3MIXA

Crystal structure of the cytosolic domain of b. subtilis flha
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
359
structure length
313
Chain Sequence
EILEEEAEVDELKSPESVVQLLHIDPIEFEFGYGLIPLADANQGGDLLDRIVMIRRQLALELGLVIPVVRIRDNIALQPNEYRLKIKGNEVAKGELLLDHYLATVVDPASVVSTHITEKIKQHAHELIGRQETKQLIDHLKESYPVLVEEVTPNPLSVGDIQKVLAKLLKEKVSIRNLVTIFETLADYGKLTTDSDLLTEYTRQALAKQITAQFAKENEVLKVVTCSGRVEKAIADGVQYLSLEPDISESIVRSVAKEAEQLSLRQETAILLCSPPVRMYVKQLLERYFPDLPVLSYNELEANVEVQSIGVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Flagellar biosynthesis protein flhA
publication title FlhA provides the adaptor for coordinated delivery of late flagella building blocks to the type III secretion system.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 93
structure length 313
sequence length 359
ec nomenclature
pdb deposition date 2010-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.60 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3mixA01
4A5PA 3A5IA 3LW9A 2X4AA 2X49A 3MYDA 3MIXA
chains in the Genus database with same CATH superfamily
2YZUA 4EKZA 1XVQA 3IHGA 5IQYA 3UVHA 2GDRA 2R6KA 2WCIA 3GHAA 1Z6MA 4OO5A 1A24A 4YQUA 3C8EA 4MJAA 2IIYA 1GUKA 4Z7XA 2H19A 3VPTA 3N9JA 3TJKA 2IMFA 13GSA 1O81A 4MJBA 3ED3A 1SK1A 2LS5A 1HD2A 5CRWA 2O85A 4EDZA 4TW5A 3TRQA 1WIKA 2RLIA 1TI3A 2IN3A 1UA5A 3Q19A 4YQVA 1BAYA 3CXGA 3SWLA 3KJYA 4ML6A 4LMWA 1PRXA 2AB6A 1PKZA 3HY2A 1THOA 1OC8A 2JACA 2YPMA 4KX4A 3EVIA 2QC7A 4K0NA 4JZQA 2GQKA 2VD0A 3LSZA 1LBKA 2KOKA 4JR6A 4POLA 3TCOA 2V6KA 1TRVA 4RI7A 3DD3A 4ZXGA 4I2UA 1W4VA 1TK0B 1B9YC 1GLQA 4EO3A 4HI7A 5IPGA 4I5QA 4L8EA 3UMAA 2B1KA 1G6YA 4POBA 1XWCA 1SD9A 3P8WA 1K0CA 1G0TA 1FAAA 2N5BA 2X8CA 4KE3A 3FZ4A 4HDEA 2A2PA 2FWGA 2YANA 3MDKA 3EU4A 5IOWA 2B3SA 2N5FA 2X8GA 4KCEA 5B6NA 2PN8A 2GSTA 3F8UA 16GSA 2C4JA 1T00A 4H86A 3GTUB 3LW9A 4IQAA 1K0NA 3E3EA 1KBNA 5JCUA 2H66A 2NVLA 3LYKA 2HLSA 4L5OA 1Z6NA 1W89A 1ZYQB 2H0IA 4PUAA 6GSYA 4HZ2A 5J41A 4KDUA 4TXOB 5DQYA 4K1FA 4BA7A 3QCPA 1MTCA 1R5PA 2X64A 4F0CA 2GZYA 1VRSD 3QMXA 1ZYPA 3LQ7A 1XIYA 2O87A 5G1KA 3VI7A 3CRUA 3KMOA 1MD4A 3CSHA 3IBHA 4YQMA 2QA2A 2CX4A 2C0FA 3LORA 1R7HA 2HXKA 2G0FA 5CO3A 2VLTA 1DE2A 2VL2C 1WJKA 4KW6A 3FZ9A 4KUNA 1MD3A 2FD3A 3HVVA 3D4TA 2H1DA 4HQSA 3ZTLA 4BPYA 1AQVA 1YF0A 4USSA 5J5NA 4RQXA 3F6FA 2PMTA 4EIQA 2AJQB 2DSAA 2E2MA 2HRAA 3D21A 2DIZA 5DVBA 11GSA 4GSTA 2GGTA 1K3LA 4N0VA 1R4WA 2HZEB 2FNOA 4F03A 3UEMA 4FH8A 3D4MA 2F9SA 3H79A 5ECOB 3US3A 4J2FA 1FOVA 5B8BA 3P7XA 1GP1A 1FG4A 4BVXA 4MPGA 2H1BA 4WBRD 1EEJA 2MMAA 7GSSA 1VF3A 1BJXA 1WPIA 3WT1A 2I1UA 2LNSA 4QL7A 3HZ4A 1A8LA 4V2MA 4NWYA 4GTUA 3M9JA 2IWTA 2A4HA 1T3BA 2QSIA 4K2XA 5D96A 5F05A 3A2VA 4XHMA 2GZPA 4Q5RA 4EE0A 3HD5A 3EC3A 3OR5A 1F37A 1JZDA 3KMNA 3F3QA 2MMNA 1M9BA 3A3TA 4ZBAA 4LL4B 2LSTA 4FYBA 4XS4B 1GWCA 1ACVA 2RIIA 3CTFA 1IYIA 5D9VA 1DSBA 2HRNA 4CDOA 1UN2A 5D9XA 3BOAA 3IDVA 2H30A 3LG6A 3L0HA 4DSQA 4NXIA 3EE2A 5KOXA 3AY8A 4BVYA 1ZOFA 1T8EB 5AGYA 2CVDA 4HJMA 5LD0A 3TGZA 2JSZA 4D73A 2B6MA 4K6XA 3APSA 1TOFA 1FOHA 3MIXA 2K6VA 1K3YA 6GSXA 2R5GA 1XPVA 1S3AA 5BMUA 3CBUA 2OE0A 2LJKA 3IPZA 4GLTA 5ECPB 3M8NA 1GSUA 1YZXA 1NSWA 1AXDA 2RM6A 2REMA 4FYUA 3PINA 2WJUA 5DAKA 2FA4A 4YAPA 1PSQA 1R26A 3TRPA 3UARA 4ECIA 5ECQB 1RW1A 3CYNA 3L78A 1OE7A 1DBYA 1XG8A 3MSZA 4E8EA 4GSNA 3HDCA 5A5KA 3EYTA 4DEJA 4HU9A 2B7JA 2WZ9A 3TJBA 2R0GA 3BBYA 3W8SA 3KP9A 1IYHA 4TVEA 2GT5A 3F0IA 2GVPA 3KM6A 4ECJA 2XHFA 14GSA 1TRSA 4IVFA 1YDKA 1C72A 3N5OA 4P3YB 5DCHA 2H75A 1TK8B 5JWQB 3GMFA 2CZ2A 4ID0A 5HR3A 3ZMKA 4DSSB 4IW9A 1SK0A 4X1UA 2L57A 1ZCPA 4QL9A 4PX1A 4XS1A 2JADA 4V1Ap 3C73A 1WWJA 1FVKA 5HFIA 1EP8A 4PQHA 2AYTA 2LRNA 2OJLA 4IP1A 1XW5A 1U87A 3KZQA 3BD2A 1GTAA 2FWEA 3MWHA 5HQPA 2J23A 1FVJA 4WXTA 3WYWA 4L5LA 2LEGA 1XW9A 1XWKA 3QPMA 3ME7A 4KSOA 1JFUA 3QFAC 3IXRA 4Z2TA 4KSMA 5H5RA 1OAZA 1X5EA 2Z9SA 3A5IA 3DMLA 4OCFA 5GAND 2IMDA 2P31A 3IHQA 1CQGA 4I97A 2L5LA 1QUWA 1O6JA 5F0GA 4ZBBA 4MNNA 2ZCTA 3HVNA 2LRCA 2YN1A 1PL1A 2HZEA 1G7OA 5DJMA 2BTOT 3IAM2 3D5JA 2VOCA 1OE8A 5LCZA 4O92A 1J08A 3G7YA 4MP4A 3NIVA 1M99A 5C00A 3ZRDA 1QQ2A 1TTZA 4I8BA 2PVOC 4PUFC 2H1AA 3DVXA 2AAWA 4ACSA 3E9JB 4XRAA 3TKSA 5JCGA 1KNGA 5DDLA 1B4QA 4YKFA 4OFNA 2PUKC 1A2JA 1B9XC 1Y6EA 3A2XA 1OC9A 2TIRA 1YF1A 1TRWA 2F8AA 2DJ0A 20GSA 4MH3A 2XPDA 5HR1A 2VL3A 3QAVA 1WMJA 2FUG2 1HNCA 4RUVA 2J9HA 1TP9A 1QXHA 5IMZA 1U3AA 2JL4A 4BVXB 5ENUA 3IOSA 2DIYA 4Z2RA 4XS6A 4OO4A 2KLXA 4HJ2A 1Z7PA 2I9HA 3PPUA 4L0WA 1SU9A 1GTBA 2A4VA 1PN9A 2IMKA 2TRXA 3FRCA 4TOPA 3ZL5A 4G10A 3HYPA 5EVOA 1GLPA 4N10A 1MEKA 4NPBA 2HT9A 4I6XA 4PURA 2C0DA 3RPNA 3WD6A 2HE3A 2DMLA 1BX9A 2R0CA 1EEMA 3EWLA 1YEPA 4JE1A 1M2DA 3D6IA 2B7KA 4AJ6A 3VFIA 3C71A 2O89A 4AGSA 3PH9A 2CZ3A 2AUVA 4KA0A 2OBKA 3ZZXA 2FA8A 3GV1A 5IMVA 17GSA 4BVYB 4ECBA 1Z3EA 4POMA 4D73B 3VLNA 1OKDA 4G19A 3ZIJA 4MZBA 3TUEA 1AQXA 2KP2A 3TKQA 5KN3A 4GRFA 3IV4A 3GX8A 5H5QA 3RDWA 4IKHA 2X8HA 3LXZA 5FT3A 2LUSA 1SL1B 5DAKB 2HSHA 4EF0A 2DKHA 3VWVA 1ERWA 1BEDA 5J9CA 1QGVA 1QFNA 4F9ZA 1O8XA 3GRXA 4KNDA 5HFGA 2VCZA 1S3RA 4WEYA 1WRYA 5J9BA 2GSSA 5G30A 5AIXA 3ERFA 2VIMA 4JEDA 2L4CA 2MYGA 4N11A 2I3YA 3H93A 2H6YA 3BCKA 4JR4A 4DSSA 6GSWA 2I81A 19GSA 4K2DA 2IMIA 1JLVA 4J57E 2LRTA 3ZFBA 4F0BA 5G31A 1GSQA 3FYGA 2L5OA 3TKSC 4ECCA 1O73A 3VPQA 4L0UA 4V2LA 2O8VB 1OC3A 4ULXA 2MZCA 3H4KA 4YH2A 4IN0A 1V57A 5AN1A 2XC2A 3F9UA 3RBTA 2ZNMA 2G2QA 4O32A 5B8AA 2V32A 1JHBA 3QD9A 2L4QA 1T4ZA 1BYEA 1K0MA 3ZYWA 3FY7A 3UJ1A 2LTKA 1YY7A 1B4PA 3DWVA 5HFKA 1SENA 2E2GA 4TN8A 3P2AA 3S9FA 2LJRA 3CMIA 2DMMA 1EOGA 1V2AA 5E59A 3TJJA 2CV4A 5DALA 2H70A 2WDUA 3HHVA 1FHEA 3F6DA 4MCUA 4GQFA 1WP0A 2VUPA 5ECHB 1EOHA 1GUHA 2H0GA 3FR3A 1QMVA 4BIKA 4ISDA 3G7IA 4GSSA 3QR6A 1JZWA 2CT6A 5D73A 4JBBA 3RHBA 2DJ2A 2HNLA 2A2SA 3HVXA 3CSIA 2FGXA 2M46A 1XW6A 2YJ7A 1Q98A 5CNWA 2QA1A 4LLRA 2C0GA 2OE3A 2DJKA 1J9BA 5IIZA 4AJ7A 4GWRA 1SD8A 2R3XA 3TDGA 4FIWA 1GH2A 3IC8A 5CRGA 3GSTA 3FW2A 4N0ZA 4O5UA 3C1RA 5KN1A 1EP7A 1ZYNA 1USBA 2PGTA 3I9V2 3WGXA 2JU5A 1OC9B 2L6CA 2K8SA 5ECRB 1ZYEA 5J3RA 5DBQA 1YEXA 3FR6A 2YJHA 1I5GA 5DCGA 4IELA 3FHKA 3GX0A 1DUGA 5IMCA 2C0EA 5CAXA 1Y25A 2MMOA 4PNGA 3HJOA 5A4VA 18GSA 3MYDA 4HUAA 3A2WA 2OACA 3EMXA 2IL3A 2VD1A 2JZTA 1A8YA 2GQLA 4MZWA 3KD0A 4YKGA 1A23A 5KN0A 4GXZA 1CQHA 2YOIA 3Q18A 1LU4A 2VCVA 1TK5B 2X4AA 1M9AA 2YV9A 4MK3A 3Q74A 3LWAA 3L9VA 1XOBA 1ABAA 5CREA 4MJEA 4ZL8A 1ML6A 1U6TA 1MDKA 1KTEA 2LQQA 6GSSA 5GSSA 2IJYA 2B5YA 1TU7A 3ZVJA 1F9MA 1JLWA 1F3AA 3M9KA 1TXXA 3O3TA 3P90A 2VLUA 12GSA 5KOWA 5D93A 4MDCA 2NBSA 1H75A 4G0LA 4O7HA 1X9SB 2DJJA 3QFBC 3HJMA 1HYUA 4N30A 4X43A 4BL7B 2WS2A 1EZKA 1NW2A 2ES7A 5HR0A 1V98A 2B5XA 5FWGA 1Z9HA 2YWOA 3IE3A 3GA4A 1SKSB 2C3NA 4POKA 2E0QA 4KF9A 5LNKe 1B48A 3U6VA 2LQOA 4NMUA 2YWNA 2NTOA 2HRKA 2A2RA 5D8IA 4F82A 3QOUA 4KCAA 4JRRA 3FZ5A 3FKFA 2VCTA 1F3BA 4EC0A 1TU8A 3KH9A 1AC1A 4Q5NA 2ZUPA 1K0BA 2JZSA 2EIOA 2P5RA 3ZFLA 3F4TA 4TR1A 5EL8A 1LJRA 5IMFA 1PKWA 1F2EA 5KEJA 6GSUA 4OCEA 4IP6A 1XWGA 4ML1A 3DYRA 1G6WA 1PL2A 1AW9A 2IFQB 4ZILA 3UIWA 4F2IA 4CHSA 1Z5YE 1O7UA 3GUSA 4X0XA 4EDYA 3LYPA 2V1MA 1GL8A 2BJXA 2OA7A 4NHZA 3KH7A 3FK8A 5INYA 3KXOA 1XWAA 1FB6A 3E0UA 4KH7A 4HU7A 2VCWA 2RUFA 5DALB 2C80A 2V41A 3BCIA 3EMPA 2FWFA 22GSA 5CRDA 2HSMA 1X9WB 3DEXA 4OD7A 1V58A 3M0FA 4EUYA 2GS3A 3PR8A 1RQMA 3UOMA 3KIJA 4EVMA 1X9MB 2H1GA 1E6BA 5ECSA 1S3CA 4OFTA 1PD21 1TDIA 2XPEA 2YNXA 4MMMA 3GNJA 4WBJA 1X0RA 3I43A 3CTGA 3H1NA 1PMTA 1GRXA 2UZ8A 2C3TA 1VF4A 1ERTA 2C3QA 2DBCA 5ECIB 2EIQA 2R4VA 4I2TA 4BWSA 1A2MA 4ILFA 5ECKB 9GSSA 3FR9A 5FHIA 1GUMA 1FB0A 2TRCP 2QKEA 3IC4A 3VI5A 5ECNB 1VF1A 2L6DA 2NDOA 1URMA 5F06A 3TRXA 2YV7A 4K9ZA 1ZL9A 4XRDA 4G0IA 3ISOA 1M3IA 1SJ6A 2KUCA 3WGEA 2CVKA 2WB9A 2OBIA 3J7Yk 5GSTA 1A0FA 4ZB6A 3WGDA 4WF4A 2GSRA 3DKSA 3NOFA 2VL2A 1XFLA 4TXVA 1R5AA 2AV4A 3IK7A 3QDNA 5IM9A 2H01A 3GYKA 2PVQA 1YKAA 1PX7A 4KAEA 2QGVA 1JZRA 3TJFA 5A4WA 1NHOA 2CAQA 1XZOA 3FZAA 2EC4A 3EPTA 3EURA 1TW9A 1B8XA 4K5SA 4GF0A 1PN0A 3L9UA 4G0KA 2WFCA 2PU9C 4K7NA 4BL7A 4MLYA 3PGTA 4DVCA 4ZL7A 1XVWA 5B6MA 5CYYA 2R37A 4YAVA 3IR4A 4WR5A 1GTUA 1K0OA 3GIXA 4O5RA 4WF5A 2YP6A 2F8FA 5DJLA 1HNAA 5AIVA 2H72A 3KTBA 4V1Ag 4V2NA 1TRUA 2K9FA 2FHEA 2M72A 2MBSA 4HOJA 2OADA 2KP1A 4J56E 3APQA 3F63A 2OE1A 2PWJA 5AISA 3SBCA 3IA1A 3W6GA 2DC5A 3DIEA 2YWMA 2K8VA 4Z2UA 5ABRA 4MJCA 3C7MA 3QAGA 5G5FA 3ZIVA 5J4UA 2E7PA 1QK8A 2LKUA 1SKRB 4LA1A 5JWOB 1X5DA 2M80A 1ST9A 1ERUA 2YCDA 5ID2A 5G5EA 1MDIA 1BQ7A 4RI6A 3G9BA 1EGRA 1GSSA 1ZZYA 2X99A 3L4NA 3ZVJD 3GKNA 4MF5A 1K0DA 4Q5FA 4AF2A 3TB2A 3TOUA 4HEA2 1ILOA 3O6TA 2B1LA 3LEFA 1PGTA 5GAPD 3GH9A 2VCXA 4HZ4A 4K7IA 2RUEA 1GTIA 1HNBA 2IFQA 2VAFA 2GQMA 1T4YA 1PFOA 4TR1B 5ELGA 3F4SA 4HSCX 2H0HA 3ZITA 1T7PB 3I6AA 4RQRA 4BWQA 3VURA 3HVSA 4EIPA 2B5EA 3L9SA 4WR4A 1PX6A 4KGIA 5G2ZA 3DVWA 3EU3A 1XWBA 2VLVA 4KB3A 1YJ6A 1SK2A 1NHYA 1WE0A 1XOAA 1RK4A 2F51A 1VF2A 4IGJA 5KN2A 4ZB9A 2YZHA 1PA3A 4TR3A 1K0AA 3ZMLA 1Z7RA 1A2LA 4CW9A 1SL2B 2K18A 4CY6A 4IHUA 3M3MA 1ERVA 3O76A 5JWRB 2R0PA 4NV2A 2VCQA 1FO5A 3VWUA 2WRTA 3F4RA 3LJRA 4G2EA 2RM5A 2HI7A 2DKIA 3FEUA 3TKPA 2VM1A 3KGKA 4QQ7A 3GKKA 3J7Yb 1EV4A 1X5CA 2GLRA 1S3DA 4PXOA 1FW1A 2V6OA 2VO4A 4IJIA 3NZNA 4WKWA 5C04A 3CSJA 3HCZA 2CAIA 2HYXA 3BJ5A 3KP8A 1N2AA 5ELAA 2ON7A 3RAZA 2PERA 3VWWA 2DLXA 4XIHA 4OFMA 2P0GA 4KDXA 3ERGA 4ZB8A 5G1LA 2C8UA 3V1WA 3Q6OA 3W8JA 5IMDA 1GNEA 3DXBA 5EPFA 4NHWA 2H71A 4OWYA 1M0UA 1THXA 3ZREA 1T1VA 2FCHA 4TR4A 1M3JA 3MAKA 3GKMA 2X49A 2HSYA 3TJGA 3KCMA 4DSRA 2WGRA 2MMZA 2GTUA 3JCML 4Q5QA 2R2JA 1H4OA 4PQIA 4ZIJA 5CRHA 3GURA 4A5PA 3HKRA 3M1GA 3HJPA 4NV5A 3MNGA 1JZOA 1NM3A 3C1SA 4CY8A 5E4WA 3G7JA 3IK9A 2H73A 1SYRA 4WETA 5L71A 3CQFA 4TR0A 3U5RE 4FYCA 2PBJA 2IMEA 5F07A 4IS0A 2GSQA 1SJZA 4MF7A 3UBKA 5IOXA 1KEBA 2D2ZA 4MPFA 1SL0B 3UAPA 2HFDA 1SKWB 4GQCA 5COHA 1V40A 4K7OA 2MBTA 4K0GA 4IQ1A 5BRTA 4G9HA 1U88A 3IAS2 1PQNA 3LFLA 1EGOA 1A0RP 2F3MA 3GH6A 4XCSA 3KEBA 4E8HA 4PQ1A 1V9WA 1AQWA 3RPPA 4FO5A 3ERWA 5ECMB 1HQOA 5D9WA 4OMVA 4ZL9A 1I9DA 4HQZA 2HZFA 4NAXA 2CVBA 1G7EA 1GSYA 1XCCA 4MABA 4MH2A 4MA9A 5IO0A 5JCWA 1WOUA 2H74A 1O8WA 3LXTA 2JSYA 2KHPA 2CA8A 1GULA 1MDJA 5DQSA 2V2GA 4HS1A 3HXSA 4PGTA 5ECLB 3R3EA 2GZZA 3GTUA 3DRNA 3EINA 3IRAA 1E2YA 5ID2B 5CP1A 1K3OA 4O5QA 5EY6A 1TI1A 2XBIA 2HRFA 2H76A 3DGQA 3LGCA 5B7CA 2XBQA 2EIRA 4K8MA 3TKRA 1GNWA 4TXOA 2H8LA 3APOA 2FWHA 2LV3A 3VK9A 1M7TA 4XTSA 4PTSA 3KTLA 1SYXA 1YKCA 5IPHA 3H8QA 3UVTA 5D9TA 1OYJA 4MF6A 2OKAA 3D22A 3GN3A 3QAWA 3R2QA 3ME8A 2FLSA 1Q4JA 1AIUA 2H6XA 1GSFA 4AJ8A 2L59A 2I4AA 3HZ8A 4IJ3A 8GSSA 1SJIA 4TKYA 2VL9A 3A5WA 3RHCA 3VWXA 1BG5A 4IBPA 4X4JA 1AAZA 3GSSA 1GSDA 3UL3A 2FY6A 4PNFA 4ZBDA 3GKXA 1UVZA 1EWXA 2YWIA 4JU5A 3FMWA 1M2AA 1XBSA 3GL3A 1ON4A 1O85A 4GCIA 1TKDB 2DJ3A 2P5QA 1VGLA 2GT6A 10GSA 1F6MC 1OKTA 2LJAA 4EXJA 3CRTA 2ON5A 1AUCA 3GL5A 2LNTA 4TRXA 1EV9A 4EL1A 3I69A 5IMAA 5HR2A 3F3RA 4K5RA 4KDYA 3UBLA 3K8NA 2NPBA 2O7KA 3HA9A 3WT2A 2JZRA 2PPTA 3GFKA 1ZGNA 4LMVA 2N5AA 3ZLPA 6GSTA 2BMXA 5H5SA 1ZMAA 1J0FA 4ICYA 2CX3A 2ALBA 1YQ1A 2H6ZA 4LL1B 3D0ZA 1TJDA 1XXUA 2AHEA 2VM2A 4MZCA 1DE1A 1N8JA 2WULA 4FQUA 5GZZB 6GSVA 1U3IA 1M2BA 2CQ9A 2C1YA 2DJ1A 2IPAA 5A4UA 5F8BA 3TOTA 1OVNA 5IO2A 1GSEA 3TKSE 1UC7A 4XS4A
chains in the Genus database with same CATH topology
2YZUA 4EKZA 1XVQA 3IHGA 5IQYA 3UVHA 2GDRA 2R6KA 2WCIA 3GHAA 1Z6MA 4OO5A 1A24A 4YQUA 3C8EA 4MJAA 2IIYA 1GUKA 4Z7XA 2H19A 3VPTA 3N9JA 3TJKA 2IMFA 13GSA 1O81A 4MJBA 3ED3A 1SK1A 2LS5A 1HD2A 5CRWA 2O85A 4EDZA 4TW5A 3TRQA 1WIKA 2RLIA 1TI3A 2IN3A 1UA5A 3Q19A 4YQVA 1BAYA 3CXGA 3SWLA 3KJYA 4ML6A 4LMWA 1PRXA 2AB6A 1PKZA 3HY2A 1THOA 1OC8A 2JACA 2YPMA 4KX4A 3EVIA 2QC7A 4K0NA 4JZQA 2GQKA 2VD0A 3LSZA 1LBKA 2KOKA 4JR6A 4POLA 3TCOA 2V6KA 1TRVA 4RI7A 3DD3A 4ZXGA 4I2UA 1W4VA 1TK0B 1B9YC 1GLQA 4EO3A 4HI7A 5IPGA 4I5QA 4L8EA 3UMAA 2B1KA 1G6YA 4POBA 1XWCA 1SD9A 3P8WA 1K0CA 1G0TA 1FAAA 2N5BA 2X8CA 4KE3A 3FZ4A 4HDEA 2A2PA 2FWGA 2YANA 3MDKA 3EU4A 5IOWA 2B3SA 2N5FA 2X8GA 4KCEA 5B6NA 2PN8A 2GSTA 3F8UA 16GSA 2C4JA 1T00A 4H86A 3GTUB 3LW9A 4IQAA 1K0NA 3E3EA 1KBNA 5JCUA 2H66A 2NVLA 3LYKA 2HLSA 4L5OA 1Z6NA 1W89A 1ZYQB 2H0IA 4PUAA 6GSYA 4HZ2A 5J41A 4KDUA 4TXOB 5DQYA 4K1FA 4BA7A 3QCPA 1MTCA 1R5PA 2X64A 4F0CA 2GZYA 1VRSD 3QMXA 1ZYPA 3LQ7A 1XIYA 2O87A 5G1KA 3VI7A 3CRUA 3KMOA 1MD4A 3CSHA 3IBHA 4YQMA 2QA2A 2CX4A 2C0FA 3LORA 1R7HA 2HXKA 2G0FA 5CO3A 2VLTA 1DE2A 2VL2C 1WJKA 4KW6A 3FZ9A 4KUNA 1MD3A 2FD3A 3HVVA 3D4TA 2H1DA 4HQSA 3ZTLA 4BPYA 1AQVA 1YF0A 4USSA 5J5NA 4RQXA 3F6FA 2PMTA 4EIQA 2AJQB 2DSAA 2E2MA 2HRAA 3D21A 2DIZA 5DVBA 11GSA 4GSTA 2GGTA 1K3LA 4N0VA 1R4WA 2HZEB 2FNOA 4F03A 3UEMA 4FH8A 3D4MA 2F9SA 3H79A 5ECOB 3US3A 4J2FA 1FOVA 5B8BA 3P7XA 1GP1A 1FG4A 4BVXA 4MPGA 2H1BA 4WBRD 1EEJA 2MMAA 7GSSA 1VF3A 1BJXA 1WPIA 3WT1A 2I1UA 2LNSA 4QL7A 3HZ4A 1A8LA 4V2MA 4NWYA 4GTUA 3M9JA 2IWTA 2A4HA 1T3BA 2QSIA 4K2XA 5D96A 5F05A 3A2VA 4XHMA 2GZPA 4Q5RA 4EE0A 3HD5A 3EC3A 3OR5A 1F37A 1JZDA 3KMNA 3F3QA 2MMNA 1M9BA 3A3TA 4ZBAA 4LL4B 2LSTA 4FYBA 4XS4B 1GWCA 1ACVA 2RIIA 3CTFA 1IYIA 5D9VA 1DSBA 2HRNA 4CDOA 1UN2A 5D9XA 3BOAA 3IDVA 2H30A 3LG6A 3L0HA 4DSQA 4NXIA 3EE2A 5KOXA 3AY8A 4BVYA 1ZOFA 1T8EB 5AGYA 2CVDA 4HJMA 5LD0A 3TGZA 2JSZA 4D73A 2B6MA 4K6XA 3APSA 1TOFA 1FOHA 3MIXA 2K6VA 1K3YA 6GSXA 2R5GA 1XPVA 1S3AA 5BMUA 3CBUA 2OE0A 2LJKA 3IPZA 4GLTA 5ECPB 3M8NA 1GSUA 1YZXA 1NSWA 1AXDA 2RM6A 2REMA 4FYUA 3PINA 2WJUA 5DAKA 2FA4A 4YAPA 1PSQA 1R26A 3TRPA 3UARA 4ECIA 5ECQB 1RW1A 3CYNA 3L78A 1OE7A 1DBYA 3MSZA 4E8EA 4GSNA 3HDCA 5A5KA 3EYTA 4DEJA 4HU9A 2B7JA 2WZ9A 3TJBA 2R0GA 3BBYA 3W8SA 3KP9A 1IYHA 4TVEA 2GT5A 3F0IA 2GVPA 3KM6A 4ECJA 2XHFA 14GSA 1TRSA 4IVFA 1YDKA 1C72A 3N5OA 4P3YB 5DCHA 2H75A 1TK8B 5JWQB 3GMFA 2CZ2A 4ID0A 5HR3A 3ZMKA 4DSSB 4IW9A 1SK0A 4X1UA 2L57A 1ZCPA 4QL9A 4PX1A 4XS1A 2JADA 4V1Ap 3C73A 1WWJA 1FVKA 5HFIA 1EP8A 4PQHA 2AYTA 2LRNA 2OJLA 4IP1A 1XW5A 1U87A 3KZQA 3BD2A 1GTAA 2FWEA 3MWHA 5HQPA 2J23A 1FVJA 4WXTA 3WYWA 4L5LA 2LEGA 1XW9A 1XWKA 3QPMA 3ME7A 4KSOA 1JFUA 3QFAC 3IXRA 4Z2TA 4KSMA 5H5RA 1OAZA 1X5EA 2Z9SA 3A5IA 3DMLA 4OCFA 5GAND 2IMDA 2P31A 3IHQA 1CQGA 4I97A 2L5LA 1QUWA 1O6JA 5F0GA 4ZBBA 4MNNA 2ZCTA 2LRCA 2YN1A 1PL1A 2HZEA 1G7OA 5DJMA 2BTOT 3IAM2 3D5JA 2VOCA 1OE8A 5LCZA 4O92A 1J08A 3G7YA 4MP4A 3NIVA 1M99A 5C00A 3ZRDA 1QQ2A 1TTZA 4I8BA 2PVOC 4PUFC 2H1AA 3DVXA 2AAWA 4ACSA 3E9JB 4XRAA 3TKSA 5JCGA 1KNGA 5DDLA 1B4QA 4YKFA 4OFNA 2PUKC 1A2JA 1B9XC 1Y6EA 3A2XA 1OC9A 2TIRA 1YF1A 1TRWA 2F8AA 2DJ0A 20GSA 4MH3A 2XPDA 5HR1A 2VL3A 3QAVA 1WMJA 2FUG2 1HNCA 4RUVA 2J9HA 1TP9A 1QXHA 5IMZA 1U3AA 2JL4A 4BVXB 5ENUA 3IOSA 2DIYA 4Z2RA 4XS6A 4OO4A 2KLXA 4HJ2A 1Z7PA 2I9HA 3PPUA 4L0WA 1SU9A 1GTBA 2A4VA 1PN9A 2IMKA 2TRXA 3FRCA 4TOPA 3ZL5A 4G10A 3HYPA 5EVOA 1GLPA 4N10A 1MEKA 4NPBA 2HT9A 4I6XA 4PURA 2C0DA 3RPNA 3WD6A 2HE3A 2DMLA 1BX9A 2R0CA 1EEMA 3EWLA 1YEPA 4JE1A 1M2DA 3D6IA 2B7KA 4AJ6A 3VFIA 3C71A 2O89A 4AGSA 3PH9A 2CZ3A 2AUVA 4KA0A 2OBKA 3ZZXA 2FA8A 3GV1A 5IMVA 17GSA 4BVYB 4ECBA 1Z3EA 4POMA 4D73B 3VLNA 1OKDA 4G19A 3ZIJA 4MZBA 3TUEA 1AQXA 2KP2A 3TKQA 5KN3A 4GRFA 3IV4A 3GX8A 5H5QA 3RDWA 4IKHA 2X8HA 3LXZA 5FT3A 2LUSA 1SL1B 5DAKB 2HSHA 4EF0A 2DKHA 3VWVA 1ERWA 1BEDA 5J9CA 1QGVA 1QFNA 4F9ZA 1O8XA 3GRXA 4KNDA 5HFGA 2VCZA 4WEYA 1WRYA 5J9BA 2GSSA 5G30A 5AIXA 3ERFA 2VIMA 4JEDA 2L4CA 2MYGA 4N11A 2I3YA 3H93A 2H6YA 3BCKA 4JR4A 4DSSA 6GSWA 2I81A 19GSA 4K2DA 2IMIA 1JLVA 4J57E 2LRTA 3ZFBA 4F0BA 5G31A 1GSQA 3FYGA 2L5OA 3TKSC 4ECCA 1O73A 3VPQA 4L0UA 4V2LA 2O8VB 1OC3A 4ULXA 2MZCA 3H4KA 4YH2A 4IN0A 1V57A 5AN1A 2XC2A 3F9UA 3RBTA 2ZNMA 2G2QA 4O32A 5B8AA 2V32A 1JHBA 3QD9A 2L4QA 1T4ZA 1BYEA 1K0MA 3ZYWA 3FY7A 3UJ1A 2LTKA 1YY7A 1B4PA 3DWVA 5HFKA 1SENA 2E2GA 4TN8A 3P2AA 3S9FA 2LJRA 3CMIA 2DMMA 1EOGA 1V2AA 5E59A 3TJJA 2CV4A 5DALA 2H70A 2WDUA 3HHVA 1FHEA 3F6DA 4MCUA 4GQFA 1WP0A 2VUPA 5ECHB 1EOHA 1GUHA 2H0GA 3FR3A 1QMVA 4ISDA 3G7IA 4GSSA 3QR6A 1JZWA 2CT6A 5D73A 4JBBA 3RHBA 2DJ2A 2HNLA 2A2SA 3HVXA 3CSIA 2FGXA 2M46A 1XW6A 2YJ7A 1Q98A 5CNWA 2QA1A 4LLRA 2C0GA 2OE3A 2DJKA 1J9BA 5IIZA 4AJ7A 4GWRA 1SD8A 2R3XA 3TDGA 4FIWA 1GH2A 3IC8A 5CRGA 3GSTA 3FW2A 4N0ZA 4O5UA 3C1RA 5KN1A 1EP7A 1ZYNA 1USBA 2PGTA 3I9V2 3WGXA 2JU5A 1OC9B 2L6CA 2K8SA 5ECRB 1ZYEA 5J3RA 5DBQA 1YEXA 3FR6A 2YJHA 1I5GA 5DCGA 4IELA 3FHKA 3GX0A 1DUGA 5IMCA 2C0EA 5CAXA 1Y25A 2MMOA 4PNGA 3HJOA 5A4VA 18GSA 3MYDA 4HUAA 3A2WA 2OACA 3EMXA 2IL3A 2VD1A 2JZTA 1A8YA 2GQLA 4MZWA 3KD0A 4YKGA 1A23A 5KN0A 4GXZA 1CQHA 2YOIA 3Q18A 1LU4A 2VCVA 1TK5B 2X4AA 1M9AA 2YV9A 4MK3A 3Q74A 3LWAA 3L9VA 1XOBA 1ABAA 5CREA 4MJEA 4ZL8A 1ML6A 1U6TA 1MDKA 1KTEA 2LQQA 6GSSA 5GSSA 2IJYA 2B5YA 1TU7A 3ZVJA 1F9MA 1JLWA 1F3AA 3M9KA 1TXXA 3O3TA 3P90A 2VLUA 12GSA 5KOWA 5D93A 4MDCA 2NBSA 1H75A 4G0LA 4O7HA 1X9SB 2DJJA 3QFBC 3HJMA 1HYUA 4N30A 4X43A 4BL7B 2WS2A 1EZKA 1NW2A 2ES7A 5HR0A 1V98A 2B5XA 5FWGA 1Z9HA 2YWOA 3IE3A 3GA4A 1SKSB 2C3NA 4POKA 2E0QA 4KF9A 5LNKe 1B48A 3U6VA 2LQOA 4NMUA 2YWNA 2NTOA 2HRKA 2A2RA 5D8IA 4F82A 3QOUA 4KCAA 4JRRA 3FZ5A 3FKFA 2VCTA 1F3BA 4EC0A 1TU8A 3KH9A 1AC1A 4Q5NA 2ZUPA 1K0BA 2JZSA 2EIOA 2P5RA 3ZFLA 3F4TA 4TR1A 5EL8A 1LJRA 5IMFA 1PKWA 1F2EA 5KEJA 6GSUA 4OCEA 4IP6A 1XWGA 4ML1A 3DYRA 1G6WA 1PL2A 1AW9A 2IFQB 4ZILA 3UIWA 4F2IA 4CHSA 1Z5YE 1O7UA 3GUSA 4X0XA 4EDYA 3LYPA 2V1MA 1GL8A 2BJXA 2OA7A 4NHZA 3KH7A 3FK8A 5INYA 3KXOA 1XWAA 1FB6A 3E0UA 4KH7A 4HU7A 2VCWA 2RUFA 5DALB 2C80A 2V41A 3BCIA 3EMPA 2FWFA 22GSA 5CRDA 2HSMA 1X9WB 3DEXA 4OD7A 1V58A 3M0FA 4EUYA 2GS3A 3PR8A 1RQMA 3UOMA 3KIJA 4EVMA 1X9MB 2H1GA 1E6BA 5ECSA 1S3CA 4OFTA 1PD21 1TDIA 2XPEA 2YNXA 4MMMA 3GNJA 4WBJA 1X0RA 3I43A 3CTGA 3H1NA 1PMTA 1GRXA 2UZ8A 2C3TA 1VF4A 1ERTA 2C3QA 2DBCA 5ECIB 2EIQA 2R4VA 4I2TA 4BWSA 1A2MA 4ILFA 5ECKB 9GSSA 3FR9A 5FHIA 1GUMA 1FB0A 2TRCP 2QKEA 3IC4A 3VI5A 5ECNB 1VF1A 2L6DA 2NDOA 1URMA 5F06A 3TRXA 2YV7A 4K9ZA 1ZL9A 4XRDA 3ISOA 4G0IA 3WGEA 1SJ6A 2KUCA 2CVKA 2WB9A 2OBIA 3J7Yk 5GSTA 1A0FA 4ZB6A 3WGDA 4WF4A 2GSRA 3DKSA 3NOFA 2VL2A 1XFLA 4TXVA 1R5AA 2AV4A 3IK7A 3QDNA 5IM9A 2H01A 3GYKA 2PVQA 1YKAA 1PX7A 4KAEA 2QGVA 1JZRA 3TJFA 5A4WA 1NHOA 2CAQA 1XZOA 3FZAA 2EC4A 3EPTA 3EURA 1TW9A 1B8XA 4K5SA 4GF0A 1PN0A 3L9UA 4G0KA 2WFCA 2PU9C 4K7NA 4BL7A 4MLYA 3PGTA 4DVCA 4ZL7A 1XVWA 5B6MA 5CYYA 2R37A 4YAVA 3IR4A 4WR5A 1GTUA 1K0OA 3GIXA 4O5RA 4WF5A 2YP6A 2F8FA 5DJLA 1HNAA 5AIVA 2H72A 3KTBA 4V1Ag 4V2NA 1TRUA 2K9FA 2FHEA 2M72A 2MBSA 4HOJA 2OADA 2KP1A 4J56E 3APQA 3F63A 2OE1A 2PWJA 5AISA 3SBCA 3IA1A 3W6GA 2DC5A 3DIEA 2YWMA 2K8VA 4Z2UA 5ABRA 4MJCA 3C7MA 3QAGA 5G5FA 3ZIVA 5J4UA 2E7PA 1QK8A 2LKUA 1SKRB 4LA1A 5JWOB 1X5DA 2M80A 1ST9A 1ERUA 2YCDA 5ID2A 5G5EA 1MDIA 1BQ7A 4RI6A 3G9BA 1EGRA 1GSSA 1ZZYA 2X99A 3L4NA 3ZVJD 3GKNA 4MF5A 1K0DA 4Q5FA 4AF2A 3TB2A 3TOUA 4HEA2 1ILOA 3O6TA 2B1LA 3LEFA 1PGTA 5GAPD 3GH9A 2VCXA 4HZ4A 4K7IA 2RUEA 1GTIA 1HNBA 2IFQA 2VAFA 2GQMA 1T4YA 4TR1B 5ELGA 3F4SA 2H0HA 3ZITA 1T7PB 3I6AA 4RQRA 4BWQA 3VURA 3HVSA 4EIPA 2B5EA 3L9SA 4WR4A 1PX6A 4KGIA 5G2ZA 3DVWA 3EU3A 1XWBA 2VLVA 4KB3A 1YJ6A 1SK2A 1NHYA 1WE0A 1XOAA 1RK4A 2F51A 1VF2A 4IGJA 5KN2A 4ZB9A 2YZHA 1PA3A 4TR3A 1K0AA 3ZMLA 1Z7RA 1A2LA 4CW9A 1SL2B 2K18A 4CY6A 4IHUA 3M3MA 1ERVA 3O76A 5JWRB 2R0PA 4NV2A 2VCQA 1FO5A 3VWUA 2WRTA 3F4RA 3LJRA 4G2EA 2RM5A 2HI7A 2DKIA 3FEUA 3TKPA 2VM1A 3KGKA 4QQ7A 3GKKA 3J7Yb 1EV4A 1X5CA 2GLRA 1S3DA 4PXOA 1FW1A 2V6OA 2VO4A 4IJIA 3NZNA 4WKWA 5C04A 3CSJA 3HCZA 2CAIA 2HYXA 3BJ5A 3KP8A 1N2AA 5ELAA 2ON7A 3RAZA 2PERA 3VWWA 2DLXA 4XIHA 4OFMA 2P0GA 4KDXA 3ERGA 4ZB8A 5G1LA 2C8UA 3V1WA 3Q6OA 3W8JA 5IMDA 1GNEA 3DXBA 5EPFA 4NHWA 2H71A 4OWYA 1M0UA 1THXA 3ZREA 1T1VA 2FCHA 4TR4A 3MAKA 3GKMA 2X49A 2HSYA 3TJGA 3KCMA 4DSRA 2WGRA 2MMZA 2GTUA 3JCML 4Q5QA 2R2JA 1H4OA 4PQIA 4ZIJA 5CRHA 3GURA 4A5PA 3HKRA 3M1GA 3HJPA 4NV5A 3MNGA 1JZOA 1NM3A 3C1SA 4CY8A 5E4WA 3G7JA 3IK9A 2H73A 1SYRA 4WETA 5L71A 4TR0A 3U5RE 4FYCA 2PBJA 2IMEA 5F07A 4IS0A 2GSQA 1SJZA 4MF7A 3UBKA 5IOXA 1KEBA 2D2ZA 4MPFA 1SL0B 3UAPA 2HFDA 1SKWB 4GQCA 5COHA 1V40A 4K7OA 2MBTA 4K0GA 4IQ1A 5BRTA 4G9HA 1U88A 3IAS2 1PQNA 3LFLA 1EGOA 1A0RP 2F3MA 3GH6A 4XCSA 3KEBA 4E8HA 4PQ1A 1V9WA 1AQWA 3RPPA 4FO5A 3ERWA 5ECMB 1HQOA 5D9WA 4OMVA 4ZL9A 1I9DA 4HQZA 2HZFA 4NAXA 2CVBA 1G7EA 1GSYA 1XCCA 4MABA 4MH2A 4MA9A 5IO0A 5JCWA 1WOUA 2H74A 1O8WA 3LXTA 2JSYA 2KHPA 2CA8A 1GULA 1MDJA 5DQSA 2V2GA 4HS1A 3HXSA 4PGTA 5ECLB 3R3EA 2GZZA 3GTUA 3DRNA 3EINA 3IRAA 1E2YA 5ID2B 5CP1A 1K3OA 4O5QA 5EY6A 1TI1A 2XBIA 2HRFA 2H76A 3DGQA 3LGCA 5B7CA 2XBQA 2EIRA 4K8MA 3TKRA 1GNWA 4TXOA 2H8LA 3APOA 2FWHA 2LV3A 3VK9A 1M7TA 4XTSA 4PTSA 3KTLA 1SYXA 1YKCA 5IPHA 3H8QA 3UVTA 5D9TA 1OYJA 4MF6A 2OKAA 3D22A 3GN3A 3QAWA 3R2QA 3ME8A 2FLSA 1Q4JA 1AIUA 2H6XA 1GSFA 4AJ8A 2L59A 2I4AA 3HZ8A 4IJ3A 8GSSA 1SJIA 4TKYA 2VL9A 3A5WA 3RHCA 3VWXA 1BG5A 4IBPA 4X4JA 1AAZA 3GSSA 1GSDA 3UL3A 2FY6A 4PNFA 4ZBDA 3GKXA 1UVZA 1EWXA 2YWIA 4JU5A 3FMWA 1M2AA 1XBSA 3GL3A 1ON4A 1O85A 4GCIA 1TKDB 2DJ3A 2P5QA 1VGLA 2GT6A 10GSA 1F6MC 1OKTA 2LJAA 4EXJA 3CRTA 2ON5A 1AUCA 3GL5A 2LNTA 4TRXA 1EV9A 4EL1A 3I69A 5IMAA 5HR2A 3F3RA 4K5RA 4KDYA 3UBLA 3K8NA 2NPBA 2O7KA 3HA9A 3WT2A 2JZRA 2PPTA 3GFKA 1ZGNA 4LMVA 2N5AA 3ZLPA 6GSTA 2BMXA 5H5SA 1ZMAA 1J0FA 4ICYA 2CX3A 2ALBA 1YQ1A 2H6ZA 4LL1B 3D0ZA 1TJDA 1XXUA 2AHEA 2VM2A 4MZCA 1DE1A 1N8JA 2WULA 4FQUA 5GZZB 6GSVA 1U3IA 1M2BA 2CQ9A 2C1YA 2DJ1A 2IPAA 5A4UA 5F8BA 3TOTA 1OVNA 5IO2A 1GSEA 3TKSE 1UC7A 4XS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A5P A;  3A5I A;  3LW9 A;  2X4A A;  2X49 A;  3MYD A;  3MIX A; 
#chains in the Genus database with same CATH topology
 2YZU A;  4EKZ A;  1XVQ A;  3IHG A;  5IQY A;  3UVH A;  2GDR A;  2R6K A;  2WCI A;  3GHA A;  1Z6M A;  4OO5 A;  1A24 A;  4YQU A;  3C8E A;  4MJA A;  2IIY A;  1GUK A;  4Z7X A;  2H19 A;  3VPT A;  3N9J A;  3TJK A;  2IMF A;  13GS A;  1O81 A;  4MJB A;  3ED3 A;  1SK1 A;  2LS5 A;  1HD2 A;  5CRW A;  2O85 A;  4EDZ A;  4TW5 A;  3TRQ A;  1WIK A;  2RLI A;  1TI3 A;  2IN3 A;  1UA5 A;  3Q19 A;  4YQV A;  1BAY A;  3CXG A;  3SWL A;  3KJY A;  4ML6 A;  4LMW A;  1PRX A;  2AB6 A;  1PKZ A;  3HY2 A;  1THO A;  1OC8 A;  2JAC A;  2YPM A;  4KX4 A;  3EVI A;  2QC7 A;  4K0N A;  4JZQ A;  2GQK A;  2VD0 A;  3LSZ A;  1LBK A;  2KOK A;  4JR6 A;  4POL A;  3TCO A;  2V6K A;  1TRV A;  4RI7 A;  3DD3 A;  4ZXG A;  4I2U A;  1W4V A;  1TK0 B;  1B9Y C;  1GLQ A;  4EO3 A;  4HI7 A;  5IPG A;  4I5Q A;  4L8E A;  3UMA A;  2B1K A;  1G6Y A;  4POB A;  1XWC A;  1SD9 A;  3P8W A;  1K0C A;  1G0T A;  1FAA A;  2N5B A;  2X8C A;  4KE3 A;  3FZ4 A;  4HDE A;  2A2P A;  2FWG A;  2YAN A;  3MDK A;  3EU4 A;  5IOW A;  2B3S A;  2N5F A;  2X8G A;  4KCE A;  5B6N A;  2PN8 A;  2GST A;  3F8U A;  16GS A;  2C4J A;  1T00 A;  4H86 A;  3GTU B;  3LW9 A;  4IQA A;  1K0N A;  3E3E A;  1KBN A;  5JCU A;  2H66 A;  2NVL A;  3LYK A;  2HLS A;  4L5O A;  1Z6N A;  1W89 A;  1ZYQ B;  2H0I A;  4PUA A;  6GSY A;  4HZ2 A;  5J41 A;  4KDU A;  4TXO B;  5DQY A;  4K1F A;  4BA7 A;  3QCP A;  1MTC A;  1R5P A;  2X64 A;  4F0C A;  2GZY A;  1VRS D;  3QMX A;  1ZYP A;  3LQ7 A;  1XIY A;  2O87 A;  5G1K A;  3VI7 A;  3CRU A;  3KMO A;  1MD4 A;  3CSH A;  3IBH A;  4YQM A;  2QA2 A;  2CX4 A;  2C0F A;  3LOR A;  1R7H A;  2HXK A;  2G0F A;  5CO3 A;  2VLT A;  1DE2 A;  2VL2 C;  1WJK A;  4KW6 A;  3FZ9 A;  4KUN A;  1MD3 A;  2FD3 A;  3HVV A;  3D4T A;  2H1D A;  4HQS A;  3ZTL A;  4BPY A;  1AQV A;  1YF0 A;  4USS A;  5J5N A;  4RQX A;  3F6F A;  2PMT A;  4EIQ A;  2AJQ B;  2DSA A;  2E2M A;  2HRA A;  3D21 A;  2DIZ A;  5DVB A;  11GS A;  4GST A;  2GGT A;  1K3L A;  4N0V A;  1R4W A;  2HZE B;  2FNO A;  4F03 A;  3UEM A;  4FH8 A;  3D4M A;  2F9S A;  3H79 A;  5ECO B;  3US3 A;  4J2F A;  1FOV A;  5B8B A;  3P7X A;  1GP1 A;  1FG4 A;  4BVX A;  4MPG A;  2H1B A;  4WBR D;  1EEJ A;  2MMA A;  7GSS A;  1VF3 A;  1BJX A;  1WPI A;  3WT1 A;  2I1U A;  2LNS A;  4QL7 A;  3HZ4 A;  1A8L A;  4V2M A;  4NWY A;  4GTU A;  3M9J A;  2IWT A;  2A4H A;  1T3B A;  2QSI A;  4K2X A;  5D96 A;  5F05 A;  3A2V A;  4XHM A;  2GZP A;  4Q5R A;  4EE0 A;  3HD5 A;  3EC3 A;  3OR5 A;  1F37 A;  1JZD A;  3KMN A;  3F3Q A;  2MMN A;  1M9B A;  3A3T A;  4ZBA A;  4LL4 B;  2LST A;  4FYB A;  4XS4 B;  1GWC A;  1ACV A;  2RII A;  3CTF A;  1IYI A;  5D9V A;  1DSB A;  2HRN A;  4CDO A;  1UN2 A;  5D9X A;  3BOA A;  3IDV A;  2H30 A;  3LG6 A;  3L0H A;  4DSQ A;  4NXI A;  3EE2 A;  5KOX A;  3AY8 A;  4BVY A;  1ZOF A;  1T8E B;  5AGY A;  2CVD A;  4HJM A;  5LD0 A;  3TGZ A;  2JSZ A;  4D73 A;  2B6M A;  4K6X A;  3APS A;  1TOF A;  1FOH A;  3MIX A;  2K6V A;  1K3Y A;  6GSX A;  2R5G A;  1XPV A;  1S3A A;  5BMU A;  3CBU A;  2OE0 A;  2LJK A;  3IPZ A;  4GLT A;  5ECP B;  3M8N A;  1GSU A;  1YZX A;  1NSW A;  1AXD A;  2RM6 A;  2REM A;  4FYU A;  3PIN A;  2WJU A;  5DAK A;  2FA4 A;  4YAP A;  1PSQ A;  1R26 A;  3TRP A;  3UAR A;  4ECI A;  5ECQ B;  1RW1 A;  3CYN A;  3L78 A;  1OE7 A;  1DBY A;  1XG8 A;  3MSZ A;  4E8E A;  4GSN A;  3HDC A;  5A5K A;  3EYT A;  4DEJ A;  4HU9 A;  2B7J A;  2WZ9 A;  3TJB A;  2R0G A;  3BBY A;  3W8S A;  3KP9 A;  1IYH A;  4TVE A;  2GT5 A;  3F0I A;  2GVP A;  3KM6 A;  4ECJ A;  2XHF A;  14GS A;  1TRS A;  4IVF A;  1YDK A;  1C72 A;  3N5O A;  4P3Y B;  5DCH A;  2H75 A;  1TK8 B;  5JWQ B;  3GMF A;  2CZ2 A;  4ID0 A;  5HR3 A;  3ZMK A;  4DSS B;  4IW9 A;  1SK0 A;  4X1U A;  2L57 A;  1ZCP A;  4QL9 A;  4PX1 A;  4XS1 A;  2JAD A;  4V1A p;  3C73 A;  1WWJ A;  1FVK A;  5HFI A;  1EP8 A;  4PQH A;  2AYT A;  2LRN A;  2OJL A;  4IP1 A;  1XW5 A;  1U87 A;  3KZQ A;  3BD2 A;  1GTA A;  2FWE A;  3MWH A;  5HQP A;  2J23 A;  1FVJ A;  4WXT A;  3WYW A;  4L5L A;  2LEG A;  1XW9 A;  1XWK A;  3QPM A;  3ME7 A;  4KSO A;  1JFU A;  3QFA C;  3IXR A;  4Z2T A;  4KSM A;  5H5R A;  1OAZ A;  1X5E A;  2Z9S A;  3A5I A;  3DML A;  4OCF A;  5GAN D;  2IMD A;  2P31 A;  3IHQ A;  1CQG A;  4I97 A;  2L5L A;  1QUW A;  1O6J A;  5F0G A;  4ZBB A;  4MNN A;  2ZCT A;  3HVN A;  2LRC A;  2YN1 A;  1PL1 A;  2HZE A;  1G7O A;  5DJM A;  2BTO T;  3IAM 2;  3D5J A;  2VOC A;  1OE8 A;  5LCZ A;  4O92 A;  1J08 A;  3G7Y A;  4MP4 A;  3NIV A;  1M99 A;  5C00 A;  3ZRD A;  1QQ2 A;  1TTZ A;  4I8B A;  2PVO C;  4PUF C;  2H1A A;  3DVX A;  2AAW A;  4ACS A;  3E9J B;  4XRA A;  3TKS A;  5JCG A;  1KNG A;  5DDL A;  1B4Q A;  4YKF A;  4OFN A;  2PUK C;  1A2J A;  1B9X C;  1Y6E A;  3A2X A;  1OC9 A;  2TIR A;  1YF1 A;  1TRW A;  2F8A A;  2DJ0 A;  20GS A;  4MH3 A;  2XPD A;  5HR1 A;  2VL3 A;  3QAV A;  1WMJ A;  2FUG 2;  1HNC A;  4RUV A;  2J9H A;  1TP9 A;  1QXH A;  5IMZ A;  1U3A A;  2JL4 A;  4BVX B;  5ENU A;  3IOS A;  2DIY A;  4Z2R A;  4XS6 A;  4OO4 A;  2KLX A;  4HJ2 A;  1Z7P A;  2I9H A;  3PPU A;  4L0W A;  1SU9 A;  1GTB A;  2A4V A;  1PN9 A;  2IMK A;  2TRX A;  3FRC A;  4TOP A;  3ZL5 A;  4G10 A;  3HYP A;  5EVO A;  1GLP A;  4N10 A;  1MEK A;  4NPB A;  2HT9 A;  4I6X A;  4PUR A;  2C0D A;  3RPN A;  3WD6 A;  2HE3 A;  2DML A;  1BX9 A;  2R0C A;  1EEM A;  3EWL A;  1YEP A;  4JE1 A;  1M2D A;  3D6I A;  2B7K A;  4AJ6 A;  3VFI A;  3C71 A;  2O89 A;  4AGS A;  3PH9 A;  2CZ3 A;  2AUV A;  4KA0 A;  2OBK A;  3ZZX A;  2FA8 A;  3GV1 A;  5IMV A;  17GS A;  4BVY B;  4ECB A;  1Z3E A;  4POM A;  4D73 B;  3VLN A;  1OKD A;  4G19 A;  3ZIJ A;  4MZB A;  3TUE A;  1AQX A;  2KP2 A;  3TKQ A;  5KN3 A;  4GRF A;  3IV4 A;  3GX8 A;  5H5Q A;  3RDW A;  4IKH A;  2X8H A;  3LXZ A;  5FT3 A;  2LUS A;  1SL1 B;  5DAK B;  2HSH A;  4EF0 A;  2DKH A;  3VWV A;  1ERW A;  1BED A;  5J9C A;  1QGV A;  1QFN A;  4F9Z A;  1O8X A;  3GRX A;  4KND A;  5HFG A;  2VCZ A;  1S3R A;  4WEY A;  1WRY A;  5J9B A;  2GSS A;  5G30 A;  5AIX A;  3ERF A;  2VIM A;  4JED A;  2L4C A;  2MYG A;  4N11 A;  2I3Y A;  3H93 A;  2H6Y A;  3BCK A;  4JR4 A;  4DSS A;  6GSW A;  2I81 A;  19GS A;  4K2D A;  2IMI A;  1JLV A;  4J57 E;  2LRT A;  3ZFB A;  4F0B A;  5G31 A;  1GSQ A;  3FYG A;  2L5O A;  3TKS C;  4ECC A;  1O73 A;  3VPQ A;  4L0U A;  4V2L A;  2O8V B;  1OC3 A;  4ULX A;  2MZC A;  3H4K A;  4YH2 A;  4IN0 A;  1V57 A;  5AN1 A;  2XC2 A;  3F9U A;  3RBT A;  2ZNM A;  2G2Q A;  4O32 A;  5B8A A;  2V32 A;  1JHB A;  3QD9 A;  2L4Q A;  1T4Z A;  1BYE A;  1K0M A;  3ZYW A;  3FY7 A;  3UJ1 A;  2LTK A;  1YY7 A;  1B4P A;  3DWV A;  5HFK A;  1SEN A;  2E2G A;  4TN8 A;  3P2A A;  3S9F A;  2LJR A;  3CMI A;  2DMM A;  1EOG A;  1V2A A;  5E59 A;  3TJJ A;  2CV4 A;  5DAL A;  2H70 A;  2WDU A;  3HHV A;  1FHE A;  3F6D A;  4MCU A;  4GQF A;  1WP0 A;  2VUP A;  5ECH B;  1EOH A;  1GUH A;  2H0G A;  3FR3 A;  1QMV A;  4BIK A;  4ISD A;  3G7I A;  4GSS A;  3QR6 A;  1JZW A;  2CT6 A;  5D73 A;  4JBB A;  3RHB A;  2DJ2 A;  2HNL A;  2A2S A;  3HVX A;  3CSI A;  2FGX A;  2M46 A;  1XW6 A;  2YJ7 A;  1Q98 A;  5CNW A;  2QA1 A;  4LLR A;  2C0G A;  2OE3 A;  2DJK A;  1J9B A;  5IIZ A;  4AJ7 A;  4GWR A;  1SD8 A;  2R3X A;  3TDG A;  4FIW A;  1GH2 A;  3IC8 A;  5CRG A;  3GST A;  3FW2 A;  4N0Z A;  4O5U A;  3C1R A;  5KN1 A;  1EP7 A;  1ZYN A;  1USB A;  2PGT A;  3I9V 2;  3WGX A;  2JU5 A;  1OC9 B;  2L6C A;  2K8S A;  5ECR B;  1ZYE A;  5J3R A;  5DBQ A;  1YEX A;  3FR6 A;  2YJH A;  1I5G A;  5DCG A;  4IEL A;  3FHK A;  3GX0 A;  1DUG A;  5IMC A;  2C0E A;  5CAX A;  1Y25 A;  2MMO A;  4PNG A;  3HJO A;  5A4V A;  18GS A;  3MYD A;  4HUA A;  3A2W A;  2OAC A;  3EMX A;  2IL3 A;  2VD1 A;  2JZT A;  1A8Y A;  2GQL A;  4MZW A;  3KD0 A;  4YKG A;  1A23 A;  5KN0 A;  4GXZ A;  1CQH A;  2YOI A;  3Q18 A;  1LU4 A;  2VCV A;  1TK5 B;  2X4A A;  1M9A A;  2YV9 A;  4MK3 A;  3Q74 A;  3LWA A;  3L9V A;  1XOB A;  1ABA A;  5CRE A;  4MJE A;  4ZL8 A;  1ML6 A;  1U6T A;  1MDK A;  1KTE A;  2LQQ A;  6GSS A;  5GSS A;  2IJY A;  2B5Y A;  1TU7 A;  3ZVJ A;  1F9M A;  1JLW A;  1F3A A;  3M9K A;  1TXX A;  3O3T A;  3P90 A;  2VLU A;  12GS A;  5KOW A;  5D93 A;  4MDC A;  2NBS A;  1H75 A;  4G0L A;  4O7H A;  1X9S B;  2DJJ A;  3QFB C;  3HJM A;  1HYU A;  4N30 A;  4X43 A;  4BL7 B;  2WS2 A;  1EZK A;  1NW2 A;  2ES7 A;  5HR0 A;  1V98 A;  2B5X A;  5FWG A;  1Z9H A;  2YWO A;  3IE3 A;  3GA4 A;  1SKS B;  2C3N A;  4POK A;  2E0Q A;  4KF9 A;  5LNK e;  1B48 A;  3U6V A;  2LQO A;  4NMU A;  2YWN A;  2NTO A;  2HRK A;  2A2R A;  5D8I A;  4F82 A;  3QOU A;  4KCA A;  4JRR A;  3FZ5 A;  3FKF A;  2VCT A;  1F3B A;  4EC0 A;  1TU8 A;  3KH9 A;  1AC1 A;  4Q5N A;  2ZUP A;  1K0B A;  2JZS A;  2EIO A;  2P5R A;  3ZFL A;  3F4T A;  4TR1 A;  5EL8 A;  1LJR A;  5IMF A;  1PKW A;  1F2E A;  5KEJ A;  6GSU A;  4OCE A;  4IP6 A;  1XWG A;  4ML1 A;  3DYR A;  1G6W A;  1PL2 A;  1AW9 A;  2IFQ B;  4ZIL A;  3UIW A;  4F2I A;  4CHS A;  1Z5Y E;  1O7U A;  3GUS A;  4X0X A;  4EDY A;  3LYP A;  2V1M A;  1GL8 A;  2BJX A;  2OA7 A;  4NHZ A;  3KH7 A;  3FK8 A;  5INY A;  3KXO A;  1XWA A;  1FB6 A;  3E0U A;  4KH7 A;  4HU7 A;  2VCW A;  2RUF A;  5DAL B;  2C80 A;  2V41 A;  3BCI A;  3EMP A;  2FWF A;  22GS A;  5CRD A;  2HSM A;  1X9W B;  3DEX A;  4OD7 A;  1V58 A;  3M0F A;  4EUY A;  2GS3 A;  3PR8 A;  1RQM A;  3UOM A;  3KIJ A;  4EVM A;  1X9M B;  2H1G A;  1E6B A;  5ECS A;  1S3C A;  4OFT A;  1PD2 1;  1TDI A;  2XPE A;  2YNX A;  4MMM A;  3GNJ A;  4WBJ A;  1X0R A;  3I43 A;  3CTG A;  3H1N A;  1PMT A;  1GRX A;  2UZ8 A;  2C3T A;  1VF4 A;  1ERT A;  2C3Q A;  2DBC A;  5ECI B;  2EIQ A;  2R4V A;  4I2T A;  4BWS A;  1A2M A;  4ILF A;  5ECK B;  9GSS A;  3FR9 A;  5FHI A;  1GUM A;  1FB0 A;  2TRC P;  2QKE A;  3IC4 A;  3VI5 A;  5ECN B;  1VF1 A;  2L6D A;  2NDO A;  1URM A;  5F06 A;  3TRX A;  2YV7 A;  4K9Z A;  1ZL9 A;  4XRD A;  4G0I A;  3ISO A;  1M3I A;  1SJ6 A;  2KUC A;  3WGE A;  2CVK A;  2WB9 A;  2OBI A;  3J7Y k;  5GST A;  1A0F A;  4ZB6 A;  3WGD A;  4WF4 A;  2GSR A;  3DKS A;  3NOF A;  2VL2 A;  1XFL A;  4TXV A;  1R5A A;  2AV4 A;  3IK7 A;  3QDN A;  5IM9 A;  2H01 A;  3GYK A;  2PVQ A;  1YKA A;  1PX7 A;  4KAE A;  2QGV A;  1JZR A;  3TJF A;  5A4W A;  1NHO A;  2CAQ A;  1XZO A;  3FZA A;  2EC4 A;  3EPT A;  3EUR A;  1TW9 A;  1B8X A;  4K5S A;  4GF0 A;  1PN0 A;  3L9U A;  4G0K A;  2WFC A;  2PU9 C;  4K7N A;  4BL7 A;  4MLY A;  3PGT A;  4DVC A;  4ZL7 A;  1XVW A;  5B6M A;  5CYY A;  2R37 A;  4YAV A;  3IR4 A;  4WR5 A;  1GTU A;  1K0O A;  3GIX A;  4O5R A;  4WF5 A;  2YP6 A;  2F8F A;  5DJL A;  1HNA A;  5AIV A;  2H72 A;  3KTB A;  4V1A g;  4V2N A;  1TRU A;  2K9F A;  2FHE A;  2M72 A;  2MBS A;  4HOJ A;  2OAD A;  2KP1 A;  4J56 E;  3APQ A;  3F63 A;  2OE1 A;  2PWJ A;  5AIS A;  3SBC A;  3IA1 A;  3W6G A;  2DC5 A;  3DIE A;  2YWM A;  2K8V A;  4Z2U A;  5ABR A;  4MJC A;  3C7M A;  3QAG A;  5G5F A;  3ZIV A;  5J4U A;  2E7P A;  1QK8 A;  2LKU A;  1SKR B;  4LA1 A;  5JWO B;  1X5D A;  2M80 A;  1ST9 A;  1ERU A;  2YCD A;  5ID2 A;  5G5E A;  1MDI A;  1BQ7 A;  4RI6 A;  3G9B A;  1EGR A;  1GSS A;  1ZZY A;  2X99 A;  3L4N A;  3ZVJ D;  3GKN A;  4MF5 A;  1K0D A;  4Q5F A;  4AF2 A;  3TB2 A;  3TOU A;  4HEA 2;  1ILO A;  3O6T A;  2B1L A;  3LEF A;  1PGT A;  5GAP D;  3GH9 A;  2VCX A;  4HZ4 A;  4K7I A;  2RUE A;  1GTI A;  1HNB A;  2IFQ A;  2VAF A;  2GQM A;  1T4Y A;  1PFO A;  4TR1 B;  5ELG A;  3F4S A;  4HSC X;  2H0H A;  3ZIT A;  1T7P B;  3I6A A;  4RQR A;  4BWQ A;  3VUR A;  3HVS A;  4EIP A;  2B5E A;  3L9S A;  4WR4 A;  1PX6 A;  4KGI A;  5G2Z A;  3DVW A;  3EU3 A;  1XWB A;  2VLV A;  4KB3 A;  1YJ6 A;  1SK2 A;  1NHY A;  1WE0 A;  1XOA A;  1RK4 A;  2F51 A;  1VF2 A;  4IGJ A;  5KN2 A;  4ZB9 A;  2YZH A;  1PA3 A;  4TR3 A;  1K0A A;  3ZML A;  1Z7R A;  1A2L A;  4CW9 A;  1SL2 B;  2K18 A;  4CY6 A;  4IHU A;  3M3M A;  1ERV A;  3O76 A;  5JWR B;  2R0P A;  4NV2 A;  2VCQ A;  1FO5 A;  3VWU A;  2WRT A;  3F4R A;  3LJR A;  4G2E A;  2RM5 A;  2HI7 A;  2DKI A;  3FEU A;  3TKP A;  2VM1 A;  3KGK A;  4QQ7 A;  3GKK A;  3J7Y b;  1EV4 A;  1X5C A;  2GLR A;  1S3D A;  4PXO A;  1FW1 A;  2V6O A;  2VO4 A;  4IJI A;  3NZN A;  4WKW A;  5C04 A;  3CSJ A;  3HCZ A;  2CAI A;  2HYX A;  3BJ5 A;  3KP8 A;  1N2A A;  5ELA A;  2ON7 A;  3RAZ A;  2PER A;  3VWW A;  2DLX A;  4XIH A;  4OFM A;  2P0G A;  4KDX A;  3ERG A;  4ZB8 A;  5G1L A;  2C8U A;  3V1W A;  3Q6O A;  3W8J A;  5IMD A;  1GNE A;  3DXB A;  5EPF A;  4NHW A;  2H71 A;  4OWY A;  1M0U A;  1THX A;  3ZRE A;  1T1V A;  2FCH A;  4TR4 A;  1M3J A;  3MAK A;  3GKM A;  2X49 A;  2HSY A;  3TJG A;  3KCM A;  4DSR A;  2WGR A;  2MMZ A;  2GTU A;  3JCM L;  4Q5Q A;  2R2J A;  1H4O A;  4PQI A;  4ZIJ A;  5CRH A;  3GUR A;  4A5P A;  3HKR A;  3M1G A;  3HJP A;  4NV5 A;  3MNG A;  1JZO A;  1NM3 A;  3C1S A;  4CY8 A;  5E4W A;  3G7J A;  3IK9 A;  2H73 A;  1SYR A;  4WET A;  5L71 A;  3CQF A;  4TR0 A;  3U5R E;  4FYC A;  2PBJ A;  2IME A;  5F07 A;  4IS0 A;  2GSQ A;  1SJZ A;  4MF7 A;  3UBK A;  5IOX A;  1KEB A;  2D2Z A;  4MPF A;  1SL0 B;  3UAP A;  2HFD A;  1SKW B;  4GQC A;  5COH A;  1V40 A;  4K7O A;  2MBT A;  4K0G A;  4IQ1 A;  5BRT A;  4G9H A;  1U88 A;  3IAS 2;  1PQN A;  3LFL A;  1EGO A;  1A0R P;  2F3M A;  3GH6 A;  4XCS A;  3KEB A;  4E8H A;  4PQ1 A;  1V9W A;  1AQW A;  3RPP A;  4FO5 A;  3ERW A;  5ECM B;  1HQO A;  5D9W A;  4OMV A;  4ZL9 A;  1I9D A;  4HQZ A;  2HZF A;  4NAX A;  2CVB A;  1G7E A;  1GSY A;  1XCC A;  4MAB A;  4MH2 A;  4MA9 A;  5IO0 A;  5JCW A;  1WOU A;  2H74 A;  1O8W A;  3LXT A;  2JSY A;  2KHP A;  2CA8 A;  1GUL A;  1MDJ A;  5DQS A;  2V2G A;  4HS1 A;  3HXS A;  4PGT A;  5ECL B;  3R3E A;  2GZZ A;  3GTU A;  3DRN A;  3EIN A;  3IRA A;  1E2Y A;  5ID2 B;  5CP1 A;  1K3O A;  4O5Q A;  5EY6 A;  1TI1 A;  2XBI A;  2HRF A;  2H76 A;  3DGQ A;  3LGC A;  5B7C A;  2XBQ A;  2EIR A;  4K8M A;  3TKR A;  1GNW A;  4TXO A;  2H8L A;  3APO A;  2FWH A;  2LV3 A;  3VK9 A;  1M7T A;  4XTS A;  4PTS A;  3KTL A;  1SYX A;  1YKC A;  5IPH A;  3H8Q A;  3UVT A;  5D9T A;  1OYJ A;  4MF6 A;  2OKA A;  3D22 A;  3GN3 A;  3QAW A;  3R2Q A;  3ME8 A;  2FLS A;  1Q4J A;  1AIU A;  2H6X A;  1GSF A;  4AJ8 A;  2L59 A;  2I4A A;  3HZ8 A;  4IJ3 A;  8GSS A;  1SJI A;  4TKY A;  2VL9 A;  3A5W A;  3RHC A;  3VWX A;  1BG5 A;  4IBP A;  4X4J A;  1AAZ A;  3GSS A;  1GSD A;  3UL3 A;  2FY6 A;  4PNF A;  4ZBD A;  3GKX A;  1UVZ A;  1EWX A;  2YWI A;  4JU5 A;  3FMW A;  1M2A A;  1XBS A;  3GL3 A;  1ON4 A;  1O85 A;  4GCI A;  1TKD B;  2DJ3 A;  2P5Q A;  1VGL A;  2GT6 A;  10GS A;  1F6M C;  1OKT A;  2LJA A;  4EXJ A;  3CRT A;  2ON5 A;  1AUC A;  3GL5 A;  2LNT A;  4TRX A;  1EV9 A;  4EL1 A;  3I69 A;  5IMA A;  5HR2 A;  3F3R A;  4K5R A;  4KDY A;  3UBL A;  3K8N A;  2NPB A;  2O7K A;  3HA9 A;  3WT2 A;  2JZR A;  2PPT A;  3GFK A;  1ZGN A;  4LMV A;  2N5A A;  3ZLP A;  6GST A;  2BMX A;  5H5S A;  1ZMA A;  1J0F A;  4ICY A;  2CX3 A;  2ALB A;  1YQ1 A;  2H6Z A;  4LL1 B;  3D0Z A;  1TJD A;  1XXU A;  2AHE A;  2VM2 A;  4MZC A;  1DE1 A;  1N8J A;  2WUL A;  4FQU A;  5GZZ B;  6GSV A;  1U3I A;  1M2B A;  2CQ9 A;  2C1Y A;  2DJ1 A;  2IPA A;  5A4U A;  5F8B A;  3TOT A;  1OVN A;  5IO2 A;  1GSE A;  3TKS E;  1UC7 A;  4XS4 A; 
#chains in the Genus database with same CATH homology
 2YZU A;  4EKZ A;  1XVQ A;  3IHG A;  5IQY A;  3UVH A;  2GDR A;  2R6K A;  2WCI A;  3GHA A;  1Z6M A;  4OO5 A;  1A24 A;  4YQU A;  3C8E A;  4MJA A;  2IIY A;  1GUK A;  4Z7X A;  2H19 A;  3VPT A;  3N9J A;  3TJK A;  2IMF A;  13GS A;  1O81 A;  4MJB A;  3ED3 A;  1SK1 A;  2LS5 A;  1HD2 A;  5CRW A;  2O85 A;  4EDZ A;  4TW5 A;  3TRQ A;  1WIK A;  2RLI A;  1TI3 A;  2IN3 A;  1UA5 A;  3Q19 A;  4YQV A;  1BAY A;  3CXG A;  3SWL A;  3KJY A;  4ML6 A;  4LMW A;  1PRX A;  2AB6 A;  1PKZ A;  3HY2 A;  1THO A;  1OC8 A;  2JAC A;  2YPM A;  4KX4 A;  3EVI A;  2QC7 A;  4K0N A;  4JZQ A;  2GQK A;  2VD0 A;  3LSZ A;  1LBK A;  2KOK A;  4JR6 A;  4POL A;  3TCO A;  2V6K A;  1TRV A;  4RI7 A;  3DD3 A;  4ZXG A;  4I2U A;  1W4V A;  1TK0 B;  1B9Y C;  1GLQ A;  4EO3 A;  4HI7 A;  5IPG A;  4I5Q A;  4L8E A;  3UMA A;  2B1K A;  1G6Y A;  4POB A;  1XWC A;  1SD9 A;  3P8W A;  1K0C A;  1G0T A;  1FAA A;  2N5B A;  2X8C A;  4KE3 A;  3FZ4 A;  4HDE A;  2A2P A;  2FWG A;  2YAN A;  3MDK A;  3EU4 A;  5IOW A;  2B3S A;  2N5F A;  2X8G A;  4KCE A;  5B6N A;  2PN8 A;  2GST A;  3F8U A;  16GS A;  2C4J A;  1T00 A;  4H86 A;  3GTU B;  3LW9 A;  4IQA A;  1K0N A;  3E3E A;  1KBN A;  5JCU A;  2H66 A;  2NVL A;  3LYK A;  2HLS A;  4L5O A;  1Z6N A;  1W89 A;  1ZYQ B;  2H0I A;  4PUA A;  6GSY A;  4HZ2 A;  5J41 A;  4KDU A;  4TXO B;  5DQY A;  4K1F A;  4BA7 A;  3QCP A;  1MTC A;  1R5P A;  2X64 A;  4F0C A;  2GZY A;  1VRS D;  3QMX A;  1ZYP A;  3LQ7 A;  1XIY A;  2O87 A;  5G1K A;  3VI7 A;  3CRU A;  3KMO A;  1MD4 A;  3CSH A;  3IBH A;  4YQM A;  2QA2 A;  2CX4 A;  2C0F A;  3LOR A;  1R7H A;  2HXK A;  2G0F A;  5CO3 A;  2VLT A;  1DE2 A;  2VL2 C;  1WJK A;  4KW6 A;  3FZ9 A;  4KUN A;  1MD3 A;  2FD3 A;  3HVV A;  3D4T A;  2H1D A;  4HQS A;  3ZTL A;  4BPY A;  1AQV A;  1YF0 A;  4USS A;  5J5N A;  4RQX A;  3F6F A;  2PMT A;  4EIQ A;  2AJQ B;  2DSA A;  2E2M A;  2HRA A;  3D21 A;  2DIZ A;  5DVB A;  11GS A;  4GST A;  2GGT A;  1K3L A;  4N0V A;  1R4W A;  2HZE B;  2FNO A;  4F03 A;  3UEM A;  4FH8 A;  3D4M A;  2F9S A;  3H79 A;  5ECO B;  3US3 A;  4J2F A;  1FOV A;  5B8B A;  3P7X A;  1GP1 A;  1FG4 A;  4BVX A;  4MPG A;  2H1B A;  4WBR D;  1EEJ A;  2MMA A;  7GSS A;  1VF3 A;  1BJX A;  1WPI A;  3WT1 A;  2I1U A;  2LNS A;  4QL7 A;  3HZ4 A;  1A8L A;  4V2M A;  4NWY A;  4GTU A;  3M9J A;  2IWT A;  2A4H A;  1T3B A;  2QSI A;  4K2X A;  5D96 A;  5F05 A;  3A2V A;  4XHM A;  2GZP A;  4Q5R A;  4EE0 A;  3HD5 A;  3EC3 A;  3OR5 A;  1F37 A;  1JZD A;  3KMN A;  3F3Q A;  2MMN A;  1M9B A;  3A3T A;  4ZBA A;  4LL4 B;  2LST A;  4FYB A;  4XS4 B;  1GWC A;  1ACV A;  2RII A;  3CTF A;  1IYI A;  5D9V A;  1DSB A;  2HRN A;  4CDO A;  1UN2 A;  5D9X A;  3BOA A;  3IDV A;  2H30 A;  3LG6 A;  3L0H A;  4DSQ A;  4NXI A;  3EE2 A;  5KOX A;  3AY8 A;  4BVY A;  1ZOF A;  1T8E B;  5AGY A;  2CVD A;  4HJM A;  5LD0 A;  3TGZ A;  2JSZ A;  4D73 A;  2B6M A;  4K6X A;  3APS A;  1TOF A;  1FOH A;  3MIX A;  2K6V A;  1K3Y A;  6GSX A;  2R5G A;  1XPV A;  1S3A A;  5BMU A;  3CBU A;  2OE0 A;  2LJK A;  3IPZ A;  4GLT A;  5ECP B;  3M8N A;  1GSU A;  1YZX A;  1NSW A;  1AXD A;  2RM6 A;  2REM A;  4FYU A;  3PIN A;  2WJU A;  5DAK A;  2FA4 A;  4YAP A;  1PSQ A;  1R26 A;  3TRP A;  3UAR A;  4ECI A;  5ECQ B;  1RW1 A;  3CYN A;  3L78 A;  1OE7 A;  1DBY A;  3MSZ A;  4E8E A;  4GSN A;  3HDC A;  5A5K A;  3EYT A;  4DEJ A;  4HU9 A;  2B7J A;  2WZ9 A;  3TJB A;  2R0G A;  3BBY A;  3W8S A;  3KP9 A;  1IYH A;  4TVE A;  2GT5 A;  3F0I A;  2GVP A;  3KM6 A;  4ECJ A;  2XHF A;  14GS A;  1TRS A;  4IVF A;  1YDK A;  1C72 A;  3N5O A;  4P3Y B;  5DCH A;  2H75 A;  1TK8 B;  5JWQ B;  3GMF A;  2CZ2 A;  4ID0 A;  5HR3 A;  3ZMK A;  4DSS B;  4IW9 A;  1SK0 A;  4X1U A;  2L57 A;  1ZCP A;  4QL9 A;  4PX1 A;  4XS1 A;  2JAD A;  4V1A p;  3C73 A;  1WWJ A;  1FVK A;  5HFI A;  1EP8 A;  4PQH A;  2AYT A;  2LRN A;  2OJL A;  4IP1 A;  1XW5 A;  1U87 A;  3KZQ A;  3BD2 A;  1GTA A;  2FWE A;  3MWH A;  5HQP A;  2J23 A;  1FVJ A;  4WXT A;  3WYW A;  4L5L A;  2LEG A;  1XW9 A;  1XWK A;  3QPM A;  3ME7 A;  4KSO A;  1JFU A;  3QFA C;  3IXR A;  4Z2T A;  4KSM A;  5H5R A;  1OAZ A;  1X5E A;  2Z9S A;  3A5I A;  3DML A;  4OCF A;  5GAN D;  2IMD A;  2P31 A;  3IHQ A;  1CQG A;  4I97 A;  2L5L A;  1QUW A;  1O6J A;  5F0G A;  4ZBB A;  4MNN A;  2ZCT A;  2LRC A;  2YN1 A;  1PL1 A;  2HZE A;  1G7O A;  5DJM A;  2BTO T;  3IAM 2;  3D5J A;  2VOC A;  1OE8 A;  5LCZ A;  4O92 A;  1J08 A;  3G7Y A;  4MP4 A;  3NIV A;  1M99 A;  5C00 A;  3ZRD A;  1QQ2 A;  1TTZ A;  4I8B A;  2PVO C;  4PUF C;  2H1A A;  3DVX A;  2AAW A;  4ACS A;  3E9J B;  4XRA A;  3TKS A;  5JCG A;  1KNG A;  5DDL A;  1B4Q A;  4YKF A;  4OFN A;  2PUK C;  1A2J A;  1B9X C;  1Y6E A;  3A2X A;  1OC9 A;  2TIR A;  1YF1 A;  1TRW A;  2F8A A;  2DJ0 A;  20GS A;  4MH3 A;  2XPD A;  5HR1 A;  2VL3 A;  3QAV A;  1WMJ A;  2FUG 2;  1HNC A;  4RUV A;  2J9H A;  1TP9 A;  1QXH A;  5IMZ A;  1U3A A;  2JL4 A;  4BVX B;  5ENU A;  3IOS A;  2DIY A;  4Z2R A;  4XS6 A;  4OO4 A;  2KLX A;  4HJ2 A;  1Z7P A;  2I9H A;  3PPU A;  4L0W A;  1SU9 A;  1GTB A;  2A4V A;  1PN9 A;  2IMK A;  2TRX A;  3FRC A;  4TOP A;  3ZL5 A;  4G10 A;  3HYP A;  5EVO A;  1GLP A;  4N10 A;  1MEK A;  4NPB A;  2HT9 A;  4I6X A;  4PUR A;  2C0D A;  3RPN A;  3WD6 A;  2HE3 A;  2DML A;  1BX9 A;  2R0C A;  1EEM A;  3EWL A;  1YEP A;  4JE1 A;  1M2D A;  3D6I A;  2B7K A;  4AJ6 A;  3VFI A;  3C71 A;  2O89 A;  4AGS A;  3PH9 A;  2CZ3 A;  2AUV A;  4KA0 A;  2OBK A;  3ZZX A;  2FA8 A;  3GV1 A;  5IMV A;  17GS A;  4BVY B;  4ECB A;  1Z3E A;  4POM A;  4D73 B;  3VLN A;  1OKD A;  4G19 A;  3ZIJ A;  4MZB A;  3TUE A;  1AQX A;  2KP2 A;  3TKQ A;  5KN3 A;  4GRF A;  3IV4 A;  3GX8 A;  5H5Q A;  3RDW A;  4IKH A;  2X8H A;  3LXZ A;  5FT3 A;  2LUS A;  1SL1 B;  5DAK B;  2HSH A;  4EF0 A;  2DKH A;  3VWV A;  1ERW A;  1BED A;  5J9C A;  1QGV A;  1QFN A;  4F9Z A;  1O8X A;  3GRX A;  4KND A;  5HFG A;  2VCZ A;  4WEY A;  1WRY A;  5J9B A;  2GSS A;  5G30 A;  5AIX A;  3ERF A;  2VIM A;  4JED A;  2L4C A;  2MYG A;  4N11 A;  2I3Y A;  3H93 A;  2H6Y A;  3BCK A;  4JR4 A;  4DSS A;  6GSW A;  2I81 A;  19GS A;  4K2D A;  2IMI A;  1JLV A;  4J57 E;  2LRT A;  3ZFB A;  4F0B A;  5G31 A;  1GSQ A;  3FYG A;  2L5O A;  3TKS C;  4ECC A;  1O73 A;  3VPQ A;  4L0U A;  4V2L A;  2O8V B;  1OC3 A;  4ULX A;  2MZC A;  3H4K A;  4YH2 A;  4IN0 A;  1V57 A;  5AN1 A;  2XC2 A;  3F9U A;  3RBT A;  2ZNM A;  2G2Q A;  4O32 A;  5B8A A;  2V32 A;  1JHB A;  3QD9 A;  2L4Q A;  1T4Z A;  1BYE A;  1K0M A;  3ZYW A;  3FY7 A;  3UJ1 A;  2LTK A;  1YY7 A;  1B4P A;  3DWV A;  5HFK A;  1SEN A;  2E2G A;  4TN8 A;  3P2A A;  3S9F A;  2LJR A;  3CMI A;  2DMM A;  1EOG A;  1V2A A;  5E59 A;  3TJJ A;  2CV4 A;  5DAL A;  2H70 A;  2WDU A;  3HHV A;  1FHE A;  3F6D A;  4MCU A;  4GQF A;  1WP0 A;  2VUP A;  5ECH B;  1EOH A;  1GUH A;  2H0G A;  3FR3 A;  1QMV A;  4ISD A;  3G7I A;  4GSS A;  3QR6 A;  1JZW A;  2CT6 A;  5D73 A;  4JBB A;  3RHB A;  2DJ2 A;  2HNL A;  2A2S A;  3HVX A;  3CSI A;  2FGX A;  2M46 A;  1XW6 A;  2YJ7 A;  1Q98 A;  5CNW A;  2QA1 A;  4LLR A;  2C0G A;  2OE3 A;  2DJK A;  1J9B A;  5IIZ A;  4AJ7 A;  4GWR A;  1SD8 A;  2R3X A;  3TDG A;  4FIW A;  1GH2 A;  3IC8 A;  5CRG A;  3GST A;  3FW2 A;  4N0Z A;  4O5U A;  3C1R A;  5KN1 A;  1EP7 A;  1ZYN A;  1USB A;  2PGT A;  3I9V 2;  3WGX A;  2JU5 A;  1OC9 B;  2L6C A;  2K8S A;  5ECR B;  1ZYE A;  5J3R A;  5DBQ A;  1YEX A;  3FR6 A;  2YJH A;  1I5G A;  5DCG A;  4IEL A;  3FHK A;  3GX0 A;  1DUG A;  5IMC A;  2C0E A;  5CAX A;  1Y25 A;  2MMO A;  4PNG A;  3HJO A;  5A4V A;  18GS A;  3MYD A;  4HUA A;  3A2W A;  2OAC A;  3EMX A;  2IL3 A;  2VD1 A;  2JZT A;  1A8Y A;  2GQL A;  4MZW A;  3KD0 A;  4YKG A;  1A23 A;  5KN0 A;  4GXZ A;  1CQH A;  2YOI A;  3Q18 A;  1LU4 A;  2VCV A;  1TK5 B;  2X4A A;  1M9A A;  2YV9 A;  4MK3 A;  3Q74 A;  3LWA A;  3L9V A;  1XOB A;  1ABA A;  5CRE A;  4MJE A;  4ZL8 A;  1ML6 A;  1U6T A;  1MDK A;  1KTE A;  2LQQ A;  6GSS A;  5GSS A;  2IJY A;  2B5Y A;  1TU7 A;  3ZVJ A;  1F9M A;  1JLW A;  1F3A A;  3M9K A;  1TXX A;  3O3T A;  3P90 A;  2VLU A;  12GS A;  5KOW A;  5D93 A;  4MDC A;  2NBS A;  1H75 A;  4G0L A;  4O7H A;  1X9S B;  2DJJ A;  3QFB C;  3HJM A;  1HYU A;  4N30 A;  4X43 A;  4BL7 B;  2WS2 A;  1EZK A;  1NW2 A;  2ES7 A;  5HR0 A;  1V98 A;  2B5X A;  5FWG A;  1Z9H A;  2YWO A;  3IE3 A;  3GA4 A;  1SKS B;  2C3N A;  4POK A;  2E0Q A;  4KF9 A;  5LNK e;  1B48 A;  3U6V A;  2LQO A;  4NMU A;  2YWN A;  2NTO A;  2HRK A;  2A2R A;  5D8I A;  4F82 A;  3QOU A;  4KCA A;  4JRR A;  3FZ5 A;  3FKF A;  2VCT A;  1F3B A;  4EC0 A;  1TU8 A;  3KH9 A;  1AC1 A;  4Q5N A;  2ZUP A;  1K0B A;  2JZS A;  2EIO A;  2P5R A;  3ZFL A;  3F4T A;  4TR1 A;  5EL8 A;  1LJR A;  5IMF A;  1PKW A;  1F2E A;  5KEJ A;  6GSU A;  4OCE A;  4IP6 A;  1XWG A;  4ML1 A;  3DYR A;  1G6W A;  1PL2 A;  1AW9 A;  2IFQ B;  4ZIL A;  3UIW A;  4F2I A;  4CHS A;  1Z5Y E;  1O7U A;  3GUS A;  4X0X A;  4EDY A;  3LYP A;  2V1M A;  1GL8 A;  2BJX A;  2OA7 A;  4NHZ A;  3KH7 A;  3FK8 A;  5INY A;  3KXO A;  1XWA A;  1FB6 A;  3E0U A;  4KH7 A;  4HU7 A;  2VCW A;  2RUF A;  5DAL B;  2C80 A;  2V41 A;  3BCI A;  3EMP A;  2FWF A;  22GS A;  5CRD A;  2HSM A;  1X9W B;  3DEX A;  4OD7 A;  1V58 A;  3M0F A;  4EUY A;  2GS3 A;  3PR8 A;  1RQM A;  3UOM A;  3KIJ A;  4EVM A;  1X9M B;  2H1G A;  1E6B A;  5ECS A;  1S3C A;  4OFT A;  1PD2 1;  1TDI A;  2XPE A;  2YNX A;  4MMM A;  3GNJ A;  4WBJ A;  1X0R A;  3I43 A;  3CTG A;  3H1N A;  1PMT A;  1GRX A;  2UZ8 A;  2C3T A;  1VF4 A;  1ERT A;  2C3Q A;  2DBC A;  5ECI B;  2EIQ A;  2R4V A;  4I2T A;  4BWS A;  1A2M A;  4ILF A;  5ECK B;  9GSS A;  3FR9 A;  5FHI A;  1GUM A;  1FB0 A;  2TRC P;  2QKE A;  3IC4 A;  3VI5 A;  5ECN B;  1VF1 A;  2L6D A;  2NDO A;  1URM A;  5F06 A;  3TRX A;  2YV7 A;  4K9Z A;  1ZL9 A;  4XRD A;  3ISO A;  4G0I A;  3WGE A;  1SJ6 A;  2KUC A;  2CVK A;  2WB9 A;  2OBI A;  3J7Y k;  5GST A;  1A0F A;  4ZB6 A;  3WGD A;  4WF4 A;  2GSR A;  3DKS A;  3NOF A;  2VL2 A;  1XFL A;  4TXV A;  1R5A A;  2AV4 A;  3IK7 A;  3QDN A;  5IM9 A;  2H01 A;  3GYK A;  2PVQ A;  1YKA A;  1PX7 A;  4KAE A;  2QGV A;  1JZR A;  3TJF A;  5A4W A;  1NHO A;  2CAQ A;  1XZO A;  3FZA A;  2EC4 A;  3EPT A;  3EUR A;  1TW9 A;  1B8X A;  4K5S A;  4GF0 A;  1PN0 A;  3L9U A;  4G0K A;  2WFC A;  2PU9 C;  4K7N A;  4BL7 A;  4MLY A;  3PGT A;  4DVC A;  4ZL7 A;  1XVW A;  5B6M A;  5CYY A;  2R37 A;  4YAV A;  3IR4 A;  4WR5 A;  1GTU A;  1K0O A;  3GIX A;  4O5R A;  4WF5 A;  2YP6 A;  2F8F A;  5DJL A;  1HNA A;  5AIV A;  2H72 A;  3KTB A;  4V1A g;  4V2N A;  1TRU A;  2K9F A;  2FHE A;  2M72 A;  2MBS A;  4HOJ A;  2OAD A;  2KP1 A;  4J56 E;  3APQ A;  3F63 A;  2OE1 A;  2PWJ A;  5AIS A;  3SBC A;  3IA1 A;  3W6G A;  2DC5 A;  3DIE A;  2YWM A;  2K8V A;  4Z2U A;  5ABR A;  4MJC A;  3C7M A;  3QAG A;  5G5F A;  3ZIV A;  5J4U A;  2E7P A;  1QK8 A;  2LKU A;  1SKR B;  4LA1 A;  5JWO B;  1X5D A;  2M80 A;  1ST9 A;  1ERU A;  2YCD A;  5ID2 A;  5G5E A;  1MDI A;  1BQ7 A;  4RI6 A;  3G9B A;  1EGR A;  1GSS A;  1ZZY A;  2X99 A;  3L4N A;  3ZVJ D;  3GKN A;  4MF5 A;  1K0D A;  4Q5F A;  4AF2 A;  3TB2 A;  3TOU A;  4HEA 2;  1ILO A;  3O6T A;  2B1L A;  3LEF A;  1PGT A;  5GAP D;  3GH9 A;  2VCX A;  4HZ4 A;  4K7I A;  2RUE A;  1GTI A;  1HNB A;  2IFQ A;  2VAF A;  2GQM A;  1T4Y A;  4TR1 B;  5ELG A;  3F4S A;  2H0H A;  3ZIT A;  1T7P B;  3I6A A;  4RQR A;  4BWQ A;  3VUR A;  3HVS A;  4EIP A;  2B5E A;  3L9S A;  4WR4 A;  1PX6 A;  4KGI A;  5G2Z A;  3DVW A;  3EU3 A;  1XWB A;  2VLV A;  4KB3 A;  1YJ6 A;  1SK2 A;  1NHY A;  1WE0 A;  1XOA A;  1RK4 A;  2F51 A;  1VF2 A;  4IGJ A;  5KN2 A;  4ZB9 A;  2YZH A;  1PA3 A;  4TR3 A;  1K0A A;  3ZML A;  1Z7R A;  1A2L A;  4CW9 A;  1SL2 B;  2K18 A;  4CY6 A;  4IHU A;  3M3M A;  1ERV A;  3O76 A;  5JWR B;  2R0P A;  4NV2 A;  2VCQ A;  1FO5 A;  3VWU A;  2WRT A;  3F4R A;  3LJR A;  4G2E A;  2RM5 A;  2HI7 A;  2DKI A;  3FEU A;  3TKP A;  2VM1 A;  3KGK A;  4QQ7 A;  3GKK A;  3J7Y b;  1EV4 A;  1X5C A;  2GLR A;  1S3D A;  4PXO A;  1FW1 A;  2V6O A;  2VO4 A;  4IJI A;  3NZN A;  4WKW A;  5C04 A;  3CSJ A;  3HCZ A;  2CAI A;  2HYX A;  3BJ5 A;  3KP8 A;  1N2A A;  5ELA A;  2ON7 A;  3RAZ A;  2PER A;  3VWW A;  2DLX A;  4XIH A;  4OFM A;  2P0G A;  4KDX A;  3ERG A;  4ZB8 A;  5G1L A;  2C8U A;  3V1W A;  3Q6O A;  3W8J A;  5IMD A;  1GNE A;  3DXB A;  5EPF A;  4NHW A;  2H71 A;  4OWY A;  1M0U A;  1THX A;  3ZRE A;  1T1V A;  2FCH A;  4TR4 A;  3MAK A;  3GKM A;  2X49 A;  2HSY A;  3TJG A;  3KCM A;  4DSR A;  2WGR A;  2MMZ A;  2GTU A;  3JCM L;  4Q5Q A;  2R2J A;  1H4O A;  4PQI A;  4ZIJ A;  5CRH A;  3GUR A;  4A5P A;  3HKR A;  3M1G A;  3HJP A;  4NV5 A;  3MNG A;  1JZO A;  1NM3 A;  3C1S A;  4CY8 A;  5E4W A;  3G7J A;  3IK9 A;  2H73 A;  1SYR A;  4WET A;  5L71 A;  4TR0 A;  3U5R E;  4FYC A;  2PBJ A;  2IME A;  5F07 A;  4IS0 A;  2GSQ A;  1SJZ A;  4MF7 A;  3UBK A;  5IOX A;  1KEB A;  2D2Z A;  4MPF A;  1SL0 B;  3UAP A;  2HFD A;  1SKW B;  4GQC A;  5COH A;  1V40 A;  4K7O A;  2MBT A;  4K0G A;  4IQ1 A;  5BRT A;  4G9H A;  1U88 A;  3IAS 2;  1PQN A;  3LFL A;  1EGO A;  1A0R P;  2F3M A;  3GH6 A;  4XCS A;  3KEB A;  4E8H A;  4PQ1 A;  1V9W A;  1AQW A;  3RPP A;  4FO5 A;  3ERW A;  5ECM B;  1HQO A;  5D9W A;  4OMV A;  4ZL9 A;  1I9D A;  4HQZ A;  2HZF A;  4NAX A;  2CVB A;  1G7E A;  1GSY A;  1XCC A;  4MAB A;  4MH2 A;  4MA9 A;  5IO0 A;  5JCW A;  1WOU A;  2H74 A;  1O8W A;  3LXT A;  2JSY A;  2KHP A;  2CA8 A;  1GUL A;  1MDJ A;  5DQS A;  2V2G A;  4HS1 A;  3HXS A;  4PGT A;  5ECL B;  3R3E A;  2GZZ A;  3GTU A;  3DRN A;  3EIN A;  3IRA A;  1E2Y A;  5ID2 B;  5CP1 A;  1K3O A;  4O5Q A;  5EY6 A;  1TI1 A;  2XBI A;  2HRF A;  2H76 A;  3DGQ A;  3LGC A;  5B7C A;  2XBQ A;  2EIR A;  4K8M A;  3TKR A;  1GNW A;  4TXO A;  2H8L A;  3APO A;  2FWH A;  2LV3 A;  3VK9 A;  1M7T A;  4XTS A;  4PTS A;  3KTL A;  1SYX A;  1YKC A;  5IPH A;  3H8Q A;  3UVT A;  5D9T A;  1OYJ A;  4MF6 A;  2OKA A;  3D22 A;  3GN3 A;  3QAW A;  3R2Q A;  3ME8 A;  2FLS A;  1Q4J A;  1AIU A;  2H6X A;  1GSF A;  4AJ8 A;  2L59 A;  2I4A A;  3HZ8 A;  4IJ3 A;  8GSS A;  1SJI A;  4TKY A;  2VL9 A;  3A5W A;  3RHC A;  3VWX A;  1BG5 A;  4IBP A;  4X4J A;  1AAZ A;  3GSS A;  1GSD A;  3UL3 A;  2FY6 A;  4PNF A;  4ZBD A;  3GKX A;  1UVZ A;  1EWX A;  2YWI A;  4JU5 A;  3FMW A;  1M2A A;  1XBS A;  3GL3 A;  1ON4 A;  1O85 A;  4GCI A;  1TKD B;  2DJ3 A;  2P5Q A;  1VGL A;  2GT6 A;  10GS A;  1F6M C;  1OKT A;  2LJA A;  4EXJ A;  3CRT A;  2ON5 A;  1AUC A;  3GL5 A;  2LNT A;  4TRX A;  1EV9 A;  4EL1 A;  3I69 A;  5IMA A;  5HR2 A;  3F3R A;  4K5R A;  4KDY A;  3UBL A;  3K8N A;  2NPB A;  2O7K A;  3HA9 A;  3WT2 A;  2JZR A;  2PPT A;  3GFK A;  1ZGN A;  4LMV A;  2N5A A;  3ZLP A;  6GST A;  2BMX A;  5H5S A;  1ZMA A;  1J0F A;  4ICY A;  2CX3 A;  2ALB A;  1YQ1 A;  2H6Z A;  4LL1 B;  3D0Z A;  1TJD A;  1XXU A;  2AHE A;  2VM2 A;  4MZC A;  1DE1 A;  1N8J A;  2WUL A;  4FQU A;  5GZZ B;  6GSV A;  1U3I A;  1M2B A;  2CQ9 A;  2C1Y A;  2DJ1 A;  2IPA A;  5A4U A;  5F8B A;  3TOT A;  1OVN A;  5IO2 A;  1GSE A;  3TKS E;  1UC7 A;  4XS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...