4EF0A

Crystal structure of the first catalytic domain of protein disulfide isomerase p5
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
115
structure length
115
Chain Sequence
MVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Protein disulfide-isomerase A6
publication title Crystal Structure of the first catalytic domain of protein disulfide isomerase P5
rcsb
source organism Homo sapiens
total genus 37
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2012-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ef0A01
1IYIA 2AHEA 3KH9A 1PL1A 4X0XA 3KIJA 5ECHB 3ERFA 1W4VA 1TJDA 3VWWA 4PGTA 2ZCTA 1A0FA 4GCIA 1X9WB 1WRYA 3C1SA 1R4WA 3HZ8A 5KN0A 3F3RA 1TK8B 4AGSA 1BQ7A 2B7JA 6GSXA 4HUAA 1RQMA 2PN8A 2C0DA 1RW1A 1E6BA 1K0CA 4TR4A 4I5QA 1SK1A 4N0ZA 2OE3A 3I69A 5HFGA 3KTLA 2XPEA 3KP9A 1FVJA 5ECKB 4IHUA 2P31A 5E59A 3GL3A 5ECMB 4KNDA 2LNTA 3NZNA 2HE3A 1G6YA 2K9FA 1GULA 2YZUA 19GSA 3D6IA 1JZDA 2CAIA 3TDGA 2NBSA 4I6XA 3IC4A 5B8BA 4ZB6A 4KW6A 1YY7A 2YOIA 5ID2A 2CVKA 1XWBA 3ZL5A 2HYXA 2R5GA 3TRXA 3KM6A 4LL4B 3ZRDA 4TXOB 3PR8A 5IMDA 2JSYA 1GLQA 2PVOC 3TKSE 3GH9A 1XWCA 1A8YA 2VL9A 2LV3A 1B9YC 2VLVA 2LKUA 2ON7A 4HQSA 4ZL8A 5FWGA 3RPPA 2FD3A 2HT9A 3HVXA 4K6XA 1OC9A 5LD0A 4NAXA 3TB2A 1FO5A 3WT1A 2H0IA 2H6XA 1K0NA 4WKWA 2PERA 1EOHA 2GGTA 3WGEA 1VF2A 3M3MA 1Z6NA 2VCQA 4IJIA 2P5QA 3PGTA 1YEXA 3GRXA 1OC8A 5KEJA 2LEGA 3ME8A 3UEMA 4KB3A 5D9WA 2Z9SA 4PQIA 4OFMA 1N8JA 1J9BA 1FB6A 4POMA 3PINA 1PD21 4TR0A 5DJLA 4TVEA 2H8LA 1T3BA 2XBIA 2LUSA 2JL4A 3I43A 3UOMA 2WZ9A 2YWNA 4JEDA 3I9V2 1JLVA 1VGLA 1EP7A 4MF5A 3EMPA 1V9WA 2IMIA 1T4YA 5ECIB 4DVCA 2FHEA 5ELAA 4IP6A 2E7PA 2YWMA 3QCPA 4DSQA 2EIOA 1PGTA 1SL2B 2TRXA 4DSSB 4ACSA 4XIHA 3BCIA 2VD0A 5JCWA 3DKSA 2X8HA 2VL2A 2EIQA 1O73A 1XPVA 1M2DA 3L9UA 4MABA 1T8EB 1CQGA 2GDRA 3SBCA 17GSA 1TU8A 1VF3A 1V98A 3ZREA 4D73A 3Q74A 1XW6A 1YKAA 5D9TA 1TU7A 2DJ2A 4JU5A 4JR6A 5GAPD 4JZQA 2RLIA 2P0GA 5G30A 18GSA 1FOVA 1F3BA 2OE0A 4PUFC 5ABRA 2F9SA 4BA7A 3IXRA 1XVQA 5G31A 2CT6A 4F03A 3GNJA 1Z3EA 2X8GA 4MDCA 1TRSA 1B8XA 1T7PB 1GWCA 1XXUA 3C8EA 1F3AA 1ZYEA 1DBYA 1EGOA 3EMXA 3MNGA 3NOFA 3FW2A 2M46A 2KHPA 4RUVA 2FA8A 2YWOA 1U88A 1F6MC 2VOCA 4ULXA 4JR4A 2GZZA 2MBSA 2H0HA 2LRTA 5GZZB 5JWOB 4AF2A 9GSSA 2I81A 1B48A 3ZVJD 3TKPA 4EXJA 1GNWA 4WR5A 4YQUA 1V40A 1U87A 1GSDA 2IFQA 1TRVA 3FEUA 3CTGA 2QC7A 4PNGA 2R3XA 2O87A 3ZFLA 3LYPA 1FHEA 4ZILA 1SU9A 4PURA 1A2MA 4K7OA 2YANA 1X5CA 4IQ1A 1JHBA 1AQVA 4N11A 2B6MA 1B4PA 3FZ4A 3ME7A 1GUKA 3GFKA 1XWKA 5IM9A 2HZFA 5F07A 8GSSA 1FW1A 4MPFA 3VK9A 3BBYA 1TI1A 2CA8A 4MZCA 3GIXA 2V2GA 3LORA 1V2AA 2PMTA 4J2FA 1ZOFA 4N10A 1Q98A 2AV4A 2FGXA 4WETA 4HZ2A 2B5XA 4EDYA 1GTAA 1THXA 3GKNA 2RIIA 3WGDA 5INYA 1SD9A 2KP2A 2H6YA 2A2RA 3RHCA 1S3DA 3UL3A 2PVQA 1G6WA 4GSNA 2R2JA 5CNWA 4Q5FA 2M72A 3IK9A 3VI5A 3F6FA 3LXTA 4HZ4A 5D9VA 1ERUA 4QL7A 2OBIA 2C0GA 1HNBA 3NIVA 4XHMA 3VWXA 1GSQA 1FAAA 3BD2A 1SL0B 2BJXA 5J5NA 4MZWA 20GSA 3M8NA 2V41A 2DJ0A 3FHKA 1X5DA 1X5EA 3VI7A 5HFIA 2AUVA 2F51A 2VAFA 3DRNA 1KTEA 4OFNA 2IIYA 1NHYA 2HLSA 2LRCA 3D0ZA 3IBHA 2JSZA 5IOXA 5AGYA 2F3MA 2IL3A 1OAZA 1YF1A 3DMLA 3ZZXA 3KH7A 4IN0A 4IS0A 3VPTA 1EGRA 3TJKA 5DVBA 4ZXGA 1TK0B 3TJGA 4TKYA 2I4AA 4MP4A 3FK8A 3UVTA 3H4KA 2YPMA 1DSBA 3QPMA 3KCMA 1OKDA 2L4QA 1YQ1A 2FWFA 2REMA 4H86A 1ST9A 1XWGA 1YKCA 1SKSB 4QQ7A 2I9HA 4KA0A 1A2LA 1TTZA 1WOUA 2G2QA 2MMAA 1UVZA 3C1RA 2KUCA 1ZL9A 2B1LA 3TJBA 3C73A 1MTCA 5F05A 1XZOA 4L8EA 2KLXA 1O8XA 4V1Ag 4OD7A 3GSSA 3KMOA 2A2SA 2HZEA 2LJRA 4GQFA 2YJHA 1ZGNA 3GV1A 4FYUA 3L0HA 4I2TA 2JZRA 3LSZA 4F9ZA 5DCHA 1W89A 2DMMA 4G10A 1BYEA 2H1AA 6GSYA 1AIUA 2GQMA 2CVBA 1OE7A 2DJ1A 3FY7A 2DSAA 5DALB 3F0IA 5KN1A 1O6JA 4GTUA 4K2DA 1V58A 4IELA 1TRUA 3L4NA 4ISDA 2JZTA 3QDNA 4XS6A 3KP8A 4IJ3A 3EU3A 1GTUA 2LTKA 4POBA 3D4MA 1BJXA 1QGVA 2HXKA 2IPAA 1ON4A 4K7NA 1GL8A 2FWHA 2FLSA 3P2AA 1GP1A 2OE1A 2TIRA 1K3OA 1KNGA 2XPDA 4MK3A 3VFIA 4EL1A 1C72A 6GSTA 2WB9A 4WBJA 3BJ5A 3TGZA 3CBUA 4TR1B 1SKRB 1AC1A 4FH8A 5CYYA 2RUEA 1LBKA 1UC7A 3A2XA 5B7CA 10GSA 3EYTA 3HDCA 1PMTA 5G5EA 4HJ2A 2H0GA 1VF4A 2CX3A 1G7EA 5CO3A 1Z7RA 2C8UA 3QD9A 1PQNA 2X8CA 5ENUA 4K0GA 1SL1B 2WCIA 4ECCA 2LJAA 1SK0A 3U6VA 3LWAA 5CRHA 3HVVA 5ECRB 1XCCA 3HKRA 4CHSA 2CZ3A 1I5GA 2WJUA 1GUMA 3RAZA 2B7KA 2B3SA 3RPNA 4KH7A 3J7Yb 2H76A 1ABAA 4ZIJA 5IQYA 1AQWA 2JZSA 2H1BA 5CREA 4MJEA 2ON5A 3QAWA 2ZNMA 2O85A 2G0FA 1GSUA 4ZBDA 1XOBA 4AJ6A 1GSEA 4K0NA 4TRXA 4V2MA 4EF0A 5B8AA 3P7XA 4E8EA 1ZCPA 1K0OA 2VM2A 3G7IA 5AISA 5F0GA 4PQ1A 3DVXA 5DALA 1ZMAA 1GLPA 2N5FA 4EUYA 2FWGA 4K7IA 1FG4A 4ZB9A 3KMNA 2VM1A 4G9HA 1QQ2A 3P8WA 1M0UA 4KCEA 2H66A 3QAGA 2PGTA 4HEA2 2DBCA 3GX8A 5DJMA 3JCML 3QFAC 3DXBA 1T4ZA 2C80A 4NPBA 4RQXA 4L0UA 4EO3A 1Q4JA 2HSHA 3ZIVA 1X0RA 1WWJA 4O5RA 4TR1A 5IO2A 1R5AA 1K3LA 1VF1A 2M80A 3H93A 2A4VA 1B9XC 3UIWA 2LRNA 2IJYA 3IPZA 1PL2A 3MSZA 3VLNA 4WXTA 4IW9A 5AIXA 4AJ8A 3Q6OA 1R5PA 3DGQA 1KEBA 3GA4A 5KN3A 3UJ1A 5H5SA 3HD5A 1GTBA 4F0BA 3GURA 3S9FA 4ILFA 4POKA 2VO4A 3D4TA 1NW2A 5A4VA 2DJ3A 3QMXA 5HR2A 4GSSA 1XW5A 1A24A 5GSTA 3LYKA 1AW9A 4ZB8A 2YV9A 1WPIA 3RDWA 3N9JA 1USBA 2I3YA 2PUKC 4YAVA 4YQVA 4TXOA 2L5LA 2MMNA 1GH2A 5ECPB 4GLTA 3VWUA 1U3IA 2H72A 5FHIA 1A2JA 4BWQA 2D2ZA 1ZYQB 1QFNA 2H01A 2WS2A 3CSJA 5AIVA 3UMAA 1F2EA 5IMAA 3RHBA 3DYRA 2WULA 4PXOA 2GTUA 2X64A 4NXIA 5ECQB 1IYHA 4KCAA 5IIZA 6GSUA 2O7KA 4BVXA 1YEPA 2ES7A 4OFTA 5EL8A 2FY6A 2B1KA 3IK7A 3WGXA 5H5QA 3WT2A 2CV4A 5A4WA 4OMVA 1PX6A 3G7JA 3OR5A 2V1MA 4GXZA 2EIRA 5D9XA 4KGIA 3ZITA 2AB6A 4DEJA 1J0FA 5C00A 4QL9A 2O89A 5GAND 5IMVA 2V6KA 4IGJA 3CYNA 4POLA 13GSA 2QGVA 4EVMA 4XTSA 3LGCA 4PUAA 4MPGA 1KBNA 1X9MB 4WR4A 1TI3A 4ML6A 5ELGA 2LQQA 3L9SA 3LFLA 2L59A 1GSFA 3TRPA 1K0AA 1M2AA 3W6GA 1M99A 2OACA 3DWVA 1DE1A 4KSOA 4YAPA 1YZXA 2MBTA 1RK4A 22GSA 3BCKA 5A5KA 4RI7A 4HI7A 1TDIA 2DMLA 4NV2A 4JRRA 5DBQA 4DSSA 3F6DA 1B4QA 3GTUB 2NVLA 5F06A 1T00A 3ISOA 4CDOA 2WGRA 2L6CA 1EEMA 4ECJA 2B5EA 2E2GA 3KGKA 4KSMA 1T1VA 3APSA 2H19A 2DC5A 3H8QA 3HJOA 1M2BA 3H1NA 4ZL9A 4L5LA 3GUSA 1GUHA 4MZBA 3APOA 2P5RA 1JZRA 2RM5A 3HHVA 4HU9A 4P3YB 4PQHA 4ZL7A 3KTBA 1PX7A 1ERVA 2PPTA 1S3AA 1ILOA 3DD3A 1K0BA 1K0MA 2GVPA 1FVKA 4MH3A 3IDVA 1HQOA 2L4CA 3LJRA 4DSRA 1WJKA 4N30A 1O85A 5J3RA 1EZKA 4KAEA 3LXZA 3W8SA 4BVYA 1TRWA 2OKAA 5IO0A 2PBJA 3IHQA 5B6MA 5COHA 3J7Yk 3HJPA 3UBLA 2VCZA 4J57E 1R26A 3GL5A 2VCTA 4EKZA 5A4UA 2XBQA 3GX0A 3FKFA 2OA7A 1SKWB 1J08A 2FWEA 5CP1A 1R7HA 4LL1B 3TKQA 1PN9A 4G19A 3E0UA 3G9BA 14GSA 1EV9A 3H79A 4N0VA 1WP0A 2YZHA 4F82A 3CTFA 4EC0A 4LA1A 3Q18A 1MD3A 1G7OA 3EU4A 5HR3A 5C04A 4KDYA 4BPYA 2FNOA 5E4WA 3A3TA 4K9ZA 4NWYA 1DUGA 1U6TA 1TXXA 4J56E 1VRSD 2RUFA 4WF5A 4LLRA 5CAXA 2VCVA 2V32A 4HS1A 3EVIA 3BOAA 6GSVA 1AUCA 2B5YA 1TK5B 1PKWA 3IAM2 1U3AA 5ID2B 1Y25A 3QOUA 4I8BA 3L9VA 3FZ9A 5B6NA 1GRXA 1LU4A 1A23A 2GSTA 2H73A 4XRDA 1GNEA 1YJ6A 3TUEA 4E8HA 1OC3A 4XS4B 4FYBA 3WD6A 2MMOA 2L5OA 3MAKA 3LEFA 4V1Ap 3W8JA 4MF7A 2H75A 1AXDA 2IMDA 2JADA 1K3YA 2H30A 4NV5A 4JBBA 2JACA 1YDKA 4MJAA 5J41A 3IA1A 1DE2A 4O32A 2CX4A 2R4VA 4I2UA 1SJZA 2AAWA 1OC9B 2CVDA 4KDXA 1N2AA 1Z7PA 3TKSA 3ERGA 2CZ2A 3QAVA 3O3TA 4MH2A 4G2EA 1X9SB 3FR9A 2ZUPA 5HFKA 3ERWA 3ZTLA 4HQZA 3TJFA 4K1FA 3ZFBA 1XVWA 2K8SA 3UVHA 2K8VA 1AAZA 4F0CA 4ECIA 2H1DA 2C0EA 1PA3A 5D93A 4KUNA 3E3EA 3F8UA 3Q19A 4Q5QA 4XRAA 2VLTA 5ECLB 2YV7A 5HQPA 3TJJA 1K0DA 2DLXA 1BAYA 2HFDA 4MF6A 4HDEA 3GKKA 1EV4A 1OE8A 3HXSA 4O92A 1NHOA 3GYKA 3APQA 4JE1A 2IMEA 5HR0A 4FO5A 1MDIA 3ZIJA 5ECOB 3D5JA 3F4SA 2IN3A 1H75A 5GSSA 2XC2A 3HYPA 3CRTA 4OWYA 5CRGA 7GSSA 2HNLA 3LG6A 2F8FA 3SWLA 1XWAA 3HY2A 4GRFA 4MA9A 1JFUA 4I97A 1MDJA 2GS3A 5JCGA 3FZ5A 2OADA 2HRNA 4XS4A 2GSRA 3MWHA 3GN3A 5G2ZA 3HJMA 1G0TA 2FUG2 1TW9A 2FCHA 3N5OA 3FR6A 2OBKA 4D73B 16GSA 1QXHA 4WF4A 3M0FA 4KE3A 1XFLA 1XBSA 5D8IA 4NHZA 1OKTA 3TKRA 2RM6A 2GZYA 5ECNB 4GQCA 1O81A 2QSIA 4HU7A 5J4UA 2YN1A 4TN8A 3O6TA 2YWIA 3A2WA 5IMCA 2L6DA 4IP1A 2DJKA 5IMFA 4GF0A 2IWTA 2O8VB 3WYWA 2IMKA 2J9HA 4IQAA 3TKSC 1CQHA 4AJ7A 4ZBBA 2VCWA 1ERWA 1PRXA 2GT6A 4EDZA 4HOJA 5ECSA 4ZBAA 1GTIA 2AYTA 4KX4A 5DAKB 1WMJA 3CRUA 2IFQB 3M9JA 3HZ4A 2J23A 1THOA 3GHAA 1GSSA 3F9UA 4KDUA 1AQXA 2DJJA 3EWLA 1SJIA 2HI7A 3VPQA 3DVWA 2H1GA 3A5WA 3V1WA 5EY6A 3E9JB 3LQ7A 1TOFA 2LSTA 2YCDA 2YNXA 3GKXA 2NTOA 4ECBA 2KOKA 5DQSA 1H4OA 2C3QA 2WRTA 1ACVA 2VLUA 5J9CA 3F3QA 1QMVA 4FIWA 3M9KA 5KN2A 1XOAA 3ZYWA 1NM3A 2GQLA 4LMWA 3CSIA 2VL3A 1BEDA 4V2NA 3IRAA 3US3A 2LJKA 5LNKe 2FA4A 2YP6A 4ID0A 4GSTA 4V2LA 4BWSA 5J9BA 2C4JA 1Y6EA 2X99A 1S3CA 3GMFA 2MZCA 5DDLA 5DQYA 2CQ9A 5JWRB 2N5AA 5EPFA 1UN2A 2LS5A 1HNCA 2C3TA 4MLYA 2H70A 3HVSA 3TCOA 1XIYA 3IV4A 6GSSA 5H5RA 5IOWA 3RBTA 1EEJA 1JLWA 4RQRA 1HD2A 2K18A 4TOPA 4YH2A 4Q5NA 5FT3A 2H6ZA 3M1GA 2GSQA 3IOSA 2PU9C 3IAS2 4OCEA 1A8LA 1MEKA 2MMZA 1Z5YE 2E2MA 2C0FA 1MDKA 2GQKA 3AY8A 4PX1A 1EOGA 2R37A 4X1UA 2GT5A 3ZVJA 4L5OA 4XCSA 3HA9A 3VURA 5DAKA 4RI6A 3D21A 4NMUA 4F2IA 3UAPA 4OO4A 3QR6A 4TW5A 4IVFA 3KXOA 3IE3A 5IPHA 3D22A 2VUPA 1URMA 1PSQA 5AN1A 1MD4A 1V57A 2QKEA 2I1UA 4CW9A 3O76A 4HJMA 5CRDA 3C7MA 3PH9A 4PNFA 3QFBC 5JCUA 3C71A 3GH6A 5HR1A 3KZQA 3G7YA 1A0RP 4ML1A 3DEXA 4MCUA 1E2YA 1F37A 3MDKA 2PWJA 3F4RA 3FYGA 3ZMKA 1F9MA 3KEBA 4XS1A 4OCFA 2ALBA 2IMFA 3EURA 1M7TA 2NPBA 1HNAA 4NHWA 3CXGA 1BG5A 1QK8A 2HZEB 5G1KA 2L57A 1NSWA 3UBKA 4K8MA 5IMZA 4O7HA 3TOUA 4GWRA 5G1LA 4EE0A 4X43A 2JU5A 2VL2C 3IR4A 2DIYA 2HRFA 2GZPA 3F63A 3HCZA 3ED3A 3U5RE 2DIZA 1SYRA 2CAQA 3KJYA 2OJLA 5D73A 2XHFA 5CRWA 1Z9HA 2F8AA 1BX9A 4MJBA 2YJ7A 4L0WA 1SENA 1EP8A 2GSSA 2E0QA 1ZZYA 2VCXA 1I9DA 1SK2A 2AJQB 3VWVA 1O7UA 4TXVA 2H71A 2N5BA 3P90A 3KD0A 1Z6MA 4YQMA 1OYJA 5JWQB 2C1YA 3FR3A 1TP9A 2V6OA 4MMMA 3ZLPA 3F4TA 3UARA 2LNSA 3R2QA 3CMIA 2WDUA 1ML6A 1JZOA 3GSTA 3I6AA 1GSYA 1OVNA 5IPGA 5L71A 1WIKA 2EC4A 5EVOA 1SJ6A 4MJCA 5LCZA 1TKDB 1EWXA 1O8WA 3GTUA 4FYCA 4WEYA 4Z7XA 1SYXA 3A2VA 11GSA 3EINA 6GSWA 4IBPA 5D96A 2BMXA 1QUWA 4BL7A 3CSHA 1M9AA 1ERTA 2C3NA 2K6VA 12GSA 1UA5A 2H74A 3FRCA 3ZMLA 2BTOT 3GKMA 2VD1A 1WE0A 3DIEA 3FZAA 3K8NA 5F8BA 1YF0A 4Q5RA 1XW9A 5G5FA 1HYUA 2KP1A 1FB0A 4OO5A 3TRQA 3EE2A 2R6KA 2GLRA 3EC3A 1M9BA 2HSYA 3TOTA 3L78A 2TRCP 4WBRD 2LQOA 1LJRA 1SD8A 4TR3A 4IKHA 2NDOA 4LMVA 1JZWA 2WFCA 2MYGA 2VIMA 5DCGA 1PKZA
chains in the Genus database with same CATH superfamily
1IYIA 2AHEA 3KH9A 1PL1A 4X0XA 4BIKA 3KIJA 5ECHB 3ERFA 1W4VA 1TJDA 3VWWA 4PGTA 2ZCTA 1A0FA 4GCIA 1X9WB 1WRYA 3C1SA 1R4WA 3HZ8A 5KN0A 2DKIA 3F3RA 1TK8B 4AGSA 1BQ7A 2B7JA 4K2XA 6GSXA 4HUAA 2X49A 1RQMA 2QA2A 2PN8A 2C0DA 1RW1A 1E6BA 1K0CA 4TR4A 4I5QA 1SK1A 3CQFA 4N0ZA 2OE3A 3I69A 5HFGA 3KTLA 2XPEA 3KP9A 1FVJA 5ECKB 4IHUA 2P31A 5E59A 3GL3A 5ECMB 4KNDA 2LNTA 3NZNA 3HVNA 2HE3A 1G6YA 2K9FA 1GULA 2YZUA 19GSA 3D6IA 1JZDA 2CAIA 3TDGA 2NBSA 4I6XA 3IC4A 5B8BA 4ZB6A 4KW6A 1YY7A 2YOIA 5ID2A 2CVKA 1XWBA 3ZL5A 2HYXA 5BMUA 2R5GA 3TRXA 3KM6A 4LL4B 3ZRDA 4TXOB 3PR8A 5IMDA 2JSYA 1GLQA 2R0CA 2PVOC 3TKSE 3GH9A 1XWCA 1A8YA 2VL9A 2LV3A 1B9YC 2VLVA 2LKUA 2ON7A 4HQSA 4ZL8A 5FWGA 3RPPA 2FD3A 2HT9A 4Z2RA 3HVXA 4K6XA 1OC9A 5LD0A 4NAXA 3TB2A 4BVXB 1FO5A 3WT1A 2H0IA 2H6XA 1K0NA 4WKWA 2PERA 1EOHA 2GGTA 3WGEA 1VF2A 3M3MA 1Z6NA 2VCQA 4IJIA 2P5QA 3PGTA 1YEXA 3GRXA 1OC8A 5KEJA 2LEGA 3ME8A 3UEMA 4KB3A 5D9WA 2Z9SA 4PQIA 4OFMA 1N8JA 1J9BA 4CY6A 1FB6A 4POMA 3PINA 1PD21 4TR0A 5DJLA 1FOHA 3MYDA 4TVEA 2H8LA 1T3BA 2XBIA 2HSMA 2LUSA 3IC8A 2JL4A 3I43A 3UOMA 2WZ9A 2YWNA 4JEDA 3I9V2 1JLVA 1VGLA 1EP7A 4MF5A 3EMPA 1V9WA 2IMIA 1T4YA 5ECIB 4DVCA 2FHEA 5ELAA 4IP6A 2E7PA 2YWMA 3QCPA 4DSQA 1ZYNA 2EIOA 1PGTA 1SL2B 2TRXA 4DSSB 4ACSA 4XIHA 3BCIA 2VD0A 5JCWA 3DKSA 2X8HA 2VL2A 2EIQA 4G0KA 1O73A 1XPVA 1M2DA 3L9UA 4MABA 1T8EB 1CQGA 2GDRA 3SBCA 17GSA 1TU8A 2X4AA 1VF3A 1V98A 3ZREA 4D73A 3Q74A 1XW6A 1YKAA 5D9TA 1TU7A 2DJ2A 4JU5A 4JR6A 5GAPD 4JZQA 3IHGA 2RLIA 2P0GA 5G30A 18GSA 1FOVA 1F3BA 2OE0A 4PUFC 4Z2TA 5ABRA 2F9SA 4BA7A 3IXRA 1XVQA 5G31A 2CT6A 4F03A 3GNJA 1Z3EA 4BVYB 2X8GA 4MDCA 1TRSA 1B8XA 1T7PB 1GWCA 1XXUA 3C8EA 1F3AA 1ZYEA 1DBYA 1EGOA 3EMXA 3MNGA 3NOFA 3FW2A 2M46A 2KHPA 4RUVA 2FA8A 2YWOA 1U88A 1F6MC 2VOCA 4ULXA 4JR4A 2GZZA 2MBSA 2H0HA 2LRTA 5GZZB 5JWOB 4AF2A 9GSSA 2I81A 1B48A 3ZVJD 3TKPA 4EXJA 1GNWA 4WR5A 4YQUA 4Z2UA 1V40A 1U87A 1GSDA 2IFQA 1TRVA 3FEUA 3CTGA 2QC7A 4PNGA 2R3XA 2O87A 3ZFLA 3LYPA 1FHEA 4ZILA 1SU9A 4PURA 1A2MA 4K7OA 2YANA 1X5CA 4IQ1A 1JHBA 1AQVA 4N11A 4FQUA 2B6MA 1B4PA 3FZ4A 3ME7A 1GUKA 3GFKA 1XWKA 5IM9A 2HZFA 5F07A 8GSSA 1FW1A 4MPFA 3VK9A 3BBYA 3LW9A 1TI1A 4YKGA 2CA8A 4MZCA 3GIXA 2V2GA 3LORA 1V2AA 2PMTA 4J2FA 1ZOFA 4N10A 1Q98A 2AV4A 2FGXA 4WETA 4HZ2A 2B5XA 4EDYA 1GTAA 1THXA 3GKNA 2RIIA 3WGDA 5INYA 1SD9A 2KP2A 2H6YA 2A2RA 3RHCA 1S3DA 3UL3A 2PVQA 1G6WA 4GSNA 2R2JA 5CNWA 4Q5FA 2M72A 3EPTA 3IK9A 3VI5A 3F6FA 3LXTA 4HZ4A 1ERUA 5D9VA 4QL7A 2OBIA 2C0GA 1HNBA 3NIVA 4XHMA 3VWXA 1GSQA 1FAAA 3BD2A 1SL0B 2BJXA 5J5NA 4MZWA 20GSA 3M8NA 2V41A 2DJ0A 3FHKA 1X5DA 1X5EA 3VI7A 5HFIA 2AUVA 2F51A 2VAFA 3DRNA 4G0IA 1KTEA 4OFNA 2IIYA 1NHYA 2HLSA 1ZYPA 4A5PA 2LRCA 3D0ZA 3IBHA 2JSZA 5IOXA 5AGYA 2F3MA 2IL3A 1OAZA 1YF1A 3DMLA 3ZZXA 3KH7A 4IN0A 4IS0A 3VPTA 1EGRA 3TJKA 5DVBA 4ZXGA 1TK0B 3TJGA 4TKYA 2I4AA 4MP4A 3FK8A 3UVTA 3H4KA 2YPMA 1DSBA 3QPMA 3KCMA 1OKDA 2L4QA 1YQ1A 2FWFA 2REMA 4H86A 1ST9A 1XWGA 1YKCA 1SKSB 4QQ7A 2I9HA 4KA0A 1A2LA 1TTZA 1WOUA 2G2QA 2MMAA 1UVZA 3C1RA 4EIQA 2KUCA 1ZL9A 2B1LA 3TJBA 3C73A 1MTCA 3PPUA 5F05A 1XZOA 4L8EA 2KLXA 1O8XA 4V1Ag 4OD7A 3GSSA 3KMOA 2A2SA 2HZEA 2LJRA 4GQFA 2YJHA 1ZGNA 3GV1A 4FYUA 3L0HA 4I2TA 2JZRA 3LSZA 4F9ZA 5DCHA 1W89A 2DMMA 4G10A 1BYEA 2H1AA 6GSYA 1AIUA 2GQMA 2CVBA 1OE7A 2DJ1A 3FY7A 2DSAA 5DALB 3F0IA 5KN1A 1O6JA 4GTUA 5KOXA 4K2DA 1V58A 4IELA 1TRUA 3L4NA 4ISDA 2JZTA 3QDNA 4XS6A 3KP8A 4IJ3A 3EU3A 1GTUA 2LTKA 4POBA 3D4MA 1BJXA 1QGVA 2HXKA 2IPAA 1ON4A 4K7NA 1GL8A 2FWHA 2FLSA 3P2AA 1GP1A 2OE1A 2TIRA 1K3OA 1KNGA 2XPDA 4MK3A 3VFIA 4EL1A 1C72A 6GSTA 2WB9A 4WBJA 3BJ5A 3TGZA 3CBUA 4TR1B 1SKRB 1AC1A 4FH8A 5CYYA 2RUEA 1LBKA 1UC7A 3A2XA 5B7CA 10GSA 3EYTA 3HDCA 1PMTA 5G5EA 4HJ2A 2H0GA 1VF4A 2CX3A 1G7EA 5CO3A 1Z7RA 2C8UA 3QD9A 1PQNA 2X8CA 5ENUA 4K0GA 1SL1B 2WCIA 4ECCA 2LJAA 1SK0A 3U6VA 3LWAA 5CRHA 3HVVA 5ECRB 1XCCA 3HKRA 4CHSA 2CZ3A 1I5GA 2WJUA 1GUMA 3RAZA 2B7KA 2B3SA 3RPNA 4KH7A 3J7Yb 2H76A 1ABAA 4ZIJA 5IQYA 1AQWA 2JZSA 2H1BA 5CREA 4MJEA 2ON5A 3QAWA 2ZNMA 2O85A 2G0FA 1GSUA 4ZBDA 1XOBA 4AJ6A 1GSEA 4K0NA 4TRXA 4V2MA 4EF0A 5B8AA 3P7XA 4E8EA 1ZCPA 1K0OA 2VM2A 3G7IA 5AISA 5F0GA 4PQ1A 3DVXA 5DALA 1ZMAA 1GLPA 2N5FA 4EUYA 2FWGA 4K7IA 1FG4A 4ZB9A 3KMNA 2VM1A 4G9HA 1QQ2A 3P8WA 1M0UA 4KCEA 2H66A 3QAGA 2PGTA 4HEA2 2DBCA 3GX8A 5DJMA 3JCML 3QFAC 4CY8A 3DXBA 1T4ZA 2A4HA 2C80A 4NPBA 4RQXA 4L0UA 4EO3A 1Q4JA 2HSHA 3ZIVA 1X0RA 1WWJA 4O5RA 4TR1A 5IO2A 1R5AA 1K3LA 1VF1A 2M80A 3H93A 2A4VA 1B9XC 3UIWA 2LRNA 2IJYA 3IPZA 1PL2A 3MSZA 3VLNA 4WXTA 4IW9A 5AIXA 4AJ8A 3Q6OA 1R5PA 3DGQA 1KEBA 3GA4A 5KN3A 3UJ1A 5H5SA 3HD5A 1GTBA 4F0BA 3GURA 3S9FA 4ILFA 4POKA 2VO4A 1PFOA 3D4TA 1NW2A 5A4VA 2DJ3A 3QMXA 5HR2A 4GSSA 1XW5A 1A24A 5GSTA 3LYKA 1AW9A 4ZB8A 2YV9A 1WPIA 3RDWA 3N9JA 1USBA 2I3YA 2PUKC 4YAVA 4YQVA 1S3RA 4TXOA 2L5LA 2MMNA 1GH2A 5ECPB 4GLTA 3VWUA 1U3IA 2H72A 5FHIA 1A2JA 4BWQA 2D2ZA 1ZYQB 1QFNA 2A2PA 2H01A 2WS2A 3CSJA 5AIVA 3UMAA 1F2EA 5IMAA 3RHBA 3DYRA 2WULA 4PXOA 2GTUA 2X64A 4NXIA 5ECQB 1IYHA 4KCAA 5IIZA 6GSUA 2O7KA 4BVXA 1YEPA 4K5SA 2ES7A 4OFTA 5EL8A 2FY6A 2B1KA 3IK7A 3WGXA 5H5QA 3WT2A 2CV4A 5A4WA 4OMVA 1PX6A 3G7JA 3OR5A 2V1MA 4O5UA 4GXZA 2EIRA 5D9XA 4KGIA 1PN0A 3ZITA 2AB6A 4DEJA 1J0FA 5C00A 4QL9A 2O89A 5GAND 5IMVA 2V6KA 4IGJA 3CYNA 4POLA 13GSA 2QGVA 4EVMA 4XTSA 3LGCA 4PUAA 4MPGA 1KBNA 1X9MB 4WR4A 2HRAA 1TI3A 4ML6A 5ELGA 2LQQA 3L9SA 3LFLA 2L59A 1GSFA 3TRPA 1K0AA 1M2AA 3W6GA 1M99A 2OACA 3DWVA 1DE1A 4KSOA 4YAPA 1YZXA 2MBTA 1RK4A 22GSA 3BCKA 5A5KA 4RI7A 4HI7A 1TDIA 2DMLA 4NV2A 4JRRA 5DBQA 4DSSA 3F6DA 1B4QA 3GTUB 2NVLA 5F06A 4BL7B 1T00A 3ISOA 4CDOA 2WGRA 2L6CA 1EEMA 4ECJA 2B5EA 2E2GA 3KGKA 4KSMA 1T1VA 3APSA 2H19A 2DC5A 3H8QA 3HJOA 1M2BA 3H1NA 4ZL9A 4L5LA 3GUSA 1GUHA 4MZBA 3APOA 2P5RA 1JZRA 2RM5A 3HHVA 4HU9A 4P3YB 4PQHA 4ZL7A 3KTBA 1PX7A 1ERVA 2PPTA 1S3AA 1ILOA 3DD3A 1K0BA 1K0MA 2GVPA 1FVKA 4MH3A 3IDVA 1HQOA 2L4CA 3LJRA 4DSRA 1WJKA 4N30A 1O85A 5J3RA 1EZKA 4KAEA 3LXZA 3W8SA 4BVYA 1TRWA 2OKAA 5IO0A 2PBJA 3IHQA 5B6MA 5COHA 3J7Yk 3HJPA 3UBLA 2VCZA 4J57E 1R26A 3GL5A 2VCTA 4EKZA 5A4UA 2XBQA 3GX0A 3FKFA 2OA7A 1SKWB 1J08A 2FWEA 3A5IA 5CP1A 1R7HA 4LL1B 3TKQA 1PN9A 1M3IA 4G19A 3E0UA 3G9BA 14GSA 1EV9A 3H79A 4N0VA 1WP0A 2YZHA 4F82A 3CTFA 4EC0A 4LA1A 3Q18A 1MD3A 1G7OA 3EU4A 5HR3A 5C04A 4KDYA 4BPYA 2FNOA 5E4WA 3A3TA 4K9ZA 4NWYA 1DUGA 1U6TA 1TXXA 4J56E 1VRSD 2RUFA 4WF5A 4LLRA 5CAXA 2VCVA 2V32A 4HS1A 3EVIA 3BOAA 6GSVA 1AUCA 2B5YA 1TK5B 1PKWA 3IAM2 1U3AA 5ID2B 1Y25A 3QOUA 4I8BA 3L9VA 3FZ9A 5B6NA 1GRXA 1LU4A 4HSCX 1A23A 2GSTA 2H73A 4XRDA 4USSA 1GNEA 1YJ6A 3TUEA 4E8HA 1OC3A 4XS4B 4FYBA 3WD6A 2MMOA 2L5OA 3MAKA 3LEFA 4V1Ap 3W8JA 4MF7A 2H75A 1AXDA 2IMDA 2JADA 1K3YA 2H30A 4NV5A 4JBBA 2JACA 1YDKA 4MJAA 5J41A 3IA1A 1DE2A 4O32A 2CX4A 2R4VA 4I2UA 1SJZA 2AAWA 1OC9B 2CVDA 4KDXA 1N2AA 1Z7PA 3TKSA 3ERGA 2CZ2A 3QAVA 3O3TA 4MH2A 4G2EA 1X9SB 3FR9A 2ZUPA 5HFKA 3ERWA 3ZTLA 4HQZA 3TJFA 4K1FA 3ZFBA 1XVWA 2K8SA 3UVHA 2K8VA 1AAZA 4F0CA 4ECIA 2H1DA 2C0EA 1PA3A 5D93A 4KUNA 3E3EA 3F8UA 3Q19A 4Q5QA 4XRAA 2VLTA 3R3EA 5ECLB 2YV7A 5HQPA 3TJJA 1K0DA 2DLXA 1BAYA 2HFDA 4MF6A 4HDEA 3GKKA 1EV4A 1OE8A 3HXSA 4O92A 1NHOA 3GYKA 3APQA 4JE1A 2IMEA 5HR0A 4FO5A 1MDIA 3ZIJA 5ECOB 5BRTA 3D5JA 3F4SA 2IN3A 4ICYA 1H75A 4G0LA 5GSSA 2XC2A 3HYPA 2UZ8A 3CRTA 4OWYA 2DKHA 5CRGA 7GSSA 2HNLA 3LG6A 2F8FA 3SWLA 1XWAA 3HY2A 4GRFA 4MA9A 2R0GA 1JFUA 4I97A 1MDJA 2GS3A 5JCGA 3FZ5A 2OADA 2HRNA 4XS4A 2GSRA 3MWHA 3GN3A 5G2ZA 3HJMA 1G0TA 2FUG2 1TW9A 2FCHA 3N5OA 3FR6A 2OBKA 4D73B 16GSA 1QXHA 4WF4A 4YKFA 3M0FA 4KE3A 1XFLA 1XBSA 5D8IA 4NHZA 1OKTA 3TKRA 2RM6A 2GZYA 5ECNB 4GQCA 1O81A 2QSIA 4HU7A 5J4UA 3FMWA 2YN1A 4TN8A 3O6TA 2YWIA 3A2WA 5IMCA 2L6DA 4IP1A 2DJKA 5IMFA 4GF0A 2IWTA 2O8VB 3WYWA 2IMKA 2J9HA 4IQAA 3TKSC 1CQHA 4AJ7A 4ZBBA 2VCWA 1ERWA 1PRXA 2GT6A 4EDZA 4HOJA 5ECSA 4ZBAA 1GTIA 2AYTA 4EIPA 4KX4A 5DAKB 1WMJA 3CRUA 2IFQB 3M9JA 3HZ4A 2J23A 1THOA 3GHAA 1GSSA 3F9UA 4KDUA 1AQXA 2DJJA 3EWLA 1SJIA 2HI7A 3VPQA 3DVWA 2H1GA 3A5WA 3V1WA 5EY6A 3E9JB 5KOWA 3LQ7A 1TOFA 2LSTA 2YCDA 2YNXA 3GKXA 2NTOA 4ECBA 2KOKA 5DQSA 1H4OA 2C3QA 2WRTA 1ACVA 2VLUA 5J9CA 3F3QA 1QMVA 4FIWA 3M9KA 5KN2A 4K5RA 1XOAA 3ZYWA 1NM3A 2GQLA 4LMWA 3CSIA 2VL3A 1BEDA 4V2NA 3IRAA 3US3A 2LJKA 5LNKe 2FA4A 2YP6A 4ID0A 4GSTA 4V2LA 4BWSA 5J9BA 2C4JA 1Y6EA 2X99A 1S3CA 3GMFA 2MZCA 5DDLA 5DQYA 2CQ9A 5JWRB 2N5AA 5EPFA 1UN2A 2LS5A 1HNCA 2R0PA 2C3TA 4MLYA 2H70A 3HVSA 3TCOA 1XIYA 3IV4A 6GSSA 5H5RA 5IOWA 3RBTA 1EEJA 1JLWA 4RQRA 1HD2A 2K18A 4TOPA 4YH2A 4Q5NA 5FT3A 2H6ZA 3M1GA 2GSQA 3IOSA 2PU9C 3IAS2 4O5QA 4OCEA 1A8LA 1MEKA 2MMZA 1Z5YE 2E2MA 2C0FA 1MDKA 2GQKA 3AY8A 4PX1A 1EOGA 2R37A 4X1UA 2GT5A 3ZVJA 4L5OA 4XCSA 3HA9A 3VURA 5DAKA 4RI6A 3D21A 4NMUA 4F2IA 3UAPA 4OO4A 3QR6A 4TW5A 4IVFA 3KXOA 3IE3A 5IPHA 3D22A 2VUPA 1URMA 1PSQA 5AN1A 1MD4A 1V57A 2QKEA 2I1UA 4CW9A 3O76A 4HJMA 5CRDA 3C7MA 3PH9A 4PNFA 3QFBC 5JCUA 3C71A 3GH6A 5HR1A 3KZQA 3G7YA 1A0RP 4ML1A 3DEXA 4MCUA 1E2YA 1F37A 3MDKA 2PWJA 3F4RA 3FYGA 3ZMKA 1F9MA 3KEBA 4XS1A 4OCFA 2ALBA 2IMFA 3EURA 1M7TA 2NPBA 1HNAA 4NHWA 3CXGA 1BG5A 1QK8A 2HRKA 2HZEB 5G1KA 2L57A 1NSWA 3UBKA 3MIXA 4K8MA 5IMZA 4O7HA 3TOUA 4GWRA 5G1LA 4EE0A 4X43A 2JU5A 2VL2C 3IR4A 2DIYA 2HRFA 2GZPA 3F63A 4PTSA 3HCZA 3ED3A 3U5RE 2DIZA 1SYRA 2CAQA 3KJYA 2OJLA 5D73A 2XHFA 5CRWA 1Z9HA 2F8AA 1BX9A 4MJBA 2YJ7A 4L0WA 1SENA 1EP8A 2GSSA 2E0QA 1ZZYA 2VCXA 1I9DA 1SK2A 2AJQB 3VWVA 1O7UA 4TXVA 2H71A 2N5BA 3P90A 3KD0A 1Z6MA 4YQMA 1OYJA 5JWQB 2C1YA 3FR3A 1TP9A 2V6OA 4MMMA 3ZLPA 3F4TA 3UARA 2LNSA 3R2QA 3CMIA 2WDUA 1ML6A 1JZOA 3GSTA 3I6AA 1GSYA 1OVNA 5IPGA 5L71A 1WIKA 2EC4A 5EVOA 1SJ6A 4MJCA 5LCZA 1TKDB 1EWXA 1O8WA 3GTUA 4MNNA 4FYCA 4WEYA 4Z7XA 1SYXA 3A2VA 11GSA 3EINA 6GSWA 4IBPA 5D96A 2BMXA 1QUWA 4BL7A 3CSHA 1M9AA 1ERTA 2C3NA 2K6VA 12GSA 1UA5A 2H74A 3FRCA 3ZMLA 2BTOT 3GKMA 2VD1A 1WE0A 3DIEA 4KF9A 3FZAA 3K8NA 5F8BA 1YF0A 4X4JA 4Q5RA 1XW9A 5G5FA 1HYUA 2KP1A 1FB0A 4OO5A 3TRQA 3EE2A 2R6KA 2GLRA 1XG8A 3EC3A 1M9BA 2HSYA 3TOTA 3L78A 2TRCP 4WBRD 2LQOA 1LJRA 1M3JA 1SD8A 4TR3A 4IKHA 2NDOA 4LMVA 1JZWA 2WFCA 2MYGA 2VIMA 2QA1A 5DCGA 1PKZA
chains in the Genus database with same CATH topology
1IYIA 2AHEA 3KH9A 1PL1A 4X0XA 3KIJA 5ECHB 3ERFA 1W4VA 1TJDA 3VWWA 4PGTA 2ZCTA 1A0FA 4GCIA 1X9WB 1WRYA 3C1SA 1R4WA 3HZ8A 5KN0A 2DKIA 3F3RA 1TK8B 4AGSA 1BQ7A 2B7JA 4K2XA 6GSXA 4HUAA 2X49A 1RQMA 2QA2A 2PN8A 2C0DA 1RW1A 1E6BA 1K0CA 4TR4A 4I5QA 1SK1A 4N0ZA 2OE3A 3I69A 5HFGA 3KTLA 2XPEA 3KP9A 1FVJA 5ECKB 4IHUA 2P31A 5E59A 3GL3A 5ECMB 4KNDA 2LNTA 3NZNA 2HE3A 1G6YA 2K9FA 1GULA 2YZUA 19GSA 3D6IA 1JZDA 2CAIA 3TDGA 2NBSA 4I6XA 3IC4A 5B8BA 4ZB6A 4KW6A 1YY7A 2YOIA 5ID2A 2CVKA 1XWBA 3ZL5A 2HYXA 5BMUA 2R5GA 3TRXA 3KM6A 4LL4B 3ZRDA 4TXOB 3PR8A 5IMDA 2JSYA 1GLQA 2R0CA 2PVOC 3TKSE 3GH9A 1XWCA 1A8YA 2VL9A 2LV3A 1B9YC 2VLVA 2LKUA 2ON7A 4HQSA 4ZL8A 5FWGA 3RPPA 2FD3A 2HT9A 4Z2RA 3HVXA 4K6XA 1OC9A 5LD0A 4NAXA 3TB2A 4BVXB 1FO5A 3WT1A 2H0IA 2H6XA 1K0NA 4WKWA 2PERA 1EOHA 2GGTA 3WGEA 1VF2A 3M3MA 1Z6NA 2VCQA 4IJIA 2P5QA 3PGTA 1YEXA 3GRXA 1OC8A 5KEJA 2LEGA 3ME8A 3UEMA 4KB3A 5D9WA 2Z9SA 4PQIA 4OFMA 1N8JA 1J9BA 4CY6A 1FB6A 4POMA 3PINA 1PD21 4TR0A 5DJLA 1FOHA 3MYDA 4TVEA 2H8LA 1T3BA 2XBIA 2HSMA 2LUSA 3IC8A 2JL4A 3I43A 3UOMA 2WZ9A 2YWNA 4JEDA 3I9V2 1JLVA 1VGLA 1EP7A 4MF5A 3EMPA 1V9WA 2IMIA 1T4YA 5ECIB 4DVCA 2FHEA 5ELAA 4IP6A 2E7PA 2YWMA 3QCPA 4DSQA 1ZYNA 2EIOA 1PGTA 1SL2B 2TRXA 4DSSB 4ACSA 4XIHA 3BCIA 2VD0A 5JCWA 3DKSA 2X8HA 2VL2A 2EIQA 4G0KA 1O73A 1XPVA 1M2DA 3L9UA 4MABA 1T8EB 1CQGA 2GDRA 3SBCA 17GSA 1TU8A 2X4AA 1VF3A 1V98A 3ZREA 4D73A 3Q74A 1XW6A 1YKAA 5D9TA 1TU7A 2DJ2A 4JU5A 4JR6A 5GAPD 4JZQA 3IHGA 2RLIA 2P0GA 5G30A 18GSA 1FOVA 1F3BA 2OE0A 4PUFC 4Z2TA 5ABRA 2F9SA 4BA7A 3IXRA 1XVQA 5G31A 2CT6A 4F03A 3GNJA 1Z3EA 4BVYB 2X8GA 4MDCA 1TRSA 1B8XA 1T7PB 1GWCA 1XXUA 3C8EA 1F3AA 1ZYEA 1DBYA 1EGOA 3EMXA 3MNGA 3NOFA 3FW2A 2M46A 2KHPA 4RUVA 2FA8A 2YWOA 1U88A 1F6MC 2VOCA 4ULXA 4JR4A 2GZZA 2MBSA 2H0HA 2LRTA 5GZZB 5JWOB 4AF2A 9GSSA 2I81A 1B48A 3ZVJD 3TKPA 4EXJA 1GNWA 4WR5A 4YQUA 4Z2UA 1V40A 1U87A 1GSDA 2IFQA 1TRVA 3FEUA 3CTGA 2QC7A 4PNGA 2R3XA 2O87A 3ZFLA 3LYPA 1FHEA 4ZILA 1SU9A 4PURA 1A2MA 4K7OA 2YANA 1X5CA 4IQ1A 1JHBA 1AQVA 4N11A 4FQUA 2B6MA 1B4PA 3FZ4A 3ME7A 1GUKA 3GFKA 1XWKA 5IM9A 2HZFA 5F07A 8GSSA 1FW1A 4MPFA 3VK9A 3BBYA 3LW9A 1TI1A 4YKGA 2CA8A 4MZCA 3GIXA 2V2GA 3LORA 1V2AA 2PMTA 4J2FA 1ZOFA 4N10A 1Q98A 2AV4A 2FGXA 4WETA 4HZ2A 2B5XA 4EDYA 1GTAA 1THXA 3GKNA 2RIIA 3WGDA 5INYA 1SD9A 2KP2A 2H6YA 2A2RA 3RHCA 1S3DA 3UL3A 2PVQA 1G6WA 4GSNA 2R2JA 5CNWA 4Q5FA 2M72A 3EPTA 3IK9A 3VI5A 3F6FA 3LXTA 4HZ4A 1ERUA 5D9VA 4QL7A 2OBIA 2C0GA 1HNBA 3NIVA 4XHMA 3VWXA 1GSQA 1FAAA 3BD2A 1SL0B 2BJXA 5J5NA 4MZWA 20GSA 3M8NA 2V41A 2DJ0A 3FHKA 1X5DA 1X5EA 3VI7A 5HFIA 2AUVA 2F51A 2VAFA 3DRNA 4G0IA 1KTEA 4OFNA 2IIYA 1NHYA 2HLSA 1ZYPA 4A5PA 2LRCA 3D0ZA 3IBHA 2JSZA 5IOXA 5AGYA 2F3MA 2IL3A 1OAZA 1YF1A 3DMLA 3ZZXA 3KH7A 4IN0A 4IS0A 3VPTA 1EGRA 3TJKA 5DVBA 4ZXGA 1TK0B 3TJGA 4TKYA 2I4AA 4MP4A 3FK8A 3UVTA 3H4KA 2YPMA 1DSBA 3QPMA 3KCMA 1OKDA 2L4QA 1YQ1A 2FWFA 2REMA 4H86A 1ST9A 1XWGA 1YKCA 1SKSB 4QQ7A 2I9HA 4KA0A 1A2LA 1TTZA 1WOUA 2G2QA 2MMAA 1UVZA 3C1RA 4EIQA 2KUCA 1ZL9A 2B1LA 3TJBA 3C73A 1MTCA 3PPUA 5F05A 1XZOA 4L8EA 2KLXA 1O8XA 4V1Ag 4OD7A 3GSSA 3KMOA 2A2SA 2HZEA 2LJRA 4GQFA 2YJHA 1ZGNA 3GV1A 4FYUA 3L0HA 4I2TA 2JZRA 3LSZA 4F9ZA 5DCHA 1W89A 2DMMA 4G10A 1BYEA 2H1AA 6GSYA 1AIUA 2GQMA 2CVBA 1OE7A 2DJ1A 3FY7A 2DSAA 5DALB 3F0IA 5KN1A 1O6JA 4GTUA 5KOXA 4K2DA 1V58A 4IELA 1TRUA 3L4NA 4ISDA 2JZTA 3QDNA 4XS6A 3KP8A 4IJ3A 3EU3A 1GTUA 2LTKA 4POBA 3D4MA 1BJXA 1QGVA 2HXKA 2IPAA 1ON4A 4K7NA 1GL8A 2FWHA 2FLSA 3P2AA 1GP1A 2OE1A 2TIRA 1K3OA 1KNGA 2XPDA 4MK3A 3VFIA 4EL1A 1C72A 6GSTA 2WB9A 4WBJA 3BJ5A 3TGZA 3CBUA 4TR1B 1SKRB 1AC1A 4FH8A 5CYYA 2RUEA 1LBKA 1UC7A 3A2XA 5B7CA 10GSA 3EYTA 3HDCA 1PMTA 5G5EA 4HJ2A 2H0GA 1VF4A 2CX3A 1G7EA 5CO3A 1Z7RA 2C8UA 3QD9A 1PQNA 2X8CA 5ENUA 4K0GA 1SL1B 2WCIA 4ECCA 2LJAA 1SK0A 3U6VA 3LWAA 5CRHA 3HVVA 5ECRB 1XCCA 3HKRA 4CHSA 2CZ3A 1I5GA 2WJUA 1GUMA 3RAZA 2B7KA 2B3SA 3RPNA 4KH7A 3J7Yb 2H76A 1ABAA 4ZIJA 5IQYA 1AQWA 2JZSA 2H1BA 5CREA 4MJEA 2ON5A 3QAWA 2ZNMA 2O85A 2G0FA 1GSUA 4ZBDA 1XOBA 4AJ6A 1GSEA 4K0NA 4TRXA 4V2MA 4EF0A 5B8AA 3P7XA 4E8EA 1ZCPA 1K0OA 2VM2A 3G7IA 5AISA 5F0GA 4PQ1A 3DVXA 5DALA 1ZMAA 1GLPA 2N5FA 4EUYA 2FWGA 4K7IA 1FG4A 4ZB9A 3KMNA 2VM1A 4G9HA 1QQ2A 3P8WA 1M0UA 4KCEA 2H66A 3QAGA 2PGTA 4HEA2 2DBCA 3GX8A 5DJMA 3JCML 3QFAC 4CY8A 3DXBA 1T4ZA 2A4HA 2C80A 4NPBA 4RQXA 4L0UA 4EO3A 1Q4JA 2HSHA 3ZIVA 1X0RA 1WWJA 4O5RA 4TR1A 5IO2A 1R5AA 1K3LA 1VF1A 2M80A 3H93A 2A4VA 1B9XC 3UIWA 2LRNA 2IJYA 3IPZA 1PL2A 3MSZA 3VLNA 4WXTA 4IW9A 5AIXA 4AJ8A 3Q6OA 1R5PA 3DGQA 1KEBA 3GA4A 5KN3A 3UJ1A 5H5SA 3HD5A 1GTBA 4F0BA 3GURA 3S9FA 4ILFA 4POKA 2VO4A 3D4TA 1NW2A 5A4VA 2DJ3A 3QMXA 5HR2A 4GSSA 1XW5A 1A24A 5GSTA 3LYKA 1AW9A 4ZB8A 2YV9A 1WPIA 3RDWA 3N9JA 1USBA 2I3YA 2PUKC 4YAVA 4YQVA 4TXOA 2L5LA 2MMNA 1GH2A 5ECPB 4GLTA 3VWUA 1U3IA 2H72A 5FHIA 1A2JA 4BWQA 2D2ZA 1ZYQB 1QFNA 2A2PA 2H01A 2WS2A 3CSJA 5AIVA 3UMAA 1F2EA 5IMAA 3RHBA 3DYRA 2WULA 4PXOA 2GTUA 2X64A 4NXIA 5ECQB 1IYHA 4KCAA 5IIZA 6GSUA 2O7KA 4BVXA 1YEPA 4K5SA 2ES7A 4OFTA 5EL8A 2FY6A 2B1KA 3IK7A 3WGXA 5H5QA 3WT2A 2CV4A 5A4WA 4OMVA 1PX6A 3G7JA 3OR5A 2V1MA 4O5UA 4GXZA 2EIRA 5D9XA 4KGIA 1PN0A 3ZITA 2AB6A 4DEJA 1J0FA 5C00A 4QL9A 2O89A 5GAND 5IMVA 2V6KA 4IGJA 3CYNA 4POLA 13GSA 2QGVA 4EVMA 4XTSA 3LGCA 4PUAA 4MPGA 1KBNA 1X9MB 4WR4A 2HRAA 1TI3A 4ML6A 5ELGA 2LQQA 3L9SA 3LFLA 2L59A 1GSFA 3TRPA 1K0AA 1M2AA 3W6GA 1M99A 2OACA 3DWVA 1DE1A 4KSOA 4YAPA 1YZXA 2MBTA 1RK4A 22GSA 3BCKA 5A5KA 4RI7A 4HI7A 1TDIA 2DMLA 4NV2A 4JRRA 5DBQA 4DSSA 3F6DA 1B4QA 3GTUB 2NVLA 5F06A 4BL7B 1T00A 3ISOA 4CDOA 2WGRA 2L6CA 1EEMA 4ECJA 2B5EA 2E2GA 3KGKA 4KSMA 1T1VA 3APSA 2H19A 2DC5A 3H8QA 3HJOA 1M2BA 3H1NA 4ZL9A 4L5LA 3GUSA 1GUHA 4MZBA 3APOA 2P5RA 1JZRA 2RM5A 3HHVA 4HU9A 4P3YB 4PQHA 4ZL7A 3KTBA 1PX7A 1ERVA 2PPTA 1S3AA 1ILOA 3DD3A 1K0BA 1K0MA 2GVPA 1FVKA 4MH3A 3IDVA 1HQOA 2L4CA 3LJRA 4DSRA 1WJKA 4N30A 1O85A 5J3RA 1EZKA 4KAEA 3LXZA 3W8SA 4BVYA 1TRWA 2OKAA 5IO0A 2PBJA 3IHQA 5B6MA 5COHA 3J7Yk 3HJPA 3UBLA 2VCZA 4J57E 1R26A 3GL5A 2VCTA 4EKZA 5A4UA 2XBQA 3GX0A 3FKFA 2OA7A 1SKWB 1J08A 2FWEA 3A5IA 5CP1A 1R7HA 4LL1B 3TKQA 1PN9A 4G19A 3E0UA 3G9BA 14GSA 1EV9A 3H79A 4N0VA 1WP0A 2YZHA 4F82A 3CTFA 4EC0A 4LA1A 3Q18A 1MD3A 1G7OA 3EU4A 5HR3A 5C04A 4KDYA 4BPYA 2FNOA 5E4WA 3A3TA 4K9ZA 4NWYA 1DUGA 1U6TA 1TXXA 4J56E 1VRSD 2RUFA 4WF5A 4LLRA 5CAXA 2VCVA 2V32A 4HS1A 3EVIA 3BOAA 6GSVA 1AUCA 2B5YA 1TK5B 1PKWA 3IAM2 1U3AA 5ID2B 1Y25A 3QOUA 4I8BA 3L9VA 3FZ9A 5B6NA 1GRXA 1LU4A 1A23A 2GSTA 2H73A 4XRDA 4USSA 1GNEA 1YJ6A 3TUEA 4E8HA 1OC3A 4XS4B 4FYBA 3WD6A 2MMOA 2L5OA 3MAKA 3LEFA 4V1Ap 3W8JA 4MF7A 2H75A 1AXDA 2IMDA 2JADA 1K3YA 2H30A 4NV5A 4JBBA 2JACA 1YDKA 4MJAA 5J41A 3IA1A 1DE2A 4O32A 2CX4A 2R4VA 4I2UA 1SJZA 2AAWA 1OC9B 2CVDA 4KDXA 1N2AA 1Z7PA 3TKSA 3ERGA 2CZ2A 3QAVA 3O3TA 4MH2A 4G2EA 1X9SB 3FR9A 2ZUPA 5HFKA 3ERWA 3ZTLA 4HQZA 3TJFA 4K1FA 3ZFBA 1XVWA 2K8SA 3UVHA 2K8VA 1AAZA 4F0CA 4ECIA 2H1DA 2C0EA 1PA3A 5D93A 4KUNA 3E3EA 3F8UA 3Q19A 4Q5QA 4XRAA 2VLTA 3R3EA 5ECLB 2YV7A 5HQPA 3TJJA 1K0DA 2DLXA 1BAYA 2HFDA 4MF6A 4HDEA 3GKKA 1EV4A 1OE8A 3HXSA 4O92A 1NHOA 3GYKA 3APQA 4JE1A 2IMEA 5HR0A 4FO5A 1MDIA 3ZIJA 5ECOB 5BRTA 3D5JA 3F4SA 2IN3A 4ICYA 1H75A 4G0LA 5GSSA 2XC2A 3HYPA 2UZ8A 3CRTA 4OWYA 2DKHA 5CRGA 7GSSA 2HNLA 3LG6A 2F8FA 3SWLA 1XWAA 3HY2A 4GRFA 4MA9A 2R0GA 1JFUA 4I97A 1MDJA 2GS3A 5JCGA 3FZ5A 2OADA 2HRNA 4XS4A 2GSRA 3MWHA 3GN3A 5G2ZA 3HJMA 1G0TA 2FUG2 1TW9A 2FCHA 3N5OA 3FR6A 2OBKA 4D73B 16GSA 1QXHA 4WF4A 4YKFA 3M0FA 4KE3A 1XFLA 1XBSA 5D8IA 4NHZA 1OKTA 3TKRA 2RM6A 2GZYA 5ECNB 4GQCA 1O81A 2QSIA 4HU7A 5J4UA 3FMWA 2YN1A 4TN8A 3O6TA 2YWIA 3A2WA 5IMCA 2L6DA 4IP1A 2DJKA 5IMFA 4GF0A 2IWTA 2O8VB 3WYWA 2IMKA 2J9HA 4IQAA 3TKSC 1CQHA 4AJ7A 4ZBBA 2VCWA 1ERWA 1PRXA 2GT6A 4EDZA 4HOJA 5ECSA 4ZBAA 1GTIA 2AYTA 4EIPA 4KX4A 5DAKB 1WMJA 3CRUA 2IFQB 3M9JA 3HZ4A 2J23A 1THOA 3GHAA 1GSSA 3F9UA 4KDUA 1AQXA 2DJJA 3EWLA 1SJIA 2HI7A 3VPQA 3DVWA 2H1GA 3A5WA 3V1WA 5EY6A 3E9JB 5KOWA 3LQ7A 1TOFA 2LSTA 2YCDA 2YNXA 3GKXA 2NTOA 4ECBA 2KOKA 5DQSA 1H4OA 2C3QA 2WRTA 1ACVA 2VLUA 5J9CA 3F3QA 1QMVA 4FIWA 3M9KA 5KN2A 4K5RA 1XOAA 3ZYWA 1NM3A 2GQLA 4LMWA 3CSIA 2VL3A 1BEDA 4V2NA 3IRAA 3US3A 2LJKA 5LNKe 2FA4A 2YP6A 4ID0A 4GSTA 4V2LA 4BWSA 5J9BA 2C4JA 1Y6EA 2X99A 1S3CA 3GMFA 2MZCA 5DDLA 5DQYA 2CQ9A 5JWRB 2N5AA 5EPFA 1UN2A 2LS5A 1HNCA 2R0PA 2C3TA 4MLYA 2H70A 3HVSA 3TCOA 1XIYA 3IV4A 6GSSA 5H5RA 5IOWA 3RBTA 1EEJA 1JLWA 4RQRA 1HD2A 2K18A 4TOPA 4YH2A 4Q5NA 5FT3A 2H6ZA 3M1GA 2GSQA 3IOSA 2PU9C 3IAS2 4O5QA 4OCEA 1A8LA 1MEKA 2MMZA 1Z5YE 2E2MA 2C0FA 1MDKA 2GQKA 3AY8A 4PX1A 1EOGA 2R37A 4X1UA 2GT5A 3ZVJA 4L5OA 4XCSA 3HA9A 3VURA 5DAKA 4RI6A 3D21A 4NMUA 4F2IA 3UAPA 4OO4A 3QR6A 4TW5A 4IVFA 3KXOA 3IE3A 5IPHA 3D22A 2VUPA 1URMA 1PSQA 5AN1A 1MD4A 1V57A 2QKEA 2I1UA 4CW9A 3O76A 4HJMA 5CRDA 3C7MA 3PH9A 4PNFA 3QFBC 5JCUA 3C71A 3GH6A 5HR1A 3KZQA 3G7YA 1A0RP 4ML1A 3DEXA 4MCUA 1E2YA 1F37A 3MDKA 2PWJA 3F4RA 3FYGA 3ZMKA 1F9MA 3KEBA 4XS1A 4OCFA 2ALBA 2IMFA 3EURA 1M7TA 2NPBA 1HNAA 4NHWA 3CXGA 1BG5A 1QK8A 2HRKA 2HZEB 5G1KA 2L57A 1NSWA 3UBKA 3MIXA 4K8MA 5IMZA 4O7HA 3TOUA 4GWRA 5G1LA 4EE0A 4X43A 2JU5A 2VL2C 3IR4A 2DIYA 2HRFA 2GZPA 3F63A 4PTSA 3HCZA 3ED3A 3U5RE 2DIZA 1SYRA 2CAQA 3KJYA 2OJLA 5D73A 2XHFA 5CRWA 1Z9HA 2F8AA 1BX9A 4MJBA 2YJ7A 4L0WA 1SENA 1EP8A 2GSSA 2E0QA 1ZZYA 2VCXA 1I9DA 1SK2A 2AJQB 3VWVA 1O7UA 4TXVA 2H71A 2N5BA 3P90A 3KD0A 1Z6MA 4YQMA 1OYJA 5JWQB 2C1YA 3FR3A 1TP9A 2V6OA 4MMMA 3ZLPA 3F4TA 3UARA 2LNSA 3R2QA 3CMIA 2WDUA 1ML6A 1JZOA 3GSTA 3I6AA 1GSYA 1OVNA 5IPGA 5L71A 1WIKA 2EC4A 5EVOA 1SJ6A 4MJCA 5LCZA 1TKDB 1EWXA 1O8WA 3GTUA 4MNNA 4FYCA 4WEYA 4Z7XA 1SYXA 3A2VA 11GSA 3EINA 6GSWA 4IBPA 5D96A 2BMXA 1QUWA 4BL7A 3CSHA 1M9AA 1ERTA 2C3NA 2K6VA 12GSA 1UA5A 2H74A 3FRCA 3ZMLA 2BTOT 3GKMA 2VD1A 1WE0A 3DIEA 4KF9A 3FZAA 3K8NA 5F8BA 1YF0A 4X4JA 4Q5RA 1XW9A 5G5FA 1HYUA 2KP1A 1FB0A 4OO5A 3TRQA 3EE2A 2R6KA 2GLRA 3EC3A 1M9BA 2HSYA 3TOTA 3L78A 2TRCP 4WBRD 2LQOA 1LJRA 1SD8A 4TR3A 4IKHA 2NDOA 4LMVA 1JZWA 2WFCA 2MYGA 2VIMA 2QA1A 5DCGA 1PKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYI A;  2AHE A;  3KH9 A;  1PL1 A;  4X0X A;  3KIJ A;  5ECH B;  3ERF A;  1W4V A;  1TJD A;  3VWW A;  4PGT A;  2ZCT A;  1A0F A;  4GCI A;  1X9W B;  1WRY A;  3C1S A;  1R4W A;  3HZ8 A;  5KN0 A;  3F3R A;  1TK8 B;  4AGS A;  1BQ7 A;  2B7J A;  6GSX A;  4HUA A;  1RQM A;  2PN8 A;  2C0D A;  1RW1 A;  1E6B A;  1K0C A;  4TR4 A;  4I5Q A;  1SK1 A;  4N0Z A;  2OE3 A;  3I69 A;  5HFG A;  3KTL A;  2XPE A;  3KP9 A;  1FVJ A;  5ECK B;  4IHU A;  2P31 A;  5E59 A;  3GL3 A;  5ECM B;  4KND A;  2LNT A;  3NZN A;  2HE3 A;  1G6Y A;  2K9F A;  1GUL A;  2YZU A;  19GS A;  3D6I A;  1JZD A;  2CAI A;  3TDG A;  2NBS A;  4I6X A;  3IC4 A;  5B8B A;  4ZB6 A;  4KW6 A;  1YY7 A;  2YOI A;  5ID2 A;  2CVK A;  1XWB A;  3ZL5 A;  2HYX A;  2R5G A;  3TRX A;  3KM6 A;  4LL4 B;  3ZRD A;  4TXO B;  3PR8 A;  5IMD A;  2JSY A;  1GLQ A;  2PVO C;  3TKS E;  3GH9 A;  1XWC A;  1A8Y A;  2VL9 A;  2LV3 A;  1B9Y C;  2VLV A;  2LKU A;  2ON7 A;  4HQS A;  4ZL8 A;  5FWG A;  3RPP A;  2FD3 A;  2HT9 A;  3HVX A;  4K6X A;  1OC9 A;  5LD0 A;  4NAX A;  3TB2 A;  1FO5 A;  3WT1 A;  2H0I A;  2H6X A;  1K0N A;  4WKW A;  2PER A;  1EOH A;  2GGT A;  3WGE A;  1VF2 A;  3M3M A;  1Z6N A;  2VCQ A;  4IJI A;  2P5Q A;  3PGT A;  1YEX A;  3GRX A;  1OC8 A;  5KEJ A;  2LEG A;  3ME8 A;  3UEM A;  4KB3 A;  5D9W A;  2Z9S A;  4PQI A;  4OFM A;  1N8J A;  1J9B A;  1FB6 A;  4POM A;  3PIN A;  1PD2 1;  4TR0 A;  5DJL A;  4TVE A;  2H8L A;  1T3B A;  2XBI A;  2LUS A;  2JL4 A;  3I43 A;  3UOM A;  2WZ9 A;  2YWN A;  4JED A;  3I9V 2;  1JLV A;  1VGL A;  1EP7 A;  4MF5 A;  3EMP A;  1V9W A;  2IMI A;  1T4Y A;  5ECI B;  4DVC A;  2FHE A;  5ELA A;  4IP6 A;  2E7P A;  2YWM A;  3QCP A;  4DSQ A;  2EIO A;  1PGT A;  1SL2 B;  2TRX A;  4DSS B;  4ACS A;  4XIH A;  3BCI A;  2VD0 A;  5JCW A;  3DKS A;  2X8H A;  2VL2 A;  2EIQ A;  1O73 A;  1XPV A;  1M2D A;  3L9U A;  4MAB A;  1T8E B;  1CQG A;  2GDR A;  3SBC A;  17GS A;  1TU8 A;  1VF3 A;  1V98 A;  3ZRE A;  4D73 A;  3Q74 A;  1XW6 A;  1YKA A;  5D9T A;  1TU7 A;  2DJ2 A;  4JU5 A;  4JR6 A;  5GAP D;  4JZQ A;  2RLI A;  2P0G A;  5G30 A;  18GS A;  1FOV A;  1F3B A;  2OE0 A;  4PUF C;  5ABR A;  2F9S A;  4BA7 A;  3IXR A;  1XVQ A;  5G31 A;  2CT6 A;  4F03 A;  3GNJ A;  1Z3E A;  2X8G A;  4MDC A;  1TRS A;  1B8X A;  1T7P B;  1GWC A;  1XXU A;  3C8E A;  1F3A A;  1ZYE A;  1DBY A;  1EGO A;  3EMX A;  3MNG A;  3NOF A;  3FW2 A;  2M46 A;  2KHP A;  4RUV A;  2FA8 A;  2YWO A;  1U88 A;  1F6M C;  2VOC A;  4ULX A;  4JR4 A;  2GZZ A;  2MBS A;  2H0H A;  2LRT A;  5GZZ B;  5JWO B;  4AF2 A;  9GSS A;  2I81 A;  1B48 A;  3ZVJ D;  3TKP A;  4EXJ A;  1GNW A;  4WR5 A;  4YQU A;  1V40 A;  1U87 A;  1GSD A;  2IFQ A;  1TRV A;  3FEU A;  3CTG A;  2QC7 A;  4PNG A;  2R3X A;  2O87 A;  3ZFL A;  3LYP A;  1FHE A;  4ZIL A;  1SU9 A;  4PUR A;  1A2M A;  4K7O A;  2YAN A;  1X5C A;  4IQ1 A;  1JHB A;  1AQV A;  4N11 A;  2B6M A;  1B4P A;  3FZ4 A;  3ME7 A;  1GUK A;  3GFK A;  1XWK A;  5IM9 A;  2HZF A;  5F07 A;  8GSS A;  1FW1 A;  4MPF A;  3VK9 A;  3BBY A;  1TI1 A;  2CA8 A;  4MZC A;  3GIX A;  2V2G A;  3LOR A;  1V2A A;  2PMT A;  4J2F A;  1ZOF A;  4N10 A;  1Q98 A;  2AV4 A;  2FGX A;  4WET A;  4HZ2 A;  2B5X A;  4EDY A;  1GTA A;  1THX A;  3GKN A;  2RII A;  3WGD A;  5INY A;  1SD9 A;  2KP2 A;  2H6Y A;  2A2R A;  3RHC A;  1S3D A;  3UL3 A;  2PVQ A;  1G6W A;  4GSN A;  2R2J A;  5CNW A;  4Q5F A;  2M72 A;  3IK9 A;  3VI5 A;  3F6F A;  3LXT A;  4HZ4 A;  5D9V A;  1ERU A;  4QL7 A;  2OBI A;  2C0G A;  1HNB A;  3NIV A;  4XHM A;  3VWX A;  1GSQ A;  1FAA A;  3BD2 A;  1SL0 B;  2BJX A;  5J5N A;  4MZW A;  20GS A;  3M8N A;  2V41 A;  2DJ0 A;  3FHK A;  1X5D A;  1X5E A;  3VI7 A;  5HFI A;  2AUV A;  2F51 A;  2VAF A;  3DRN A;  1KTE A;  4OFN A;  2IIY A;  1NHY A;  2HLS A;  2LRC A;  3D0Z A;  3IBH A;  2JSZ A;  5IOX A;  5AGY A;  2F3M A;  2IL3 A;  1OAZ A;  1YF1 A;  3DML A;  3ZZX A;  3KH7 A;  4IN0 A;  4IS0 A;  3VPT A;  1EGR A;  3TJK A;  5DVB A;  4ZXG A;  1TK0 B;  3TJG A;  4TKY A;  2I4A A;  4MP4 A;  3FK8 A;  3UVT A;  3H4K A;  2YPM A;  1DSB A;  3QPM A;  3KCM A;  1OKD A;  2L4Q A;  1YQ1 A;  2FWF A;  2REM A;  4H86 A;  1ST9 A;  1XWG A;  1YKC A;  1SKS B;  4QQ7 A;  2I9H A;  4KA0 A;  1A2L A;  1TTZ A;  1WOU A;  2G2Q A;  2MMA A;  1UVZ A;  3C1R A;  2KUC A;  1ZL9 A;  2B1L A;  3TJB A;  3C73 A;  1MTC A;  5F05 A;  1XZO A;  4L8E A;  2KLX A;  1O8X A;  4V1A g;  4OD7 A;  3GSS A;  3KMO A;  2A2S A;  2HZE A;  2LJR A;  4GQF A;  2YJH A;  1ZGN A;  3GV1 A;  4FYU A;  3L0H A;  4I2T A;  2JZR A;  3LSZ A;  4F9Z A;  5DCH A;  1W89 A;  2DMM A;  4G10 A;  1BYE A;  2H1A A;  6GSY A;  1AIU A;  2GQM A;  2CVB A;  1OE7 A;  2DJ1 A;  3FY7 A;  2DSA A;  5DAL B;  3F0I A;  5KN1 A;  1O6J A;  4GTU A;  4K2D A;  1V58 A;  4IEL A;  1TRU A;  3L4N A;  4ISD A;  2JZT A;  3QDN A;  4XS6 A;  3KP8 A;  4IJ3 A;  3EU3 A;  1GTU A;  2LTK A;  4POB A;  3D4M A;  1BJX A;  1QGV A;  2HXK A;  2IPA A;  1ON4 A;  4K7N A;  1GL8 A;  2FWH A;  2FLS A;  3P2A A;  1GP1 A;  2OE1 A;  2TIR A;  1K3O A;  1KNG A;  2XPD A;  4MK3 A;  3VFI A;  4EL1 A;  1C72 A;  6GST A;  2WB9 A;  4WBJ A;  3BJ5 A;  3TGZ A;  3CBU A;  4TR1 B;  1SKR B;  1AC1 A;  4FH8 A;  5CYY A;  2RUE A;  1LBK A;  1UC7 A;  3A2X A;  5B7C A;  10GS A;  3EYT A;  3HDC A;  1PMT A;  5G5E A;  4HJ2 A;  2H0G A;  1VF4 A;  2CX3 A;  1G7E A;  5CO3 A;  1Z7R A;  2C8U A;  3QD9 A;  1PQN A;  2X8C A;  5ENU A;  4K0G A;  1SL1 B;  2WCI A;  4ECC A;  2LJA A;  1SK0 A;  3U6V A;  3LWA A;  5CRH A;  3HVV A;  5ECR B;  1XCC A;  3HKR A;  4CHS A;  2CZ3 A;  1I5G A;  2WJU A;  1GUM A;  3RAZ A;  2B7K A;  2B3S A;  3RPN A;  4KH7 A;  3J7Y b;  2H76 A;  1ABA A;  4ZIJ A;  5IQY A;  1AQW A;  2JZS A;  2H1B A;  5CRE A;  4MJE A;  2ON5 A;  3QAW A;  2ZNM A;  2O85 A;  2G0F A;  1GSU A;  4ZBD A;  1XOB A;  4AJ6 A;  1GSE A;  4K0N A;  4TRX A;  4V2M A;  4EF0 A;  5B8A A;  3P7X A;  4E8E A;  1ZCP A;  1K0O A;  2VM2 A;  3G7I A;  5AIS A;  5F0G A;  4PQ1 A;  3DVX A;  5DAL A;  1ZMA A;  1GLP A;  2N5F A;  4EUY A;  2FWG A;  4K7I A;  1FG4 A;  4ZB9 A;  3KMN A;  2VM1 A;  4G9H A;  1QQ2 A;  3P8W A;  1M0U A;  4KCE A;  2H66 A;  3QAG A;  2PGT A;  4HEA 2;  2DBC A;  3GX8 A;  5DJM A;  3JCM L;  3QFA C;  3DXB A;  1T4Z A;  2C80 A;  4NPB A;  4RQX A;  4L0U A;  4EO3 A;  1Q4J A;  2HSH A;  3ZIV A;  1X0R A;  1WWJ A;  4O5R A;  4TR1 A;  5IO2 A;  1R5A A;  1K3L A;  1VF1 A;  2M80 A;  3H93 A;  2A4V A;  1B9X C;  3UIW A;  2LRN A;  2IJY A;  3IPZ A;  1PL2 A;  3MSZ A;  3VLN A;  4WXT A;  4IW9 A;  5AIX A;  4AJ8 A;  3Q6O A;  1R5P A;  3DGQ A;  1KEB A;  3GA4 A;  5KN3 A;  3UJ1 A;  5H5S A;  3HD5 A;  1GTB A;  4F0B A;  3GUR A;  3S9F A;  4ILF A;  4POK A;  2VO4 A;  3D4T A;  1NW2 A;  5A4V A;  2DJ3 A;  3QMX A;  5HR2 A;  4GSS A;  1XW5 A;  1A24 A;  5GST A;  3LYK A;  1AW9 A;  4ZB8 A;  2YV9 A;  1WPI A;  3RDW A;  3N9J A;  1USB A;  2I3Y A;  2PUK C;  4YAV A;  4YQV A;  4TXO A;  2L5L A;  2MMN A;  1GH2 A;  5ECP B;  4GLT A;  3VWU A;  1U3I A;  2H72 A;  5FHI A;  1A2J A;  4BWQ A;  2D2Z A;  1ZYQ B;  1QFN A;  2H01 A;  2WS2 A;  3CSJ A;  5AIV A;  3UMA A;  1F2E A;  5IMA A;  3RHB A;  3DYR A;  2WUL A;  4PXO A;  2GTU A;  2X64 A;  4NXI A;  5ECQ B;  1IYH A;  4KCA A;  5IIZ A;  6GSU A;  2O7K A;  4BVX A;  1YEP A;  2ES7 A;  4OFT A;  5EL8 A;  2FY6 A;  2B1K A;  3IK7 A;  3WGX A;  5H5Q A;  3WT2 A;  2CV4 A;  5A4W A;  4OMV A;  1PX6 A;  3G7J A;  3OR5 A;  2V1M A;  4GXZ A;  2EIR A;  5D9X A;  4KGI A;  3ZIT A;  2AB6 A;  4DEJ A;  1J0F A;  5C00 A;  4QL9 A;  2O89 A;  5GAN D;  5IMV A;  2V6K A;  4IGJ A;  3CYN A;  4POL A;  13GS A;  2QGV A;  4EVM A;  4XTS A;  3LGC A;  4PUA A;  4MPG A;  1KBN A;  1X9M B;  4WR4 A;  1TI3 A;  4ML6 A;  5ELG A;  2LQQ A;  3L9S A;  3LFL A;  2L59 A;  1GSF A;  3TRP A;  1K0A A;  1M2A A;  3W6G A;  1M99 A;  2OAC A;  3DWV A;  1DE1 A;  4KSO A;  4YAP A;  1YZX A;  2MBT A;  1RK4 A;  22GS A;  3BCK A;  5A5K A;  4RI7 A;  4HI7 A;  1TDI A;  2DML A;  4NV2 A;  4JRR A;  5DBQ A;  4DSS A;  3F6D A;  1B4Q A;  3GTU B;  2NVL A;  5F06 A;  1T00 A;  3ISO A;  4CDO A;  2WGR A;  2L6C A;  1EEM A;  4ECJ A;  2B5E A;  2E2G A;  3KGK A;  4KSM A;  1T1V A;  3APS A;  2H19 A;  2DC5 A;  3H8Q A;  3HJO A;  1M2B A;  3H1N A;  4ZL9 A;  4L5L A;  3GUS A;  1GUH A;  4MZB A;  3APO A;  2P5R A;  1JZR A;  2RM5 A;  3HHV A;  4HU9 A;  4P3Y B;  4PQH A;  4ZL7 A;  3KTB A;  1PX7 A;  1ERV A;  2PPT A;  1S3A A;  1ILO A;  3DD3 A;  1K0B A;  1K0M A;  2GVP A;  1FVK A;  4MH3 A;  3IDV A;  1HQO A;  2L4C A;  3LJR A;  4DSR A;  1WJK A;  4N30 A;  1O85 A;  5J3R A;  1EZK A;  4KAE A;  3LXZ A;  3W8S A;  4BVY A;  1TRW A;  2OKA A;  5IO0 A;  2PBJ A;  3IHQ A;  5B6M A;  5COH A;  3J7Y k;  3HJP A;  3UBL A;  2VCZ A;  4J57 E;  1R26 A;  3GL5 A;  2VCT A;  4EKZ A;  5A4U A;  2XBQ A;  3GX0 A;  3FKF A;  2OA7 A;  1SKW B;  1J08 A;  2FWE A;  5CP1 A;  1R7H A;  4LL1 B;  3TKQ A;  1PN9 A;  4G19 A;  3E0U A;  3G9B A;  14GS A;  1EV9 A;  3H79 A;  4N0V A;  1WP0 A;  2YZH A;  4F82 A;  3CTF A;  4EC0 A;  4LA1 A;  3Q18 A;  1MD3 A;  1G7O A;  3EU4 A;  5HR3 A;  5C04 A;  4KDY A;  4BPY A;  2FNO A;  5E4W A;  3A3T A;  4K9Z A;  4NWY A;  1DUG A;  1U6T A;  1TXX A;  4J56 E;  1VRS D;  2RUF A;  4WF5 A;  4LLR A;  5CAX A;  2VCV A;  2V32 A;  4HS1 A;  3EVI A;  3BOA A;  6GSV A;  1AUC A;  2B5Y A;  1TK5 B;  1PKW A;  3IAM 2;  1U3A A;  5ID2 B;  1Y25 A;  3QOU A;  4I8B A;  3L9V A;  3FZ9 A;  5B6N A;  1GRX A;  1LU4 A;  1A23 A;  2GST A;  2H73 A;  4XRD A;  1GNE A;  1YJ6 A;  3TUE A;  4E8H A;  1OC3 A;  4XS4 B;  4FYB A;  3WD6 A;  2MMO A;  2L5O A;  3MAK A;  3LEF A;  4V1A p;  3W8J A;  4MF7 A;  2H75 A;  1AXD A;  2IMD A;  2JAD A;  1K3Y A;  2H30 A;  4NV5 A;  4JBB A;  2JAC A;  1YDK A;  4MJA A;  5J41 A;  3IA1 A;  1DE2 A;  4O32 A;  2CX4 A;  2R4V A;  4I2U A;  1SJZ A;  2AAW A;  1OC9 B;  2CVD A;  4KDX A;  1N2A A;  1Z7P A;  3TKS A;  3ERG A;  2CZ2 A;  3QAV A;  3O3T A;  4MH2 A;  4G2E A;  1X9S B;  3FR9 A;  2ZUP A;  5HFK A;  3ERW A;  3ZTL A;  4HQZ A;  3TJF A;  4K1F A;  3ZFB A;  1XVW A;  2K8S A;  3UVH A;  2K8V A;  1AAZ A;  4F0C A;  4ECI A;  2H1D A;  2C0E A;  1PA3 A;  5D93 A;  4KUN A;  3E3E A;  3F8U A;  3Q19 A;  4Q5Q A;  4XRA A;  2VLT A;  5ECL B;  2YV7 A;  5HQP A;  3TJJ A;  1K0D A;  2DLX A;  1BAY A;  2HFD A;  4MF6 A;  4HDE A;  3GKK A;  1EV4 A;  1OE8 A;  3HXS A;  4O92 A;  1NHO A;  3GYK A;  3APQ A;  4JE1 A;  2IME A;  5HR0 A;  4FO5 A;  1MDI A;  3ZIJ A;  5ECO B;  3D5J A;  3F4S A;  2IN3 A;  1H75 A;  5GSS A;  2XC2 A;  3HYP A;  3CRT A;  4OWY A;  5CRG A;  7GSS A;  2HNL A;  3LG6 A;  2F8F A;  3SWL A;  1XWA A;  3HY2 A;  4GRF A;  4MA9 A;  1JFU A;  4I97 A;  1MDJ A;  2GS3 A;  5JCG A;  3FZ5 A;  2OAD A;  2HRN A;  4XS4 A;  2GSR A;  3MWH A;  3GN3 A;  5G2Z A;  3HJM A;  1G0T A;  2FUG 2;  1TW9 A;  2FCH A;  3N5O A;  3FR6 A;  2OBK A;  4D73 B;  16GS A;  1QXH A;  4WF4 A;  3M0F A;  4KE3 A;  1XFL A;  1XBS A;  5D8I A;  4NHZ A;  1OKT A;  3TKR A;  2RM6 A;  2GZY A;  5ECN B;  4GQC A;  1O81 A;  2QSI A;  4HU7 A;  5J4U A;  2YN1 A;  4TN8 A;  3O6T A;  2YWI A;  3A2W A;  5IMC A;  2L6D A;  4IP1 A;  2DJK A;  5IMF A;  4GF0 A;  2IWT A;  2O8V B;  3WYW A;  2IMK A;  2J9H A;  4IQA A;  3TKS C;  1CQH A;  4AJ7 A;  4ZBB A;  2VCW A;  1ERW A;  1PRX A;  2GT6 A;  4EDZ A;  4HOJ A;  5ECS A;  4ZBA A;  1GTI A;  2AYT A;  4KX4 A;  5DAK B;  1WMJ A;  3CRU A;  2IFQ B;  3M9J A;  3HZ4 A;  2J23 A;  1THO A;  3GHA A;  1GSS A;  3F9U A;  4KDU A;  1AQX A;  2DJJ A;  3EWL A;  1SJI A;  2HI7 A;  3VPQ A;  3DVW A;  2H1G A;  3A5W A;  3V1W A;  5EY6 A;  3E9J B;  3LQ7 A;  1TOF A;  2LST A;  2YCD A;  2YNX A;  3GKX A;  2NTO A;  4ECB A;  2KOK A;  5DQS A;  1H4O A;  2C3Q A;  2WRT A;  1ACV A;  2VLU A;  5J9C A;  3F3Q A;  1QMV A;  4FIW A;  3M9K A;  5KN2 A;  1XOA A;  3ZYW A;  1NM3 A;  2GQL A;  4LMW A;  3CSI A;  2VL3 A;  1BED A;  4V2N A;  3IRA A;  3US3 A;  2LJK A;  5LNK e;  2FA4 A;  2YP6 A;  4ID0 A;  4GST A;  4V2L A;  4BWS A;  5J9B A;  2C4J A;  1Y6E A;  2X99 A;  1S3C A;  3GMF A;  2MZC A;  5DDL A;  5DQY A;  2CQ9 A;  5JWR B;  2N5A A;  5EPF A;  1UN2 A;  2LS5 A;  1HNC A;  2C3T A;  4MLY A;  2H70 A;  3HVS A;  3TCO A;  1XIY A;  3IV4 A;  6GSS A;  5H5R A;  5IOW A;  3RBT A;  1EEJ A;  1JLW A;  4RQR A;  1HD2 A;  2K18 A;  4TOP A;  4YH2 A;  4Q5N A;  5FT3 A;  2H6Z A;  3M1G A;  2GSQ A;  3IOS A;  2PU9 C;  3IAS 2;  4OCE A;  1A8L A;  1MEK A;  2MMZ A;  1Z5Y E;  2E2M A;  2C0F A;  1MDK A;  2GQK A;  3AY8 A;  4PX1 A;  1EOG A;  2R37 A;  4X1U A;  2GT5 A;  3ZVJ A;  4L5O A;  4XCS A;  3HA9 A;  3VUR A;  5DAK A;  4RI6 A;  3D21 A;  4NMU A;  4F2I A;  3UAP A;  4OO4 A;  3QR6 A;  4TW5 A;  4IVF A;  3KXO A;  3IE3 A;  5IPH A;  3D22 A;  2VUP A;  1URM A;  1PSQ A;  5AN1 A;  1MD4 A;  1V57 A;  2QKE A;  2I1U A;  4CW9 A;  3O76 A;  4HJM A;  5CRD A;  3C7M A;  3PH9 A;  4PNF A;  3QFB C;  5JCU A;  3C71 A;  3GH6 A;  5HR1 A;  3KZQ A;  3G7Y A;  1A0R P;  4ML1 A;  3DEX A;  4MCU A;  1E2Y A;  1F37 A;  3MDK A;  2PWJ A;  3F4R A;  3FYG A;  3ZMK A;  1F9M A;  3KEB A;  4XS1 A;  4OCF A;  2ALB A;  2IMF A;  3EUR A;  1M7T A;  2NPB A;  1HNA A;  4NHW A;  3CXG A;  1BG5 A;  1QK8 A;  2HZE B;  5G1K A;  2L57 A;  1NSW A;  3UBK A;  4K8M A;  5IMZ A;  4O7H A;  3TOU A;  4GWR A;  5G1L A;  4EE0 A;  4X43 A;  2JU5 A;  2VL2 C;  3IR4 A;  2DIY A;  2HRF A;  2GZP A;  3F63 A;  3HCZ A;  3ED3 A;  3U5R E;  2DIZ A;  1SYR A;  2CAQ A;  3KJY A;  2OJL A;  5D73 A;  2XHF A;  5CRW A;  1Z9H A;  2F8A A;  1BX9 A;  4MJB A;  2YJ7 A;  4L0W A;  1SEN A;  1EP8 A;  2GSS A;  2E0Q A;  1ZZY A;  2VCX A;  1I9D A;  1SK2 A;  2AJQ B;  3VWV A;  1O7U A;  4TXV A;  2H71 A;  2N5B A;  3P90 A;  3KD0 A;  1Z6M A;  4YQM A;  1OYJ A;  5JWQ B;  2C1Y A;  3FR3 A;  1TP9 A;  2V6O A;  4MMM A;  3ZLP A;  3F4T A;  3UAR A;  2LNS A;  3R2Q A;  3CMI A;  2WDU A;  1ML6 A;  1JZO A;  3GST A;  3I6A A;  1GSY A;  1OVN A;  5IPG A;  5L71 A;  1WIK A;  2EC4 A;  5EVO A;  1SJ6 A;  4MJC A;  5LCZ A;  1TKD B;  1EWX A;  1O8W A;  3GTU A;  4FYC A;  4WEY A;  4Z7X A;  1SYX A;  3A2V A;  11GS A;  3EIN A;  6GSW A;  4IBP A;  5D96 A;  2BMX A;  1QUW A;  4BL7 A;  3CSH A;  1M9A A;  1ERT A;  2C3N A;  2K6V A;  12GS A;  1UA5 A;  2H74 A;  3FRC A;  3ZML A;  2BTO T;  3GKM A;  2VD1 A;  1WE0 A;  3DIE A;  3FZA A;  3K8N A;  5F8B A;  1YF0 A;  4Q5R A;  1XW9 A;  5G5F A;  1HYU A;  2KP1 A;  1FB0 A;  4OO5 A;  3TRQ A;  3EE2 A;  2R6K A;  2GLR A;  3EC3 A;  1M9B A;  2HSY A;  3TOT A;  3L78 A;  2TRC P;  4WBR D;  2LQO A;  1LJR A;  1SD8 A;  4TR3 A;  4IKH A;  2NDO A;  4LMV A;  1JZW A;  2WFC A;  2MYG A;  2VIM A;  5DCG A;  1PKZ A; 
#chains in the Genus database with same CATH topology
 1IYI A;  2AHE A;  3KH9 A;  1PL1 A;  4X0X A;  4BIK A;  3KIJ A;  5ECH B;  3ERF A;  1W4V A;  1TJD A;  3VWW A;  4PGT A;  2ZCT A;  1A0F A;  4GCI A;  1X9W B;  1WRY A;  3C1S A;  1R4W A;  3HZ8 A;  5KN0 A;  2DKI A;  3F3R A;  1TK8 B;  4AGS A;  1BQ7 A;  2B7J A;  4K2X A;  6GSX A;  4HUA A;  2X49 A;  1RQM A;  2QA2 A;  2PN8 A;  2C0D A;  1RW1 A;  1E6B A;  1K0C A;  4TR4 A;  4I5Q A;  1SK1 A;  3CQF A;  4N0Z A;  2OE3 A;  3I69 A;  5HFG A;  3KTL A;  2XPE A;  3KP9 A;  1FVJ A;  5ECK B;  4IHU A;  2P31 A;  5E59 A;  3GL3 A;  5ECM B;  4KND A;  2LNT A;  3NZN A;  3HVN A;  2HE3 A;  1G6Y A;  2K9F A;  1GUL A;  2YZU A;  19GS A;  3D6I A;  1JZD A;  2CAI A;  3TDG A;  2NBS A;  4I6X A;  3IC4 A;  5B8B A;  4ZB6 A;  4KW6 A;  1YY7 A;  2YOI A;  5ID2 A;  2CVK A;  1XWB A;  3ZL5 A;  2HYX A;  5BMU A;  2R5G A;  3TRX A;  3KM6 A;  4LL4 B;  3ZRD A;  4TXO B;  3PR8 A;  5IMD A;  2JSY A;  1GLQ A;  2R0C A;  2PVO C;  3TKS E;  3GH9 A;  1XWC A;  1A8Y A;  2VL9 A;  2LV3 A;  1B9Y C;  2VLV A;  2LKU A;  2ON7 A;  4HQS A;  4ZL8 A;  5FWG A;  3RPP A;  2FD3 A;  2HT9 A;  4Z2R A;  3HVX A;  4K6X A;  1OC9 A;  5LD0 A;  4NAX A;  3TB2 A;  4BVX B;  1FO5 A;  3WT1 A;  2H0I A;  2H6X A;  1K0N A;  4WKW A;  2PER A;  1EOH A;  2GGT A;  3WGE A;  1VF2 A;  3M3M A;  1Z6N A;  2VCQ A;  4IJI A;  2P5Q A;  3PGT A;  1YEX A;  3GRX A;  1OC8 A;  5KEJ A;  2LEG A;  3ME8 A;  3UEM A;  4KB3 A;  5D9W A;  2Z9S A;  4PQI A;  4OFM A;  1N8J A;  1J9B A;  4CY6 A;  1FB6 A;  4POM A;  3PIN A;  1PD2 1;  4TR0 A;  5DJL A;  1FOH A;  3MYD A;  4TVE A;  2H8L A;  1T3B A;  2XBI A;  2HSM A;  2LUS A;  3IC8 A;  2JL4 A;  3I43 A;  3UOM A;  2WZ9 A;  2YWN A;  4JED A;  3I9V 2;  1JLV A;  1VGL A;  1EP7 A;  4MF5 A;  3EMP A;  1V9W A;  2IMI A;  1T4Y A;  5ECI B;  4DVC A;  2FHE A;  5ELA A;  4IP6 A;  2E7P A;  2YWM A;  3QCP A;  4DSQ A;  1ZYN A;  2EIO A;  1PGT A;  1SL2 B;  2TRX A;  4DSS B;  4ACS A;  4XIH A;  3BCI A;  2VD0 A;  5JCW A;  3DKS A;  2X8H A;  2VL2 A;  2EIQ A;  4G0K A;  1O73 A;  1XPV A;  1M2D A;  3L9U A;  4MAB A;  1T8E B;  1CQG A;  2GDR A;  3SBC A;  17GS A;  1TU8 A;  2X4A A;  1VF3 A;  1V98 A;  3ZRE A;  4D73 A;  3Q74 A;  1XW6 A;  1YKA A;  5D9T A;  1TU7 A;  2DJ2 A;  4JU5 A;  4JR6 A;  5GAP D;  4JZQ A;  3IHG A;  2RLI A;  2P0G A;  5G30 A;  18GS A;  1FOV A;  1F3B A;  2OE0 A;  4PUF C;  4Z2T A;  5ABR A;  2F9S A;  4BA7 A;  3IXR A;  1XVQ A;  5G31 A;  2CT6 A;  4F03 A;  3GNJ A;  1Z3E A;  4BVY B;  2X8G A;  4MDC A;  1TRS A;  1B8X A;  1T7P B;  1GWC A;  1XXU A;  3C8E A;  1F3A A;  1ZYE A;  1DBY A;  1EGO A;  3EMX A;  3MNG A;  3NOF A;  3FW2 A;  2M46 A;  2KHP A;  4RUV A;  2FA8 A;  2YWO A;  1U88 A;  1F6M C;  2VOC A;  4ULX A;  4JR4 A;  2GZZ A;  2MBS A;  2H0H A;  2LRT A;  5GZZ B;  5JWO B;  4AF2 A;  9GSS A;  2I81 A;  1B48 A;  3ZVJ D;  3TKP A;  4EXJ A;  1GNW A;  4WR5 A;  4YQU A;  4Z2U A;  1V40 A;  1U87 A;  1GSD A;  2IFQ A;  1TRV A;  3FEU A;  3CTG A;  2QC7 A;  4PNG A;  2R3X A;  2O87 A;  3ZFL A;  3LYP A;  1FHE A;  4ZIL A;  1SU9 A;  4PUR A;  1A2M A;  4K7O A;  2YAN A;  1X5C A;  4IQ1 A;  1JHB A;  1AQV A;  4N11 A;  4FQU A;  2B6M A;  1B4P A;  3FZ4 A;  3ME7 A;  1GUK A;  3GFK A;  1XWK A;  5IM9 A;  2HZF A;  5F07 A;  8GSS A;  1FW1 A;  4MPF A;  3VK9 A;  3BBY A;  3LW9 A;  1TI1 A;  4YKG A;  2CA8 A;  4MZC A;  3GIX A;  2V2G A;  3LOR A;  1V2A A;  2PMT A;  4J2F A;  1ZOF A;  4N10 A;  1Q98 A;  2AV4 A;  2FGX A;  4WET A;  4HZ2 A;  2B5X A;  4EDY A;  1GTA A;  1THX A;  3GKN A;  2RII A;  3WGD A;  5INY A;  1SD9 A;  2KP2 A;  2H6Y A;  2A2R A;  3RHC A;  1S3D A;  3UL3 A;  2PVQ A;  1G6W A;  4GSN A;  2R2J A;  5CNW A;  4Q5F A;  2M72 A;  3EPT A;  3IK9 A;  3VI5 A;  3F6F A;  3LXT A;  4HZ4 A;  1ERU A;  5D9V A;  4QL7 A;  2OBI A;  2C0G A;  1HNB A;  3NIV A;  4XHM A;  3VWX A;  1GSQ A;  1FAA A;  3BD2 A;  1SL0 B;  2BJX A;  5J5N A;  4MZW A;  20GS A;  3M8N A;  2V41 A;  2DJ0 A;  3FHK A;  1X5D A;  1X5E A;  3VI7 A;  5HFI A;  2AUV A;  2F51 A;  2VAF A;  3DRN A;  4G0I A;  1KTE A;  4OFN A;  2IIY A;  1NHY A;  2HLS A;  1ZYP A;  4A5P A;  2LRC A;  3D0Z A;  3IBH A;  2JSZ A;  5IOX A;  5AGY A;  2F3M A;  2IL3 A;  1OAZ A;  1YF1 A;  3DML A;  3ZZX A;  3KH7 A;  4IN0 A;  4IS0 A;  3VPT A;  1EGR A;  3TJK A;  5DVB A;  4ZXG A;  1TK0 B;  3TJG A;  4TKY A;  2I4A A;  4MP4 A;  3FK8 A;  3UVT A;  3H4K A;  2YPM A;  1DSB A;  3QPM A;  3KCM A;  1OKD A;  2L4Q A;  1YQ1 A;  2FWF A;  2REM A;  4H86 A;  1ST9 A;  1XWG A;  1YKC A;  1SKS B;  4QQ7 A;  2I9H A;  4KA0 A;  1A2L A;  1TTZ A;  1WOU A;  2G2Q A;  2MMA A;  1UVZ A;  3C1R A;  4EIQ A;  2KUC A;  1ZL9 A;  2B1L A;  3TJB A;  3C73 A;  1MTC A;  3PPU A;  5F05 A;  1XZO A;  4L8E A;  2KLX A;  1O8X A;  4V1A g;  4OD7 A;  3GSS A;  3KMO A;  2A2S A;  2HZE A;  2LJR A;  4GQF A;  2YJH A;  1ZGN A;  3GV1 A;  4FYU A;  3L0H A;  4I2T A;  2JZR A;  3LSZ A;  4F9Z A;  5DCH A;  1W89 A;  2DMM A;  4G10 A;  1BYE A;  2H1A A;  6GSY A;  1AIU A;  2GQM A;  2CVB A;  1OE7 A;  2DJ1 A;  3FY7 A;  2DSA A;  5DAL B;  3F0I A;  5KN1 A;  1O6J A;  4GTU A;  5KOX A;  4K2D A;  1V58 A;  4IEL A;  1TRU A;  3L4N A;  4ISD A;  2JZT A;  3QDN A;  4XS6 A;  3KP8 A;  4IJ3 A;  3EU3 A;  1GTU A;  2LTK A;  4POB A;  3D4M A;  1BJX A;  1QGV A;  2HXK A;  2IPA A;  1ON4 A;  4K7N A;  1GL8 A;  2FWH A;  2FLS A;  3P2A A;  1GP1 A;  2OE1 A;  2TIR A;  1K3O A;  1KNG A;  2XPD A;  4MK3 A;  3VFI A;  4EL1 A;  1C72 A;  6GST A;  2WB9 A;  4WBJ A;  3BJ5 A;  3TGZ A;  3CBU A;  4TR1 B;  1SKR B;  1AC1 A;  4FH8 A;  5CYY A;  2RUE A;  1LBK A;  1UC7 A;  3A2X A;  5B7C A;  10GS A;  3EYT A;  3HDC A;  1PMT A;  5G5E A;  4HJ2 A;  2H0G A;  1VF4 A;  2CX3 A;  1G7E A;  5CO3 A;  1Z7R A;  2C8U A;  3QD9 A;  1PQN A;  2X8C A;  5ENU A;  4K0G A;  1SL1 B;  2WCI A;  4ECC A;  2LJA A;  1SK0 A;  3U6V A;  3LWA A;  5CRH A;  3HVV A;  5ECR B;  1XCC A;  3HKR A;  4CHS A;  2CZ3 A;  1I5G A;  2WJU A;  1GUM A;  3RAZ A;  2B7K A;  2B3S A;  3RPN A;  4KH7 A;  3J7Y b;  2H76 A;  1ABA A;  4ZIJ A;  5IQY A;  1AQW A;  2JZS A;  2H1B A;  5CRE A;  4MJE A;  2ON5 A;  3QAW A;  2ZNM A;  2O85 A;  2G0F A;  1GSU A;  4ZBD A;  1XOB A;  4AJ6 A;  1GSE A;  4K0N A;  4TRX A;  4V2M A;  4EF0 A;  5B8A A;  3P7X A;  4E8E A;  1ZCP A;  1K0O A;  2VM2 A;  3G7I A;  5AIS A;  5F0G A;  4PQ1 A;  3DVX A;  5DAL A;  1ZMA A;  1GLP A;  2N5F A;  4EUY A;  2FWG A;  4K7I A;  1FG4 A;  4ZB9 A;  3KMN A;  2VM1 A;  4G9H A;  1QQ2 A;  3P8W A;  1M0U A;  4KCE A;  2H66 A;  3QAG A;  2PGT A;  4HEA 2;  2DBC A;  3GX8 A;  5DJM A;  3JCM L;  3QFA C;  4CY8 A;  3DXB A;  1T4Z A;  2A4H A;  2C80 A;  4NPB A;  4RQX A;  4L0U A;  4EO3 A;  1Q4J A;  2HSH A;  3ZIV A;  1X0R A;  1WWJ A;  4O5R A;  4TR1 A;  5IO2 A;  1R5A A;  1K3L A;  1VF1 A;  2M80 A;  3H93 A;  2A4V A;  1B9X C;  3UIW A;  2LRN A;  2IJY A;  3IPZ A;  1PL2 A;  3MSZ A;  3VLN A;  4WXT A;  4IW9 A;  5AIX A;  4AJ8 A;  3Q6O A;  1R5P A;  3DGQ A;  1KEB A;  3GA4 A;  5KN3 A;  3UJ1 A;  5H5S A;  3HD5 A;  1GTB A;  4F0B A;  3GUR A;  3S9F A;  4ILF A;  4POK A;  2VO4 A;  1PFO A;  3D4T A;  1NW2 A;  5A4V A;  2DJ3 A;  3QMX A;  5HR2 A;  4GSS A;  1XW5 A;  1A24 A;  5GST A;  3LYK A;  1AW9 A;  4ZB8 A;  2YV9 A;  1WPI A;  3RDW A;  3N9J A;  1USB A;  2I3Y A;  2PUK C;  4YAV A;  4YQV A;  1S3R A;  4TXO A;  2L5L A;  2MMN A;  1GH2 A;  5ECP B;  4GLT A;  3VWU A;  1U3I A;  2H72 A;  5FHI A;  1A2J A;  4BWQ A;  2D2Z A;  1ZYQ B;  1QFN A;  2A2P A;  2H01 A;  2WS2 A;  3CSJ A;  5AIV A;  3UMA A;  1F2E A;  5IMA A;  3RHB A;  3DYR A;  2WUL A;  4PXO A;  2GTU A;  2X64 A;  4NXI A;  5ECQ B;  1IYH A;  4KCA A;  5IIZ A;  6GSU A;  2O7K A;  4BVX A;  1YEP A;  4K5S A;  2ES7 A;  4OFT A;  5EL8 A;  2FY6 A;  2B1K A;  3IK7 A;  3WGX A;  5H5Q A;  3WT2 A;  2CV4 A;  5A4W A;  4OMV A;  1PX6 A;  3G7J A;  3OR5 A;  2V1M A;  4O5U A;  4GXZ A;  2EIR A;  5D9X A;  4KGI A;  1PN0 A;  3ZIT A;  2AB6 A;  4DEJ A;  1J0F A;  5C00 A;  4QL9 A;  2O89 A;  5GAN D;  5IMV A;  2V6K A;  4IGJ A;  3CYN A;  4POL A;  13GS A;  2QGV A;  4EVM A;  4XTS A;  3LGC A;  4PUA A;  4MPG A;  1KBN A;  1X9M B;  4WR4 A;  2HRA A;  1TI3 A;  4ML6 A;  5ELG A;  2LQQ A;  3L9S A;  3LFL A;  2L59 A;  1GSF A;  3TRP A;  1K0A A;  1M2A A;  3W6G A;  1M99 A;  2OAC A;  3DWV A;  1DE1 A;  4KSO A;  4YAP A;  1YZX A;  2MBT A;  1RK4 A;  22GS A;  3BCK A;  5A5K A;  4RI7 A;  4HI7 A;  1TDI A;  2DML A;  4NV2 A;  4JRR A;  5DBQ A;  4DSS A;  3F6D A;  1B4Q A;  3GTU B;  2NVL A;  5F06 A;  4BL7 B;  1T00 A;  3ISO A;  4CDO A;  2WGR A;  2L6C A;  1EEM A;  4ECJ A;  2B5E A;  2E2G A;  3KGK A;  4KSM A;  1T1V A;  3APS A;  2H19 A;  2DC5 A;  3H8Q A;  3HJO A;  1M2B A;  3H1N A;  4ZL9 A;  4L5L A;  3GUS A;  1GUH A;  4MZB A;  3APO A;  2P5R A;  1JZR A;  2RM5 A;  3HHV A;  4HU9 A;  4P3Y B;  4PQH A;  4ZL7 A;  3KTB A;  1PX7 A;  1ERV A;  2PPT A;  1S3A A;  1ILO A;  3DD3 A;  1K0B A;  1K0M A;  2GVP A;  1FVK A;  4MH3 A;  3IDV A;  1HQO A;  2L4C A;  3LJR A;  4DSR A;  1WJK A;  4N30 A;  1O85 A;  5J3R A;  1EZK A;  4KAE A;  3LXZ A;  3W8S A;  4BVY A;  1TRW A;  2OKA A;  5IO0 A;  2PBJ A;  3IHQ A;  5B6M A;  5COH A;  3J7Y k;  3HJP A;  3UBL A;  2VCZ A;  4J57 E;  1R26 A;  3GL5 A;  2VCT A;  4EKZ A;  5A4U A;  2XBQ A;  3GX0 A;  3FKF A;  2OA7 A;  1SKW B;  1J08 A;  2FWE A;  3A5I A;  5CP1 A;  1R7H A;  4LL1 B;  3TKQ A;  1PN9 A;  1M3I A;  4G19 A;  3E0U A;  3G9B A;  14GS A;  1EV9 A;  3H79 A;  4N0V A;  1WP0 A;  2YZH A;  4F82 A;  3CTF A;  4EC0 A;  4LA1 A;  3Q18 A;  1MD3 A;  1G7O A;  3EU4 A;  5HR3 A;  5C04 A;  4KDY A;  4BPY A;  2FNO A;  5E4W A;  3A3T A;  4K9Z A;  4NWY A;  1DUG A;  1U6T A;  1TXX A;  4J56 E;  1VRS D;  2RUF A;  4WF5 A;  4LLR A;  5CAX A;  2VCV A;  2V32 A;  4HS1 A;  3EVI A;  3BOA A;  6GSV A;  1AUC A;  2B5Y A;  1TK5 B;  1PKW A;  3IAM 2;  1U3A A;  5ID2 B;  1Y25 A;  3QOU A;  4I8B A;  3L9V A;  3FZ9 A;  5B6N A;  1GRX A;  1LU4 A;  4HSC X;  1A23 A;  2GST A;  2H73 A;  4XRD A;  4USS A;  1GNE A;  1YJ6 A;  3TUE A;  4E8H A;  1OC3 A;  4XS4 B;  4FYB A;  3WD6 A;  2MMO A;  2L5O A;  3MAK A;  3LEF A;  4V1A p;  3W8J A;  4MF7 A;  2H75 A;  1AXD A;  2IMD A;  2JAD A;  1K3Y A;  2H30 A;  4NV5 A;  4JBB A;  2JAC A;  1YDK A;  4MJA A;  5J41 A;  3IA1 A;  1DE2 A;  4O32 A;  2CX4 A;  2R4V A;  4I2U A;  1SJZ A;  2AAW A;  1OC9 B;  2CVD A;  4KDX A;  1N2A A;  1Z7P A;  3TKS A;  3ERG A;  2CZ2 A;  3QAV A;  3O3T A;  4MH2 A;  4G2E A;  1X9S B;  3FR9 A;  2ZUP A;  5HFK A;  3ERW A;  3ZTL A;  4HQZ A;  3TJF A;  4K1F A;  3ZFB A;  1XVW A;  2K8S A;  3UVH A;  2K8V A;  1AAZ A;  4F0C A;  4ECI A;  2H1D A;  2C0E A;  1PA3 A;  5D93 A;  4KUN A;  3E3E A;  3F8U A;  3Q19 A;  4Q5Q A;  4XRA A;  2VLT A;  3R3E A;  5ECL B;  2YV7 A;  5HQP A;  3TJJ A;  1K0D A;  2DLX A;  1BAY A;  2HFD A;  4MF6 A;  4HDE A;  3GKK A;  1EV4 A;  1OE8 A;  3HXS A;  4O92 A;  1NHO A;  3GYK A;  3APQ A;  4JE1 A;  2IME A;  5HR0 A;  4FO5 A;  1MDI A;  3ZIJ A;  5ECO B;  5BRT A;  3D5J A;  3F4S A;  2IN3 A;  4ICY A;  1H75 A;  4G0L A;  5GSS A;  2XC2 A;  3HYP A;  2UZ8 A;  3CRT A;  4OWY A;  2DKH A;  5CRG A;  7GSS A;  2HNL A;  3LG6 A;  2F8F A;  3SWL A;  1XWA A;  3HY2 A;  4GRF A;  4MA9 A;  2R0G A;  1JFU A;  4I97 A;  1MDJ A;  2GS3 A;  5JCG A;  3FZ5 A;  2OAD A;  2HRN A;  4XS4 A;  2GSR A;  3MWH A;  3GN3 A;  5G2Z A;  3HJM A;  1G0T A;  2FUG 2;  1TW9 A;  2FCH A;  3N5O A;  3FR6 A;  2OBK A;  4D73 B;  16GS A;  1QXH A;  4WF4 A;  4YKF A;  3M0F A;  4KE3 A;  1XFL A;  1XBS A;  5D8I A;  4NHZ A;  1OKT A;  3TKR A;  2RM6 A;  2GZY A;  5ECN B;  4GQC A;  1O81 A;  2QSI A;  4HU7 A;  5J4U A;  3FMW A;  2YN1 A;  4TN8 A;  3O6T A;  2YWI A;  3A2W A;  5IMC A;  2L6D A;  4IP1 A;  2DJK A;  5IMF A;  4GF0 A;  2IWT A;  2O8V B;  3WYW A;  2IMK A;  2J9H A;  4IQA A;  3TKS C;  1CQH A;  4AJ7 A;  4ZBB A;  2VCW A;  1ERW A;  1PRX A;  2GT6 A;  4EDZ A;  4HOJ A;  5ECS A;  4ZBA A;  1GTI A;  2AYT A;  4EIP A;  4KX4 A;  5DAK B;  1WMJ A;  3CRU A;  2IFQ B;  3M9J A;  3HZ4 A;  2J23 A;  1THO A;  3GHA A;  1GSS A;  3F9U A;  4KDU A;  1AQX A;  2DJJ A;  3EWL A;  1SJI A;  2HI7 A;  3VPQ A;  3DVW A;  2H1G A;  3A5W A;  3V1W A;  5EY6 A;  3E9J B;  5KOW A;  3LQ7 A;  1TOF A;  2LST A;  2YCD A;  2YNX A;  3GKX A;  2NTO A;  4ECB A;  2KOK A;  5DQS A;  1H4O A;  2C3Q A;  2WRT A;  1ACV A;  2VLU A;  5J9C A;  3F3Q A;  1QMV A;  4FIW A;  3M9K A;  5KN2 A;  4K5R A;  1XOA A;  3ZYW A;  1NM3 A;  2GQL A;  4LMW A;  3CSI A;  2VL3 A;  1BED A;  4V2N A;  3IRA A;  3US3 A;  2LJK A;  5LNK e;  2FA4 A;  2YP6 A;  4ID0 A;  4GST A;  4V2L A;  4BWS A;  5J9B A;  2C4J A;  1Y6E A;  2X99 A;  1S3C A;  3GMF A;  2MZC A;  5DDL A;  5DQY A;  2CQ9 A;  5JWR B;  2N5A A;  5EPF A;  1UN2 A;  2LS5 A;  1HNC A;  2R0P A;  2C3T A;  4MLY A;  2H70 A;  3HVS A;  3TCO A;  1XIY A;  3IV4 A;  6GSS A;  5H5R A;  5IOW A;  3RBT A;  1EEJ A;  1JLW A;  4RQR A;  1HD2 A;  2K18 A;  4TOP A;  4YH2 A;  4Q5N A;  5FT3 A;  2H6Z A;  3M1G A;  2GSQ A;  3IOS A;  2PU9 C;  3IAS 2;  4O5Q A;  4OCE A;  1A8L A;  1MEK A;  2MMZ A;  1Z5Y E;  2E2M A;  2C0F A;  1MDK A;  2GQK A;  3AY8 A;  4PX1 A;  1EOG A;  2R37 A;  4X1U A;  2GT5 A;  3ZVJ A;  4L5O A;  4XCS A;  3HA9 A;  3VUR A;  5DAK A;  4RI6 A;  3D21 A;  4NMU A;  4F2I A;  3UAP A;  4OO4 A;  3QR6 A;  4TW5 A;  4IVF A;  3KXO A;  3IE3 A;  5IPH A;  3D22 A;  2VUP A;  1URM A;  1PSQ A;  5AN1 A;  1MD4 A;  1V57 A;  2QKE A;  2I1U A;  4CW9 A;  3O76 A;  4HJM A;  5CRD A;  3C7M A;  3PH9 A;  4PNF A;  3QFB C;  5JCU A;  3C71 A;  3GH6 A;  5HR1 A;  3KZQ A;  3G7Y A;  1A0R P;  4ML1 A;  3DEX A;  4MCU A;  1E2Y A;  1F37 A;  3MDK A;  2PWJ A;  3F4R A;  3FYG A;  3ZMK A;  1F9M A;  3KEB A;  4XS1 A;  4OCF A;  2ALB A;  2IMF A;  3EUR A;  1M7T A;  2NPB A;  1HNA A;  4NHW A;  3CXG A;  1BG5 A;  1QK8 A;  2HRK A;  2HZE B;  5G1K A;  2L57 A;  1NSW A;  3UBK A;  3MIX A;  4K8M A;  5IMZ A;  4O7H A;  3TOU A;  4GWR A;  5G1L A;  4EE0 A;  4X43 A;  2JU5 A;  2VL2 C;  3IR4 A;  2DIY A;  2HRF A;  2GZP A;  3F63 A;  4PTS A;  3HCZ A;  3ED3 A;  3U5R E;  2DIZ A;  1SYR A;  2CAQ A;  3KJY A;  2OJL A;  5D73 A;  2XHF A;  5CRW A;  1Z9H A;  2F8A A;  1BX9 A;  4MJB A;  2YJ7 A;  4L0W A;  1SEN A;  1EP8 A;  2GSS A;  2E0Q A;  1ZZY A;  2VCX A;  1I9D A;  1SK2 A;  2AJQ B;  3VWV A;  1O7U A;  4TXV A;  2H71 A;  2N5B A;  3P90 A;  3KD0 A;  1Z6M A;  4YQM A;  1OYJ A;  5JWQ B;  2C1Y A;  3FR3 A;  1TP9 A;  2V6O A;  4MMM A;  3ZLP A;  3F4T A;  3UAR A;  2LNS A;  3R2Q A;  3CMI A;  2WDU A;  1ML6 A;  1JZO A;  3GST A;  3I6A A;  1GSY A;  1OVN A;  5IPG A;  5L71 A;  1WIK A;  2EC4 A;  5EVO A;  1SJ6 A;  4MJC A;  5LCZ A;  1TKD B;  1EWX A;  1O8W A;  3GTU A;  4MNN A;  4FYC A;  4WEY A;  4Z7X A;  1SYX A;  3A2V A;  11GS A;  3EIN A;  6GSW A;  4IBP A;  5D96 A;  2BMX A;  1QUW A;  4BL7 A;  3CSH A;  1M9A A;  1ERT A;  2C3N A;  2K6V A;  12GS A;  1UA5 A;  2H74 A;  3FRC A;  3ZML A;  2BTO T;  3GKM A;  2VD1 A;  1WE0 A;  3DIE A;  4KF9 A;  3FZA A;  3K8N A;  5F8B A;  1YF0 A;  4X4J A;  4Q5R A;  1XW9 A;  5G5F A;  1HYU A;  2KP1 A;  1FB0 A;  4OO5 A;  3TRQ A;  3EE2 A;  2R6K A;  2GLR A;  1XG8 A;  3EC3 A;  1M9B A;  2HSY A;  3TOT A;  3L78 A;  2TRC P;  4WBR D;  2LQO A;  1LJR A;  1M3J A;  1SD8 A;  4TR3 A;  4IKH A;  2NDO A;  4LMV A;  1JZW A;  2WFC A;  2MYG A;  2VIM A;  2QA1 A;  5DCG A;  1PKZ A; 
#chains in the Genus database with same CATH homology
 1IYI A;  2AHE A;  3KH9 A;  1PL1 A;  4X0X A;  3KIJ A;  5ECH B;  3ERF A;  1W4V A;  1TJD A;  3VWW A;  4PGT A;  2ZCT A;  1A0F A;  4GCI A;  1X9W B;  1WRY A;  3C1S A;  1R4W A;  3HZ8 A;  5KN0 A;  2DKI A;  3F3R A;  1TK8 B;  4AGS A;  1BQ7 A;  2B7J A;  4K2X A;  6GSX A;  4HUA A;  2X49 A;  1RQM A;  2QA2 A;  2PN8 A;  2C0D A;  1RW1 A;  1E6B A;  1K0C A;  4TR4 A;  4I5Q A;  1SK1 A;  4N0Z A;  2OE3 A;  3I69 A;  5HFG A;  3KTL A;  2XPE A;  3KP9 A;  1FVJ A;  5ECK B;  4IHU A;  2P31 A;  5E59 A;  3GL3 A;  5ECM B;  4KND A;  2LNT A;  3NZN A;  2HE3 A;  1G6Y A;  2K9F A;  1GUL A;  2YZU A;  19GS A;  3D6I A;  1JZD A;  2CAI A;  3TDG A;  2NBS A;  4I6X A;  3IC4 A;  5B8B A;  4ZB6 A;  4KW6 A;  1YY7 A;  2YOI A;  5ID2 A;  2CVK A;  1XWB A;  3ZL5 A;  2HYX A;  5BMU A;  2R5G A;  3TRX A;  3KM6 A;  4LL4 B;  3ZRD A;  4TXO B;  3PR8 A;  5IMD A;  2JSY A;  1GLQ A;  2R0C A;  2PVO C;  3TKS E;  3GH9 A;  1XWC A;  1A8Y A;  2VL9 A;  2LV3 A;  1B9Y C;  2VLV A;  2LKU A;  2ON7 A;  4HQS A;  4ZL8 A;  5FWG A;  3RPP A;  2FD3 A;  2HT9 A;  4Z2R A;  3HVX A;  4K6X A;  1OC9 A;  5LD0 A;  4NAX A;  3TB2 A;  4BVX B;  1FO5 A;  3WT1 A;  2H0I A;  2H6X A;  1K0N A;  4WKW A;  2PER A;  1EOH A;  2GGT A;  3WGE A;  1VF2 A;  3M3M A;  1Z6N A;  2VCQ A;  4IJI A;  2P5Q A;  3PGT A;  1YEX A;  3GRX A;  1OC8 A;  5KEJ A;  2LEG A;  3ME8 A;  3UEM A;  4KB3 A;  5D9W A;  2Z9S A;  4PQI A;  4OFM A;  1N8J A;  1J9B A;  4CY6 A;  1FB6 A;  4POM A;  3PIN A;  1PD2 1;  4TR0 A;  5DJL A;  1FOH A;  3MYD A;  4TVE A;  2H8L A;  1T3B A;  2XBI A;  2HSM A;  2LUS A;  3IC8 A;  2JL4 A;  3I43 A;  3UOM A;  2WZ9 A;  2YWN A;  4JED A;  3I9V 2;  1JLV A;  1VGL A;  1EP7 A;  4MF5 A;  3EMP A;  1V9W A;  2IMI A;  1T4Y A;  5ECI B;  4DVC A;  2FHE A;  5ELA A;  4IP6 A;  2E7P A;  2YWM A;  3QCP A;  4DSQ A;  1ZYN A;  2EIO A;  1PGT A;  1SL2 B;  2TRX A;  4DSS B;  4ACS A;  4XIH A;  3BCI A;  2VD0 A;  5JCW A;  3DKS A;  2X8H A;  2VL2 A;  2EIQ A;  4G0K A;  1O73 A;  1XPV A;  1M2D A;  3L9U A;  4MAB A;  1T8E B;  1CQG A;  2GDR A;  3SBC A;  17GS A;  1TU8 A;  2X4A A;  1VF3 A;  1V98 A;  3ZRE A;  4D73 A;  3Q74 A;  1XW6 A;  1YKA A;  5D9T A;  1TU7 A;  2DJ2 A;  4JU5 A;  4JR6 A;  5GAP D;  4JZQ A;  3IHG A;  2RLI A;  2P0G A;  5G30 A;  18GS A;  1FOV A;  1F3B A;  2OE0 A;  4PUF C;  4Z2T A;  5ABR A;  2F9S A;  4BA7 A;  3IXR A;  1XVQ A;  5G31 A;  2CT6 A;  4F03 A;  3GNJ A;  1Z3E A;  4BVY B;  2X8G A;  4MDC A;  1TRS A;  1B8X A;  1T7P B;  1GWC A;  1XXU A;  3C8E A;  1F3A A;  1ZYE A;  1DBY A;  1EGO A;  3EMX A;  3MNG A;  3NOF A;  3FW2 A;  2M46 A;  2KHP A;  4RUV A;  2FA8 A;  2YWO A;  1U88 A;  1F6M C;  2VOC A;  4ULX A;  4JR4 A;  2GZZ A;  2MBS A;  2H0H A;  2LRT A;  5GZZ B;  5JWO B;  4AF2 A;  9GSS A;  2I81 A;  1B48 A;  3ZVJ D;  3TKP A;  4EXJ A;  1GNW A;  4WR5 A;  4YQU A;  4Z2U A;  1V40 A;  1U87 A;  1GSD A;  2IFQ A;  1TRV A;  3FEU A;  3CTG A;  2QC7 A;  4PNG A;  2R3X A;  2O87 A;  3ZFL A;  3LYP A;  1FHE A;  4ZIL A;  1SU9 A;  4PUR A;  1A2M A;  4K7O A;  2YAN A;  1X5C A;  4IQ1 A;  1JHB A;  1AQV A;  4N11 A;  4FQU A;  2B6M A;  1B4P A;  3FZ4 A;  3ME7 A;  1GUK A;  3GFK A;  1XWK A;  5IM9 A;  2HZF A;  5F07 A;  8GSS A;  1FW1 A;  4MPF A;  3VK9 A;  3BBY A;  3LW9 A;  1TI1 A;  4YKG A;  2CA8 A;  4MZC A;  3GIX A;  2V2G A;  3LOR A;  1V2A A;  2PMT A;  4J2F A;  1ZOF A;  4N10 A;  1Q98 A;  2AV4 A;  2FGX A;  4WET A;  4HZ2 A;  2B5X A;  4EDY A;  1GTA A;  1THX A;  3GKN A;  2RII A;  3WGD A;  5INY A;  1SD9 A;  2KP2 A;  2H6Y A;  2A2R A;  3RHC A;  1S3D A;  3UL3 A;  2PVQ A;  1G6W A;  4GSN A;  2R2J A;  5CNW A;  4Q5F A;  2M72 A;  3EPT A;  3IK9 A;  3VI5 A;  3F6F A;  3LXT A;  4HZ4 A;  1ERU A;  5D9V A;  4QL7 A;  2OBI A;  2C0G A;  1HNB A;  3NIV A;  4XHM A;  3VWX A;  1GSQ A;  1FAA A;  3BD2 A;  1SL0 B;  2BJX A;  5J5N A;  4MZW A;  20GS A;  3M8N A;  2V41 A;  2DJ0 A;  3FHK A;  1X5D A;  1X5E A;  3VI7 A;  5HFI A;  2AUV A;  2F51 A;  2VAF A;  3DRN A;  4G0I A;  1KTE A;  4OFN A;  2IIY A;  1NHY A;  2HLS A;  1ZYP A;  4A5P A;  2LRC A;  3D0Z A;  3IBH A;  2JSZ A;  5IOX A;  5AGY A;  2F3M A;  2IL3 A;  1OAZ A;  1YF1 A;  3DML A;  3ZZX A;  3KH7 A;  4IN0 A;  4IS0 A;  3VPT A;  1EGR A;  3TJK A;  5DVB A;  4ZXG A;  1TK0 B;  3TJG A;  4TKY A;  2I4A A;  4MP4 A;  3FK8 A;  3UVT A;  3H4K A;  2YPM A;  1DSB A;  3QPM A;  3KCM A;  1OKD A;  2L4Q A;  1YQ1 A;  2FWF A;  2REM A;  4H86 A;  1ST9 A;  1XWG A;  1YKC A;  1SKS B;  4QQ7 A;  2I9H A;  4KA0 A;  1A2L A;  1TTZ A;  1WOU A;  2G2Q A;  2MMA A;  1UVZ A;  3C1R A;  4EIQ A;  2KUC A;  1ZL9 A;  2B1L A;  3TJB A;  3C73 A;  1MTC A;  3PPU A;  5F05 A;  1XZO A;  4L8E A;  2KLX A;  1O8X A;  4V1A g;  4OD7 A;  3GSS A;  3KMO A;  2A2S A;  2HZE A;  2LJR A;  4GQF A;  2YJH A;  1ZGN A;  3GV1 A;  4FYU A;  3L0H A;  4I2T A;  2JZR A;  3LSZ A;  4F9Z A;  5DCH A;  1W89 A;  2DMM A;  4G10 A;  1BYE A;  2H1A A;  6GSY A;  1AIU A;  2GQM A;  2CVB A;  1OE7 A;  2DJ1 A;  3FY7 A;  2DSA A;  5DAL B;  3F0I A;  5KN1 A;  1O6J A;  4GTU A;  5KOX A;  4K2D A;  1V58 A;  4IEL A;  1TRU A;  3L4N A;  4ISD A;  2JZT A;  3QDN A;  4XS6 A;  3KP8 A;  4IJ3 A;  3EU3 A;  1GTU A;  2LTK A;  4POB A;  3D4M A;  1BJX A;  1QGV A;  2HXK A;  2IPA A;  1ON4 A;  4K7N A;  1GL8 A;  2FWH A;  2FLS A;  3P2A A;  1GP1 A;  2OE1 A;  2TIR A;  1K3O A;  1KNG A;  2XPD A;  4MK3 A;  3VFI A;  4EL1 A;  1C72 A;  6GST A;  2WB9 A;  4WBJ A;  3BJ5 A;  3TGZ A;  3CBU A;  4TR1 B;  1SKR B;  1AC1 A;  4FH8 A;  5CYY A;  2RUE A;  1LBK A;  1UC7 A;  3A2X A;  5B7C A;  10GS A;  3EYT A;  3HDC A;  1PMT A;  5G5E A;  4HJ2 A;  2H0G A;  1VF4 A;  2CX3 A;  1G7E A;  5CO3 A;  1Z7R A;  2C8U A;  3QD9 A;  1PQN A;  2X8C A;  5ENU A;  4K0G A;  1SL1 B;  2WCI A;  4ECC A;  2LJA A;  1SK0 A;  3U6V A;  3LWA A;  5CRH A;  3HVV A;  5ECR B;  1XCC A;  3HKR A;  4CHS A;  2CZ3 A;  1I5G A;  2WJU A;  1GUM A;  3RAZ A;  2B7K A;  2B3S A;  3RPN A;  4KH7 A;  3J7Y b;  2H76 A;  1ABA A;  4ZIJ A;  5IQY A;  1AQW A;  2JZS A;  2H1B A;  5CRE A;  4MJE A;  2ON5 A;  3QAW A;  2ZNM A;  2O85 A;  2G0F A;  1GSU A;  4ZBD A;  1XOB A;  4AJ6 A;  1GSE A;  4K0N A;  4TRX A;  4V2M A;  4EF0 A;  5B8A A;  3P7X A;  4E8E A;  1ZCP A;  1K0O A;  2VM2 A;  3G7I A;  5AIS A;  5F0G A;  4PQ1 A;  3DVX A;  5DAL A;  1ZMA A;  1GLP A;  2N5F A;  4EUY A;  2FWG A;  4K7I A;  1FG4 A;  4ZB9 A;  3KMN A;  2VM1 A;  4G9H A;  1QQ2 A;  3P8W A;  1M0U A;  4KCE A;  2H66 A;  3QAG A;  2PGT A;  4HEA 2;  2DBC A;  3GX8 A;  5DJM A;  3JCM L;  3QFA C;  4CY8 A;  3DXB A;  1T4Z A;  2A4H A;  2C80 A;  4NPB A;  4RQX A;  4L0U A;  4EO3 A;  1Q4J A;  2HSH A;  3ZIV A;  1X0R A;  1WWJ A;  4O5R A;  4TR1 A;  5IO2 A;  1R5A A;  1K3L A;  1VF1 A;  2M80 A;  3H93 A;  2A4V A;  1B9X C;  3UIW A;  2LRN A;  2IJY A;  3IPZ A;  1PL2 A;  3MSZ A;  3VLN A;  4WXT A;  4IW9 A;  5AIX A;  4AJ8 A;  3Q6O A;  1R5P A;  3DGQ A;  1KEB A;  3GA4 A;  5KN3 A;  3UJ1 A;  5H5S A;  3HD5 A;  1GTB A;  4F0B A;  3GUR A;  3S9F A;  4ILF A;  4POK A;  2VO4 A;  3D4T A;  1NW2 A;  5A4V A;  2DJ3 A;  3QMX A;  5HR2 A;  4GSS A;  1XW5 A;  1A24 A;  5GST A;  3LYK A;  1AW9 A;  4ZB8 A;  2YV9 A;  1WPI A;  3RDW A;  3N9J A;  1USB A;  2I3Y A;  2PUK C;  4YAV A;  4YQV A;  4TXO A;  2L5L A;  2MMN A;  1GH2 A;  5ECP B;  4GLT A;  3VWU A;  1U3I A;  2H72 A;  5FHI A;  1A2J A;  4BWQ A;  2D2Z A;  1ZYQ B;  1QFN A;  2A2P A;  2H01 A;  2WS2 A;  3CSJ A;  5AIV A;  3UMA A;  1F2E A;  5IMA A;  3RHB A;  3DYR A;  2WUL A;  4PXO A;  2GTU A;  2X64 A;  4NXI A;  5ECQ B;  1IYH A;  4KCA A;  5IIZ A;  6GSU A;  2O7K A;  4BVX A;  1YEP A;  4K5S A;  2ES7 A;  4OFT A;  5EL8 A;  2FY6 A;  2B1K A;  3IK7 A;  3WGX A;  5H5Q A;  3WT2 A;  2CV4 A;  5A4W A;  4OMV A;  1PX6 A;  3G7J A;  3OR5 A;  2V1M A;  4O5U A;  4GXZ A;  2EIR A;  5D9X A;  4KGI A;  1PN0 A;  3ZIT A;  2AB6 A;  4DEJ A;  1J0F A;  5C00 A;  4QL9 A;  2O89 A;  5GAN D;  5IMV A;  2V6K A;  4IGJ A;  3CYN A;  4POL A;  13GS A;  2QGV A;  4EVM A;  4XTS A;  3LGC A;  4PUA A;  4MPG A;  1KBN A;  1X9M B;  4WR4 A;  2HRA A;  1TI3 A;  4ML6 A;  5ELG A;  2LQQ A;  3L9S A;  3LFL A;  2L59 A;  1GSF A;  3TRP A;  1K0A A;  1M2A A;  3W6G A;  1M99 A;  2OAC A;  3DWV A;  1DE1 A;  4KSO A;  4YAP A;  1YZX A;  2MBT A;  1RK4 A;  22GS A;  3BCK A;  5A5K A;  4RI7 A;  4HI7 A;  1TDI A;  2DML A;  4NV2 A;  4JRR A;  5DBQ A;  4DSS A;  3F6D A;  1B4Q A;  3GTU B;  2NVL A;  5F06 A;  4BL7 B;  1T00 A;  3ISO A;  4CDO A;  2WGR A;  2L6C A;  1EEM A;  4ECJ A;  2B5E A;  2E2G A;  3KGK A;  4KSM A;  1T1V A;  3APS A;  2H19 A;  2DC5 A;  3H8Q A;  3HJO A;  1M2B A;  3H1N A;  4ZL9 A;  4L5L A;  3GUS A;  1GUH A;  4MZB A;  3APO A;  2P5R A;  1JZR A;  2RM5 A;  3HHV A;  4HU9 A;  4P3Y B;  4PQH A;  4ZL7 A;  3KTB A;  1PX7 A;  1ERV A;  2PPT A;  1S3A A;  1ILO A;  3DD3 A;  1K0B A;  1K0M A;  2GVP A;  1FVK A;  4MH3 A;  3IDV A;  1HQO A;  2L4C A;  3LJR A;  4DSR A;  1WJK A;  4N30 A;  1O85 A;  5J3R A;  1EZK A;  4KAE A;  3LXZ A;  3W8S A;  4BVY A;  1TRW A;  2OKA A;  5IO0 A;  2PBJ A;  3IHQ A;  5B6M A;  5COH A;  3J7Y k;  3HJP A;  3UBL A;  2VCZ A;  4J57 E;  1R26 A;  3GL5 A;  2VCT A;  4EKZ A;  5A4U A;  2XBQ A;  3GX0 A;  3FKF A;  2OA7 A;  1SKW B;  1J08 A;  2FWE A;  3A5I A;  5CP1 A;  1R7H A;  4LL1 B;  3TKQ A;  1PN9 A;  4G19 A;  3E0U A;  3G9B A;  14GS A;  1EV9 A;  3H79 A;  4N0V A;  1WP0 A;  2YZH A;  4F82 A;  3CTF A;  4EC0 A;  4LA1 A;  3Q18 A;  1MD3 A;  1G7O A;  3EU4 A;  5HR3 A;  5C04 A;  4KDY A;  4BPY A;  2FNO A;  5E4W A;  3A3T A;  4K9Z A;  4NWY A;  1DUG A;  1U6T A;  1TXX A;  4J56 E;  1VRS D;  2RUF A;  4WF5 A;  4LLR A;  5CAX A;  2VCV A;  2V32 A;  4HS1 A;  3EVI A;  3BOA A;  6GSV A;  1AUC A;  2B5Y A;  1TK5 B;  1PKW A;  3IAM 2;  1U3A A;  5ID2 B;  1Y25 A;  3QOU A;  4I8B A;  3L9V A;  3FZ9 A;  5B6N A;  1GRX A;  1LU4 A;  1A23 A;  2GST A;  2H73 A;  4XRD A;  4USS A;  1GNE A;  1YJ6 A;  3TUE A;  4E8H A;  1OC3 A;  4XS4 B;  4FYB A;  3WD6 A;  2MMO A;  2L5O A;  3MAK A;  3LEF A;  4V1A p;  3W8J A;  4MF7 A;  2H75 A;  1AXD A;  2IMD A;  2JAD A;  1K3Y A;  2H30 A;  4NV5 A;  4JBB A;  2JAC A;  1YDK A;  4MJA A;  5J41 A;  3IA1 A;  1DE2 A;  4O32 A;  2CX4 A;  2R4V A;  4I2U A;  1SJZ A;  2AAW A;  1OC9 B;  2CVD A;  4KDX A;  1N2A A;  1Z7P A;  3TKS A;  3ERG A;  2CZ2 A;  3QAV A;  3O3T A;  4MH2 A;  4G2E A;  1X9S B;  3FR9 A;  2ZUP A;  5HFK A;  3ERW A;  3ZTL A;  4HQZ A;  3TJF A;  4K1F A;  3ZFB A;  1XVW A;  2K8S A;  3UVH A;  2K8V A;  1AAZ A;  4F0C A;  4ECI A;  2H1D A;  2C0E A;  1PA3 A;  5D93 A;  4KUN A;  3E3E A;  3F8U A;  3Q19 A;  4Q5Q A;  4XRA A;  2VLT A;  3R3E A;  5ECL B;  2YV7 A;  5HQP A;  3TJJ A;  1K0D A;  2DLX A;  1BAY A;  2HFD A;  4MF6 A;  4HDE A;  3GKK A;  1EV4 A;  1OE8 A;  3HXS A;  4O92 A;  1NHO A;  3GYK A;  3APQ A;  4JE1 A;  2IME A;  5HR0 A;  4FO5 A;  1MDI A;  3ZIJ A;  5ECO B;  5BRT A;  3D5J A;  3F4S A;  2IN3 A;  4ICY A;  1H75 A;  4G0L A;  5GSS A;  2XC2 A;  3HYP A;  2UZ8 A;  3CRT A;  4OWY A;  2DKH A;  5CRG A;  7GSS A;  2HNL A;  3LG6 A;  2F8F A;  3SWL A;  1XWA A;  3HY2 A;  4GRF A;  4MA9 A;  2R0G A;  1JFU A;  4I97 A;  1MDJ A;  2GS3 A;  5JCG A;  3FZ5 A;  2OAD A;  2HRN A;  4XS4 A;  2GSR A;  3MWH A;  3GN3 A;  5G2Z A;  3HJM A;  1G0T A;  2FUG 2;  1TW9 A;  2FCH A;  3N5O A;  3FR6 A;  2OBK A;  4D73 B;  16GS A;  1QXH A;  4WF4 A;  4YKF A;  3M0F A;  4KE3 A;  1XFL A;  1XBS A;  5D8I A;  4NHZ A;  1OKT A;  3TKR A;  2RM6 A;  2GZY A;  5ECN B;  4GQC A;  1O81 A;  2QSI A;  4HU7 A;  5J4U A;  3FMW A;  2YN1 A;  4TN8 A;  3O6T A;  2YWI A;  3A2W A;  5IMC A;  2L6D A;  4IP1 A;  2DJK A;  5IMF A;  4GF0 A;  2IWT A;  2O8V B;  3WYW A;  2IMK A;  2J9H A;  4IQA A;  3TKS C;  1CQH A;  4AJ7 A;  4ZBB A;  2VCW A;  1ERW A;  1PRX A;  2GT6 A;  4EDZ A;  4HOJ A;  5ECS A;  4ZBA A;  1GTI A;  2AYT A;  4EIP A;  4KX4 A;  5DAK B;  1WMJ A;  3CRU A;  2IFQ B;  3M9J A;  3HZ4 A;  2J23 A;  1THO A;  3GHA A;  1GSS A;  3F9U A;  4KDU A;  1AQX A;  2DJJ A;  3EWL A;  1SJI A;  2HI7 A;  3VPQ A;  3DVW A;  2H1G A;  3A5W A;  3V1W A;  5EY6 A;  3E9J B;  5KOW A;  3LQ7 A;  1TOF A;  2LST A;  2YCD A;  2YNX A;  3GKX A;  2NTO A;  4ECB A;  2KOK A;  5DQS A;  1H4O A;  2C3Q A;  2WRT A;  1ACV A;  2VLU A;  5J9C A;  3F3Q A;  1QMV A;  4FIW A;  3M9K A;  5KN2 A;  4K5R A;  1XOA A;  3ZYW A;  1NM3 A;  2GQL A;  4LMW A;  3CSI A;  2VL3 A;  1BED A;  4V2N A;  3IRA A;  3US3 A;  2LJK A;  5LNK e;  2FA4 A;  2YP6 A;  4ID0 A;  4GST A;  4V2L A;  4BWS A;  5J9B A;  2C4J A;  1Y6E A;  2X99 A;  1S3C A;  3GMF A;  2MZC A;  5DDL A;  5DQY A;  2CQ9 A;  5JWR B;  2N5A A;  5EPF A;  1UN2 A;  2LS5 A;  1HNC A;  2R0P A;  2C3T A;  4MLY A;  2H70 A;  3HVS A;  3TCO A;  1XIY A;  3IV4 A;  6GSS A;  5H5R A;  5IOW A;  3RBT A;  1EEJ A;  1JLW A;  4RQR A;  1HD2 A;  2K18 A;  4TOP A;  4YH2 A;  4Q5N A;  5FT3 A;  2H6Z A;  3M1G A;  2GSQ A;  3IOS A;  2PU9 C;  3IAS 2;  4O5Q A;  4OCE A;  1A8L A;  1MEK A;  2MMZ A;  1Z5Y E;  2E2M A;  2C0F A;  1MDK A;  2GQK A;  3AY8 A;  4PX1 A;  1EOG A;  2R37 A;  4X1U A;  2GT5 A;  3ZVJ A;  4L5O A;  4XCS A;  3HA9 A;  3VUR A;  5DAK A;  4RI6 A;  3D21 A;  4NMU A;  4F2I A;  3UAP A;  4OO4 A;  3QR6 A;  4TW5 A;  4IVF A;  3KXO A;  3IE3 A;  5IPH A;  3D22 A;  2VUP A;  1URM A;  1PSQ A;  5AN1 A;  1MD4 A;  1V57 A;  2QKE A;  2I1U A;  4CW9 A;  3O76 A;  4HJM A;  5CRD A;  3C7M A;  3PH9 A;  4PNF A;  3QFB C;  5JCU A;  3C71 A;  3GH6 A;  5HR1 A;  3KZQ A;  3G7Y A;  1A0R P;  4ML1 A;  3DEX A;  4MCU A;  1E2Y A;  1F37 A;  3MDK A;  2PWJ A;  3F4R A;  3FYG A;  3ZMK A;  1F9M A;  3KEB A;  4XS1 A;  4OCF A;  2ALB A;  2IMF A;  3EUR A;  1M7T A;  2NPB A;  1HNA A;  4NHW A;  3CXG A;  1BG5 A;  1QK8 A;  2HRK A;  2HZE B;  5G1K A;  2L57 A;  1NSW A;  3UBK A;  3MIX A;  4K8M A;  5IMZ A;  4O7H A;  3TOU A;  4GWR A;  5G1L A;  4EE0 A;  4X43 A;  2JU5 A;  2VL2 C;  3IR4 A;  2DIY A;  2HRF A;  2GZP A;  3F63 A;  4PTS A;  3HCZ A;  3ED3 A;  3U5R E;  2DIZ A;  1SYR A;  2CAQ A;  3KJY A;  2OJL A;  5D73 A;  2XHF A;  5CRW A;  1Z9H A;  2F8A A;  1BX9 A;  4MJB A;  2YJ7 A;  4L0W A;  1SEN A;  1EP8 A;  2GSS A;  2E0Q A;  1ZZY A;  2VCX A;  1I9D A;  1SK2 A;  2AJQ B;  3VWV A;  1O7U A;  4TXV A;  2H71 A;  2N5B A;  3P90 A;  3KD0 A;  1Z6M A;  4YQM A;  1OYJ A;  5JWQ B;  2C1Y A;  3FR3 A;  1TP9 A;  2V6O A;  4MMM A;  3ZLP A;  3F4T A;  3UAR A;  2LNS A;  3R2Q A;  3CMI A;  2WDU A;  1ML6 A;  1JZO A;  3GST A;  3I6A A;  1GSY A;  1OVN A;  5IPG A;  5L71 A;  1WIK A;  2EC4 A;  5EVO A;  1SJ6 A;  4MJC A;  5LCZ A;  1TKD B;  1EWX A;  1O8W A;  3GTU A;  4MNN A;  4FYC A;  4WEY A;  4Z7X A;  1SYX A;  3A2V A;  11GS A;  3EIN A;  6GSW A;  4IBP A;  5D96 A;  2BMX A;  1QUW A;  4BL7 A;  3CSH A;  1M9A A;  1ERT A;  2C3N A;  2K6V A;  12GS A;  1UA5 A;  2H74 A;  3FRC A;  3ZML A;  2BTO T;  3GKM A;  2VD1 A;  1WE0 A;  3DIE A;  4KF9 A;  3FZA A;  3K8N A;  5F8B A;  1YF0 A;  4X4J A;  4Q5R A;  1XW9 A;  5G5F A;  1HYU A;  2KP1 A;  1FB0 A;  4OO5 A;  3TRQ A;  3EE2 A;  2R6K A;  2GLR A;  3EC3 A;  1M9B A;  2HSY A;  3TOT A;  3L78 A;  2TRC P;  4WBR D;  2LQO A;  1LJR A;  1SD8 A;  4TR3 A;  4IKH A;  2NDO A;  4LMV A;  1JZW A;  2WFC A;  2MYG A;  2VIM A;  2QA1 A;  5DCG A;  1PKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...