1XWBA

Drospohila thioredoxin, oxidized, p42212
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords thioredoxin
publication title Comparative structural analysis of oxidized and reduced thioredoxin from Drosophila melanogaster
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 32
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1xwbA00
4KDUA 5AIVA 4J56E 4GSSA 5CREA 4L0UA 4K9ZA 1N2AA 4BPYA 3LG6A 4HU7A 5HR0A 3E3EA 4MF5A 1IYIA 1TU7A 1JFUA 1O8WA 3ZVJD 4CW9A 2LRTA 1EV4A 4MPFA 2C0FA 3L9VA 1MD3A 3P90A 3LEFA 2JZTA 3DKSA 2L4QA 4PUAA 2ALBA 4YQVA 4TR4A 2GSQA 2IMEA 4FIWA 2YOIA 1X9SB 4MJCA 3F3QA 3QR6A 2H73A 3ZIJA 5H5QA 4MLYA 4Q5QA 5ECNB 3KP8A 1FW1A 4GF0A 1SK0A 3KJYA 3W8JA 2YN1A 2JL4A 5IO0A 3KD0A 5G1LA 3TCOA 1B4QA 1V57A 2EIOA 1F9MA 4IQ1A 4MCUA 3FY7A 1TK8B 2QSIA 3F4RA 3IK7A 3IV4A 1F6MC 2WGRA 2YZHA 3GH9A 4YH2A 1GNEA 1USBA 1XCCA 2GSRA 1MDKA 4NPBA 16GSA 3GX8A 3KH9A 1BYEA 3BD2A 1AQWA 1X9MB 2HE3A 3A2XA 5IMFA 2DJ1A 3CRUA 5DBQA 1JZOA 2I1UA 3E9JB 4EKZA 4RQXA 2GQKA 2VCTA 3GMFA 5JWOB 2QC7A 4HU9A 1OKDA 1SK2A 4EUYA 5DDLA 3VWVA 3D4TA 5CP1A 2K8SA 4RI7A 2GS3A 1CQHA 3FZ9A 3VWXA 1DE1A 2AB6A 4POKA 3IOSA 3GURA 2GT5A 1JLVA 3ME8A 4MZWA 4XCSA 1Q4JA 3HJMA 5J3RA 2JZRA 1T4ZA 4PNFA 5IOWA 4TXOA 3IAS2 4POLA 4TXVA 1U3IA 5G2ZA 2C0DA 3ZFBA 2KHPA 3MDKA 1B4PA 5G30A 3DVWA 3PINA 4BWSA 1THOA 1EOHA 1UN2A 3EURA 1A2JA 5F07A 1AC1A 2O85A 2PVOC 1K0OA 2MMOA 1GSDA 2CVKA 2YP6A 5C00A 5DALB 2GSTA 1KTEA 3CXGA 3GH6A 5HQPA 5AGYA 2L6DA 4K0GA 5GSTA 1PKZA 5CAXA 1FB0A 1YF0A 2KP2A 4F9ZA 4PGTA 1MDIA 3PR8A 2AV4A 1S3CA 2AJQB 4IVFA 1U6TA 4OD7A 4QQ7A 2H74A 3TRPA 1YQ1A 2JADA 5LD0A 5B6NA 4ZILA 3UBKA 2OADA 1TU8A 3M9JA 4PQHA 1M7TA 4ZB9A 4RUVA 3TJBA 2O8VB 2D2ZA 2HZEA 3Q18A 1T1VA 1O81A 1K0MA 1I9DA 3TRQA 1GULA 2CVBA 2IJYA 1DSBA 5D9TA 2HNLA 2VL2C 4IQAA 3E0UA 3HZ4A 3QPMA 3I43A 3F0IA 4EDZA 1PL2A 1V98A 4FYBA 4XS1A 2YWNA 2HFDA 5GAPD 3ZFLA 4DSQA 3RHCA 2H72A 4PURA 2K6VA 4KCAA 3EVIA 1K0CA 1MD4A 3ED3A 4V2MA 5E59A 2VM2A 4TR3A 4OFTA 4IP1A 3CTGA 1V40A 3GTUB 1QXHA 3S9FA 4WF4A 5JCGA 3M3MA 1SJ6A 2PGTA 2VD0A 5G5FA 5LCZA 1ACVA 5J9BA 5IMZA 2JACA 2E0QA 3CSHA 5EL8A 3F4TA 2I4AA 2NVLA 2H0GA 1WPIA 2IMFA 5F06A 5GZZB 2H1GA 1NM3A 2WFCA 5LNKe 3IE3A 4POMA 3M0FA 3D4MA 3TB2A 3UVHA 1OC3A 4QL9A 1VF2A 5AIXA 3DD3A 2GGTA 4MABA 1M2AA 5DJLA 1KBNA 5IPGA 1AIUA 4G19A 1ON4A 5KN0A 1SYXA 2LV3A 2C0GA 2C80A 5F05A 3LXTA 3FHKA 5GAND 4FYUA 5IMAA 4BVXA 2M72A 3QMXA 4EXJA 2OBIA 2CAIA 2AUVA 1XOBA 1ZL9A 1XWAA 3LFLA 3F6FA 3LYKA 1EGRA 5IO2A 2R6KA 3KM6A 5ECMB 3HVSA 4FH8A 4NHWA 1XPVA 2N5BA 3TRXA 1TK5B 3JCML 1LBKA 5A4WA 3WT1A 4ACSA 1OAZA 2FUG2 4GWRA 4JE1A 2YZUA 3LGCA 1XWGA 2N5FA 4E8HA 5F0GA 4I97A 4RI6A 5CRDA 5DJMA 3Q19A 1Z5YE 1A2LA 1U3AA 5H5SA 2V6OA 1QQ2A 1XWBA 3Q6OA 3NZNA 1WWJA 5G31A 5KN3A 2KLXA 3HHVA 4KB3A 1QGVA 2AYTA 4FO5A 1S3DA 1LU4A 2ZUPA 3RPNA 3UJ1A 4K0NA 1SD8A 2DMLA 4I2UA 2OE1A 5FWGA 1YEPA 1K3LA 2PN8A 2H6XA 3D0ZA 3G7IA 3FKFA 2KOKA 5DAKA 1A0FA 1M2DA 3I6AA 1ERTA 2LQOA 2H66A 3HY2A 2HSHA 1PGTA 2H71A 4WR4A 3KIJA 4KDYA 1GUKA 3R2QA 3HA9A 4NV2A 2O87A 4XTSA 2YPMA 2H1DA 3ERWA 5CRHA 3QD9A 2MBSA 4HUAA 1TJDA 1PMTA 4LA1A 4TW5A 2YWMA 4MH3A 3FEUA 3CBUA 3J7Yb 3VK9A 3U5RE 1AAZA 1F37A 3FW2A 1ST9A 4Q5FA 2RM5A 3TGZA 4WBJA 2LNTA 1GSQA 2LQQA 1M9BA 2Z9SA 1GUHA 3OR5A 4XS4B 1EV9A 3TKRA 4MZCA 2CX4A 3FZ4A 4HQZA 5A4UA 1EP8A 1C72A 2PUKC 4QL7A 5CNWA 3F4SA 3TKQA 1GTUA 3P2AA 2VD1A 3FRCA 2WDUA 4TVEA 2MBTA 2FA4A 2H8LA 1XZOA 3QAVA 1TP9A 4HZ2A 1GSEA 1QK8A 2H1BA 2C3NA 2CT6A 1BEDA 3CSJA 3IK9A 2BMXA 4EDYA 4E8EA 2VO4A 3A5WA 4XIHA 3LQ7A 4N10A 4PUFC 1WE0A 4WXTA 3LYPA 1KNGA 1F3BA 5D96A 1YKAA 5J4UA 4AJ8A 1K0NA 2XC2A 1JZDA 1XWCA 5DALA 2HRNA 2IL3A 4HJ2A 5E4WA 3LORA 2VL9A 1A8YA 4IELA 2FD3A 5EVOA 1J0FA 1AQVA 2C1YA 17GSA 3WGXA 4IW9A 3N9JA 1Q98A 3CYNA 3KP9A 4AF2A 2YV7A 2M46A 3TJJA 4WF5A 4I8BA 2JU5A 1B48A 2OACA 2HXKA 2PMTA 2P5QA 1OC9B 4N0VA 1HNCA 1SD9A 3GYKA 3MNGA 4ECIA 3C71A 2I81A 2RLIA 5J5NA 1SKWB 2DJ3A 1R5PA 3RPPA 3GIXA 4NHZA 4ECJA 5ECKB 3SBCA 4OO5A 2DC5A 2EIQA 2O89A 3A2WA 3IPZA 3TJFA 2G2QA 5COHA 2CZ2A 3H1NA 1ERUA 1DE2A 1WIKA 3DGQA 6GSXA 3VWUA 3BOAA 1ZYEA 3GL5A 3ZL5A 2O7KA 3KXOA 14GSA 4JZQA 4IBPA 2GQLA 3ZMKA 1RK4A 2YANA 3P8WA 2YJ7A 1UVZA 1T00A 1NHOA 4PQIA 3IA1A 2EIRA 4PQ1A 2LRNA 3M9KA 3TOUA 3H4KA 3WYWA 4IJ3A 10GSA 2IMDA 3GKNA 3IBHA 4WEYA 2LRCA 2XPDA 1Z9HA 4MP4A 3GTUA 3GL3A 1TKDB 1B9YC 5L71A 3UARA 1TW9A 3APSA 1VGLA 4KW6A 3IR4A 1FG4A 4L0WA 1X9WB 1XW9A 4LL1B 5IQYA 2H75A 1U88A 3HYPA 2H01A 4KSOA 2BJXA 1U87A 3UOMA 4ZBAA 1YKCA 2H70A 2QGVA 3G9BA 3KTBA 4ZB6A 4O7HA 4KDXA 5JWRB 2K18A 4N0ZA 5D8IA 1BQ7A 4ML6A 5ID2B 3FR3A 1FOVA 1WJKA 2B1KA 1JHBA 2NDOA 6GSSA 1ILOA 3RAZA 5FT3A 1HNAA 3IRAA 5DQYA 2E2MA 1F3AA 4KUNA 4IHUA 1VRSD 2REMA 2DJKA 3I9V2 3DRNA 3F6DA 2GSSA 4H86A 4YQUA 4TR0A 2JSZA 4HEA2 3DVXA 3GKXA 1OC8A 2L5OA 4K6XA 3TUEA 2RUEA 4L5OA 5D73A 4TR1B 3DMLA 4KGIA 3HVVA 5EY6A 3VI5A 1PD21 1TXXA 1K3YA 1Z7PA 3FR6A 3IHQA 5INYA 3APOA 4EO3A 1OE7A 2R37A 3ZYWA 2B1LA 3PH9A 4HZ4A 5KEJA 2EC4A 1IYHA 2YWIA 2FGXA 3ME7A 4X0XA 1G6YA 1SL1B 3Q74A 1EEJA 1YY7A 3EINA 5B8BA 2I3YA 4OWYA 4DSSB 4GLTA 2GDRA 5KN2A 1OKTA 5DCGA 2X64A 1Y6EA 1T3BA 3O3TA 3I69A 3IAM2 4I2TA 4XRDA 3EU3A 5ECSA 1R5AA 4IS0A 2VIMA 3RDWA 4IJIA 2N5AA 2MMNA 2R3XA 5IPHA 1VF1A 2OKAA 4Q5NA 1V2AA 1AXDA 1XOAA 2RIIA 1FO5A 1EEMA 5HR2A 2DJ2A 6GSYA 2XHFA 1TI3A 2B7KA 4K1FA 2F8FA 1ERWA 1GSSA 2YV9A 1XBSA 4JBBA 4AGSA 1GTBA 1GRXA 2TIRA 1H75A 3GHAA 3NIVA 3GUSA 2L59A 1PKWA 2NTOA 3CTFA 1AUCA 6GSVA 3PGTA 2DIYA 1XW5A 6GSWA 4EL1A 4MK3A 2A2SA 2R5GA 1I5GA 3O76A 2LJRA 5ECPB 1Z6NA 22GSA 5A4VA 3L4NA 3DXBA 4I5QA 4XS4A 1FHEA 4J2FA 1HQOA 2IIYA 4DSRA 3QAWA 4Q5RA 3M1GA 20GSA 1PSQA 4MF6A 2F9SA 3MAKA 2GT6A 2OE3A 2LKUA 1A2MA 2LEGA 3A3TA 2VL3A 1KEBA 1PRXA 2V32A 4IKHA 2DSAA 3ISOA 5AN1A 2WRTA 1PX6A 3TJKA 3GV1A 4MJEA 2XPEA 1GNWA 2LNSA 4PNGA 1JLWA 4NAXA 2IPAA 5DQSA 4K7IA 1BX9A 2ES7A 4L5LA 5IMCA 3ZLPA 5IIZA 2E7PA 4F82A 4HQSA 3ERFA 3BCKA 2IN3A 3ZMLA 2YWOA 4F0CA 3DIEA 1X5DA 1ZCPA 5HFKA 3NOFA 5F8BA 2K9FA 3APQA 3TJGA 6GSUA 1OC9A 5EPFA 3VPQA 1J08A 3UEMA 4GCIA 1SU9A 2IMIA 2H76A 2X8CA 3EC3A 3HDCA 2NPBA 1TRVA 2ZNMA 4ZB8A 1EGOA 1AW9A 2LSTA 5IM9A 5KN1A 1V58A 3ZREA 3GFKA 1H4OA 2LJAA 3AY8A 3HJOA 3CRTA 1R26A 4HI7A 2VCXA 2DJJA 1XFLA 2H6YA 3VFIA 2L5LA 3QAGA 2WCIA 4EE0A 3N5OA 1K0DA 4O32A 3FYGA 4ZL8A 5CYYA 5D9WA 5ECOB 1PX7A 2FNOA 1TTZA 2FWEA 1F2EA 1O6JA 3TDGA 5AISA 3D5JA 2IMKA 4MPGA 4O92A 1TRSA 4XHMA 3ERGA 4JRRA 4ML1A 3CMIA 2V2GA 4O5RA 5D9VA 4DEJA 1FVKA 3QFBC 1JZWA 4MF7A 1HD2A 3KMNA 3GNJA 1QFNA 4WR5A 1OVNA 4WKWA 4AJ7A 3WT2A 2CA8A 6GSTA 3EMXA 4IN0A 2F51A 5IMDA 4I6XA 4IP6A 4G2EA 2LJKA 1YZXA 5B6MA 5G1KA 1YEXA 4ZL9A 2G0FA 2H6ZA 1PA3A 4TOPA 2CQ9A 4LLRA 2FCHA 1S3AA 2R4VA 1YDKA 1ABAA 2I9HA 2FY6A 2DLXA 4POBA 1T8EB 1SYRA 5G5EA 4WETA 4GTUA 5ID2A 1K0AA 1O8XA 1PL1A 2P0GA 2DIZA 3L78A 5ECRB 1XWKA 2F3MA 1ZGNA 2CZ3A 4BVYA 2DMMA 1GSYA 2JSYA 1SKRB 3FR9A 3HKRA 1FVJA 2C3QA 2WJUA 4GSNA 1WP0A 4V1Ap 2FWFA 2VLUA 1SKSB 3GKKA 3KEBA 5IMVA 2B3SA 3KMOA 2HYXA 5D93A 4TR1A 3LSZA 2DJ0A 4NXIA 3LXZA 1W89A 1HNBA 4OCEA 3C1RA 3KH7A 3W6GA 2F8AA 1EOGA 3UIWA 3RBTA 4JEDA 1R4WA 2HSYA 2WB9A 2XBIA 1NSWA 2FLSA 5HR1A 1GTIA 2PPTA 3J7Yk 3M8NA 3VURA 3EE2A 3QFAC 5CO3A 1M99A 4DSSA 4BL7A 1A8LA 2PERA 2OBKA 4ZIJA 3F63A 3F8UA 3HD5A 2VLVA 5DAKB 1XIYA 1GTAA 1O85A 3H93A 4V1Ag 1MEKA 4GQCA 4GQFA 3WGEA 19GSA 3LJRA 3O6TA 1RQMA 4MDCA 4YAVA 3D6IA 1SL0B 4ILFA 1BJXA 2VM1A 4F2IA 4F0BA 4HDEA 1G7EA 2LUSA 4TKYA 5ELGA 2VOCA 1Z6MA 2WULA 2B5XA 1XXUA 2VUPA 4ID0A 3TKPA 3HXSA 3GRXA 3KCMA 1GH2A 4AJ6A 2AHEA 4ZBBA 2PVQA 5D9XA 2BTOT 3MWHA 2GZYA 2FWGA 5J41A 1GUMA 1GLQA 4OCFA 4MA9A 2A2RA 2L4CA 4KAEA 1X0RA 3QCPA 4RQRA 1X5EA 2IFQB 1GSUA 2MMAA 1TK0B 5DVBA 7GSSA 1YJ6A 5ECLB 2JZSA 4MMMA 1ZZYA 4KNDA 1NHYA 3IDVA 2A4VA 1O7UA 5JCUA 2X99A 4D73B 1X5CA 2C0EA 3BBYA 1ERVA 2H19A 1T7PB 2H1AA 4F03A 4OFMA 4K7NA 3L0HA 3WD6A 4NWYA 4BA7A 4JR6A 1FB6A 4N11A 1UA5A 3GSTA 1M2BA 1TI1A 4L8EA 1M9AA 3D21A 2L57A 3EWLA 3WGDA 2YCDA 1K3OA 2VCZA 2FWHA 3MSZA 4YQMA 1BAYA 3TKSE 2V41A 3ZZXA 2YJHA 5HFGA 1AQXA 2CX3A 2GVPA 3FZAA 4K8MA 1W4VA 3FK8A 2XBQA 4GRFA 4ZBDA 1E2YA 3H8QA 1GWCA 4Z7XA 4ECBA 1DBYA 3TKSC 5JCWA 1K0BA 3UL3A 2HLSA 4ZL7A 5C04A 3LWAA 1SL2B 1V9WA 3D22A 3EMPA 3KGKA 1TDIA 2FA8A 1MDJA 4X1UA 2LTKA 1UC7A 2PWJA 2B5YA 3KZQA 2AAWA 1B9XC 2X8HA 3GX0A 4XS6A 5CRWA 2P5RA 4EC0A 4PX1A 5CRGA 2X8GA 5ECHB 2CAQA 4LMWA 3A2VA 1NW2A 2YNXA 1FAAA 1EWXA 3F9UA 4HS1A 2FHEA 2GQMA 1THXA 4KH7A 1Z3EA 3DEXA 4NV5A 1Y25A 3TKSA 1ZOFA 4G9HA 2V1MA 3P7XA 1M0UA 1EP7A 4KA0A 8GSSA 1GL8A 2TRXA 3DYRA 3QDNA 5ECIB 2VLTA 3GA4A 3UAPA 2GZPA 1ZYQB 4OMVA 2VL2A 4HJMA 3C7MA 4N30A 4PXOA 1J9BA 5ELAA 3KTLA 4BWQA 5HR3A 5IOXA 2TRCP 4CDOA 2B7JA 5ECQB 1GSFA 2L6CA 2OA7A 1YF1A 1G7OA 2GZZA 1ZMAA 4EVMA 2ON7A 3DWVA 1T4YA 3H79A 4TXOB 2RUFA 13GSA 1SENA 4YAPA 1RW1A 1SJZA 3C73A 1Z7RA 3GSSA 2HZFA 3C8EA 4MJBA 2R2JA 3FZ5A 1B8XA 2NBSA 3EYTA 5B7CA 1A23A 1PN9A 1GP1A 2H30A 5GSSA 1OYJA 4ISDA 2V6KA 2ZCTA 3SWLA 3RHBA 1BG5A 2VAFA 3V1WA 2MZCA 2VCWA 1WRYA 2LS5A 5ABRA 1XVWA 3F3RA 2KP1A 1TRWA 2WS2A 4G10A 5J9CA 2B6MA 1CQGA 1SK1A 4JR4A 2HZEB 4MJAA 4KX4A 2J9HA 4MZBA 2KUCA 3W8SA 2OJLA 3G7JA 3IXRA 2WZ9A 4HOJA 3TOTA 4GXZA 1MTCA 5HFIA 3US3A 2DBCA 3VWWA 2RM6A 4ULXA 1LJRA 2P31A 3ZTLA 2HT9A 4K7OA 2J23A 4TRXA 4ZXGA 3ZIVA 1WMJA 2MMZA 1A24A 2VCQA 2MYGA 4OO4A 4FYCA 2GLRA 4KSMA 1E6BA 3BCIA 3UVTA 1HYUA 1R7HA 2C4JA 3UBLA 3HVXA 1N8JA 2K8VA 1QUWA 4EF0A 4XRAA 1ML6A 3ZRDA 3ZITA 4ECCA 4DVCA 1TRUA 4J57E 3GN3A 5A5KA 4KE3A 3L9UA 2E2GA 11GSA 4NMUA 4K2DA 4P3YB 4LL4B 2C3TA 1WOUA 2VCVA 3VPTA 5JWQB 3HJPA 4V2LA 3HZ8A 1QMVA 2CV4A 3C1SA 4GSTA 3HCZA 2IWTA 1PQNA 3BJ5A 1A0RP 1JZRA 2H0IA 2OE0A 1GLPA 3VI7A 5H5RA 2QKEA 3ZVJA 5DCHA 3GKMA 5FHIA 2PU9C 4V2NA 3K8NA 2IFQA 9GSSA 3L9SA 4IGJA 1DUGA 5ENUA 4X43A 4CHSA 3UMAA 4OFNA 4JU5A 1O73A 2CVDA 2HRFA 3QOUA 1EZKA 1G0TA 2GTUA 1VF3A 2M80A 3U6VA 2C8UA 4MH2A 1XW6A 1OE8A 1VF4A 3VLNA 4D73A 3CSIA 1SJIA 5B8AA 1XVQA 4TN8A 2B5EA 2HI7A 4LMVA 1TOFA 2PBJA 4WBRD 3EU4A 2ON5A 18GSA 1URMA 3IC4A 2H0HA 3G7YA 12GSA 1G6WA 4KCEA
chains in the Genus database with same CATH superfamily
4KDUA 5AIVA 4J56E 4GSSA 5CREA 4L0UA 4K9ZA 1N2AA 4BPYA 3LG6A 4HU7A 5HR0A 3E3EA 4MF5A 1IYIA 1TU7A 1JFUA 1O8WA 3ZVJD 4CW9A 2LRTA 1EV4A 4MPFA 2C0FA 2X49A 1MD3A 3L9VA 3P90A 3LEFA 2JZTA 3DKSA 2L4QA 4PUAA 2ALBA 4MNNA 4YQVA 4TR4A 2GSQA 2IMEA 4YKGA 4FIWA 2YOIA 1X9SB 4MJCA 3F3QA 3QR6A 2H73A 3ZIJA 4CY8A 5H5QA 4MLYA 4Q5QA 5ECNB 3KP8A 1FW1A 4GF0A 1SK0A 3KJYA 3W8JA 2YN1A 2JL4A 5IO0A 4G0KA 3KD0A 5G1LA 3TCOA 1B4QA 1V57A 2EIOA 1F9MA 4IQ1A 4MCUA 3FY7A 1TK8B 2QSIA 3F4RA 3IK7A 3IV4A 1F6MC 2WGRA 2YZHA 3GH9A 4YH2A 1GNEA 1USBA 1XCCA 2GSRA 1MDKA 4NPBA 16GSA 3GX8A 3KH9A 1BYEA 3BD2A 1AQWA 1X9MB 2HE3A 3A2XA 5IMFA 2DJ1A 3CRUA 4Z2RA 5DBQA 4USSA 1JZOA 2I1UA 3E9JB 4EKZA 4RQXA 2GQKA 2VCTA 3GMFA 5JWOB 2QC7A 4HU9A 1OKDA 1SK2A 4EUYA 5DDLA 3VWVA 3D4TA 4G0LA 5CP1A 2K8SA 4RI7A 2GS3A 1CQHA 3FZ9A 3VWXA 1DE1A 2AB6A 5BRTA 4POKA 3IOSA 3GURA 4Z2UA 2GT5A 1JLVA 3ME8A 4MZWA 4XCSA 1Q4JA 3HJMA 2UZ8A 5J3RA 2JZRA 1T4ZA 4PNFA 5IOWA 4TXOA 3IAS2 4POLA 4TXVA 1U3IA 5G2ZA 2C0DA 3ZFBA 2KHPA 3MDKA 1B4PA 5G30A 3DVWA 3PINA 4BWSA 1THOA 1EOHA 1UN2A 3EURA 1PFOA 1A2JA 5F07A 1AC1A 2O85A 2PVOC 1K0OA 2MMOA 1GSDA 2CVKA 2YP6A 5C00A 5DALB 2GSTA 1KTEA 3CXGA 3GH6A 5HQPA 5AGYA 2L6DA 4K0GA 4PTSA 5GSTA 1PKZA 5CAXA 1FB0A 1YF0A 2KP2A 4F9ZA 4PGTA 1MDIA 3PR8A 2AV4A 1S3CA 2AJQB 4IVFA 1U6TA 4OD7A 4QQ7A 2H74A 3TRPA 1YQ1A 2JADA 5LD0A 5B6NA 4ZILA 3UBKA 2OADA 1TU8A 3M9JA 4PQHA 1M7TA 4ZB9A 4RUVA 3TJBA 2O8VB 2D2ZA 2HZEA 3Q18A 1T1VA 1O81A 1K0MA 1I9DA 3TRQA 1GULA 2CVBA 4BL7B 2IJYA 1DSBA 5D9TA 2HNLA 2VL2C 4IQAA 3E0UA 3HZ4A 3QPMA 3I43A 3F0IA 4EDZA 1PL2A 1V98A 4FYBA 4XS1A 2YWNA 2HFDA 5GAPD 3ZFLA 4DSQA 3RHCA 2H72A 4PURA 1S3RA 2K6VA 4KCAA 3EVIA 1K0CA 1MD4A 3ED3A 4V2MA 5E59A 2VM2A 4TR3A 4K5RA 4OFTA 4IP1A 3CTGA 1V40A 3GTUB 1QXHA 3S9FA 4WF4A 5JCGA 3M3MA 1SJ6A 2PGTA 2VD0A 5G5FA 5LCZA 1ACVA 5J9BA 5IMZA 2JACA 2E0QA 3CSHA 5EL8A 3F4TA 2I4AA 2NVLA 2H0GA 1WPIA 2IMFA 5F06A 2DKIA 5GZZB 2H1GA 1NM3A 2WFCA 5LNKe 3IE3A 4POMA 3M0FA 3D4MA 3TB2A 3UVHA 1OC3A 4QL9A 1VF2A 5AIXA 3DD3A 2GGTA 4MABA 1M2AA 5DJLA 1KBNA 5IPGA 1AIUA 4G19A 1ON4A 5KN0A 1SYXA 2LV3A 2C0GA 2C80A 5F05A 3LXTA 3FHKA 5KOXA 5GAND 4FYUA 4BIKA 5IMAA 4BVXA 2M72A 3QMXA 4EXJA 2OBIA 2CAIA 2AUVA 1XOBA 1ZL9A 1XWAA 3LFLA 3F6FA 3LYKA 1EGRA 5IO2A 2R6KA 3KM6A 5ECMB 3HVSA 4FH8A 4NHWA 1XPVA 2N5BA 4ICYA 3TRXA 1TK5B 3JCML 1LBKA 5A4WA 3WT1A 4ACSA 1OAZA 2FUG2 4GWRA 4JE1A 2YZUA 3LGCA 1XWGA 2N5FA 4E8HA 5F0GA 4I97A 4RI6A 5CRDA 5DJMA 3LW9A 3Q19A 1Z5YE 1A2LA 1U3AA 5H5SA 2V6OA 1QQ2A 1XWBA 3Q6OA 3NZNA 3MYDA 4CY6A 1WWJA 5G31A 5KN3A 2KLXA 3HHVA 4KB3A 1QGVA 2AYTA 4FO5A 1S3DA 1LU4A 2ZUPA 3RPNA 3UJ1A 4K0NA 1SD8A 2DMLA 4I2UA 2OE1A 5FWGA 1YEPA 1K3LA 2PN8A 2H6XA 3D0ZA 3G7IA 3FKFA 2KOKA 5DAKA 1A0FA 1M2DA 3I6AA 1ERTA 2LQOA 2H66A 3HY2A 2HSHA 1PGTA 2H71A 2QA1A 4WR4A 3KIJA 4KDYA 1GUKA 3R2QA 3HA9A 4NV2A 2O87A 4XTSA 2YPMA 2H1DA 3ERWA 5CRHA 3QD9A 2MBSA 4HUAA 1TJDA 1PMTA 4LA1A 4TW5A 2YWMA 4MH3A 3FEUA 3CBUA 3J7Yb 3VK9A 3U5RE 1AAZA 1F37A 3FW2A 1ST9A 4Q5FA 2RM5A 3TGZA 4WBJA 2LNTA 1GSQA 2LQQA 1M9BA 2Z9SA 1GUHA 3OR5A 2R0CA 4XS4B 1EV9A 3TKRA 4MZCA 2CX4A 3FZ4A 4HQZA 5A4UA 1EP8A 1C72A 2PUKC 4QL7A 5CNWA 3F4SA 3TKQA 1GTUA 3P2AA 2VD1A 3FRCA 2WDUA 4TVEA 2MBTA 2FA4A 2H8LA 1XZOA 3QAVA 1TP9A 4HZ2A 1GSEA 3HVNA 1QK8A 2H1BA 2C3NA 2CT6A 1BEDA 3CSJA 3IK9A 2HRAA 2BMXA 4EDYA 4E8EA 2VO4A 3A5WA 4XIHA 3LQ7A 4N10A 4PUFC 1WE0A 4WXTA 3LYPA 1KNGA 1F3BA 5D96A 1YKAA 5J4UA 4AJ8A 1K0NA 2XC2A 1JZDA 1XWCA 5DALA 1XG8A 4X4JA 2HRNA 2IL3A 4HJ2A 5E4WA 3LORA 2VL9A 1A8YA 4IELA 2FD3A 5EVOA 1J0FA 1AQVA 2C1YA 17GSA 3WGXA 4IW9A 3N9JA 1Q98A 3CYNA 3KP9A 4AF2A 2YV7A 2M46A 3TJJA 4WF5A 4I8BA 2JU5A 1B48A 2OACA 4A5PA 2HXKA 2PMTA 2P5QA 1OC9B 4N0VA 1HNCA 1SD9A 3GYKA 3MNGA 4ECIA 4Z2TA 3C71A 2I81A 2RLIA 5J5NA 1SKWB 2DJ3A 1R5PA 3RPPA 3GIXA 4NHZA 4ECJA 5ECKB 3SBCA 2R0PA 4OO5A 2DC5A 2EIQA 2O89A 4G0IA 3A2WA 3IPZA 3TJFA 2G2QA 5COHA 2CZ2A 3H1NA 1ERUA 1DE2A 1WIKA 1PN0A 3DGQA 6GSXA 3VWUA 3BOAA 1ZYEA 3GL5A 3ZL5A 2O7KA 3KXOA 14GSA 4JZQA 4IBPA 2GQLA 3ZMKA 1RK4A 2YANA 3P8WA 2YJ7A 1UVZA 1T00A 1NHOA 4PQIA 3IA1A 2EIRA 4PQ1A 2LRNA 4EIQA 3M9KA 3TOUA 3H4KA 3WYWA 4IJ3A 10GSA 2IMDA 3GKNA 3IBHA 4WEYA 2LRCA 2XPDA 1Z9HA 4MP4A 3GTUA 3GL3A 1TKDB 1B9YC 5L71A 3UARA 1TW9A 3APSA 1VGLA 4KW6A 3IR4A 1FG4A 4L0WA 1X9WB 1XW9A 4LL1B 5IQYA 2H75A 1U88A 3HYPA 2H01A 4KSOA 2BJXA 1U87A 3UOMA 4ZBAA 1YKCA 2H70A 2QGVA 3G9BA 3KTBA 4ZB6A 4O7HA 4KDXA 1M3IA 5JWRB 2K18A 4N0ZA 4YKFA 1BQ7A 5D8IA 4ML6A 5ID2B 3FR3A 1FOVA 1WJKA 2B1KA 1JHBA 2NDOA 6GSSA 1ILOA 3RAZA 5FT3A 1HNAA 3IRAA 5DQYA 2E2MA 1F3AA 4BVYB 4KUNA 4IHUA 1VRSD 2REMA 2DJKA 3I9V2 3DRNA 3F6DA 2GSSA 4H86A 2QA2A 4YQUA 4TR0A 2JSZA 4HEA2 3DVXA 3GKXA 1OC8A 2L5OA 4K6XA 3TUEA 2RUEA 4L5OA 5D73A 4TR1B 3DMLA 4KGIA 3HVVA 5EY6A 3VI5A 1PD21 1TXXA 1K3YA 1Z7PA 3FR6A 3IHQA 5INYA 3APOA 4EO3A 1OE7A 2R37A 3ZYWA 2B1LA 3PH9A 4HZ4A 5KEJA 2EC4A 1IYHA 2YWIA 2FGXA 3ME7A 4X0XA 1G6YA 1SL1B 3Q74A 1EEJA 1YY7A 3EINA 5B8BA 2I3YA 4OWYA 4DSSB 4GLTA 2GDRA 4K5SA 5KN2A 1OKTA 5DCGA 2X64A 1Y6EA 1T3BA 3O3TA 3I69A 3IAM2 4I2TA 4XRDA 3EU3A 5ECSA 1R5AA 4IS0A 2VIMA 2A2PA 2HSMA 3RDWA 4IJIA 2N5AA 2MMNA 2R3XA 5IPHA 1VF1A 2OKAA 4Q5NA 1V2AA 1AXDA 1XOAA 2RIIA 1FO5A 1EEMA 5HR2A 2DJ2A 6GSYA 2XHFA 1TI3A 2B7KA 4K1FA 2F8FA 1ERWA 1GSSA 2YV9A 1XBSA 4JBBA 4AGSA 1GTBA 1GRXA 2TIRA 1H75A 3GHAA 3NIVA 3GUSA 2L59A 1PKWA 2NTOA 3CTFA 1AUCA 6GSVA 3PGTA 2DIYA 1XW5A 6GSWA 4EL1A 4MK3A 2A2SA 2R5GA 1I5GA 3O76A 2LJRA 5ECPB 1Z6NA 22GSA 5A4VA 3L4NA 3DXBA 4I5QA 3MIXA 4XS4A 1FHEA 4J2FA 1HQOA 2IIYA 4DSRA 3QAWA 4Q5RA 3M1GA 20GSA 1PSQA 4MF6A 2F9SA 3MAKA 2GT6A 2OE3A 2LKUA 1A2MA 2LEGA 3A3TA 2VL3A 1KEBA 1PRXA 3PPUA 2V32A 4IKHA 2DSAA 3ISOA 5AN1A 2WRTA 1ZYNA 1PX6A 2A4HA 3TJKA 3GV1A 4MJEA 2XPEA 1GNWA 2LNSA 4PNGA 1JLWA 4NAXA 2IPAA 5DQSA 4K7IA 1BX9A 2ES7A 4L5LA 5IMCA 3ZLPA 5IIZA 2E7PA 4F82A 4HQSA 3ERFA 3BCKA 2IN3A 3ZMLA 2YWOA 4F0CA 3DIEA 1X5DA 1ZCPA 5HFKA 3NOFA 5F8BA 2K9FA 3APQA 3TJGA 6GSUA 1OC9A 5EPFA 3VPQA 1J08A 3UEMA 4GCIA 1SU9A 2IMIA 2H76A 2X8CA 3EC3A 3HDCA 2NPBA 1TRVA 2ZNMA 4ZB8A 1EGOA 1AW9A 2LSTA 5IM9A 5KN1A 1V58A 3ZREA 3GFKA 1H4OA 3R3EA 2LJAA 3AY8A 3HJOA 3CRTA 1R26A 4HI7A 2VCXA 3IC8A 2DJJA 1XFLA 2H6YA 3VFIA 2L5LA 3QAGA 2WCIA 4EE0A 3N5OA 1K0DA 4O32A 3FYGA 4ZL8A 5CYYA 5D9WA 5ECOB 1PX7A 2FNOA 1TTZA 2FWEA 1F2EA 1O6JA 3TDGA 5AISA 3D5JA 2IMKA 4K2XA 4MPGA 4O92A 1TRSA 4XHMA 3ERGA 4JRRA 4ML1A 3CMIA 2V2GA 4O5RA 5D9VA 4DEJA 1FVKA 3QFBC 1JZWA 4MF7A 1HD2A 3KMNA 3GNJA 1QFNA 4WR5A 1OVNA 4WKWA 4AJ7A 3WT2A 2CA8A 6GSTA 3EMXA 4IN0A 2F51A 5IMDA 4I6XA 4IP6A 4G2EA 2LJKA 1YZXA 5B6MA 5G1KA 1YEXA 4ZL9A 2G0FA 2H6ZA 1PA3A 4TOPA 2CQ9A 4KF9A 4LLRA 2FCHA 1S3AA 2R4VA 1YDKA 1ABAA 2I9HA 2FY6A 2DLXA 4POBA 1T8EB 1SYRA 5G5EA 4WETA 4GTUA 5ID2A 1K0AA 1O8XA 1PL1A 2P0GA 2DIZA 1ZYPA 3L78A 1XWKA 2F3MA 5ECRB 1ZGNA 2CZ3A 4BVYA 2DMMA 1GSYA 2JSYA 1SKRB 3FR9A 3HKRA 1FVJA 2C3QA 2WJUA 4GSNA 1WP0A 4V1Ap 1FOHA 2FWFA 2VLUA 1SKSB 3GKKA 3KEBA 5IMVA 2B3SA 3KMOA 2HYXA 5D93A 4TR1A 3LSZA 2DJ0A 4NXIA 3LXZA 1W89A 1HNBA 4OCEA 3C1RA 3KH7A 3W6GA 2F8AA 1EOGA 3UIWA 3RBTA 4JEDA 1R4WA 2HSYA 2WB9A 2XBIA 1NSWA 2FLSA 5HR1A 1GTIA 2PPTA 3J7Yk 3M8NA 3VURA 3EE2A 3QFAC 5CO3A 1M99A 4DSSA 4BL7A 1A8LA 2PERA 2OBKA 4ZIJA 3F63A 3F8UA 3HD5A 2VLVA 5DAKB 1XIYA 1GTAA 1O85A 3H93A 4V1Ag 1MEKA 4GQCA 4GQFA 3WGEA 19GSA 3LJRA 3O6TA 1RQMA 4MDCA 4YAVA 3D6IA 1SL0B 4ILFA 1BJXA 2VM1A 4F2IA 4F0BA 4HDEA 1G7EA 2LUSA 4TKYA 5ELGA 2VOCA 1Z6MA 3A5IA 2WULA 2B5XA 1XXUA 2VUPA 4ID0A 3TKPA 3HXSA 3GRXA 3KCMA 1GH2A 4AJ6A 2AHEA 4ZBBA 2PVQA 5D9XA 2BTOT 3MWHA 2GZYA 2FWGA 5J41A 1GUMA 1GLQA 4OCFA 4MA9A 2A2RA 2L4CA 4KAEA 1X0RA 3QCPA 4RQRA 1X5EA 2IFQB 1GSUA 2MMAA 1TK0B 5DVBA 7GSSA 1YJ6A 5ECLB 2JZSA 4MMMA 1ZZYA 4KNDA 1NHYA 3IDVA 2A4VA 1O7UA 5JCUA 2X99A 4D73B 1X5CA 2C0EA 3BBYA 1ERVA 2H19A 2DKHA 1T7PB 2H1AA 4F03A 4OFMA 4K7NA 3L0HA 3WD6A 4NWYA 4BA7A 4JR6A 1FB6A 4N11A 1UA5A 3GSTA 1M2BA 1TI1A 4L8EA 1M9AA 3D21A 2L57A 3EWLA 3WGDA 2YCDA 1K3OA 2VCZA 2FWHA 3MSZA 4YQMA 1BAYA 3TKSE 2V41A 3ZZXA 2YJHA 5HFGA 1AQXA 2CX3A 2GVPA 3FZAA 4K8MA 1W4VA 3FK8A 2X4AA 2XBQA 4GRFA 4ZBDA 1E2YA 3H8QA 1GWCA 4Z7XA 4ECBA 1DBYA 3TKSC 5JCWA 1K0BA 3UL3A 2HLSA 4ZL7A 5C04A 3LWAA 1SL2B 1V9WA 3D22A 3EMPA 3KGKA 1TDIA 2FA8A 1MDJA 4HSCX 4X1UA 2LTKA 1UC7A 2PWJA 2B5YA 3KZQA 2AAWA 1B9XC 2X8HA 3GX0A 4XS6A 5KOWA 5CRWA 2P5RA 4EC0A 4PX1A 5CRGA 2X8GA 5ECHB 2CAQA 4LMWA 3A2VA 1NW2A 2YNXA 1FAAA 1EWXA 4O5QA 3F9UA 4HS1A 2FHEA 2GQMA 1M3JA 1THXA 4KH7A 1Z3EA 3DEXA 4NV5A 1Y25A 3TKSA 1ZOFA 4G9HA 2V1MA 3P7XA 4FQUA 1M0UA 1EP7A 4KA0A 8GSSA 1GL8A 2TRXA 3DYRA 3QDNA 5ECIB 2VLTA 3GA4A 3UAPA 2GZPA 1ZYQB 4OMVA 2VL2A 4HJMA 3C7MA 4N30A 3EPTA 4PXOA 1J9BA 5ELAA 3KTLA 4BWQA 5HR3A 5IOXA 4EIPA 2HRKA 2TRCP 4CDOA 2B7JA 5ECQB 1GSFA 2L6CA 2OA7A 1YF1A 1G7OA 2GZZA 1ZMAA 4EVMA 2ON7A 3DWVA 1T4YA 3H79A 4TXOB 2RUFA 13GSA 1SENA 4YAPA 1RW1A 1SJZA 3C73A 5BMUA 1Z7RA 3GSSA 2HZFA 3C8EA 4MJBA 2R2JA 3FZ5A 1B8XA 2NBSA 3EYTA 4O5UA 5B7CA 1A23A 1PN9A 1GP1A 2H30A 5GSSA 1OYJA 4ISDA 2V6KA 2ZCTA 3SWLA 3RHBA 1BG5A 2VAFA 3V1WA 2MZCA 2VCWA 1WRYA 2LS5A 5ABRA 1XVWA 3F3RA 2KP1A 1TRWA 2WS2A 4G10A 5J9CA 3IHGA 2B6MA 1CQGA 1SK1A 4JR4A 2HZEB 4MJAA 4KX4A 2J9HA 4MZBA 2KUCA 3W8SA 2OJLA 3G7JA 3IXRA 2WZ9A 4HOJA 3TOTA 4GXZA 1MTCA 5HFIA 3US3A 2DBCA 3VWWA 2RM6A 4ULXA 1LJRA 2P31A 3ZTLA 2HT9A 4K7OA 2J23A 4TRXA 4ZXGA 3ZIVA 1WMJA 2MMZA 1A24A 2VCQA 2MYGA 4OO4A 4FYCA 2GLRA 4KSMA 1E6BA 3BCIA 3UVTA 1HYUA 1R7HA 2C4JA 3UBLA 3HVXA 3FMWA 1N8JA 2K8VA 1QUWA 4EF0A 4XRAA 1ML6A 3ZRDA 3ZITA 4ECCA 4DVCA 1TRUA 4J57E 3GN3A 5A5KA 4KE3A 3L9UA 2E2GA 11GSA 4NMUA 4K2DA 4P3YB 4LL4B 2C3TA 1WOUA 2VCVA 3VPTA 5JWQB 3HJPA 4V2LA 3HZ8A 1QMVA 2CV4A 3C1SA 4GSTA 3HCZA 2IWTA 1PQNA 3BJ5A 1A0RP 1JZRA 2H0IA 2OE0A 1GLPA 3VI7A 5H5RA 2QKEA 3ZVJA 5DCHA 3GKMA 5FHIA 2PU9C 4V2NA 3K8NA 2IFQA 9GSSA 3L9SA 4IGJA 1DUGA 5ENUA 3CQFA 4X43A 4CHSA 3UMAA 4OFNA 2R0GA 4JU5A 1O73A 2CVDA 2HRFA 3QOUA 1EZKA 1G0TA 2GTUA 1VF3A 2M80A 3U6VA 2C8UA 4MH2A 1XW6A 1OE8A 1VF4A 3VLNA 4D73A 4BVXB 3CSIA 1SJIA 5B8AA 1XVQA 4TN8A 2B5EA 2HI7A 4LMVA 1TOFA 2PBJA 4WBRD 3EU4A 2ON5A 18GSA 1URMA 3IC4A 2H0HA 3G7YA 12GSA 1G6WA 4KCEA
chains in the Genus database with same CATH topology
4KDUA 5AIVA 4J56E 4GSSA 5CREA 4L0UA 4K9ZA 1N2AA 4BPYA 3LG6A 4HU7A 5HR0A 3E3EA 4MF5A 1IYIA 1TU7A 1JFUA 1O8WA 3ZVJD 4CW9A 2LRTA 1EV4A 4MPFA 2C0FA 2X49A 1MD3A 3L9VA 3P90A 3LEFA 2JZTA 3DKSA 2L4QA 4PUAA 2ALBA 4MNNA 4YQVA 4TR4A 2GSQA 2IMEA 4YKGA 4FIWA 2YOIA 1X9SB 4MJCA 3F3QA 3QR6A 2H73A 3ZIJA 4CY8A 5H5QA 4MLYA 4Q5QA 5ECNB 3KP8A 1FW1A 4GF0A 1SK0A 3KJYA 3W8JA 2YN1A 2JL4A 5IO0A 4G0KA 3KD0A 5G1LA 3TCOA 1B4QA 1V57A 2EIOA 1F9MA 4IQ1A 4MCUA 3FY7A 1TK8B 2QSIA 3F4RA 3IK7A 3IV4A 1F6MC 2WGRA 2YZHA 3GH9A 4YH2A 1GNEA 1USBA 1XCCA 2GSRA 1MDKA 4NPBA 16GSA 3GX8A 3KH9A 1BYEA 3BD2A 1AQWA 1X9MB 2HE3A 3A2XA 5IMFA 2DJ1A 3CRUA 4Z2RA 5DBQA 4USSA 1JZOA 2I1UA 3E9JB 4EKZA 4RQXA 2GQKA 2VCTA 3GMFA 5JWOB 2QC7A 4HU9A 1OKDA 1SK2A 4EUYA 5DDLA 3VWVA 3D4TA 4G0LA 5CP1A 2K8SA 4RI7A 2GS3A 1CQHA 3FZ9A 3VWXA 1DE1A 2AB6A 5BRTA 4POKA 3IOSA 3GURA 4Z2UA 2GT5A 1JLVA 3ME8A 4MZWA 4XCSA 1Q4JA 3HJMA 2UZ8A 5J3RA 2JZRA 1T4ZA 4PNFA 5IOWA 4TXOA 3IAS2 4POLA 4TXVA 1U3IA 5G2ZA 2C0DA 3ZFBA 2KHPA 3MDKA 1B4PA 5G30A 3DVWA 3PINA 4BWSA 1THOA 1EOHA 1UN2A 3EURA 1A2JA 5F07A 1AC1A 2O85A 2PVOC 1K0OA 2MMOA 1GSDA 2CVKA 2YP6A 5C00A 5DALB 2GSTA 1KTEA 3CXGA 3GH6A 5HQPA 5AGYA 2L6DA 4K0GA 4PTSA 5GSTA 1PKZA 5CAXA 1FB0A 1YF0A 2KP2A 4F9ZA 4PGTA 1MDIA 3PR8A 2AV4A 1S3CA 2AJQB 4IVFA 1U6TA 4OD7A 4QQ7A 2H74A 3TRPA 1YQ1A 2JADA 5LD0A 5B6NA 4ZILA 3UBKA 2OADA 1TU8A 3M9JA 4PQHA 1M7TA 4ZB9A 4RUVA 3TJBA 2O8VB 2D2ZA 2HZEA 3Q18A 1T1VA 1O81A 1K0MA 1I9DA 3TRQA 1GULA 2CVBA 4BL7B 2IJYA 1DSBA 5D9TA 2HNLA 2VL2C 4IQAA 3E0UA 3HZ4A 3QPMA 3I43A 3F0IA 4EDZA 1PL2A 1V98A 4FYBA 4XS1A 2YWNA 2HFDA 5GAPD 3ZFLA 4DSQA 3RHCA 2H72A 4PURA 2K6VA 4KCAA 3EVIA 1K0CA 1MD4A 3ED3A 4V2MA 5E59A 2VM2A 4TR3A 4K5RA 4OFTA 4IP1A 3CTGA 1V40A 3GTUB 1QXHA 3S9FA 4WF4A 5JCGA 3M3MA 1SJ6A 2PGTA 2VD0A 5G5FA 5LCZA 1ACVA 5J9BA 5IMZA 2JACA 2E0QA 3CSHA 5EL8A 3F4TA 2I4AA 2NVLA 2H0GA 1WPIA 2IMFA 5F06A 2DKIA 5GZZB 2H1GA 1NM3A 2WFCA 5LNKe 3IE3A 4POMA 3M0FA 3D4MA 3TB2A 3UVHA 1OC3A 4QL9A 1VF2A 5AIXA 3DD3A 2GGTA 4MABA 1M2AA 5DJLA 1KBNA 5IPGA 1AIUA 4G19A 1ON4A 5KN0A 1SYXA 2LV3A 2C0GA 2C80A 5F05A 3LXTA 3FHKA 5KOXA 5GAND 4FYUA 5IMAA 4BVXA 2M72A 3QMXA 4EXJA 2OBIA 2CAIA 2AUVA 1XOBA 1ZL9A 1XWAA 3LFLA 3F6FA 3LYKA 1EGRA 5IO2A 2R6KA 3KM6A 5ECMB 3HVSA 4FH8A 4NHWA 1XPVA 2N5BA 4ICYA 3TRXA 1TK5B 3JCML 1LBKA 5A4WA 3WT1A 4ACSA 1OAZA 2FUG2 4GWRA 4JE1A 2YZUA 3LGCA 1XWGA 2N5FA 4E8HA 5F0GA 4I97A 4RI6A 5CRDA 5DJMA 3LW9A 3Q19A 1Z5YE 1A2LA 1U3AA 5H5SA 2V6OA 1QQ2A 1XWBA 3Q6OA 3NZNA 3MYDA 4CY6A 1WWJA 5G31A 5KN3A 2KLXA 3HHVA 4KB3A 1QGVA 2AYTA 4FO5A 1S3DA 1LU4A 2ZUPA 3RPNA 3UJ1A 4K0NA 1SD8A 2DMLA 4I2UA 2OE1A 5FWGA 1YEPA 1K3LA 2PN8A 2H6XA 3D0ZA 3G7IA 3FKFA 2KOKA 5DAKA 1A0FA 1M2DA 3I6AA 1ERTA 2LQOA 2H66A 3HY2A 2HSHA 1PGTA 2H71A 2QA1A 4WR4A 3KIJA 4KDYA 1GUKA 3R2QA 3HA9A 4NV2A 2O87A 4XTSA 2YPMA 2H1DA 3ERWA 5CRHA 3QD9A 2MBSA 4HUAA 1TJDA 1PMTA 4LA1A 4TW5A 2YWMA 4MH3A 3FEUA 3CBUA 3J7Yb 3VK9A 3U5RE 1AAZA 1F37A 3FW2A 1ST9A 4Q5FA 2RM5A 3TGZA 4WBJA 2LNTA 1GSQA 2LQQA 1M9BA 2Z9SA 1GUHA 3OR5A 2R0CA 4XS4B 1EV9A 3TKRA 4MZCA 2CX4A 3FZ4A 4HQZA 5A4UA 1EP8A 1C72A 2PUKC 4QL7A 5CNWA 3F4SA 3TKQA 1GTUA 3P2AA 2VD1A 3FRCA 2WDUA 4TVEA 2MBTA 2FA4A 2H8LA 1XZOA 3QAVA 1TP9A 4HZ2A 1GSEA 1QK8A 2H1BA 2C3NA 2CT6A 1BEDA 3CSJA 3IK9A 2HRAA 2BMXA 4EDYA 4E8EA 2VO4A 3A5WA 4XIHA 3LQ7A 4N10A 4PUFC 1WE0A 4WXTA 3LYPA 1KNGA 1F3BA 5D96A 1YKAA 5J4UA 4AJ8A 1K0NA 2XC2A 1JZDA 1XWCA 5DALA 4X4JA 2HRNA 2IL3A 4HJ2A 5E4WA 3LORA 2VL9A 1A8YA 4IELA 2FD3A 5EVOA 1J0FA 1AQVA 2C1YA 17GSA 3WGXA 4IW9A 3N9JA 1Q98A 3CYNA 3KP9A 4AF2A 2YV7A 2M46A 3TJJA 4WF5A 4I8BA 2JU5A 1B48A 2OACA 4A5PA 2HXKA 2PMTA 2P5QA 1OC9B 4N0VA 1HNCA 1SD9A 3GYKA 3MNGA 4ECIA 4Z2TA 3C71A 2I81A 2RLIA 5J5NA 1SKWB 2DJ3A 1R5PA 3RPPA 3GIXA 4NHZA 4ECJA 5ECKB 3SBCA 2R0PA 4OO5A 2DC5A 2EIQA 2O89A 4G0IA 3A2WA 3IPZA 3TJFA 2G2QA 5COHA 2CZ2A 3H1NA 1ERUA 1DE2A 1WIKA 1PN0A 3DGQA 6GSXA 3VWUA 3BOAA 1ZYEA 3GL5A 3ZL5A 2O7KA 3KXOA 14GSA 4JZQA 4IBPA 2GQLA 3ZMKA 1RK4A 2YANA 3P8WA 2YJ7A 1UVZA 1T00A 1NHOA 4PQIA 3IA1A 2EIRA 4PQ1A 2LRNA 4EIQA 3M9KA 3TOUA 3H4KA 3WYWA 4IJ3A 10GSA 2IMDA 3GKNA 3IBHA 4WEYA 2LRCA 2XPDA 1Z9HA 4MP4A 3GTUA 3GL3A 1TKDB 1B9YC 5L71A 3UARA 1TW9A 3APSA 1VGLA 4KW6A 3IR4A 1FG4A 4L0WA 1X9WB 1XW9A 4LL1B 5IQYA 2H75A 1U88A 3HYPA 2H01A 4KSOA 2BJXA 1U87A 3UOMA 4ZBAA 1YKCA 2H70A 2QGVA 3G9BA 3KTBA 4ZB6A 4O7HA 4KDXA 5JWRB 2K18A 4N0ZA 4YKFA 1BQ7A 5D8IA 4ML6A 5ID2B 3FR3A 1FOVA 1WJKA 2B1KA 1JHBA 2NDOA 6GSSA 1ILOA 3RAZA 5FT3A 1HNAA 3IRAA 5DQYA 2E2MA 1F3AA 4BVYB 4KUNA 4IHUA 1VRSD 2REMA 2DJKA 3I9V2 3DRNA 3F6DA 2GSSA 4H86A 2QA2A 4YQUA 4TR0A 2JSZA 4HEA2 3DVXA 3GKXA 1OC8A 2L5OA 4K6XA 3TUEA 2RUEA 4L5OA 5D73A 4TR1B 3DMLA 4KGIA 3HVVA 5EY6A 3VI5A 1PD21 1TXXA 1K3YA 1Z7PA 3FR6A 3IHQA 5INYA 3APOA 4EO3A 1OE7A 2R37A 3ZYWA 2B1LA 3PH9A 4HZ4A 5KEJA 2EC4A 1IYHA 2YWIA 2FGXA 3ME7A 4X0XA 1G6YA 1SL1B 3Q74A 1EEJA 1YY7A 3EINA 5B8BA 2I3YA 4OWYA 4DSSB 4GLTA 2GDRA 4K5SA 5KN2A 1OKTA 5DCGA 2X64A 1Y6EA 1T3BA 3O3TA 3I69A 3IAM2 4I2TA 4XRDA 3EU3A 5ECSA 1R5AA 4IS0A 2VIMA 2A2PA 2HSMA 3RDWA 4IJIA 2N5AA 2MMNA 2R3XA 5IPHA 1VF1A 2OKAA 4Q5NA 1V2AA 1AXDA 1XOAA 2RIIA 1FO5A 1EEMA 5HR2A 2DJ2A 6GSYA 2XHFA 1TI3A 2B7KA 4K1FA 2F8FA 1ERWA 1GSSA 2YV9A 1XBSA 4JBBA 4AGSA 1GTBA 1GRXA 2TIRA 1H75A 3GHAA 3NIVA 3GUSA 2L59A 1PKWA 2NTOA 3CTFA 1AUCA 6GSVA 3PGTA 2DIYA 1XW5A 6GSWA 4EL1A 4MK3A 2A2SA 2R5GA 1I5GA 3O76A 2LJRA 5ECPB 1Z6NA 22GSA 5A4VA 3L4NA 3DXBA 4I5QA 3MIXA 4XS4A 1FHEA 4J2FA 1HQOA 2IIYA 4DSRA 3QAWA 4Q5RA 3M1GA 20GSA 1PSQA 4MF6A 2F9SA 3MAKA 2GT6A 2OE3A 2LKUA 1A2MA 2LEGA 3A3TA 2VL3A 1KEBA 1PRXA 3PPUA 2V32A 4IKHA 2DSAA 3ISOA 5AN1A 2WRTA 1ZYNA 1PX6A 2A4HA 3TJKA 3GV1A 4MJEA 2XPEA 1GNWA 2LNSA 4PNGA 1JLWA 4NAXA 2IPAA 5DQSA 4K7IA 1BX9A 2ES7A 4L5LA 5IMCA 3ZLPA 5IIZA 2E7PA 4F82A 4HQSA 3ERFA 3BCKA 2IN3A 3ZMLA 2YWOA 4F0CA 3DIEA 1X5DA 1ZCPA 5HFKA 3NOFA 5F8BA 2K9FA 3APQA 3TJGA 6GSUA 1OC9A 5EPFA 3VPQA 1J08A 3UEMA 4GCIA 1SU9A 2IMIA 2H76A 2X8CA 3EC3A 3HDCA 2NPBA 1TRVA 2ZNMA 4ZB8A 1EGOA 1AW9A 2LSTA 5IM9A 5KN1A 1V58A 3ZREA 3GFKA 1H4OA 3R3EA 2LJAA 3AY8A 3HJOA 3CRTA 1R26A 4HI7A 2VCXA 3IC8A 2DJJA 1XFLA 2H6YA 3VFIA 2L5LA 3QAGA 2WCIA 4EE0A 3N5OA 1K0DA 4O32A 3FYGA 4ZL8A 5CYYA 5D9WA 5ECOB 1PX7A 2FNOA 1TTZA 2FWEA 1F2EA 1O6JA 3TDGA 5AISA 3D5JA 2IMKA 4K2XA 4MPGA 4O92A 1TRSA 4XHMA 3ERGA 4JRRA 4ML1A 3CMIA 2V2GA 4O5RA 5D9VA 4DEJA 1FVKA 3QFBC 1JZWA 4MF7A 1HD2A 3KMNA 3GNJA 1QFNA 4WR5A 1OVNA 4WKWA 4AJ7A 3WT2A 2CA8A 6GSTA 3EMXA 4IN0A 2F51A 5IMDA 4I6XA 4IP6A 4G2EA 2LJKA 1YZXA 5B6MA 5G1KA 1YEXA 4ZL9A 2G0FA 2H6ZA 1PA3A 4TOPA 2CQ9A 4KF9A 4LLRA 2FCHA 1S3AA 2R4VA 1YDKA 1ABAA 2I9HA 2FY6A 2DLXA 4POBA 1T8EB 1SYRA 5G5EA 4WETA 4GTUA 5ID2A 1K0AA 1O8XA 1PL1A 2P0GA 2DIZA 1ZYPA 3L78A 1XWKA 2F3MA 5ECRB 1ZGNA 2CZ3A 4BVYA 2DMMA 1GSYA 2JSYA 1SKRB 3FR9A 3HKRA 1FVJA 2C3QA 2WJUA 4GSNA 1WP0A 4V1Ap 1FOHA 2FWFA 2VLUA 1SKSB 3GKKA 3KEBA 5IMVA 2B3SA 3KMOA 2HYXA 5D93A 4TR1A 3LSZA 2DJ0A 4NXIA 3LXZA 1W89A 1HNBA 4OCEA 3C1RA 3KH7A 3W6GA 2F8AA 1EOGA 3UIWA 3RBTA 4JEDA 1R4WA 2HSYA 2WB9A 2XBIA 1NSWA 2FLSA 5HR1A 1GTIA 2PPTA 3J7Yk 3M8NA 3VURA 3EE2A 3QFAC 5CO3A 1M99A 4DSSA 4BL7A 1A8LA 2PERA 2OBKA 4ZIJA 3F63A 3F8UA 3HD5A 2VLVA 5DAKB 1XIYA 1GTAA 1O85A 3H93A 4V1Ag 1MEKA 4GQCA 4GQFA 3WGEA 19GSA 3LJRA 3O6TA 1RQMA 4MDCA 4YAVA 3D6IA 1SL0B 4ILFA 1BJXA 2VM1A 4F2IA 4F0BA 4HDEA 1G7EA 2LUSA 4TKYA 5ELGA 2VOCA 1Z6MA 3A5IA 2WULA 2B5XA 1XXUA 2VUPA 4ID0A 3TKPA 3HXSA 3GRXA 3KCMA 1GH2A 4AJ6A 2AHEA 4ZBBA 2PVQA 5D9XA 2BTOT 3MWHA 2GZYA 2FWGA 5J41A 1GUMA 1GLQA 4OCFA 4MA9A 2A2RA 2L4CA 4KAEA 1X0RA 3QCPA 4RQRA 1X5EA 2IFQB 1GSUA 2MMAA 1TK0B 5DVBA 7GSSA 1YJ6A 5ECLB 2JZSA 4MMMA 1ZZYA 4KNDA 1NHYA 3IDVA 2A4VA 1O7UA 5JCUA 2X99A 4D73B 1X5CA 2C0EA 3BBYA 1ERVA 2H19A 2DKHA 1T7PB 2H1AA 4F03A 4OFMA 4K7NA 3L0HA 3WD6A 4NWYA 4BA7A 4JR6A 1FB6A 4N11A 1UA5A 3GSTA 1M2BA 1TI1A 4L8EA 1M9AA 3D21A 2L57A 3EWLA 3WGDA 2YCDA 1K3OA 2VCZA 2FWHA 3MSZA 4YQMA 1BAYA 3TKSE 2V41A 3ZZXA 2YJHA 5HFGA 1AQXA 2CX3A 2GVPA 3FZAA 4K8MA 1W4VA 3FK8A 2X4AA 2XBQA 4GRFA 4ZBDA 1E2YA 3H8QA 1GWCA 4Z7XA 4ECBA 1DBYA 3TKSC 5JCWA 1K0BA 3UL3A 2HLSA 4ZL7A 5C04A 3LWAA 1SL2B 1V9WA 3D22A 3EMPA 3KGKA 1TDIA 2FA8A 1MDJA 4X1UA 2LTKA 1UC7A 2PWJA 2B5YA 3KZQA 2AAWA 1B9XC 2X8HA 3GX0A 4XS6A 5KOWA 5CRWA 2P5RA 4EC0A 4PX1A 5CRGA 2X8GA 5ECHB 2CAQA 4LMWA 3A2VA 1NW2A 2YNXA 1FAAA 1EWXA 4O5QA 3F9UA 4HS1A 2FHEA 2GQMA 1THXA 4KH7A 1Z3EA 3DEXA 4NV5A 1Y25A 3TKSA 1ZOFA 4G9HA 2V1MA 3P7XA 4FQUA 1M0UA 1EP7A 4KA0A 8GSSA 1GL8A 2TRXA 3DYRA 3QDNA 5ECIB 2VLTA 3GA4A 3UAPA 2GZPA 1ZYQB 4OMVA 2VL2A 4HJMA 3C7MA 4N30A 3EPTA 4PXOA 1J9BA 5ELAA 3KTLA 4BWQA 5HR3A 5IOXA 4EIPA 2HRKA 2TRCP 4CDOA 2B7JA 5ECQB 1GSFA 2L6CA 2OA7A 1YF1A 1G7OA 2GZZA 1ZMAA 4EVMA 2ON7A 3DWVA 1T4YA 3H79A 4TXOB 2RUFA 13GSA 1SENA 4YAPA 1RW1A 1SJZA 3C73A 5BMUA 1Z7RA 3GSSA 2HZFA 3C8EA 4MJBA 2R2JA 3FZ5A 1B8XA 2NBSA 3EYTA 4O5UA 5B7CA 1A23A 1PN9A 1GP1A 2H30A 5GSSA 1OYJA 4ISDA 2V6KA 2ZCTA 3SWLA 3RHBA 1BG5A 2VAFA 3V1WA 2MZCA 2VCWA 1WRYA 2LS5A 5ABRA 1XVWA 3F3RA 2KP1A 1TRWA 2WS2A 4G10A 5J9CA 3IHGA 2B6MA 1CQGA 1SK1A 4JR4A 2HZEB 4MJAA 4KX4A 2J9HA 4MZBA 2KUCA 3W8SA 2OJLA 3G7JA 3IXRA 2WZ9A 4HOJA 3TOTA 4GXZA 1MTCA 5HFIA 3US3A 2DBCA 3VWWA 2RM6A 4ULXA 1LJRA 2P31A 3ZTLA 2HT9A 4K7OA 2J23A 4TRXA 4ZXGA 3ZIVA 1WMJA 2MMZA 1A24A 2VCQA 2MYGA 4OO4A 4FYCA 2GLRA 4KSMA 1E6BA 3BCIA 3UVTA 1HYUA 1R7HA 2C4JA 3UBLA 3HVXA 3FMWA 1N8JA 2K8VA 1QUWA 4EF0A 4XRAA 1ML6A 3ZRDA 3ZITA 4ECCA 4DVCA 1TRUA 4J57E 3GN3A 5A5KA 4KE3A 3L9UA 2E2GA 11GSA 4NMUA 4K2DA 4P3YB 4LL4B 2C3TA 1WOUA 2VCVA 3VPTA 5JWQB 3HJPA 4V2LA 3HZ8A 1QMVA 2CV4A 3C1SA 4GSTA 3HCZA 2IWTA 1PQNA 3BJ5A 1A0RP 1JZRA 2H0IA 2OE0A 1GLPA 3VI7A 5H5RA 2QKEA 3ZVJA 5DCHA 3GKMA 5FHIA 2PU9C 4V2NA 3K8NA 2IFQA 9GSSA 3L9SA 4IGJA 1DUGA 5ENUA 4X43A 4CHSA 3UMAA 4OFNA 2R0GA 4JU5A 1O73A 2CVDA 2HRFA 3QOUA 1EZKA 1G0TA 2GTUA 1VF3A 2M80A 3U6VA 2C8UA 4MH2A 1XW6A 1OE8A 1VF4A 3VLNA 4D73A 4BVXB 3CSIA 1SJIA 5B8AA 1XVQA 4TN8A 2B5EA 2HI7A 4LMVA 1TOFA 2PBJA 4WBRD 3EU4A 2ON5A 18GSA 1URMA 3IC4A 2H0HA 3G7YA 12GSA 1G6WA 4KCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KDU A;  5AIV A;  4J56 E;  4GSS A;  5CRE A;  4L0U A;  4K9Z A;  1N2A A;  4BPY A;  3LG6 A;  4HU7 A;  5HR0 A;  3E3E A;  4MF5 A;  1IYI A;  1TU7 A;  1JFU A;  1O8W A;  3ZVJ D;  4CW9 A;  2LRT A;  1EV4 A;  4MPF A;  2C0F A;  3L9V A;  1MD3 A;  3P90 A;  3LEF A;  2JZT A;  3DKS A;  2L4Q A;  4PUA A;  2ALB A;  4YQV A;  4TR4 A;  2GSQ A;  2IME A;  4FIW A;  2YOI A;  1X9S B;  4MJC A;  3F3Q A;  3QR6 A;  2H73 A;  3ZIJ A;  5H5Q A;  4MLY A;  4Q5Q A;  5ECN B;  3KP8 A;  1FW1 A;  4GF0 A;  1SK0 A;  3KJY A;  3W8J A;  2YN1 A;  2JL4 A;  5IO0 A;  3KD0 A;  5G1L A;  3TCO A;  1B4Q A;  1V57 A;  2EIO A;  1F9M A;  4IQ1 A;  4MCU A;  3FY7 A;  1TK8 B;  2QSI A;  3F4R A;  3IK7 A;  3IV4 A;  1F6M C;  2WGR A;  2YZH A;  3GH9 A;  4YH2 A;  1GNE A;  1USB A;  1XCC A;  2GSR A;  1MDK A;  4NPB A;  16GS A;  3GX8 A;  3KH9 A;  1BYE A;  3BD2 A;  1AQW A;  1X9M B;  2HE3 A;  3A2X A;  5IMF A;  2DJ1 A;  3CRU A;  5DBQ A;  1JZO A;  2I1U A;  3E9J B;  4EKZ A;  4RQX A;  2GQK A;  2VCT A;  3GMF A;  5JWO B;  2QC7 A;  4HU9 A;  1OKD A;  1SK2 A;  4EUY A;  5DDL A;  3VWV A;  3D4T A;  5CP1 A;  2K8S A;  4RI7 A;  2GS3 A;  1CQH A;  3FZ9 A;  3VWX A;  1DE1 A;  2AB6 A;  4POK A;  3IOS A;  3GUR A;  2GT5 A;  1JLV A;  3ME8 A;  4MZW A;  4XCS A;  1Q4J A;  3HJM A;  5J3R A;  2JZR A;  1T4Z A;  4PNF A;  5IOW A;  4TXO A;  3IAS 2;  4POL A;  4TXV A;  1U3I A;  5G2Z A;  2C0D A;  3ZFB A;  2KHP A;  3MDK A;  1B4P A;  5G30 A;  3DVW A;  3PIN A;  4BWS A;  1THO A;  1EOH A;  1UN2 A;  3EUR A;  1A2J A;  5F07 A;  1AC1 A;  2O85 A;  2PVO C;  1K0O A;  2MMO A;  1GSD A;  2CVK A;  2YP6 A;  5C00 A;  5DAL B;  2GST A;  1KTE A;  3CXG A;  3GH6 A;  5HQP A;  5AGY A;  2L6D A;  4K0G A;  5GST A;  1PKZ A;  5CAX A;  1FB0 A;  1YF0 A;  2KP2 A;  4F9Z A;  4PGT A;  1MDI A;  3PR8 A;  2AV4 A;  1S3C A;  2AJQ B;  4IVF A;  1U6T A;  4OD7 A;  4QQ7 A;  2H74 A;  3TRP A;  1YQ1 A;  2JAD A;  5LD0 A;  5B6N A;  4ZIL A;  3UBK A;  2OAD A;  1TU8 A;  3M9J A;  4PQH A;  1M7T A;  4ZB9 A;  4RUV A;  3TJB A;  2O8V B;  2D2Z A;  2HZE A;  3Q18 A;  1T1V A;  1O81 A;  1K0M A;  1I9D A;  3TRQ A;  1GUL A;  2CVB A;  2IJY A;  1DSB A;  5D9T A;  2HNL A;  2VL2 C;  4IQA A;  3E0U A;  3HZ4 A;  3QPM A;  3I43 A;  3F0I A;  4EDZ A;  1PL2 A;  1V98 A;  4FYB A;  4XS1 A;  2YWN A;  2HFD A;  5GAP D;  3ZFL A;  4DSQ A;  3RHC A;  2H72 A;  4PUR A;  2K6V A;  4KCA A;  3EVI A;  1K0C A;  1MD4 A;  3ED3 A;  4V2M A;  5E59 A;  2VM2 A;  4TR3 A;  4OFT A;  4IP1 A;  3CTG A;  1V40 A;  3GTU B;  1QXH A;  3S9F A;  4WF4 A;  5JCG A;  3M3M A;  1SJ6 A;  2PGT A;  2VD0 A;  5G5F A;  5LCZ A;  1ACV A;  5J9B A;  5IMZ A;  2JAC A;  2E0Q A;  3CSH A;  5EL8 A;  3F4T A;  2I4A A;  2NVL A;  2H0G A;  1WPI A;  2IMF A;  5F06 A;  5GZZ B;  2H1G A;  1NM3 A;  2WFC A;  5LNK e;  3IE3 A;  4POM A;  3M0F A;  3D4M A;  3TB2 A;  3UVH A;  1OC3 A;  4QL9 A;  1VF2 A;  5AIX A;  3DD3 A;  2GGT A;  4MAB A;  1M2A A;  5DJL A;  1KBN A;  5IPG A;  1AIU A;  4G19 A;  1ON4 A;  5KN0 A;  1SYX A;  2LV3 A;  2C0G A;  2C80 A;  5F05 A;  3LXT A;  3FHK A;  5GAN D;  4FYU A;  5IMA A;  4BVX A;  2M72 A;  3QMX A;  4EXJ A;  2OBI A;  2CAI A;  2AUV A;  1XOB A;  1ZL9 A;  1XWA A;  3LFL A;  3F6F A;  3LYK A;  1EGR A;  5IO2 A;  2R6K A;  3KM6 A;  5ECM B;  3HVS A;  4FH8 A;  4NHW A;  1XPV A;  2N5B A;  3TRX A;  1TK5 B;  3JCM L;  1LBK A;  5A4W A;  3WT1 A;  4ACS A;  1OAZ A;  2FUG 2;  4GWR A;  4JE1 A;  2YZU A;  3LGC A;  1XWG A;  2N5F A;  4E8H A;  5F0G A;  4I97 A;  4RI6 A;  5CRD A;  5DJM A;  3Q19 A;  1Z5Y E;  1A2L A;  1U3A A;  5H5S A;  2V6O A;  1QQ2 A;  1XWB A;  3Q6O A;  3NZN A;  1WWJ A;  5G31 A;  5KN3 A;  2KLX A;  3HHV A;  4KB3 A;  1QGV A;  2AYT A;  4FO5 A;  1S3D A;  1LU4 A;  2ZUP A;  3RPN A;  3UJ1 A;  4K0N A;  1SD8 A;  2DML A;  4I2U A;  2OE1 A;  5FWG A;  1YEP A;  1K3L A;  2PN8 A;  2H6X A;  3D0Z A;  3G7I A;  3FKF A;  2KOK A;  5DAK A;  1A0F A;  1M2D A;  3I6A A;  1ERT A;  2LQO A;  2H66 A;  3HY2 A;  2HSH A;  1PGT A;  2H71 A;  4WR4 A;  3KIJ A;  4KDY A;  1GUK A;  3R2Q A;  3HA9 A;  4NV2 A;  2O87 A;  4XTS A;  2YPM A;  2H1D A;  3ERW A;  5CRH A;  3QD9 A;  2MBS A;  4HUA A;  1TJD A;  1PMT A;  4LA1 A;  4TW5 A;  2YWM A;  4MH3 A;  3FEU A;  3CBU A;  3J7Y b;  3VK9 A;  3U5R E;  1AAZ A;  1F37 A;  3FW2 A;  1ST9 A;  4Q5F A;  2RM5 A;  3TGZ A;  4WBJ A;  2LNT A;  1GSQ A;  2LQQ A;  1M9B A;  2Z9S A;  1GUH A;  3OR5 A;  4XS4 B;  1EV9 A;  3TKR A;  4MZC A;  2CX4 A;  3FZ4 A;  4HQZ A;  5A4U A;  1EP8 A;  1C72 A;  2PUK C;  4QL7 A;  5CNW A;  3F4S A;  3TKQ A;  1GTU A;  3P2A A;  2VD1 A;  3FRC A;  2WDU A;  4TVE A;  2MBT A;  2FA4 A;  2H8L A;  1XZO A;  3QAV A;  1TP9 A;  4HZ2 A;  1GSE A;  1QK8 A;  2H1B A;  2C3N A;  2CT6 A;  1BED A;  3CSJ A;  3IK9 A;  2BMX A;  4EDY A;  4E8E A;  2VO4 A;  3A5W A;  4XIH A;  3LQ7 A;  4N10 A;  4PUF C;  1WE0 A;  4WXT A;  3LYP A;  1KNG A;  1F3B A;  5D96 A;  1YKA A;  5J4U A;  4AJ8 A;  1K0N A;  2XC2 A;  1JZD A;  1XWC A;  5DAL A;  2HRN A;  2IL3 A;  4HJ2 A;  5E4W A;  3LOR A;  2VL9 A;  1A8Y A;  4IEL A;  2FD3 A;  5EVO A;  1J0F A;  1AQV A;  2C1Y A;  17GS A;  3WGX A;  4IW9 A;  3N9J A;  1Q98 A;  3CYN A;  3KP9 A;  4AF2 A;  2YV7 A;  2M46 A;  3TJJ A;  4WF5 A;  4I8B A;  2JU5 A;  1B48 A;  2OAC A;  2HXK A;  2PMT A;  2P5Q A;  1OC9 B;  4N0V A;  1HNC A;  1SD9 A;  3GYK A;  3MNG A;  4ECI A;  3C71 A;  2I81 A;  2RLI A;  5J5N A;  1SKW B;  2DJ3 A;  1R5P A;  3RPP A;  3GIX A;  4NHZ A;  4ECJ A;  5ECK B;  3SBC A;  4OO5 A;  2DC5 A;  2EIQ A;  2O89 A;  3A2W A;  3IPZ A;  3TJF A;  2G2Q A;  5COH A;  2CZ2 A;  3H1N A;  1ERU A;  1DE2 A;  1WIK A;  3DGQ A;  6GSX A;  3VWU A;  3BOA A;  1ZYE A;  3GL5 A;  3ZL5 A;  2O7K A;  3KXO A;  14GS A;  4JZQ A;  4IBP A;  2GQL A;  3ZMK A;  1RK4 A;  2YAN A;  3P8W A;  2YJ7 A;  1UVZ A;  1T00 A;  1NHO A;  4PQI A;  3IA1 A;  2EIR A;  4PQ1 A;  2LRN A;  3M9K A;  3TOU A;  3H4K A;  3WYW A;  4IJ3 A;  10GS A;  2IMD A;  3GKN A;  3IBH A;  4WEY A;  2LRC A;  2XPD A;  1Z9H A;  4MP4 A;  3GTU A;  3GL3 A;  1TKD B;  1B9Y C;  5L71 A;  3UAR A;  1TW9 A;  3APS A;  1VGL A;  4KW6 A;  3IR4 A;  1FG4 A;  4L0W A;  1X9W B;  1XW9 A;  4LL1 B;  5IQY A;  2H75 A;  1U88 A;  3HYP A;  2H01 A;  4KSO A;  2BJX A;  1U87 A;  3UOM A;  4ZBA A;  1YKC A;  2H70 A;  2QGV A;  3G9B A;  3KTB A;  4ZB6 A;  4O7H A;  4KDX A;  5JWR B;  2K18 A;  4N0Z A;  5D8I A;  1BQ7 A;  4ML6 A;  5ID2 B;  3FR3 A;  1FOV A;  1WJK A;  2B1K A;  1JHB A;  2NDO A;  6GSS A;  1ILO A;  3RAZ A;  5FT3 A;  1HNA A;  3IRA A;  5DQY A;  2E2M A;  1F3A A;  4KUN A;  4IHU A;  1VRS D;  2REM A;  2DJK A;  3I9V 2;  3DRN A;  3F6D A;  2GSS A;  4H86 A;  4YQU A;  4TR0 A;  2JSZ A;  4HEA 2;  3DVX A;  3GKX A;  1OC8 A;  2L5O A;  4K6X A;  3TUE A;  2RUE A;  4L5O A;  5D73 A;  4TR1 B;  3DML A;  4KGI A;  3HVV A;  5EY6 A;  3VI5 A;  1PD2 1;  1TXX A;  1K3Y A;  1Z7P A;  3FR6 A;  3IHQ A;  5INY A;  3APO A;  4EO3 A;  1OE7 A;  2R37 A;  3ZYW A;  2B1L A;  3PH9 A;  4HZ4 A;  5KEJ A;  2EC4 A;  1IYH A;  2YWI A;  2FGX A;  3ME7 A;  4X0X A;  1G6Y A;  1SL1 B;  3Q74 A;  1EEJ A;  1YY7 A;  3EIN A;  5B8B A;  2I3Y A;  4OWY A;  4DSS B;  4GLT A;  2GDR A;  5KN2 A;  1OKT A;  5DCG A;  2X64 A;  1Y6E A;  1T3B A;  3O3T A;  3I69 A;  3IAM 2;  4I2T A;  4XRD A;  3EU3 A;  5ECS A;  1R5A A;  4IS0 A;  2VIM A;  3RDW A;  4IJI A;  2N5A A;  2MMN A;  2R3X A;  5IPH A;  1VF1 A;  2OKA A;  4Q5N A;  1V2A A;  1AXD A;  1XOA A;  2RII A;  1FO5 A;  1EEM A;  5HR2 A;  2DJ2 A;  6GSY A;  2XHF A;  1TI3 A;  2B7K A;  4K1F A;  2F8F A;  1ERW A;  1GSS A;  2YV9 A;  1XBS A;  4JBB A;  4AGS A;  1GTB A;  1GRX A;  2TIR A;  1H75 A;  3GHA A;  3NIV A;  3GUS A;  2L59 A;  1PKW A;  2NTO A;  3CTF A;  1AUC A;  6GSV A;  3PGT A;  2DIY A;  1XW5 A;  6GSW A;  4EL1 A;  4MK3 A;  2A2S A;  2R5G A;  1I5G A;  3O76 A;  2LJR A;  5ECP B;  1Z6N A;  22GS A;  5A4V A;  3L4N A;  3DXB A;  4I5Q A;  4XS4 A;  1FHE A;  4J2F A;  1HQO A;  2IIY A;  4DSR A;  3QAW A;  4Q5R A;  3M1G A;  20GS A;  1PSQ A;  4MF6 A;  2F9S A;  3MAK A;  2GT6 A;  2OE3 A;  2LKU A;  1A2M A;  2LEG A;  3A3T A;  2VL3 A;  1KEB A;  1PRX A;  2V32 A;  4IKH A;  2DSA A;  3ISO A;  5AN1 A;  2WRT A;  1PX6 A;  3TJK A;  3GV1 A;  4MJE A;  2XPE A;  1GNW A;  2LNS A;  4PNG A;  1JLW A;  4NAX A;  2IPA A;  5DQS A;  4K7I A;  1BX9 A;  2ES7 A;  4L5L A;  5IMC A;  3ZLP A;  5IIZ A;  2E7P A;  4F82 A;  4HQS A;  3ERF A;  3BCK A;  2IN3 A;  3ZML A;  2YWO A;  4F0C A;  3DIE A;  1X5D A;  1ZCP A;  5HFK A;  3NOF A;  5F8B A;  2K9F A;  3APQ A;  3TJG A;  6GSU A;  1OC9 A;  5EPF A;  3VPQ A;  1J08 A;  3UEM A;  4GCI A;  1SU9 A;  2IMI A;  2H76 A;  2X8C A;  3EC3 A;  3HDC A;  2NPB A;  1TRV A;  2ZNM A;  4ZB8 A;  1EGO A;  1AW9 A;  2LST A;  5IM9 A;  5KN1 A;  1V58 A;  3ZRE A;  3GFK A;  1H4O A;  2LJA A;  3AY8 A;  3HJO A;  3CRT A;  1R26 A;  4HI7 A;  2VCX A;  2DJJ A;  1XFL A;  2H6Y A;  3VFI A;  2L5L A;  3QAG A;  2WCI A;  4EE0 A;  3N5O A;  1K0D A;  4O32 A;  3FYG A;  4ZL8 A;  5CYY A;  5D9W A;  5ECO B;  1PX7 A;  2FNO A;  1TTZ A;  2FWE A;  1F2E A;  1O6J A;  3TDG A;  5AIS A;  3D5J A;  2IMK A;  4MPG A;  4O92 A;  1TRS A;  4XHM A;  3ERG A;  4JRR A;  4ML1 A;  3CMI A;  2V2G A;  4O5R A;  5D9V A;  4DEJ A;  1FVK A;  3QFB C;  1JZW A;  4MF7 A;  1HD2 A;  3KMN A;  3GNJ A;  1QFN A;  4WR5 A;  1OVN A;  4WKW A;  4AJ7 A;  3WT2 A;  2CA8 A;  6GST A;  3EMX A;  4IN0 A;  2F51 A;  5IMD A;  4I6X A;  4IP6 A;  4G2E A;  2LJK A;  1YZX A;  5B6M A;  5G1K A;  1YEX A;  4ZL9 A;  2G0F A;  2H6Z A;  1PA3 A;  4TOP A;  2CQ9 A;  4LLR A;  2FCH A;  1S3A A;  2R4V A;  1YDK A;  1ABA A;  2I9H A;  2FY6 A;  2DLX A;  4POB A;  1T8E B;  1SYR A;  5G5E A;  4WET A;  4GTU A;  5ID2 A;  1K0A A;  1O8X A;  1PL1 A;  2P0G A;  2DIZ A;  3L78 A;  5ECR B;  1XWK A;  2F3M A;  1ZGN A;  2CZ3 A;  4BVY A;  2DMM A;  1GSY A;  2JSY A;  1SKR B;  3FR9 A;  3HKR A;  1FVJ A;  2C3Q A;  2WJU A;  4GSN A;  1WP0 A;  4V1A p;  2FWF A;  2VLU A;  1SKS B;  3GKK A;  3KEB A;  5IMV A;  2B3S A;  3KMO A;  2HYX A;  5D93 A;  4TR1 A;  3LSZ A;  2DJ0 A;  4NXI A;  3LXZ A;  1W89 A;  1HNB A;  4OCE A;  3C1R A;  3KH7 A;  3W6G A;  2F8A A;  1EOG A;  3UIW A;  3RBT A;  4JED A;  1R4W A;  2HSY A;  2WB9 A;  2XBI A;  1NSW A;  2FLS A;  5HR1 A;  1GTI A;  2PPT A;  3J7Y k;  3M8N A;  3VUR A;  3EE2 A;  3QFA C;  5CO3 A;  1M99 A;  4DSS A;  4BL7 A;  1A8L A;  2PER A;  2OBK A;  4ZIJ A;  3F63 A;  3F8U A;  3HD5 A;  2VLV A;  5DAK B;  1XIY A;  1GTA A;  1O85 A;  3H93 A;  4V1A g;  1MEK A;  4GQC A;  4GQF A;  3WGE A;  19GS A;  3LJR A;  3O6T A;  1RQM A;  4MDC A;  4YAV A;  3D6I A;  1SL0 B;  4ILF A;  1BJX A;  2VM1 A;  4F2I A;  4F0B A;  4HDE A;  1G7E A;  2LUS A;  4TKY A;  5ELG A;  2VOC A;  1Z6M A;  2WUL A;  2B5X A;  1XXU A;  2VUP A;  4ID0 A;  3TKP A;  3HXS A;  3GRX A;  3KCM A;  1GH2 A;  4AJ6 A;  2AHE A;  4ZBB A;  2PVQ A;  5D9X A;  2BTO T;  3MWH A;  2GZY A;  2FWG A;  5J41 A;  1GUM A;  1GLQ A;  4OCF A;  4MA9 A;  2A2R A;  2L4C A;  4KAE A;  1X0R A;  3QCP A;  4RQR A;  1X5E A;  2IFQ B;  1GSU A;  2MMA A;  1TK0 B;  5DVB A;  7GSS A;  1YJ6 A;  5ECL B;  2JZS A;  4MMM A;  1ZZY A;  4KND A;  1NHY A;  3IDV A;  2A4V A;  1O7U A;  5JCU A;  2X99 A;  4D73 B;  1X5C A;  2C0E A;  3BBY A;  1ERV A;  2H19 A;  1T7P B;  2H1A A;  4F03 A;  4OFM A;  4K7N A;  3L0H A;  3WD6 A;  4NWY A;  4BA7 A;  4JR6 A;  1FB6 A;  4N11 A;  1UA5 A;  3GST A;  1M2B A;  1TI1 A;  4L8E A;  1M9A A;  3D21 A;  2L57 A;  3EWL A;  3WGD A;  2YCD A;  1K3O A;  2VCZ A;  2FWH A;  3MSZ A;  4YQM A;  1BAY A;  3TKS E;  2V41 A;  3ZZX A;  2YJH A;  5HFG A;  1AQX A;  2CX3 A;  2GVP A;  3FZA A;  4K8M A;  1W4V A;  3FK8 A;  2XBQ A;  4GRF A;  4ZBD A;  1E2Y A;  3H8Q A;  1GWC A;  4Z7X A;  4ECB A;  1DBY A;  3TKS C;  5JCW A;  1K0B A;  3UL3 A;  2HLS A;  4ZL7 A;  5C04 A;  3LWA A;  1SL2 B;  1V9W A;  3D22 A;  3EMP A;  3KGK A;  1TDI A;  2FA8 A;  1MDJ A;  4X1U A;  2LTK A;  1UC7 A;  2PWJ A;  2B5Y A;  3KZQ A;  2AAW A;  1B9X C;  2X8H A;  3GX0 A;  4XS6 A;  5CRW A;  2P5R A;  4EC0 A;  4PX1 A;  5CRG A;  2X8G A;  5ECH B;  2CAQ A;  4LMW A;  3A2V A;  1NW2 A;  2YNX A;  1FAA A;  1EWX A;  3F9U A;  4HS1 A;  2FHE A;  2GQM A;  1THX A;  4KH7 A;  1Z3E A;  3DEX A;  4NV5 A;  1Y25 A;  3TKS A;  1ZOF A;  4G9H A;  2V1M A;  3P7X A;  1M0U A;  1EP7 A;  4KA0 A;  8GSS A;  1GL8 A;  2TRX A;  3DYR A;  3QDN A;  5ECI B;  2VLT A;  3GA4 A;  3UAP A;  2GZP A;  1ZYQ B;  4OMV A;  2VL2 A;  4HJM A;  3C7M A;  4N30 A;  4PXO A;  1J9B A;  5ELA A;  3KTL A;  4BWQ A;  5HR3 A;  5IOX A;  2TRC P;  4CDO A;  2B7J A;  5ECQ B;  1GSF A;  2L6C A;  2OA7 A;  1YF1 A;  1G7O A;  2GZZ A;  1ZMA A;  4EVM A;  2ON7 A;  3DWV A;  1T4Y A;  3H79 A;  4TXO B;  2RUF A;  13GS A;  1SEN A;  4YAP A;  1RW1 A;  1SJZ A;  3C73 A;  1Z7R A;  3GSS A;  2HZF A;  3C8E A;  4MJB A;  2R2J A;  3FZ5 A;  1B8X A;  2NBS A;  3EYT A;  5B7C A;  1A23 A;  1PN9 A;  1GP1 A;  2H30 A;  5GSS A;  1OYJ A;  4ISD A;  2V6K A;  2ZCT A;  3SWL A;  3RHB A;  1BG5 A;  2VAF A;  3V1W A;  2MZC A;  2VCW A;  1WRY A;  2LS5 A;  5ABR A;  1XVW A;  3F3R A;  2KP1 A;  1TRW A;  2WS2 A;  4G10 A;  5J9C A;  2B6M A;  1CQG A;  1SK1 A;  4JR4 A;  2HZE B;  4MJA A;  4KX4 A;  2J9H A;  4MZB A;  2KUC A;  3W8S A;  2OJL A;  3G7J A;  3IXR A;  2WZ9 A;  4HOJ A;  3TOT A;  4GXZ A;  1MTC A;  5HFI A;  3US3 A;  2DBC A;  3VWW A;  2RM6 A;  4ULX A;  1LJR A;  2P31 A;  3ZTL A;  2HT9 A;  4K7O A;  2J23 A;  4TRX A;  4ZXG A;  3ZIV A;  1WMJ A;  2MMZ A;  1A24 A;  2VCQ A;  2MYG A;  4OO4 A;  4FYC A;  2GLR A;  4KSM A;  1E6B A;  3BCI A;  3UVT A;  1HYU A;  1R7H A;  2C4J A;  3UBL A;  3HVX A;  1N8J A;  2K8V A;  1QUW A;  4EF0 A;  4XRA A;  1ML6 A;  3ZRD A;  3ZIT A;  4ECC A;  4DVC A;  1TRU A;  4J57 E;  3GN3 A;  5A5K A;  4KE3 A;  3L9U A;  2E2G A;  11GS A;  4NMU A;  4K2D A;  4P3Y B;  4LL4 B;  2C3T A;  1WOU A;  2VCV A;  3VPT A;  5JWQ B;  3HJP A;  4V2L A;  3HZ8 A;  1QMV A;  2CV4 A;  3C1S A;  4GST A;  3HCZ A;  2IWT A;  1PQN A;  3BJ5 A;  1A0R P;  1JZR A;  2H0I A;  2OE0 A;  1GLP A;  3VI7 A;  5H5R A;  2QKE A;  3ZVJ A;  5DCH A;  3GKM A;  5FHI A;  2PU9 C;  4V2N A;  3K8N A;  2IFQ A;  9GSS A;  3L9S A;  4IGJ A;  1DUG A;  5ENU A;  4X43 A;  4CHS A;  3UMA A;  4OFN A;  4JU5 A;  1O73 A;  2CVD A;  2HRF A;  3QOU A;  1EZK A;  1G0T A;  2GTU A;  1VF3 A;  2M80 A;  3U6V A;  2C8U A;  4MH2 A;  1XW6 A;  1OE8 A;  1VF4 A;  3VLN A;  4D73 A;  3CSI A;  1SJI A;  5B8A A;  1XVQ A;  4TN8 A;  2B5E A;  2HI7 A;  4LMV A;  1TOF A;  2PBJ A;  4WBR D;  3EU4 A;  2ON5 A;  18GS A;  1URM A;  3IC4 A;  2H0H A;  3G7Y A;  12GS A;  1G6W A;  4KCE A; 
#chains in the Genus database with same CATH topology
 4KDU A;  5AIV A;  4J56 E;  4GSS A;  5CRE A;  4L0U A;  4K9Z A;  1N2A A;  4BPY A;  3LG6 A;  4HU7 A;  5HR0 A;  3E3E A;  4MF5 A;  1IYI A;  1TU7 A;  1JFU A;  1O8W A;  3ZVJ D;  4CW9 A;  2LRT A;  1EV4 A;  4MPF A;  2C0F A;  2X49 A;  1MD3 A;  3L9V A;  3P90 A;  3LEF A;  2JZT A;  3DKS A;  2L4Q A;  4PUA A;  2ALB A;  4MNN A;  4YQV A;  4TR4 A;  2GSQ A;  2IME A;  4YKG A;  4FIW A;  2YOI A;  1X9S B;  4MJC A;  3F3Q A;  3QR6 A;  2H73 A;  3ZIJ A;  4CY8 A;  5H5Q A;  4MLY A;  4Q5Q A;  5ECN B;  3KP8 A;  1FW1 A;  4GF0 A;  1SK0 A;  3KJY A;  3W8J A;  2YN1 A;  2JL4 A;  5IO0 A;  4G0K A;  3KD0 A;  5G1L A;  3TCO A;  1B4Q A;  1V57 A;  2EIO A;  1F9M A;  4IQ1 A;  4MCU A;  3FY7 A;  1TK8 B;  2QSI A;  3F4R A;  3IK7 A;  3IV4 A;  1F6M C;  2WGR A;  2YZH A;  3GH9 A;  4YH2 A;  1GNE A;  1USB A;  1XCC A;  2GSR A;  1MDK A;  4NPB A;  16GS A;  3GX8 A;  3KH9 A;  1BYE A;  3BD2 A;  1AQW A;  1X9M B;  2HE3 A;  3A2X A;  5IMF A;  2DJ1 A;  3CRU A;  4Z2R A;  5DBQ A;  4USS A;  1JZO A;  2I1U A;  3E9J B;  4EKZ A;  4RQX A;  2GQK A;  2VCT A;  3GMF A;  5JWO B;  2QC7 A;  4HU9 A;  1OKD A;  1SK2 A;  4EUY A;  5DDL A;  3VWV A;  3D4T A;  4G0L A;  5CP1 A;  2K8S A;  4RI7 A;  2GS3 A;  1CQH A;  3FZ9 A;  3VWX A;  1DE1 A;  2AB6 A;  5BRT A;  4POK A;  3IOS A;  3GUR A;  4Z2U A;  2GT5 A;  1JLV A;  3ME8 A;  4MZW A;  4XCS A;  1Q4J A;  3HJM A;  2UZ8 A;  5J3R A;  2JZR A;  1T4Z A;  4PNF A;  5IOW A;  4TXO A;  3IAS 2;  4POL A;  4TXV A;  1U3I A;  5G2Z A;  2C0D A;  3ZFB A;  2KHP A;  3MDK A;  1B4P A;  5G30 A;  3DVW A;  3PIN A;  4BWS A;  1THO A;  1EOH A;  1UN2 A;  3EUR A;  1PFO A;  1A2J A;  5F07 A;  1AC1 A;  2O85 A;  2PVO C;  1K0O A;  2MMO A;  1GSD A;  2CVK A;  2YP6 A;  5C00 A;  5DAL B;  2GST A;  1KTE A;  3CXG A;  3GH6 A;  5HQP A;  5AGY A;  2L6D A;  4K0G A;  4PTS A;  5GST A;  1PKZ A;  5CAX A;  1FB0 A;  1YF0 A;  2KP2 A;  4F9Z A;  4PGT A;  1MDI A;  3PR8 A;  2AV4 A;  1S3C A;  2AJQ B;  4IVF A;  1U6T A;  4OD7 A;  4QQ7 A;  2H74 A;  3TRP A;  1YQ1 A;  2JAD A;  5LD0 A;  5B6N A;  4ZIL A;  3UBK A;  2OAD A;  1TU8 A;  3M9J A;  4PQH A;  1M7T A;  4ZB9 A;  4RUV A;  3TJB A;  2O8V B;  2D2Z A;  2HZE A;  3Q18 A;  1T1V A;  1O81 A;  1K0M A;  1I9D A;  3TRQ A;  1GUL A;  2CVB A;  4BL7 B;  2IJY A;  1DSB A;  5D9T A;  2HNL A;  2VL2 C;  4IQA A;  3E0U A;  3HZ4 A;  3QPM A;  3I43 A;  3F0I A;  4EDZ A;  1PL2 A;  1V98 A;  4FYB A;  4XS1 A;  2YWN A;  2HFD A;  5GAP D;  3ZFL A;  4DSQ A;  3RHC A;  2H72 A;  4PUR A;  1S3R A;  2K6V A;  4KCA A;  3EVI A;  1K0C A;  1MD4 A;  3ED3 A;  4V2M A;  5E59 A;  2VM2 A;  4TR3 A;  4K5R A;  4OFT A;  4IP1 A;  3CTG A;  1V40 A;  3GTU B;  1QXH A;  3S9F A;  4WF4 A;  5JCG A;  3M3M A;  1SJ6 A;  2PGT A;  2VD0 A;  5G5F A;  5LCZ A;  1ACV A;  5J9B A;  5IMZ A;  2JAC A;  2E0Q A;  3CSH A;  5EL8 A;  3F4T A;  2I4A A;  2NVL A;  2H0G A;  1WPI A;  2IMF A;  5F06 A;  2DKI A;  5GZZ B;  2H1G A;  1NM3 A;  2WFC A;  5LNK e;  3IE3 A;  4POM A;  3M0F A;  3D4M A;  3TB2 A;  3UVH A;  1OC3 A;  4QL9 A;  1VF2 A;  5AIX A;  3DD3 A;  2GGT A;  4MAB A;  1M2A A;  5DJL A;  1KBN A;  5IPG A;  1AIU A;  4G19 A;  1ON4 A;  5KN0 A;  1SYX A;  2LV3 A;  2C0G A;  2C80 A;  5F05 A;  3LXT A;  3FHK A;  5KOX A;  5GAN D;  4FYU A;  4BIK A;  5IMA A;  4BVX A;  2M72 A;  3QMX A;  4EXJ A;  2OBI A;  2CAI A;  2AUV A;  1XOB A;  1ZL9 A;  1XWA A;  3LFL A;  3F6F A;  3LYK A;  1EGR A;  5IO2 A;  2R6K A;  3KM6 A;  5ECM B;  3HVS A;  4FH8 A;  4NHW A;  1XPV A;  2N5B A;  4ICY A;  3TRX A;  1TK5 B;  3JCM L;  1LBK A;  5A4W A;  3WT1 A;  4ACS A;  1OAZ A;  2FUG 2;  4GWR A;  4JE1 A;  2YZU A;  3LGC A;  1XWG A;  2N5F A;  4E8H A;  5F0G A;  4I97 A;  4RI6 A;  5CRD A;  5DJM A;  3LW9 A;  3Q19 A;  1Z5Y E;  1A2L A;  1U3A A;  5H5S A;  2V6O A;  1QQ2 A;  1XWB A;  3Q6O A;  3NZN A;  3MYD A;  4CY6 A;  1WWJ A;  5G31 A;  5KN3 A;  2KLX A;  3HHV A;  4KB3 A;  1QGV A;  2AYT A;  4FO5 A;  1S3D A;  1LU4 A;  2ZUP A;  3RPN A;  3UJ1 A;  4K0N A;  1SD8 A;  2DML A;  4I2U A;  2OE1 A;  5FWG A;  1YEP A;  1K3L A;  2PN8 A;  2H6X A;  3D0Z A;  3G7I A;  3FKF A;  2KOK A;  5DAK A;  1A0F A;  1M2D A;  3I6A A;  1ERT A;  2LQO A;  2H66 A;  3HY2 A;  2HSH A;  1PGT A;  2H71 A;  2QA1 A;  4WR4 A;  3KIJ A;  4KDY A;  1GUK A;  3R2Q A;  3HA9 A;  4NV2 A;  2O87 A;  4XTS A;  2YPM A;  2H1D A;  3ERW A;  5CRH A;  3QD9 A;  2MBS A;  4HUA A;  1TJD A;  1PMT A;  4LA1 A;  4TW5 A;  2YWM A;  4MH3 A;  3FEU A;  3CBU A;  3J7Y b;  3VK9 A;  3U5R E;  1AAZ A;  1F37 A;  3FW2 A;  1ST9 A;  4Q5F A;  2RM5 A;  3TGZ A;  4WBJ A;  2LNT A;  1GSQ A;  2LQQ A;  1M9B A;  2Z9S A;  1GUH A;  3OR5 A;  2R0C A;  4XS4 B;  1EV9 A;  3TKR A;  4MZC A;  2CX4 A;  3FZ4 A;  4HQZ A;  5A4U A;  1EP8 A;  1C72 A;  2PUK C;  4QL7 A;  5CNW A;  3F4S A;  3TKQ A;  1GTU A;  3P2A A;  2VD1 A;  3FRC A;  2WDU A;  4TVE A;  2MBT A;  2FA4 A;  2H8L A;  1XZO A;  3QAV A;  1TP9 A;  4HZ2 A;  1GSE A;  3HVN A;  1QK8 A;  2H1B A;  2C3N A;  2CT6 A;  1BED A;  3CSJ A;  3IK9 A;  2HRA A;  2BMX A;  4EDY A;  4E8E A;  2VO4 A;  3A5W A;  4XIH A;  3LQ7 A;  4N10 A;  4PUF C;  1WE0 A;  4WXT A;  3LYP A;  1KNG A;  1F3B A;  5D96 A;  1YKA A;  5J4U A;  4AJ8 A;  1K0N A;  2XC2 A;  1JZD A;  1XWC A;  5DAL A;  1XG8 A;  4X4J A;  2HRN A;  2IL3 A;  4HJ2 A;  5E4W A;  3LOR A;  2VL9 A;  1A8Y A;  4IEL A;  2FD3 A;  5EVO A;  1J0F A;  1AQV A;  2C1Y A;  17GS A;  3WGX A;  4IW9 A;  3N9J A;  1Q98 A;  3CYN A;  3KP9 A;  4AF2 A;  2YV7 A;  2M46 A;  3TJJ A;  4WF5 A;  4I8B A;  2JU5 A;  1B48 A;  2OAC A;  4A5P A;  2HXK A;  2PMT A;  2P5Q A;  1OC9 B;  4N0V A;  1HNC A;  1SD9 A;  3GYK A;  3MNG A;  4ECI A;  4Z2T A;  3C71 A;  2I81 A;  2RLI A;  5J5N A;  1SKW B;  2DJ3 A;  1R5P A;  3RPP A;  3GIX A;  4NHZ A;  4ECJ A;  5ECK B;  3SBC A;  2R0P A;  4OO5 A;  2DC5 A;  2EIQ A;  2O89 A;  4G0I A;  3A2W A;  3IPZ A;  3TJF A;  2G2Q A;  5COH A;  2CZ2 A;  3H1N A;  1ERU A;  1DE2 A;  1WIK A;  1PN0 A;  3DGQ A;  6GSX A;  3VWU A;  3BOA A;  1ZYE A;  3GL5 A;  3ZL5 A;  2O7K A;  3KXO A;  14GS A;  4JZQ A;  4IBP A;  2GQL A;  3ZMK A;  1RK4 A;  2YAN A;  3P8W A;  2YJ7 A;  1UVZ A;  1T00 A;  1NHO A;  4PQI A;  3IA1 A;  2EIR A;  4PQ1 A;  2LRN A;  4EIQ A;  3M9K A;  3TOU A;  3H4K A;  3WYW A;  4IJ3 A;  10GS A;  2IMD A;  3GKN A;  3IBH A;  4WEY A;  2LRC A;  2XPD A;  1Z9H A;  4MP4 A;  3GTU A;  3GL3 A;  1TKD B;  1B9Y C;  5L71 A;  3UAR A;  1TW9 A;  3APS A;  1VGL A;  4KW6 A;  3IR4 A;  1FG4 A;  4L0W A;  1X9W B;  1XW9 A;  4LL1 B;  5IQY A;  2H75 A;  1U88 A;  3HYP A;  2H01 A;  4KSO A;  2BJX A;  1U87 A;  3UOM A;  4ZBA A;  1YKC A;  2H70 A;  2QGV A;  3G9B A;  3KTB A;  4ZB6 A;  4O7H A;  4KDX A;  1M3I A;  5JWR B;  2K18 A;  4N0Z A;  4YKF A;  1BQ7 A;  5D8I A;  4ML6 A;  5ID2 B;  3FR3 A;  1FOV A;  1WJK A;  2B1K A;  1JHB A;  2NDO A;  6GSS A;  1ILO A;  3RAZ A;  5FT3 A;  1HNA A;  3IRA A;  5DQY A;  2E2M A;  1F3A A;  4BVY B;  4KUN A;  4IHU A;  1VRS D;  2REM A;  2DJK A;  3I9V 2;  3DRN A;  3F6D A;  2GSS A;  4H86 A;  2QA2 A;  4YQU A;  4TR0 A;  2JSZ A;  4HEA 2;  3DVX A;  3GKX A;  1OC8 A;  2L5O A;  4K6X A;  3TUE A;  2RUE A;  4L5O A;  5D73 A;  4TR1 B;  3DML A;  4KGI A;  3HVV A;  5EY6 A;  3VI5 A;  1PD2 1;  1TXX A;  1K3Y A;  1Z7P A;  3FR6 A;  3IHQ A;  5INY A;  3APO A;  4EO3 A;  1OE7 A;  2R37 A;  3ZYW A;  2B1L A;  3PH9 A;  4HZ4 A;  5KEJ A;  2EC4 A;  1IYH A;  2YWI A;  2FGX A;  3ME7 A;  4X0X A;  1G6Y A;  1SL1 B;  3Q74 A;  1EEJ A;  1YY7 A;  3EIN A;  5B8B A;  2I3Y A;  4OWY A;  4DSS B;  4GLT A;  2GDR A;  4K5S A;  5KN2 A;  1OKT A;  5DCG A;  2X64 A;  1Y6E A;  1T3B A;  3O3T A;  3I69 A;  3IAM 2;  4I2T A;  4XRD A;  3EU3 A;  5ECS A;  1R5A A;  4IS0 A;  2VIM A;  2A2P A;  2HSM A;  3RDW A;  4IJI A;  2N5A A;  2MMN A;  2R3X A;  5IPH A;  1VF1 A;  2OKA A;  4Q5N A;  1V2A A;  1AXD A;  1XOA A;  2RII A;  1FO5 A;  1EEM A;  5HR2 A;  2DJ2 A;  6GSY A;  2XHF A;  1TI3 A;  2B7K A;  4K1F A;  2F8F A;  1ERW A;  1GSS A;  2YV9 A;  1XBS A;  4JBB A;  4AGS A;  1GTB A;  1GRX A;  2TIR A;  1H75 A;  3GHA A;  3NIV A;  3GUS A;  2L59 A;  1PKW A;  2NTO A;  3CTF A;  1AUC A;  6GSV A;  3PGT A;  2DIY A;  1XW5 A;  6GSW A;  4EL1 A;  4MK3 A;  2A2S A;  2R5G A;  1I5G A;  3O76 A;  2LJR A;  5ECP B;  1Z6N A;  22GS A;  5A4V A;  3L4N A;  3DXB A;  4I5Q A;  3MIX A;  4XS4 A;  1FHE A;  4J2F A;  1HQO A;  2IIY A;  4DSR A;  3QAW A;  4Q5R A;  3M1G A;  20GS A;  1PSQ A;  4MF6 A;  2F9S A;  3MAK A;  2GT6 A;  2OE3 A;  2LKU A;  1A2M A;  2LEG A;  3A3T A;  2VL3 A;  1KEB A;  1PRX A;  3PPU A;  2V32 A;  4IKH A;  2DSA A;  3ISO A;  5AN1 A;  2WRT A;  1ZYN A;  1PX6 A;  2A4H A;  3TJK A;  3GV1 A;  4MJE A;  2XPE A;  1GNW A;  2LNS A;  4PNG A;  1JLW A;  4NAX A;  2IPA A;  5DQS A;  4K7I A;  1BX9 A;  2ES7 A;  4L5L A;  5IMC A;  3ZLP A;  5IIZ A;  2E7P A;  4F82 A;  4HQS A;  3ERF A;  3BCK A;  2IN3 A;  3ZML A;  2YWO A;  4F0C A;  3DIE A;  1X5D A;  1ZCP A;  5HFK A;  3NOF A;  5F8B A;  2K9F A;  3APQ A;  3TJG A;  6GSU A;  1OC9 A;  5EPF A;  3VPQ A;  1J08 A;  3UEM A;  4GCI A;  1SU9 A;  2IMI A;  2H76 A;  2X8C A;  3EC3 A;  3HDC A;  2NPB A;  1TRV A;  2ZNM A;  4ZB8 A;  1EGO A;  1AW9 A;  2LST A;  5IM9 A;  5KN1 A;  1V58 A;  3ZRE A;  3GFK A;  1H4O A;  3R3E A;  2LJA A;  3AY8 A;  3HJO A;  3CRT A;  1R26 A;  4HI7 A;  2VCX A;  3IC8 A;  2DJJ A;  1XFL A;  2H6Y A;  3VFI A;  2L5L A;  3QAG A;  2WCI A;  4EE0 A;  3N5O A;  1K0D A;  4O32 A;  3FYG A;  4ZL8 A;  5CYY A;  5D9W A;  5ECO B;  1PX7 A;  2FNO A;  1TTZ A;  2FWE A;  1F2E A;  1O6J A;  3TDG A;  5AIS A;  3D5J A;  2IMK A;  4K2X A;  4MPG A;  4O92 A;  1TRS A;  4XHM A;  3ERG A;  4JRR A;  4ML1 A;  3CMI A;  2V2G A;  4O5R A;  5D9V A;  4DEJ A;  1FVK A;  3QFB C;  1JZW A;  4MF7 A;  1HD2 A;  3KMN A;  3GNJ A;  1QFN A;  4WR5 A;  1OVN A;  4WKW A;  4AJ7 A;  3WT2 A;  2CA8 A;  6GST A;  3EMX A;  4IN0 A;  2F51 A;  5IMD A;  4I6X A;  4IP6 A;  4G2E A;  2LJK A;  1YZX A;  5B6M A;  5G1K A;  1YEX A;  4ZL9 A;  2G0F A;  2H6Z A;  1PA3 A;  4TOP A;  2CQ9 A;  4KF9 A;  4LLR A;  2FCH A;  1S3A A;  2R4V A;  1YDK A;  1ABA A;  2I9H A;  2FY6 A;  2DLX A;  4POB A;  1T8E B;  1SYR A;  5G5E A;  4WET A;  4GTU A;  5ID2 A;  1K0A A;  1O8X A;  1PL1 A;  2P0G A;  2DIZ A;  1ZYP A;  3L78 A;  1XWK A;  2F3M A;  5ECR B;  1ZGN A;  2CZ3 A;  4BVY A;  2DMM A;  1GSY A;  2JSY A;  1SKR B;  3FR9 A;  3HKR A;  1FVJ A;  2C3Q A;  2WJU A;  4GSN A;  1WP0 A;  4V1A p;  1FOH A;  2FWF A;  2VLU A;  1SKS B;  3GKK A;  3KEB A;  5IMV A;  2B3S A;  3KMO A;  2HYX A;  5D93 A;  4TR1 A;  3LSZ A;  2DJ0 A;  4NXI A;  3LXZ A;  1W89 A;  1HNB A;  4OCE A;  3C1R A;  3KH7 A;  3W6G A;  2F8A A;  1EOG A;  3UIW A;  3RBT A;  4JED A;  1R4W A;  2HSY A;  2WB9 A;  2XBI A;  1NSW A;  2FLS A;  5HR1 A;  1GTI A;  2PPT A;  3J7Y k;  3M8N A;  3VUR A;  3EE2 A;  3QFA C;  5CO3 A;  1M99 A;  4DSS A;  4BL7 A;  1A8L A;  2PER A;  2OBK A;  4ZIJ A;  3F63 A;  3F8U A;  3HD5 A;  2VLV A;  5DAK B;  1XIY A;  1GTA A;  1O85 A;  3H93 A;  4V1A g;  1MEK A;  4GQC A;  4GQF A;  3WGE A;  19GS A;  3LJR A;  3O6T A;  1RQM A;  4MDC A;  4YAV A;  3D6I A;  1SL0 B;  4ILF A;  1BJX A;  2VM1 A;  4F2I A;  4F0B A;  4HDE A;  1G7E A;  2LUS A;  4TKY A;  5ELG A;  2VOC A;  1Z6M A;  3A5I A;  2WUL A;  2B5X A;  1XXU A;  2VUP A;  4ID0 A;  3TKP A;  3HXS A;  3GRX A;  3KCM A;  1GH2 A;  4AJ6 A;  2AHE A;  4ZBB A;  2PVQ A;  5D9X A;  2BTO T;  3MWH A;  2GZY A;  2FWG A;  5J41 A;  1GUM A;  1GLQ A;  4OCF A;  4MA9 A;  2A2R A;  2L4C A;  4KAE A;  1X0R A;  3QCP A;  4RQR A;  1X5E A;  2IFQ B;  1GSU A;  2MMA A;  1TK0 B;  5DVB A;  7GSS A;  1YJ6 A;  5ECL B;  2JZS A;  4MMM A;  1ZZY A;  4KND A;  1NHY A;  3IDV A;  2A4V A;  1O7U A;  5JCU A;  2X99 A;  4D73 B;  1X5C A;  2C0E A;  3BBY A;  1ERV A;  2H19 A;  2DKH A;  1T7P B;  2H1A A;  4F03 A;  4OFM A;  4K7N A;  3L0H A;  3WD6 A;  4NWY A;  4BA7 A;  4JR6 A;  1FB6 A;  4N11 A;  1UA5 A;  3GST A;  1M2B A;  1TI1 A;  4L8E A;  1M9A A;  3D21 A;  2L57 A;  3EWL A;  3WGD A;  2YCD A;  1K3O A;  2VCZ A;  2FWH A;  3MSZ A;  4YQM A;  1BAY A;  3TKS E;  2V41 A;  3ZZX A;  2YJH A;  5HFG A;  1AQX A;  2CX3 A;  2GVP A;  3FZA A;  4K8M A;  1W4V A;  3FK8 A;  2X4A A;  2XBQ A;  4GRF A;  4ZBD A;  1E2Y A;  3H8Q A;  1GWC A;  4Z7X A;  4ECB A;  1DBY A;  3TKS C;  5JCW A;  1K0B A;  3UL3 A;  2HLS A;  4ZL7 A;  5C04 A;  3LWA A;  1SL2 B;  1V9W A;  3D22 A;  3EMP A;  3KGK A;  1TDI A;  2FA8 A;  1MDJ A;  4HSC X;  4X1U A;  2LTK A;  1UC7 A;  2PWJ A;  2B5Y A;  3KZQ A;  2AAW A;  1B9X C;  2X8H A;  3GX0 A;  4XS6 A;  5KOW A;  5CRW A;  2P5R A;  4EC0 A;  4PX1 A;  5CRG A;  2X8G A;  5ECH B;  2CAQ A;  4LMW A;  3A2V A;  1NW2 A;  2YNX A;  1FAA A;  1EWX A;  4O5Q A;  3F9U A;  4HS1 A;  2FHE A;  2GQM A;  1M3J A;  1THX A;  4KH7 A;  1Z3E A;  3DEX A;  4NV5 A;  1Y25 A;  3TKS A;  1ZOF A;  4G9H A;  2V1M A;  3P7X A;  4FQU A;  1M0U A;  1EP7 A;  4KA0 A;  8GSS A;  1GL8 A;  2TRX A;  3DYR A;  3QDN A;  5ECI B;  2VLT A;  3GA4 A;  3UAP A;  2GZP A;  1ZYQ B;  4OMV A;  2VL2 A;  4HJM A;  3C7M A;  4N30 A;  3EPT A;  4PXO A;  1J9B A;  5ELA A;  3KTL A;  4BWQ A;  5HR3 A;  5IOX A;  4EIP A;  2HRK A;  2TRC P;  4CDO A;  2B7J A;  5ECQ B;  1GSF A;  2L6C A;  2OA7 A;  1YF1 A;  1G7O A;  2GZZ A;  1ZMA A;  4EVM A;  2ON7 A;  3DWV A;  1T4Y A;  3H79 A;  4TXO B;  2RUF A;  13GS A;  1SEN A;  4YAP A;  1RW1 A;  1SJZ A;  3C73 A;  5BMU A;  1Z7R A;  3GSS A;  2HZF A;  3C8E A;  4MJB A;  2R2J A;  3FZ5 A;  1B8X A;  2NBS A;  3EYT A;  4O5U A;  5B7C A;  1A23 A;  1PN9 A;  1GP1 A;  2H30 A;  5GSS A;  1OYJ A;  4ISD A;  2V6K A;  2ZCT A;  3SWL A;  3RHB A;  1BG5 A;  2VAF A;  3V1W A;  2MZC A;  2VCW A;  1WRY A;  2LS5 A;  5ABR A;  1XVW A;  3F3R A;  2KP1 A;  1TRW A;  2WS2 A;  4G10 A;  5J9C A;  3IHG A;  2B6M A;  1CQG A;  1SK1 A;  4JR4 A;  2HZE B;  4MJA A;  4KX4 A;  2J9H A;  4MZB A;  2KUC A;  3W8S A;  2OJL A;  3G7J A;  3IXR A;  2WZ9 A;  4HOJ A;  3TOT A;  4GXZ A;  1MTC A;  5HFI A;  3US3 A;  2DBC A;  3VWW A;  2RM6 A;  4ULX A;  1LJR A;  2P31 A;  3ZTL A;  2HT9 A;  4K7O A;  2J23 A;  4TRX A;  4ZXG A;  3ZIV A;  1WMJ A;  2MMZ A;  1A24 A;  2VCQ A;  2MYG A;  4OO4 A;  4FYC A;  2GLR A;  4KSM A;  1E6B A;  3BCI A;  3UVT A;  1HYU A;  1R7H A;  2C4J A;  3UBL A;  3HVX A;  3FMW A;  1N8J A;  2K8V A;  1QUW A;  4EF0 A;  4XRA A;  1ML6 A;  3ZRD A;  3ZIT A;  4ECC A;  4DVC A;  1TRU A;  4J57 E;  3GN3 A;  5A5K A;  4KE3 A;  3L9U A;  2E2G A;  11GS A;  4NMU A;  4K2D A;  4P3Y B;  4LL4 B;  2C3T A;  1WOU A;  2VCV A;  3VPT A;  5JWQ B;  3HJP A;  4V2L A;  3HZ8 A;  1QMV A;  2CV4 A;  3C1S A;  4GST A;  3HCZ A;  2IWT A;  1PQN A;  3BJ5 A;  1A0R P;  1JZR A;  2H0I A;  2OE0 A;  1GLP A;  3VI7 A;  5H5R A;  2QKE A;  3ZVJ A;  5DCH A;  3GKM A;  5FHI A;  2PU9 C;  4V2N A;  3K8N A;  2IFQ A;  9GSS A;  3L9S A;  4IGJ A;  1DUG A;  5ENU A;  3CQF A;  4X43 A;  4CHS A;  3UMA A;  4OFN A;  2R0G A;  4JU5 A;  1O73 A;  2CVD A;  2HRF A;  3QOU A;  1EZK A;  1G0T A;  2GTU A;  1VF3 A;  2M80 A;  3U6V A;  2C8U A;  4MH2 A;  1XW6 A;  1OE8 A;  1VF4 A;  3VLN A;  4D73 A;  4BVX B;  3CSI A;  1SJI A;  5B8A A;  1XVQ A;  4TN8 A;  2B5E A;  2HI7 A;  4LMV A;  1TOF A;  2PBJ A;  4WBR D;  3EU4 A;  2ON5 A;  18GS A;  1URM A;  3IC4 A;  2H0H A;  3G7Y A;  12GS A;  1G6W A;  4KCE A; 
#chains in the Genus database with same CATH homology
 4KDU A;  5AIV A;  4J56 E;  4GSS A;  5CRE A;  4L0U A;  4K9Z A;  1N2A A;  4BPY A;  3LG6 A;  4HU7 A;  5HR0 A;  3E3E A;  4MF5 A;  1IYI A;  1TU7 A;  1JFU A;  1O8W A;  3ZVJ D;  4CW9 A;  2LRT A;  1EV4 A;  4MPF A;  2C0F A;  2X49 A;  1MD3 A;  3L9V A;  3P90 A;  3LEF A;  2JZT A;  3DKS A;  2L4Q A;  4PUA A;  2ALB A;  4MNN A;  4YQV A;  4TR4 A;  2GSQ A;  2IME A;  4YKG A;  4FIW A;  2YOI A;  1X9S B;  4MJC A;  3F3Q A;  3QR6 A;  2H73 A;  3ZIJ A;  4CY8 A;  5H5Q A;  4MLY A;  4Q5Q A;  5ECN B;  3KP8 A;  1FW1 A;  4GF0 A;  1SK0 A;  3KJY A;  3W8J A;  2YN1 A;  2JL4 A;  5IO0 A;  4G0K A;  3KD0 A;  5G1L A;  3TCO A;  1B4Q A;  1V57 A;  2EIO A;  1F9M A;  4IQ1 A;  4MCU A;  3FY7 A;  1TK8 B;  2QSI A;  3F4R A;  3IK7 A;  3IV4 A;  1F6M C;  2WGR A;  2YZH A;  3GH9 A;  4YH2 A;  1GNE A;  1USB A;  1XCC A;  2GSR A;  1MDK A;  4NPB A;  16GS A;  3GX8 A;  3KH9 A;  1BYE A;  3BD2 A;  1AQW A;  1X9M B;  2HE3 A;  3A2X A;  5IMF A;  2DJ1 A;  3CRU A;  4Z2R A;  5DBQ A;  4USS A;  1JZO A;  2I1U A;  3E9J B;  4EKZ A;  4RQX A;  2GQK A;  2VCT A;  3GMF A;  5JWO B;  2QC7 A;  4HU9 A;  1OKD A;  1SK2 A;  4EUY A;  5DDL A;  3VWV A;  3D4T A;  4G0L A;  5CP1 A;  2K8S A;  4RI7 A;  2GS3 A;  1CQH A;  3FZ9 A;  3VWX A;  1DE1 A;  2AB6 A;  5BRT A;  4POK A;  3IOS A;  3GUR A;  4Z2U A;  2GT5 A;  1JLV A;  3ME8 A;  4MZW A;  4XCS A;  1Q4J A;  3HJM A;  2UZ8 A;  5J3R A;  2JZR A;  1T4Z A;  4PNF A;  5IOW A;  4TXO A;  3IAS 2;  4POL A;  4TXV A;  1U3I A;  5G2Z A;  2C0D A;  3ZFB A;  2KHP A;  3MDK A;  1B4P A;  5G30 A;  3DVW A;  3PIN A;  4BWS A;  1THO A;  1EOH A;  1UN2 A;  3EUR A;  1A2J A;  5F07 A;  1AC1 A;  2O85 A;  2PVO C;  1K0O A;  2MMO A;  1GSD A;  2CVK A;  2YP6 A;  5C00 A;  5DAL B;  2GST A;  1KTE A;  3CXG A;  3GH6 A;  5HQP A;  5AGY A;  2L6D A;  4K0G A;  4PTS A;  5GST A;  1PKZ A;  5CAX A;  1FB0 A;  1YF0 A;  2KP2 A;  4F9Z A;  4PGT A;  1MDI A;  3PR8 A;  2AV4 A;  1S3C A;  2AJQ B;  4IVF A;  1U6T A;  4OD7 A;  4QQ7 A;  2H74 A;  3TRP A;  1YQ1 A;  2JAD A;  5LD0 A;  5B6N A;  4ZIL A;  3UBK A;  2OAD A;  1TU8 A;  3M9J A;  4PQH A;  1M7T A;  4ZB9 A;  4RUV A;  3TJB A;  2O8V B;  2D2Z A;  2HZE A;  3Q18 A;  1T1V A;  1O81 A;  1K0M A;  1I9D A;  3TRQ A;  1GUL A;  2CVB A;  4BL7 B;  2IJY A;  1DSB A;  5D9T A;  2HNL A;  2VL2 C;  4IQA A;  3E0U A;  3HZ4 A;  3QPM A;  3I43 A;  3F0I A;  4EDZ A;  1PL2 A;  1V98 A;  4FYB A;  4XS1 A;  2YWN A;  2HFD A;  5GAP D;  3ZFL A;  4DSQ A;  3RHC A;  2H72 A;  4PUR A;  2K6V A;  4KCA A;  3EVI A;  1K0C A;  1MD4 A;  3ED3 A;  4V2M A;  5E59 A;  2VM2 A;  4TR3 A;  4K5R A;  4OFT A;  4IP1 A;  3CTG A;  1V40 A;  3GTU B;  1QXH A;  3S9F A;  4WF4 A;  5JCG A;  3M3M A;  1SJ6 A;  2PGT A;  2VD0 A;  5G5F A;  5LCZ A;  1ACV A;  5J9B A;  5IMZ A;  2JAC A;  2E0Q A;  3CSH A;  5EL8 A;  3F4T A;  2I4A A;  2NVL A;  2H0G A;  1WPI A;  2IMF A;  5F06 A;  2DKI A;  5GZZ B;  2H1G A;  1NM3 A;  2WFC A;  5LNK e;  3IE3 A;  4POM A;  3M0F A;  3D4M A;  3TB2 A;  3UVH A;  1OC3 A;  4QL9 A;  1VF2 A;  5AIX A;  3DD3 A;  2GGT A;  4MAB A;  1M2A A;  5DJL A;  1KBN A;  5IPG A;  1AIU A;  4G19 A;  1ON4 A;  5KN0 A;  1SYX A;  2LV3 A;  2C0G A;  2C80 A;  5F05 A;  3LXT A;  3FHK A;  5KOX A;  5GAN D;  4FYU A;  5IMA A;  4BVX A;  2M72 A;  3QMX A;  4EXJ A;  2OBI A;  2CAI A;  2AUV A;  1XOB A;  1ZL9 A;  1XWA A;  3LFL A;  3F6F A;  3LYK A;  1EGR A;  5IO2 A;  2R6K A;  3KM6 A;  5ECM B;  3HVS A;  4FH8 A;  4NHW A;  1XPV A;  2N5B A;  4ICY A;  3TRX A;  1TK5 B;  3JCM L;  1LBK A;  5A4W A;  3WT1 A;  4ACS A;  1OAZ A;  2FUG 2;  4GWR A;  4JE1 A;  2YZU A;  3LGC A;  1XWG A;  2N5F A;  4E8H A;  5F0G A;  4I97 A;  4RI6 A;  5CRD A;  5DJM A;  3LW9 A;  3Q19 A;  1Z5Y E;  1A2L A;  1U3A A;  5H5S A;  2V6O A;  1QQ2 A;  1XWB A;  3Q6O A;  3NZN A;  3MYD A;  4CY6 A;  1WWJ A;  5G31 A;  5KN3 A;  2KLX A;  3HHV A;  4KB3 A;  1QGV A;  2AYT A;  4FO5 A;  1S3D A;  1LU4 A;  2ZUP A;  3RPN A;  3UJ1 A;  4K0N A;  1SD8 A;  2DML A;  4I2U A;  2OE1 A;  5FWG A;  1YEP A;  1K3L A;  2PN8 A;  2H6X A;  3D0Z A;  3G7I A;  3FKF A;  2KOK A;  5DAK A;  1A0F A;  1M2D A;  3I6A A;  1ERT A;  2LQO A;  2H66 A;  3HY2 A;  2HSH A;  1PGT A;  2H71 A;  2QA1 A;  4WR4 A;  3KIJ A;  4KDY A;  1GUK A;  3R2Q A;  3HA9 A;  4NV2 A;  2O87 A;  4XTS A;  2YPM A;  2H1D A;  3ERW A;  5CRH A;  3QD9 A;  2MBS A;  4HUA A;  1TJD A;  1PMT A;  4LA1 A;  4TW5 A;  2YWM A;  4MH3 A;  3FEU A;  3CBU A;  3J7Y b;  3VK9 A;  3U5R E;  1AAZ A;  1F37 A;  3FW2 A;  1ST9 A;  4Q5F A;  2RM5 A;  3TGZ A;  4WBJ A;  2LNT A;  1GSQ A;  2LQQ A;  1M9B A;  2Z9S A;  1GUH A;  3OR5 A;  2R0C A;  4XS4 B;  1EV9 A;  3TKR A;  4MZC A;  2CX4 A;  3FZ4 A;  4HQZ A;  5A4U A;  1EP8 A;  1C72 A;  2PUK C;  4QL7 A;  5CNW A;  3F4S A;  3TKQ A;  1GTU A;  3P2A A;  2VD1 A;  3FRC A;  2WDU A;  4TVE A;  2MBT A;  2FA4 A;  2H8L A;  1XZO A;  3QAV A;  1TP9 A;  4HZ2 A;  1GSE A;  1QK8 A;  2H1B A;  2C3N A;  2CT6 A;  1BED A;  3CSJ A;  3IK9 A;  2HRA A;  2BMX A;  4EDY A;  4E8E A;  2VO4 A;  3A5W A;  4XIH A;  3LQ7 A;  4N10 A;  4PUF C;  1WE0 A;  4WXT A;  3LYP A;  1KNG A;  1F3B A;  5D96 A;  1YKA A;  5J4U A;  4AJ8 A;  1K0N A;  2XC2 A;  1JZD A;  1XWC A;  5DAL A;  4X4J A;  2HRN A;  2IL3 A;  4HJ2 A;  5E4W A;  3LOR A;  2VL9 A;  1A8Y A;  4IEL A;  2FD3 A;  5EVO A;  1J0F A;  1AQV A;  2C1Y A;  17GS A;  3WGX A;  4IW9 A;  3N9J A;  1Q98 A;  3CYN A;  3KP9 A;  4AF2 A;  2YV7 A;  2M46 A;  3TJJ A;  4WF5 A;  4I8B A;  2JU5 A;  1B48 A;  2OAC A;  4A5P A;  2HXK A;  2PMT A;  2P5Q A;  1OC9 B;  4N0V A;  1HNC A;  1SD9 A;  3GYK A;  3MNG A;  4ECI A;  4Z2T A;  3C71 A;  2I81 A;  2RLI A;  5J5N A;  1SKW B;  2DJ3 A;  1R5P A;  3RPP A;  3GIX A;  4NHZ A;  4ECJ A;  5ECK B;  3SBC A;  2R0P A;  4OO5 A;  2DC5 A;  2EIQ A;  2O89 A;  4G0I A;  3A2W A;  3IPZ A;  3TJF A;  2G2Q A;  5COH A;  2CZ2 A;  3H1N A;  1ERU A;  1DE2 A;  1WIK A;  1PN0 A;  3DGQ A;  6GSX A;  3VWU A;  3BOA A;  1ZYE A;  3GL5 A;  3ZL5 A;  2O7K A;  3KXO A;  14GS A;  4JZQ A;  4IBP A;  2GQL A;  3ZMK A;  1RK4 A;  2YAN A;  3P8W A;  2YJ7 A;  1UVZ A;  1T00 A;  1NHO A;  4PQI A;  3IA1 A;  2EIR A;  4PQ1 A;  2LRN A;  4EIQ A;  3M9K A;  3TOU A;  3H4K A;  3WYW A;  4IJ3 A;  10GS A;  2IMD A;  3GKN A;  3IBH A;  4WEY A;  2LRC A;  2XPD A;  1Z9H A;  4MP4 A;  3GTU A;  3GL3 A;  1TKD B;  1B9Y C;  5L71 A;  3UAR A;  1TW9 A;  3APS A;  1VGL A;  4KW6 A;  3IR4 A;  1FG4 A;  4L0W A;  1X9W B;  1XW9 A;  4LL1 B;  5IQY A;  2H75 A;  1U88 A;  3HYP A;  2H01 A;  4KSO A;  2BJX A;  1U87 A;  3UOM A;  4ZBA A;  1YKC A;  2H70 A;  2QGV A;  3G9B A;  3KTB A;  4ZB6 A;  4O7H A;  4KDX A;  5JWR B;  2K18 A;  4N0Z A;  4YKF A;  1BQ7 A;  5D8I A;  4ML6 A;  5ID2 B;  3FR3 A;  1FOV A;  1WJK A;  2B1K A;  1JHB A;  2NDO A;  6GSS A;  1ILO A;  3RAZ A;  5FT3 A;  1HNA A;  3IRA A;  5DQY A;  2E2M A;  1F3A A;  4BVY B;  4KUN A;  4IHU A;  1VRS D;  2REM A;  2DJK A;  3I9V 2;  3DRN A;  3F6D A;  2GSS A;  4H86 A;  2QA2 A;  4YQU A;  4TR0 A;  2JSZ A;  4HEA 2;  3DVX A;  3GKX A;  1OC8 A;  2L5O A;  4K6X A;  3TUE A;  2RUE A;  4L5O A;  5D73 A;  4TR1 B;  3DML A;  4KGI A;  3HVV A;  5EY6 A;  3VI5 A;  1PD2 1;  1TXX A;  1K3Y A;  1Z7P A;  3FR6 A;  3IHQ A;  5INY A;  3APO A;  4EO3 A;  1OE7 A;  2R37 A;  3ZYW A;  2B1L A;  3PH9 A;  4HZ4 A;  5KEJ A;  2EC4 A;  1IYH A;  2YWI A;  2FGX A;  3ME7 A;  4X0X A;  1G6Y A;  1SL1 B;  3Q74 A;  1EEJ A;  1YY7 A;  3EIN A;  5B8B A;  2I3Y A;  4OWY A;  4DSS B;  4GLT A;  2GDR A;  4K5S A;  5KN2 A;  1OKT A;  5DCG A;  2X64 A;  1Y6E A;  1T3B A;  3O3T A;  3I69 A;  3IAM 2;  4I2T A;  4XRD A;  3EU3 A;  5ECS A;  1R5A A;  4IS0 A;  2VIM A;  2A2P A;  2HSM A;  3RDW A;  4IJI A;  2N5A A;  2MMN A;  2R3X A;  5IPH A;  1VF1 A;  2OKA A;  4Q5N A;  1V2A A;  1AXD A;  1XOA A;  2RII A;  1FO5 A;  1EEM A;  5HR2 A;  2DJ2 A;  6GSY A;  2XHF A;  1TI3 A;  2B7K A;  4K1F A;  2F8F A;  1ERW A;  1GSS A;  2YV9 A;  1XBS A;  4JBB A;  4AGS A;  1GTB A;  1GRX A;  2TIR A;  1H75 A;  3GHA A;  3NIV A;  3GUS A;  2L59 A;  1PKW A;  2NTO A;  3CTF A;  1AUC A;  6GSV A;  3PGT A;  2DIY A;  1XW5 A;  6GSW A;  4EL1 A;  4MK3 A;  2A2S A;  2R5G A;  1I5G A;  3O76 A;  2LJR A;  5ECP B;  1Z6N A;  22GS A;  5A4V A;  3L4N A;  3DXB A;  4I5Q A;  3MIX A;  4XS4 A;  1FHE A;  4J2F A;  1HQO A;  2IIY A;  4DSR A;  3QAW A;  4Q5R A;  3M1G A;  20GS A;  1PSQ A;  4MF6 A;  2F9S A;  3MAK A;  2GT6 A;  2OE3 A;  2LKU A;  1A2M A;  2LEG A;  3A3T A;  2VL3 A;  1KEB A;  1PRX A;  3PPU A;  2V32 A;  4IKH A;  2DSA A;  3ISO A;  5AN1 A;  2WRT A;  1ZYN A;  1PX6 A;  2A4H A;  3TJK A;  3GV1 A;  4MJE A;  2XPE A;  1GNW A;  2LNS A;  4PNG A;  1JLW A;  4NAX A;  2IPA A;  5DQS A;  4K7I A;  1BX9 A;  2ES7 A;  4L5L A;  5IMC A;  3ZLP A;  5IIZ A;  2E7P A;  4F82 A;  4HQS A;  3ERF A;  3BCK A;  2IN3 A;  3ZML A;  2YWO A;  4F0C A;  3DIE A;  1X5D A;  1ZCP A;  5HFK A;  3NOF A;  5F8B A;  2K9F A;  3APQ A;  3TJG A;  6GSU A;  1OC9 A;  5EPF A;  3VPQ A;  1J08 A;  3UEM A;  4GCI A;  1SU9 A;  2IMI A;  2H76 A;  2X8C A;  3EC3 A;  3HDC A;  2NPB A;  1TRV A;  2ZNM A;  4ZB8 A;  1EGO A;  1AW9 A;  2LST A;  5IM9 A;  5KN1 A;  1V58 A;  3ZRE A;  3GFK A;  1H4O A;  3R3E A;  2LJA A;  3AY8 A;  3HJO A;  3CRT A;  1R26 A;  4HI7 A;  2VCX A;  3IC8 A;  2DJJ A;  1XFL A;  2H6Y A;  3VFI A;  2L5L A;  3QAG A;  2WCI A;  4EE0 A;  3N5O A;  1K0D A;  4O32 A;  3FYG A;  4ZL8 A;  5CYY A;  5D9W A;  5ECO B;  1PX7 A;  2FNO A;  1TTZ A;  2FWE A;  1F2E A;  1O6J A;  3TDG A;  5AIS A;  3D5J A;  2IMK A;  4K2X A;  4MPG A;  4O92 A;  1TRS A;  4XHM A;  3ERG A;  4JRR A;  4ML1 A;  3CMI A;  2V2G A;  4O5R A;  5D9V A;  4DEJ A;  1FVK A;  3QFB C;  1JZW A;  4MF7 A;  1HD2 A;  3KMN A;  3GNJ A;  1QFN A;  4WR5 A;  1OVN A;  4WKW A;  4AJ7 A;  3WT2 A;  2CA8 A;  6GST A;  3EMX A;  4IN0 A;  2F51 A;  5IMD A;  4I6X A;  4IP6 A;  4G2E A;  2LJK A;  1YZX A;  5B6M A;  5G1K A;  1YEX A;  4ZL9 A;  2G0F A;  2H6Z A;  1PA3 A;  4TOP A;  2CQ9 A;  4KF9 A;  4LLR A;  2FCH A;  1S3A A;  2R4V A;  1YDK A;  1ABA A;  2I9H A;  2FY6 A;  2DLX A;  4POB A;  1T8E B;  1SYR A;  5G5E A;  4WET A;  4GTU A;  5ID2 A;  1K0A A;  1O8X A;  1PL1 A;  2P0G A;  2DIZ A;  1ZYP A;  3L78 A;  1XWK A;  2F3M A;  5ECR B;  1ZGN A;  2CZ3 A;  4BVY A;  2DMM A;  1GSY A;  2JSY A;  1SKR B;  3FR9 A;  3HKR A;  1FVJ A;  2C3Q A;  2WJU A;  4GSN A;  1WP0 A;  4V1A p;  1FOH A;  2FWF A;  2VLU A;  1SKS B;  3GKK A;  3KEB A;  5IMV A;  2B3S A;  3KMO A;  2HYX A;  5D93 A;  4TR1 A;  3LSZ A;  2DJ0 A;  4NXI A;  3LXZ A;  1W89 A;  1HNB A;  4OCE A;  3C1R A;  3KH7 A;  3W6G A;  2F8A A;  1EOG A;  3UIW A;  3RBT A;  4JED A;  1R4W A;  2HSY A;  2WB9 A;  2XBI A;  1NSW A;  2FLS A;  5HR1 A;  1GTI A;  2PPT A;  3J7Y k;  3M8N A;  3VUR A;  3EE2 A;  3QFA C;  5CO3 A;  1M99 A;  4DSS A;  4BL7 A;  1A8L A;  2PER A;  2OBK A;  4ZIJ A;  3F63 A;  3F8U A;  3HD5 A;  2VLV A;  5DAK B;  1XIY A;  1GTA A;  1O85 A;  3H93 A;  4V1A g;  1MEK A;  4GQC A;  4GQF A;  3WGE A;  19GS A;  3LJR A;  3O6T A;  1RQM A;  4MDC A;  4YAV A;  3D6I A;  1SL0 B;  4ILF A;  1BJX A;  2VM1 A;  4F2I A;  4F0B A;  4HDE A;  1G7E A;  2LUS A;  4TKY A;  5ELG A;  2VOC A;  1Z6M A;  3A5I A;  2WUL A;  2B5X A;  1XXU A;  2VUP A;  4ID0 A;  3TKP A;  3HXS A;  3GRX A;  3KCM A;  1GH2 A;  4AJ6 A;  2AHE A;  4ZBB A;  2PVQ A;  5D9X A;  2BTO T;  3MWH A;  2GZY A;  2FWG A;  5J41 A;  1GUM A;  1GLQ A;  4OCF A;  4MA9 A;  2A2R A;  2L4C A;  4KAE A;  1X0R A;  3QCP A;  4RQR A;  1X5E A;  2IFQ B;  1GSU A;  2MMA A;  1TK0 B;  5DVB A;  7GSS A;  1YJ6 A;  5ECL B;  2JZS A;  4MMM A;  1ZZY A;  4KND A;  1NHY A;  3IDV A;  2A4V A;  1O7U A;  5JCU A;  2X99 A;  4D73 B;  1X5C A;  2C0E A;  3BBY A;  1ERV A;  2H19 A;  2DKH A;  1T7P B;  2H1A A;  4F03 A;  4OFM A;  4K7N A;  3L0H A;  3WD6 A;  4NWY A;  4BA7 A;  4JR6 A;  1FB6 A;  4N11 A;  1UA5 A;  3GST A;  1M2B A;  1TI1 A;  4L8E A;  1M9A A;  3D21 A;  2L57 A;  3EWL A;  3WGD A;  2YCD A;  1K3O A;  2VCZ A;  2FWH A;  3MSZ A;  4YQM A;  1BAY A;  3TKS E;  2V41 A;  3ZZX A;  2YJH A;  5HFG A;  1AQX A;  2CX3 A;  2GVP A;  3FZA A;  4K8M A;  1W4V A;  3FK8 A;  2X4A A;  2XBQ A;  4GRF A;  4ZBD A;  1E2Y A;  3H8Q A;  1GWC A;  4Z7X A;  4ECB A;  1DBY A;  3TKS C;  5JCW A;  1K0B A;  3UL3 A;  2HLS A;  4ZL7 A;  5C04 A;  3LWA A;  1SL2 B;  1V9W A;  3D22 A;  3EMP A;  3KGK A;  1TDI A;  2FA8 A;  1MDJ A;  4X1U A;  2LTK A;  1UC7 A;  2PWJ A;  2B5Y A;  3KZQ A;  2AAW A;  1B9X C;  2X8H A;  3GX0 A;  4XS6 A;  5KOW A;  5CRW A;  2P5R A;  4EC0 A;  4PX1 A;  5CRG A;  2X8G A;  5ECH B;  2CAQ A;  4LMW A;  3A2V A;  1NW2 A;  2YNX A;  1FAA A;  1EWX A;  4O5Q A;  3F9U A;  4HS1 A;  2FHE A;  2GQM A;  1THX A;  4KH7 A;  1Z3E A;  3DEX A;  4NV5 A;  1Y25 A;  3TKS A;  1ZOF A;  4G9H A;  2V1M A;  3P7X A;  4FQU A;  1M0U A;  1EP7 A;  4KA0 A;  8GSS A;  1GL8 A;  2TRX A;  3DYR A;  3QDN A;  5ECI B;  2VLT A;  3GA4 A;  3UAP A;  2GZP A;  1ZYQ B;  4OMV A;  2VL2 A;  4HJM A;  3C7M A;  4N30 A;  3EPT A;  4PXO A;  1J9B A;  5ELA A;  3KTL A;  4BWQ A;  5HR3 A;  5IOX A;  4EIP A;  2HRK A;  2TRC P;  4CDO A;  2B7J A;  5ECQ B;  1GSF A;  2L6C A;  2OA7 A;  1YF1 A;  1G7O A;  2GZZ A;  1ZMA A;  4EVM A;  2ON7 A;  3DWV A;  1T4Y A;  3H79 A;  4TXO B;  2RUF A;  13GS A;  1SEN A;  4YAP A;  1RW1 A;  1SJZ A;  3C73 A;  5BMU A;  1Z7R A;  3GSS A;  2HZF A;  3C8E A;  4MJB A;  2R2J A;  3FZ5 A;  1B8X A;  2NBS A;  3EYT A;  4O5U A;  5B7C A;  1A23 A;  1PN9 A;  1GP1 A;  2H30 A;  5GSS A;  1OYJ A;  4ISD A;  2V6K A;  2ZCT A;  3SWL A;  3RHB A;  1BG5 A;  2VAF A;  3V1W A;  2MZC A;  2VCW A;  1WRY A;  2LS5 A;  5ABR A;  1XVW A;  3F3R A;  2KP1 A;  1TRW A;  2WS2 A;  4G10 A;  5J9C A;  3IHG A;  2B6M A;  1CQG A;  1SK1 A;  4JR4 A;  2HZE B;  4MJA A;  4KX4 A;  2J9H A;  4MZB A;  2KUC A;  3W8S A;  2OJL A;  3G7J A;  3IXR A;  2WZ9 A;  4HOJ A;  3TOT A;  4GXZ A;  1MTC A;  5HFI A;  3US3 A;  2DBC A;  3VWW A;  2RM6 A;  4ULX A;  1LJR A;  2P31 A;  3ZTL A;  2HT9 A;  4K7O A;  2J23 A;  4TRX A;  4ZXG A;  3ZIV A;  1WMJ A;  2MMZ A;  1A24 A;  2VCQ A;  2MYG A;  4OO4 A;  4FYC A;  2GLR A;  4KSM A;  1E6B A;  3BCI A;  3UVT A;  1HYU A;  1R7H A;  2C4J A;  3UBL A;  3HVX A;  3FMW A;  1N8J A;  2K8V A;  1QUW A;  4EF0 A;  4XRA A;  1ML6 A;  3ZRD A;  3ZIT A;  4ECC A;  4DVC A;  1TRU A;  4J57 E;  3GN3 A;  5A5K A;  4KE3 A;  3L9U A;  2E2G A;  11GS A;  4NMU A;  4K2D A;  4P3Y B;  4LL4 B;  2C3T A;  1WOU A;  2VCV A;  3VPT A;  5JWQ B;  3HJP A;  4V2L A;  3HZ8 A;  1QMV A;  2CV4 A;  3C1S A;  4GST A;  3HCZ A;  2IWT A;  1PQN A;  3BJ5 A;  1A0R P;  1JZR A;  2H0I A;  2OE0 A;  1GLP A;  3VI7 A;  5H5R A;  2QKE A;  3ZVJ A;  5DCH A;  3GKM A;  5FHI A;  2PU9 C;  4V2N A;  3K8N A;  2IFQ A;  9GSS A;  3L9S A;  4IGJ A;  1DUG A;  5ENU A;  4X43 A;  4CHS A;  3UMA A;  4OFN A;  2R0G A;  4JU5 A;  1O73 A;  2CVD A;  2HRF A;  3QOU A;  1EZK A;  1G0T A;  2GTU A;  1VF3 A;  2M80 A;  3U6V A;  2C8U A;  4MH2 A;  1XW6 A;  1OE8 A;  1VF4 A;  3VLN A;  4D73 A;  4BVX B;  3CSI A;  1SJI A;  5B8A A;  1XVQ A;  4TN8 A;  2B5E A;  2HI7 A;  4LMV A;  1TOF A;  2PBJ A;  4WBR D;  3EU4 A;  2ON5 A;  18GS A;  1URM A;  3IC4 A;  2H0H A;  3G7Y A;  12GS A;  1G6W A;  4KCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...