4EF0A

Crystal structure of the first catalytic domain of protein disulfide isomerase p5
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
115
structure length
115
Chain Sequence
b'MVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein disulfide-isomerase A6
publication title Crystal Structure of the first catalytic domain of protein disulfide isomerase P5
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 37
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2012-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ef0A01
1OC9B 1N8JA 3DD3A 1DSBA 5HFGA 2YV7A 4MJEA 1NHYA 2WZ9A 3CTFA 1VF2A 3VURA 4LL4B 3QD9A 1R26A 4MLYA 3D21A 4ILFA 1ON4A 1U87A 4FIWA 2C0EA 2PWJA 1DBYA 1B4QA 4IP6A 3ZZXA 5GSTA 3IPZA 1OKTA 2H71A 2WJUA 2P5QA 3KP8A 4KB3A 4POBA 1JZWA 5B7CA 2OE3A 1XZOA 2L5LA 3FRCA 3DKSA 1Q98A 3ZVJA 4X43A 1XVWA 4MPFA 1FOVA 1WJKA 1NM3A 2OE1A 1K3YA 3S9FA 1PQNA 4PUFC 1R4WA 2KLXA 4DVCA 5D93A 4XIHA 5D73A 2PVQA 2FNOA 4CW9A 3TOTA 4XCSA 1ZMAA 4MK3A 5F06A 4LLRA 3DEXA 2MZCA 2KHPA 4MF5A 3LXZA 1JZDA 4KAEA 2LJKA 2C4JA 1Z6NA 5IMVA 2WCIA 1TRUA 1WWJA 3TKSE 2VIMA 3DGQA 1TI1A 3TUEA 3ZREA 3FR6A 3GHAA 3NIVA 3RHCA 5HFKA 1BG5A 3U6VA 1AC1A 2CVBA 5D9XA 1M9AA 2GSQA 3IBHA 5COHA 1G6WA 2F8AA 4KH7A 3KZQA 3HJMA 1GLPA 1ILOA 2H74A 2ZNMA 1XW9A 2H6YA 3I43A 4QL7A 2OKAA 1YZXA 3LWAA 2H0IA 3VK9A 4E8EA 1PKWA 3L0HA 2DMLA 3NOFA 5ECHB 3VLNA 3TRQA 1TOFA 18GSA 4K8MA 2I1UA 2CT6A 4MMMA 2M72A 3KTBA 2HRFA 4I97A 4EDZA 1AW9A 2HZFA 1B4PA 4I2UA 1S3CA 3EYTA 1GP1A 5ECOB 2H30A 2L4CA 1YDKA 4O32A 2VO4A 2V32A 5AISA 1ACVA 3NZNA 3RBTA 3TRXA 1Z6MA 2EIRA 2O89A 1PX6A 4MJBA 1Y25A 1GTAA 4PQHA 3WT1A 4JE1A 2CV4A 3EURA 2MMOA 5IIZA 2V1MA 1ZGNA 3H93A 3KD0A 1XW5A 4YQVA 2LQQA 4O92A 3CRTA 1EOHA 1HD2A 5DJLA 4EL1A 3KMNA 4JZQA 3DWVA 4LMVA 1GLQA 1EP8A 1K0NA 1Y6EA 4TXOB 2JZSA 1VGLA 4K2DA 3GSTA 5FHIA 1HNBA 1Z9HA 1UC7A 2KP1A 5E59A 4GSSA 3KTLA 3HKRA 3FR9A 4I2TA 2VL3A 4LA1A 1AQXA 1MD3A 1SKWB 1YQ1A 2ZCTA 16GSA 10GSA 4ZL7A 3HHVA 2O85A 2FA4A 2GZPA 3G7IA 5HQPA 5AGYA 3QR6A 4WEYA 1TU7A 1SKSB 1T8EB 3PGTA 2M46A 2TRXA 2OBKA 2ON5A 2YWNA 2CZ3A 2H1GA 2H6ZA 4MZWA 3OR5A 2H70A 1XWAA 2QSIA 2YZUA 4WETA 2H01A 3H1NA 1KTEA 1GSDA 1XXUA 4BVXA 1A2LA 2WULA 2L6DA 2TIRA 2GQMA 2HT9A 2V2GA 3C1SA 2J9HA 4OFMA 4ECBA 4RQXA 2VCVA 1UVZA 3VFIA 2LV3A 4YAVA 1FHEA 2GT6A 5ECLB 4FYBA 1T7PB 5J4UA 4MA9A 4Z7XA 1T4YA 1I9DA 4OCEA 2LS5A 4XTSA 3U5RE 2RM6A 1Q4JA 1WRYA 3W8JA 4K6XA 5ECNB 2DC5A 3FYGA 2OA7A 2RM5A 3RAZA 3ZIJA 5EVOA 3KP9A 5D9TA 2C0DA 4TR4A 3UBLA 2C0FA 4OWYA 5DVBA 4POKA 2VCXA 2CAIA 4KW6A 2K18A 2H1AA 1GSYA 3IXRA 1H75A 1J0FA 3KH9A 5DJMA 3QAVA 4L5LA 4CDOA 1F37A 3LFLA 3BCKA 1HNCA 4KDUA 1IYIA 2VD0A 2V41A 4TR3A 4JR4A 1A0RP 4TXOA 4JEDA 4MH3A 4TR0A 4G19A 1OE7A 1XOBA 4EVMA 4PUAA 4OFTA 2VD1A 2JZRA 4IW9A 1M2BA 4ZL9A 3J7Yb 1ZYEA 3WGEA 1TXXA 4YQMA 3M8NA 4N10A 5IMCA 3KEBA 2XHFA 3EWLA 4OFNA 3HVVA 3DXBA 5HR1A 1X5CA 5DQSA 1YF0A 4NHWA 3M3MA 4EE0A 4ULXA 1TK8B 3F3RA 2H1BA 3KXOA 1GULA 1AQWA 2XC2A 3DVWA 4O7HA 3L9VA 3HZ8A 3G7JA 3GH9A 1XOAA 1Z7PA 3KCMA 2REMA 4GQFA 1PMTA 1O73A 3GNJA 3FKFA 2PGTA 2YNXA 4YH2A 4I6XA 2AB6A 2H76A 3L78A 2HZEB 1OC3A 5ELGA 3UVHA 2DJ2A 1V2AA 2P31A 2FWFA 4OD7A 4TW5A 5B8AA 4V2NA 5J41A 5ECRB 1F6MC 5IQYA 2B3SA 3IAS2 4HU9A 2O8VB 1GNWA 5G31A 4EDYA 3TJBA 5D96A 2A4VA 4KSOA 5IMZA 1GRXA 2K9FA 4NWYA 3GYKA 1YF1A 2CVDA 2DJ1A 4K7IA 2OE0A 1O81A 1BEDA 1K0CA 3HVXA 2VOCA 4KDXA 2L59A 3ZLPA 3RHBA 1BQ7A 5G5EA 3HJPA 3APOA 3VWUA 3UOMA 3FHKA 2CVKA 4GQCA 5CYYA 3F3QA 2E2MA 1SKRB 1GTUA 3Q74A 5J9BA 3BD2A 1ZYQB 2HSYA 1FVJA 2CX4A 2L4QA 2H73A 3CBUA 4PGTA 3F4TA 2LRNA 5ECPB 3HVSA 2F8FA 3M1GA 5D8IA 3VI5A 2G2QA 2LJAA 4HQSA 4HJ2A 2LJRA 1THXA 4Q5NA 2EIQA 1XW6A 4LL1B 1BJXA 2C3TA 2C0GA 2LEGA 3AY8A 3A3TA 5F07A 5IOWA 3G7YA 1SYRA 2H8LA 6GSUA 3C1RA 1U3IA 4POMA 3KM6A 4MZCA 4KNDA 2VL2C 2GSRA 2IMEA 2LNSA 4Q5RA 5CREA 2DJ0A 3BBYA 1EP7A 5EL8A 2B7JA 4KA0A 2VCWA 4RI7A 3EC3A 3WYWA 1YKCA 1MTCA 5EY6A 1EOGA 2QC7A 4XRAA 2F9SA 4TR1B 1K0BA 2HZEA 2IFQB 2MBSA 4GCIA 4AF2A 4Q5FA 2AAWA 1SJIA 4F9ZA 1GH2A 2FCHA 3LYKA 4BVYA 1TKDB 2WB9A 3HA9A 4TXVA 2XBQA 3GTUB 4MPGA 1X5EA 2VM1A 1MD4A 3F9UA 1XWCA 1GUKA 4DEJA 4ZIJA 2PMTA 3M9KA 3IHQA 2GS3A 3TKRA 1SJZA 4KCEA 14GSA 3TCOA 2X99A 2GTUA 1F9MA 2GVPA 4IS0A 1NW2A 2PERA 3HDCA 2C3QA 1X9WB 5IO0A 5HR3A 5GZZB 3WT2A 4ZILA 4J2FA 3GKXA 4HI7A 3QAWA 2GSTA 4MH2A 2XPEA 4LMWA 3E3EA 3CMIA 4ZB8A 3V1WA 2QKEA 3L4NA 4IQ1A 2VL2A 4F2IA 3LJRA 1SJ6A 2I9HA 2P0GA 3M9JA 3F0IA 1SL0B 4ECCA 3DVXA 3SBCA 4JRRA 3QOUA 4XS4B 2R4VA 3ZIVA 3GKNA 5CRHA 4EXJA 3EMPA 1H4OA 2DJKA 5AIVA 2DJ3A 1JZOA 5CRWA 1OC9A 2EC4A 5JWQB 3RPNA 4KE3A 2VLTA 2G0FA 2H72A 12GSA 3IRAA 2BMXA 4KUNA 4KGIA 1BYEA 1SU9A 3HXSA 1GSQA 1FW1A 2YWIA 3IE3A 2DSAA 1M2AA 1KBNA 2K8SA 3ZL5A 1AAZA 4KDYA 4NAXA 1LJRA 2N5AA 3TKSC 1Z3EA 3D6IA 2MYGA 3GH6A 3MAKA 4MF7A 5DAKB 1X5DA 3LEFA 4V1Ag 1GL8A 5G5FA 3L9UA 11GSA 1TRSA 1TK5B 3F63A 5INYA 3E9JB 1PA3A 2K6VA 3I6AA 1R5PA 2JADA 4N0ZA 3GL3A 3EU3A 4D73B 2R6KA 3HYPA 4HS1A 1EGOA 1AUCA 1GUHA 4N0VA 3UL3A 4IELA 1XVQA 1A0FA 2P5RA 1W89A 5ID2B 1SK0A 2MMAA 1K0AA 5J9CA 2GQKA 3Q19A 1EGRA 2BJXA 4X0XA 1G6YA 1QMVA 3TOUA 5JWRB 4ZBDA 4PURA 1M7TA 1FG4A 6GSVA 5CNWA 2PU9C 2IN3A 2B5EA 2ON7A 3CSJA 5EPFA 3IOSA 1GWCA 4GXZA 3TKSA 1FO5A 4IBPA 2VCQA 3UEMA 3SWLA 4IJ3A 4KSMA 3H79A 4ZBBA 4XS4A 8GSSA 2CX3A 2F51A 2LQOA 4NV2A 4GLTA 3FK8A 1AXDA 2GLRA 4NXIA 3LG6A 1TK0B 2ZUPA 1T00A 3HJOA 3P2AA 2H0HA 2VL9A 2IIYA 5IPGA 4PQIA 3ZMKA 2YJHA 3D4TA 3DRNA 1S3DA 4G9HA 4GSTA 4MDCA 3TJJA 3C7MA 2YJ7A 3D22A 2KP2A 5GAPD 1LBKA 3DYRA 4NPBA 3QDNA 1SD9A 2A2SA 6GSSA 2OJLA 5HR0A 1A2MA 3A2WA 1KNGA 4FH8A 5JCGA 4BWQA 1S3AA 4DSSB 1MDKA 2NTOA 2VLVA 2TRCP 4RUVA 2OACA 3O76A 6GSYA 2GT5A 4QL9A 1AIUA 2E2GA 3IAM2 1U3AA 3I9V2 4K0NA 2V6KA 4ECJA 5IOXA 2LUSA 4D73A 4JU5A 3WGDA 5CRGA 1XWKA 3TJGA 4FYCA 3N9JA 3ERGA 4F82A 2AV4A 4EO3A 1G0TA 2I3YA 1NHOA 3MSZA 1T1VA 4ZL8A 4PX1A 4TOPA 4WKWA 5CAXA 5G1LA 3GN3A 1TP9A 2H19A 1PX7A 4XHMA 2LKUA 1SENA 1EEJA 1DE1A 22GSA 4NMUA 3H4KA 2K8VA 2H66A 3LSZA 3HCZA 2JU5A 4RI6A 1ERVA 3ZITA 1WMJA 3UVTA 1K0MA 4F03A 1EV9A 3VWVA 2JSYA 5KN1A 3CXGA 4AJ6A 1V58A 1V40A 2CQ9A 2DBCA 2IPAA 2B1KA 1SK2A 1QK8A 5AIXA 2OBIA 2C1YA 3CTGA 3FZ5A 4GRFA 5F05A 1RK4A 5ECQB 3F6FA 2KUCA 2AYTA 5ECSA 3P7XA 5IMDA 1BAYA 1F3BA 2C80A 19GSA 2WGRA 1XIYA 3DMLA 1PSQA 4KCAA 2LSTA 3IK7A 2E7PA 2VAFA 4IGJA 4QQ7A 5L71A 2IMKA 3IA1A 4E8HA 4DSSA 5F0GA 1J9BA 2EIOA 4IKHA 2DIZA 3IC4A 4OCFA 5B6MA 3A2XA 4K7OA 1CQGA 2FHEA 1VF3A 1NSWA 4V1Ap 1F2EA 3GV1A 2YWOA 4X1UA 4MZBA 4OMVA 1ERWA 2RIIA 1QGVA 4IJIA 4WBRD 3R2QA 4KX4A 2MMZA 4NHZA 2DIYA 3PINA 1PGTA 1GSSA 4J56E 3P90A 2PPTA 3TJKA 1B48A 2WDUA 3PH9A 4ZB6A 3QCPA 1K3LA 1G7EA 4NV5A 1MEKA 4IHUA 1PL1A 5DBQA 2A2RA 2DLXA 5KN2A 2JACA 3GA4A 3FEUA 1USBA 1GSEA 1PN9A 2AJQB 3HD5A 3CRUA 1I5GA 1Z5YE 1FVKA 3CYNA 4K0GA 2HNLA 2X8CA 6GSWA 1K0DA 2VM2A 3A5WA 4HU7A 2YN1A 2Z9SA 4HZ2A 4ZB9A 1TRVA 1OC8A 3DIEA 3C73A 1A24A 4POLA 4EUYA 4I8BA 5HR2A 3CSIA 1O8XA 2RUFA 4WR4A 1ZOFA 1LU4A 1M2DA 1O8WA 2NPBA 3ME7A 5G1KA 1A8YA 1V57A 4ML1A 4N11A 1K0OA 1MDJA 4TN8A 2L5OA 2X8HA 2WRTA 4WXTA 2GQLA 4EC0A 5D9WA 3O6TA 3VPTA 4OO4A 5H5QA 1QQ2A 1U6TA 17GSA 4IVFA 2YOIA 3UMAA 1EEMA 2FWEA 1UN2A 4H86A 4GWRA 1G7OA 5DALB 1DUGA 1XCCA 3APSA 2NDOA 3LYPA 2MMNA 4F0CA 1V9WA 2DJJA 1GSFA 2HE3A 5E4WA 5G30A 1TRWA 3KIJA 2FLSA 4HUAA 1TJDA 3F4SA 1WP0A 5C00A 2CZ2A 4HEA2 1TW9A 2N5FA 5ECIB 4O5RA 5HFIA 1O7UA 2FA8A 2PVOC 2YCDA 4XS6A 3EE2A 4HQZA 2QGVA 1E2YA 3ZVJD 5D9VA 5B8BA 3E0UA 2H0GA 4L0WA 1ZL9A 1YKAA 3BOAA 2HYXA 2AUVA 3GL5A 4JBBA 2GSSA 2HRNA 4FYUA 1ERUA 5KN3A 4HDEA 4XS1A 1XWBA 4ML6A 1FB6A 1ML6A 3FZ4A 2LTKA 13GSA 1VRSD 5A5KA 3UIWA 1A8LA 7GSSA 3EU4A 4GTUA 1TU8A 1WPIA 5ABRA 1EWXA 1OVNA 1BX9A 3ZFLA 1Z7RA 2VUPA 4K7NA 1EV4A 5ECMB 3ZMLA 2M80A 2IMDA 4BWSA 3J7Yk 2B1LA 4MABA 2E0QA 5AN1A 2CA8A 2HLSA 3LGCA 3GKKA 4WF4A 5F8BA 2RUEA 3C71A 1PD21 2D2ZA 1JZRA 1E6BA 3EVIA 5FWGA 1SL1B 2IMFA 5KEJA 2IMIA 2FGXA 4PQ1A 6GSTA 3A2VA 3FY7A 4XRDA 1WIKA 3P8WA 3D0ZA 4MJCA 1IYHA 2YPMA 4FO5A 2LNTA 1M0UA 3F8UA 4TVEA 1YEXA 1SYXA 3F4RA 3GRXA 3C8EA 5IPHA 3IK9A 3QFBC 5LNKe 4TR1A 5DALA 1PL2A 3MDKA 1MDIA 2IFQA 3ERWA 1FB0A 2IJYA 2WS2A 4EF0A 1A2JA 3GIXA 2HI7A 3GTUA 3W6GA 1ABAA 3ZFBA 3GUSA 2IWTA 2YANA 1THOA 3W8SA 1OE8A 1M99A 1YY7A 1QFNA 4ZXGA 4IQAA 3H8QA 1XFLA 3VI7A 3UAPA 4MF6A 3ERFA 2GGTA 4ACSA 3HZ4A 3VWWA 3UARA 3GX8A 2C8UA 4MCUA 3UJ1A 1TI3A 3US3A 3HY2A 4Q5QA 3ME8A 1W4VA 3LXTA 1C72A 1WE0A 5ECKB 2XBIA 1B8XA 4BA7A 5A4WA 3IDVA 1HYUA 5DCGA 1JFUA 1T4ZA 3FZ9A 5JCWA 3FR3A 4RQRA 2YV9A 9GSSA 4HOJA 4WR5A 3TKPA 1HNAA 1WOUA 1VF4A 1R5AA 2LRCA 1GTIA 1K3OA 1KEBA 4ECIA 3BCIA 3EMXA 2JL4A 4ISDA 2GDRA 1YEPA 3G9BA 4PNFA 2NBSA 3TRPA 3UBKA 2CAQA 5CP1A 3EINA 4V2LA 3I69A 4IN0A 1J08A 1FAAA 2XPDA 5J5NA 1VF1A 1M9BA 3TGZA 2MBTA 3GKMA 2VLUA 4L8EA 2GZZA 3ZYWA 2NVLA 5DAKA 1U88A 2F3MA 1RW1A 5IO2A 5LD0A 3D4MA 5KN0A 3IV4A 4BL7A 3KH7A 2H6XA 3LORA 1ZCPA 5B6NA 3IR4A 4YQUA 5FT3A 3QFAC 4PNGA 1DE2A 1JLWA 1UA5A 2B7KA 2B5XA 2FUG2 1X9SB 3Q18A 4HZ4A 3N5OA 2X8GA 1SD8A 1B9YC 2GZYA 5ID2A 1ZZYA 4I5QA 4CHSA 1TTZA 2FWHA 1OYJA 1V98A 4N30A 5ELAA 5GSSA 2JSZA 1XBSA 3L9SA 3FZAA 3GSSA 2H1DA 3BJ5A 4L0UA 5J3RA 5H5SA 3KJYA 3WGXA 1SL2B 5DCHA 1OAZA 1JHBA 1ERTA 4ZBAA 3K8NA 1N2AA 4K9ZA 5IMAA 1B9XC 4MP4A 1T3BA 3ISOA 1GTBA 2HXKA 4JR6A 2YP6A 4EKZA 4YAPA 2B6MA 2YZHA 2JZTA 2VCZA 4AJ7A 3ED3A 3MNGA 3O3TA 2KOKA 2B5YA 5G2ZA 1HQOA 2HSHA 5H5RA 2L6CA 1ST9A 4J57E 3VWXA 3QPMA 5LCZA 1PKZA 1TDIA 4MJAA 5ENUA 3APQA 2WFCA 1X0RA 2FD3A 4PXOA 3GMFA 5C04A 1GSUA 4DSRA 1URMA 4WF5A 20GSA 1RQMA 2H75A 2R3XA 3PR8A 4DSQA 5A4VA 2PN8A 4WBJA 2V6OA 3LQ7A 1A23A 5JWOB 3D5JA 4IP1A 2AHEA 3Q6OA 4GF0A 1GNEA 1AQVA 2ES7A 2X64A 5GAND 1XWGA 3F6DA 1YJ6A 1PRXA 1F3AA 2J23A 2FWGA 3JCML 1SK1A 5CRDA 3GURA 1O85A 4AJ8A 5DDLA 3KMOA 1R7HA 2R37A 2LRTA 4G10A 5CO3A 1OKDA 1EZKA 3TKQA 1QXHA 2R2JA 2I4AA 4OO5A 2PUKC 2L57A 3GX0A 3TJFA 2OADA 3ZTLA 3CSHA 2YWMA 5IMFA 4F0BA 4BPYA 2C3NA 1X9MB 2PBJA 1CQHA 5IM9A 3MWHA 4G2EA 2BTOT 1XPVA 2DMMA 1O6JA 2FY6A 4TRXA 4P3YB 3M0FA 3RDWA 3TDGA 2O7KA 5DQYA 3QAGA 2N5BA 3TB2A 2IL3A 1GUMA 4L5OA 2VCTA 4TKYA 5A4UA 2HFDA 2RLIA 4AGSA 6GSXA 3GFKA 3VPQA 4K1FA 3RPPA 5JCUA 3QMXA 2R5GA 2ALBA 4V2MA 4ID0A 4HJMA 3FW2A 2I81A 3WD6A 3ZRDA 3KGKA 2O87A 4GSNA 1QUWA 1JLVA
chains in the Genus database with same CATH superfamily
1OC9B 1N8JA 3DD3A 1DSBA 5HFGA 2YV7A 4MJEA 1NHYA 2WZ9A 3CTFA 1VF2A 3VURA 4LL4B 3QD9A 1R26A 4MLYA 3D21A 4ILFA 1ON4A 1U87A 4FIWA 2C0EA 2PWJA 1DBYA 1B4QA 4IP6A 3ZZXA 5GSTA 3IPZA 1OKTA 4G0IA 2H71A 1FOHA 2WJUA 2P5QA 3KP8A 4KB3A 4POBA 1JZWA 5B7CA 2OE3A 1XZOA 2L5LA 3FRCA 3DKSA 1Q98A 3ZVJA 5BRTA 4X43A 1XVWA 4MPFA 4O5UA 1WJKA 1FOVA 1NM3A 2OE1A 1K3YA 3S9FA 1PQNA 4PUFC 1R4WA 2KLXA 4DVCA 5D93A 4XIHA 5D73A 2PVQA 2FNOA 4CW9A 3TOTA 4XCSA 1ZMAA 4MK3A 5F06A 4LLRA 3DEXA 2MZCA 2KHPA 4MF5A 3LXZA 1JZDA 4KAEA 2LJKA 2C4JA 1Z6NA 5IMVA 2WCIA 1TRUA 1WWJA 3TKSE 2VIMA 3DGQA 1TI1A 3TUEA 3ZREA 3FR6A 3GHAA 3NIVA 3IHGA 3RHCA 5HFKA 1BG5A 3U6VA 1AC1A 2CVBA 5D9XA 2DKIA 3CQFA 1M9AA 2GSQA 3IBHA 5COHA 1G6WA 2F8AA 4KH7A 3KZQA 3HJMA 1GLPA 1ILOA 4O5QA 2H74A 2ZNMA 1XW9A 2H6YA 3I43A 4QL7A 2OKAA 1YZXA 3LWAA 1PN0A 2R0CA 2H0IA 3VK9A 4E8EA 1PKWA 3L0HA 2DMLA 3NOFA 5ECHB 2A4HA 3VLNA 3TRQA 1TOFA 18GSA 4K8MA 2I1UA 2CT6A 4MMMA 2M72A 3KTBA 2HRFA 4I97A 4EDZA 1AW9A 2HZFA 1B4PA 4I2UA 1S3CA 3EYTA 1GP1A 5ECOB 2H30A 2L4CA 1YDKA 4O32A 2VO4A 2V32A 5AISA 1ACVA 3NZNA 3RBTA 3TRXA 4X4JA 1Z6MA 2EIRA 2O89A 1PX6A 1PFOA 4MJBA 1Y25A 1GTAA 4PQHA 3WT1A 4JE1A 2CV4A 3EURA 2MMOA 5IIZA 2V1MA 1ZGNA 3H93A 3KD0A 1XW5A 4YQVA 2LQQA 4Z2RA 4O92A 3CRTA 1EOHA 1HD2A 5DJLA 1ZYPA 4EL1A 3KMNA 4JZQA 3DWVA 4LMVA 1GLQA 1EP8A 1K0NA 1Y6EA 4TXOB 2JZSA 1VGLA 4K2DA 3GSTA 5FHIA 1HNBA 1Z9HA 1UC7A 2KP1A 5E59A 4GSSA 3KTLA 3HKRA 3FR9A 4I2TA 2VL3A 4LA1A 1AQXA 1MD3A 1SKWB 1YQ1A 2ZCTA 16GSA 10GSA 4ZL7A 3HHVA 2O85A 2FA4A 2GZPA 3G7IA 5HQPA 5AGYA 3QR6A 4WEYA 1TU7A 1SKSB 1T8EB 3PGTA 2M46A 2TRXA 2OBKA 2ON5A 2YWNA 2CZ3A 2H1GA 2H6ZA 4MZWA 3OR5A 2H70A 1XWAA 2QSIA 2YZUA 4WETA 2H01A 3H1NA 1KTEA 1GSDA 3LW9A 1XXUA 4BVXA 1A2LA 2WULA 2L6DA 2TIRA 2GQMA 2HT9A 2V2GA 3C1SA 2J9HA 4OFMA 4ECBA 4RQXA 2VCVA 1UVZA 3VFIA 2LV3A 4YAVA 1FHEA 2GT6A 5ECLB 4FYBA 1T7PB 5J4UA 4G0LA 4MA9A 4Z7XA 1T4YA 2HSMA 1I9DA 4OCEA 2LS5A 4XTSA 3U5RE 2RM6A 1Q4JA 1WRYA 3W8JA 4K6XA 5ECNB 2DC5A 3FYGA 2OA7A 2RM5A 3RAZA 3ZIJA 5KOXA 5EVOA 3KP9A 5D9TA 2C0DA 4TR4A 3UBLA 2C0FA 4OWYA 5DVBA 4POKA 2VCXA 2CAIA 4KW6A 2K18A 2H1AA 1GSYA 3IXRA 1H75A 1J0FA 3KH9A 5DJMA 3QAVA 4L5LA 4CDOA 1F37A 3LFLA 3BCKA 1HNCA 4KDUA 1IYIA 2VD0A 2V41A 4TR3A 4JR4A 1A0RP 4TXOA 4JEDA 4MH3A 4TR0A 4G19A 1M3IA 2A2PA 1OE7A 1XOBA 2UZ8A 4EVMA 4PUAA 4OFTA 4PTSA 2VD1A 2JZRA 4IW9A 1M2BA 4EIQA 4ZL9A 3J7Yb 1ZYEA 3WGEA 1TXXA 4YQMA 3M8NA 4N10A 5IMCA 3KEBA 2XHFA 3EWLA 4OFNA 3HVVA 3DXBA 5HR1A 1X5CA 5DQSA 1YF0A 4NHWA 3M3MA 4EE0A 4ULXA 1TK8B 3F3RA 2H1BA 3KXOA 1GULA 1AQWA 2XC2A 3DVWA 4O7HA 3L9VA 3HZ8A 3G7JA 3GH9A 1XOAA 1Z7PA 3KCMA 2REMA 4GQFA 1PMTA 1O73A 3GNJA 3FKFA 2PGTA 2YNXA 4YH2A 4I6XA 2AB6A 2H76A 3L78A 2HZEB 1OC3A 5ELGA 3UVHA 2DJ2A 1V2AA 2P31A 2FWFA 4OD7A 4TW5A 5B8AA 4V2NA 5J41A 4BVYB 5ECRB 1F6MC 5IQYA 2B3SA 4BIKA 3IAS2 4HU9A 2O8VB 1GNWA 5G31A 4EDYA 3TJBA 5D96A 2A4VA 4KSOA 5IMZA 1GRXA 2K9FA 4NWYA 3GYKA 1YF1A 2CVDA 2DJ1A 4K7IA 2OE0A 1O81A 1BEDA 1K0CA 3HVXA 2VOCA 4KDXA 2L59A 3ZLPA 3RHBA 1BQ7A 2X49A 5G5EA 3HJPA 3APOA 3VWUA 3UOMA 3FHKA 2CVKA 4GQCA 5CYYA 3F3QA 2HRKA 2E2MA 1SKRB 1GTUA 3Q74A 5J9BA 3BD2A 1ZYQB 2HSYA 1FVJA 2CX4A 2L4QA 2H73A 3CBUA 4PGTA 3F4TA 2LRNA 5ECPB 3HVSA 2F8FA 3M1GA 5D8IA 3VI5A 2G2QA 1ZYNA 2LJAA 4HQSA 4HJ2A 2LJRA 1THXA 4Q5NA 2EIQA 1XW6A 4LL1B 1BJXA 2C3TA 2C0GA 2LEGA 3AY8A 3A3TA 5F07A 5IOWA 3G7YA 1SYRA 2H8LA 6GSUA 3C1RA 1U3IA 4POMA 3KM6A 4MZCA 4KNDA 2VL2C 2GSRA 2IMEA 2LNSA 4Q5RA 5CREA 2DJ0A 3BBYA 1EP7A 5EL8A 2B7JA 4KA0A 2VCWA 4RI7A 3EC3A 3WYWA 1YKCA 1MTCA 1M3JA 5EY6A 1EOGA 2QC7A 4XRAA 2F9SA 4TR1B 1K0BA 2HZEA 2IFQB 2MBSA 4GCIA 4AF2A 4Q5FA 2AAWA 1SJIA 4F9ZA 1GH2A 2FCHA 3LYKA 4BVYA 1TKDB 2WB9A 3HA9A 4TXVA 2XBQA 3GTUB 4MPGA 1X5EA 2VM1A 1MD4A 3F9UA 1XWCA 1GUKA 4DEJA 4ZIJA 2PMTA 3M9KA 3IHQA 2GS3A 3TKRA 1SJZA 4KCEA 14GSA 3TCOA 2X99A 2GTUA 1F9MA 2GVPA 4IS0A 1NW2A 2PERA 3HDCA 2C3QA 1X9WB 5IO0A 5HR3A 5GZZB 3WT2A 4ZILA 2X4AA 4J2FA 3GKXA 4HI7A 3QAWA 2GSTA 4MH2A 2XPEA 4LMWA 3E3EA 3CMIA 4ZB8A 3V1WA 2QKEA 3L4NA 4IQ1A 2VL2A 4F2IA 3LJRA 1SJ6A 2I9HA 2P0GA 3M9JA 3F0IA 1SL0B 4ECCA 3DVXA 3SBCA 4JRRA 3QOUA 4XS4B 2R4VA 3ZIVA 3GKNA 5CRHA 4EXJA 3EMPA 1H4OA 2DJKA 5AIVA 2DJ3A 1JZOA 5CRWA 1OC9A 2EC4A 5JWQB 3RPNA 4KF9A 4KE3A 2VLTA 4G0KA 2G0FA 2H72A 12GSA 3IRAA 2BMXA 4KUNA 4KGIA 1BYEA 1SU9A 3HXSA 1GSQA 1FW1A 2YWIA 3IE3A 2DSAA 1M2AA 1KBNA 2K8SA 3ZL5A 1AAZA 4KDYA 4NAXA 1LJRA 2N5AA 3TKSC 1Z3EA 3D6IA 2MYGA 3GH6A 3MAKA 4MF7A 5DAKB 1X5DA 3LEFA 4V1Ag 1GL8A 5G5FA 3L9UA 11GSA 1TRSA 1TK5B 3F63A 5INYA 3E9JB 1PA3A 2K6VA 3I6AA 1R5PA 2JADA 4N0ZA 3GL3A 3EU3A 4D73B 2R6KA 3HYPA 4HS1A 1EGOA 1AUCA 1GUHA 4N0VA 3UL3A 4IELA 1XVQA 1A0FA 2P5RA 1W89A 5ID2B 1SK0A 4ICYA 2MMAA 1K0AA 4USSA 5J9CA 2GQKA 3Q19A 1EGRA 2BJXA 4X0XA 1G6YA 1QMVA 3TOUA 5JWRB 4ZBDA 4PURA 1M7TA 1FG4A 6GSVA 5CNWA 2PU9C 2IN3A 2B5EA 2ON7A 3CSJA 5EPFA 3IOSA 1GWCA 4GXZA 3TKSA 1FO5A 4IBPA 3A5IA 2VCQA 3UEMA 3SWLA 4IJ3A 4KSMA 3H79A 4ZBBA 4XS4A 8GSSA 2CX3A 2F51A 2LQOA 4NV2A 4GLTA 3FK8A 1AXDA 4MNNA 2GLRA 4NXIA 3LG6A 1TK0B 2ZUPA 1T00A 3HJOA 3P2AA 2H0HA 2VL9A 2IIYA 5IPGA 4PQIA 3ZMKA 2YJHA 3D4TA 3DRNA 1S3DA 4G9HA 4Z2UA 4GSTA 4MDCA 3TJJA 3C7MA 2YJ7A 3D22A 2KP2A 5GAPD 1LBKA 3DYRA 4NPBA 3QDNA 1SD9A 2A2SA 6GSSA 2OJLA 5HR0A 1A2MA 3A2WA 4YKFA 1KNGA 4FH8A 5JCGA 4BWQA 1S3AA 4DSSB 1MDKA 2NTOA 2VLVA 2TRCP 4RUVA 2OACA 3O76A 6GSYA 2GT5A 4QL9A 1AIUA 2E2GA 3IAM2 1U3AA 3I9V2 4K0NA 2V6KA 4ECJA 5IOXA 2LUSA 4D73A 4JU5A 3WGDA 5CRGA 1XWKA 3TJGA 4FYCA 3N9JA 3ERGA 4F82A 2AV4A 4EO3A 1G0TA 2I3YA 1NHOA 3MSZA 1T1VA 4ZL8A 4PX1A 4TOPA 4WKWA 5CAXA 5G1LA 3GN3A 1TP9A 2H19A 1PX7A 4XHMA 2LKUA 1SENA 1EEJA 1DE1A 22GSA 4NMUA 3H4KA 2K8VA 2H66A 3LSZA 3HCZA 2JU5A 4RI6A 1S3RA 1ERVA 3ZITA 1WMJA 3UVTA 1K0MA 4F03A 1EV9A 3VWVA 2JSYA 5KN1A 3CXGA 4AJ6A 1V58A 1V40A 2CQ9A 2DBCA 2IPAA 2B1KA 1SK2A 1QK8A 5AIXA 2OBIA 2C1YA 3CTGA 3FZ5A 4GRFA 5F05A 1RK4A 5ECQB 3F6FA 2KUCA 2AYTA 5ECSA 3P7XA 5IMDA 1BAYA 1F3BA 2C80A 19GSA 2WGRA 3R3EA 1XIYA 3DMLA 1PSQA 4KCAA 2LSTA 4CY6A 3IK7A 2E7PA 4YKGA 2VAFA 4IGJA 4QQ7A 5L71A 2IMKA 3IA1A 4E8HA 4DSSA 5F0GA 1J9BA 2EIOA 4IKHA 2DIZA 3IC4A 4OCFA 5B6MA 3A2XA 4K7OA 1CQGA 2FHEA 1VF3A 1NSWA 4V1Ap 1F2EA 5BMUA 3GV1A 2YWOA 4X1UA 4MZBA 4OMVA 1ERWA 2RIIA 1QGVA 4IJIA 4WBRD 3R2QA 4KX4A 2MMZA 4NHZA 2DIYA 3PINA 1PGTA 1GSSA 4J56E 3P90A 2PPTA 3TJKA 1B48A 2WDUA 3PH9A 4ZB6A 3QCPA 1K3LA 1G7EA 4NV5A 1MEKA 4IHUA 1PL1A 5DBQA 2A2RA 2DLXA 5KN2A 2JACA 3GA4A 3FEUA 1USBA 1GSEA 1PN9A 2AJQB 3HD5A 3CRUA 4CY8A 1I5GA 1Z5YE 1FVKA 3CYNA 4K0GA 2HNLA 2X8CA 6GSWA 1K0DA 2VM2A 3A5WA 4HSCX 4HU7A 2YN1A 2Z9SA 4HZ2A 4ZB9A 1TRVA 1OC8A 3DIEA 3C73A 5KOWA 1A24A 4POLA 4EUYA 4I8BA 5HR2A 3CSIA 1O8XA 2RUFA 4WR4A 1ZOFA 1LU4A 1M2DA 1O8WA 2NPBA 3ME7A 5G1KA 1A8YA 1V57A 4ML1A 4N11A 1K0OA 1MDJA 4TN8A 2L5OA 2X8HA 2WRTA 4WXTA 4K2XA 2GQLA 4EC0A 5D9WA 3O6TA 3VPTA 4OO4A 5H5QA 1QQ2A 1U6TA 17GSA 4IVFA 2YOIA 3UMAA 1EEMA 2FWEA 1UN2A 4H86A 4GWRA 1G7OA 2R0GA 5DALB 1DUGA 1XCCA 3APSA 2NDOA 3LYPA 2MMNA 4F0CA 1V9WA 2DJJA 1GSFA 2HE3A 5E4WA 5G30A 1TRWA 3KIJA 2FLSA 4HUAA 1TJDA 3F4SA 1WP0A 5C00A 2CZ2A 4HEA2 1TW9A 2N5FA 5ECIB 4O5RA 5HFIA 1O7UA 2FA8A 2PVOC 2YCDA 4XS6A 3EE2A 4HQZA 2QGVA 1E2YA 3ZVJD 5D9VA 5B8BA 3E0UA 2H0GA 3HVNA 1ZL9A 4L0WA 1YKAA 3BOAA 2HYXA 2AUVA 3GL5A 4JBBA 2GSSA 2HRNA 4FYUA 1ERUA 5KN3A 4HDEA 4XS1A 1XWBA 4ML6A 1FB6A 1ML6A 3FZ4A 2LTKA 13GSA 1VRSD 5A5KA 3UIWA 1A8LA 7GSSA 3EU4A 4GTUA 1TU8A 1WPIA 5ABRA 1EWXA 1OVNA 1BX9A 3ZFLA 1Z7RA 2VUPA 4K7NA 1EV4A 4A5PA 5ECMB 3ZMLA 2M80A 2IMDA 4BWSA 3J7Yk 2B1LA 4MABA 2E0QA 5AN1A 2CA8A 2HLSA 3LGCA 3GKKA 4WF4A 5F8BA 2RUEA 3C71A 1PD21 2D2ZA 4BVXB 1JZRA 1E6BA 3EVIA 5FWGA 1SL1B 2IMFA 5KEJA 2IMIA 2FGXA 4PQ1A 6GSTA 3A2VA 3FY7A 4XRDA 1WIKA 3P8WA 3D0ZA 4MJCA 1IYHA 2YPMA 4FO5A 2LNTA 1M0UA 3F8UA 4TVEA 1YEXA 1SYXA 3F4RA 3GRXA 3C8EA 5IPHA 3IK9A 3QFBC 5LNKe 4TR1A 5DALA 4BL7B 1PL2A 3MDKA 1MDIA 2IFQA 2R0PA 1FB0A 3ERWA 3IC8A 2IJYA 2WS2A 4EF0A 1A2JA 3GIXA 2HI7A 3GTUA 3W6GA 1ABAA 3ZFBA 2HRAA 3GUSA 2IWTA 2YANA 1THOA 3W8SA 1OE8A 1M99A 1YY7A 1QFNA 4ZXGA 4IQAA 3H8QA 1XFLA 3VI7A 3UAPA 4MF6A 3ERFA 2GGTA 4ACSA 3HZ4A 3VWWA 3UARA 3GX8A 2C8UA 4MCUA 3UJ1A 1TI3A 3US3A 3HY2A 4Z2TA 4Q5QA 3ME8A 1W4VA 3LXTA 1C72A 1WE0A 5ECKB 2XBIA 1B8XA 4BA7A 5A4WA 3IDVA 1HYUA 5DCGA 1JFUA 1T4ZA 3FZ9A 5JCWA 3FR3A 4RQRA 2YV9A 9GSSA 4HOJA 4WR5A 3TKPA 1HNAA 1WOUA 1VF4A 1R5AA 2LRCA 1GTIA 1K3OA 1KEBA 4ECIA 3BCIA 3EMXA 2JL4A 4ISDA 2GDRA 1YEPA 3G9BA 4PNFA 2NBSA 3TRPA 3UBKA 2CAQA 5CP1A 3EINA 4V2LA 3I69A 4IN0A 1J08A 1FAAA 2XPDA 5J5NA 1VF1A 1M9BA 3TGZA 2MBTA 3GKMA 2VLUA 4L8EA 2GZZA 3ZYWA 2NVLA 5DAKA 1U88A 2F3MA 1RW1A 5IO2A 5LD0A 3D4MA 5KN0A 3IV4A 4BL7A 3KH7A 2H6XA 3LORA 4K5RA 1ZCPA 5B6NA 3IR4A 4YQUA 5FT3A 3QFAC 4PNGA 1DE2A 1JLWA 1UA5A 2B7KA 2B5XA 2FUG2 1X9SB 3Q18A 4HZ4A 2QA1A 3N5OA 2X8GA 1SD8A 1B9YC 2GZYA 5ID2A 1ZZYA 4I5QA 4CHSA 1TTZA 2FWHA 1OYJA 1V98A 4N30A 5ELAA 5GSSA 2JSZA 1XBSA 3L9SA 3FZAA 4FQUA 3GSSA 2H1DA 3BJ5A 4L0UA 5J3RA 5H5SA 3KJYA 3WGXA 1SL2B 5DCHA 1OAZA 1JHBA 1ERTA 4ZBAA 3K8NA 1N2AA 4K9ZA 5IMAA 1B9XC 4MP4A 1T3BA 3ISOA 1GTBA 2HXKA 4JR6A 2YP6A 4EKZA 4YAPA 2B6MA 2YZHA 2JZTA 2VCZA 4AJ7A 3ED3A 3MNGA 3O3TA 2KOKA 2B5YA 5G2ZA 1HQOA 2HSHA 5H5RA 2L6CA 1ST9A 4J57E 3VWXA 3QPMA 5LCZA 1PKZA 3EPTA 1TDIA 4MJAA 5ENUA 3APQA 2WFCA 1X0RA 2FD3A 4PXOA 3GMFA 5C04A 4EIPA 1GSUA 4DSRA 1URMA 4WF5A 20GSA 1RQMA 2H75A 2R3XA 3PR8A 4DSQA 5A4VA 2PN8A 4WBJA 2V6OA 3LQ7A 1A23A 5JWOB 3D5JA 4IP1A 2AHEA 3Q6OA 4GF0A 3MIXA 1GNEA 1AQVA 2ES7A 2X64A 5GAND 1XWGA 3F6DA 1YJ6A 1PRXA 1F3AA 2J23A 2FWGA 3JCML 1SK1A 5CRDA 3GURA 1O85A 4AJ8A 5DDLA 3KMOA 1R7HA 2R37A 2LRTA 4G10A 5CO3A 1OKDA 1EZKA 3TKQA 1QXHA 2R2JA 2I4AA 4OO5A 2PUKC 2L57A 3GX0A 3TJFA 2OADA 3ZTLA 3CSHA 2YWMA 5IMFA 4F0BA 4BPYA 2C3NA 1X9MB 2PBJA 1CQHA 5IM9A 3MWHA 4G2EA 2DKHA 2BTOT 1XPVA 2DMMA 1O6JA 2FY6A 4TRXA 4P3YB 3M0FA 3RDWA 3TDGA 2O7KA 5DQYA 3QAGA 3PPUA 3FMWA 2N5BA 4K5SA 3TB2A 2IL3A 1GUMA 4L5OA 2VCTA 4TKYA 5A4UA 2HFDA 2RLIA 4AGSA 6GSXA 3GFKA 3VPQA 3MYDA 2QA2A 4K1FA 3RPPA 5JCUA 3QMXA 2R5GA 2ALBA 4V2MA 4ID0A 4HJMA 3FW2A 2I81A 3WD6A 3ZRDA 1XG8A 3KGKA 2O87A 4GSNA 1QUWA 1JLVA
chains in the Genus database with same CATH topology
1OC9B 1N8JA 3DD3A 1DSBA 5HFGA 2YV7A 4MJEA 1NHYA 2WZ9A 3CTFA 1VF2A 3VURA 4LL4B 3QD9A 1R26A 4MLYA 3D21A 4ILFA 1ON4A 1U87A 4FIWA 2C0EA 2PWJA 1DBYA 1B4QA 4IP6A 3ZZXA 5GSTA 3IPZA 1OKTA 4G0IA 2H71A 1FOHA 2WJUA 2P5QA 3KP8A 4KB3A 4POBA 1JZWA 5B7CA 2OE3A 1XZOA 2L5LA 3FRCA 3DKSA 1Q98A 3ZVJA 5BRTA 4X43A 1XVWA 4MPFA 4O5UA 1WJKA 1FOVA 1NM3A 2OE1A 1K3YA 3S9FA 1PQNA 4PUFC 1R4WA 2KLXA 4DVCA 5D93A 4XIHA 5D73A 2PVQA 2FNOA 4CW9A 3TOTA 4XCSA 1ZMAA 4MK3A 5F06A 4LLRA 3DEXA 2MZCA 2KHPA 4MF5A 3LXZA 1JZDA 4KAEA 2LJKA 2C4JA 1Z6NA 5IMVA 2WCIA 1TRUA 1WWJA 3TKSE 2VIMA 3DGQA 1TI1A 3TUEA 3ZREA 3FR6A 3GHAA 3NIVA 3IHGA 3RHCA 5HFKA 1BG5A 3U6VA 1AC1A 2CVBA 5D9XA 2DKIA 1M9AA 2GSQA 3IBHA 5COHA 1G6WA 2F8AA 4KH7A 3KZQA 3HJMA 1GLPA 1ILOA 4O5QA 2H74A 2ZNMA 1XW9A 2H6YA 3I43A 4QL7A 2OKAA 1YZXA 3LWAA 1PN0A 2R0CA 2H0IA 3VK9A 4E8EA 1PKWA 3L0HA 2DMLA 3NOFA 5ECHB 2A4HA 3VLNA 3TRQA 1TOFA 18GSA 4K8MA 2I1UA 2CT6A 4MMMA 2M72A 3KTBA 2HRFA 4I97A 4EDZA 1AW9A 2HZFA 1B4PA 4I2UA 1S3CA 3EYTA 1GP1A 5ECOB 2H30A 2L4CA 1YDKA 4O32A 2VO4A 2V32A 5AISA 1ACVA 3NZNA 3RBTA 3TRXA 4X4JA 1Z6MA 2EIRA 2O89A 1PX6A 4MJBA 1Y25A 1GTAA 4PQHA 3WT1A 4JE1A 2CV4A 3EURA 2MMOA 5IIZA 2V1MA 1ZGNA 3H93A 3KD0A 1XW5A 4YQVA 2LQQA 4Z2RA 4O92A 3CRTA 1EOHA 1HD2A 5DJLA 1ZYPA 4EL1A 3KMNA 4JZQA 3DWVA 4LMVA 1GLQA 1EP8A 1K0NA 1Y6EA 4TXOB 2JZSA 1VGLA 4K2DA 3GSTA 5FHIA 1HNBA 1Z9HA 1UC7A 2KP1A 5E59A 4GSSA 3KTLA 3HKRA 3FR9A 4I2TA 2VL3A 4LA1A 1AQXA 1MD3A 1SKWB 1YQ1A 2ZCTA 16GSA 10GSA 4ZL7A 3HHVA 2O85A 2FA4A 2GZPA 3G7IA 5HQPA 5AGYA 3QR6A 4WEYA 1TU7A 1SKSB 1T8EB 3PGTA 2M46A 2TRXA 2OBKA 2ON5A 2YWNA 2CZ3A 2H1GA 2H6ZA 4MZWA 3OR5A 2H70A 1XWAA 2QSIA 2YZUA 4WETA 2H01A 3H1NA 1KTEA 1GSDA 3LW9A 1XXUA 4BVXA 1A2LA 2WULA 2L6DA 2TIRA 2GQMA 2HT9A 2V2GA 3C1SA 2J9HA 4OFMA 4ECBA 4RQXA 2VCVA 1UVZA 3VFIA 2LV3A 4YAVA 1FHEA 2GT6A 5ECLB 4FYBA 1T7PB 5J4UA 4G0LA 4MA9A 4Z7XA 1T4YA 2HSMA 1I9DA 4OCEA 2LS5A 4XTSA 3U5RE 2RM6A 1Q4JA 1WRYA 3W8JA 4K6XA 5ECNB 2DC5A 3FYGA 2OA7A 2RM5A 3RAZA 3ZIJA 5KOXA 5EVOA 3KP9A 5D9TA 2C0DA 4TR4A 3UBLA 2C0FA 4OWYA 5DVBA 4POKA 2VCXA 2CAIA 4KW6A 2K18A 2H1AA 1GSYA 3IXRA 1H75A 1J0FA 3KH9A 5DJMA 3QAVA 4L5LA 4CDOA 1F37A 3LFLA 3BCKA 1HNCA 4KDUA 1IYIA 2VD0A 2V41A 4TR3A 4JR4A 1A0RP 4TXOA 4JEDA 4MH3A 4TR0A 4G19A 2A2PA 1OE7A 1XOBA 2UZ8A 4EVMA 4PUAA 4OFTA 4PTSA 2VD1A 2JZRA 4IW9A 1M2BA 4EIQA 4ZL9A 3J7Yb 1ZYEA 3WGEA 1TXXA 4YQMA 3M8NA 4N10A 5IMCA 3KEBA 2XHFA 3EWLA 4OFNA 3HVVA 3DXBA 5HR1A 1X5CA 5DQSA 1YF0A 4NHWA 3M3MA 4EE0A 4ULXA 1TK8B 3F3RA 2H1BA 3KXOA 1GULA 1AQWA 2XC2A 3DVWA 4O7HA 3L9VA 3HZ8A 3G7JA 3GH9A 1XOAA 1Z7PA 3KCMA 2REMA 4GQFA 1PMTA 1O73A 3GNJA 3FKFA 2PGTA 2YNXA 4YH2A 4I6XA 2AB6A 2H76A 3L78A 2HZEB 1OC3A 5ELGA 3UVHA 2DJ2A 1V2AA 2P31A 2FWFA 4OD7A 4TW5A 5B8AA 4V2NA 5J41A 4BVYB 5ECRB 1F6MC 5IQYA 2B3SA 3IAS2 4HU9A 2O8VB 1GNWA 5G31A 4EDYA 3TJBA 5D96A 2A4VA 4KSOA 5IMZA 1GRXA 2K9FA 4NWYA 3GYKA 1YF1A 2CVDA 2DJ1A 4K7IA 2OE0A 1O81A 1BEDA 1K0CA 3HVXA 2VOCA 4KDXA 2L59A 3ZLPA 3RHBA 1BQ7A 2X49A 5G5EA 3HJPA 3APOA 3VWUA 3UOMA 3FHKA 2CVKA 4GQCA 5CYYA 3F3QA 2HRKA 2E2MA 1SKRB 1GTUA 3Q74A 5J9BA 3BD2A 1ZYQB 2HSYA 1FVJA 2CX4A 2L4QA 2H73A 3CBUA 4PGTA 3F4TA 2LRNA 5ECPB 3HVSA 2F8FA 3M1GA 5D8IA 3VI5A 2G2QA 1ZYNA 2LJAA 4HQSA 4HJ2A 2LJRA 1THXA 4Q5NA 2EIQA 1XW6A 4LL1B 1BJXA 2C3TA 2C0GA 2LEGA 3AY8A 3A3TA 5F07A 5IOWA 3G7YA 1SYRA 2H8LA 6GSUA 3C1RA 1U3IA 4POMA 3KM6A 4MZCA 4KNDA 2VL2C 2GSRA 2IMEA 2LNSA 4Q5RA 5CREA 2DJ0A 3BBYA 1EP7A 5EL8A 2B7JA 4KA0A 2VCWA 4RI7A 3EC3A 3WYWA 1YKCA 1MTCA 5EY6A 1EOGA 2QC7A 4XRAA 2F9SA 4TR1B 1K0BA 2HZEA 2IFQB 2MBSA 4GCIA 4AF2A 4Q5FA 2AAWA 1SJIA 4F9ZA 1GH2A 2FCHA 3LYKA 4BVYA 1TKDB 2WB9A 3HA9A 4TXVA 2XBQA 3GTUB 4MPGA 1X5EA 2VM1A 1MD4A 3F9UA 1XWCA 1GUKA 4DEJA 4ZIJA 2PMTA 3M9KA 3IHQA 2GS3A 3TKRA 1SJZA 4KCEA 14GSA 3TCOA 2X99A 2GTUA 1F9MA 2GVPA 4IS0A 1NW2A 2PERA 3HDCA 2C3QA 1X9WB 5IO0A 5HR3A 5GZZB 3WT2A 4ZILA 2X4AA 4J2FA 3GKXA 4HI7A 3QAWA 2GSTA 4MH2A 2XPEA 4LMWA 3E3EA 3CMIA 4ZB8A 3V1WA 2QKEA 3L4NA 4IQ1A 2VL2A 4F2IA 3LJRA 1SJ6A 2I9HA 2P0GA 3M9JA 3F0IA 1SL0B 4ECCA 3DVXA 3SBCA 4JRRA 3QOUA 4XS4B 2R4VA 3ZIVA 3GKNA 5CRHA 4EXJA 3EMPA 1H4OA 2DJKA 5AIVA 2DJ3A 1JZOA 5CRWA 1OC9A 2EC4A 5JWQB 3RPNA 4KF9A 4KE3A 2VLTA 4G0KA 2G0FA 2H72A 12GSA 3IRAA 2BMXA 4KUNA 4KGIA 1BYEA 1SU9A 3HXSA 1GSQA 1FW1A 2YWIA 3IE3A 2DSAA 1M2AA 1KBNA 2K8SA 3ZL5A 1AAZA 4KDYA 4NAXA 1LJRA 2N5AA 3TKSC 1Z3EA 3D6IA 2MYGA 3GH6A 3MAKA 4MF7A 5DAKB 1X5DA 3LEFA 4V1Ag 1GL8A 5G5FA 3L9UA 11GSA 1TRSA 1TK5B 3F63A 5INYA 3E9JB 1PA3A 2K6VA 3I6AA 1R5PA 2JADA 4N0ZA 3GL3A 3EU3A 4D73B 2R6KA 3HYPA 4HS1A 1EGOA 1AUCA 1GUHA 4N0VA 3UL3A 4IELA 1XVQA 1A0FA 2P5RA 1W89A 5ID2B 1SK0A 4ICYA 2MMAA 1K0AA 4USSA 5J9CA 2GQKA 3Q19A 1EGRA 2BJXA 4X0XA 1G6YA 1QMVA 3TOUA 5JWRB 4ZBDA 4PURA 1M7TA 1FG4A 6GSVA 5CNWA 2PU9C 2IN3A 2B5EA 2ON7A 3CSJA 5EPFA 3IOSA 1GWCA 4GXZA 3TKSA 1FO5A 4IBPA 3A5IA 2VCQA 3UEMA 3SWLA 4IJ3A 4KSMA 3H79A 4ZBBA 4XS4A 8GSSA 2CX3A 2F51A 2LQOA 4NV2A 4GLTA 3FK8A 1AXDA 4MNNA 2GLRA 4NXIA 3LG6A 1TK0B 2ZUPA 1T00A 3HJOA 3P2AA 2H0HA 2VL9A 2IIYA 5IPGA 4PQIA 3ZMKA 2YJHA 3D4TA 3DRNA 1S3DA 4G9HA 4Z2UA 4GSTA 4MDCA 3TJJA 3C7MA 2YJ7A 3D22A 2KP2A 5GAPD 1LBKA 3DYRA 4NPBA 3QDNA 1SD9A 2A2SA 6GSSA 2OJLA 5HR0A 1A2MA 3A2WA 4YKFA 1KNGA 4FH8A 5JCGA 4BWQA 1S3AA 4DSSB 1MDKA 2NTOA 2VLVA 2TRCP 4RUVA 2OACA 3O76A 6GSYA 2GT5A 4QL9A 1AIUA 2E2GA 3IAM2 1U3AA 3I9V2 4K0NA 2V6KA 4ECJA 5IOXA 2LUSA 4D73A 4JU5A 3WGDA 5CRGA 1XWKA 3TJGA 4FYCA 3N9JA 3ERGA 4F82A 2AV4A 4EO3A 1G0TA 2I3YA 1NHOA 3MSZA 1T1VA 4ZL8A 4PX1A 4TOPA 4WKWA 5CAXA 5G1LA 3GN3A 1TP9A 2H19A 1PX7A 4XHMA 2LKUA 1SENA 1EEJA 1DE1A 22GSA 4NMUA 3H4KA 2K8VA 2H66A 3LSZA 3HCZA 2JU5A 4RI6A 1ERVA 3ZITA 1WMJA 3UVTA 1K0MA 4F03A 1EV9A 3VWVA 2JSYA 5KN1A 3CXGA 4AJ6A 1V58A 1V40A 2CQ9A 2DBCA 2IPAA 2B1KA 1SK2A 1QK8A 5AIXA 2OBIA 2C1YA 3CTGA 3FZ5A 4GRFA 5F05A 1RK4A 5ECQB 3F6FA 2KUCA 2AYTA 5ECSA 3P7XA 5IMDA 1BAYA 1F3BA 2C80A 19GSA 2WGRA 3R3EA 1XIYA 3DMLA 1PSQA 4KCAA 2LSTA 4CY6A 3IK7A 2E7PA 4YKGA 2VAFA 4IGJA 4QQ7A 5L71A 2IMKA 3IA1A 4E8HA 4DSSA 5F0GA 1J9BA 2EIOA 4IKHA 2DIZA 3IC4A 4OCFA 5B6MA 3A2XA 4K7OA 1CQGA 2FHEA 1VF3A 1NSWA 4V1Ap 1F2EA 5BMUA 3GV1A 2YWOA 4X1UA 4MZBA 4OMVA 1ERWA 2RIIA 1QGVA 4IJIA 4WBRD 3R2QA 4KX4A 2MMZA 4NHZA 2DIYA 3PINA 1PGTA 1GSSA 4J56E 3P90A 2PPTA 3TJKA 1B48A 2WDUA 3PH9A 4ZB6A 3QCPA 1K3LA 1G7EA 4NV5A 1MEKA 4IHUA 1PL1A 5DBQA 2A2RA 2DLXA 5KN2A 2JACA 3GA4A 3FEUA 1USBA 1GSEA 1PN9A 2AJQB 3HD5A 3CRUA 4CY8A 1I5GA 1Z5YE 1FVKA 3CYNA 4K0GA 2HNLA 2X8CA 6GSWA 1K0DA 2VM2A 3A5WA 4HU7A 2YN1A 2Z9SA 4HZ2A 4ZB9A 1TRVA 1OC8A 3DIEA 3C73A 5KOWA 1A24A 4POLA 4EUYA 4I8BA 5HR2A 3CSIA 1O8XA 2RUFA 4WR4A 1ZOFA 1LU4A 1M2DA 1O8WA 2NPBA 3ME7A 5G1KA 1A8YA 1V57A 4ML1A 4N11A 1K0OA 1MDJA 4TN8A 2L5OA 2X8HA 2WRTA 4WXTA 4K2XA 2GQLA 4EC0A 5D9WA 3O6TA 3VPTA 4OO4A 5H5QA 1QQ2A 1U6TA 17GSA 4IVFA 2YOIA 3UMAA 1EEMA 2FWEA 1UN2A 4H86A 4GWRA 1G7OA 2R0GA 5DALB 1DUGA 1XCCA 3APSA 2NDOA 3LYPA 2MMNA 4F0CA 1V9WA 2DJJA 1GSFA 2HE3A 5E4WA 5G30A 1TRWA 3KIJA 2FLSA 4HUAA 1TJDA 3F4SA 1WP0A 5C00A 2CZ2A 4HEA2 1TW9A 2N5FA 5ECIB 4O5RA 5HFIA 1O7UA 2FA8A 2PVOC 2YCDA 4XS6A 3EE2A 4HQZA 2QGVA 1E2YA 3ZVJD 5D9VA 5B8BA 3E0UA 2H0GA 4L0WA 1ZL9A 1YKAA 3BOAA 2HYXA 2AUVA 3GL5A 4JBBA 2GSSA 2HRNA 4FYUA 1ERUA 5KN3A 4HDEA 4XS1A 1XWBA 4ML6A 1FB6A 1ML6A 3FZ4A 2LTKA 13GSA 1VRSD 5A5KA 3UIWA 1A8LA 7GSSA 3EU4A 4GTUA 1TU8A 1WPIA 5ABRA 1EWXA 1OVNA 1BX9A 3ZFLA 1Z7RA 2VUPA 4K7NA 1EV4A 4A5PA 5ECMB 3ZMLA 2M80A 2IMDA 4BWSA 3J7Yk 2B1LA 4MABA 2E0QA 5AN1A 2CA8A 2HLSA 3LGCA 3GKKA 4WF4A 5F8BA 2RUEA 3C71A 1PD21 2D2ZA 4BVXB 1JZRA 1E6BA 3EVIA 5FWGA 1SL1B 2IMFA 5KEJA 2IMIA 2FGXA 4PQ1A 6GSTA 3A2VA 3FY7A 4XRDA 1WIKA 3P8WA 3D0ZA 4MJCA 1IYHA 2YPMA 4FO5A 2LNTA 1M0UA 3F8UA 4TVEA 1YEXA 1SYXA 3F4RA 3GRXA 3C8EA 5IPHA 3IK9A 3QFBC 5LNKe 4TR1A 5DALA 4BL7B 1PL2A 3MDKA 1MDIA 2IFQA 2R0PA 1FB0A 3ERWA 3IC8A 2IJYA 2WS2A 4EF0A 1A2JA 3GIXA 2HI7A 3GTUA 3W6GA 1ABAA 3ZFBA 2HRAA 3GUSA 2IWTA 2YANA 1THOA 3W8SA 1OE8A 1M99A 1YY7A 1QFNA 4ZXGA 4IQAA 3H8QA 1XFLA 3VI7A 3UAPA 4MF6A 3ERFA 2GGTA 4ACSA 3HZ4A 3VWWA 3UARA 3GX8A 2C8UA 4MCUA 3UJ1A 1TI3A 3US3A 3HY2A 4Z2TA 4Q5QA 3ME8A 1W4VA 3LXTA 1C72A 1WE0A 5ECKB 2XBIA 1B8XA 4BA7A 5A4WA 3IDVA 1HYUA 5DCGA 1JFUA 1T4ZA 3FZ9A 5JCWA 3FR3A 4RQRA 2YV9A 9GSSA 4HOJA 4WR5A 3TKPA 1HNAA 1WOUA 1VF4A 1R5AA 2LRCA 1GTIA 1K3OA 1KEBA 4ECIA 3BCIA 3EMXA 2JL4A 4ISDA 2GDRA 1YEPA 3G9BA 4PNFA 2NBSA 3TRPA 3UBKA 2CAQA 5CP1A 3EINA 4V2LA 3I69A 4IN0A 1J08A 1FAAA 2XPDA 5J5NA 1VF1A 1M9BA 3TGZA 2MBTA 3GKMA 2VLUA 4L8EA 2GZZA 3ZYWA 2NVLA 5DAKA 1U88A 2F3MA 1RW1A 5IO2A 5LD0A 3D4MA 5KN0A 3IV4A 4BL7A 3KH7A 2H6XA 3LORA 4K5RA 1ZCPA 5B6NA 3IR4A 4YQUA 5FT3A 3QFAC 4PNGA 1DE2A 1JLWA 1UA5A 2B7KA 2B5XA 2FUG2 1X9SB 3Q18A 4HZ4A 2QA1A 3N5OA 2X8GA 1SD8A 1B9YC 2GZYA 5ID2A 1ZZYA 4I5QA 4CHSA 1TTZA 2FWHA 1OYJA 1V98A 4N30A 5ELAA 5GSSA 2JSZA 1XBSA 3L9SA 3FZAA 4FQUA 3GSSA 2H1DA 3BJ5A 4L0UA 5J3RA 5H5SA 3KJYA 3WGXA 1SL2B 5DCHA 1OAZA 1JHBA 1ERTA 4ZBAA 3K8NA 1N2AA 4K9ZA 5IMAA 1B9XC 4MP4A 1T3BA 3ISOA 1GTBA 2HXKA 4JR6A 2YP6A 4EKZA 4YAPA 2B6MA 2YZHA 2JZTA 2VCZA 4AJ7A 3ED3A 3MNGA 3O3TA 2KOKA 2B5YA 5G2ZA 1HQOA 2HSHA 5H5RA 2L6CA 1ST9A 4J57E 3VWXA 3QPMA 5LCZA 1PKZA 3EPTA 1TDIA 4MJAA 5ENUA 3APQA 2WFCA 1X0RA 2FD3A 4PXOA 3GMFA 5C04A 4EIPA 1GSUA 4DSRA 1URMA 4WF5A 20GSA 1RQMA 2H75A 2R3XA 3PR8A 4DSQA 5A4VA 2PN8A 4WBJA 2V6OA 3LQ7A 1A23A 5JWOB 3D5JA 4IP1A 2AHEA 3Q6OA 4GF0A 3MIXA 1GNEA 1AQVA 2ES7A 2X64A 5GAND 1XWGA 3F6DA 1YJ6A 1PRXA 1F3AA 2J23A 2FWGA 3JCML 1SK1A 5CRDA 3GURA 1O85A 4AJ8A 5DDLA 3KMOA 1R7HA 2R37A 2LRTA 4G10A 5CO3A 1OKDA 1EZKA 3TKQA 1QXHA 2R2JA 2I4AA 4OO5A 2PUKC 2L57A 3GX0A 3TJFA 2OADA 3ZTLA 3CSHA 2YWMA 5IMFA 4F0BA 4BPYA 2C3NA 1X9MB 2PBJA 1CQHA 5IM9A 3MWHA 4G2EA 2DKHA 2BTOT 1XPVA 2DMMA 1O6JA 2FY6A 4TRXA 4P3YB 3M0FA 3RDWA 3TDGA 2O7KA 5DQYA 3QAGA 3PPUA 3FMWA 2N5BA 4K5SA 3TB2A 2IL3A 1GUMA 4L5OA 2VCTA 4TKYA 5A4UA 2HFDA 2RLIA 4AGSA 6GSXA 3GFKA 3VPQA 3MYDA 2QA2A 4K1FA 3RPPA 5JCUA 3QMXA 2R5GA 2ALBA 4V2MA 4ID0A 4HJMA 3FW2A 2I81A 3WD6A 3ZRDA 3KGKA 2O87A 4GSNA 1QUWA 1JLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OC9 B;  1N8J A;  3DD3 A;  1DSB A;  5HFG A;  2YV7 A;  4MJE A;  1NHY A;  2WZ9 A;  3CTF A;  1VF2 A;  3VUR A;  4LL4 B;  3QD9 A;  1R26 A;  4MLY A;  3D21 A;  4ILF A;  1ON4 A;  1U87 A;  4FIW A;  2C0E A;  2PWJ A;  1DBY A;  1B4Q A;  4IP6 A;  3ZZX A;  5GST A;  3IPZ A;  1OKT A;  2H71 A;  2WJU A;  2P5Q A;  3KP8 A;  4KB3 A;  4POB A;  1JZW A;  5B7C A;  2OE3 A;  1XZO A;  2L5L A;  3FRC A;  3DKS A;  1Q98 A;  3ZVJ A;  4X43 A;  1XVW A;  4MPF A;  1FOV A;  1WJK A;  1NM3 A;  2OE1 A;  1K3Y A;  3S9F A;  1PQN A;  4PUF C;  1R4W A;  2KLX A;  4DVC A;  5D93 A;  4XIH A;  5D73 A;  2PVQ A;  2FNO A;  4CW9 A;  3TOT A;  4XCS A;  1ZMA A;  4MK3 A;  5F06 A;  4LLR A;  3DEX A;  2MZC A;  2KHP A;  4MF5 A;  3LXZ A;  1JZD A;  4KAE A;  2LJK A;  2C4J A;  1Z6N A;  5IMV A;  2WCI A;  1TRU A;  1WWJ A;  3TKS E;  2VIM A;  3DGQ A;  1TI1 A;  3TUE A;  3ZRE A;  3FR6 A;  3GHA A;  3NIV A;  3RHC A;  5HFK A;  1BG5 A;  3U6V A;  1AC1 A;  2CVB A;  5D9X A;  1M9A A;  2GSQ A;  3IBH A;  5COH A;  1G6W A;  2F8A A;  4KH7 A;  3KZQ A;  3HJM A;  1GLP A;  1ILO A;  2H74 A;  2ZNM A;  1XW9 A;  2H6Y A;  3I43 A;  4QL7 A;  2OKA A;  1YZX A;  3LWA A;  2H0I A;  3VK9 A;  4E8E A;  1PKW A;  3L0H A;  2DML A;  3NOF A;  5ECH B;  3VLN A;  3TRQ A;  1TOF A;  18GS A;  4K8M A;  2I1U A;  2CT6 A;  4MMM A;  2M72 A;  3KTB A;  2HRF A;  4I97 A;  4EDZ A;  1AW9 A;  2HZF A;  1B4P A;  4I2U A;  1S3C A;  3EYT A;  1GP1 A;  5ECO B;  2H30 A;  2L4C A;  1YDK A;  4O32 A;  2VO4 A;  2V32 A;  5AIS A;  1ACV A;  3NZN A;  3RBT A;  3TRX A;  1Z6M A;  2EIR A;  2O89 A;  1PX6 A;  4MJB A;  1Y25 A;  1GTA A;  4PQH A;  3WT1 A;  4JE1 A;  2CV4 A;  3EUR A;  2MMO A;  5IIZ A;  2V1M A;  1ZGN A;  3H93 A;  3KD0 A;  1XW5 A;  4YQV A;  2LQQ A;  4O92 A;  3CRT A;  1EOH A;  1HD2 A;  5DJL A;  4EL1 A;  3KMN A;  4JZQ A;  3DWV A;  4LMV A;  1GLQ A;  1EP8 A;  1K0N A;  1Y6E A;  4TXO B;  2JZS A;  1VGL A;  4K2D A;  3GST A;  5FHI A;  1HNB A;  1Z9H A;  1UC7 A;  2KP1 A;  5E59 A;  4GSS A;  3KTL A;  3HKR A;  3FR9 A;  4I2T A;  2VL3 A;  4LA1 A;  1AQX A;  1MD3 A;  1SKW B;  1YQ1 A;  2ZCT A;  16GS A;  10GS A;  4ZL7 A;  3HHV A;  2O85 A;  2FA4 A;  2GZP A;  3G7I A;  5HQP A;  5AGY A;  3QR6 A;  4WEY A;  1TU7 A;  1SKS B;  1T8E B;  3PGT A;  2M46 A;  2TRX A;  2OBK A;  2ON5 A;  2YWN A;  2CZ3 A;  2H1G A;  2H6Z A;  4MZW A;  3OR5 A;  2H70 A;  1XWA A;  2QSI A;  2YZU A;  4WET A;  2H01 A;  3H1N A;  1KTE A;  1GSD A;  1XXU A;  4BVX A;  1A2L A;  2WUL A;  2L6D A;  2TIR A;  2GQM A;  2HT9 A;  2V2G A;  3C1S A;  2J9H A;  4OFM A;  4ECB A;  4RQX A;  2VCV A;  1UVZ A;  3VFI A;  2LV3 A;  4YAV A;  1FHE A;  2GT6 A;  5ECL B;  4FYB A;  1T7P B;  5J4U A;  4MA9 A;  4Z7X A;  1T4Y A;  1I9D A;  4OCE A;  2LS5 A;  4XTS A;  3U5R E;  2RM6 A;  1Q4J A;  1WRY A;  3W8J A;  4K6X A;  5ECN B;  2DC5 A;  3FYG A;  2OA7 A;  2RM5 A;  3RAZ A;  3ZIJ A;  5EVO A;  3KP9 A;  5D9T A;  2C0D A;  4TR4 A;  3UBL A;  2C0F A;  4OWY A;  5DVB A;  4POK A;  2VCX A;  2CAI A;  4KW6 A;  2K18 A;  2H1A A;  1GSY A;  3IXR A;  1H75 A;  1J0F A;  3KH9 A;  5DJM A;  3QAV A;  4L5L A;  4CDO A;  1F37 A;  3LFL A;  3BCK A;  1HNC A;  4KDU A;  1IYI A;  2VD0 A;  2V41 A;  4TR3 A;  4JR4 A;  1A0R P;  4TXO A;  4JED A;  4MH3 A;  4TR0 A;  4G19 A;  1OE7 A;  1XOB A;  4EVM A;  4PUA A;  4OFT A;  2VD1 A;  2JZR A;  4IW9 A;  1M2B A;  4ZL9 A;  3J7Y b;  1ZYE A;  3WGE A;  1TXX A;  4YQM A;  3M8N A;  4N10 A;  5IMC A;  3KEB A;  2XHF A;  3EWL A;  4OFN A;  3HVV A;  3DXB A;  5HR1 A;  1X5C A;  5DQS A;  1YF0 A;  4NHW A;  3M3M A;  4EE0 A;  4ULX A;  1TK8 B;  3F3R A;  2H1B A;  3KXO A;  1GUL A;  1AQW A;  2XC2 A;  3DVW A;  4O7H A;  3L9V A;  3HZ8 A;  3G7J A;  3GH9 A;  1XOA A;  1Z7P A;  3KCM A;  2REM A;  4GQF A;  1PMT A;  1O73 A;  3GNJ A;  3FKF A;  2PGT A;  2YNX A;  4YH2 A;  4I6X A;  2AB6 A;  2H76 A;  3L78 A;  2HZE B;  1OC3 A;  5ELG A;  3UVH A;  2DJ2 A;  1V2A A;  2P31 A;  2FWF A;  4OD7 A;  4TW5 A;  5B8A A;  4V2N A;  5J41 A;  5ECR B;  1F6M C;  5IQY A;  2B3S A;  3IAS 2;  4HU9 A;  2O8V B;  1GNW A;  5G31 A;  4EDY A;  3TJB A;  5D96 A;  2A4V A;  4KSO A;  5IMZ A;  1GRX A;  2K9F A;  4NWY A;  3GYK A;  1YF1 A;  2CVD A;  2DJ1 A;  4K7I A;  2OE0 A;  1O81 A;  1BED A;  1K0C A;  3HVX A;  2VOC A;  4KDX A;  2L59 A;  3ZLP A;  3RHB A;  1BQ7 A;  5G5E A;  3HJP A;  3APO A;  3VWU A;  3UOM A;  3FHK A;  2CVK A;  4GQC A;  5CYY A;  3F3Q A;  2E2M A;  1SKR B;  1GTU A;  3Q74 A;  5J9B A;  3BD2 A;  1ZYQ B;  2HSY A;  1FVJ A;  2CX4 A;  2L4Q A;  2H73 A;  3CBU A;  4PGT A;  3F4T A;  2LRN A;  5ECP B;  3HVS A;  2F8F A;  3M1G A;  5D8I A;  3VI5 A;  2G2Q A;  2LJA A;  4HQS A;  4HJ2 A;  2LJR A;  1THX A;  4Q5N A;  2EIQ A;  1XW6 A;  4LL1 B;  1BJX A;  2C3T A;  2C0G A;  2LEG A;  3AY8 A;  3A3T A;  5F07 A;  5IOW A;  3G7Y A;  1SYR A;  2H8L A;  6GSU A;  3C1R A;  1U3I A;  4POM A;  3KM6 A;  4MZC A;  4KND A;  2VL2 C;  2GSR A;  2IME A;  2LNS A;  4Q5R A;  5CRE A;  2DJ0 A;  3BBY A;  1EP7 A;  5EL8 A;  2B7J A;  4KA0 A;  2VCW A;  4RI7 A;  3EC3 A;  3WYW A;  1YKC A;  1MTC A;  5EY6 A;  1EOG A;  2QC7 A;  4XRA A;  2F9S A;  4TR1 B;  1K0B A;  2HZE A;  2IFQ B;  2MBS A;  4GCI A;  4AF2 A;  4Q5F A;  2AAW A;  1SJI A;  4F9Z A;  1GH2 A;  2FCH A;  3LYK A;  4BVY A;  1TKD B;  2WB9 A;  3HA9 A;  4TXV A;  2XBQ A;  3GTU B;  4MPG A;  1X5E A;  2VM1 A;  1MD4 A;  3F9U A;  1XWC A;  1GUK A;  4DEJ A;  4ZIJ A;  2PMT A;  3M9K A;  3IHQ A;  2GS3 A;  3TKR A;  1SJZ A;  4KCE A;  14GS A;  3TCO A;  2X99 A;  2GTU A;  1F9M A;  2GVP A;  4IS0 A;  1NW2 A;  2PER A;  3HDC A;  2C3Q A;  1X9W B;  5IO0 A;  5HR3 A;  5GZZ B;  3WT2 A;  4ZIL A;  4J2F A;  3GKX A;  4HI7 A;  3QAW A;  2GST A;  4MH2 A;  2XPE A;  4LMW A;  3E3E A;  3CMI A;  4ZB8 A;  3V1W A;  2QKE A;  3L4N A;  4IQ1 A;  2VL2 A;  4F2I A;  3LJR A;  1SJ6 A;  2I9H A;  2P0G A;  3M9J A;  3F0I A;  1SL0 B;  4ECC A;  3DVX A;  3SBC A;  4JRR A;  3QOU A;  4XS4 B;  2R4V A;  3ZIV A;  3GKN A;  5CRH A;  4EXJ A;  3EMP A;  1H4O A;  2DJK A;  5AIV A;  2DJ3 A;  1JZO A;  5CRW A;  1OC9 A;  2EC4 A;  5JWQ B;  3RPN A;  4KE3 A;  2VLT A;  2G0F A;  2H72 A;  12GS A;  3IRA A;  2BMX A;  4KUN A;  4KGI A;  1BYE A;  1SU9 A;  3HXS A;  1GSQ A;  1FW1 A;  2YWI A;  3IE3 A;  2DSA A;  1M2A A;  1KBN A;  2K8S A;  3ZL5 A;  1AAZ A;  4KDY A;  4NAX A;  1LJR A;  2N5A A;  3TKS C;  1Z3E A;  3D6I A;  2MYG A;  3GH6 A;  3MAK A;  4MF7 A;  5DAK B;  1X5D A;  3LEF A;  4V1A g;  1GL8 A;  5G5F A;  3L9U A;  11GS A;  1TRS A;  1TK5 B;  3F63 A;  5INY A;  3E9J B;  1PA3 A;  2K6V A;  3I6A A;  1R5P A;  2JAD A;  4N0Z A;  3GL3 A;  3EU3 A;  4D73 B;  2R6K A;  3HYP A;  4HS1 A;  1EGO A;  1AUC A;  1GUH A;  4N0V A;  3UL3 A;  4IEL A;  1XVQ A;  1A0F A;  2P5R A;  1W89 A;  5ID2 B;  1SK0 A;  2MMA A;  1K0A A;  5J9C A;  2GQK A;  3Q19 A;  1EGR A;  2BJX A;  4X0X A;  1G6Y A;  1QMV A;  3TOU A;  5JWR B;  4ZBD A;  4PUR A;  1M7T A;  1FG4 A;  6GSV A;  5CNW A;  2PU9 C;  2IN3 A;  2B5E A;  2ON7 A;  3CSJ A;  5EPF A;  3IOS A;  1GWC A;  4GXZ A;  3TKS A;  1FO5 A;  4IBP A;  2VCQ A;  3UEM A;  3SWL A;  4IJ3 A;  4KSM A;  3H79 A;  4ZBB A;  4XS4 A;  8GSS A;  2CX3 A;  2F51 A;  2LQO A;  4NV2 A;  4GLT A;  3FK8 A;  1AXD A;  2GLR A;  4NXI A;  3LG6 A;  1TK0 B;  2ZUP A;  1T00 A;  3HJO A;  3P2A A;  2H0H A;  2VL9 A;  2IIY A;  5IPG A;  4PQI A;  3ZMK A;  2YJH A;  3D4T A;  3DRN A;  1S3D A;  4G9H A;  4GST A;  4MDC A;  3TJJ A;  3C7M A;  2YJ7 A;  3D22 A;  2KP2 A;  5GAP D;  1LBK A;  3DYR A;  4NPB A;  3QDN A;  1SD9 A;  2A2S A;  6GSS A;  2OJL A;  5HR0 A;  1A2M A;  3A2W A;  1KNG A;  4FH8 A;  5JCG A;  4BWQ A;  1S3A A;  4DSS B;  1MDK A;  2NTO A;  2VLV A;  2TRC P;  4RUV A;  2OAC A;  3O76 A;  6GSY A;  2GT5 A;  4QL9 A;  1AIU A;  2E2G A;  3IAM 2;  1U3A A;  3I9V 2;  4K0N A;  2V6K A;  4ECJ A;  5IOX A;  2LUS A;  4D73 A;  4JU5 A;  3WGD A;  5CRG A;  1XWK A;  3TJG A;  4FYC A;  3N9J A;  3ERG A;  4F82 A;  2AV4 A;  4EO3 A;  1G0T A;  2I3Y A;  1NHO A;  3MSZ A;  1T1V A;  4ZL8 A;  4PX1 A;  4TOP A;  4WKW A;  5CAX A;  5G1L A;  3GN3 A;  1TP9 A;  2H19 A;  1PX7 A;  4XHM A;  2LKU A;  1SEN A;  1EEJ A;  1DE1 A;  22GS A;  4NMU A;  3H4K A;  2K8V A;  2H66 A;  3LSZ A;  3HCZ A;  2JU5 A;  4RI6 A;  1ERV A;  3ZIT A;  1WMJ A;  3UVT A;  1K0M A;  4F03 A;  1EV9 A;  3VWV A;  2JSY A;  5KN1 A;  3CXG A;  4AJ6 A;  1V58 A;  1V40 A;  2CQ9 A;  2DBC A;  2IPA A;  2B1K A;  1SK2 A;  1QK8 A;  5AIX A;  2OBI A;  2C1Y A;  3CTG A;  3FZ5 A;  4GRF A;  5F05 A;  1RK4 A;  5ECQ B;  3F6F A;  2KUC A;  2AYT A;  5ECS A;  3P7X A;  5IMD A;  1BAY A;  1F3B A;  2C80 A;  19GS A;  2WGR A;  1XIY A;  3DML A;  1PSQ A;  4KCA A;  2LST A;  3IK7 A;  2E7P A;  2VAF A;  4IGJ A;  4QQ7 A;  5L71 A;  2IMK A;  3IA1 A;  4E8H A;  4DSS A;  5F0G A;  1J9B A;  2EIO A;  4IKH A;  2DIZ A;  3IC4 A;  4OCF A;  5B6M A;  3A2X A;  4K7O A;  1CQG A;  2FHE A;  1VF3 A;  1NSW A;  4V1A p;  1F2E A;  3GV1 A;  2YWO A;  4X1U A;  4MZB A;  4OMV A;  1ERW A;  2RII A;  1QGV A;  4IJI A;  4WBR D;  3R2Q A;  4KX4 A;  2MMZ A;  4NHZ A;  2DIY A;  3PIN A;  1PGT A;  1GSS A;  4J56 E;  3P90 A;  2PPT A;  3TJK A;  1B48 A;  2WDU A;  3PH9 A;  4ZB6 A;  3QCP A;  1K3L A;  1G7E A;  4NV5 A;  1MEK A;  4IHU A;  1PL1 A;  5DBQ A;  2A2R A;  2DLX A;  5KN2 A;  2JAC A;  3GA4 A;  3FEU A;  1USB A;  1GSE A;  1PN9 A;  2AJQ B;  3HD5 A;  3CRU A;  1I5G A;  1Z5Y E;  1FVK A;  3CYN A;  4K0G A;  2HNL A;  2X8C A;  6GSW A;  1K0D A;  2VM2 A;  3A5W A;  4HU7 A;  2YN1 A;  2Z9S A;  4HZ2 A;  4ZB9 A;  1TRV A;  1OC8 A;  3DIE A;  3C73 A;  1A24 A;  4POL A;  4EUY A;  4I8B A;  5HR2 A;  3CSI A;  1O8X A;  2RUF A;  4WR4 A;  1ZOF A;  1LU4 A;  1M2D A;  1O8W A;  2NPB A;  3ME7 A;  5G1K A;  1A8Y A;  1V57 A;  4ML1 A;  4N11 A;  1K0O A;  1MDJ A;  4TN8 A;  2L5O A;  2X8H A;  2WRT A;  4WXT A;  2GQL A;  4EC0 A;  5D9W A;  3O6T A;  3VPT A;  4OO4 A;  5H5Q A;  1QQ2 A;  1U6T A;  17GS A;  4IVF A;  2YOI A;  3UMA A;  1EEM A;  2FWE A;  1UN2 A;  4H86 A;  4GWR A;  1G7O A;  5DAL B;  1DUG A;  1XCC A;  3APS A;  2NDO A;  3LYP A;  2MMN A;  4F0C A;  1V9W A;  2DJJ A;  1GSF A;  2HE3 A;  5E4W A;  5G30 A;  1TRW A;  3KIJ A;  2FLS A;  4HUA A;  1TJD A;  3F4S A;  1WP0 A;  5C00 A;  2CZ2 A;  4HEA 2;  1TW9 A;  2N5F A;  5ECI B;  4O5R A;  5HFI A;  1O7U A;  2FA8 A;  2PVO C;  2YCD A;  4XS6 A;  3EE2 A;  4HQZ A;  2QGV A;  1E2Y A;  3ZVJ D;  5D9V A;  5B8B A;  3E0U A;  2H0G A;  4L0W A;  1ZL9 A;  1YKA A;  3BOA A;  2HYX A;  2AUV A;  3GL5 A;  4JBB A;  2GSS A;  2HRN A;  4FYU A;  1ERU A;  5KN3 A;  4HDE A;  4XS1 A;  1XWB A;  4ML6 A;  1FB6 A;  1ML6 A;  3FZ4 A;  2LTK A;  13GS A;  1VRS D;  5A5K A;  3UIW A;  1A8L A;  7GSS A;  3EU4 A;  4GTU A;  1TU8 A;  1WPI A;  5ABR A;  1EWX A;  1OVN A;  1BX9 A;  3ZFL A;  1Z7R A;  2VUP A;  4K7N A;  1EV4 A;  5ECM B;  3ZML A;  2M80 A;  2IMD A;  4BWS A;  3J7Y k;  2B1L A;  4MAB A;  2E0Q A;  5AN1 A;  2CA8 A;  2HLS A;  3LGC A;  3GKK A;  4WF4 A;  5F8B A;  2RUE A;  3C71 A;  1PD2 1;  2D2Z A;  1JZR A;  1E6B A;  3EVI A;  5FWG A;  1SL1 B;  2IMF A;  5KEJ A;  2IMI A;  2FGX A;  4PQ1 A;  6GST A;  3A2V A;  3FY7 A;  4XRD A;  1WIK A;  3P8W A;  3D0Z A;  4MJC A;  1IYH A;  2YPM A;  4FO5 A;  2LNT A;  1M0U A;  3F8U A;  4TVE A;  1YEX A;  1SYX A;  3F4R A;  3GRX A;  3C8E A;  5IPH A;  3IK9 A;  3QFB C;  5LNK e;  4TR1 A;  5DAL A;  1PL2 A;  3MDK A;  1MDI A;  2IFQ A;  3ERW A;  1FB0 A;  2IJY A;  2WS2 A;  4EF0 A;  1A2J A;  3GIX A;  2HI7 A;  3GTU A;  3W6G A;  1ABA A;  3ZFB A;  3GUS A;  2IWT A;  2YAN A;  1THO A;  3W8S A;  1OE8 A;  1M99 A;  1YY7 A;  1QFN A;  4ZXG A;  4IQA A;  3H8Q A;  1XFL A;  3VI7 A;  3UAP A;  4MF6 A;  3ERF A;  2GGT A;  4ACS A;  3HZ4 A;  3VWW A;  3UAR A;  3GX8 A;  2C8U A;  4MCU A;  3UJ1 A;  1TI3 A;  3US3 A;  3HY2 A;  4Q5Q A;  3ME8 A;  1W4V A;  3LXT A;  1C72 A;  1WE0 A;  5ECK B;  2XBI A;  1B8X A;  4BA7 A;  5A4W A;  3IDV A;  1HYU A;  5DCG A;  1JFU A;  1T4Z A;  3FZ9 A;  5JCW A;  3FR3 A;  4RQR A;  2YV9 A;  9GSS A;  4HOJ A;  4WR5 A;  3TKP A;  1HNA A;  1WOU A;  1VF4 A;  1R5A A;  2LRC A;  1GTI A;  1K3O A;  1KEB A;  4ECI A;  3BCI A;  3EMX A;  2JL4 A;  4ISD A;  2GDR A;  1YEP A;  3G9B A;  4PNF A;  2NBS A;  3TRP A;  3UBK A;  2CAQ A;  5CP1 A;  3EIN A;  4V2L A;  3I69 A;  4IN0 A;  1J08 A;  1FAA A;  2XPD A;  5J5N A;  1VF1 A;  1M9B A;  3TGZ A;  2MBT A;  3GKM A;  2VLU A;  4L8E A;  2GZZ A;  3ZYW A;  2NVL A;  5DAK A;  1U88 A;  2F3M A;  1RW1 A;  5IO2 A;  5LD0 A;  3D4M A;  5KN0 A;  3IV4 A;  4BL7 A;  3KH7 A;  2H6X A;  3LOR A;  1ZCP A;  5B6N A;  3IR4 A;  4YQU A;  5FT3 A;  3QFA C;  4PNG A;  1DE2 A;  1JLW A;  1UA5 A;  2B7K A;  2B5X A;  2FUG 2;  1X9S B;  3Q18 A;  4HZ4 A;  3N5O A;  2X8G A;  1SD8 A;  1B9Y C;  2GZY A;  5ID2 A;  1ZZY A;  4I5Q A;  4CHS A;  1TTZ A;  2FWH A;  1OYJ A;  1V98 A;  4N30 A;  5ELA A;  5GSS A;  2JSZ A;  1XBS A;  3L9S A;  3FZA A;  3GSS A;  2H1D A;  3BJ5 A;  4L0U A;  5J3R A;  5H5S A;  3KJY A;  3WGX A;  1SL2 B;  5DCH A;  1OAZ A;  1JHB A;  1ERT A;  4ZBA A;  3K8N A;  1N2A A;  4K9Z A;  5IMA A;  1B9X C;  4MP4 A;  1T3B A;  3ISO A;  1GTB A;  2HXK A;  4JR6 A;  2YP6 A;  4EKZ A;  4YAP A;  2B6M A;  2YZH A;  2JZT A;  2VCZ A;  4AJ7 A;  3ED3 A;  3MNG A;  3O3T A;  2KOK A;  2B5Y A;  5G2Z A;  1HQO A;  2HSH A;  5H5R A;  2L6C A;  1ST9 A;  4J57 E;  3VWX A;  3QPM A;  5LCZ A;  1PKZ A;  1TDI A;  4MJA A;  5ENU A;  3APQ A;  2WFC A;  1X0R A;  2FD3 A;  4PXO A;  3GMF A;  5C04 A;  1GSU A;  4DSR A;  1URM A;  4WF5 A;  20GS A;  1RQM A;  2H75 A;  2R3X A;  3PR8 A;  4DSQ A;  5A4V A;  2PN8 A;  4WBJ A;  2V6O A;  3LQ7 A;  1A23 A;  5JWO B;  3D5J A;  4IP1 A;  2AHE A;  3Q6O A;  4GF0 A;  1GNE A;  1AQV A;  2ES7 A;  2X64 A;  5GAN D;  1XWG A;  3F6D A;  1YJ6 A;  1PRX A;  1F3A A;  2J23 A;  2FWG A;  3JCM L;  1SK1 A;  5CRD A;  3GUR A;  1O85 A;  4AJ8 A;  5DDL A;  3KMO A;  1R7H A;  2R37 A;  2LRT A;  4G10 A;  5CO3 A;  1OKD A;  1EZK A;  3TKQ A;  1QXH A;  2R2J A;  2I4A A;  4OO5 A;  2PUK C;  2L57 A;  3GX0 A;  3TJF A;  2OAD A;  3ZTL A;  3CSH A;  2YWM A;  5IMF A;  4F0B A;  4BPY A;  2C3N A;  1X9M B;  2PBJ A;  1CQH A;  5IM9 A;  3MWH A;  4G2E A;  2BTO T;  1XPV A;  2DMM A;  1O6J A;  2FY6 A;  4TRX A;  4P3Y B;  3M0F A;  3RDW A;  3TDG A;  2O7K A;  5DQY A;  3QAG A;  2N5B A;  3TB2 A;  2IL3 A;  1GUM A;  4L5O A;  2VCT A;  4TKY A;  5A4U A;  2HFD A;  2RLI A;  4AGS A;  6GSX A;  3GFK A;  3VPQ A;  4K1F A;  3RPP A;  5JCU A;  3QMX A;  2R5G A;  2ALB A;  4V2M A;  4ID0 A;  4HJM A;  3FW2 A;  2I81 A;  3WD6 A;  3ZRD A;  3KGK A;  2O87 A;  4GSN A;  1QUW A;  1JLV A; 
#chains in the Genus database with same CATH topology
 1OC9 B;  1N8J A;  3DD3 A;  1DSB A;  5HFG A;  2YV7 A;  4MJE A;  1NHY A;  2WZ9 A;  3CTF A;  1VF2 A;  3VUR A;  4LL4 B;  3QD9 A;  1R26 A;  4MLY A;  3D21 A;  4ILF A;  1ON4 A;  1U87 A;  4FIW A;  2C0E A;  2PWJ A;  1DBY A;  1B4Q A;  4IP6 A;  3ZZX A;  5GST A;  3IPZ A;  1OKT A;  4G0I A;  2H71 A;  1FOH A;  2WJU A;  2P5Q A;  3KP8 A;  4KB3 A;  4POB A;  1JZW A;  5B7C A;  2OE3 A;  1XZO A;  2L5L A;  3FRC A;  3DKS A;  1Q98 A;  3ZVJ A;  5BRT A;  4X43 A;  1XVW A;  4MPF A;  4O5U A;  1WJK A;  1FOV A;  1NM3 A;  2OE1 A;  1K3Y A;  3S9F A;  1PQN A;  4PUF C;  1R4W A;  2KLX A;  4DVC A;  5D93 A;  4XIH A;  5D73 A;  2PVQ A;  2FNO A;  4CW9 A;  3TOT A;  4XCS A;  1ZMA A;  4MK3 A;  5F06 A;  4LLR A;  3DEX A;  2MZC A;  2KHP A;  4MF5 A;  3LXZ A;  1JZD A;  4KAE A;  2LJK A;  2C4J A;  1Z6N A;  5IMV A;  2WCI A;  1TRU A;  1WWJ A;  3TKS E;  2VIM A;  3DGQ A;  1TI1 A;  3TUE A;  3ZRE A;  3FR6 A;  3GHA A;  3NIV A;  3IHG A;  3RHC A;  5HFK A;  1BG5 A;  3U6V A;  1AC1 A;  2CVB A;  5D9X A;  2DKI A;  3CQF A;  1M9A A;  2GSQ A;  3IBH A;  5COH A;  1G6W A;  2F8A A;  4KH7 A;  3KZQ A;  3HJM A;  1GLP A;  1ILO A;  4O5Q A;  2H74 A;  2ZNM A;  1XW9 A;  2H6Y A;  3I43 A;  4QL7 A;  2OKA A;  1YZX A;  3LWA A;  1PN0 A;  2R0C A;  2H0I A;  3VK9 A;  4E8E A;  1PKW A;  3L0H A;  2DML A;  3NOF A;  5ECH B;  2A4H A;  3VLN A;  3TRQ A;  1TOF A;  18GS A;  4K8M A;  2I1U A;  2CT6 A;  4MMM A;  2M72 A;  3KTB A;  2HRF A;  4I97 A;  4EDZ A;  1AW9 A;  2HZF A;  1B4P A;  4I2U A;  1S3C A;  3EYT A;  1GP1 A;  5ECO B;  2H30 A;  2L4C A;  1YDK A;  4O32 A;  2VO4 A;  2V32 A;  5AIS A;  1ACV A;  3NZN A;  3RBT A;  3TRX A;  4X4J A;  1Z6M A;  2EIR A;  2O89 A;  1PX6 A;  1PFO A;  4MJB A;  1Y25 A;  1GTA A;  4PQH A;  3WT1 A;  4JE1 A;  2CV4 A;  3EUR A;  2MMO A;  5IIZ A;  2V1M A;  1ZGN A;  3H93 A;  3KD0 A;  1XW5 A;  4YQV A;  2LQQ A;  4Z2R A;  4O92 A;  3CRT A;  1EOH A;  1HD2 A;  5DJL A;  1ZYP A;  4EL1 A;  3KMN A;  4JZQ A;  3DWV A;  4LMV A;  1GLQ A;  1EP8 A;  1K0N A;  1Y6E A;  4TXO B;  2JZS A;  1VGL A;  4K2D A;  3GST A;  5FHI A;  1HNB A;  1Z9H A;  1UC7 A;  2KP1 A;  5E59 A;  4GSS A;  3KTL A;  3HKR A;  3FR9 A;  4I2T A;  2VL3 A;  4LA1 A;  1AQX A;  1MD3 A;  1SKW B;  1YQ1 A;  2ZCT A;  16GS A;  10GS A;  4ZL7 A;  3HHV A;  2O85 A;  2FA4 A;  2GZP A;  3G7I A;  5HQP A;  5AGY A;  3QR6 A;  4WEY A;  1TU7 A;  1SKS B;  1T8E B;  3PGT A;  2M46 A;  2TRX A;  2OBK A;  2ON5 A;  2YWN A;  2CZ3 A;  2H1G A;  2H6Z A;  4MZW A;  3OR5 A;  2H70 A;  1XWA A;  2QSI A;  2YZU A;  4WET A;  2H01 A;  3H1N A;  1KTE A;  1GSD A;  3LW9 A;  1XXU A;  4BVX A;  1A2L A;  2WUL A;  2L6D A;  2TIR A;  2GQM A;  2HT9 A;  2V2G A;  3C1S A;  2J9H A;  4OFM A;  4ECB A;  4RQX A;  2VCV A;  1UVZ A;  3VFI A;  2LV3 A;  4YAV A;  1FHE A;  2GT6 A;  5ECL B;  4FYB A;  1T7P B;  5J4U A;  4G0L A;  4MA9 A;  4Z7X A;  1T4Y A;  2HSM A;  1I9D A;  4OCE A;  2LS5 A;  4XTS A;  3U5R E;  2RM6 A;  1Q4J A;  1WRY A;  3W8J A;  4K6X A;  5ECN B;  2DC5 A;  3FYG A;  2OA7 A;  2RM5 A;  3RAZ A;  3ZIJ A;  5KOX A;  5EVO A;  3KP9 A;  5D9T A;  2C0D A;  4TR4 A;  3UBL A;  2C0F A;  4OWY A;  5DVB A;  4POK A;  2VCX A;  2CAI A;  4KW6 A;  2K18 A;  2H1A A;  1GSY A;  3IXR A;  1H75 A;  1J0F A;  3KH9 A;  5DJM A;  3QAV A;  4L5L A;  4CDO A;  1F37 A;  3LFL A;  3BCK A;  1HNC A;  4KDU A;  1IYI A;  2VD0 A;  2V41 A;  4TR3 A;  4JR4 A;  1A0R P;  4TXO A;  4JED A;  4MH3 A;  4TR0 A;  4G19 A;  1M3I A;  2A2P A;  1OE7 A;  1XOB A;  2UZ8 A;  4EVM A;  4PUA A;  4OFT A;  4PTS A;  2VD1 A;  2JZR A;  4IW9 A;  1M2B A;  4EIQ A;  4ZL9 A;  3J7Y b;  1ZYE A;  3WGE A;  1TXX A;  4YQM A;  3M8N A;  4N10 A;  5IMC A;  3KEB A;  2XHF A;  3EWL A;  4OFN A;  3HVV A;  3DXB A;  5HR1 A;  1X5C A;  5DQS A;  1YF0 A;  4NHW A;  3M3M A;  4EE0 A;  4ULX A;  1TK8 B;  3F3R A;  2H1B A;  3KXO A;  1GUL A;  1AQW A;  2XC2 A;  3DVW A;  4O7H A;  3L9V A;  3HZ8 A;  3G7J A;  3GH9 A;  1XOA A;  1Z7P A;  3KCM A;  2REM A;  4GQF A;  1PMT A;  1O73 A;  3GNJ A;  3FKF A;  2PGT A;  2YNX A;  4YH2 A;  4I6X A;  2AB6 A;  2H76 A;  3L78 A;  2HZE B;  1OC3 A;  5ELG A;  3UVH A;  2DJ2 A;  1V2A A;  2P31 A;  2FWF A;  4OD7 A;  4TW5 A;  5B8A A;  4V2N A;  5J41 A;  4BVY B;  5ECR B;  1F6M C;  5IQY A;  2B3S A;  4BIK A;  3IAS 2;  4HU9 A;  2O8V B;  1GNW A;  5G31 A;  4EDY A;  3TJB A;  5D96 A;  2A4V A;  4KSO A;  5IMZ A;  1GRX A;  2K9F A;  4NWY A;  3GYK A;  1YF1 A;  2CVD A;  2DJ1 A;  4K7I A;  2OE0 A;  1O81 A;  1BED A;  1K0C A;  3HVX A;  2VOC A;  4KDX A;  2L59 A;  3ZLP A;  3RHB A;  1BQ7 A;  2X49 A;  5G5E A;  3HJP A;  3APO A;  3VWU A;  3UOM A;  3FHK A;  2CVK A;  4GQC A;  5CYY A;  3F3Q A;  2HRK A;  2E2M A;  1SKR B;  1GTU A;  3Q74 A;  5J9B A;  3BD2 A;  1ZYQ B;  2HSY A;  1FVJ A;  2CX4 A;  2L4Q A;  2H73 A;  3CBU A;  4PGT A;  3F4T A;  2LRN A;  5ECP B;  3HVS A;  2F8F A;  3M1G A;  5D8I A;  3VI5 A;  2G2Q A;  1ZYN A;  2LJA A;  4HQS A;  4HJ2 A;  2LJR A;  1THX A;  4Q5N A;  2EIQ A;  1XW6 A;  4LL1 B;  1BJX A;  2C3T A;  2C0G A;  2LEG A;  3AY8 A;  3A3T A;  5F07 A;  5IOW A;  3G7Y A;  1SYR A;  2H8L A;  6GSU A;  3C1R A;  1U3I A;  4POM A;  3KM6 A;  4MZC A;  4KND A;  2VL2 C;  2GSR A;  2IME A;  2LNS A;  4Q5R A;  5CRE A;  2DJ0 A;  3BBY A;  1EP7 A;  5EL8 A;  2B7J A;  4KA0 A;  2VCW A;  4RI7 A;  3EC3 A;  3WYW A;  1YKC A;  1MTC A;  1M3J A;  5EY6 A;  1EOG A;  2QC7 A;  4XRA A;  2F9S A;  4TR1 B;  1K0B A;  2HZE A;  2IFQ B;  2MBS A;  4GCI A;  4AF2 A;  4Q5F A;  2AAW A;  1SJI A;  4F9Z A;  1GH2 A;  2FCH A;  3LYK A;  4BVY A;  1TKD B;  2WB9 A;  3HA9 A;  4TXV A;  2XBQ A;  3GTU B;  4MPG A;  1X5E A;  2VM1 A;  1MD4 A;  3F9U A;  1XWC A;  1GUK A;  4DEJ A;  4ZIJ A;  2PMT A;  3M9K A;  3IHQ A;  2GS3 A;  3TKR A;  1SJZ A;  4KCE A;  14GS A;  3TCO A;  2X99 A;  2GTU A;  1F9M A;  2GVP A;  4IS0 A;  1NW2 A;  2PER A;  3HDC A;  2C3Q A;  1X9W B;  5IO0 A;  5HR3 A;  5GZZ B;  3WT2 A;  4ZIL A;  2X4A A;  4J2F A;  3GKX A;  4HI7 A;  3QAW A;  2GST A;  4MH2 A;  2XPE A;  4LMW A;  3E3E A;  3CMI A;  4ZB8 A;  3V1W A;  2QKE A;  3L4N A;  4IQ1 A;  2VL2 A;  4F2I A;  3LJR A;  1SJ6 A;  2I9H A;  2P0G A;  3M9J A;  3F0I A;  1SL0 B;  4ECC A;  3DVX A;  3SBC A;  4JRR A;  3QOU A;  4XS4 B;  2R4V A;  3ZIV A;  3GKN A;  5CRH A;  4EXJ A;  3EMP A;  1H4O A;  2DJK A;  5AIV A;  2DJ3 A;  1JZO A;  5CRW A;  1OC9 A;  2EC4 A;  5JWQ B;  3RPN A;  4KF9 A;  4KE3 A;  2VLT A;  4G0K A;  2G0F A;  2H72 A;  12GS A;  3IRA A;  2BMX A;  4KUN A;  4KGI A;  1BYE A;  1SU9 A;  3HXS A;  1GSQ A;  1FW1 A;  2YWI A;  3IE3 A;  2DSA A;  1M2A A;  1KBN A;  2K8S A;  3ZL5 A;  1AAZ A;  4KDY A;  4NAX A;  1LJR A;  2N5A A;  3TKS C;  1Z3E A;  3D6I A;  2MYG A;  3GH6 A;  3MAK A;  4MF7 A;  5DAK B;  1X5D A;  3LEF A;  4V1A g;  1GL8 A;  5G5F A;  3L9U A;  11GS A;  1TRS A;  1TK5 B;  3F63 A;  5INY A;  3E9J B;  1PA3 A;  2K6V A;  3I6A A;  1R5P A;  2JAD A;  4N0Z A;  3GL3 A;  3EU3 A;  4D73 B;  2R6K A;  3HYP A;  4HS1 A;  1EGO A;  1AUC A;  1GUH A;  4N0V A;  3UL3 A;  4IEL A;  1XVQ A;  1A0F A;  2P5R A;  1W89 A;  5ID2 B;  1SK0 A;  4ICY A;  2MMA A;  1K0A A;  4USS A;  5J9C A;  2GQK A;  3Q19 A;  1EGR A;  2BJX A;  4X0X A;  1G6Y A;  1QMV A;  3TOU A;  5JWR B;  4ZBD A;  4PUR A;  1M7T A;  1FG4 A;  6GSV A;  5CNW A;  2PU9 C;  2IN3 A;  2B5E A;  2ON7 A;  3CSJ A;  5EPF A;  3IOS A;  1GWC A;  4GXZ A;  3TKS A;  1FO5 A;  4IBP A;  3A5I A;  2VCQ A;  3UEM A;  3SWL A;  4IJ3 A;  4KSM A;  3H79 A;  4ZBB A;  4XS4 A;  8GSS A;  2CX3 A;  2F51 A;  2LQO A;  4NV2 A;  4GLT A;  3FK8 A;  1AXD A;  4MNN A;  2GLR A;  4NXI A;  3LG6 A;  1TK0 B;  2ZUP A;  1T00 A;  3HJO A;  3P2A A;  2H0H A;  2VL9 A;  2IIY A;  5IPG A;  4PQI A;  3ZMK A;  2YJH A;  3D4T A;  3DRN A;  1S3D A;  4G9H A;  4Z2U A;  4GST A;  4MDC A;  3TJJ A;  3C7M A;  2YJ7 A;  3D22 A;  2KP2 A;  5GAP D;  1LBK A;  3DYR A;  4NPB A;  3QDN A;  1SD9 A;  2A2S A;  6GSS A;  2OJL A;  5HR0 A;  1A2M A;  3A2W A;  4YKF A;  1KNG A;  4FH8 A;  5JCG A;  4BWQ A;  1S3A A;  4DSS B;  1MDK A;  2NTO A;  2VLV A;  2TRC P;  4RUV A;  2OAC A;  3O76 A;  6GSY A;  2GT5 A;  4QL9 A;  1AIU A;  2E2G A;  3IAM 2;  1U3A A;  3I9V 2;  4K0N A;  2V6K A;  4ECJ A;  5IOX A;  2LUS A;  4D73 A;  4JU5 A;  3WGD A;  5CRG A;  1XWK A;  3TJG A;  4FYC A;  3N9J A;  3ERG A;  4F82 A;  2AV4 A;  4EO3 A;  1G0T A;  2I3Y A;  1NHO A;  3MSZ A;  1T1V A;  4ZL8 A;  4PX1 A;  4TOP A;  4WKW A;  5CAX A;  5G1L A;  3GN3 A;  1TP9 A;  2H19 A;  1PX7 A;  4XHM A;  2LKU A;  1SEN A;  1EEJ A;  1DE1 A;  22GS A;  4NMU A;  3H4K A;  2K8V A;  2H66 A;  3LSZ A;  3HCZ A;  2JU5 A;  4RI6 A;  1S3R A;  1ERV A;  3ZIT A;  1WMJ A;  3UVT A;  1K0M A;  4F03 A;  1EV9 A;  3VWV A;  2JSY A;  5KN1 A;  3CXG A;  4AJ6 A;  1V58 A;  1V40 A;  2CQ9 A;  2DBC A;  2IPA A;  2B1K A;  1SK2 A;  1QK8 A;  5AIX A;  2OBI A;  2C1Y A;  3CTG A;  3FZ5 A;  4GRF A;  5F05 A;  1RK4 A;  5ECQ B;  3F6F A;  2KUC A;  2AYT A;  5ECS A;  3P7X A;  5IMD A;  1BAY A;  1F3B A;  2C80 A;  19GS A;  2WGR A;  3R3E A;  1XIY A;  3DML A;  1PSQ A;  4KCA A;  2LST A;  4CY6 A;  3IK7 A;  2E7P A;  4YKG A;  2VAF A;  4IGJ A;  4QQ7 A;  5L71 A;  2IMK A;  3IA1 A;  4E8H A;  4DSS A;  5F0G A;  1J9B A;  2EIO A;  4IKH A;  2DIZ A;  3IC4 A;  4OCF A;  5B6M A;  3A2X A;  4K7O A;  1CQG A;  2FHE A;  1VF3 A;  1NSW A;  4V1A p;  1F2E A;  5BMU A;  3GV1 A;  2YWO A;  4X1U A;  4MZB A;  4OMV A;  1ERW A;  2RII A;  1QGV A;  4IJI A;  4WBR D;  3R2Q A;  4KX4 A;  2MMZ A;  4NHZ A;  2DIY A;  3PIN A;  1PGT A;  1GSS A;  4J56 E;  3P90 A;  2PPT A;  3TJK A;  1B48 A;  2WDU A;  3PH9 A;  4ZB6 A;  3QCP A;  1K3L A;  1G7E A;  4NV5 A;  1MEK A;  4IHU A;  1PL1 A;  5DBQ A;  2A2R A;  2DLX A;  5KN2 A;  2JAC A;  3GA4 A;  3FEU A;  1USB A;  1GSE A;  1PN9 A;  2AJQ B;  3HD5 A;  3CRU A;  4CY8 A;  1I5G A;  1Z5Y E;  1FVK A;  3CYN A;  4K0G A;  2HNL A;  2X8C A;  6GSW A;  1K0D A;  2VM2 A;  3A5W A;  4HSC X;  4HU7 A;  2YN1 A;  2Z9S A;  4HZ2 A;  4ZB9 A;  1TRV A;  1OC8 A;  3DIE A;  3C73 A;  5KOW A;  1A24 A;  4POL A;  4EUY A;  4I8B A;  5HR2 A;  3CSI A;  1O8X A;  2RUF A;  4WR4 A;  1ZOF A;  1LU4 A;  1M2D A;  1O8W A;  2NPB A;  3ME7 A;  5G1K A;  1A8Y A;  1V57 A;  4ML1 A;  4N11 A;  1K0O A;  1MDJ A;  4TN8 A;  2L5O A;  2X8H A;  2WRT A;  4WXT A;  4K2X A;  2GQL A;  4EC0 A;  5D9W A;  3O6T A;  3VPT A;  4OO4 A;  5H5Q A;  1QQ2 A;  1U6T A;  17GS A;  4IVF A;  2YOI A;  3UMA A;  1EEM A;  2FWE A;  1UN2 A;  4H86 A;  4GWR A;  1G7O A;  2R0G A;  5DAL B;  1DUG A;  1XCC A;  3APS A;  2NDO A;  3LYP A;  2MMN A;  4F0C A;  1V9W A;  2DJJ A;  1GSF A;  2HE3 A;  5E4W A;  5G30 A;  1TRW A;  3KIJ A;  2FLS A;  4HUA A;  1TJD A;  3F4S A;  1WP0 A;  5C00 A;  2CZ2 A;  4HEA 2;  1TW9 A;  2N5F A;  5ECI B;  4O5R A;  5HFI A;  1O7U A;  2FA8 A;  2PVO C;  2YCD A;  4XS6 A;  3EE2 A;  4HQZ A;  2QGV A;  1E2Y A;  3ZVJ D;  5D9V A;  5B8B A;  3E0U A;  2H0G A;  3HVN A;  1ZL9 A;  4L0W A;  1YKA A;  3BOA A;  2HYX A;  2AUV A;  3GL5 A;  4JBB A;  2GSS A;  2HRN A;  4FYU A;  1ERU A;  5KN3 A;  4HDE A;  4XS1 A;  1XWB A;  4ML6 A;  1FB6 A;  1ML6 A;  3FZ4 A;  2LTK A;  13GS A;  1VRS D;  5A5K A;  3UIW A;  1A8L A;  7GSS A;  3EU4 A;  4GTU A;  1TU8 A;  1WPI A;  5ABR A;  1EWX A;  1OVN A;  1BX9 A;  3ZFL A;  1Z7R A;  2VUP A;  4K7N A;  1EV4 A;  4A5P A;  5ECM B;  3ZML A;  2M80 A;  2IMD A;  4BWS A;  3J7Y k;  2B1L A;  4MAB A;  2E0Q A;  5AN1 A;  2CA8 A;  2HLS A;  3LGC A;  3GKK A;  4WF4 A;  5F8B A;  2RUE A;  3C71 A;  1PD2 1;  2D2Z A;  4BVX B;  1JZR A;  1E6B A;  3EVI A;  5FWG A;  1SL1 B;  2IMF A;  5KEJ A;  2IMI A;  2FGX A;  4PQ1 A;  6GST A;  3A2V A;  3FY7 A;  4XRD A;  1WIK A;  3P8W A;  3D0Z A;  4MJC A;  1IYH A;  2YPM A;  4FO5 A;  2LNT A;  1M0U A;  3F8U A;  4TVE A;  1YEX A;  1SYX A;  3F4R A;  3GRX A;  3C8E A;  5IPH A;  3IK9 A;  3QFB C;  5LNK e;  4TR1 A;  5DAL A;  4BL7 B;  1PL2 A;  3MDK A;  1MDI A;  2IFQ A;  2R0P A;  1FB0 A;  3ERW A;  3IC8 A;  2IJY A;  2WS2 A;  4EF0 A;  1A2J A;  3GIX A;  2HI7 A;  3GTU A;  3W6G A;  1ABA A;  3ZFB A;  2HRA A;  3GUS A;  2IWT A;  2YAN A;  1THO A;  3W8S A;  1OE8 A;  1M99 A;  1YY7 A;  1QFN A;  4ZXG A;  4IQA A;  3H8Q A;  1XFL A;  3VI7 A;  3UAP A;  4MF6 A;  3ERF A;  2GGT A;  4ACS A;  3HZ4 A;  3VWW A;  3UAR A;  3GX8 A;  2C8U A;  4MCU A;  3UJ1 A;  1TI3 A;  3US3 A;  3HY2 A;  4Z2T A;  4Q5Q A;  3ME8 A;  1W4V A;  3LXT A;  1C72 A;  1WE0 A;  5ECK B;  2XBI A;  1B8X A;  4BA7 A;  5A4W A;  3IDV A;  1HYU A;  5DCG A;  1JFU A;  1T4Z A;  3FZ9 A;  5JCW A;  3FR3 A;  4RQR A;  2YV9 A;  9GSS A;  4HOJ A;  4WR5 A;  3TKP A;  1HNA A;  1WOU A;  1VF4 A;  1R5A A;  2LRC A;  1GTI A;  1K3O A;  1KEB A;  4ECI A;  3BCI A;  3EMX A;  2JL4 A;  4ISD A;  2GDR A;  1YEP A;  3G9B A;  4PNF A;  2NBS A;  3TRP A;  3UBK A;  2CAQ A;  5CP1 A;  3EIN A;  4V2L A;  3I69 A;  4IN0 A;  1J08 A;  1FAA A;  2XPD A;  5J5N A;  1VF1 A;  1M9B A;  3TGZ A;  2MBT A;  3GKM A;  2VLU A;  4L8E A;  2GZZ A;  3ZYW A;  2NVL A;  5DAK A;  1U88 A;  2F3M A;  1RW1 A;  5IO2 A;  5LD0 A;  3D4M A;  5KN0 A;  3IV4 A;  4BL7 A;  3KH7 A;  2H6X A;  3LOR A;  4K5R A;  1ZCP A;  5B6N A;  3IR4 A;  4YQU A;  5FT3 A;  3QFA C;  4PNG A;  1DE2 A;  1JLW A;  1UA5 A;  2B7K A;  2B5X A;  2FUG 2;  1X9S B;  3Q18 A;  4HZ4 A;  2QA1 A;  3N5O A;  2X8G A;  1SD8 A;  1B9Y C;  2GZY A;  5ID2 A;  1ZZY A;  4I5Q A;  4CHS A;  1TTZ A;  2FWH A;  1OYJ A;  1V98 A;  4N30 A;  5ELA A;  5GSS A;  2JSZ A;  1XBS A;  3L9S A;  3FZA A;  4FQU A;  3GSS A;  2H1D A;  3BJ5 A;  4L0U A;  5J3R A;  5H5S A;  3KJY A;  3WGX A;  1SL2 B;  5DCH A;  1OAZ A;  1JHB A;  1ERT A;  4ZBA A;  3K8N A;  1N2A A;  4K9Z A;  5IMA A;  1B9X C;  4MP4 A;  1T3B A;  3ISO A;  1GTB A;  2HXK A;  4JR6 A;  2YP6 A;  4EKZ A;  4YAP A;  2B6M A;  2YZH A;  2JZT A;  2VCZ A;  4AJ7 A;  3ED3 A;  3MNG A;  3O3T A;  2KOK A;  2B5Y A;  5G2Z A;  1HQO A;  2HSH A;  5H5R A;  2L6C A;  1ST9 A;  4J57 E;  3VWX A;  3QPM A;  5LCZ A;  1PKZ A;  3EPT A;  1TDI A;  4MJA A;  5ENU A;  3APQ A;  2WFC A;  1X0R A;  2FD3 A;  4PXO A;  3GMF A;  5C04 A;  4EIP A;  1GSU A;  4DSR A;  1URM A;  4WF5 A;  20GS A;  1RQM A;  2H75 A;  2R3X A;  3PR8 A;  4DSQ A;  5A4V A;  2PN8 A;  4WBJ A;  2V6O A;  3LQ7 A;  1A23 A;  5JWO B;  3D5J A;  4IP1 A;  2AHE A;  3Q6O A;  4GF0 A;  3MIX A;  1GNE A;  1AQV A;  2ES7 A;  2X64 A;  5GAN D;  1XWG A;  3F6D A;  1YJ6 A;  1PRX A;  1F3A A;  2J23 A;  2FWG A;  3JCM L;  1SK1 A;  5CRD A;  3GUR A;  1O85 A;  4AJ8 A;  5DDL A;  3KMO A;  1R7H A;  2R37 A;  2LRT A;  4G10 A;  5CO3 A;  1OKD A;  1EZK A;  3TKQ A;  1QXH A;  2R2J A;  2I4A A;  4OO5 A;  2PUK C;  2L57 A;  3GX0 A;  3TJF A;  2OAD A;  3ZTL A;  3CSH A;  2YWM A;  5IMF A;  4F0B A;  4BPY A;  2C3N A;  1X9M B;  2PBJ A;  1CQH A;  5IM9 A;  3MWH A;  4G2E A;  2DKH A;  2BTO T;  1XPV A;  2DMM A;  1O6J A;  2FY6 A;  4TRX A;  4P3Y B;  3M0F A;  3RDW A;  3TDG A;  2O7K A;  5DQY A;  3QAG A;  3PPU A;  3FMW A;  2N5B A;  4K5S A;  3TB2 A;  2IL3 A;  1GUM A;  4L5O A;  2VCT A;  4TKY A;  5A4U A;  2HFD A;  2RLI A;  4AGS A;  6GSX A;  3GFK A;  3VPQ A;  3MYD A;  2QA2 A;  4K1F A;  3RPP A;  5JCU A;  3QMX A;  2R5G A;  2ALB A;  4V2M A;  4ID0 A;  4HJM A;  3FW2 A;  2I81 A;  3WD6 A;  3ZRD A;  1XG8 A;  3KGK A;  2O87 A;  4GSN A;  1QUW A;  1JLV A; 
#chains in the Genus database with same CATH homology
 1OC9 B;  1N8J A;  3DD3 A;  1DSB A;  5HFG A;  2YV7 A;  4MJE A;  1NHY A;  2WZ9 A;  3CTF A;  1VF2 A;  3VUR A;  4LL4 B;  3QD9 A;  1R26 A;  4MLY A;  3D21 A;  4ILF A;  1ON4 A;  1U87 A;  4FIW A;  2C0E A;  2PWJ A;  1DBY A;  1B4Q A;  4IP6 A;  3ZZX A;  5GST A;  3IPZ A;  1OKT A;  4G0I A;  2H71 A;  1FOH A;  2WJU A;  2P5Q A;  3KP8 A;  4KB3 A;  4POB A;  1JZW A;  5B7C A;  2OE3 A;  1XZO A;  2L5L A;  3FRC A;  3DKS A;  1Q98 A;  3ZVJ A;  5BRT A;  4X43 A;  1XVW A;  4MPF A;  4O5U A;  1WJK A;  1FOV A;  1NM3 A;  2OE1 A;  1K3Y A;  3S9F A;  1PQN A;  4PUF C;  1R4W A;  2KLX A;  4DVC A;  5D93 A;  4XIH A;  5D73 A;  2PVQ A;  2FNO A;  4CW9 A;  3TOT A;  4XCS A;  1ZMA A;  4MK3 A;  5F06 A;  4LLR A;  3DEX A;  2MZC A;  2KHP A;  4MF5 A;  3LXZ A;  1JZD A;  4KAE A;  2LJK A;  2C4J A;  1Z6N A;  5IMV A;  2WCI A;  1TRU A;  1WWJ A;  3TKS E;  2VIM A;  3DGQ A;  1TI1 A;  3TUE A;  3ZRE A;  3FR6 A;  3GHA A;  3NIV A;  3IHG A;  3RHC A;  5HFK A;  1BG5 A;  3U6V A;  1AC1 A;  2CVB A;  5D9X A;  2DKI A;  1M9A A;  2GSQ A;  3IBH A;  5COH A;  1G6W A;  2F8A A;  4KH7 A;  3KZQ A;  3HJM A;  1GLP A;  1ILO A;  4O5Q A;  2H74 A;  2ZNM A;  1XW9 A;  2H6Y A;  3I43 A;  4QL7 A;  2OKA A;  1YZX A;  3LWA A;  1PN0 A;  2R0C A;  2H0I A;  3VK9 A;  4E8E A;  1PKW A;  3L0H A;  2DML A;  3NOF A;  5ECH B;  2A4H A;  3VLN A;  3TRQ A;  1TOF A;  18GS A;  4K8M A;  2I1U A;  2CT6 A;  4MMM A;  2M72 A;  3KTB A;  2HRF A;  4I97 A;  4EDZ A;  1AW9 A;  2HZF A;  1B4P A;  4I2U A;  1S3C A;  3EYT A;  1GP1 A;  5ECO B;  2H30 A;  2L4C A;  1YDK A;  4O32 A;  2VO4 A;  2V32 A;  5AIS A;  1ACV A;  3NZN A;  3RBT A;  3TRX A;  4X4J A;  1Z6M A;  2EIR A;  2O89 A;  1PX6 A;  4MJB A;  1Y25 A;  1GTA A;  4PQH A;  3WT1 A;  4JE1 A;  2CV4 A;  3EUR A;  2MMO A;  5IIZ A;  2V1M A;  1ZGN A;  3H93 A;  3KD0 A;  1XW5 A;  4YQV A;  2LQQ A;  4Z2R A;  4O92 A;  3CRT A;  1EOH A;  1HD2 A;  5DJL A;  1ZYP A;  4EL1 A;  3KMN A;  4JZQ A;  3DWV A;  4LMV A;  1GLQ A;  1EP8 A;  1K0N A;  1Y6E A;  4TXO B;  2JZS A;  1VGL A;  4K2D A;  3GST A;  5FHI A;  1HNB A;  1Z9H A;  1UC7 A;  2KP1 A;  5E59 A;  4GSS A;  3KTL A;  3HKR A;  3FR9 A;  4I2T A;  2VL3 A;  4LA1 A;  1AQX A;  1MD3 A;  1SKW B;  1YQ1 A;  2ZCT A;  16GS A;  10GS A;  4ZL7 A;  3HHV A;  2O85 A;  2FA4 A;  2GZP A;  3G7I A;  5HQP A;  5AGY A;  3QR6 A;  4WEY A;  1TU7 A;  1SKS B;  1T8E B;  3PGT A;  2M46 A;  2TRX A;  2OBK A;  2ON5 A;  2YWN A;  2CZ3 A;  2H1G A;  2H6Z A;  4MZW A;  3OR5 A;  2H70 A;  1XWA A;  2QSI A;  2YZU A;  4WET A;  2H01 A;  3H1N A;  1KTE A;  1GSD A;  3LW9 A;  1XXU A;  4BVX A;  1A2L A;  2WUL A;  2L6D A;  2TIR A;  2GQM A;  2HT9 A;  2V2G A;  3C1S A;  2J9H A;  4OFM A;  4ECB A;  4RQX A;  2VCV A;  1UVZ A;  3VFI A;  2LV3 A;  4YAV A;  1FHE A;  2GT6 A;  5ECL B;  4FYB A;  1T7P B;  5J4U A;  4G0L A;  4MA9 A;  4Z7X A;  1T4Y A;  2HSM A;  1I9D A;  4OCE A;  2LS5 A;  4XTS A;  3U5R E;  2RM6 A;  1Q4J A;  1WRY A;  3W8J A;  4K6X A;  5ECN B;  2DC5 A;  3FYG A;  2OA7 A;  2RM5 A;  3RAZ A;  3ZIJ A;  5KOX A;  5EVO A;  3KP9 A;  5D9T A;  2C0D A;  4TR4 A;  3UBL A;  2C0F A;  4OWY A;  5DVB A;  4POK A;  2VCX A;  2CAI A;  4KW6 A;  2K18 A;  2H1A A;  1GSY A;  3IXR A;  1H75 A;  1J0F A;  3KH9 A;  5DJM A;  3QAV A;  4L5L A;  4CDO A;  1F37 A;  3LFL A;  3BCK A;  1HNC A;  4KDU A;  1IYI A;  2VD0 A;  2V41 A;  4TR3 A;  4JR4 A;  1A0R P;  4TXO A;  4JED A;  4MH3 A;  4TR0 A;  4G19 A;  2A2P A;  1OE7 A;  1XOB A;  2UZ8 A;  4EVM A;  4PUA A;  4OFT A;  4PTS A;  2VD1 A;  2JZR A;  4IW9 A;  1M2B A;  4EIQ A;  4ZL9 A;  3J7Y b;  1ZYE A;  3WGE A;  1TXX A;  4YQM A;  3M8N A;  4N10 A;  5IMC A;  3KEB A;  2XHF A;  3EWL A;  4OFN A;  3HVV A;  3DXB A;  5HR1 A;  1X5C A;  5DQS A;  1YF0 A;  4NHW A;  3M3M A;  4EE0 A;  4ULX A;  1TK8 B;  3F3R A;  2H1B A;  3KXO A;  1GUL A;  1AQW A;  2XC2 A;  3DVW A;  4O7H A;  3L9V A;  3HZ8 A;  3G7J A;  3GH9 A;  1XOA A;  1Z7P A;  3KCM A;  2REM A;  4GQF A;  1PMT A;  1O73 A;  3GNJ A;  3FKF A;  2PGT A;  2YNX A;  4YH2 A;  4I6X A;  2AB6 A;  2H76 A;  3L78 A;  2HZE B;  1OC3 A;  5ELG A;  3UVH A;  2DJ2 A;  1V2A A;  2P31 A;  2FWF A;  4OD7 A;  4TW5 A;  5B8A A;  4V2N A;  5J41 A;  4BVY B;  5ECR B;  1F6M C;  5IQY A;  2B3S A;  3IAS 2;  4HU9 A;  2O8V B;  1GNW A;  5G31 A;  4EDY A;  3TJB A;  5D96 A;  2A4V A;  4KSO A;  5IMZ A;  1GRX A;  2K9F A;  4NWY A;  3GYK A;  1YF1 A;  2CVD A;  2DJ1 A;  4K7I A;  2OE0 A;  1O81 A;  1BED A;  1K0C A;  3HVX A;  2VOC A;  4KDX A;  2L59 A;  3ZLP A;  3RHB A;  1BQ7 A;  2X49 A;  5G5E A;  3HJP A;  3APO A;  3VWU A;  3UOM A;  3FHK A;  2CVK A;  4GQC A;  5CYY A;  3F3Q A;  2HRK A;  2E2M A;  1SKR B;  1GTU A;  3Q74 A;  5J9B A;  3BD2 A;  1ZYQ B;  2HSY A;  1FVJ A;  2CX4 A;  2L4Q A;  2H73 A;  3CBU A;  4PGT A;  3F4T A;  2LRN A;  5ECP B;  3HVS A;  2F8F A;  3M1G A;  5D8I A;  3VI5 A;  2G2Q A;  1ZYN A;  2LJA A;  4HQS A;  4HJ2 A;  2LJR A;  1THX A;  4Q5N A;  2EIQ A;  1XW6 A;  4LL1 B;  1BJX A;  2C3T A;  2C0G A;  2LEG A;  3AY8 A;  3A3T A;  5F07 A;  5IOW A;  3G7Y A;  1SYR A;  2H8L A;  6GSU A;  3C1R A;  1U3I A;  4POM A;  3KM6 A;  4MZC A;  4KND A;  2VL2 C;  2GSR A;  2IME A;  2LNS A;  4Q5R A;  5CRE A;  2DJ0 A;  3BBY A;  1EP7 A;  5EL8 A;  2B7J A;  4KA0 A;  2VCW A;  4RI7 A;  3EC3 A;  3WYW A;  1YKC A;  1MTC A;  5EY6 A;  1EOG A;  2QC7 A;  4XRA A;  2F9S A;  4TR1 B;  1K0B A;  2HZE A;  2IFQ B;  2MBS A;  4GCI A;  4AF2 A;  4Q5F A;  2AAW A;  1SJI A;  4F9Z A;  1GH2 A;  2FCH A;  3LYK A;  4BVY A;  1TKD B;  2WB9 A;  3HA9 A;  4TXV A;  2XBQ A;  3GTU B;  4MPG A;  1X5E A;  2VM1 A;  1MD4 A;  3F9U A;  1XWC A;  1GUK A;  4DEJ A;  4ZIJ A;  2PMT A;  3M9K A;  3IHQ A;  2GS3 A;  3TKR A;  1SJZ A;  4KCE A;  14GS A;  3TCO A;  2X99 A;  2GTU A;  1F9M A;  2GVP A;  4IS0 A;  1NW2 A;  2PER A;  3HDC A;  2C3Q A;  1X9W B;  5IO0 A;  5HR3 A;  5GZZ B;  3WT2 A;  4ZIL A;  2X4A A;  4J2F A;  3GKX A;  4HI7 A;  3QAW A;  2GST A;  4MH2 A;  2XPE A;  4LMW A;  3E3E A;  3CMI A;  4ZB8 A;  3V1W A;  2QKE A;  3L4N A;  4IQ1 A;  2VL2 A;  4F2I A;  3LJR A;  1SJ6 A;  2I9H A;  2P0G A;  3M9J A;  3F0I A;  1SL0 B;  4ECC A;  3DVX A;  3SBC A;  4JRR A;  3QOU A;  4XS4 B;  2R4V A;  3ZIV A;  3GKN A;  5CRH A;  4EXJ A;  3EMP A;  1H4O A;  2DJK A;  5AIV A;  2DJ3 A;  1JZO A;  5CRW A;  1OC9 A;  2EC4 A;  5JWQ B;  3RPN A;  4KF9 A;  4KE3 A;  2VLT A;  4G0K A;  2G0F A;  2H72 A;  12GS A;  3IRA A;  2BMX A;  4KUN A;  4KGI A;  1BYE A;  1SU9 A;  3HXS A;  1GSQ A;  1FW1 A;  2YWI A;  3IE3 A;  2DSA A;  1M2A A;  1KBN A;  2K8S A;  3ZL5 A;  1AAZ A;  4KDY A;  4NAX A;  1LJR A;  2N5A A;  3TKS C;  1Z3E A;  3D6I A;  2MYG A;  3GH6 A;  3MAK A;  4MF7 A;  5DAK B;  1X5D A;  3LEF A;  4V1A g;  1GL8 A;  5G5F A;  3L9U A;  11GS A;  1TRS A;  1TK5 B;  3F63 A;  5INY A;  3E9J B;  1PA3 A;  2K6V A;  3I6A A;  1R5P A;  2JAD A;  4N0Z A;  3GL3 A;  3EU3 A;  4D73 B;  2R6K A;  3HYP A;  4HS1 A;  1EGO A;  1AUC A;  1GUH A;  4N0V A;  3UL3 A;  4IEL A;  1XVQ A;  1A0F A;  2P5R A;  1W89 A;  5ID2 B;  1SK0 A;  4ICY A;  2MMA A;  1K0A A;  4USS A;  5J9C A;  2GQK A;  3Q19 A;  1EGR A;  2BJX A;  4X0X A;  1G6Y A;  1QMV A;  3TOU A;  5JWR B;  4ZBD A;  4PUR A;  1M7T A;  1FG4 A;  6GSV A;  5CNW A;  2PU9 C;  2IN3 A;  2B5E A;  2ON7 A;  3CSJ A;  5EPF A;  3IOS A;  1GWC A;  4GXZ A;  3TKS A;  1FO5 A;  4IBP A;  3A5I A;  2VCQ A;  3UEM A;  3SWL A;  4IJ3 A;  4KSM A;  3H79 A;  4ZBB A;  4XS4 A;  8GSS A;  2CX3 A;  2F51 A;  2LQO A;  4NV2 A;  4GLT A;  3FK8 A;  1AXD A;  4MNN A;  2GLR A;  4NXI A;  3LG6 A;  1TK0 B;  2ZUP A;  1T00 A;  3HJO A;  3P2A A;  2H0H A;  2VL9 A;  2IIY A;  5IPG A;  4PQI A;  3ZMK A;  2YJH A;  3D4T A;  3DRN A;  1S3D A;  4G9H A;  4Z2U A;  4GST A;  4MDC A;  3TJJ A;  3C7M A;  2YJ7 A;  3D22 A;  2KP2 A;  5GAP D;  1LBK A;  3DYR A;  4NPB A;  3QDN A;  1SD9 A;  2A2S A;  6GSS A;  2OJL A;  5HR0 A;  1A2M A;  3A2W A;  4YKF A;  1KNG A;  4FH8 A;  5JCG A;  4BWQ A;  1S3A A;  4DSS B;  1MDK A;  2NTO A;  2VLV A;  2TRC P;  4RUV A;  2OAC A;  3O76 A;  6GSY A;  2GT5 A;  4QL9 A;  1AIU A;  2E2G A;  3IAM 2;  1U3A A;  3I9V 2;  4K0N A;  2V6K A;  4ECJ A;  5IOX A;  2LUS A;  4D73 A;  4JU5 A;  3WGD A;  5CRG A;  1XWK A;  3TJG A;  4FYC A;  3N9J A;  3ERG A;  4F82 A;  2AV4 A;  4EO3 A;  1G0T A;  2I3Y A;  1NHO A;  3MSZ A;  1T1V A;  4ZL8 A;  4PX1 A;  4TOP A;  4WKW A;  5CAX A;  5G1L A;  3GN3 A;  1TP9 A;  2H19 A;  1PX7 A;  4XHM A;  2LKU A;  1SEN A;  1EEJ A;  1DE1 A;  22GS A;  4NMU A;  3H4K A;  2K8V A;  2H66 A;  3LSZ A;  3HCZ A;  2JU5 A;  4RI6 A;  1ERV A;  3ZIT A;  1WMJ A;  3UVT A;  1K0M A;  4F03 A;  1EV9 A;  3VWV A;  2JSY A;  5KN1 A;  3CXG A;  4AJ6 A;  1V58 A;  1V40 A;  2CQ9 A;  2DBC A;  2IPA A;  2B1K A;  1SK2 A;  1QK8 A;  5AIX A;  2OBI A;  2C1Y A;  3CTG A;  3FZ5 A;  4GRF A;  5F05 A;  1RK4 A;  5ECQ B;  3F6F A;  2KUC A;  2AYT A;  5ECS A;  3P7X A;  5IMD A;  1BAY A;  1F3B A;  2C80 A;  19GS A;  2WGR A;  3R3E A;  1XIY A;  3DML A;  1PSQ A;  4KCA A;  2LST A;  4CY6 A;  3IK7 A;  2E7P A;  4YKG A;  2VAF A;  4IGJ A;  4QQ7 A;  5L71 A;  2IMK A;  3IA1 A;  4E8H A;  4DSS A;  5F0G A;  1J9B A;  2EIO A;  4IKH A;  2DIZ A;  3IC4 A;  4OCF A;  5B6M A;  3A2X A;  4K7O A;  1CQG A;  2FHE A;  1VF3 A;  1NSW A;  4V1A p;  1F2E A;  5BMU A;  3GV1 A;  2YWO A;  4X1U A;  4MZB A;  4OMV A;  1ERW A;  2RII A;  1QGV A;  4IJI A;  4WBR D;  3R2Q A;  4KX4 A;  2MMZ A;  4NHZ A;  2DIY A;  3PIN A;  1PGT A;  1GSS A;  4J56 E;  3P90 A;  2PPT A;  3TJK A;  1B48 A;  2WDU A;  3PH9 A;  4ZB6 A;  3QCP A;  1K3L A;  1G7E A;  4NV5 A;  1MEK A;  4IHU A;  1PL1 A;  5DBQ A;  2A2R A;  2DLX A;  5KN2 A;  2JAC A;  3GA4 A;  3FEU A;  1USB A;  1GSE A;  1PN9 A;  2AJQ B;  3HD5 A;  3CRU A;  4CY8 A;  1I5G A;  1Z5Y E;  1FVK A;  3CYN A;  4K0G A;  2HNL A;  2X8C A;  6GSW A;  1K0D A;  2VM2 A;  3A5W A;  4HU7 A;  2YN1 A;  2Z9S A;  4HZ2 A;  4ZB9 A;  1TRV A;  1OC8 A;  3DIE A;  3C73 A;  5KOW A;  1A24 A;  4POL A;  4EUY A;  4I8B A;  5HR2 A;  3CSI A;  1O8X A;  2RUF A;  4WR4 A;  1ZOF A;  1LU4 A;  1M2D A;  1O8W A;  2NPB A;  3ME7 A;  5G1K A;  1A8Y A;  1V57 A;  4ML1 A;  4N11 A;  1K0O A;  1MDJ A;  4TN8 A;  2L5O A;  2X8H A;  2WRT A;  4WXT A;  4K2X A;  2GQL A;  4EC0 A;  5D9W A;  3O6T A;  3VPT A;  4OO4 A;  5H5Q A;  1QQ2 A;  1U6T A;  17GS A;  4IVF A;  2YOI A;  3UMA A;  1EEM A;  2FWE A;  1UN2 A;  4H86 A;  4GWR A;  1G7O A;  2R0G A;  5DAL B;  1DUG A;  1XCC A;  3APS A;  2NDO A;  3LYP A;  2MMN A;  4F0C A;  1V9W A;  2DJJ A;  1GSF A;  2HE3 A;  5E4W A;  5G30 A;  1TRW A;  3KIJ A;  2FLS A;  4HUA A;  1TJD A;  3F4S A;  1WP0 A;  5C00 A;  2CZ2 A;  4HEA 2;  1TW9 A;  2N5F A;  5ECI B;  4O5R A;  5HFI A;  1O7U A;  2FA8 A;  2PVO C;  2YCD A;  4XS6 A;  3EE2 A;  4HQZ A;  2QGV A;  1E2Y A;  3ZVJ D;  5D9V A;  5B8B A;  3E0U A;  2H0G A;  4L0W A;  1ZL9 A;  1YKA A;  3BOA A;  2HYX A;  2AUV A;  3GL5 A;  4JBB A;  2GSS A;  2HRN A;  4FYU A;  1ERU A;  5KN3 A;  4HDE A;  4XS1 A;  1XWB A;  4ML6 A;  1FB6 A;  1ML6 A;  3FZ4 A;  2LTK A;  13GS A;  1VRS D;  5A5K A;  3UIW A;  1A8L A;  7GSS A;  3EU4 A;  4GTU A;  1TU8 A;  1WPI A;  5ABR A;  1EWX A;  1OVN A;  1BX9 A;  3ZFL A;  1Z7R A;  2VUP A;  4K7N A;  1EV4 A;  4A5P A;  5ECM B;  3ZML A;  2M80 A;  2IMD A;  4BWS A;  3J7Y k;  2B1L A;  4MAB A;  2E0Q A;  5AN1 A;  2CA8 A;  2HLS A;  3LGC A;  3GKK A;  4WF4 A;  5F8B A;  2RUE A;  3C71 A;  1PD2 1;  2D2Z A;  4BVX B;  1JZR A;  1E6B A;  3EVI A;  5FWG A;  1SL1 B;  2IMF A;  5KEJ A;  2IMI A;  2FGX A;  4PQ1 A;  6GST A;  3A2V A;  3FY7 A;  4XRD A;  1WIK A;  3P8W A;  3D0Z A;  4MJC A;  1IYH A;  2YPM A;  4FO5 A;  2LNT A;  1M0U A;  3F8U A;  4TVE A;  1YEX A;  1SYX A;  3F4R A;  3GRX A;  3C8E A;  5IPH A;  3IK9 A;  3QFB C;  5LNK e;  4TR1 A;  5DAL A;  4BL7 B;  1PL2 A;  3MDK A;  1MDI A;  2IFQ A;  2R0P A;  1FB0 A;  3ERW A;  3IC8 A;  2IJY A;  2WS2 A;  4EF0 A;  1A2J A;  3GIX A;  2HI7 A;  3GTU A;  3W6G A;  1ABA A;  3ZFB A;  2HRA A;  3GUS A;  2IWT A;  2YAN A;  1THO A;  3W8S A;  1OE8 A;  1M99 A;  1YY7 A;  1QFN A;  4ZXG A;  4IQA A;  3H8Q A;  1XFL A;  3VI7 A;  3UAP A;  4MF6 A;  3ERF A;  2GGT A;  4ACS A;  3HZ4 A;  3VWW A;  3UAR A;  3GX8 A;  2C8U A;  4MCU A;  3UJ1 A;  1TI3 A;  3US3 A;  3HY2 A;  4Z2T A;  4Q5Q A;  3ME8 A;  1W4V A;  3LXT A;  1C72 A;  1WE0 A;  5ECK B;  2XBI A;  1B8X A;  4BA7 A;  5A4W A;  3IDV A;  1HYU A;  5DCG A;  1JFU A;  1T4Z A;  3FZ9 A;  5JCW A;  3FR3 A;  4RQR A;  2YV9 A;  9GSS A;  4HOJ A;  4WR5 A;  3TKP A;  1HNA A;  1WOU A;  1VF4 A;  1R5A A;  2LRC A;  1GTI A;  1K3O A;  1KEB A;  4ECI A;  3BCI A;  3EMX A;  2JL4 A;  4ISD A;  2GDR A;  1YEP A;  3G9B A;  4PNF A;  2NBS A;  3TRP A;  3UBK A;  2CAQ A;  5CP1 A;  3EIN A;  4V2L A;  3I69 A;  4IN0 A;  1J08 A;  1FAA A;  2XPD A;  5J5N A;  1VF1 A;  1M9B A;  3TGZ A;  2MBT A;  3GKM A;  2VLU A;  4L8E A;  2GZZ A;  3ZYW A;  2NVL A;  5DAK A;  1U88 A;  2F3M A;  1RW1 A;  5IO2 A;  5LD0 A;  3D4M A;  5KN0 A;  3IV4 A;  4BL7 A;  3KH7 A;  2H6X A;  3LOR A;  4K5R A;  1ZCP A;  5B6N A;  3IR4 A;  4YQU A;  5FT3 A;  3QFA C;  4PNG A;  1DE2 A;  1JLW A;  1UA5 A;  2B7K A;  2B5X A;  2FUG 2;  1X9S B;  3Q18 A;  4HZ4 A;  2QA1 A;  3N5O A;  2X8G A;  1SD8 A;  1B9Y C;  2GZY A;  5ID2 A;  1ZZY A;  4I5Q A;  4CHS A;  1TTZ A;  2FWH A;  1OYJ A;  1V98 A;  4N30 A;  5ELA A;  5GSS A;  2JSZ A;  1XBS A;  3L9S A;  3FZA A;  4FQU A;  3GSS A;  2H1D A;  3BJ5 A;  4L0U A;  5J3R A;  5H5S A;  3KJY A;  3WGX A;  1SL2 B;  5DCH A;  1OAZ A;  1JHB A;  1ERT A;  4ZBA A;  3K8N A;  1N2A A;  4K9Z A;  5IMA A;  1B9X C;  4MP4 A;  1T3B A;  3ISO A;  1GTB A;  2HXK A;  4JR6 A;  2YP6 A;  4EKZ A;  4YAP A;  2B6M A;  2YZH A;  2JZT A;  2VCZ A;  4AJ7 A;  3ED3 A;  3MNG A;  3O3T A;  2KOK A;  2B5Y A;  5G2Z A;  1HQO A;  2HSH A;  5H5R A;  2L6C A;  1ST9 A;  4J57 E;  3VWX A;  3QPM A;  5LCZ A;  1PKZ A;  3EPT A;  1TDI A;  4MJA A;  5ENU A;  3APQ A;  2WFC A;  1X0R A;  2FD3 A;  4PXO A;  3GMF A;  5C04 A;  4EIP A;  1GSU A;  4DSR A;  1URM A;  4WF5 A;  20GS A;  1RQM A;  2H75 A;  2R3X A;  3PR8 A;  4DSQ A;  5A4V A;  2PN8 A;  4WBJ A;  2V6O A;  3LQ7 A;  1A23 A;  5JWO B;  3D5J A;  4IP1 A;  2AHE A;  3Q6O A;  4GF0 A;  3MIX A;  1GNE A;  1AQV A;  2ES7 A;  2X64 A;  5GAN D;  1XWG A;  3F6D A;  1YJ6 A;  1PRX A;  1F3A A;  2J23 A;  2FWG A;  3JCM L;  1SK1 A;  5CRD A;  3GUR A;  1O85 A;  4AJ8 A;  5DDL A;  3KMO A;  1R7H A;  2R37 A;  2LRT A;  4G10 A;  5CO3 A;  1OKD A;  1EZK A;  3TKQ A;  1QXH A;  2R2J A;  2I4A A;  4OO5 A;  2PUK C;  2L57 A;  3GX0 A;  3TJF A;  2OAD A;  3ZTL A;  3CSH A;  2YWM A;  5IMF A;  4F0B A;  4BPY A;  2C3N A;  1X9M B;  2PBJ A;  1CQH A;  5IM9 A;  3MWH A;  4G2E A;  2DKH A;  2BTO T;  1XPV A;  2DMM A;  1O6J A;  2FY6 A;  4TRX A;  4P3Y B;  3M0F A;  3RDW A;  3TDG A;  2O7K A;  5DQY A;  3QAG A;  3PPU A;  3FMW A;  2N5B A;  4K5S A;  3TB2 A;  2IL3 A;  1GUM A;  4L5O A;  2VCT A;  4TKY A;  5A4U A;  2HFD A;  2RLI A;  4AGS A;  6GSX A;  3GFK A;  3VPQ A;  3MYD A;  2QA2 A;  4K1F A;  3RPP A;  5JCU A;  3QMX A;  2R5G A;  2ALB A;  4V2M A;  4ID0 A;  4HJM A;  3FW2 A;  2I81 A;  3WD6 A;  3ZRD A;  3KGK A;  2O87 A;  4GSN A;  1QUW A;  1JLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...