4BA7A

Crystal structure of ancestral thioredoxin relative to last bacteria common ancestor (lbca) from the precambrian period
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
b'SVIEINDENFEEEVLKSDKPVLVDFWAPWCGPCRMIAPIIEELAEEYEGKVKFAKVNVDENPETAAKYGIMSIPTLLLFKNGEVVDKLVGARPKEALKERIEKHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LBCA THIOREDOXIN
publication title Conservation of Protein Structure Over Four Billion Years
pubmed doi rcsb
source organism Synthetic construct
molecule tags Oxidoreductase
total genus 30
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 4.7.1.4:
pdb deposition date 2012-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ba7A00
2DJ1A 3DGQA 2C0FA 3HKRA 3L9UA 2C0EA 4GRFA 5KN1A 2WCIA 4KAEA 2DLXA 5ECRB 4ZILA 2YN1A 5LCZA 4K7IA 3HA9A 2O89A 4EUYA 3RHCA 3EMXA 3F4RA 1HNCA 2E2MA 2DJKA 4OWYA 2R3XA 3BOAA 1M0UA 3AY8A 3KIJA 5HFIA 2L5LA 2NBSA 3M8NA 4OFNA 2VD0A 2RM5A 4ZL7A 5HR1A 3CRUA 4ECJA 3ZRDA 1UVZA 2H19A 2LQOA 3DIEA 2LJAA 2JZSA 3TKSE 5F06A 2HSHA 2WB9A 4BL7A 3FZ5A 1N2AA 1B9YC 2AHEA 1PX6A 2OE1A 4EKZA 3BJ5A 3ZFLA 4IP6A 2E0QA 2EIRA 3HZ8A 3PH9A 5D9VA 5ECPB 3SBCA 2IN3A 2IMIA 1J08A 3VWUA 4JRRA 1H75A 2HXKA 1F6MC 3WT1A 3C71A 1TK5B 4E8HA 2YANA 2VL2C 4F0BA 5DCGA 1A2JA 2VCQA 1WWJA 3R2QA 5D96A 4V1Ap 1U6TA 3W8SA 1X5EA 2H1AA 4WF4A 3GH9A 2R4VA 2LSTA 2V2GA 3ZLPA 3IE3A 2BMXA 3QPMA 1MD3A 1ERWA 2B1KA 1ML6A 4F0CA 1QQ2A 1EZKA 1X5CA 4G10A 2QGVA 5CP1A 1X0RA 1OKTA 5LNKe 4DSRA 4MJBA 1GULA 1TK0B 3DXBA 5D9XA 3H8QA 4EF0A 2V6OA 2OADA 5CO3A 3IRAA 2LTKA 1T3BA 2C4JA 5ID2A 3A2WA 2CVBA 2RLIA 3FK8A 1X5DA 1GNEA 1KEBA 4CDOA 3TKSC 2ES7A 2RM6A 2VLVA 4TOPA 5H5RA 2H76A 3P2AA 5E59A 5J9CA 5ECSA 3N9JA 2LQQA 3UL3A 2FHEA 1SK2A 5ECLB 3WGEA 4V1Ag 1O6JA 3UBKA 3KMNA 3GKNA 2XC2A 5LD0A 5ID2B 3GSSA 4K0NA 3H79A 3WGXA 3DVXA 5G5EA 1VF1A 4KCAA 1JZOA 4ZB8A 1UA5A 1BAYA 2BTOT 3LG6A 1GLPA 1PKWA 1Z6MA 1RW1A 2RUEA 1M2DA 1XPVA 5ECHB 2TRCP 2VIMA 3SWLA 4AF2A 4ECIA 4ULXA 1V9WA 2MYGA 3UBLA 1A8YA 4V2MA 3IAS2 1DBYA 5DAKA 3UVTA 1GUHA 3DYRA 1GTAA 3LXTA 2GQMA 2H1BA 2F8FA 1TDIA 1GSDA 9GSSA 5EL8A 2H8LA 4RI7A 4YQMA 4BWQA 1HD2A 2FWFA 2ZCTA 4ML1A 1A0RP 2YWIA 4MP4A 3F6FA 2IIYA 4BVXA 5IO0A 4NWYA 3CRTA 2H6ZA 2MZCA 2WS2A 1SKRB 3GKMA 4ZBDA 2K18A 1PSQA 2PPTA 1HQOA 1Z7RA 3VK9A 3EYTA 1AIUA 3J7Yk 5DAKB 3M9JA 3LXZA 3D0ZA 3P7XA 5CREA 2NVLA 1ZMAA 2VL3A 4N10A 2DIYA 2LRCA 4DEJA 2GT6A 1ERTA 3G9BA 3ZYWA 2GSTA 4XRAA 2QSIA 1GWCA 3WD6A 5DALA 4Q5RA 3F3QA 3IBHA 4XIHA 1JLWA 2LRNA 1GNWA 1XWBA 1DE1A 2JSYA 5D73A 5DJLA 3EWLA 4GLTA 4NHWA 1SL2B 2DMLA 2CZ3A 3IDVA 3VWWA 5G1KA 1EEJA 4IJIA 1T7PB 1TW9A 1GSEA 3HVXA 2IFQA 3KTBA 2GZZA 2AV4A 2QKEA 2HRFA 4WEYA 10GSA 2CA8A 1F3BA 5JWRB 4HUAA 1NW2A 2H71A 1TXXA 4LMWA 1E6BA 5GAPD 2GSRA 2A4VA 4ZL8A 3HZ4A 2GQLA 2K9FA 5H5QA 4V2NA 5AISA 1R4WA 2VM2A 1TK8B 2N5FA 4GQCA 2DJ3A 4HU9A 4N0ZA 3LWAA 2D2ZA 3IOSA 4IKHA 1OVNA 3UIWA 4PGTA 2R37A 2CT6A 1ZGNA 3KZQA 4MF6A 3GIXA 3F4SA 4MF5A 1GSFA 5IOWA 4F82A 4OO4A 2LNSA 4AJ6A 4WXTA 2R6KA 3WT2A 4CW9A 1T1VA 1QXHA 1YEXA 2XPDA 2B1LA 5IO2A 5DQSA 4MJAA 1OKDA 3J7Yb 2OA7A 5JCWA 12GSA 4G19A 2XBIA 1B4PA 4RQXA 2OACA 2IJYA 2XPEA 5CAXA 2HZEA 3V1WA 1FAAA 1A24A 3VPQA 3VWXA 2YNXA 4TVEA 3GKKA 3C1SA 2L5OA 2YV7A 4G2EA 2DJJA 4IBPA 2H1GA 3HYPA 5ECQB 3G7YA 2B5XA 1K0DA 1XWCA 1NHYA 1G6YA 5IIZA 2LNTA 3M3MA 16GSA 3F8UA 3FR3A 2H0GA 2H1DA 2PVQA 4H86A 4MF7A 4TRXA 2VCXA 1YY7A 1Q98A 5KN0A 4TR1A 2WRTA 3KXOA 4GF0A 1O73A 4K6XA 2P0GA 5AIXA 3KCMA 2ZUPA 5HR3A 3DEXA 3LFLA 4WF5A 2H66A 1TU7A 3ERWA 4PUAA 2HSYA 1E2YA 1O85A 2P31A 2LEGA 2KP2A 4ISDA 3IPZA 2OKAA 3E3EA 4YH2A 4DSSA 5ECMB 4MPFA 1TRSA 5IMAA 3KH9A 1WOUA 2I1UA 4TR1B 4HZ4A 2H6YA 3GTUA 3PINA 4BPYA 3TB2A 3CBUA 3EE2A 3QFAC 3HHVA 5J4UA 1AQVA 1B48A 3MWHA 3UEMA 2L6DA 4WR4A 1KNGA 2H6XA 3VFIA 1EGOA 2GSQA 1S3CA 1V57A 3D22A 1XWKA 4XCSA 4TR0A 5IQYA 4KUNA 2L59A 3DMLA 4PQHA 3LEFA 1PX7A 2WULA 2GTUA 3H4KA 1WP0A 4XRDA 1ABAA 1PKZA 2XHFA 5CRGA 5DJMA 3CSIA 5KN3A 4N0VA 2DC5A 1T00A 3LORA 4TN8A 4KDYA 4FYCA 2IMEA 5GAND 18GSA 3MAKA 2P5QA 3KMOA 3L4NA 1M9AA 1FVKA 1HNBA 1K0AA 1V40A 5AGYA 1XCCA 2MMAA 3MSZA 4GCIA 1M9BA 1OE8A 4LLRA 3KTLA 1YF0A 4L5LA 4ZXGA 1XOAA 1T4YA 4ZL9A 3QD9A 1A0FA 1M2AA 5J9BA 3QAGA 5ELGA 1ZCPA 2TIRA 3GL3A 4HS1A 4BVYA 1SD9A 3GL5A 5DQYA 1GLQA 1G6WA 5L71A 1CQGA 4KSMA 1V2AA 5COHA 1TI3A 2WDUA 3RPNA 3DD3A 4PURA 3O76A 1U88A 2G2QA 2XBQA 3M1GA 5DDLA 3FEUA 3LYKA 4WBJA 4HEA2 3RBTA 3HVVA 4D73A 2CAQA 1USBA 4V2LA 3ME7A 4NAXA 1SK1A 1URMA 2B7KA 3P8WA 4ILFA 2GS3A 1YKCA 3TKQA 1DSBA 5D9TA 1DE2A 4J56E 4JBBA 3TJGA 3K8NA 2K8SA 2OE0A 4I8BA 3RHBA 22GSA 2RIIA 1K3OA 4F2IA 2IL3A 1PL1A 1S3DA 2IPAA 4X43A 3CYNA 1SU9A 2YWNA 2DMMA 5KN2A 3F4TA 5ECNB 3CXGA 5ECIB 3TJFA 5HR0A 2CX3A 3ZIVA 4ZIJA 1NM3A 2WJUA 4I6XA 1TRUA 3E0UA 3GH6A 3MNGA 1AUCA 1PQNA 2CZ2A 5DBQA 3QAVA 2B5YA 4HI7A 4N30A 4MLYA 2YPMA 1FHEA 3LSZA 1ACVA 5EY6A 1Q4JA 2VCZA 3I6AA 3HDCA 1M2BA 4J57E 1WRYA 2X8GA 4EO3A 3HXSA 4TR3A 3S9FA 1GSQA 4F03A 3N5OA 2J9HA 3I43A 3KGKA 4KB3A 1TP9A 4AJ7A 1LBKA 2KHPA 3LQ7A 2HE3A 2MMNA 3IA1A 4Q5FA 5AN1A 4OFMA 2LJKA 3TRQA 1VF3A 4ECBA 5AIVA 3HD5A 3UVHA 1JHBA 1ST9A 2X8HA 2NDOA 2PBJA 4RQRA 5G30A 1G0TA 1QMVA 4ZB9A 4IJ3A 2NPBA 3FY7A 3UOMA 6GSWA 1MDJA 2CX4A 3LJRA 5HFKA 3CTGA 3D21A 2H0IA 2H70A 2FNOA 1LJRA 3KP9A 5IM9A 5D93A 5D9WA 1YF1A 1SK0A 2RUFA 6GSXA 5J5NA 3BD2A 2JU5A 2VM1A 1FO5A 4MJEA 3VI7A 1Z3EA 1XOBA 1K3LA 2J23A 3F0IA 2AUVA 4K7OA 4JZQA 4POKA 2ALBA 4MA9A 1TOFA 4MDCA 2B5EA 3H1NA 1XVWA 4IHUA 4GXZA 2O7KA 5B6NA 4OO5A 1F2EA 3L9VA 1PD21 4YAVA 1EWXA 1ON4A 3GX0A 1TKDB 2IWTA 19GSA 4I5QA 2C1YA 11GSA 3G7IA 5G5FA 4I97A 5G2ZA 4RI6A 2ON5A 3EURA 5HFGA 1YQ1A 3HCZA 1HYUA 2EC4A 1V98A 4GSSA 4OD7A 6GSVA 2GSSA 1K0NA 2VLUA 5JCGA 2JZRA 2OJLA 4ML6A 3BCIA 2YWMA 3EU3A 3PR8A 13GSA 3CSHA 5F05A 2GZYA 3EMPA 3EU4A 3TOUA 3BBYA 3DVWA 5FT3A 4MMMA 3MDKA 3APOA 2R2JA 4GQFA 2MMZA 3D5JA 5DALB 3F63A 1BEDA 1Y6EA 2PUKC 2DIZA 2HYXA 5A4UA 1EOHA 1LU4A 4AGSA 4LL4B 3TKPA 1NSWA 1BJXA 2VCTA 4OCEA 3TKRA 1GRXA 1EGRA 4LA1A 2AB6A 2VL2A 2IFQB 4KH7A 1B4QA 2I3YA 14GSA 3QAWA 2X8CA 6GSSA 4K7NA 4PQ1A 3TRPA 2X99A 2FD3A 1XXUA 2MBSA 4MZWA 2O85A 1THOA 4ECCA 1BX9A 3LYPA 5IMCA 3U5RE 3TOTA 3NOFA 1JZDA 4MZBA 3TCOA 1QUWA 4P3YB 1A2MA 4HQZA 4FH8A 2KUCA 2N5BA 1FW1A 1ZL9A 1FVJA 3UMAA 2C0GA 4KE3A 4HOJA 4J2FA 1GL8A 4HJMA 5J41A 3UAPA 4EDYA 3O6TA 4PUFC 5A4WA 3VLNA 1XW6A 1G7OA 1TRWA 3QOUA 1SYRA 4JU5A 4MPGA 1X9SB 2O87A 3NIVA 3WYWA 2C3TA 3TKSA 2F8AA 2A2RA 2GVPA 2YZUA 4ZBAA 1ZYEA 3U6VA 4K1FA 1J0FA 17GSA 2CQ9A 2F51A 2BJXA 4XS4A 4KDUA 3FW2A 4IP1A 1G7EA 4JR4A 5CRWA 2K8VA 4LL1B 1T4ZA 3FZ9A 2HZEB 4ACSA 2L6CA 5IMFA 4IQ1A 2C3NA 5IOXA 3A2VA 4LMVA 5IMDA 2FGXA 3KEBA 2LUSA 2B3SA 3TDGA 1TI1A 1K0CA 1R5AA 3VWVA 1O8XA 2H72A 4G9HA 4EDZA 1ZZYA 2PERA 3FZAA 4AJ8A 2I4AA 2PMTA 2MMOA 1IYHA 1RK4A 1SJ6A 4MJCA 1FG4A 3ERGA 1AQXA 1SKWB 1T8EB 3C73A 3KM6A 1AC1A 1AAZA 4HZ2A 1PRXA 5C00A 1B8XA 1JFUA 1MTCA 1JZRA 2FWEA 3IK7A 4OMVA 1PMTA 5HQPA 2GDRA 4MH2A 1NHOA 3GURA 2DJ2A 4X1UA 6GSTA 1OC3A 2CVDA 4YQVA 2LV3A 2B6MA 5B8AA 1GSSA 3IV4A 2E2GA 1RQMA 2NTOA 2YJ7A 3RPPA 2N5AA 1EV9A 1OE7A 3C7MA 3EVIA 3RAZA 3GV1A 1SENA 2JL4A 2LJRA 2H01A 4IQAA 2WGRA 3JCML 4DSSB 4KGIA 2HNLA 2YJHA 3TGZA 1ERVA 1K0MA 1GH2A 3F3RA 4BA7A 2LKUA 6GSYA 3GTUB 7GSSA 5B6MA 2VCWA 4KCEA 2M80A 4NXIA 4E8EA 1OC9A 5B7CA 4WKWA 1AQWA 1K0BA 2P5RA 1GTBA 1SL0B 3ISOA 1OC8A 5C04A 3FRCA 2C3QA 5IPGA 2HT9A 4HDEA 1ZYQB 5F0GA 1WJKA 2VAFA 1SD8A 1A2LA 1QK8A 3ZZXA 1GUMA 3FZ4A 2IMFA 5F07A 1QGVA 2V32A 1FB6A 2GT5A 5CYYA 3FR6A 4EVMA 4BWSA 2FWHA 2QC7A 2FCHA 2HFDA 4MABA 2C80A 4Q5QA 3C1RA 1R7HA 3ZMKA 1R5PA 2GQKA 1PA3A 1XW5A 3TJJA 1Y25A 4NPBA 4L0UA 4X0XA 1VF4A 2LS5A 1CQHA 2H74A 3ZTLA 3NZNA 3VI5A 3A5WA 3QCPA 4K8MA 3L0HA 4IGJA 3H93A 3L9SA 2AYTA 3P90A 2GGTA 1JLVA 5F8BA 1BG5A 2F3MA 2KLXA 3OR5A 4KX4A 5HR2A 1X9WB 3I69A 4MK3A 3GMFA 3TJBA 3RDWA 1WMJA 1F3AA 2WZ9A 2YZHA 5ENUA 1MD4A 4RUVA 2HI7A 3FHKA 4D73B 1EP8A 1YZXA 3US3A 1WPIA 1MDKA 4MZCA 3HJPA 4GWRA 3HJOA 3KJYA 5A5KA 2FWGA 2GLRA 4TW5A 5JWOB 5E4WA 4WR5A 1XWGA 1J9BA 2ZNMA 3IHQA 1WIKA 4K0GA 1Z5YE 3ZREA 2CVKA 1AW9A 3ED3A 4JR6A 4QL7A 1THXA 4PNGA 4KDXA 5EPFA 2FA4A 4XHMA 2FLSA 4YAPA 5JCUA 3UARA 2CV4A 2JADA 4IN0A 1FB0A 3Q74A 2PGTA 2X64A 2C0DA 1XWAA 1ZOFA 3M0FA 3VPTA 8GSSA 5D8IA 4FO5A 4IS0A 1ERUA 1KBNA 1OYJA 2IMKA 3VURA 4TXVA 1FOVA 3QR6A 2G0FA 2WFCA 5KEJA 1XW9A 4FYUA 5FWGA 1UN2A 4TXOA 3DWVA 4ZB6A 1GP1A 5EVOA 3E9JB 5IMVA 1O7UA 5H5SA 4JE1A 1GUKA 4F9ZA 2V1MA 4O5RA 3D4MA 3GNJA 1M99A 5ECKB 3GX8A 1YDKA 3ME8A 3LGCA 1HNAA 4MCUA 1TU8A 2EIOA 1R26A 4K2DA 2I81A 3Q6OA 1EV4A 3DKSA 1GSYA 4O92A 3GRXA 4TXOB 5INYA 1V58A 2C8UA 1TJDA 2L4CA 2AAWA 2L57A 1U3IA 3M9KA 3IC4A 1VF2A 1XBSA 2HLSA 5IMZA 5DVBA 1BYEA 2H30A 4OCFA 1N8JA 1MDIA 2VLTA 4L0WA 3ZMLA 3C8EA 1UC7A 2OBKA 4KA0A 3APQA 2V41A 4POLA 1F9MA 1K0OA 2DJ0A 1KTEA 4OFTA 1A8LA 1YEPA 4FIWA 3ZVJA 3KD0A 4IW9A 2VCVA 1MEKA 2V6KA 3EINA 3PGTA 1O8WA 3KP8A 3GYKA 3ZIJA 2YP6A 1YKAA 2JACA 4JEDA 2A2SA 5ELAA 4MH3A 1SL1B 2OE3A 4DVCA 3QDNA 5CRDA 2FA8A 3W6GA 3ZITA 5GZZB 3TUEA 1VGLA 1JZWA 4EL1A 2H73A 4EE0A 3GUSA 2R5GA 4QQ7A 1PL2A 4L5OA 2F9SA 2KP1A 2EIQA 4N11A 2H0HA 1QFNA 2VOCA 3CSJA 3HVSA 2FUG2 1TTZA 3TJKA 3KH7A 3FKFA 2YCDA 2K6VA 3CTFA 4IVFA 4O32A 2OBIA 4L8EA 3D4TA 2M46A 3W8JA 2PVOC 3A3TA 5ABRA 5IPHA 2FY6A 1W4VA 2KOKA 2B7JA 3GHAA 2Z9SA 1O81A 3ZFBA 2MBTA 6GSUA 5A4VA 1YJ6A 4NV2A 2VUPA 4XS1A 3ZL5A 1S3AA 3GKXA 2JZTA 5CRHA 2YOIA 4HJ2A 3GA4A 4K9ZA 4ID0A 2TRXA 3GSTA 4DSQA 4NV5A 2L4QA 1H4OA 1PGTA 2ON7A 1SKSB 4EXJA 1A23A 1BQ7A 2H75A 2PN8A 3HY2A 2E7PA 3FR9A 1EOGA 1SYXA 1Z6NA 1W89A 3F9UA 3ERFA 4TKYA 1WE0A 1I9DA 4PNFA 1DUGA 5G1LA 4WBRD 3Q19A 3IAM2 1U3AA 4Q5NA 3UJ1A 2M72A 1PN9A 4NMUA 3WGDA 4CHSA 3EC3A 2PU9C 4FYBA 1I5GA 1XFLA 5J3RA 3A2XA 20GSA 1B9XC 4POMA 1SJIA 5GSTA 2AJQB 4Z7XA 1OAZA 3GN3A 3Q18A 4I2UA 4EC0A 4IELA 1X9MB 1K3YA 3QMXA 4XS4B 4ZBBA 1GSUA 2REMA 4XS6A 1EP7A 3D6IA 3TRXA 4YQUA 3I9V2 2PWJA 3APSA 5B8BA 1U87A 3CMIA 2YV9A 4I2TA 2HRNA 4WETA 1VRSD 5G31A 3G7JA 1AXDA 1Z7PA 2YWOA 3HJMA 4QL9A 4PXOA 2HZFA 2I9HA 2JSZA 2O8VB 1C72A 3IR4A 4KSOA 2CAIA 3BCKA 3O3TA 4HQSA 4GTUA 1ILOA 2VD1A 3DRNA 2GZPA 3FYGA 3IK9A 1GTIA 2IMDA 1TRVA 3GFKA 3ZVJD 1M7TA 1IYIA 2LRTA 4HU7A 1GTUA 1SJZA 3F6DA 4NHZA 4O7HA 3L78A 1F37A 1XVQA 5DCHA 4GSTA 2VO4A 4GSNA 3QFBC 4KW6A 4TR4A 1XZOA 4PQIA 2DBCA 4XTSA 4PX1A 2DSAA 5ECOB 2VL9A 5CNWA 1EEMA 5GSSA 5JWQB 3IXRA 1Z9HA 4POBA 1OC9B 4KNDA 5FHIA 1XIYA
chains in the Genus database with same CATH superfamily
2DJ1A 3DGQA 2C0FA 3HKRA 3L9UA 2C0EA 4GRFA 5KN1A 2WCIA 4KAEA 2DLXA 5ECRB 4ZILA 2YN1A 5LCZA 4K7IA 1PN0A 2O89A 3HA9A 4EUYA 3RHCA 3EMXA 3F4RA 1HNCA 3FMWA 2E2MA 2DJKA 4OWYA 2R3XA 3BOAA 1M0UA 3AY8A 3KIJA 5HFIA 2L5LA 2NBSA 3M8NA 4OFNA 2VD0A 2RM5A 4ZL7A 5HR1A 3CRUA 4ECJA 3ZRDA 1UVZA 2H19A 2LQOA 3DIEA 2LJAA 2JZSA 3TKSE 5F06A 2HSHA 2WB9A 4BL7A 3FZ5A 1N2AA 1B9YC 2AHEA 1PX6A 2OE1A 4EKZA 3BJ5A 3ZFLA 4IP6A 2E0QA 2EIRA 3HZ8A 3PH9A 5D9VA 5ECPB 3SBCA 2IN3A 2IMIA 1J08A 3VWUA 4JRRA 1H75A 2HXKA 1F6MC 3WT1A 3C71A 1TK5B 4E8HA 2YANA 2VL2C 2DKHA 4F0BA 5DCGA 1A2JA 2VCQA 1WWJA 3R2QA 5D96A 4V1Ap 1U6TA 3W8SA 1X5EA 2H1AA 3MYDA 4WF4A 3GH9A 4HSCX 2R4VA 2LSTA 2V2GA 3ZLPA 3IE3A 2BMXA 3QPMA 1MD3A 1ERWA 2B1KA 1ML6A 4F0CA 1QQ2A 1EZKA 5KOXA 1X5CA 4G10A 2QGVA 5CP1A 1X0RA 1OKTA 5LNKe 4DSRA 4MJBA 1GULA 1TK0B 3DXBA 5D9XA 3H8QA 4EF0A 2V6OA 2OADA 5CO3A 3IRAA 2LTKA 1T3BA 2C4JA 4MNNA 5ID2A 3A2WA 2CVBA 3EPTA 1ZYNA 2RLIA 3FK8A 1X5DA 1GNEA 1KEBA 4CDOA 3TKSC 2ES7A 4O5QA 2RM6A 2VLVA 4TOPA 5H5RA 4K2XA 2H76A 3P2AA 5E59A 5J9CA 5ECSA 3N9JA 2LQQA 3UL3A 2FHEA 1SK2A 5ECLB 3WGEA 4V1Ag 1O6JA 3UBKA 3KMNA 3GKNA 2XC2A 5LD0A 5ID2B 3GSSA 4K0NA 3H79A 3WGXA 3DVXA 5G5EA 1VF1A 4KCAA 1JZOA 4ZB8A 1UA5A 1BAYA 2BTOT 3LG6A 1GLPA 1PKWA 1Z6MA 1RW1A 2RUEA 1M2DA 1XPVA 5ECHB 2TRCP 2VIMA 3SWLA 4AF2A 4ECIA 4ULXA 1V9WA 2MYGA 2QA2A 3UBLA 1A8YA 4EIQA 4V2MA 3IAS2 1DBYA 5DAKA 3UVTA 1GUHA 3DYRA 1GTAA 3LXTA 2GQMA 2H1BA 2F8FA 1TDIA 1GSDA 9GSSA 5EL8A 2H8LA 4RI7A 4YQMA 4BWQA 1HD2A 2FWFA 2ZCTA 4ML1A 3IC8A 3LW9A 1A0RP 2YWIA 4MP4A 3F6FA 2IIYA 4BVXA 5IO0A 4NWYA 3CRTA 2H6ZA 2MZCA 2WS2A 1SKRB 3GKMA 4ZBDA 2K18A 1PSQA 2PPTA 1HQOA 1Z7RA 3VK9A 3EYTA 1AIUA 3J7Yk 5DAKB 3M9JA 3LXZA 3D0ZA 3P7XA 5CREA 2NVLA 1ZMAA 2VL3A 4N10A 2DIYA 2LRCA 4DEJA 2GT6A 1ERTA 4X4JA 3G9BA 3ZYWA 2GSTA 4XRAA 2QSIA 1GWCA 3WD6A 4A5PA 5DALA 4Q5RA 3F3QA 3IBHA 4XIHA 1JLWA 2R0PA 2LRNA 1GNWA 4BVXB 1XWBA 1DE1A 2JSYA 5D73A 5DJLA 3EWLA 4GLTA 4NHWA 1SL2B 2DMLA 2CZ3A 3IDVA 3VWWA 5G1KA 1EEJA 4IJIA 1T7PB 1TW9A 1GSEA 3HVXA 2IFQA 3KTBA 2GZZA 2AV4A 2QKEA 2HRFA 4WEYA 10GSA 2CA8A 1F3BA 5JWRB 4HUAA 1NW2A 2H71A 1TXXA 4LMWA 1E6BA 1M3IA 5GAPD 2GSRA 2A4VA 4ZL8A 3HZ4A 2GQLA 2K9FA 5H5QA 4FQUA 4V2NA 5AISA 1R4WA 2VM2A 1TK8B 2N5FA 4GQCA 2DJ3A 4HU9A 4N0ZA 3LWAA 2D2ZA 3IOSA 4IKHA 1OVNA 3UIWA 4PGTA 2R37A 2CT6A 1ZGNA 3KZQA 4MF6A 3GIXA 3F4SA 4MF5A 1GSFA 5IOWA 4F82A 4OO4A 2LNSA 4AJ6A 4WXTA 2R6KA 3WT2A 4CW9A 1T1VA 1QXHA 1YEXA 2XPDA 2B1LA 5IO2A 5DQSA 4MJAA 1OKDA 4YKGA 3J7Yb 2OA7A 5JCWA 12GSA 4G19A 2XBIA 1B4PA 4RQXA 2OACA 4O5UA 2IJYA 2XPEA 5CAXA 2HZEA 3V1WA 1FAAA 1A24A 3VPQA 2A2PA 3VWXA 2YNXA 4TVEA 3GKKA 3C1SA 2L5OA 2YV7A 4G2EA 2DJJA 4IBPA 2H1GA 3HYPA 5ECQB 3G7YA 2B5XA 1K0DA 2HRAA 1XWCA 1NHYA 1G6YA 5IIZA 2LNTA 3M3MA 16GSA 4Z2TA 3F8UA 3FR3A 2H0GA 2H1DA 2PVQA 4H86A 4MF7A 4TRXA 2VCXA 1YY7A 1Q98A 5KN0A 4TR1A 2WRTA 3KXOA 4GF0A 1O73A 4K6XA 2P0GA 5AIXA 3KCMA 2ZUPA 5HR3A 3DEXA 3LFLA 4WF5A 2H66A 1TU7A 3ERWA 4PUAA 2HSYA 1E2YA 1O85A 2P31A 2LEGA 2KP2A 4ISDA 3IPZA 2OKAA 3E3EA 4YH2A 4DSSA 5ECMB 4MPFA 1TRSA 5IMAA 3KH9A 1WOUA 2I1UA 4TR1B 4HZ4A 2H6YA 3GTUA 3PINA 4BPYA 3TB2A 3CBUA 3EE2A 3QFAC 3HHVA 5J4UA 1AQVA 1B48A 3MWHA 3UEMA 2L6DA 4WR4A 1KNGA 2H6XA 3VFIA 1EGOA 2GSQA 1S3CA 1V57A 3D22A 1XWKA 4XCSA 4TR0A 5IQYA 4Z2RA 4KUNA 2L59A 3DMLA 4PQHA 3LEFA 1PX7A 2WULA 2GTUA 3H4KA 2UZ8A 1WP0A 4XRDA 1ABAA 1PKZA 2XHFA 5CRGA 5DJMA 3CSIA 5KN3A 4N0VA 2DC5A 1T00A 3LORA 4TN8A 4G0IA 4KDYA 4FYCA 2IMEA 5GAND 18GSA 3MAKA 2P5QA 3KMOA 3L4NA 1M9AA 1FVKA 1HNBA 4KF9A 1K0AA 1V40A 5AGYA 1XCCA 2MMAA 3MSZA 4GCIA 1M9BA 1OE8A 4LLRA 3KTLA 1YF0A 4L5LA 4ZXGA 1FOHA 1XOAA 1T4YA 4ZL9A 3QD9A 1A0FA 1M2AA 5J9BA 3QAGA 5ELGA 1ZCPA 2TIRA 3GL3A 4HS1A 4BVYA 1SD9A 3GL5A 5DQYA 1GLQA 1G6WA 5L71A 1CQGA 4KSMA 1V2AA 5COHA 1TI3A 2WDUA 3RPNA 3DD3A 4PURA 3O76A 1U88A 2G2QA 2XBQA 3M1GA 5DDLA 3FEUA 3LYKA 4WBJA 2HRKA 4HEA2 2HSMA 3RBTA 3HVVA 4D73A 2CAQA 1USBA 4V2LA 3ME7A 4NAXA 1SK1A 1URMA 2B7KA 3P8WA 4ILFA 2GS3A 1YKCA 3TKQA 1DSBA 3R3EA 5D9TA 1DE2A 3IHGA 4J56E 4JBBA 3TJGA 3K8NA 2K8SA 2OE0A 4I8BA 3RHBA 22GSA 2RIIA 1K3OA 4F2IA 2IL3A 1PL1A 1S3DA 2IPAA 4X43A 3CYNA 1SU9A 2YWNA 2R0CA 2DMMA 5KN2A 3F4TA 5ECNB 3CXGA 5ECIB 3TJFA 5HR0A 2CX3A 3ZIVA 4BL7B 4ZIJA 1NM3A 2WJUA 4I6XA 1TRUA 3E0UA 3GH6A 3MNGA 1AUCA 1PQNA 2CZ2A 5DBQA 3QAVA 2B5YA 4HI7A 4N30A 4MLYA 2YPMA 1FHEA 3LSZA 1ACVA 5EY6A 1Q4JA 2VCZA 3I6AA 3HDCA 1M2BA 4J57E 4YKFA 1WRYA 2X8GA 4EO3A 3HXSA 4TR3A 3S9FA 1GSQA 4F03A 3N5OA 2J9HA 3I43A 3KGKA 4KB3A 1TP9A 4AJ7A 1LBKA 2KHPA 3LQ7A 2HE3A 2MMNA 3IA1A 4Q5FA 5AN1A 4OFMA 2LJKA 3TRQA 1VF3A 4ECBA 5AIVA 3HD5A 3UVHA 1JHBA 1ST9A 2X8HA 2NDOA 2PBJA 4RQRA 5G30A 1G0TA 1ZYPA 1QMVA 4ZB9A 4IJ3A 2NPBA 3FY7A 3UOMA 6GSWA 1MDJA 2CX4A 3LJRA 5HFKA 3CTGA 3D21A 2H0IA 2H70A 2FNOA 1LJRA 3KP9A 5IM9A 5D93A 5D9WA 1YF1A 1SK0A 2RUFA 6GSXA 5J5NA 3BD2A 2JU5A 2VM1A 1FO5A 4MJEA 3VI7A 1Z3EA 1XOBA 1K3LA 2J23A 3F0IA 2AUVA 4K7OA 4JZQA 4POKA 2ALBA 4MA9A 1TOFA 4MDCA 2B5EA 3H1NA 1XVWA 4IHUA 4GXZA 2O7KA 5B6NA 4OO5A 1F2EA 3L9VA 1PD21 4YAVA 1EWXA 1ON4A 3GX0A 1TKDB 2IWTA 19GSA 4I5QA 2C1YA 11GSA 3G7IA 5G5FA 4I97A 5G2ZA 4RI6A 2ON5A 3EURA 5HFGA 1YQ1A 3HCZA 1HYUA 2EC4A 2X49A 1V98A 4GSSA 4OD7A 6GSVA 2GSSA 1K0NA 2VLUA 5JCGA 2JZRA 2OJLA 4ML6A 3BCIA 2YWMA 3EU3A 3PR8A 13GSA 3CSHA 5F05A 2GZYA 3EMPA 3EU4A 4G0KA 3TOUA 3BBYA 3DVWA 5FT3A 4MMMA 3MDKA 4Z2UA 3APOA 2R2JA 4GQFA 2MMZA 3D5JA 5DALB 3F63A 1BEDA 1Y6EA 2PUKC 2DIZA 2HYXA 5A4UA 1EOHA 1LU4A 4AGSA 4LL4B 3TKPA 1NSWA 1BJXA 2VCTA 4OCEA 3TKRA 1GRXA 1EGRA 4LA1A 2AB6A 2VL2A 2IFQB 4KH7A 1B4QA 2I3YA 14GSA 3QAWA 2X8CA 6GSSA 4K7NA 4PQ1A 3TRPA 2X99A 2FD3A 1XXUA 2MBSA 4MZWA 2O85A 1THOA 4ECCA 1BX9A 3LYPA 3CQFA 5IMCA 3U5RE 3TOTA 3NOFA 1JZDA 4MZBA 3TCOA 1QUWA 4P3YB 1A2MA 4HQZA 4FH8A 2KUCA 2N5BA 1FW1A 1ZL9A 1FVJA 3UMAA 2C0GA 4KE3A 4HOJA 4J2FA 1GL8A 4HJMA 5J41A 3UAPA 4EDYA 3O6TA 4PUFC 5A4WA 3VLNA 1XW6A 1G7OA 1TRWA 3QOUA 1SYRA 4JU5A 4MPGA 5BRTA 1X9SB 2O87A 3NIVA 3WYWA 2C3TA 3TKSA 2F8AA 2A2RA 2GVPA 2YZUA 2R0GA 4ZBAA 1ZYEA 3U6VA 4K1FA 1J0FA 17GSA 2CQ9A 2F51A 2A4HA 2BJXA 4XS4A 4KDUA 3FW2A 4IP1A 1G7EA 4JR4A 5CRWA 2K8VA 4LL1B 1T4ZA 3FZ9A 2HZEB 4ACSA 2L6CA 5IMFA 4IQ1A 2C3NA 5IOXA 3A2VA 4LMVA 5IMDA 2FGXA 3KEBA 2LUSA 2B3SA 3TDGA 1TI1A 1K0CA 1R5AA 3VWVA 1O8XA 2H72A 4G9HA 4EDZA 1ZZYA 2PERA 3FZAA 4AJ8A 2I4AA 2PMTA 2MMOA 1IYHA 1RK4A 1SJ6A 4MJCA 1FG4A 3ERGA 1AQXA 1SKWB 1T8EB 3C73A 3KM6A 1AC1A 1AAZA 4HZ2A 1PRXA 5C00A 1B8XA 1JFUA 1MTCA 1JZRA 2FWEA 3IK7A 3A5IA 4OMVA 1PMTA 5HQPA 2GDRA 4MH2A 1NHOA 3GURA 2DJ2A 4X1UA 6GSTA 1OC3A 2CVDA 4YQVA 2LV3A 2B6MA 5B8AA 1GSSA 3IV4A 2E2GA 1RQMA 2NTOA 2YJ7A 3RPPA 2N5AA 1EV9A 1OE7A 3C7MA 3EVIA 3RAZA 3GV1A 1SENA 2JL4A 2LJRA 2H01A 4IQAA 5KOWA 2WGRA 3JCML 4DSSB 4KGIA 2HNLA 2YJHA 3TGZA 1ERVA 1K0MA 1GH2A 3F3RA 4BA7A 2LKUA 6GSYA 3GTUB 7GSSA 5B6MA 2VCWA 4KCEA 2M80A 4NXIA 4E8EA 1OC9A 4K5SA 5B7CA 4WKWA 1AQWA 1K0BA 2P5RA 1S3RA 1GTBA 1SL0B 3ISOA 1OC8A 5C04A 3FRCA 2C3QA 5IPGA 2HT9A 4HDEA 1ZYQB 5F0GA 1WJKA 2VAFA 1SD8A 1A2LA 1QK8A 3ZZXA 1GUMA 3FZ4A 2IMFA 5F07A 1QGVA 2V32A 1FB6A 2GT5A 3PPUA 5CYYA 3FR6A 4EVMA 4BWSA 2FWHA 2QC7A 2FCHA 2HFDA 4MABA 2C80A 4Q5QA 3C1RA 1R7HA 3ZMKA 1R5PA 2GQKA 1PA3A 1XW5A 3TJJA 1Y25A 4NPBA 4L0UA 4X0XA 1VF4A 2LS5A 1CQHA 2H74A 3ZTLA 3NZNA 4BVYB 3VI5A 3A5WA 2QA1A 3QCPA 4K8MA 3L0HA 4IGJA 3H93A 3L9SA 2AYTA 3P90A 2GGTA 3HVNA 1JLVA 5F8BA 1BG5A 2F3MA 2KLXA 3OR5A 4KX4A 5HR2A 1X9WB 3I69A 4MK3A 3GMFA 3TJBA 4ICYA 3RDWA 1WMJA 1F3AA 2WZ9A 2YZHA 5ENUA 1MD4A 4RUVA 2HI7A 3FHKA 4D73B 1EP8A 2X4AA 1YZXA 3US3A 1WPIA 1MDKA 4MZCA 3HJPA 4GWRA 1M3JA 3HJOA 3KJYA 5A5KA 2FWGA 2GLRA 4TW5A 5JWOB 5E4WA 4WR5A 1XWGA 4USSA 1J9BA 2ZNMA 3IHQA 1WIKA 4K0GA 1Z5YE 3ZREA 2CVKA 1AW9A 3ED3A 4JR6A 4QL7A 1THXA 4PNGA 4KDXA 5EPFA 2FA4A 4XHMA 2FLSA 4YAPA 5JCUA 3UARA 2CV4A 2JADA 4IN0A 1FB0A 3Q74A 2PGTA 2X64A 2C0DA 1XWAA 1ZOFA 3M0FA 1PFOA 3VPTA 8GSSA 5D8IA 4FO5A 4IS0A 1ERUA 1KBNA 1OYJA 2IMKA 3VURA 4TXVA 1FOVA 3QR6A 2G0FA 2WFCA 5KEJA 1XW9A 4FYUA 5FWGA 1UN2A 4TXOA 3DWVA 4ZB6A 1GP1A 5EVOA 3E9JB 5IMVA 1O7UA 5H5SA 4JE1A 1GUKA 4F9ZA 2V1MA 4O5RA 3D4MA 3GNJA 1M99A 5ECKB 3GX8A 1YDKA 3ME8A 3LGCA 1HNAA 4MCUA 1TU8A 2EIOA 1R26A 4K2DA 2I81A 3Q6OA 1EV4A 3DKSA 1GSYA 4O92A 3GRXA 4TXOB 5INYA 1V58A 2C8UA 1TJDA 2L4CA 2AAWA 2L57A 1U3IA 3M9KA 3IC4A 1VF2A 1XBSA 2HLSA 5IMZA 5DVBA 1BYEA 2H30A 4OCFA 1N8JA 1MDIA 2VLTA 4L0WA 2DKIA 3ZMLA 3C8EA 1UC7A 2OBKA 4KA0A 3APQA 2V41A 4POLA 1F9MA 1K0OA 2DJ0A 1KTEA 4OFTA 1A8LA 1YEPA 4FIWA 3ZVJA 3KD0A 4IW9A 2VCVA 1MEKA 2V6KA 3EINA 3PGTA 1O8WA 3KP8A 3GYKA 3ZIJA 2YP6A 1YKAA 2JACA 4JEDA 2A2SA 5ELAA 4MH3A 1SL1B 2OE3A 4DVCA 1XG8A 3QDNA 5CRDA 2FA8A 3W6GA 3ZITA 5GZZB 3TUEA 1VGLA 1JZWA 4EL1A 2H73A 4EE0A 3GUSA 2R5GA 4QQ7A 1PL2A 4L5OA 2F9SA 2KP1A 2EIQA 4N11A 2H0HA 1QFNA 2VOCA 3CSJA 3HVSA 2FUG2 1TTZA 3TJKA 3KH7A 4CY8A 3FKFA 2YCDA 2K6VA 3CTFA 4IVFA 4O32A 3MIXA 2OBIA 4L8EA 3D4TA 2M46A 3W8JA 2PVOC 3A3TA 5ABRA 5IPHA 2FY6A 1W4VA 2KOKA 2B7JA 3GHAA 2Z9SA 1O81A 3ZFBA 2MBTA 6GSUA 5BMUA 5A4VA 1YJ6A 4NV2A 2VUPA 4XS1A 3ZL5A 4BIKA 4CY6A 1S3AA 3GKXA 2JZTA 5CRHA 2YOIA 4HJ2A 3GA4A 4K9ZA 4ID0A 2TRXA 3GSTA 4DSQA 4NV5A 2L4QA 1H4OA 1PGTA 2ON7A 1SKSB 4EXJA 1A23A 1BQ7A 2H75A 2PN8A 3HY2A 2E7PA 3FR9A 1EOGA 1SYXA 1Z6NA 1W89A 4EIPA 3F9UA 3ERFA 4TKYA 1WE0A 1I9DA 4PNFA 1DUGA 5G1LA 4WBRD 3Q19A 3IAM2 1U3AA 4G0LA 4Q5NA 3UJ1A 2M72A 1PN9A 4NMUA 3WGDA 4CHSA 3EC3A 2PU9C 4FYBA 1I5GA 1XFLA 5J3RA 3A2XA 20GSA 1B9XC 4POMA 1SJIA 5GSTA 2AJQB 4Z7XA 1OAZA 3GN3A 3Q18A 4I2UA 4EC0A 4IELA 1X9MB 1K3YA 3QMXA 4XS4B 4ZBBA 1GSUA 4PTSA 2REMA 4XS6A 1EP7A 3D6IA 3TRXA 4YQUA 3I9V2 2PWJA 3APSA 5B8BA 1U87A 3CMIA 2YV9A 4I2TA 2HRNA 4WETA 1VRSD 5G31A 3G7JA 1AXDA 1Z7PA 2YWOA 3HJMA 4QL9A 4PXOA 2HZFA 2I9HA 2JSZA 2O8VB 1C72A 3IR4A 4KSOA 2CAIA 3BCKA 3O3TA 4HQSA 4GTUA 1ILOA 2VD1A 3DRNA 2GZPA 3FYGA 3IK9A 1GTIA 2IMDA 1TRVA 3GFKA 3ZVJD 1M7TA 1IYIA 2LRTA 4HU7A 1GTUA 1SJZA 3F6DA 4NHZA 4O7HA 3L78A 1F37A 1XVQA 5DCHA 4GSTA 2VO4A 4GSNA 3QFBC 4KW6A 4TR4A 1XZOA 4PQIA 2DBCA 4XTSA 4PX1A 2DSAA 5ECOB 2VL9A 5CNWA 1EEMA 5GSSA 5JWQB 3IXRA 1Z9HA 4POBA 1OC9B 4K5RA 4KNDA 5FHIA 1XIYA
chains in the Genus database with same CATH topology
2DJ1A 3DGQA 2C0FA 3HKRA 3L9UA 2C0EA 4GRFA 5KN1A 2WCIA 4KAEA 2DLXA 5ECRB 4ZILA 2YN1A 5LCZA 4K7IA 1PN0A 2O89A 3HA9A 4EUYA 3RHCA 3EMXA 3F4RA 1HNCA 3FMWA 2E2MA 2DJKA 4OWYA 2R3XA 3BOAA 1M0UA 3AY8A 3KIJA 5HFIA 2L5LA 2NBSA 3M8NA 4OFNA 2VD0A 2RM5A 4ZL7A 5HR1A 3CRUA 4ECJA 3ZRDA 1UVZA 2H19A 2LQOA 3DIEA 2LJAA 2JZSA 3TKSE 5F06A 2HSHA 2WB9A 4BL7A 3FZ5A 1N2AA 1B9YC 2AHEA 1PX6A 2OE1A 4EKZA 3BJ5A 3ZFLA 4IP6A 2E0QA 2EIRA 3HZ8A 3PH9A 5D9VA 5ECPB 3SBCA 2IN3A 2IMIA 1J08A 3VWUA 4JRRA 1H75A 2HXKA 1F6MC 3WT1A 3C71A 1TK5B 4E8HA 2YANA 2VL2C 2DKHA 4F0BA 5DCGA 1A2JA 2VCQA 1WWJA 3R2QA 5D96A 4V1Ap 1U6TA 3W8SA 1X5EA 2H1AA 3MYDA 4WF4A 3GH9A 2R4VA 2LSTA 2V2GA 3ZLPA 3IE3A 2BMXA 3QPMA 1MD3A 1ERWA 2B1KA 1ML6A 4F0CA 1QQ2A 1EZKA 5KOXA 1X5CA 4G10A 2QGVA 5CP1A 1X0RA 1OKTA 5LNKe 4DSRA 4MJBA 1GULA 1TK0B 3DXBA 5D9XA 3H8QA 4EF0A 2V6OA 2OADA 5CO3A 3IRAA 2LTKA 1T3BA 2C4JA 4MNNA 5ID2A 3A2WA 2CVBA 3EPTA 1ZYNA 2RLIA 3FK8A 1X5DA 1GNEA 1KEBA 4CDOA 3TKSC 2ES7A 4O5QA 2RM6A 2VLVA 4TOPA 5H5RA 4K2XA 2H76A 3P2AA 5E59A 5J9CA 5ECSA 3N9JA 2LQQA 3UL3A 2FHEA 1SK2A 5ECLB 3WGEA 4V1Ag 1O6JA 3UBKA 3KMNA 3GKNA 2XC2A 5LD0A 5ID2B 3GSSA 4K0NA 3H79A 3WGXA 3DVXA 5G5EA 1VF1A 4KCAA 1JZOA 4ZB8A 1UA5A 1BAYA 2BTOT 3LG6A 1GLPA 1PKWA 1Z6MA 1RW1A 2RUEA 1M2DA 1XPVA 5ECHB 2TRCP 2VIMA 3SWLA 4AF2A 4ECIA 4ULXA 1V9WA 2MYGA 2QA2A 3UBLA 1A8YA 4EIQA 4V2MA 3IAS2 1DBYA 5DAKA 3UVTA 1GUHA 3DYRA 1GTAA 3LXTA 2GQMA 2H1BA 2F8FA 1TDIA 1GSDA 9GSSA 5EL8A 2H8LA 4RI7A 4YQMA 4BWQA 1HD2A 2FWFA 2ZCTA 4ML1A 3IC8A 3LW9A 1A0RP 2YWIA 4MP4A 3F6FA 2IIYA 4BVXA 5IO0A 4NWYA 3CRTA 2H6ZA 2MZCA 2WS2A 1SKRB 3GKMA 4ZBDA 2K18A 1PSQA 2PPTA 1HQOA 1Z7RA 3VK9A 3EYTA 1AIUA 3J7Yk 5DAKB 3M9JA 3LXZA 3D0ZA 3P7XA 5CREA 2NVLA 1ZMAA 2VL3A 4N10A 2DIYA 2LRCA 4DEJA 2GT6A 1ERTA 4X4JA 3G9BA 3ZYWA 2GSTA 4XRAA 2QSIA 1GWCA 3WD6A 4A5PA 5DALA 4Q5RA 3F3QA 3IBHA 4XIHA 1JLWA 2R0PA 2LRNA 1GNWA 4BVXB 1XWBA 1DE1A 2JSYA 5D73A 5DJLA 3EWLA 4GLTA 4NHWA 1SL2B 2DMLA 2CZ3A 3IDVA 3VWWA 5G1KA 1EEJA 4IJIA 1T7PB 1TW9A 1GSEA 3HVXA 2IFQA 3KTBA 2GZZA 2AV4A 2QKEA 2HRFA 4WEYA 10GSA 2CA8A 1F3BA 5JWRB 4HUAA 1NW2A 2H71A 1TXXA 4LMWA 1E6BA 5GAPD 2GSRA 2A4VA 4ZL8A 3HZ4A 2GQLA 2K9FA 5H5QA 4FQUA 4V2NA 5AISA 1R4WA 2VM2A 1TK8B 2N5FA 4GQCA 2DJ3A 4HU9A 4N0ZA 3LWAA 2D2ZA 3IOSA 4IKHA 1OVNA 3UIWA 4PGTA 2R37A 2CT6A 1ZGNA 3KZQA 4MF6A 3GIXA 3F4SA 4MF5A 1GSFA 5IOWA 4F82A 4OO4A 2LNSA 4AJ6A 4WXTA 2R6KA 3WT2A 4CW9A 1T1VA 1QXHA 1YEXA 2XPDA 2B1LA 5IO2A 5DQSA 4MJAA 1OKDA 4YKGA 3J7Yb 2OA7A 5JCWA 12GSA 4G19A 2XBIA 1B4PA 4RQXA 2OACA 4O5UA 2IJYA 2XPEA 5CAXA 2HZEA 3V1WA 1FAAA 1A24A 3VPQA 2A2PA 3VWXA 2YNXA 4TVEA 3GKKA 3C1SA 2L5OA 2YV7A 4G2EA 2DJJA 4IBPA 2H1GA 3HYPA 5ECQB 3G7YA 2B5XA 1K0DA 2HRAA 1XWCA 1NHYA 1G6YA 5IIZA 2LNTA 3M3MA 16GSA 4Z2TA 3F8UA 3FR3A 2H0GA 2H1DA 2PVQA 4H86A 4MF7A 4TRXA 2VCXA 1YY7A 1Q98A 5KN0A 4TR1A 2WRTA 3KXOA 4GF0A 1O73A 4K6XA 2P0GA 5AIXA 3KCMA 2ZUPA 5HR3A 3DEXA 3LFLA 4WF5A 2H66A 1TU7A 3ERWA 4PUAA 2HSYA 1E2YA 1O85A 2P31A 2LEGA 2KP2A 4ISDA 3IPZA 2OKAA 3E3EA 4YH2A 4DSSA 5ECMB 4MPFA 1TRSA 5IMAA 3KH9A 1WOUA 2I1UA 4TR1B 4HZ4A 2H6YA 3GTUA 3PINA 4BPYA 3TB2A 3CBUA 3EE2A 3QFAC 3HHVA 5J4UA 1AQVA 1B48A 3MWHA 3UEMA 2L6DA 4WR4A 1KNGA 2H6XA 3VFIA 1EGOA 2GSQA 1S3CA 1V57A 3D22A 1XWKA 4XCSA 4TR0A 5IQYA 4Z2RA 4KUNA 2L59A 3DMLA 4PQHA 3LEFA 1PX7A 2WULA 2GTUA 3H4KA 2UZ8A 1WP0A 4XRDA 1ABAA 1PKZA 2XHFA 5CRGA 5DJMA 3CSIA 5KN3A 4N0VA 2DC5A 1T00A 3LORA 4TN8A 4G0IA 4KDYA 4FYCA 2IMEA 5GAND 18GSA 3MAKA 2P5QA 3KMOA 3L4NA 1M9AA 1FVKA 1HNBA 4KF9A 1K0AA 1V40A 5AGYA 1XCCA 2MMAA 3MSZA 4GCIA 1M9BA 1OE8A 4LLRA 3KTLA 1YF0A 4L5LA 4ZXGA 1FOHA 1XOAA 1T4YA 4ZL9A 3QD9A 1A0FA 1M2AA 5J9BA 3QAGA 5ELGA 1ZCPA 2TIRA 3GL3A 4HS1A 4BVYA 1SD9A 3GL5A 5DQYA 1GLQA 1G6WA 5L71A 1CQGA 4KSMA 1V2AA 5COHA 1TI3A 2WDUA 3RPNA 3DD3A 4PURA 3O76A 1U88A 2G2QA 2XBQA 3M1GA 5DDLA 3FEUA 3LYKA 4WBJA 2HRKA 4HEA2 2HSMA 3RBTA 3HVVA 4D73A 2CAQA 1USBA 4V2LA 3ME7A 4NAXA 1SK1A 1URMA 2B7KA 3P8WA 4ILFA 2GS3A 1YKCA 3TKQA 1DSBA 3R3EA 5D9TA 1DE2A 3IHGA 4J56E 4JBBA 3TJGA 3K8NA 2K8SA 2OE0A 4I8BA 3RHBA 22GSA 2RIIA 1K3OA 4F2IA 2IL3A 1PL1A 1S3DA 2IPAA 4X43A 3CYNA 1SU9A 2YWNA 2R0CA 2DMMA 5KN2A 3F4TA 5ECNB 3CXGA 5ECIB 3TJFA 5HR0A 2CX3A 3ZIVA 4BL7B 4ZIJA 1NM3A 2WJUA 4I6XA 1TRUA 3E0UA 3GH6A 3MNGA 1AUCA 1PQNA 2CZ2A 5DBQA 3QAVA 2B5YA 4HI7A 4N30A 4MLYA 2YPMA 1FHEA 3LSZA 1ACVA 5EY6A 1Q4JA 2VCZA 3I6AA 3HDCA 1M2BA 4J57E 4YKFA 1WRYA 2X8GA 4EO3A 3HXSA 4TR3A 3S9FA 1GSQA 4F03A 3N5OA 2J9HA 3I43A 3KGKA 4KB3A 1TP9A 4AJ7A 1LBKA 2KHPA 3LQ7A 2HE3A 2MMNA 3IA1A 4Q5FA 5AN1A 4OFMA 2LJKA 3TRQA 1VF3A 4ECBA 5AIVA 3HD5A 3UVHA 1JHBA 1ST9A 2X8HA 2NDOA 2PBJA 4RQRA 5G30A 1G0TA 1ZYPA 1QMVA 4ZB9A 4IJ3A 2NPBA 3FY7A 3UOMA 6GSWA 1MDJA 2CX4A 3LJRA 5HFKA 3CTGA 3D21A 2H0IA 2H70A 2FNOA 1LJRA 3KP9A 5IM9A 5D93A 5D9WA 1YF1A 1SK0A 2RUFA 6GSXA 5J5NA 3BD2A 2JU5A 2VM1A 1FO5A 4MJEA 3VI7A 1Z3EA 1XOBA 1K3LA 2J23A 3F0IA 2AUVA 4K7OA 4JZQA 4POKA 2ALBA 4MA9A 1TOFA 4MDCA 2B5EA 3H1NA 1XVWA 4IHUA 4GXZA 2O7KA 5B6NA 4OO5A 1F2EA 3L9VA 1PD21 4YAVA 1EWXA 1ON4A 3GX0A 1TKDB 2IWTA 19GSA 4I5QA 2C1YA 11GSA 3G7IA 5G5FA 4I97A 5G2ZA 4RI6A 2ON5A 3EURA 5HFGA 1YQ1A 3HCZA 1HYUA 2EC4A 2X49A 1V98A 4GSSA 4OD7A 6GSVA 2GSSA 1K0NA 2VLUA 5JCGA 2JZRA 2OJLA 4ML6A 3BCIA 2YWMA 3EU3A 3PR8A 13GSA 3CSHA 5F05A 2GZYA 3EMPA 3EU4A 4G0KA 3TOUA 3BBYA 3DVWA 5FT3A 4MMMA 3MDKA 4Z2UA 3APOA 2R2JA 4GQFA 2MMZA 3D5JA 5DALB 3F63A 1BEDA 1Y6EA 2PUKC 2DIZA 2HYXA 5A4UA 1EOHA 1LU4A 4AGSA 4LL4B 3TKPA 1NSWA 1BJXA 2VCTA 4OCEA 3TKRA 1GRXA 1EGRA 4LA1A 2AB6A 2VL2A 2IFQB 4KH7A 1B4QA 2I3YA 14GSA 3QAWA 2X8CA 6GSSA 4K7NA 4PQ1A 3TRPA 2X99A 2FD3A 1XXUA 2MBSA 4MZWA 2O85A 1THOA 4ECCA 1BX9A 3LYPA 5IMCA 3U5RE 3TOTA 3NOFA 1JZDA 4MZBA 3TCOA 1QUWA 4P3YB 1A2MA 4HQZA 4FH8A 2KUCA 2N5BA 1FW1A 1ZL9A 1FVJA 3UMAA 2C0GA 4KE3A 4HOJA 4J2FA 1GL8A 4HJMA 5J41A 3UAPA 4EDYA 3O6TA 4PUFC 5A4WA 3VLNA 1XW6A 1G7OA 1TRWA 3QOUA 1SYRA 4JU5A 4MPGA 5BRTA 1X9SB 2O87A 3NIVA 3WYWA 2C3TA 3TKSA 2F8AA 2A2RA 2GVPA 2YZUA 2R0GA 4ZBAA 1ZYEA 3U6VA 4K1FA 1J0FA 17GSA 2CQ9A 2F51A 2A4HA 2BJXA 4XS4A 4KDUA 3FW2A 4IP1A 1G7EA 4JR4A 5CRWA 2K8VA 4LL1B 1T4ZA 3FZ9A 2HZEB 4ACSA 2L6CA 5IMFA 4IQ1A 2C3NA 5IOXA 3A2VA 4LMVA 5IMDA 2FGXA 3KEBA 2LUSA 2B3SA 3TDGA 1TI1A 1K0CA 1R5AA 3VWVA 1O8XA 2H72A 4G9HA 4EDZA 1ZZYA 2PERA 3FZAA 4AJ8A 2I4AA 2PMTA 2MMOA 1IYHA 1RK4A 1SJ6A 4MJCA 1FG4A 3ERGA 1AQXA 1SKWB 1T8EB 3C73A 3KM6A 1AC1A 1AAZA 4HZ2A 1PRXA 5C00A 1B8XA 1JFUA 1MTCA 1JZRA 2FWEA 3IK7A 3A5IA 4OMVA 1PMTA 5HQPA 2GDRA 4MH2A 1NHOA 3GURA 2DJ2A 4X1UA 6GSTA 1OC3A 2CVDA 4YQVA 2LV3A 2B6MA 5B8AA 1GSSA 3IV4A 2E2GA 1RQMA 2NTOA 2YJ7A 3RPPA 2N5AA 1EV9A 1OE7A 3C7MA 3EVIA 3RAZA 3GV1A 1SENA 2JL4A 2LJRA 2H01A 4IQAA 5KOWA 2WGRA 3JCML 4DSSB 4KGIA 2HNLA 2YJHA 3TGZA 1ERVA 1K0MA 1GH2A 3F3RA 4BA7A 2LKUA 6GSYA 3GTUB 7GSSA 5B6MA 2VCWA 4KCEA 2M80A 4NXIA 4E8EA 1OC9A 4K5SA 5B7CA 4WKWA 1AQWA 1K0BA 2P5RA 1GTBA 1SL0B 3ISOA 1OC8A 5C04A 3FRCA 2C3QA 5IPGA 2HT9A 4HDEA 1ZYQB 5F0GA 1WJKA 2VAFA 1SD8A 1A2LA 1QK8A 3ZZXA 1GUMA 3FZ4A 2IMFA 5F07A 1QGVA 2V32A 1FB6A 2GT5A 3PPUA 5CYYA 3FR6A 4EVMA 4BWSA 2FWHA 2QC7A 2FCHA 2HFDA 4MABA 2C80A 4Q5QA 3C1RA 1R7HA 3ZMKA 1R5PA 2GQKA 1PA3A 1XW5A 3TJJA 1Y25A 4NPBA 4L0UA 4X0XA 1VF4A 2LS5A 1CQHA 2H74A 3ZTLA 3NZNA 4BVYB 3VI5A 3A5WA 2QA1A 3QCPA 4K8MA 3L0HA 4IGJA 3H93A 3L9SA 2AYTA 3P90A 2GGTA 1JLVA 5F8BA 1BG5A 2F3MA 2KLXA 3OR5A 4KX4A 5HR2A 1X9WB 3I69A 4MK3A 3GMFA 3TJBA 4ICYA 3RDWA 1WMJA 1F3AA 2WZ9A 2YZHA 5ENUA 1MD4A 4RUVA 2HI7A 3FHKA 4D73B 1EP8A 2X4AA 1YZXA 3US3A 1WPIA 1MDKA 4MZCA 3HJPA 4GWRA 3HJOA 3KJYA 5A5KA 2FWGA 2GLRA 4TW5A 5JWOB 5E4WA 4WR5A 1XWGA 4USSA 1J9BA 2ZNMA 3IHQA 1WIKA 4K0GA 1Z5YE 3ZREA 2CVKA 1AW9A 3ED3A 4JR6A 4QL7A 1THXA 4PNGA 4KDXA 5EPFA 2FA4A 4XHMA 2FLSA 4YAPA 5JCUA 3UARA 2CV4A 2JADA 4IN0A 1FB0A 3Q74A 2PGTA 2X64A 2C0DA 1XWAA 1ZOFA 3M0FA 3VPTA 8GSSA 5D8IA 4FO5A 4IS0A 1ERUA 1KBNA 1OYJA 2IMKA 3VURA 4TXVA 1FOVA 3QR6A 2G0FA 2WFCA 5KEJA 1XW9A 4FYUA 5FWGA 1UN2A 4TXOA 3DWVA 4ZB6A 1GP1A 5EVOA 3E9JB 5IMVA 1O7UA 5H5SA 4JE1A 1GUKA 4F9ZA 2V1MA 4O5RA 3D4MA 3GNJA 1M99A 5ECKB 3GX8A 1YDKA 3ME8A 3LGCA 1HNAA 4MCUA 1TU8A 2EIOA 1R26A 4K2DA 2I81A 3Q6OA 1EV4A 3DKSA 1GSYA 4O92A 3GRXA 4TXOB 5INYA 1V58A 2C8UA 1TJDA 2L4CA 2AAWA 2L57A 1U3IA 3M9KA 3IC4A 1VF2A 1XBSA 2HLSA 5IMZA 5DVBA 1BYEA 2H30A 4OCFA 1N8JA 1MDIA 2VLTA 4L0WA 2DKIA 3ZMLA 3C8EA 1UC7A 2OBKA 4KA0A 3APQA 2V41A 4POLA 1F9MA 1K0OA 2DJ0A 1KTEA 4OFTA 1A8LA 1YEPA 4FIWA 3ZVJA 3KD0A 4IW9A 2VCVA 1MEKA 2V6KA 3EINA 3PGTA 1O8WA 3KP8A 3GYKA 3ZIJA 2YP6A 1YKAA 2JACA 4JEDA 2A2SA 5ELAA 4MH3A 1SL1B 2OE3A 4DVCA 3QDNA 5CRDA 2FA8A 3W6GA 3ZITA 5GZZB 3TUEA 1VGLA 1JZWA 4EL1A 2H73A 4EE0A 3GUSA 2R5GA 4QQ7A 1PL2A 4L5OA 2F9SA 2KP1A 2EIQA 4N11A 2H0HA 1QFNA 2VOCA 3CSJA 3HVSA 2FUG2 1TTZA 3TJKA 3KH7A 4CY8A 3FKFA 2YCDA 2K6VA 3CTFA 4IVFA 4O32A 3MIXA 2OBIA 4L8EA 3D4TA 2M46A 3W8JA 2PVOC 3A3TA 5ABRA 5IPHA 2FY6A 1W4VA 2KOKA 2B7JA 3GHAA 2Z9SA 1O81A 3ZFBA 2MBTA 6GSUA 5BMUA 5A4VA 1YJ6A 4NV2A 2VUPA 4XS1A 3ZL5A 4CY6A 1S3AA 3GKXA 2JZTA 5CRHA 2YOIA 4HJ2A 3GA4A 4K9ZA 4ID0A 2TRXA 3GSTA 4DSQA 4NV5A 2L4QA 1H4OA 1PGTA 2ON7A 1SKSB 4EXJA 1A23A 1BQ7A 2H75A 2PN8A 3HY2A 2E7PA 3FR9A 1EOGA 1SYXA 1Z6NA 1W89A 4EIPA 3F9UA 3ERFA 4TKYA 1WE0A 1I9DA 4PNFA 1DUGA 5G1LA 4WBRD 3Q19A 3IAM2 1U3AA 4G0LA 4Q5NA 3UJ1A 2M72A 1PN9A 4NMUA 3WGDA 4CHSA 3EC3A 2PU9C 4FYBA 1I5GA 1XFLA 5J3RA 3A2XA 20GSA 1B9XC 4POMA 1SJIA 5GSTA 2AJQB 4Z7XA 1OAZA 3GN3A 3Q18A 4I2UA 4EC0A 4IELA 1X9MB 1K3YA 3QMXA 4XS4B 4ZBBA 1GSUA 4PTSA 2REMA 4XS6A 1EP7A 3D6IA 3TRXA 4YQUA 3I9V2 2PWJA 3APSA 5B8BA 1U87A 3CMIA 2YV9A 4I2TA 2HRNA 4WETA 1VRSD 5G31A 3G7JA 1AXDA 1Z7PA 2YWOA 3HJMA 4QL9A 4PXOA 2HZFA 2I9HA 2JSZA 2O8VB 1C72A 3IR4A 4KSOA 2CAIA 3BCKA 3O3TA 4HQSA 4GTUA 1ILOA 2VD1A 3DRNA 2GZPA 3FYGA 3IK9A 1GTIA 2IMDA 1TRVA 3GFKA 3ZVJD 1M7TA 1IYIA 2LRTA 4HU7A 1GTUA 1SJZA 3F6DA 4NHZA 4O7HA 3L78A 1F37A 1XVQA 5DCHA 4GSTA 2VO4A 4GSNA 3QFBC 4KW6A 4TR4A 1XZOA 4PQIA 2DBCA 4XTSA 4PX1A 2DSAA 5ECOB 2VL9A 5CNWA 1EEMA 5GSSA 5JWQB 3IXRA 1Z9HA 4POBA 1OC9B 4K5RA 4KNDA 5FHIA 1XIYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJ1 A;  3DGQ A;  2C0F A;  3HKR A;  3L9U A;  2C0E A;  4GRF A;  5KN1 A;  2WCI A;  4KAE A;  2DLX A;  5ECR B;  4ZIL A;  2YN1 A;  5LCZ A;  4K7I A;  3HA9 A;  2O89 A;  4EUY A;  3RHC A;  3EMX A;  3F4R A;  1HNC A;  2E2M A;  2DJK A;  4OWY A;  2R3X A;  3BOA A;  1M0U A;  3AY8 A;  3KIJ A;  5HFI A;  2L5L A;  2NBS A;  3M8N A;  4OFN A;  2VD0 A;  2RM5 A;  4ZL7 A;  5HR1 A;  3CRU A;  4ECJ A;  3ZRD A;  1UVZ A;  2H19 A;  2LQO A;  3DIE A;  2LJA A;  2JZS A;  3TKS E;  5F06 A;  2HSH A;  2WB9 A;  4BL7 A;  3FZ5 A;  1N2A A;  1B9Y C;  2AHE A;  1PX6 A;  2OE1 A;  4EKZ A;  3BJ5 A;  3ZFL A;  4IP6 A;  2E0Q A;  2EIR A;  3HZ8 A;  3PH9 A;  5D9V A;  5ECP B;  3SBC A;  2IN3 A;  2IMI A;  1J08 A;  3VWU A;  4JRR A;  1H75 A;  2HXK A;  1F6M C;  3WT1 A;  3C71 A;  1TK5 B;  4E8H A;  2YAN A;  2VL2 C;  4F0B A;  5DCG A;  1A2J A;  2VCQ A;  1WWJ A;  3R2Q A;  5D96 A;  4V1A p;  1U6T A;  3W8S A;  1X5E A;  2H1A A;  4WF4 A;  3GH9 A;  2R4V A;  2LST A;  2V2G A;  3ZLP A;  3IE3 A;  2BMX A;  3QPM A;  1MD3 A;  1ERW A;  2B1K A;  1ML6 A;  4F0C A;  1QQ2 A;  1EZK A;  1X5C A;  4G10 A;  2QGV A;  5CP1 A;  1X0R A;  1OKT A;  5LNK e;  4DSR A;  4MJB A;  1GUL A;  1TK0 B;  3DXB A;  5D9X A;  3H8Q A;  4EF0 A;  2V6O A;  2OAD A;  5CO3 A;  3IRA A;  2LTK A;  1T3B A;  2C4J A;  5ID2 A;  3A2W A;  2CVB A;  2RLI A;  3FK8 A;  1X5D A;  1GNE A;  1KEB A;  4CDO A;  3TKS C;  2ES7 A;  2RM6 A;  2VLV A;  4TOP A;  5H5R A;  2H76 A;  3P2A A;  5E59 A;  5J9C A;  5ECS A;  3N9J A;  2LQQ A;  3UL3 A;  2FHE A;  1SK2 A;  5ECL B;  3WGE A;  4V1A g;  1O6J A;  3UBK A;  3KMN A;  3GKN A;  2XC2 A;  5LD0 A;  5ID2 B;  3GSS A;  4K0N A;  3H79 A;  3WGX A;  3DVX A;  5G5E A;  1VF1 A;  4KCA A;  1JZO A;  4ZB8 A;  1UA5 A;  1BAY A;  2BTO T;  3LG6 A;  1GLP A;  1PKW A;  1Z6M A;  1RW1 A;  2RUE A;  1M2D A;  1XPV A;  5ECH B;  2TRC P;  2VIM A;  3SWL A;  4AF2 A;  4ECI A;  4ULX A;  1V9W A;  2MYG A;  3UBL A;  1A8Y A;  4V2M A;  3IAS 2;  1DBY A;  5DAK A;  3UVT A;  1GUH A;  3DYR A;  1GTA A;  3LXT A;  2GQM A;  2H1B A;  2F8F A;  1TDI A;  1GSD A;  9GSS A;  5EL8 A;  2H8L A;  4RI7 A;  4YQM A;  4BWQ A;  1HD2 A;  2FWF A;  2ZCT A;  4ML1 A;  1A0R P;  2YWI A;  4MP4 A;  3F6F A;  2IIY A;  4BVX A;  5IO0 A;  4NWY A;  3CRT A;  2H6Z A;  2MZC A;  2WS2 A;  1SKR B;  3GKM A;  4ZBD A;  2K18 A;  1PSQ A;  2PPT A;  1HQO A;  1Z7R A;  3VK9 A;  3EYT A;  1AIU A;  3J7Y k;  5DAK B;  3M9J A;  3LXZ A;  3D0Z A;  3P7X A;  5CRE A;  2NVL A;  1ZMA A;  2VL3 A;  4N10 A;  2DIY A;  2LRC A;  4DEJ A;  2GT6 A;  1ERT A;  3G9B A;  3ZYW A;  2GST A;  4XRA A;  2QSI A;  1GWC A;  3WD6 A;  5DAL A;  4Q5R A;  3F3Q A;  3IBH A;  4XIH A;  1JLW A;  2LRN A;  1GNW A;  1XWB A;  1DE1 A;  2JSY A;  5D73 A;  5DJL A;  3EWL A;  4GLT A;  4NHW A;  1SL2 B;  2DML A;  2CZ3 A;  3IDV A;  3VWW A;  5G1K A;  1EEJ A;  4IJI A;  1T7P B;  1TW9 A;  1GSE A;  3HVX A;  2IFQ A;  3KTB A;  2GZZ A;  2AV4 A;  2QKE A;  2HRF A;  4WEY A;  10GS A;  2CA8 A;  1F3B A;  5JWR B;  4HUA A;  1NW2 A;  2H71 A;  1TXX A;  4LMW A;  1E6B A;  5GAP D;  2GSR A;  2A4V A;  4ZL8 A;  3HZ4 A;  2GQL A;  2K9F A;  5H5Q A;  4V2N A;  5AIS A;  1R4W A;  2VM2 A;  1TK8 B;  2N5F A;  4GQC A;  2DJ3 A;  4HU9 A;  4N0Z A;  3LWA A;  2D2Z A;  3IOS A;  4IKH A;  1OVN A;  3UIW A;  4PGT A;  2R37 A;  2CT6 A;  1ZGN A;  3KZQ A;  4MF6 A;  3GIX A;  3F4S A;  4MF5 A;  1GSF A;  5IOW A;  4F82 A;  4OO4 A;  2LNS A;  4AJ6 A;  4WXT A;  2R6K A;  3WT2 A;  4CW9 A;  1T1V A;  1QXH A;  1YEX A;  2XPD A;  2B1L A;  5IO2 A;  5DQS A;  4MJA A;  1OKD A;  3J7Y b;  2OA7 A;  5JCW A;  12GS A;  4G19 A;  2XBI A;  1B4P A;  4RQX A;  2OAC A;  2IJY A;  2XPE A;  5CAX A;  2HZE A;  3V1W A;  1FAA A;  1A24 A;  3VPQ A;  3VWX A;  2YNX A;  4TVE A;  3GKK A;  3C1S A;  2L5O A;  2YV7 A;  4G2E A;  2DJJ A;  4IBP A;  2H1G A;  3HYP A;  5ECQ B;  3G7Y A;  2B5X A;  1K0D A;  1XWC A;  1NHY A;  1G6Y A;  5IIZ A;  2LNT A;  3M3M A;  16GS A;  3F8U A;  3FR3 A;  2H0G A;  2H1D A;  2PVQ A;  4H86 A;  4MF7 A;  4TRX A;  2VCX A;  1YY7 A;  1Q98 A;  5KN0 A;  4TR1 A;  2WRT A;  3KXO A;  4GF0 A;  1O73 A;  4K6X A;  2P0G A;  5AIX A;  3KCM A;  2ZUP A;  5HR3 A;  3DEX A;  3LFL A;  4WF5 A;  2H66 A;  1TU7 A;  3ERW A;  4PUA A;  2HSY A;  1E2Y A;  1O85 A;  2P31 A;  2LEG A;  2KP2 A;  4ISD A;  3IPZ A;  2OKA A;  3E3E A;  4YH2 A;  4DSS A;  5ECM B;  4MPF A;  1TRS A;  5IMA A;  3KH9 A;  1WOU A;  2I1U A;  4TR1 B;  4HZ4 A;  2H6Y A;  3GTU A;  3PIN A;  4BPY A;  3TB2 A;  3CBU A;  3EE2 A;  3QFA C;  3HHV A;  5J4U A;  1AQV A;  1B48 A;  3MWH A;  3UEM A;  2L6D A;  4WR4 A;  1KNG A;  2H6X A;  3VFI A;  1EGO A;  2GSQ A;  1S3C A;  1V57 A;  3D22 A;  1XWK A;  4XCS A;  4TR0 A;  5IQY A;  4KUN A;  2L59 A;  3DML A;  4PQH A;  3LEF A;  1PX7 A;  2WUL A;  2GTU A;  3H4K A;  1WP0 A;  4XRD A;  1ABA A;  1PKZ A;  2XHF A;  5CRG A;  5DJM A;  3CSI A;  5KN3 A;  4N0V A;  2DC5 A;  1T00 A;  3LOR A;  4TN8 A;  4KDY A;  4FYC A;  2IME A;  5GAN D;  18GS A;  3MAK A;  2P5Q A;  3KMO A;  3L4N A;  1M9A A;  1FVK A;  1HNB A;  1K0A A;  1V40 A;  5AGY A;  1XCC A;  2MMA A;  3MSZ A;  4GCI A;  1M9B A;  1OE8 A;  4LLR A;  3KTL A;  1YF0 A;  4L5L A;  4ZXG A;  1XOA A;  1T4Y A;  4ZL9 A;  3QD9 A;  1A0F A;  1M2A A;  5J9B A;  3QAG A;  5ELG A;  1ZCP A;  2TIR A;  3GL3 A;  4HS1 A;  4BVY A;  1SD9 A;  3GL5 A;  5DQY A;  1GLQ A;  1G6W A;  5L71 A;  1CQG A;  4KSM A;  1V2A A;  5COH A;  1TI3 A;  2WDU A;  3RPN A;  3DD3 A;  4PUR A;  3O76 A;  1U88 A;  2G2Q A;  2XBQ A;  3M1G A;  5DDL A;  3FEU A;  3LYK A;  4WBJ A;  4HEA 2;  3RBT A;  3HVV A;  4D73 A;  2CAQ A;  1USB A;  4V2L A;  3ME7 A;  4NAX A;  1SK1 A;  1URM A;  2B7K A;  3P8W A;  4ILF A;  2GS3 A;  1YKC A;  3TKQ A;  1DSB A;  5D9T A;  1DE2 A;  4J56 E;  4JBB A;  3TJG A;  3K8N A;  2K8S A;  2OE0 A;  4I8B A;  3RHB A;  22GS A;  2RII A;  1K3O A;  4F2I A;  2IL3 A;  1PL1 A;  1S3D A;  2IPA A;  4X43 A;  3CYN A;  1SU9 A;  2YWN A;  2DMM A;  5KN2 A;  3F4T A;  5ECN B;  3CXG A;  5ECI B;  3TJF A;  5HR0 A;  2CX3 A;  3ZIV A;  4ZIJ A;  1NM3 A;  2WJU A;  4I6X A;  1TRU A;  3E0U A;  3GH6 A;  3MNG A;  1AUC A;  1PQN A;  2CZ2 A;  5DBQ A;  3QAV A;  2B5Y A;  4HI7 A;  4N30 A;  4MLY A;  2YPM A;  1FHE A;  3LSZ A;  1ACV A;  5EY6 A;  1Q4J A;  2VCZ A;  3I6A A;  3HDC A;  1M2B A;  4J57 E;  1WRY A;  2X8G A;  4EO3 A;  3HXS A;  4TR3 A;  3S9F A;  1GSQ A;  4F03 A;  3N5O A;  2J9H A;  3I43 A;  3KGK A;  4KB3 A;  1TP9 A;  4AJ7 A;  1LBK A;  2KHP A;  3LQ7 A;  2HE3 A;  2MMN A;  3IA1 A;  4Q5F A;  5AN1 A;  4OFM A;  2LJK A;  3TRQ A;  1VF3 A;  4ECB A;  5AIV A;  3HD5 A;  3UVH A;  1JHB A;  1ST9 A;  2X8H A;  2NDO A;  2PBJ A;  4RQR A;  5G30 A;  1G0T A;  1QMV A;  4ZB9 A;  4IJ3 A;  2NPB A;  3FY7 A;  3UOM A;  6GSW A;  1MDJ A;  2CX4 A;  3LJR A;  5HFK A;  3CTG A;  3D21 A;  2H0I A;  2H70 A;  2FNO A;  1LJR A;  3KP9 A;  5IM9 A;  5D93 A;  5D9W A;  1YF1 A;  1SK0 A;  2RUF A;  6GSX A;  5J5N A;  3BD2 A;  2JU5 A;  2VM1 A;  1FO5 A;  4MJE A;  3VI7 A;  1Z3E A;  1XOB A;  1K3L A;  2J23 A;  3F0I A;  2AUV A;  4K7O A;  4JZQ A;  4POK A;  2ALB A;  4MA9 A;  1TOF A;  4MDC A;  2B5E A;  3H1N A;  1XVW A;  4IHU A;  4GXZ A;  2O7K A;  5B6N A;  4OO5 A;  1F2E A;  3L9V A;  1PD2 1;  4YAV A;  1EWX A;  1ON4 A;  3GX0 A;  1TKD B;  2IWT A;  19GS A;  4I5Q A;  2C1Y A;  11GS A;  3G7I A;  5G5F A;  4I97 A;  5G2Z A;  4RI6 A;  2ON5 A;  3EUR A;  5HFG A;  1YQ1 A;  3HCZ A;  1HYU A;  2EC4 A;  1V98 A;  4GSS A;  4OD7 A;  6GSV A;  2GSS A;  1K0N A;  2VLU A;  5JCG A;  2JZR A;  2OJL A;  4ML6 A;  3BCI A;  2YWM A;  3EU3 A;  3PR8 A;  13GS A;  3CSH A;  5F05 A;  2GZY A;  3EMP A;  3EU4 A;  3TOU A;  3BBY A;  3DVW A;  5FT3 A;  4MMM A;  3MDK A;  3APO A;  2R2J A;  4GQF A;  2MMZ A;  3D5J A;  5DAL B;  3F63 A;  1BED A;  1Y6E A;  2PUK C;  2DIZ A;  2HYX A;  5A4U A;  1EOH A;  1LU4 A;  4AGS A;  4LL4 B;  3TKP A;  1NSW A;  1BJX A;  2VCT A;  4OCE A;  3TKR A;  1GRX A;  1EGR A;  4LA1 A;  2AB6 A;  2VL2 A;  2IFQ B;  4KH7 A;  1B4Q A;  2I3Y A;  14GS A;  3QAW A;  2X8C A;  6GSS A;  4K7N A;  4PQ1 A;  3TRP A;  2X99 A;  2FD3 A;  1XXU A;  2MBS A;  4MZW A;  2O85 A;  1THO A;  4ECC A;  1BX9 A;  3LYP A;  5IMC A;  3U5R E;  3TOT A;  3NOF A;  1JZD A;  4MZB A;  3TCO A;  1QUW A;  4P3Y B;  1A2M A;  4HQZ A;  4FH8 A;  2KUC A;  2N5B A;  1FW1 A;  1ZL9 A;  1FVJ A;  3UMA A;  2C0G A;  4KE3 A;  4HOJ A;  4J2F A;  1GL8 A;  4HJM A;  5J41 A;  3UAP A;  4EDY A;  3O6T A;  4PUF C;  5A4W A;  3VLN A;  1XW6 A;  1G7O A;  1TRW A;  3QOU A;  1SYR A;  4JU5 A;  4MPG A;  1X9S B;  2O87 A;  3NIV A;  3WYW A;  2C3T A;  3TKS A;  2F8A A;  2A2R A;  2GVP A;  2YZU A;  4ZBA A;  1ZYE A;  3U6V A;  4K1F A;  1J0F A;  17GS A;  2CQ9 A;  2F51 A;  2BJX A;  4XS4 A;  4KDU A;  3FW2 A;  4IP1 A;  1G7E A;  4JR4 A;  5CRW A;  2K8V A;  4LL1 B;  1T4Z A;  3FZ9 A;  2HZE B;  4ACS A;  2L6C A;  5IMF A;  4IQ1 A;  2C3N A;  5IOX A;  3A2V A;  4LMV A;  5IMD A;  2FGX A;  3KEB A;  2LUS A;  2B3S A;  3TDG A;  1TI1 A;  1K0C A;  1R5A A;  3VWV A;  1O8X A;  2H72 A;  4G9H A;  4EDZ A;  1ZZY A;  2PER A;  3FZA A;  4AJ8 A;  2I4A A;  2PMT A;  2MMO A;  1IYH A;  1RK4 A;  1SJ6 A;  4MJC A;  1FG4 A;  3ERG A;  1AQX A;  1SKW B;  1T8E B;  3C73 A;  3KM6 A;  1AC1 A;  1AAZ A;  4HZ2 A;  1PRX A;  5C00 A;  1B8X A;  1JFU A;  1MTC A;  1JZR A;  2FWE A;  3IK7 A;  4OMV A;  1PMT A;  5HQP A;  2GDR A;  4MH2 A;  1NHO A;  3GUR A;  2DJ2 A;  4X1U A;  6GST A;  1OC3 A;  2CVD A;  4YQV A;  2LV3 A;  2B6M A;  5B8A A;  1GSS A;  3IV4 A;  2E2G A;  1RQM A;  2NTO A;  2YJ7 A;  3RPP A;  2N5A A;  1EV9 A;  1OE7 A;  3C7M A;  3EVI A;  3RAZ A;  3GV1 A;  1SEN A;  2JL4 A;  2LJR A;  2H01 A;  4IQA A;  2WGR A;  3JCM L;  4DSS B;  4KGI A;  2HNL A;  2YJH A;  3TGZ A;  1ERV A;  1K0M A;  1GH2 A;  3F3R A;  4BA7 A;  2LKU A;  6GSY A;  3GTU B;  7GSS A;  5B6M A;  2VCW A;  4KCE A;  2M80 A;  4NXI A;  4E8E A;  1OC9 A;  5B7C A;  4WKW A;  1AQW A;  1K0B A;  2P5R A;  1GTB A;  1SL0 B;  3ISO A;  1OC8 A;  5C04 A;  3FRC A;  2C3Q A;  5IPG A;  2HT9 A;  4HDE A;  1ZYQ B;  5F0G A;  1WJK A;  2VAF A;  1SD8 A;  1A2L A;  1QK8 A;  3ZZX A;  1GUM A;  3FZ4 A;  2IMF A;  5F07 A;  1QGV A;  2V32 A;  1FB6 A;  2GT5 A;  5CYY A;  3FR6 A;  4EVM A;  4BWS A;  2FWH A;  2QC7 A;  2FCH A;  2HFD A;  4MAB A;  2C80 A;  4Q5Q A;  3C1R A;  1R7H A;  3ZMK A;  1R5P A;  2GQK A;  1PA3 A;  1XW5 A;  3TJJ A;  1Y25 A;  4NPB A;  4L0U A;  4X0X A;  1VF4 A;  2LS5 A;  1CQH A;  2H74 A;  3ZTL A;  3NZN A;  3VI5 A;  3A5W A;  3QCP A;  4K8M A;  3L0H A;  4IGJ A;  3H93 A;  3L9S A;  2AYT A;  3P90 A;  2GGT A;  1JLV A;  5F8B A;  1BG5 A;  2F3M A;  2KLX A;  3OR5 A;  4KX4 A;  5HR2 A;  1X9W B;  3I69 A;  4MK3 A;  3GMF A;  3TJB A;  3RDW A;  1WMJ A;  1F3A A;  2WZ9 A;  2YZH A;  5ENU A;  1MD4 A;  4RUV A;  2HI7 A;  3FHK A;  4D73 B;  1EP8 A;  1YZX A;  3US3 A;  1WPI A;  1MDK A;  4MZC A;  3HJP A;  4GWR A;  3HJO A;  3KJY A;  5A5K A;  2FWG A;  2GLR A;  4TW5 A;  5JWO B;  5E4W A;  4WR5 A;  1XWG A;  1J9B A;  2ZNM A;  3IHQ A;  1WIK A;  4K0G A;  1Z5Y E;  3ZRE A;  2CVK A;  1AW9 A;  3ED3 A;  4JR6 A;  4QL7 A;  1THX A;  4PNG A;  4KDX A;  5EPF A;  2FA4 A;  4XHM A;  2FLS A;  4YAP A;  5JCU A;  3UAR A;  2CV4 A;  2JAD A;  4IN0 A;  1FB0 A;  3Q74 A;  2PGT A;  2X64 A;  2C0D A;  1XWA A;  1ZOF A;  3M0F A;  3VPT A;  8GSS A;  5D8I A;  4FO5 A;  4IS0 A;  1ERU A;  1KBN A;  1OYJ A;  2IMK A;  3VUR A;  4TXV A;  1FOV A;  3QR6 A;  2G0F A;  2WFC A;  5KEJ A;  1XW9 A;  4FYU A;  5FWG A;  1UN2 A;  4TXO A;  3DWV A;  4ZB6 A;  1GP1 A;  5EVO A;  3E9J B;  5IMV A;  1O7U A;  5H5S A;  4JE1 A;  1GUK A;  4F9Z A;  2V1M A;  4O5R A;  3D4M A;  3GNJ A;  1M99 A;  5ECK B;  3GX8 A;  1YDK A;  3ME8 A;  3LGC A;  1HNA A;  4MCU A;  1TU8 A;  2EIO A;  1R26 A;  4K2D A;  2I81 A;  3Q6O A;  1EV4 A;  3DKS A;  1GSY A;  4O92 A;  3GRX A;  4TXO B;  5INY A;  1V58 A;  2C8U A;  1TJD A;  2L4C A;  2AAW A;  2L57 A;  1U3I A;  3M9K A;  3IC4 A;  1VF2 A;  1XBS A;  2HLS A;  5IMZ A;  5DVB A;  1BYE A;  2H30 A;  4OCF A;  1N8J A;  1MDI A;  2VLT A;  4L0W A;  3ZML A;  3C8E A;  1UC7 A;  2OBK A;  4KA0 A;  3APQ A;  2V41 A;  4POL A;  1F9M A;  1K0O A;  2DJ0 A;  1KTE A;  4OFT A;  1A8L A;  1YEP A;  4FIW A;  3ZVJ A;  3KD0 A;  4IW9 A;  2VCV A;  1MEK A;  2V6K A;  3EIN A;  3PGT A;  1O8W A;  3KP8 A;  3GYK A;  3ZIJ A;  2YP6 A;  1YKA A;  2JAC A;  4JED A;  2A2S A;  5ELA A;  4MH3 A;  1SL1 B;  2OE3 A;  4DVC A;  3QDN A;  5CRD A;  2FA8 A;  3W6G A;  3ZIT A;  5GZZ B;  3TUE A;  1VGL A;  1JZW A;  4EL1 A;  2H73 A;  4EE0 A;  3GUS A;  2R5G A;  4QQ7 A;  1PL2 A;  4L5O A;  2F9S A;  2KP1 A;  2EIQ A;  4N11 A;  2H0H A;  1QFN A;  2VOC A;  3CSJ A;  3HVS A;  2FUG 2;  1TTZ A;  3TJK A;  3KH7 A;  3FKF A;  2YCD A;  2K6V A;  3CTF A;  4IVF A;  4O32 A;  2OBI A;  4L8E A;  3D4T A;  2M46 A;  3W8J A;  2PVO C;  3A3T A;  5ABR A;  5IPH A;  2FY6 A;  1W4V A;  2KOK A;  2B7J A;  3GHA A;  2Z9S A;  1O81 A;  3ZFB A;  2MBT A;  6GSU A;  5A4V A;  1YJ6 A;  4NV2 A;  2VUP A;  4XS1 A;  3ZL5 A;  1S3A A;  3GKX A;  2JZT A;  5CRH A;  2YOI A;  4HJ2 A;  3GA4 A;  4K9Z A;  4ID0 A;  2TRX A;  3GST A;  4DSQ A;  4NV5 A;  2L4Q A;  1H4O A;  1PGT A;  2ON7 A;  1SKS B;  4EXJ A;  1A23 A;  1BQ7 A;  2H75 A;  2PN8 A;  3HY2 A;  2E7P A;  3FR9 A;  1EOG A;  1SYX A;  1Z6N A;  1W89 A;  3F9U A;  3ERF A;  4TKY A;  1WE0 A;  1I9D A;  4PNF A;  1DUG A;  5G1L A;  4WBR D;  3Q19 A;  3IAM 2;  1U3A A;  4Q5N A;  3UJ1 A;  2M72 A;  1PN9 A;  4NMU A;  3WGD A;  4CHS A;  3EC3 A;  2PU9 C;  4FYB A;  1I5G A;  1XFL A;  5J3R A;  3A2X A;  20GS A;  1B9X C;  4POM A;  1SJI A;  5GST A;  2AJQ B;  4Z7X A;  1OAZ A;  3GN3 A;  3Q18 A;  4I2U A;  4EC0 A;  4IEL A;  1X9M B;  1K3Y A;  3QMX A;  4XS4 B;  4ZBB A;  1GSU A;  2REM A;  4XS6 A;  1EP7 A;  3D6I A;  3TRX A;  4YQU A;  3I9V 2;  2PWJ A;  3APS A;  5B8B A;  1U87 A;  3CMI A;  2YV9 A;  4I2T A;  2HRN A;  4WET A;  1VRS D;  5G31 A;  3G7J A;  1AXD A;  1Z7P A;  2YWO A;  3HJM A;  4QL9 A;  4PXO A;  2HZF A;  2I9H A;  2JSZ A;  2O8V B;  1C72 A;  3IR4 A;  4KSO A;  2CAI A;  3BCK A;  3O3T A;  4HQS A;  4GTU A;  1ILO A;  2VD1 A;  3DRN A;  2GZP A;  3FYG A;  3IK9 A;  1GTI A;  2IMD A;  1TRV A;  3GFK A;  3ZVJ D;  1M7T A;  1IYI A;  2LRT A;  4HU7 A;  1GTU A;  1SJZ A;  3F6D A;  4NHZ A;  4O7H A;  3L78 A;  1F37 A;  1XVQ A;  5DCH A;  4GST A;  2VO4 A;  4GSN A;  3QFB C;  4KW6 A;  4TR4 A;  1XZO A;  4PQI A;  2DBC A;  4XTS A;  4PX1 A;  2DSA A;  5ECO B;  2VL9 A;  5CNW A;  1EEM A;  5GSS A;  5JWQ B;  3IXR A;  1Z9H A;  4POB A;  1OC9 B;  4KND A;  5FHI A;  1XIY A; 
#chains in the Genus database with same CATH topology
 2DJ1 A;  3DGQ A;  2C0F A;  3HKR A;  3L9U A;  2C0E A;  4GRF A;  5KN1 A;  2WCI A;  4KAE A;  2DLX A;  5ECR B;  4ZIL A;  2YN1 A;  5LCZ A;  4K7I A;  1PN0 A;  2O89 A;  3HA9 A;  4EUY A;  3RHC A;  3EMX A;  3F4R A;  1HNC A;  3FMW A;  2E2M A;  2DJK A;  4OWY A;  2R3X A;  3BOA A;  1M0U A;  3AY8 A;  3KIJ A;  5HFI A;  2L5L A;  2NBS A;  3M8N A;  4OFN A;  2VD0 A;  2RM5 A;  4ZL7 A;  5HR1 A;  3CRU A;  4ECJ A;  3ZRD A;  1UVZ A;  2H19 A;  2LQO A;  3DIE A;  2LJA A;  2JZS A;  3TKS E;  5F06 A;  2HSH A;  2WB9 A;  4BL7 A;  3FZ5 A;  1N2A A;  1B9Y C;  2AHE A;  1PX6 A;  2OE1 A;  4EKZ A;  3BJ5 A;  3ZFL A;  4IP6 A;  2E0Q A;  2EIR A;  3HZ8 A;  3PH9 A;  5D9V A;  5ECP B;  3SBC A;  2IN3 A;  2IMI A;  1J08 A;  3VWU A;  4JRR A;  1H75 A;  2HXK A;  1F6M C;  3WT1 A;  3C71 A;  1TK5 B;  4E8H A;  2YAN A;  2VL2 C;  2DKH A;  4F0B A;  5DCG A;  1A2J A;  2VCQ A;  1WWJ A;  3R2Q A;  5D96 A;  4V1A p;  1U6T A;  3W8S A;  1X5E A;  2H1A A;  3MYD A;  4WF4 A;  3GH9 A;  4HSC X;  2R4V A;  2LST A;  2V2G A;  3ZLP A;  3IE3 A;  2BMX A;  3QPM A;  1MD3 A;  1ERW A;  2B1K A;  1ML6 A;  4F0C A;  1QQ2 A;  1EZK A;  5KOX A;  1X5C A;  4G10 A;  2QGV A;  5CP1 A;  1X0R A;  1OKT A;  5LNK e;  4DSR A;  4MJB A;  1GUL A;  1TK0 B;  3DXB A;  5D9X A;  3H8Q A;  4EF0 A;  2V6O A;  2OAD A;  5CO3 A;  3IRA A;  2LTK A;  1T3B A;  2C4J A;  4MNN A;  5ID2 A;  3A2W A;  2CVB A;  3EPT A;  1ZYN A;  2RLI A;  3FK8 A;  1X5D A;  1GNE A;  1KEB A;  4CDO A;  3TKS C;  2ES7 A;  4O5Q A;  2RM6 A;  2VLV A;  4TOP A;  5H5R A;  4K2X A;  2H76 A;  3P2A A;  5E59 A;  5J9C A;  5ECS A;  3N9J A;  2LQQ A;  3UL3 A;  2FHE A;  1SK2 A;  5ECL B;  3WGE A;  4V1A g;  1O6J A;  3UBK A;  3KMN A;  3GKN A;  2XC2 A;  5LD0 A;  5ID2 B;  3GSS A;  4K0N A;  3H79 A;  3WGX A;  3DVX A;  5G5E A;  1VF1 A;  4KCA A;  1JZO A;  4ZB8 A;  1UA5 A;  1BAY A;  2BTO T;  3LG6 A;  1GLP A;  1PKW A;  1Z6M A;  1RW1 A;  2RUE A;  1M2D A;  1XPV A;  5ECH B;  2TRC P;  2VIM A;  3SWL A;  4AF2 A;  4ECI A;  4ULX A;  1V9W A;  2MYG A;  2QA2 A;  3UBL A;  1A8Y A;  4EIQ A;  4V2M A;  3IAS 2;  1DBY A;  5DAK A;  3UVT A;  1GUH A;  3DYR A;  1GTA A;  3LXT A;  2GQM A;  2H1B A;  2F8F A;  1TDI A;  1GSD A;  9GSS A;  5EL8 A;  2H8L A;  4RI7 A;  4YQM A;  4BWQ A;  1HD2 A;  2FWF A;  2ZCT A;  4ML1 A;  3IC8 A;  3LW9 A;  1A0R P;  2YWI A;  4MP4 A;  3F6F A;  2IIY A;  4BVX A;  5IO0 A;  4NWY A;  3CRT A;  2H6Z A;  2MZC A;  2WS2 A;  1SKR B;  3GKM A;  4ZBD A;  2K18 A;  1PSQ A;  2PPT A;  1HQO A;  1Z7R A;  3VK9 A;  3EYT A;  1AIU A;  3J7Y k;  5DAK B;  3M9J A;  3LXZ A;  3D0Z A;  3P7X A;  5CRE A;  2NVL A;  1ZMA A;  2VL3 A;  4N10 A;  2DIY A;  2LRC A;  4DEJ A;  2GT6 A;  1ERT A;  4X4J A;  3G9B A;  3ZYW A;  2GST A;  4XRA A;  2QSI A;  1GWC A;  3WD6 A;  4A5P A;  5DAL A;  4Q5R A;  3F3Q A;  3IBH A;  4XIH A;  1JLW A;  2R0P A;  2LRN A;  1GNW A;  4BVX B;  1XWB A;  1DE1 A;  2JSY A;  5D73 A;  5DJL A;  3EWL A;  4GLT A;  4NHW A;  1SL2 B;  2DML A;  2CZ3 A;  3IDV A;  3VWW A;  5G1K A;  1EEJ A;  4IJI A;  1T7P B;  1TW9 A;  1GSE A;  3HVX A;  2IFQ A;  3KTB A;  2GZZ A;  2AV4 A;  2QKE A;  2HRF A;  4WEY A;  10GS A;  2CA8 A;  1F3B A;  5JWR B;  4HUA A;  1NW2 A;  2H71 A;  1TXX A;  4LMW A;  1E6B A;  1M3I A;  5GAP D;  2GSR A;  2A4V A;  4ZL8 A;  3HZ4 A;  2GQL A;  2K9F A;  5H5Q A;  4FQU A;  4V2N A;  5AIS A;  1R4W A;  2VM2 A;  1TK8 B;  2N5F A;  4GQC A;  2DJ3 A;  4HU9 A;  4N0Z A;  3LWA A;  2D2Z A;  3IOS A;  4IKH A;  1OVN A;  3UIW A;  4PGT A;  2R37 A;  2CT6 A;  1ZGN A;  3KZQ A;  4MF6 A;  3GIX A;  3F4S A;  4MF5 A;  1GSF A;  5IOW A;  4F82 A;  4OO4 A;  2LNS A;  4AJ6 A;  4WXT A;  2R6K A;  3WT2 A;  4CW9 A;  1T1V A;  1QXH A;  1YEX A;  2XPD A;  2B1L A;  5IO2 A;  5DQS A;  4MJA A;  1OKD A;  4YKG A;  3J7Y b;  2OA7 A;  5JCW A;  12GS A;  4G19 A;  2XBI A;  1B4P A;  4RQX A;  2OAC A;  4O5U A;  2IJY A;  2XPE A;  5CAX A;  2HZE A;  3V1W A;  1FAA A;  1A24 A;  3VPQ A;  2A2P A;  3VWX A;  2YNX A;  4TVE A;  3GKK A;  3C1S A;  2L5O A;  2YV7 A;  4G2E A;  2DJJ A;  4IBP A;  2H1G A;  3HYP A;  5ECQ B;  3G7Y A;  2B5X A;  1K0D A;  2HRA A;  1XWC A;  1NHY A;  1G6Y A;  5IIZ A;  2LNT A;  3M3M A;  16GS A;  4Z2T A;  3F8U A;  3FR3 A;  2H0G A;  2H1D A;  2PVQ A;  4H86 A;  4MF7 A;  4TRX A;  2VCX A;  1YY7 A;  1Q98 A;  5KN0 A;  4TR1 A;  2WRT A;  3KXO A;  4GF0 A;  1O73 A;  4K6X A;  2P0G A;  5AIX A;  3KCM A;  2ZUP A;  5HR3 A;  3DEX A;  3LFL A;  4WF5 A;  2H66 A;  1TU7 A;  3ERW A;  4PUA A;  2HSY A;  1E2Y A;  1O85 A;  2P31 A;  2LEG A;  2KP2 A;  4ISD A;  3IPZ A;  2OKA A;  3E3E A;  4YH2 A;  4DSS A;  5ECM B;  4MPF A;  1TRS A;  5IMA A;  3KH9 A;  1WOU A;  2I1U A;  4TR1 B;  4HZ4 A;  2H6Y A;  3GTU A;  3PIN A;  4BPY A;  3TB2 A;  3CBU A;  3EE2 A;  3QFA C;  3HHV A;  5J4U A;  1AQV A;  1B48 A;  3MWH A;  3UEM A;  2L6D A;  4WR4 A;  1KNG A;  2H6X A;  3VFI A;  1EGO A;  2GSQ A;  1S3C A;  1V57 A;  3D22 A;  1XWK A;  4XCS A;  4TR0 A;  5IQY A;  4Z2R A;  4KUN A;  2L59 A;  3DML A;  4PQH A;  3LEF A;  1PX7 A;  2WUL A;  2GTU A;  3H4K A;  2UZ8 A;  1WP0 A;  4XRD A;  1ABA A;  1PKZ A;  2XHF A;  5CRG A;  5DJM A;  3CSI A;  5KN3 A;  4N0V A;  2DC5 A;  1T00 A;  3LOR A;  4TN8 A;  4G0I A;  4KDY A;  4FYC A;  2IME A;  5GAN D;  18GS A;  3MAK A;  2P5Q A;  3KMO A;  3L4N A;  1M9A A;  1FVK A;  1HNB A;  4KF9 A;  1K0A A;  1V40 A;  5AGY A;  1XCC A;  2MMA A;  3MSZ A;  4GCI A;  1M9B A;  1OE8 A;  4LLR A;  3KTL A;  1YF0 A;  4L5L A;  4ZXG A;  1FOH A;  1XOA A;  1T4Y A;  4ZL9 A;  3QD9 A;  1A0F A;  1M2A A;  5J9B A;  3QAG A;  5ELG A;  1ZCP A;  2TIR A;  3GL3 A;  4HS1 A;  4BVY A;  1SD9 A;  3GL5 A;  5DQY A;  1GLQ A;  1G6W A;  5L71 A;  1CQG A;  4KSM A;  1V2A A;  5COH A;  1TI3 A;  2WDU A;  3RPN A;  3DD3 A;  4PUR A;  3O76 A;  1U88 A;  2G2Q A;  2XBQ A;  3M1G A;  5DDL A;  3FEU A;  3LYK A;  4WBJ A;  2HRK A;  4HEA 2;  2HSM A;  3RBT A;  3HVV A;  4D73 A;  2CAQ A;  1USB A;  4V2L A;  3ME7 A;  4NAX A;  1SK1 A;  1URM A;  2B7K A;  3P8W A;  4ILF A;  2GS3 A;  1YKC A;  3TKQ A;  1DSB A;  3R3E A;  5D9T A;  1DE2 A;  3IHG A;  4J56 E;  4JBB A;  3TJG A;  3K8N A;  2K8S A;  2OE0 A;  4I8B A;  3RHB A;  22GS A;  2RII A;  1K3O A;  4F2I A;  2IL3 A;  1PL1 A;  1S3D A;  2IPA A;  4X43 A;  3CYN A;  1SU9 A;  2YWN A;  2R0C A;  2DMM A;  5KN2 A;  3F4T A;  5ECN B;  3CXG A;  5ECI B;  3TJF A;  5HR0 A;  2CX3 A;  3ZIV A;  4BL7 B;  4ZIJ A;  1NM3 A;  2WJU A;  4I6X A;  1TRU A;  3E0U A;  3GH6 A;  3MNG A;  1AUC A;  1PQN A;  2CZ2 A;  5DBQ A;  3QAV A;  2B5Y A;  4HI7 A;  4N30 A;  4MLY A;  2YPM A;  1FHE A;  3LSZ A;  1ACV A;  5EY6 A;  1Q4J A;  2VCZ A;  3I6A A;  3HDC A;  1M2B A;  4J57 E;  4YKF A;  1WRY A;  2X8G A;  4EO3 A;  3HXS A;  4TR3 A;  3S9F A;  1GSQ A;  4F03 A;  3N5O A;  2J9H A;  3I43 A;  3KGK A;  4KB3 A;  1TP9 A;  4AJ7 A;  1LBK A;  2KHP A;  3LQ7 A;  2HE3 A;  2MMN A;  3IA1 A;  4Q5F A;  5AN1 A;  4OFM A;  2LJK A;  3TRQ A;  1VF3 A;  4ECB A;  5AIV A;  3HD5 A;  3UVH A;  1JHB A;  1ST9 A;  2X8H A;  2NDO A;  2PBJ A;  4RQR A;  5G30 A;  1G0T A;  1ZYP A;  1QMV A;  4ZB9 A;  4IJ3 A;  2NPB A;  3FY7 A;  3UOM A;  6GSW A;  1MDJ A;  2CX4 A;  3LJR A;  5HFK A;  3CTG A;  3D21 A;  2H0I A;  2H70 A;  2FNO A;  1LJR A;  3KP9 A;  5IM9 A;  5D93 A;  5D9W A;  1YF1 A;  1SK0 A;  2RUF A;  6GSX A;  5J5N A;  3BD2 A;  2JU5 A;  2VM1 A;  1FO5 A;  4MJE A;  3VI7 A;  1Z3E A;  1XOB A;  1K3L A;  2J23 A;  3F0I A;  2AUV A;  4K7O A;  4JZQ A;  4POK A;  2ALB A;  4MA9 A;  1TOF A;  4MDC A;  2B5E A;  3H1N A;  1XVW A;  4IHU A;  4GXZ A;  2O7K A;  5B6N A;  4OO5 A;  1F2E A;  3L9V A;  1PD2 1;  4YAV A;  1EWX A;  1ON4 A;  3GX0 A;  1TKD B;  2IWT A;  19GS A;  4I5Q A;  2C1Y A;  11GS A;  3G7I A;  5G5F A;  4I97 A;  5G2Z A;  4RI6 A;  2ON5 A;  3EUR A;  5HFG A;  1YQ1 A;  3HCZ A;  1HYU A;  2EC4 A;  2X49 A;  1V98 A;  4GSS A;  4OD7 A;  6GSV A;  2GSS A;  1K0N A;  2VLU A;  5JCG A;  2JZR A;  2OJL A;  4ML6 A;  3BCI A;  2YWM A;  3EU3 A;  3PR8 A;  13GS A;  3CSH A;  5F05 A;  2GZY A;  3EMP A;  3EU4 A;  4G0K A;  3TOU A;  3BBY A;  3DVW A;  5FT3 A;  4MMM A;  3MDK A;  4Z2U A;  3APO A;  2R2J A;  4GQF A;  2MMZ A;  3D5J A;  5DAL B;  3F63 A;  1BED A;  1Y6E A;  2PUK C;  2DIZ A;  2HYX A;  5A4U A;  1EOH A;  1LU4 A;  4AGS A;  4LL4 B;  3TKP A;  1NSW A;  1BJX A;  2VCT A;  4OCE A;  3TKR A;  1GRX A;  1EGR A;  4LA1 A;  2AB6 A;  2VL2 A;  2IFQ B;  4KH7 A;  1B4Q A;  2I3Y A;  14GS A;  3QAW A;  2X8C A;  6GSS A;  4K7N A;  4PQ1 A;  3TRP A;  2X99 A;  2FD3 A;  1XXU A;  2MBS A;  4MZW A;  2O85 A;  1THO A;  4ECC A;  1BX9 A;  3LYP A;  3CQF A;  5IMC A;  3U5R E;  3TOT A;  3NOF A;  1JZD A;  4MZB A;  3TCO A;  1QUW A;  4P3Y B;  1A2M A;  4HQZ A;  4FH8 A;  2KUC A;  2N5B A;  1FW1 A;  1ZL9 A;  1FVJ A;  3UMA A;  2C0G A;  4KE3 A;  4HOJ A;  4J2F A;  1GL8 A;  4HJM A;  5J41 A;  3UAP A;  4EDY A;  3O6T A;  4PUF C;  5A4W A;  3VLN A;  1XW6 A;  1G7O A;  1TRW A;  3QOU A;  1SYR A;  4JU5 A;  4MPG A;  5BRT A;  1X9S B;  2O87 A;  3NIV A;  3WYW A;  2C3T A;  3TKS A;  2F8A A;  2A2R A;  2GVP A;  2YZU A;  2R0G A;  4ZBA A;  1ZYE A;  3U6V A;  4K1F A;  1J0F A;  17GS A;  2CQ9 A;  2F51 A;  2A4H A;  2BJX A;  4XS4 A;  4KDU A;  3FW2 A;  4IP1 A;  1G7E A;  4JR4 A;  5CRW A;  2K8V A;  4LL1 B;  1T4Z A;  3FZ9 A;  2HZE B;  4ACS A;  2L6C A;  5IMF A;  4IQ1 A;  2C3N A;  5IOX A;  3A2V A;  4LMV A;  5IMD A;  2FGX A;  3KEB A;  2LUS A;  2B3S A;  3TDG A;  1TI1 A;  1K0C A;  1R5A A;  3VWV A;  1O8X A;  2H72 A;  4G9H A;  4EDZ A;  1ZZY A;  2PER A;  3FZA A;  4AJ8 A;  2I4A A;  2PMT A;  2MMO A;  1IYH A;  1RK4 A;  1SJ6 A;  4MJC A;  1FG4 A;  3ERG A;  1AQX A;  1SKW B;  1T8E B;  3C73 A;  3KM6 A;  1AC1 A;  1AAZ A;  4HZ2 A;  1PRX A;  5C00 A;  1B8X A;  1JFU A;  1MTC A;  1JZR A;  2FWE A;  3IK7 A;  3A5I A;  4OMV A;  1PMT A;  5HQP A;  2GDR A;  4MH2 A;  1NHO A;  3GUR A;  2DJ2 A;  4X1U A;  6GST A;  1OC3 A;  2CVD A;  4YQV A;  2LV3 A;  2B6M A;  5B8A A;  1GSS A;  3IV4 A;  2E2G A;  1RQM A;  2NTO A;  2YJ7 A;  3RPP A;  2N5A A;  1EV9 A;  1OE7 A;  3C7M A;  3EVI A;  3RAZ A;  3GV1 A;  1SEN A;  2JL4 A;  2LJR A;  2H01 A;  4IQA A;  5KOW A;  2WGR A;  3JCM L;  4DSS B;  4KGI A;  2HNL A;  2YJH A;  3TGZ A;  1ERV A;  1K0M A;  1GH2 A;  3F3R A;  4BA7 A;  2LKU A;  6GSY A;  3GTU B;  7GSS A;  5B6M A;  2VCW A;  4KCE A;  2M80 A;  4NXI A;  4E8E A;  1OC9 A;  4K5S A;  5B7C A;  4WKW A;  1AQW A;  1K0B A;  2P5R A;  1S3R A;  1GTB A;  1SL0 B;  3ISO A;  1OC8 A;  5C04 A;  3FRC A;  2C3Q A;  5IPG A;  2HT9 A;  4HDE A;  1ZYQ B;  5F0G A;  1WJK A;  2VAF A;  1SD8 A;  1A2L A;  1QK8 A;  3ZZX A;  1GUM A;  3FZ4 A;  2IMF A;  5F07 A;  1QGV A;  2V32 A;  1FB6 A;  2GT5 A;  3PPU A;  5CYY A;  3FR6 A;  4EVM A;  4BWS A;  2FWH A;  2QC7 A;  2FCH A;  2HFD A;  4MAB A;  2C80 A;  4Q5Q A;  3C1R A;  1R7H A;  3ZMK A;  1R5P A;  2GQK A;  1PA3 A;  1XW5 A;  3TJJ A;  1Y25 A;  4NPB A;  4L0U A;  4X0X A;  1VF4 A;  2LS5 A;  1CQH A;  2H74 A;  3ZTL A;  3NZN A;  4BVY B;  3VI5 A;  3A5W A;  2QA1 A;  3QCP A;  4K8M A;  3L0H A;  4IGJ A;  3H93 A;  3L9S A;  2AYT A;  3P90 A;  2GGT A;  3HVN A;  1JLV A;  5F8B A;  1BG5 A;  2F3M A;  2KLX A;  3OR5 A;  4KX4 A;  5HR2 A;  1X9W B;  3I69 A;  4MK3 A;  3GMF A;  3TJB A;  4ICY A;  3RDW A;  1WMJ A;  1F3A A;  2WZ9 A;  2YZH A;  5ENU A;  1MD4 A;  4RUV A;  2HI7 A;  3FHK A;  4D73 B;  1EP8 A;  2X4A A;  1YZX A;  3US3 A;  1WPI A;  1MDK A;  4MZC A;  3HJP A;  4GWR A;  1M3J A;  3HJO A;  3KJY A;  5A5K A;  2FWG A;  2GLR A;  4TW5 A;  5JWO B;  5E4W A;  4WR5 A;  1XWG A;  4USS A;  1J9B A;  2ZNM A;  3IHQ A;  1WIK A;  4K0G A;  1Z5Y E;  3ZRE A;  2CVK A;  1AW9 A;  3ED3 A;  4JR6 A;  4QL7 A;  1THX A;  4PNG A;  4KDX A;  5EPF A;  2FA4 A;  4XHM A;  2FLS A;  4YAP A;  5JCU A;  3UAR A;  2CV4 A;  2JAD A;  4IN0 A;  1FB0 A;  3Q74 A;  2PGT A;  2X64 A;  2C0D A;  1XWA A;  1ZOF A;  3M0F A;  1PFO A;  3VPT A;  8GSS A;  5D8I A;  4FO5 A;  4IS0 A;  1ERU A;  1KBN A;  1OYJ A;  2IMK A;  3VUR A;  4TXV A;  1FOV A;  3QR6 A;  2G0F A;  2WFC A;  5KEJ A;  1XW9 A;  4FYU A;  5FWG A;  1UN2 A;  4TXO A;  3DWV A;  4ZB6 A;  1GP1 A;  5EVO A;  3E9J B;  5IMV A;  1O7U A;  5H5S A;  4JE1 A;  1GUK A;  4F9Z A;  2V1M A;  4O5R A;  3D4M A;  3GNJ A;  1M99 A;  5ECK B;  3GX8 A;  1YDK A;  3ME8 A;  3LGC A;  1HNA A;  4MCU A;  1TU8 A;  2EIO A;  1R26 A;  4K2D A;  2I81 A;  3Q6O A;  1EV4 A;  3DKS A;  1GSY A;  4O92 A;  3GRX A;  4TXO B;  5INY A;  1V58 A;  2C8U A;  1TJD A;  2L4C A;  2AAW A;  2L57 A;  1U3I A;  3M9K A;  3IC4 A;  1VF2 A;  1XBS A;  2HLS A;  5IMZ A;  5DVB A;  1BYE A;  2H30 A;  4OCF A;  1N8J A;  1MDI A;  2VLT A;  4L0W A;  2DKI A;  3ZML A;  3C8E A;  1UC7 A;  2OBK A;  4KA0 A;  3APQ A;  2V41 A;  4POL A;  1F9M A;  1K0O A;  2DJ0 A;  1KTE A;  4OFT A;  1A8L A;  1YEP A;  4FIW A;  3ZVJ A;  3KD0 A;  4IW9 A;  2VCV A;  1MEK A;  2V6K A;  3EIN A;  3PGT A;  1O8W A;  3KP8 A;  3GYK A;  3ZIJ A;  2YP6 A;  1YKA A;  2JAC A;  4JED A;  2A2S A;  5ELA A;  4MH3 A;  1SL1 B;  2OE3 A;  4DVC A;  1XG8 A;  3QDN A;  5CRD A;  2FA8 A;  3W6G A;  3ZIT A;  5GZZ B;  3TUE A;  1VGL A;  1JZW A;  4EL1 A;  2H73 A;  4EE0 A;  3GUS A;  2R5G A;  4QQ7 A;  1PL2 A;  4L5O A;  2F9S A;  2KP1 A;  2EIQ A;  4N11 A;  2H0H A;  1QFN A;  2VOC A;  3CSJ A;  3HVS A;  2FUG 2;  1TTZ A;  3TJK A;  3KH7 A;  4CY8 A;  3FKF A;  2YCD A;  2K6V A;  3CTF A;  4IVF A;  4O32 A;  3MIX A;  2OBI A;  4L8E A;  3D4T A;  2M46 A;  3W8J A;  2PVO C;  3A3T A;  5ABR A;  5IPH A;  2FY6 A;  1W4V A;  2KOK A;  2B7J A;  3GHA A;  2Z9S A;  1O81 A;  3ZFB A;  2MBT A;  6GSU A;  5BMU A;  5A4V A;  1YJ6 A;  4NV2 A;  2VUP A;  4XS1 A;  3ZL5 A;  4BIK A;  4CY6 A;  1S3A A;  3GKX A;  2JZT A;  5CRH A;  2YOI A;  4HJ2 A;  3GA4 A;  4K9Z A;  4ID0 A;  2TRX A;  3GST A;  4DSQ A;  4NV5 A;  2L4Q A;  1H4O A;  1PGT A;  2ON7 A;  1SKS B;  4EXJ A;  1A23 A;  1BQ7 A;  2H75 A;  2PN8 A;  3HY2 A;  2E7P A;  3FR9 A;  1EOG A;  1SYX A;  1Z6N A;  1W89 A;  4EIP A;  3F9U A;  3ERF A;  4TKY A;  1WE0 A;  1I9D A;  4PNF A;  1DUG A;  5G1L A;  4WBR D;  3Q19 A;  3IAM 2;  1U3A A;  4G0L A;  4Q5N A;  3UJ1 A;  2M72 A;  1PN9 A;  4NMU A;  3WGD A;  4CHS A;  3EC3 A;  2PU9 C;  4FYB A;  1I5G A;  1XFL A;  5J3R A;  3A2X A;  20GS A;  1B9X C;  4POM A;  1SJI A;  5GST A;  2AJQ B;  4Z7X A;  1OAZ A;  3GN3 A;  3Q18 A;  4I2U A;  4EC0 A;  4IEL A;  1X9M B;  1K3Y A;  3QMX A;  4XS4 B;  4ZBB A;  1GSU A;  4PTS A;  2REM A;  4XS6 A;  1EP7 A;  3D6I A;  3TRX A;  4YQU A;  3I9V 2;  2PWJ A;  3APS A;  5B8B A;  1U87 A;  3CMI A;  2YV9 A;  4I2T A;  2HRN A;  4WET A;  1VRS D;  5G31 A;  3G7J A;  1AXD A;  1Z7P A;  2YWO A;  3HJM A;  4QL9 A;  4PXO A;  2HZF A;  2I9H A;  2JSZ A;  2O8V B;  1C72 A;  3IR4 A;  4KSO A;  2CAI A;  3BCK A;  3O3T A;  4HQS A;  4GTU A;  1ILO A;  2VD1 A;  3DRN A;  2GZP A;  3FYG A;  3IK9 A;  1GTI A;  2IMD A;  1TRV A;  3GFK A;  3ZVJ D;  1M7T A;  1IYI A;  2LRT A;  4HU7 A;  1GTU A;  1SJZ A;  3F6D A;  4NHZ A;  4O7H A;  3L78 A;  1F37 A;  1XVQ A;  5DCH A;  4GST A;  2VO4 A;  4GSN A;  3QFB C;  4KW6 A;  4TR4 A;  1XZO A;  4PQI A;  2DBC A;  4XTS A;  4PX1 A;  2DSA A;  5ECO B;  2VL9 A;  5CNW A;  1EEM A;  5GSS A;  5JWQ B;  3IXR A;  1Z9H A;  4POB A;  1OC9 B;  4K5R A;  4KND A;  5FHI A;  1XIY A; 
#chains in the Genus database with same CATH homology
 2DJ1 A;  3DGQ A;  2C0F A;  3HKR A;  3L9U A;  2C0E A;  4GRF A;  5KN1 A;  2WCI A;  4KAE A;  2DLX A;  5ECR B;  4ZIL A;  2YN1 A;  5LCZ A;  4K7I A;  1PN0 A;  2O89 A;  3HA9 A;  4EUY A;  3RHC A;  3EMX A;  3F4R A;  1HNC A;  3FMW A;  2E2M A;  2DJK A;  4OWY A;  2R3X A;  3BOA A;  1M0U A;  3AY8 A;  3KIJ A;  5HFI A;  2L5L A;  2NBS A;  3M8N A;  4OFN A;  2VD0 A;  2RM5 A;  4ZL7 A;  5HR1 A;  3CRU A;  4ECJ A;  3ZRD A;  1UVZ A;  2H19 A;  2LQO A;  3DIE A;  2LJA A;  2JZS A;  3TKS E;  5F06 A;  2HSH A;  2WB9 A;  4BL7 A;  3FZ5 A;  1N2A A;  1B9Y C;  2AHE A;  1PX6 A;  2OE1 A;  4EKZ A;  3BJ5 A;  3ZFL A;  4IP6 A;  2E0Q A;  2EIR A;  3HZ8 A;  3PH9 A;  5D9V A;  5ECP B;  3SBC A;  2IN3 A;  2IMI A;  1J08 A;  3VWU A;  4JRR A;  1H75 A;  2HXK A;  1F6M C;  3WT1 A;  3C71 A;  1TK5 B;  4E8H A;  2YAN A;  2VL2 C;  2DKH A;  4F0B A;  5DCG A;  1A2J A;  2VCQ A;  1WWJ A;  3R2Q A;  5D96 A;  4V1A p;  1U6T A;  3W8S A;  1X5E A;  2H1A A;  3MYD A;  4WF4 A;  3GH9 A;  2R4V A;  2LST A;  2V2G A;  3ZLP A;  3IE3 A;  2BMX A;  3QPM A;  1MD3 A;  1ERW A;  2B1K A;  1ML6 A;  4F0C A;  1QQ2 A;  1EZK A;  5KOX A;  1X5C A;  4G10 A;  2QGV A;  5CP1 A;  1X0R A;  1OKT A;  5LNK e;  4DSR A;  4MJB A;  1GUL A;  1TK0 B;  3DXB A;  5D9X A;  3H8Q A;  4EF0 A;  2V6O A;  2OAD A;  5CO3 A;  3IRA A;  2LTK A;  1T3B A;  2C4J A;  4MNN A;  5ID2 A;  3A2W A;  2CVB A;  3EPT A;  1ZYN A;  2RLI A;  3FK8 A;  1X5D A;  1GNE A;  1KEB A;  4CDO A;  3TKS C;  2ES7 A;  4O5Q A;  2RM6 A;  2VLV A;  4TOP A;  5H5R A;  4K2X A;  2H76 A;  3P2A A;  5E59 A;  5J9C A;  5ECS A;  3N9J A;  2LQQ A;  3UL3 A;  2FHE A;  1SK2 A;  5ECL B;  3WGE A;  4V1A g;  1O6J A;  3UBK A;  3KMN A;  3GKN A;  2XC2 A;  5LD0 A;  5ID2 B;  3GSS A;  4K0N A;  3H79 A;  3WGX A;  3DVX A;  5G5E A;  1VF1 A;  4KCA A;  1JZO A;  4ZB8 A;  1UA5 A;  1BAY A;  2BTO T;  3LG6 A;  1GLP A;  1PKW A;  1Z6M A;  1RW1 A;  2RUE A;  1M2D A;  1XPV A;  5ECH B;  2TRC P;  2VIM A;  3SWL A;  4AF2 A;  4ECI A;  4ULX A;  1V9W A;  2MYG A;  2QA2 A;  3UBL A;  1A8Y A;  4EIQ A;  4V2M A;  3IAS 2;  1DBY A;  5DAK A;  3UVT A;  1GUH A;  3DYR A;  1GTA A;  3LXT A;  2GQM A;  2H1B A;  2F8F A;  1TDI A;  1GSD A;  9GSS A;  5EL8 A;  2H8L A;  4RI7 A;  4YQM A;  4BWQ A;  1HD2 A;  2FWF A;  2ZCT A;  4ML1 A;  3IC8 A;  3LW9 A;  1A0R P;  2YWI A;  4MP4 A;  3F6F A;  2IIY A;  4BVX A;  5IO0 A;  4NWY A;  3CRT A;  2H6Z A;  2MZC A;  2WS2 A;  1SKR B;  3GKM A;  4ZBD A;  2K18 A;  1PSQ A;  2PPT A;  1HQO A;  1Z7R A;  3VK9 A;  3EYT A;  1AIU A;  3J7Y k;  5DAK B;  3M9J A;  3LXZ A;  3D0Z A;  3P7X A;  5CRE A;  2NVL A;  1ZMA A;  2VL3 A;  4N10 A;  2DIY A;  2LRC A;  4DEJ A;  2GT6 A;  1ERT A;  4X4J A;  3G9B A;  3ZYW A;  2GST A;  4XRA A;  2QSI A;  1GWC A;  3WD6 A;  4A5P A;  5DAL A;  4Q5R A;  3F3Q A;  3IBH A;  4XIH A;  1JLW A;  2R0P A;  2LRN A;  1GNW A;  4BVX B;  1XWB A;  1DE1 A;  2JSY A;  5D73 A;  5DJL A;  3EWL A;  4GLT A;  4NHW A;  1SL2 B;  2DML A;  2CZ3 A;  3IDV A;  3VWW A;  5G1K A;  1EEJ A;  4IJI A;  1T7P B;  1TW9 A;  1GSE A;  3HVX A;  2IFQ A;  3KTB A;  2GZZ A;  2AV4 A;  2QKE A;  2HRF A;  4WEY A;  10GS A;  2CA8 A;  1F3B A;  5JWR B;  4HUA A;  1NW2 A;  2H71 A;  1TXX A;  4LMW A;  1E6B A;  5GAP D;  2GSR A;  2A4V A;  4ZL8 A;  3HZ4 A;  2GQL A;  2K9F A;  5H5Q A;  4FQU A;  4V2N A;  5AIS A;  1R4W A;  2VM2 A;  1TK8 B;  2N5F A;  4GQC A;  2DJ3 A;  4HU9 A;  4N0Z A;  3LWA A;  2D2Z A;  3IOS A;  4IKH A;  1OVN A;  3UIW A;  4PGT A;  2R37 A;  2CT6 A;  1ZGN A;  3KZQ A;  4MF6 A;  3GIX A;  3F4S A;  4MF5 A;  1GSF A;  5IOW A;  4F82 A;  4OO4 A;  2LNS A;  4AJ6 A;  4WXT A;  2R6K A;  3WT2 A;  4CW9 A;  1T1V A;  1QXH A;  1YEX A;  2XPD A;  2B1L A;  5IO2 A;  5DQS A;  4MJA A;  1OKD A;  4YKG A;  3J7Y b;  2OA7 A;  5JCW A;  12GS A;  4G19 A;  2XBI A;  1B4P A;  4RQX A;  2OAC A;  4O5U A;  2IJY A;  2XPE A;  5CAX A;  2HZE A;  3V1W A;  1FAA A;  1A24 A;  3VPQ A;  2A2P A;  3VWX A;  2YNX A;  4TVE A;  3GKK A;  3C1S A;  2L5O A;  2YV7 A;  4G2E A;  2DJJ A;  4IBP A;  2H1G A;  3HYP A;  5ECQ B;  3G7Y A;  2B5X A;  1K0D A;  2HRA A;  1XWC A;  1NHY A;  1G6Y A;  5IIZ A;  2LNT A;  3M3M A;  16GS A;  4Z2T A;  3F8U A;  3FR3 A;  2H0G A;  2H1D A;  2PVQ A;  4H86 A;  4MF7 A;  4TRX A;  2VCX A;  1YY7 A;  1Q98 A;  5KN0 A;  4TR1 A;  2WRT A;  3KXO A;  4GF0 A;  1O73 A;  4K6X A;  2P0G A;  5AIX A;  3KCM A;  2ZUP A;  5HR3 A;  3DEX A;  3LFL A;  4WF5 A;  2H66 A;  1TU7 A;  3ERW A;  4PUA A;  2HSY A;  1E2Y A;  1O85 A;  2P31 A;  2LEG A;  2KP2 A;  4ISD A;  3IPZ A;  2OKA A;  3E3E A;  4YH2 A;  4DSS A;  5ECM B;  4MPF A;  1TRS A;  5IMA A;  3KH9 A;  1WOU A;  2I1U A;  4TR1 B;  4HZ4 A;  2H6Y A;  3GTU A;  3PIN A;  4BPY A;  3TB2 A;  3CBU A;  3EE2 A;  3QFA C;  3HHV A;  5J4U A;  1AQV A;  1B48 A;  3MWH A;  3UEM A;  2L6D A;  4WR4 A;  1KNG A;  2H6X A;  3VFI A;  1EGO A;  2GSQ A;  1S3C A;  1V57 A;  3D22 A;  1XWK A;  4XCS A;  4TR0 A;  5IQY A;  4Z2R A;  4KUN A;  2L59 A;  3DML A;  4PQH A;  3LEF A;  1PX7 A;  2WUL A;  2GTU A;  3H4K A;  2UZ8 A;  1WP0 A;  4XRD A;  1ABA A;  1PKZ A;  2XHF A;  5CRG A;  5DJM A;  3CSI A;  5KN3 A;  4N0V A;  2DC5 A;  1T00 A;  3LOR A;  4TN8 A;  4G0I A;  4KDY A;  4FYC A;  2IME A;  5GAN D;  18GS A;  3MAK A;  2P5Q A;  3KMO A;  3L4N A;  1M9A A;  1FVK A;  1HNB A;  4KF9 A;  1K0A A;  1V40 A;  5AGY A;  1XCC A;  2MMA A;  3MSZ A;  4GCI A;  1M9B A;  1OE8 A;  4LLR A;  3KTL A;  1YF0 A;  4L5L A;  4ZXG A;  1FOH A;  1XOA A;  1T4Y A;  4ZL9 A;  3QD9 A;  1A0F A;  1M2A A;  5J9B A;  3QAG A;  5ELG A;  1ZCP A;  2TIR A;  3GL3 A;  4HS1 A;  4BVY A;  1SD9 A;  3GL5 A;  5DQY A;  1GLQ A;  1G6W A;  5L71 A;  1CQG A;  4KSM A;  1V2A A;  5COH A;  1TI3 A;  2WDU A;  3RPN A;  3DD3 A;  4PUR A;  3O76 A;  1U88 A;  2G2Q A;  2XBQ A;  3M1G A;  5DDL A;  3FEU A;  3LYK A;  4WBJ A;  2HRK A;  4HEA 2;  2HSM A;  3RBT A;  3HVV A;  4D73 A;  2CAQ A;  1USB A;  4V2L A;  3ME7 A;  4NAX A;  1SK1 A;  1URM A;  2B7K A;  3P8W A;  4ILF A;  2GS3 A;  1YKC A;  3TKQ A;  1DSB A;  3R3E A;  5D9T A;  1DE2 A;  3IHG A;  4J56 E;  4JBB A;  3TJG A;  3K8N A;  2K8S A;  2OE0 A;  4I8B A;  3RHB A;  22GS A;  2RII A;  1K3O A;  4F2I A;  2IL3 A;  1PL1 A;  1S3D A;  2IPA A;  4X43 A;  3CYN A;  1SU9 A;  2YWN A;  2R0C A;  2DMM A;  5KN2 A;  3F4T A;  5ECN B;  3CXG A;  5ECI B;  3TJF A;  5HR0 A;  2CX3 A;  3ZIV A;  4BL7 B;  4ZIJ A;  1NM3 A;  2WJU A;  4I6X A;  1TRU A;  3E0U A;  3GH6 A;  3MNG A;  1AUC A;  1PQN A;  2CZ2 A;  5DBQ A;  3QAV A;  2B5Y A;  4HI7 A;  4N30 A;  4MLY A;  2YPM A;  1FHE A;  3LSZ A;  1ACV A;  5EY6 A;  1Q4J A;  2VCZ A;  3I6A A;  3HDC A;  1M2B A;  4J57 E;  4YKF A;  1WRY A;  2X8G A;  4EO3 A;  3HXS A;  4TR3 A;  3S9F A;  1GSQ A;  4F03 A;  3N5O A;  2J9H A;  3I43 A;  3KGK A;  4KB3 A;  1TP9 A;  4AJ7 A;  1LBK A;  2KHP A;  3LQ7 A;  2HE3 A;  2MMN A;  3IA1 A;  4Q5F A;  5AN1 A;  4OFM A;  2LJK A;  3TRQ A;  1VF3 A;  4ECB A;  5AIV A;  3HD5 A;  3UVH A;  1JHB A;  1ST9 A;  2X8H A;  2NDO A;  2PBJ A;  4RQR A;  5G30 A;  1G0T A;  1ZYP A;  1QMV A;  4ZB9 A;  4IJ3 A;  2NPB A;  3FY7 A;  3UOM A;  6GSW A;  1MDJ A;  2CX4 A;  3LJR A;  5HFK A;  3CTG A;  3D21 A;  2H0I A;  2H70 A;  2FNO A;  1LJR A;  3KP9 A;  5IM9 A;  5D93 A;  5D9W A;  1YF1 A;  1SK0 A;  2RUF A;  6GSX A;  5J5N A;  3BD2 A;  2JU5 A;  2VM1 A;  1FO5 A;  4MJE A;  3VI7 A;  1Z3E A;  1XOB A;  1K3L A;  2J23 A;  3F0I A;  2AUV A;  4K7O A;  4JZQ A;  4POK A;  2ALB A;  4MA9 A;  1TOF A;  4MDC A;  2B5E A;  3H1N A;  1XVW A;  4IHU A;  4GXZ A;  2O7K A;  5B6N A;  4OO5 A;  1F2E A;  3L9V A;  1PD2 1;  4YAV A;  1EWX A;  1ON4 A;  3GX0 A;  1TKD B;  2IWT A;  19GS A;  4I5Q A;  2C1Y A;  11GS A;  3G7I A;  5G5F A;  4I97 A;  5G2Z A;  4RI6 A;  2ON5 A;  3EUR A;  5HFG A;  1YQ1 A;  3HCZ A;  1HYU A;  2EC4 A;  2X49 A;  1V98 A;  4GSS A;  4OD7 A;  6GSV A;  2GSS A;  1K0N A;  2VLU A;  5JCG A;  2JZR A;  2OJL A;  4ML6 A;  3BCI A;  2YWM A;  3EU3 A;  3PR8 A;  13GS A;  3CSH A;  5F05 A;  2GZY A;  3EMP A;  3EU4 A;  4G0K A;  3TOU A;  3BBY A;  3DVW A;  5FT3 A;  4MMM A;  3MDK A;  4Z2U A;  3APO A;  2R2J A;  4GQF A;  2MMZ A;  3D5J A;  5DAL B;  3F63 A;  1BED A;  1Y6E A;  2PUK C;  2DIZ A;  2HYX A;  5A4U A;  1EOH A;  1LU4 A;  4AGS A;  4LL4 B;  3TKP A;  1NSW A;  1BJX A;  2VCT A;  4OCE A;  3TKR A;  1GRX A;  1EGR A;  4LA1 A;  2AB6 A;  2VL2 A;  2IFQ B;  4KH7 A;  1B4Q A;  2I3Y A;  14GS A;  3QAW A;  2X8C A;  6GSS A;  4K7N A;  4PQ1 A;  3TRP A;  2X99 A;  2FD3 A;  1XXU A;  2MBS A;  4MZW A;  2O85 A;  1THO A;  4ECC A;  1BX9 A;  3LYP A;  5IMC A;  3U5R E;  3TOT A;  3NOF A;  1JZD A;  4MZB A;  3TCO A;  1QUW A;  4P3Y B;  1A2M A;  4HQZ A;  4FH8 A;  2KUC A;  2N5B A;  1FW1 A;  1ZL9 A;  1FVJ A;  3UMA A;  2C0G A;  4KE3 A;  4HOJ A;  4J2F A;  1GL8 A;  4HJM A;  5J41 A;  3UAP A;  4EDY A;  3O6T A;  4PUF C;  5A4W A;  3VLN A;  1XW6 A;  1G7O A;  1TRW A;  3QOU A;  1SYR A;  4JU5 A;  4MPG A;  5BRT A;  1X9S B;  2O87 A;  3NIV A;  3WYW A;  2C3T A;  3TKS A;  2F8A A;  2A2R A;  2GVP A;  2YZU A;  2R0G A;  4ZBA A;  1ZYE A;  3U6V A;  4K1F A;  1J0F A;  17GS A;  2CQ9 A;  2F51 A;  2A4H A;  2BJX A;  4XS4 A;  4KDU A;  3FW2 A;  4IP1 A;  1G7E A;  4JR4 A;  5CRW A;  2K8V A;  4LL1 B;  1T4Z A;  3FZ9 A;  2HZE B;  4ACS A;  2L6C A;  5IMF A;  4IQ1 A;  2C3N A;  5IOX A;  3A2V A;  4LMV A;  5IMD A;  2FGX A;  3KEB A;  2LUS A;  2B3S A;  3TDG A;  1TI1 A;  1K0C A;  1R5A A;  3VWV A;  1O8X A;  2H72 A;  4G9H A;  4EDZ A;  1ZZY A;  2PER A;  3FZA A;  4AJ8 A;  2I4A A;  2PMT A;  2MMO A;  1IYH A;  1RK4 A;  1SJ6 A;  4MJC A;  1FG4 A;  3ERG A;  1AQX A;  1SKW B;  1T8E B;  3C73 A;  3KM6 A;  1AC1 A;  1AAZ A;  4HZ2 A;  1PRX A;  5C00 A;  1B8X A;  1JFU A;  1MTC A;  1JZR A;  2FWE A;  3IK7 A;  3A5I A;  4OMV A;  1PMT A;  5HQP A;  2GDR A;  4MH2 A;  1NHO A;  3GUR A;  2DJ2 A;  4X1U A;  6GST A;  1OC3 A;  2CVD A;  4YQV A;  2LV3 A;  2B6M A;  5B8A A;  1GSS A;  3IV4 A;  2E2G A;  1RQM A;  2NTO A;  2YJ7 A;  3RPP A;  2N5A A;  1EV9 A;  1OE7 A;  3C7M A;  3EVI A;  3RAZ A;  3GV1 A;  1SEN A;  2JL4 A;  2LJR A;  2H01 A;  4IQA A;  5KOW A;  2WGR A;  3JCM L;  4DSS B;  4KGI A;  2HNL A;  2YJH A;  3TGZ A;  1ERV A;  1K0M A;  1GH2 A;  3F3R A;  4BA7 A;  2LKU A;  6GSY A;  3GTU B;  7GSS A;  5B6M A;  2VCW A;  4KCE A;  2M80 A;  4NXI A;  4E8E A;  1OC9 A;  4K5S A;  5B7C A;  4WKW A;  1AQW A;  1K0B A;  2P5R A;  1GTB A;  1SL0 B;  3ISO A;  1OC8 A;  5C04 A;  3FRC A;  2C3Q A;  5IPG A;  2HT9 A;  4HDE A;  1ZYQ B;  5F0G A;  1WJK A;  2VAF A;  1SD8 A;  1A2L A;  1QK8 A;  3ZZX A;  1GUM A;  3FZ4 A;  2IMF A;  5F07 A;  1QGV A;  2V32 A;  1FB6 A;  2GT5 A;  3PPU A;  5CYY A;  3FR6 A;  4EVM A;  4BWS A;  2FWH A;  2QC7 A;  2FCH A;  2HFD A;  4MAB A;  2C80 A;  4Q5Q A;  3C1R A;  1R7H A;  3ZMK A;  1R5P A;  2GQK A;  1PA3 A;  1XW5 A;  3TJJ A;  1Y25 A;  4NPB A;  4L0U A;  4X0X A;  1VF4 A;  2LS5 A;  1CQH A;  2H74 A;  3ZTL A;  3NZN A;  4BVY B;  3VI5 A;  3A5W A;  2QA1 A;  3QCP A;  4K8M A;  3L0H A;  4IGJ A;  3H93 A;  3L9S A;  2AYT A;  3P90 A;  2GGT A;  1JLV A;  5F8B A;  1BG5 A;  2F3M A;  2KLX A;  3OR5 A;  4KX4 A;  5HR2 A;  1X9W B;  3I69 A;  4MK3 A;  3GMF A;  3TJB A;  4ICY A;  3RDW A;  1WMJ A;  1F3A A;  2WZ9 A;  2YZH A;  5ENU A;  1MD4 A;  4RUV A;  2HI7 A;  3FHK A;  4D73 B;  1EP8 A;  2X4A A;  1YZX A;  3US3 A;  1WPI A;  1MDK A;  4MZC A;  3HJP A;  4GWR A;  3HJO A;  3KJY A;  5A5K A;  2FWG A;  2GLR A;  4TW5 A;  5JWO B;  5E4W A;  4WR5 A;  1XWG A;  4USS A;  1J9B A;  2ZNM A;  3IHQ A;  1WIK A;  4K0G A;  1Z5Y E;  3ZRE A;  2CVK A;  1AW9 A;  3ED3 A;  4JR6 A;  4QL7 A;  1THX A;  4PNG A;  4KDX A;  5EPF A;  2FA4 A;  4XHM A;  2FLS A;  4YAP A;  5JCU A;  3UAR A;  2CV4 A;  2JAD A;  4IN0 A;  1FB0 A;  3Q74 A;  2PGT A;  2X64 A;  2C0D A;  1XWA A;  1ZOF A;  3M0F A;  3VPT A;  8GSS A;  5D8I A;  4FO5 A;  4IS0 A;  1ERU A;  1KBN A;  1OYJ A;  2IMK A;  3VUR A;  4TXV A;  1FOV A;  3QR6 A;  2G0F A;  2WFC A;  5KEJ A;  1XW9 A;  4FYU A;  5FWG A;  1UN2 A;  4TXO A;  3DWV A;  4ZB6 A;  1GP1 A;  5EVO A;  3E9J B;  5IMV A;  1O7U A;  5H5S A;  4JE1 A;  1GUK A;  4F9Z A;  2V1M A;  4O5R A;  3D4M A;  3GNJ A;  1M99 A;  5ECK B;  3GX8 A;  1YDK A;  3ME8 A;  3LGC A;  1HNA A;  4MCU A;  1TU8 A;  2EIO A;  1R26 A;  4K2D A;  2I81 A;  3Q6O A;  1EV4 A;  3DKS A;  1GSY A;  4O92 A;  3GRX A;  4TXO B;  5INY A;  1V58 A;  2C8U A;  1TJD A;  2L4C A;  2AAW A;  2L57 A;  1U3I A;  3M9K A;  3IC4 A;  1VF2 A;  1XBS A;  2HLS A;  5IMZ A;  5DVB A;  1BYE A;  2H30 A;  4OCF A;  1N8J A;  1MDI A;  2VLT A;  4L0W A;  2DKI A;  3ZML A;  3C8E A;  1UC7 A;  2OBK A;  4KA0 A;  3APQ A;  2V41 A;  4POL A;  1F9M A;  1K0O A;  2DJ0 A;  1KTE A;  4OFT A;  1A8L A;  1YEP A;  4FIW A;  3ZVJ A;  3KD0 A;  4IW9 A;  2VCV A;  1MEK A;  2V6K A;  3EIN A;  3PGT A;  1O8W A;  3KP8 A;  3GYK A;  3ZIJ A;  2YP6 A;  1YKA A;  2JAC A;  4JED A;  2A2S A;  5ELA A;  4MH3 A;  1SL1 B;  2OE3 A;  4DVC A;  3QDN A;  5CRD A;  2FA8 A;  3W6G A;  3ZIT A;  5GZZ B;  3TUE A;  1VGL A;  1JZW A;  4EL1 A;  2H73 A;  4EE0 A;  3GUS A;  2R5G A;  4QQ7 A;  1PL2 A;  4L5O A;  2F9S A;  2KP1 A;  2EIQ A;  4N11 A;  2H0H A;  1QFN A;  2VOC A;  3CSJ A;  3HVS A;  2FUG 2;  1TTZ A;  3TJK A;  3KH7 A;  4CY8 A;  3FKF A;  2YCD A;  2K6V A;  3CTF A;  4IVF A;  4O32 A;  3MIX A;  2OBI A;  4L8E A;  3D4T A;  2M46 A;  3W8J A;  2PVO C;  3A3T A;  5ABR A;  5IPH A;  2FY6 A;  1W4V A;  2KOK A;  2B7J A;  3GHA A;  2Z9S A;  1O81 A;  3ZFB A;  2MBT A;  6GSU A;  5BMU A;  5A4V A;  1YJ6 A;  4NV2 A;  2VUP A;  4XS1 A;  3ZL5 A;  4CY6 A;  1S3A A;  3GKX A;  2JZT A;  5CRH A;  2YOI A;  4HJ2 A;  3GA4 A;  4K9Z A;  4ID0 A;  2TRX A;  3GST A;  4DSQ A;  4NV5 A;  2L4Q A;  1H4O A;  1PGT A;  2ON7 A;  1SKS B;  4EXJ A;  1A23 A;  1BQ7 A;  2H75 A;  2PN8 A;  3HY2 A;  2E7P A;  3FR9 A;  1EOG A;  1SYX A;  1Z6N A;  1W89 A;  4EIP A;  3F9U A;  3ERF A;  4TKY A;  1WE0 A;  1I9D A;  4PNF A;  1DUG A;  5G1L A;  4WBR D;  3Q19 A;  3IAM 2;  1U3A A;  4G0L A;  4Q5N A;  3UJ1 A;  2M72 A;  1PN9 A;  4NMU A;  3WGD A;  4CHS A;  3EC3 A;  2PU9 C;  4FYB A;  1I5G A;  1XFL A;  5J3R A;  3A2X A;  20GS A;  1B9X C;  4POM A;  1SJI A;  5GST A;  2AJQ B;  4Z7X A;  1OAZ A;  3GN3 A;  3Q18 A;  4I2U A;  4EC0 A;  4IEL A;  1X9M B;  1K3Y A;  3QMX A;  4XS4 B;  4ZBB A;  1GSU A;  4PTS A;  2REM A;  4XS6 A;  1EP7 A;  3D6I A;  3TRX A;  4YQU A;  3I9V 2;  2PWJ A;  3APS A;  5B8B A;  1U87 A;  3CMI A;  2YV9 A;  4I2T A;  2HRN A;  4WET A;  1VRS D;  5G31 A;  3G7J A;  1AXD A;  1Z7P A;  2YWO A;  3HJM A;  4QL9 A;  4PXO A;  2HZF A;  2I9H A;  2JSZ A;  2O8V B;  1C72 A;  3IR4 A;  4KSO A;  2CAI A;  3BCK A;  3O3T A;  4HQS A;  4GTU A;  1ILO A;  2VD1 A;  3DRN A;  2GZP A;  3FYG A;  3IK9 A;  1GTI A;  2IMD A;  1TRV A;  3GFK A;  3ZVJ D;  1M7T A;  1IYI A;  2LRT A;  4HU7 A;  1GTU A;  1SJZ A;  3F6D A;  4NHZ A;  4O7H A;  3L78 A;  1F37 A;  1XVQ A;  5DCH A;  4GST A;  2VO4 A;  4GSN A;  3QFB C;  4KW6 A;  4TR4 A;  1XZO A;  4PQI A;  2DBC A;  4XTS A;  4PX1 A;  2DSA A;  5ECO B;  2VL9 A;  5CNW A;  1EEM A;  5GSS A;  5JWQ B;  3IXR A;  1Z9H A;  4POB A;  1OC9 B;  4K5R A;  4KND A;  5FHI A;  1XIY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...