1HYU A;  4ECB A;  16GS A;  1U3I A;  1R7H A;  1T1V A;  2KLX A;  2P5R A;  3GL5 A;  4WXT A;  3FHK A;  2X4A A;  1ZYN A;  1TK5 B;  1NM3 A;  4QL9 A;  3HYP A;  1K3O A;  2AJQ B;  3VPQ A;  4JED A;  5IMD A;  4KH7 A;  3WT1 A;  3FYG A;  4TR1 B;  3RPN A;  3APO A;  3VI5 A;  1YQ1 A;  3PPU A;  2QGV A;  5LNK e;  2GVP A;  1R26 A;  1WJK A;  1SYR A;  4IJI A;  3TKP A;  3I9V 2;  4HQZ A;  2G0F A;  2VL2 C;  1SJ6 A;  4FIW A;  1FHE A;  4YKF A;  2DKI A;  5GZZ B;  4CHS A;  5COH A;  3A5I A;  5DBQ A;  1SKS B;  2QA2 A;  2PUK C;  4K2D A;  2A2P A;  5CRD A;  5ECS A;  3GV1 A;  2IMD A;  3TRQ A;  4BVY A;  1O8W A;  2JZR A;  4AF2 A;  5DQY A;  2L57 A;  2H6Z A;  1YKA A;  2GSR A;  2YV7 A;  1YZX A;  2LJA A;  19GS A;  1EOH A;  4MDC A;  3CYN A;  5KOW A;  2NDO A;  5ECM B;  1LU4 A;  1WP0 A;  2CVK A;  3A5W A;  4NAX A;  2HSY A;  4MA9 A;  4N10 A;  2LEG A;  3KMN A;  1PL2 A;  1R4W A;  3D4T A;  4NPB A;  4K9Z A;  3UOM A;  4E8E A;  1GUH A;  1JZO A;  4JE1 A;  4PUF C;  3IK7 A;  5ELA A;  3G9B A;  3WD6 A;  1YY7 A;  1IYI A;  3EE2 A;  5EVO A;  1UC7 A;  1WRY A;  5C04 A;  2DSA A;  4ZIJ A;  4G10 A;  5DAK B;  3DEX A;  4MZB A;  2VOC A;  3UEM A;  1GLP A;  3F0I A;  4H86 A;  2CX4 A;  3ME7 A;  4PUA A;  2L6D A;  1OKD A;  4NWY A;  3U5R E;  5J3R A;  1R5P A;  5IO0 A;  3TJF A;  3P8W A;  5D9V A;  1R5A A;  3E9J B;  2IWT A;  2K8V A;  4EL1 A;  2KP2 A;  1A24 A;  2C4J A;  3GTU A;  4IBP A;  1QMV A;  1ZOF A;  1GUK A;  3F63 A;  4PNF A;  4IJ3 A;  2OAD A;  4EXJ A;  1A2M A;  1GP1 A;  4HS1 A;  1EP7 A;  2FA4 A;  1YJ6 A;  3VWW A;  4NHZ A;  3PGT A;  4BL7 B;  1VF1 A;  3H1N A;  3IK9 A;  2LKU A;  2GT6 A;  2PPT A;  2JZS A;  5ECO B;  22GS A;  4N30 A;  3WGE A;  3GKX A;  3ISO A;  3O6T A;  1UVZ A;  3TJJ A;  2MMO A;  1WIK A;  4XS1 A;  2N5A A;  4BA7 A;  1EV4 A;  3GKK A;  4AGS A;  4JRR A;  4ICY A;  3HZ4 A;  4MZW A;  4OWY A;  3DML A;  7GSS A;  1ST9 A;  4GST A;  2CZ2 A;  5B8A A;  2VIM A;  4FYC A;  2B1K A;  3RHC A;  4QL7 A;  2H8L A;  2VO4 A;  1UA5 A;  2LTK A;  4G2E A;  4V2L A;  4K6X A;  1B9Y C;  5CRH A;  2O87 A;  1OE8 A;  3LW9 A;  3HY2 A;  2JZT A;  3LXT A;  2GTU A;  3LOR A;  4KE3 A;  1SYX A;  2MMN A;  2IMI A;  3QAW A;  2K8S A;  2HXK A;  1V57 A;  4XRD A;  1TW9 A;  5D73 A;  2X49 A;  2LS5 A;  3BBY A;  2H1B A;  4GRF A;  1EP8 A;  2BTO T;  1GUM A;  3D5J A;  2H75 A;  4YQU A;  1X9M B;  4A5P A;  3GNJ A;  2KOK A;  3PR8 A;  3GKM A;  3HZ8 A;  3PH9 A;  4EIP A;  2L5L A;  2B7J A;  2FY6 A;  2IL3 A;  1Y6E A;  3H93 A;  4MF7 A;  5CYY A;  4GXZ A;  3EPT A;  4L0U A;  1VF2 A;  2AYT A;  1ACV A;  4RQX A;  4I2U A;  5FWG A;  4PTS A;  4V2M A;  3FY7 A;  3ZLP A;  3CBU A;  2B5X A;  3UJ1 A;  3IC8 A;  6GSX A;  2J23 A;  3QPM A;  3RPP A;  2DML A;  1B9X C;  5IOX A;  4ZL8 A;  2VCZ A;  1JLV A;  3VWU A;  1XVW A;  6GSW A;  1K0C A;  2H0H A;  4ZB6 A;  2C0F A;  2WGR A;  4P3Y B;  3AY8 A;  4IVF A;  1KEB A;  1QUW A;  4FYB A;  1FO5 A;  3F4T A;  4POB A;  2FA8 A;  2C0D A;  4LA1 A;  4AJ6 A;  3MAK A;  5H5R A;  4WBJ A;  1TI1 A;  3TRX A;  2PWJ A;  2JL4 A;  3Q74 A;  5ECK B;  4TRX A;  3M0F A;  1TTZ A;  2FGX A;  3QDN A;  4K8M A;  2H01 A;  3UVT A;  3IOS A;  2PMT A;  3N5O A;  4TN8 A;  2JU5 A;  3DWV A;  5DAL A;  2LUS A;  3HXS A;  2HZE B;  3QD9 A;  2VM1 A;  2MMA A;  1XFL A;  4MPF A;  4HEA 2;  5DCG A;  3V1W A;  1T3B A;  4IKH A;  1TP9 A;  3ZIT A;  4BPY A;  2K18 A;  3IE3 A;  3A2W A;  2KUC A;  3UVH A;  3ZTL A;  4OFM A;  1YF1 A;  2DC5 A;  3IHG A;  5E59 A;  1FVK A;  4I2T A;  3Q18 A;  2FHE A;  2JAC A;  2F8A A;  3KZQ A;  6GSS A;  5A4W A;  4QQ7 A;  3MNG A;  4OO5 A;  2VLT A;  2EIR A;  2MBT A;  1AQW A;  3ERF A;  4EE0 A;  1O81 A;  2ALB A;  1B4P A;  2FWH A;  4WKW A;  4K5S A;  5ECP B;  5BMU A;  4HOJ A;  1C72 A;  1SJZ A;  3KJY A;  1M99 A;  5HFG A;  2GZY A;  1GTB A;  1SD8 A;  2K6V A;  3LQ7 A;  4EDY A;  1FOV A;  4MPG A;  1XZO A;  1GRX A;  3F4R A;  1A2L A;  4XS4 A;  2F51 A;  1XWC A;  1S3A A;  4EKZ A;  1HD2 A;  4TKY A;  3KH9 A;  2HRN A;  1HQO A;  4IP1 A;  3HJM A;  4ACS A;  2LQQ A;  4MK3 A;  2GQL A;  3ZML A;  2X8H A;  1F3A A;  2R6K A;  6GSU A;  2F8F A;  2H19 A;  3IPZ A;  2C0E A;  4KDY A;  2CT6 A;  2GST A;  1AAZ A;  4KGI A;  1M9B A;  1KTE A;  1G7O A;  4V2N A;  2H1G A;  2RUE A;  1ZZY A;  3DXB A;  1OC9 A;  5ENU A;  2A2S A;  5KN0 A;  4MJB A;  1V9W A;  4F0B A;  5C00 A;  2PN8 A;  2CVD A;  1GH2 A;  3ZFL A;  1O8X A;  4HQS A;  4WBR D;  5D8I A;  1O73 A;  4HJ2 A;  3JCM L;  2X8G A;  4KCA A;  1PN0 A;  3I43 A;  3C1R A;  1G6Y A;  4J2F A;  1PKW A;  1ON4 A;  1SU9 A;  3H79 A;  2B3S A;  5IQY A;  1AIU A;  4DVC A;  3FK8 A;  2C8U A;  2VL3 A;  2PBJ A;  3IXR A;  3G7J A;  3H4K A;  3TKS A;  2MBS A;  3IBH A;  1O85 A;  2YWM A;  3F3Q A;  2R0P A;  1DUG A;  4ZBB A;  5CO3 A;  5G5F A;  3UAR A;  5HR2 A;  4YQM A;  1K0A A;  2DJK A;  5IMF A;  4XCS A;  3GA4 A;  2A4V A;  1PX6 A;  4DSQ A;  4G19 A;  4KDU A;  2E7P A;  4BWQ A;  3KEB A;  5B6M A;  1AQX A;  3U6V A;  3FEU A;  3LWA A;  5HFI A;  1U6T A;  1V2A A;  1XWA A;  4K5R A;  2VL9 A;  2IFQ B;  3FRC A;  3UIW A;  1EWX A;  1J9B A;  3LYK A;  4KDX A;  5EL8 A;  2X99 A;  4Z2R A;  1TKD B;  3IRA A;  4WR5 A;  3HD5 A;  2V6K A;  4E8H A;  3KM6 A;  2IMK A;  3HCZ A;  3E0U A;  4FH8 A;  2REM A;  2RLI A;  1ZGN A;  3RDW A;  4O5R A;  2H30 A;  1Z9H A;  1MDJ A;  5DJL A;  3HDC A;  4EIQ A;  5L71 A;  1A23 A;  2E2M A;  2FWE A;  2H71 A;  2FLS A;  3P7X A;  5AGY A;  2AB6 A;  1B48 A;  3SWL A;  1Q4J A;  3QFB C;  4KSM A;  1M2B A;  3TJG A;  5ID2 B;  5ECI B;  4X4J A;  18GS A;  3KTL A;  1AXD A;  3GUS A;  4GWR A;  3SBC A;  1ZYP A;  2N5F A;  2VD1 A;  1X5E A;  5IMA A;  1URM A;  2XPD A;  3GRX A;  1GSU A;  4X43 A;  1W89 A;  4G0L A;  3TGZ A;  2NVL A;  6GSY A;  5DQS A;  2NBS A;  3GFK A;  3VI7 A;  3G7Y A;  4IHU A;  2GDR A;  4LMV A;  1NHO A;  2BMX A;  2VM2 A;  2PVQ A;  3L4N A;  5GAP D;  3E3E A;  1BQ7 A;  2Z9S A;  2P31 A;  1VGL A;  1A8Y A;  1MDI A;  4Z7X A;  4KAE A;  4PQI A;  2PVO C;  4OO4 A;  2H6X A;  4K7I A;  1Z7P A;  4K0N A;  5F06 A;  3GYK A;  4O92 A;  2WDU A;  4ULX A;  1TI3 A;  3KCM A;  4G0I A;  4MJA A;  2LST A;  4TXV A;  14GS A;  3IC4 A;  2JAD A;  2HRA A;  3IR4 A;  3ZFB A;  3KXO A;  1OC8 A;  5AIS A;  4MH2 A;  5AIX A;  3F9U A;  1NSW A;  2DBC A;  5G1L A;  3M8N A;  4Z2T A;  4I5Q A;  4HI7 A;  2A2R A;  4RUV A;  4POK A;  2R0G A;  1M0U A;  3LYP A;  1XIY A;  3EYT A;  1DE2 A;  2CV4 A;  2WRT A;  4K1F A;  4DSR A;  4O7H A;  4IN0 A;  4POL A;  4MNN A;  4L0W A;  4YAV A;  4OFN A;  3M9K A;  2IPA A;  2LRN A;  3P2A A;  1GWC A;  3DKS A;  1WMJ A;  5ECH B;  1GUL A;  4YKG A;  4ZXG A;  1B4Q A;  4EVM A;  2YWN A;  2YNX A;  2FWG A;  1THO A;  4MJC A;  2YJ7 A;  3BOA A;  1G0T A;  2R2J A;  4AJ8 A;  2XPE A;  3OR5 A;  3M9J A;  1ILO A;  3C1S A;  3KIJ A;  2LNS A;  5IMC A;  2VCT A;  2O85 A;  2B5Y A;  2IN3 A;  5G2Z A;  1AQV A;  5ABR A;  2C3N A;  5ECL B;  3C7M A;  1G7E A;  2L6C A;  4NV2 A;  1XXU A;  4ZIL A;  4O5U A;  4FQU A;  2LNT A;  5G5E A;  1GNW A;  2WUL A;  3APS A;  1GSE A;  2FNO A;  2EIQ A;  3F6D A;  4D73 B;  2IME A;  1O7U A;  3TJB A;  2YOI A;  2OE3 A;  1SKR B;  3VUR A;  3S9F A;  2R4V A;  2YZH A;  4KSO A;  4XHM A;  4ZL9 A;  5D96 A;  4OD7 A;  5JCU A;  3KP8 A;  1GSS A;  4TR0 A;  1N2A A;  5KEJ A;  1LBK A;  1JHB A;  4NMU A;  2UZ8 A;  1ZYE A;  4TR1 A;  4EUY A;  2DMM A;  2HZF A;  2GQK A;  2VCW A;  3KMO A;  3KTB A;  1TXX A;  4DSS B;  4I8B A;  2E2G A;  2F9S A;  4IEL A;  1K0O A;  3ZIV A;  5KN2 A;  1QQ2 A;  2FWF A;  1JZR A;  1MD3 A;  3WT2 A;  4KUN A;  3LG6 A;  4OCE A;  1VRS D;  5BRT A;  2H74 A;  4TXO A;  4BWS A;  1EGR A;  2ZUP A;  3BCI A;  4FYU A;  1XW9 A;  2DJJ A;  2DLX A;  5B6N A;  4GSS A;  4RI7 A;  2VD0 A;  1BYE A;  3WGX A;  1GSY A;  3LEF A;  4ML6 A;  3GH6 A;  4GCI A;  2CQ9 A;  4HZ2 A;  3TOU A;  6GST A;  4BVX B;  3HVS A;  1K0M A;  4GSN A;  2VUP A;  3DRN A;  1THX A;  4JBB A;  4Z2U A;  3MDK A;  4XTS A;  4PXO A;  2KP1 A;  5G30 A;  20GS A;  2D2Z A;  4K7O A;  4X1U A;  1DSB A;  1EZK A;  2H72 A;  2HI7 A;  1ERT A;  3FW2 A;  1EV9 A;  3BD2 A;  1XWB A;  2XBQ A;  3L9V A;  2LQO A;  2FUG 2;  1SJI A;  4NXI A;  2VCX A;  1A0R P;  4LMW A;  3GIX A;  2TIR A;  4N0V A;  4PNG A;  5IMZ A;  3BCK A;  2HSH A;  1KBN A;  1RK4 A;  2OJL A;  1G6W A;  3Q6O A;  5DAK A;  5AIV A;  2AAW A;  3M1G A;  5HFK A;  3MYD A;  3CTF A;  4KCE A;  4MZC A;  1GTI A;  5A5K A;  1TK0 B;  3L9U A;  3FR3 A;  4RI6 A;  2G2Q A;  1XWG A;  3MWH A;  3ZVJ D;  1KNG A;  3GN3 A;  3R3E A;  1SK0 A;  3QCP A;  1PL1 A;  2B1L A;  5DJM A;  3ZRE A;  1SK1 A;  2L5O A;  3ZL5 A;  4ECI A;  2RUF A;  3EMX A;  5B8B A;  3TKS C;  5EPF A;  2MMZ A;  4BVY B;  5IMV A;  2WZ9 A;  4MCU A;  1AUC A;  4KA0 A;  2I9H A;  4ECC A;  3FZA A;  4IQA A;  5D9T A;  5DCH A;  5INY A;  4BL7 A;  1OC3 A;  4ISD A;  4AJ7 A;  1V98 A;  3FR6 A;  1BG5 A;  4KND A;  2HSM A;  5F8B A;  4K7N A;  2A4H A;  3RAZ A;  2AV4 A;  5JWQ B;  4L5O A;  1JLW A;  1SK2 A;  4V1A p;  1QFN A;  2WFC A;  2YCD A;  1VF4 A;  6GSV A;  4N0Z A;  1TU7 A;  5A4U A;  4POM A;  1ZCP A;  2GSS A;  1F2E A;  3WYW A;  1BED A;  3FZ9 A;  2LJR A;  4YAP A;  1ERU A;  4EF0 A;  5F0G A;  2OBK A;  1RW1 A;  1T4Y A;  1OVN A;  3FKF A;  2R3X A;  1GSD A;  3PIN A;  1U88 A;  1DBY A;  3W8J A;  3HJO A;  2GZZ A;  4XS6 A;  2M46 A;  3O76 A;  2H6Y A;  2TRC P;  2H70 A;  1XOB A;  3GHA A;  1A0F A;  1K0N A;  3EWL A;  3IHQ A;  5LCZ A;  1FW1 A;  1LJR A;  2WJU A;  3GTU B;  2QA1 A;  1EEM A;  3FZ4 A;  4ECJ A;  2GZP A;  1S3D A;  2IMF A;  2OA7 A;  3VLN A;  1K0D A;  4CY8 A;  3GST A;  3HHV A;  3N9J A;  4PUR A;  1YF0 A;  1SD9 A;  2WS2 A;  3I6A A;  2L4C A;  2HRK A;  2OE1 A;  1I5G A;  2B6M A;  3H8Q A;  1F9M A;  2YAN A;  4F82 A;  5FT3 A;  2R0C A;  1AC1 A;  2C3Q A;  2WB9 A;  2AHE A;  2LV3 A;  1M2D A;  3CSH A;  5HR0 A;  1EEJ A;  4XRA A;  2ON5 A;  2VCQ A;  5CRW A;  4CW9 A;  2ZNM A;  3IAM 2;  3US3 A;  5G31 A;  1WOU A;  2BJX A;  2ES7 A;  2DJ3 A;  4ZB8 A;  4PQH A;  1RQM A;  2X8C A;  5ECN B;  1USB A;  3TOT A;  2E0Q A;  3NOF A;  1M9A A;  3VFI A;  1F6M C;  4USS A;  4LL1 B;  1TRV A;  1FB0 A;  4HU7 A;  2HZE A;  1M2A A;  3QAG A;  4WET A;  5LD0 A;  3J7Y b;  1QXH A;  3RBT A;  3KP9 A;  1T7P B;  4WF5 A;  1XPV A;  2AUV A;  4I6X A;  1Z6N A;  3EMP A;  2QSI A;  3GX0 A;  4HU9 A;  3VPT A;  2V2G A;  4CDO A;  3ME8 A;  2GQM A;  4ZL7 A;  5KN3 A;  4ILF A;  3D21 A;  4CY6 A;  2QC7 A;  1E2Y A;  1F3B A;  1OYJ A;  4TVE A;  5J5N A;  3TJK A;  2YJH A;  1FG4 A;  5A4V A;  5KOX A;  2ON7 A;  4ZBA A;  1XCC A;  4KF9 A;  3QAV A;  5CAX A;  2OKA A;  3UBL A;  1Z5Y E;  3HVV A;  2C80 A;  4MH3 A;  3LXZ A;  4TXO B;  1N8J A;  1UN2 A;  3LSZ A;  4Q5R A;  4N11 A;  2PU9 C;  4JU5 A;  3HJP A;  1SEN A;  2I1U A;  4EC0 A;  2RII A;  4WR4 A;  2JSZ A;  1SL1 B;  1MTC A;  2P0G A;  3VWV A;  1JZD A;  3ZYW A;  3RHB A;  1Z6M A;  2IJY A;  4G9H A;  4XIH A;  4JZQ A;  1K0B A;  5J9C A;  2GLR A;  3F4S A;  1XWK A;  2HE3 A;  2XHF A;  4K2X A;  3A3T A;  1H4O A;  4TR3 A;  4MF6 A;  1J0F A;  2V6O A;  1T4Z A;  5DAL B;  1T8E B;  3FR9 A;  2WCI A;  2I81 A;  1AW9 A;  1FOH A;  3ZZX A;  1GLQ A;  2GSQ A;  4TR4 A;  1TRU A;  4F2I A;  3GUR A;  3APQ A;  2EC4 A;  2C3T A;  1PA3 A;  1TU8 A;  5CRE A;  2OBI A;  1K3Y A;  2GS3 A;  3NIV A;  1GSF A;  2L59 A;  2NTO A;  5J9B A;  2GGT A;  2HLS A;  2VL2 A;  2FD3 A;  2I3Y A;  1JZW A;  1MEK A;  4EDZ A;  4OMV A;  1FAA A;  3CMI A;  8GSS A;  1TRS A;  4Q5Q A;  1M7T A;  1PSQ A;  1WWJ A;  3GH9 A;  5IOW A;  4IW9 A;  3CTG A;  4O32 A;  1TK8 B;  2DKH A;  1CQG A;  3M3M A;  2DIY A;  3DD3 A;  3LJR A;  3WGD A;  3HVX A;  4F03 A;  3ZIJ A;  3L9S A;  4ZB9 A;  3DIE A;  4KW6 A;  2HNL A;  5D93 A;  1A8L A;  1BJX A;  12GS A;  4KB3 A;  1WPI A;  5DDL A;  3LFL A;  5JWR B;  4ML1 A;  1Z3E A;  2RM5 A;  2YWO A;  4XS4 B;  2N5B A;  3TB2 A;  3O3T A;  4J57 E;  3GSS A;  2V32 A;  4YH2 A;  2YV9 A;  3CSI A;  13GS A;  3TUE A;  1XVQ A;  3CSJ A;  4IS0 A;  2IFQ A;  2YP6 A;  1QGV A;  3CXG A;  3FMW A;  5HQP A;  1YDK A;  3IV4 A;  2K9F A;  1A2J A;  2XC2 A;  1J08 A;  5H5S A;  1U3A A;  1X0R A;  4I97 A;  2CAI A;  2I4A A;  2R37 A;  5CNW A;  5CP1 A;  1PKZ A;  4HUA A;  1OE7 A;  1OC9 B;  1FVJ A;  1TDI A;  3TKQ A;  2RM6 A;  2B7K A;  4Q5N A;  1XBS A;  1Y25 A;  5FHI A;  3L0H A;  3MIX A;  3ED3 A;  4G0K A;  1ABA A;  3DVW A;  4HJM A;  4MLY A;  5IIZ A;  2B5E A;  5IPG A;  2R5G A;  1PGT A;  4PX1 A;  1MDK A;  5ID2 A;  5ECQ B;  1VF3 A;  1X5D A;  3TKS E;  5B7C A;  3CRU A;  1XW5 A;  2VLU A;  5DVB A;  2VCV A;  2HRF A;  4L5L A;  3QMX A;  17GS A;  3EU4 A;  2O8V B;  3ZRD A;  2TRX A;  2CZ3 A;  1IYH A;  1XW6 A;  3GL3 A;  1PD2 1;  1YEX A;  3CRT A;  2FCH A;  2H76 A;  2KHP A;  2JSY A;  3Q19 A;  3GMF A;  4GF0 A;  3IA1 A;  1K3L A;  2IIY A;  3EIN A;  1MD4 A;  5KN1 A;  1GNE A;  4YQV A;  2M80 A;  5J4U A;  4TW5 A;  1HNA A;  5F05 A;  3EUR A;  4IGJ A;  3IAS 2;  5GAN D;  4GLT A;  3KH7 A;  5H5Q A;  4F9Z A;  3VWX A;  3NZN A;  5JCG A;  2HFD A;  1ZMA A;  4PQ1 A;  4OFT A;  1OKT A;  1GL8 A;  4OCF A;  2P5Q A;  1XOA A;  4HZ4 A;  1X5C A;  1DE1 A;  1X9W B;  2MZC A;  4GTU A;  3ERG A;  3C73 A;  3L78 A;  1WE0 A;  1QK8 A;  2PER A;  1OAZ A;  3R2Q A;  1YEP A;  2OAC A;  1PRX A;  4DEJ A;  2OE0 A;  5E4W A;  5J41 A;  2CVB A;  4K0G A;  2YZU A;  4MP4 A;  3VK9 A;  4GQF A;  1FB6 A;  3UL3 A;  3UMA A;  3P90 A;  1TRW A;  5D9W A;  3TDG A;  3QFA C;  3DGQ A;  1S3C A;  4IP6 A;  3HA9 A;  4LL4 B;  1GTU A;  5IM9 A;  1V40 A;  4F0C A;  3HKR A;  4V1A g;  3UAP A;  1NW2 A;  4RQR A;  2L4Q A;  10GS A;  4MJE A;  2C1Y A;  1CQH A;  2H0G A;  1I9D A;  5GST A;  5IO2 A;  4TOP A;  1TJD A;  2YPM A;  2GT5 A;  2CA8 A;  2XBI A;  5ECR B;  3ERW A;  4MAB A;  4KX4 A;  2F3M A;  2M72 A;  2H66 A;  3BJ5 A;  4NV5 A;  4X0X A;  1ML6 A;  1O6J A;  4ID0 A;  1BAY A;  5GSS A;  4L8E A;  2C0G A;  2LJK A;  3DYR A;  2YN1 A;  3K8N A;  2O7K A;  3EC3 A;  3LGC A;  5G1K A;  3F6F A;  5CRG A;  3IDV A;  3A2V A;  3MSZ A;  2HT9 A;  3TCO A;  3W8S A;  3ZVJ A;  1W4V A;  3F3R A;  5AN1 A;  4JR6 A;  1PQN A;  4Q5F A;  2DJ1 A;  1SKW B;  2CX3 A;  3D22 A;  1HNC A;  1V58 A;  5EY6 A;  5IPH A;  3TKR A;  4O5Q A;  4WF4 A;  2MYG A;  4JR4 A;  4D73 A;  1U87 A;  2QKE A;  1PMT A;  2LRC A;  2VAF A;  1ZL9 A;  1PX7 A;  9GSS A;  4EO3 A;  2H73 A;  3F8U A;  3D4M A;  3G7I A;  1SL2 B;  4J56 E;  2VLV A;  5D9X A;  1B8X A;  3A2X A;  5HR1 A;  2X64 A;  1BX9 A;  4MF5 A;  2DJ0 A;  5F07 A;  2EIO A;  1SL0 B;  11GS A;  1Z7R A;  3W6G A;  5ELG A;  3GKN A;  1T00 A;  3D6I A;  1GSQ A;  4HDE A;  1YKC A;  3QR6 A;  5JWO B;  1ZYQ B;  1ERV A;  1TOF A;  2H1A A;  1PN9 A;  2DJ2 A;  3DVX A;  3KD0 A;  3EVI A;  1NHY A;  4PGT A;  4DSS A;  3UBK A;  3D0Z A;  1EOG A;  2HYX A;  3FZ5 A;  2O89 A;  1EGO A;  2J9H A;  3TRP A;  4IQ1 A;  1X9S B;  1F37 A;  2ZCT A;  2YWI A;  3EU3 A;  3GX8 A;  3KGK A;  2CAQ A;  2NPB A;  3C8E A;  2V1M A;  1ERW A;  4LLR A;  4ZBD A;  1GTA A;  1JFU A;  3C71 A;  4NHW A;  3ZMK A;  2PGT A;  4WEY A;  1HNB A;  3QOU A;  1E6B A;  1H75 A;  4GQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...