4HU9A

E. coli thioredoxin variant with (4s)-fluoropro76 as single proline residue
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
107
Chain Sequence
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGACKMIAAILDEIADEYQGKLTVAKLNIDQNAGTAAKYGIRGITLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin-1
publication title (4R)- and (4S)-Fluoroproline in the Conserved cis-Prolyl Peptide Bond of the Thioredoxin Fold: Tertiary Structure Context Dictates Ring Puckering.
pubmed doi rcsb
source organism Escherichia coli
total genus 31
structure length 107
sequence length 108
ec nomenclature
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4hu9A00
3ISOA 2LQQA 2P5QA 1MTCA 1YEXA 2YJ7A 1OC9A 4JZQA 3KZQA 4GCIA 5IMVA 3FZ9A 3ERWA 1AW9A 2M72A 3ED3A 1XW6A 4OFTA 5HR1A 3Q6OA 4OO4A 2JU5A 2H1AA 1TRUA 3D22A 1TP9A 3QR6A 1XIYA 1PN9A 4YQUA 4PQHA 1VRSD 2LQOA 1PRXA 1O6JA 1BAYA 1JLVA 2B5YA 4RUVA 2H0GA 3A5WA 1O8WA 4GWRA 1BYEA 1H75A 2OBIA 2BTOT 1B9YC 2K8SA 3TUEA 3LG6A 1SU9A 3QFBC 3A3TA 2O7KA 3GFKA 3L0HA 1V2AA 1SK1A 5D93A 4YAPA 2CX3A 3C1RA 3GKNA 3CTGA 4LL4B 5D8IA 2I81A 2H01A 4FO5A 2MMOA 2TIRA 2YZUA 5J9CA 3GH9A 2DLXA 4MH3A 2LRCA 10GSA 5AN1A 1T3BA 1SJIA 5IM9A 4AJ7A 1O7UA 1YF0A 2DJJA 4OCFA 2VLUA 1XW5A 2DJ2A 4HJ2A 4F82A 4NV2A 2XBIA 2CV4A 3VK9A 4K8MA 5IMZA 2F51A 2MMAA 3GRXA 4XRDA 2MMZA 3GKXA 2CAIA 1X0RA 3HJPA 3PINA 3LWAA 3HYPA 2R5GA 1TK8B 2IPAA 5GZZB 3IAS2 1TK5B 1YEPA 1GNWA 5IMCA 1YF1A 2DMMA 2L6DA 4XIHA 4OCEA 5G2ZA 2VM1A 2F9SA 3ZIVA 1LU4A 2NDOA 4PUAA 3HD5A 1GLPA 5F05A 3F3QA 4AGSA 4PX1A 2LJKA 1EV4A 4ZL9A 2LS5A 4WBJA 2V6KA 2HYXA 3HKRA 3GH6A 5B6NA 2F8FA 3F6FA 4RI6A 4PXOA 2C0GA 2H1GA 4TKYA 1BG5A 4HS1A 4EVMA 4GQCA 1GSUA 2M80A 2VL9A 3JCML 3UOMA 2PBJA 5JWOB 3M8NA 1HNAA 1WWJA 5CRHA 3IRAA 1J9BA 5IO2A 5EL8A 5G5EA 4CW9A 3UVTA 1UN2A 4QQ7A 4K6XA 1AQXA 3GX0A 5A4WA 5IOWA 3LGCA 4ZB6A 2DSAA 4IBPA 3C7MA 1QQ2A 3L9VA 2QGVA 5F07A 3GL5A 4RI7A 5JWQB 4EO3A 3TCOA 3KP9A 12GSA 1A2JA 1TRWA 5FWGA 2VO4A 4MJCA 5D9WA 2E2MA 2JACA 4NPBA 2WDUA 2OE0A 3EE2A 1SJZA 2F3MA 3UBLA 4LLRA 2O89A 4WBRD 5FT3A 2RM5A 4XTSA 2IFQA 1U6TA 3BCIA 4LMWA 2PU9C 2QSIA 1A8LA 3L9SA 5ECQB 3ZMKA 6GSUA 4K7IA 2C80A 5AGYA 4MJEA 2LV3A 1R4WA 2OE3A 3IXRA 5DCHA 1B4QA 4G19A 1O8XA 1YDKA 2X8GA 3U5RE 1MEKA 4TR1B 3MWHA 4AF2A 1OKDA 4AJ8A 1T00A 1R5PA 4XS6A 2V32A 3O3TA 3H93A 4N0VA 4MABA 4GF0A 2DIYA 1UA5A 1UVZA 4NWYA 4PGTA 1MDIA 1SYRA 5ENUA 1PX7A 4V1Ap 5LNKe 1OC3A 4ILFA 2HNLA 1OC9B 2H1DA 2CX4A 1GL8A 1FVJA 5KN0A 3LYPA 3TKQA 3CRTA 3QMXA 5CRWA 4EE0A 5ECIB 1DE1A 4HZ4A 2GSTA 1FVKA 2XC2A 4ECCA 1GSEA 1YJ6A 3EINA 1NHOA 3TJGA 4LA1A 2IMDA 5HQPA 4IELA 2OA7A 4ECIA 4KDYA 1GSFA 5A4UA 3F8UA 2H19A 4PNFA 3IA1A 3KTLA 1TXXA 3FW2A 5HR3A 1J0FA 2C1YA 5DAKA 2MZCA 3UAPA 3Q18A 5D9VA 4MPFA 1K0BA 4G10A 2KUCA 1Q98A 3F9UA 1XPVA 5ABRA 5KN2A 2I9HA 4JR6A 2HRNA 3SBCA 3WD6A 1SK2A 3HVXA 4BWQA 3KH9A 2O87A 1YKAA 2AAWA 4BPYA 2VL2A 3QFAC 5JCWA 3ZZXA 1PKZA 1S3AA 1W4VA 2X64A 1XWBA 1TRVA 3DGQA 2TRCP 1F3AA 2L59A 4JU5A 4DVCA 3WGEA 1OYJA 5IOXA 4J2FA 3GHAA 1Z3EA 2HXKA 1QK8A 3TRPA 4HEA2 2FWHA 5GSTA 3H4KA 4X43A 2ZNMA 5IMFA 5CNWA 3G7IA 4K2DA 16GSA 1M9BA 4N0ZA 4Z7XA 3UL3A 4GSNA 3S9FA 4GLTA 3TKRA 1EZKA 1BQ7A 4YQVA 2J23A 1EEJA 2I4AA 1F2EA 4O7HA 1NW2A 3BOAA 2ON5A 3A2WA 3IE3A 1JZRA 4EF0A 1F9MA 3LFLA 2LSTA 1T7PB 1SL1B 4EDZA 2GT5A 2OACA 9GSSA 5G30A 2HFDA 4GSSA 20GSA 5CREA 3M0FA 5G1LA 2CZ3A 1M0UA 3D5JA 3QAWA 2PVOC 3WT1A 1ERTA 3F6DA 1V57A 4EL1A 5A4VA 1X9WB 1UC7A 2FCHA 3IAM2 5HR0A 1E2YA 3CMIA 2PN8A 1G7OA 1OKTA 2HE3A 3GSTA 3HJOA 1PA3A 2VOCA 3US3A 2FWGA 3IV4A 2C8UA 2MYGA 1V58A 3EWLA 4KUNA 1EGRA 4EUYA 4J56E 3C8EA 4X1UA 1ERWA 2DJ3A 2GS3A 4IQ1A 5HFGA 3LORA 3DXBA 1T1VA 4MCUA 3RHBA 2A2RA 5D9XA 2HSYA 1K0CA 2GZZA 3TOUA 2K8VA 1QUWA 3QDNA 3P90A 2JZRA 2YWNA 2MBSA 2L4QA 2VD1A 1EOHA 3GX8A 3ZRDA 1ZYQB 3LXTA 2PUKC 1ERVA 3HDCA 1PKWA 3HZ8A 5IO0A 3VPTA 3J7Yb 1FHEA 1XW9A 4IQAA 3DMLA 2K18A 4I8BA 3F4SA 2NPBA 1VF2A 4I5QA 5CP1A 2YWIA 3GUSA 2B7JA 2DIZA 4EKZA 2GZYA 3O6TA 1FW1A 5ID2A 4Q5QA 2BJXA 3ZFLA 1G7EA 14GSA 3LXZA 5IMAA 5J4UA 1ZYEA 2GT6A 4NAXA 4J57E 1JLWA 4FYUA 2HZEA 3DVWA 3KH7A 3FY7A 3NIVA 5H5RA 1EP8A 1TRSA 1GUMA 2P0GA 2GSRA 1GTIA 2PWJA 4TN8A 3ZREA 3H8QA 4OD7A 2IFQB 3BBYA 4FYCA 3KIJA 4V2NA 5JCGA 4KB3A 4O92A 2B6MA 4MF6A 3P2AA 2E2GA 5H5SA 1XVQA 4WEYA 4HU7A 1FAAA 4MF5A 1F6MC 1K0DA 1I9DA 3VFIA 5CO3A 4K0NA 4MZBA 1PD21 3FEUA 2MBTA 3WGXA 1X5DA 2OJLA 1FOVA 1WOUA 4MP4A 5DJMA 2H6XA 1S3DA 6GSSA 3TRQA 2R4VA 4YQMA 4MZCA 4PUFC 4K7NA 2P31A 2IL3A 3FZ5A 3M3MA 4POLA 5EY6A 3NOFA 2FLSA 3WT2A 2H73A 1GTAA 1ACVA 2FY6A 4AJ6A 3I9V2 4IJ3A 2NBSA 2XPEA 1Z9HA 3ZFBA 3FR6A 5CAXA 4YAVA 1QXHA 2GZPA 4XS4A 3KJYA 1XWCA 4QL9A 4FYBA 2B5EA 2YV7A 3EURA 2MMNA 3VPQA 2H70A 2WS2A 2FA4A 3HVSA 2HI7A 1JHBA 2CZ2A 2C4JA 1VGLA 3KD0A 3RHCA 2FNOA 2HT9A 2JZSA 4O32A 1K3OA 1MDJA 5DAKB 5F8BA 5GSSA 1FB0A 3PR8A 1A8YA 4TXVA 4E8HA 1A2MA 4KCAA 1VF4A 1CQGA 4ZBAA 3J7Yk 1TOFA 4WR5A 5ECRB 1OAZA 1K0NA 2IIYA 5INYA 1Y6EA 1WIKA 1R26A 1X9SB 1GSSA 4K9ZA 3FK8A 4IGJA 3GKMA 4WXTA 2CVKA 2KP2A 3CYNA 4WETA 4DSSA 4D73A 3KXOA 1X5EA 3UBKA 1GULA 5ECNB 1GSYA 4PQIA 2IWTA 3CRUA 3RPPA 2VAFA 1JZWA 1V98A 1HQOA 2NVLA 2H66A 4GTUA 2IN3A 3PGTA 1GSDA 3DIEA 2GDRA 2O85A 3E3EA 2KLXA 2B3SA 4KE3A 3UJ1A 3VWXA 4POKA 1F37A 2FGXA 3KEBA 3A2XA 1EP7A 4GRFA 3TJKA 1R5AA 2JADA 5GAND 3VLNA 2E0QA 2VLTA 4BVYA 3LJRA 1ON4A 2G2QA 1A2LA 1TI3A 5ECSA 4HQSA 3D0ZA 4HDEA 3F4TA 3I6AA 3D4TA 2ES7A 5G5FA 4BA7A 2FD3A 2C3QA 1U88A 2TRXA 3KP8A 1SKSB 4ACSA 3LQ7A 1M2DA 4KNDA 3GTUA 2YCDA 5HR2A 3F0IA 1TK0B 2AUVA 1YZXA 2J9HA 3APQA 3EVIA 1GNEA 2JSYA 3KCMA 4V1Ag 3APOA 2YNXA 2CVBA 3K8NA 2WCIA 1ST9A 3SWLA 1T4YA 3IPZA 1G6YA 1URMA 1N8JA 3FR3A 4XHMA 4F03A 4ZXGA 6GSYA 1V9WA 1WRYA 3EYTA 4XRAA 1VF3A 3F3RA 3GV1A 4FH8A 2HRFA 4MK3A 1LBKA 3D6IA 3LSZA 1A0FA 5C00A 1XBSA 4IJIA 1EWXA 4HOJA 4MMMA 3KGKA 5DALB 2KP1A 1YY7A 4I2TA 3GMFA 3TKSC 2H0HA 2GLRA 1PGTA 3N5OA 2LNTA 1KNGA 2H75A 4ULXA 1S3CA 4P3YB 5GAPD 1HNCA 5ID2B 1Z6NA 2LEGA 1FB6A 2H8LA 3G7YA 3TRXA 5DJLA 1HNBA 3HZ4A 2L6CA 2HZEB 4WF4A 1W89A 4WKWA 3KMOA 2O8VB 4KH7A 3HVVA 2JSZA 2CQ9A 11GSA 2YOIA 4Q5NA 2N5FA 5ECOB 2F8AA 1Z7RA 1DE2A 2ZUPA 5J9BA 2X99A 1PL2A 4N11A 2HZFA 3DKSA 5ECMB 3EU3A 3GN3A 4HJMA 1XVWA 3TOTA 4KSOA 3VWWA 4NMUA 5AIXA 3QD9A 2PGTA 5COHA 1A0RP 1GUHA 3RDWA 2GQMA 1QFNA 1GP1A 6GSWA 3TKPA 2NTOA 2YZHA 1THOA 4O5RA 13GSA 1VF1A 3M9KA 5DCGA 4X0XA 3MDKA 2WZ9A 4H86A 3VWUA 3OR5A 2H76A 4GSTA 5IPHA 2DJ0A 3D4MA 1GTBA 6GSTA 1LJRA 3C71A 5J5NA 1GSQA 5DDLA 1XXUA 4TR0A 1WPIA 1TU7A 4L0WA 5D73A 2L57A 3KTBA 2K6VA 3FZAA 1QMVA 5FHIA 2H6ZA 1ZOFA 3F4RA 4XS4B 2ON7A 1IYHA 1SJ6A 4MZWA 2H1BA 3RBTA 1M99A 4HU9A 4IHUA 1GH2A 5LD0A 5IIZA 1AUCA 3L78A 4V2LA 2VUPA 1SKRB 1DSBA 2LJAA 1AAZA 2LNSA 1XZOA 4MPGA 4MDCA 1OVNA 2D2ZA 3APSA 2CA8A 1TJDA 2REMA 4KSMA 2R6KA 2H74A 3CTFA 2B7KA 4DSQA 2GTUA 2XBQA 2JL4A 4Q5FA 2ZCTA 4DSRA 3UARA 2KOKA 3ZYWA 3ZL5A 4DSSB 4PQ1A 3FHKA 4XS1A 4KAEA 2I3YA 4V2MA 2H71A 2VCQA 5G1KA 1X5CA 4ISDA 1K3LA 3DVXA 3HXSA 1PX6A 5DQYA 4WR4A 1YQ1A 1NHYA 1J08A 2R37A 5D9TA 3HY2A 2X8HA 3ZTLA 3ERFA 2AV4A 4K0GA 2FWEA 5G31A 4NHZA 4IN0A 4BVXA 3IHQA 1KEBA 2C3NA 4ZB8A 2OE1A 2DJKA 2VLVA 2RUFA 2V1MA 2PMTA 5H5QA 2B5XA 2V6OA 1SL0B 4ZBDA 3L9UA 19GSA 4ZIJA 2EIOA 1O81A 4NHWA 3EMPA 4IP1A 1A23A 1ML6A 2CAQA 5ELAA 1SENA 1Z7PA 1N2AA 2FHEA 2AJQB 4ML6A 4WF5A 2IJYA 2LKUA 1DBYA 4EXJA 5B6MA 1HD2A 4TR3A 3ZVJD 5EPFA 3GTUB 5ECLB 1M9AA 1RW1A 2KHPA 3FKFA 2OADA 1PMTA 2ALBA 2VM2A 1U87A 4BL7A 1BX9A 4LL1B 4F2IA 5B8AA 4F0CA 1K0MA 3HCZA 5LCZA 4IP6A 3GURA 1GUKA 5D96A 4HZ2A 1B8XA 4DEJA 2LJRA 1F3BA 4KX4A 4KW6A 4NXIA 4KGIA 1PSQA 3UEMA 1EEMA 2LRTA 5B7CA 3ZMLA 1R7HA 3FZ4A 5B8BA 3P8WA 4MF7A 1U3IA 3FR9A 3KMNA 2EC4A 5ECPB 5KEJA 4IVFA 4XCSA 3TJJA 2YANA 4POMA 1SKWB 4F0BA 5JWRB 4L0UA 3VI5A 1KBNA 3C1SA 7GSSA 4ZILA 1PL1A 1XOAA 4MA9A 1Y25A 2A4VA 3IK9A 1X9MB 1USBA 2WJUA 4IKHA 3TJBA 3A2VA 1MD3A 3EC3A 3W8JA 3DEXA 2R2JA 3IDVA 1KTEA 2FUG2 3M9JA 2G0FA 1ERUA 5CRDA 1BEDA 1M2AA 2L4CA 3CSIA 2VD0A 2DBCA 5KN1A 1ZMAA 4TR4A 3IBHA 1ILOA 3TKSA 1OE8A 2VCZA 1G0TA 4GXZA 2X8CA 4JEDA 2VCVA 2AB6A 4Q5RA 3F63A 5JCUA 2YV9A 4N30A 5J41A 3CXGA 1A24A 1I5GA 2YWOA 2IMIA 1ZL9A 1FG4A 2I1UA 5F06A 3ME7A 4OFMA 4PURA 2L5OA 3GNJA 3ZITA 3QAGA 1MDKA 2B1KA 3H1NA 3MAKA 4TVEA 3D21A 2DJ1A 1XOBA 1QGVA 1SL2B 1THXA 1WP0A 5A5KA 3C73A 2WB9A 5E4WA 3TGZA 4POBA 2DC5A 1T4ZA 2V2GA 4TXOA 3E0UA 3RAZA 3AY8A 1XWAA 1JFUA 2GVPA 4HI7A 1O73A 3R2QA 3ME8A 3GKKA 2C0DA 1E6BA 2P5RA 4GQFA 1U3AA 2C0EA 3I69A 1Z5YE 1ZCPA 1XCCA 3VI7A 2M46A 3FRCA 4EDYA 4OMVA 4CDOA 3DD3A 1GRXA 3TJFA 5C04A 2E7PA 2LUSA 5DQSA 4IS0A 5ELGA 2JZTA 4KA0A 1GLQA 2WULA 2PVQA 2H72A 2PPTA 4E8EA 3QAVA 4HQZA 5DVBA 3QOUA 3PH9A 3V1WA 1CQHA 1XFLA 1YKCA 2HLSA 1ZZYA 3U6VA 5ECHB 3G9BA 2VCWA 2FWFA 5KN3A 3VURA 6GSVA 5F0GA 1TI1A 2AYTA 4OWYA 3VWVA 3W6GA 3QPMA 2EIQA 4ZBBA 4I6XA 2L5LA 2YJHA 2A2SA 4I2UA 3EU4A 1TW9A 4NV5A 1JZDA 3DYRA 4EC0A 1K0AA 2RIIA 2YP6A 5HFIA 5EVOA 1HYUA 3GA4A 1DUGA 3G7JA 4K7OA 2IMEA 3O76A 1IYIA 4TOPA 2N5AA 3NZNA 3IC4A 5CRGA 2B1LA 1NSWA 2Z9SA 4MH2A 1ABAA 2YN1A 3EMXA 4RQRA 2YWMA 2H6YA 1Q4JA 3HA9A 5AISA 3IK7A 3TDGA 4OFNA 4PNGA 22GSA 1EGOA 3Q19A 2EIRA 4ZL7A 1SD9A 2LRNA 1G6WA 3MSZA 4JRRA 4JBBA 5ECKB 1TDIA 1M7TA 5CYYA 3H79A 2C3TA 2VCXA 1K3YA 3W8SA 1K0OA 4TRXA 1TKDB 3HHVA 3DWVA 1AXDA 1M2BA 4CHSA 3I43A 3GIXA 2DMLA 3LEFA 1TU8A 3RPNA 3GL3A 2FA8A 3UVHA 3CBUA 3E9JB 1GTUA 5E59A 1SD8A 5HFKA 2IMFA 5IPGA 2XPDA 4JE1A 2VL3A 1T8EB 4HUAA 5DBQA 8GSSA 2GSQA 2QKEA 2RM6A 3IR4A 1OC8A 1WJKA 3ZLPA 4FIWA 5AIVA 2WFCA 2PERA 3GYKA 4MJBA 1JZOA 3TB2A 1B4PA 3M1GA 2GQLA 3P7XA 3GSSA 1GWCA 4F9ZA 1ZGNA 4N10A 5IQYA 2C0FA 2GGTA 4ZL8A 1NM3A 4JR4A 4KDXA 3N9JA 2YPMA 2QC7A 1TTZA 4K1FA 3MNGA 2K9FA 1B48A 18GSA 1O85A 2HSHA 3LYKA 1B9XC 4TW5A 2H30A 4L8EA 5IMDA 3UMAA 3BCKA 3CSJA 3HJMA 3L4NA 2GQKA 3BJ5A 4D73B 4YH2A 2N5BA 2BMXA 1AQVA 2GSSA 4KDUA 5J3RA 4MLYA 2CT6A 2H0IA 1BJXA 3ERGA 1RK4A 1MD4A 1AIUA 4ECBA 4L5OA 1C72A 2XHFA 4OO5A 1SYXA 3WYWA 2OBKA 3TKSE 3UIWA 1SK0A 3IOSA 1XWGA 4RQXA 2OKAA 4TXOB 3CSHA 3FYGA 2AHEA 4IW9A 2IMKA 5L71A 2VIMA 4ID0A 17GSA 4LMVA 3Q74A 2VCTA 2LTKA 4G2EA 3ZVJA 3DRNA 2R3XA 4KCEA 4ECJA 2CVDA 4ZB9A 4BWSA 6GSXA 3WGDA 4ML1A 1AQWA 1EOGA 1V40A 3KM6A 2WRTA 4I97A 4G9HA 2V41A 1WMJA 1FO5A 1H4OA 1WE0A 1PQNA 1AC1A 1OE7A 1RQMA 3QCPA 5DALA 4TR1A 1EV9A 2RUEA 3BD2A 4MJAA 2WGRA 1XWKA 4L5LA 2VL2C 2RLIA 3ZIJA 1Z6MA 4QL7A
chains in the Genus database with same CATH superfamily
3ISOA 2LQQA 4O5QA 2P5QA 1MTCA 1YEXA 2YJ7A 1OC9A 4JZQA 3KZQA 4GCIA 5IMVA 3FZ9A 3ERWA 1AW9A 2M72A 4HSCX 3ED3A 1XW6A 4OFTA 5HR1A 3Q6OA 4OO4A 2JU5A 2H1AA 1TRUA 3D22A 1TP9A 3QR6A 1XIYA 1PN9A 4YQUA 4PQHA 1VRSD 2LQOA 1PRXA 1O6JA 1BAYA 1JLVA 2B5YA 4RUVA 2H0GA 3A5WA 1O8WA 4GWRA 1BYEA 1H75A 2OBIA 2BTOT 1B9YC 2K8SA 3TUEA 3LG6A 1SU9A 3QFBC 3A3TA 2O7KA 3GFKA 3L0HA 1V2AA 1SK1A 5D93A 4YAPA 2CX3A 3C1RA 3GKNA 3CTGA 4LL4B 5D8IA 2I81A 2H01A 4FO5A 2MMOA 2TIRA 2YZUA 5J9CA 3GH9A 2DLXA 4MH3A 2LRCA 10GSA 5AN1A 1T3BA 1SJIA 4USSA 5IM9A 4AJ7A 1O7UA 1YF0A 2DJJA 4OCFA 2VLUA 1XW5A 2DJ2A 4HJ2A 4F82A 4NV2A 2XBIA 2CV4A 3VK9A 4K8MA 5IMZA 2F51A 2MMAA 3GRXA 4XRDA 2MMZA 3GKXA 1ZYPA 2CAIA 1X0RA 3HJPA 3PINA 3LWAA 3HYPA 2R5GA 1TK8B 2IPAA 5GZZB 3IAS2 1TK5B 1YEPA 1GNWA 5IMCA 1YF1A 2DMMA 2L6DA 4XIHA 4OCEA 5G2ZA 2VM1A 2F9SA 3ZIVA 1LU4A 2NDOA 4PUAA 3HD5A 1GLPA 5F05A 3F3QA 4AGSA 4PX1A 2LJKA 1EV4A 4ZL9A 2LS5A 4WBJA 2V6KA 2HYXA 3HKRA 3GH6A 5B6NA 2F8FA 3F6FA 4RI6A 4PXOA 2C0GA 2H1GA 4TKYA 1BG5A 4HS1A 4EVMA 4GQCA 1GSUA 2M80A 2VL9A 3JCML 3UOMA 2PBJA 5JWOB 3M8NA 1HNAA 1WWJA 5CRHA 3IRAA 1J9BA 5IO2A 5EL8A 5G5EA 4CW9A 3UVTA 1UN2A 4QQ7A 4K6XA 1AQXA 3GX0A 5A4WA 5IOWA 3LGCA 4ZB6A 2DSAA 4IBPA 4Z2TA 3C7MA 1QQ2A 3L9VA 2QGVA 5F07A 3GL5A 4RI7A 5JWQB 2A4HA 4EO3A 3TCOA 3KP9A 12GSA 1A2JA 1TRWA 5FWGA 2VO4A 4MJCA 5D9WA 2E2MA 2JACA 4NPBA 2WDUA 2OE0A 3EE2A 1SJZA 2F3MA 3UBLA 4LLRA 2O89A 4WBRD 5FT3A 2RM5A 4XTSA 2IFQA 1U6TA 3BCIA 4LMWA 2PU9C 2QSIA 1A8LA 3L9SA 5ECQB 3ZMKA 6GSUA 4K7IA 2C80A 5AGYA 4MJEA 2LV3A 1R4WA 2OE3A 3IXRA 5DCHA 1B4QA 4G19A 1O8XA 1YDKA 2X8GA 3U5RE 2R0CA 1MEKA 4TR1B 3MWHA 4AF2A 1OKDA 4AJ8A 1T00A 1R5PA 4XS6A 2V32A 3O3TA 3H93A 4N0VA 4MABA 4GF0A 4EIQA 2DIYA 1UA5A 1UVZA 4G0IA 4NWYA 4PGTA 1MDIA 1SYRA 5ENUA 1PX7A 4V1Ap 5LNKe 1OC3A 4ILFA 2HNLA 1OC9B 2H1DA 2CX4A 1GL8A 1FVJA 5KN0A 3LYPA 3TKQA 3CRTA 3QMXA 5CRWA 4EE0A 5ECIB 1DE1A 4HZ4A 2GSTA 1FVKA 2XC2A 4G0LA 4ECCA 1GSEA 1YJ6A 3EINA 1NHOA 3TJGA 4LA1A 2IMDA 5HQPA 4IELA 2OA7A 4ECIA 4KDYA 1GSFA 5A4UA 3F8UA 2H19A 4PNFA 3IA1A 3KTLA 1TXXA 3FW2A 5HR3A 1J0FA 3LW9A 2C1YA 5DAKA 2MZCA 3UAPA 3Q18A 5D9VA 4MPFA 1K0BA 4G10A 2KUCA 1Q98A 3F9UA 1XPVA 3EPTA 5ABRA 5KN2A 2I9HA 4JR6A 2HRNA 3SBCA 3WD6A 1SK2A 3HVXA 4BWQA 3KH9A 2O87A 4X4JA 1YKAA 2AAWA 4BPYA 2VL2A 3QFAC 5JCWA 3ZZXA 1PKZA 1S3AA 1W4VA 2X64A 1XWBA 1TRVA 3DGQA 2TRCP 1F3AA 2L59A 4JU5A 4DVCA 4KF9A 1OYJA 3WGEA 5IOXA 4J2FA 3GHAA 1Z3EA 2HXKA 1QK8A 3TRPA 4HEA2 2FWHA 5GSTA 3H4KA 4X43A 2ZNMA 5IMFA 5CNWA 3G7IA 4K2DA 16GSA 1M9BA 4N0ZA 4Z7XA 3UL3A 4GSNA 3S9FA 4GLTA 3TKRA 1EZKA 1BQ7A 4YQVA 2J23A 1EEJA 2I4AA 1F2EA 4O7HA 1NW2A 3BOAA 2ON5A 3A2WA 3IE3A 1JZRA 4EF0A 1F9MA 3LFLA 2LSTA 1T7PB 1SL1B 4EDZA 2GT5A 2OACA 9GSSA 5G30A 2HFDA 4GSSA 20GSA 5CREA 3M0FA 5G1LA 2CZ3A 1M0UA 3D5JA 3QAWA 2PVOC 3WT1A 1ERTA 3F6DA 1V57A 4EL1A 5A4VA 1X9WB 1UC7A 2FCHA 3IAM2 5HR0A 1E2YA 3CMIA 2PN8A 1G7OA 1OKTA 2HE3A 3GSTA 3HJOA 1PA3A 2VOCA 3US3A 2FWGA 3IV4A 2C8UA 2MYGA 1V58A 3EWLA 4KUNA 1EGRA 4K2XA 4EUYA 4J56E 3C8EA 4X1UA 1ERWA 2DJ3A 2GS3A 4IQ1A 5HFGA 3LORA 3DXBA 1T1VA 3CQFA 4MCUA 3RHBA 2A2RA 5D9XA 2HSYA 1K0CA 2GZZA 3TOUA 2K8VA 1QUWA 3QDNA 3P90A 2JZRA 2YWNA 2MBSA 2L4QA 2VD1A 1EOHA 3GX8A 3ZRDA 1ZYQB 3LXTA 2PUKC 1ERVA 4A5PA 3HDCA 1PKWA 3HZ8A 5IO0A 3VPTA 3J7Yb 1FHEA 4G0KA 1XW9A 4IQAA 3DMLA 2K18A 4I8BA 3F4SA 2NPBA 1VF2A 4I5QA 5CP1A 2YWIA 3GUSA 2B7JA 2QA2A 2DIZA 4EKZA 2GZYA 3O6TA 1FW1A 5ID2A 4Q5QA 2BJXA 3ZFLA 1G7EA 14GSA 3LXZA 5IMAA 4K5RA 1ZYEA 5J4UA 2GT6A 4NAXA 4J57E 1JLWA 4FYUA 2HZEA 3DVWA 3KH7A 3FY7A 3NIVA 5H5RA 1EP8A 1TRSA 1GUMA 2P0GA 2GSRA 1GTIA 2PWJA 4TN8A 3ZREA 3H8QA 4OD7A 2IFQB 3BBYA 4FYCA 3KIJA 4V2NA 5JCGA 4KB3A 4O92A 2B6MA 4MF6A 3P2AA 2E2GA 5H5SA 1XVQA 4WEYA 4HU7A 1FAAA 4MF5A 1F6MC 1K0DA 1I9DA 4K5SA 3VFIA 5CO3A 4K0NA 4MZBA 1PD21 3FEUA 2MBTA 3WGXA 5KOWA 1X5DA 2OJLA 1FOVA 1WOUA 4MP4A 5DJMA 2H6XA 1S3DA 6GSSA 3TRQA 2R4VA 4YQMA 4MZCA 5BMUA 4PUFC 2UZ8A 4K7NA 2P31A 2IL3A 3FZ5A 3M3MA 4POLA 5EY6A 3NOFA 2FLSA 3WT2A 2H73A 1GTAA 1ACVA 2FY6A 4AJ6A 3I9V2 4IJ3A 2NBSA 2XPEA 1Z9HA 3ZFBA 3FR6A 5CAXA 4YAVA 1QXHA 4XS4A 2GZPA 3KJYA 1XWCA 4QL9A 4FYBA 2B5EA 2YV7A 3EURA 2MMNA 3VPQA 2H70A 2WS2A 2FA4A 3HVSA 2HI7A 1JHBA 2CZ2A 2C4JA 1VGLA 3KD0A 3RHCA 2FNOA 2HT9A 2JZSA 4O32A 1K3OA 1MDJA 5DAKB 5F8BA 5GSSA 1FB0A 3PR8A 1A8YA 4TXVA 4E8HA 1A2MA 4KCAA 1VF4A 1CQGA 4ZBAA 3J7Yk 1TOFA 4WR5A 5ECRB 1OAZA 1K0NA 2IIYA 5INYA 1Y6EA 1WIKA 1R26A 1X9SB 2DKHA 1GSSA 4K9ZA 3FK8A 4IGJA 3GKMA 3A5IA 4WXTA 2CVKA 3R3EA 2KP2A 3CYNA 2QA1A 4WETA 4DSSA 4D73A 3KXOA 1X5EA 3UBKA 1GULA 5ECNB 1GSYA 4PQIA 2IWTA 3CRUA 3RPPA 2VAFA 1JZWA 1V98A 1HQOA 2NVLA 2H66A 4GTUA 2IN3A 3PGTA 1GSDA 3DIEA 2GDRA 2O85A 3E3EA 2KLXA 2B3SA 4KE3A 3UJ1A 3VWXA 4POKA 4MNNA 1F37A 2FGXA 3KEBA 3A2XA 1EP7A 4GRFA 3FMWA 3TJKA 1R5AA 4Z2RA 2JADA 5GAND 3VLNA 2E0QA 2VLTA 4BVYA 3LJRA 4BIKA 1ON4A 2G2QA 1A2LA 1TI3A 5ECSA 4HQSA 3D0ZA 4HDEA 3F4TA 3I6AA 3D4TA 2ES7A 5G5FA 4BA7A 2FD3A 2C3QA 1U88A 2TRXA 3KP8A 1SKSB 4ACSA 2HSMA 3LQ7A 1M2DA 4KNDA 3GTUA 2YCDA 5HR2A 3F0IA 1TK0B 2AUVA 1YZXA 2J9HA 3APQA 3EVIA 1GNEA 2JSYA 3KCMA 4V1Ag 3APOA 3MYDA 2YNXA 2CVBA 3K8NA 2WCIA 1ST9A 3SWLA 1T4YA 3IPZA 1G6YA 1URMA 1N8JA 3FR3A 4XHMA 4F03A 4ZXGA 6GSYA 1V9WA 1WRYA 3EYTA 4XRAA 1VF3A 3F3RA 3GV1A 4FH8A 2HRFA 4MK3A 1LBKA 3D6IA 3LSZA 1A0FA 5C00A 1XBSA 4IJIA 1EWXA 4HOJA 4MMMA 3KGKA 5DALB 2KP1A 1YY7A 4I2TA 3GMFA 3TKSC 2H0HA 2GLRA 1PGTA 3N5OA 2LNTA 1KNGA 2H75A 4ULXA 1S3CA 4P3YB 5GAPD 1HNCA 5ID2B 1Z6NA 2LEGA 1FB6A 2H8LA 3G7YA 3TRXA 5DJLA 1PN0A 1HNBA 3HZ4A 2L6CA 2HZEB 4WF4A 1W89A 4WKWA 3KMOA 2O8VB 4KH7A 2HRAA 3HVVA 2JSZA 2CQ9A 11GSA 2YOIA 4Q5NA 2N5FA 5ECOB 2F8AA 1Z7RA 1DE2A 2ZUPA 5J9BA 2X99A 1PL2A 4N11A 2HZFA 3DKSA 5ECMB 3EU3A 3GN3A 4HJMA 1XVWA 3TOTA 4KSOA 3VWWA 4NMUA 5AIXA 3QD9A 2PGTA 5COHA 4PTSA 1A0RP 1GUHA 3RDWA 2GQMA 1QFNA 1GP1A 6GSWA 3TKPA 2NTOA 2YZHA 1THOA 4O5RA 13GSA 1VF1A 3M9KA 4X0XA 3MDKA 5DCGA 2WZ9A 4H86A 3VWUA 3OR5A 2H76A 4GSTA 5IPHA 2DJ0A 3D4MA 1GTBA 6GSTA 1LJRA 3C71A 5J5NA 1GSQA 5DDLA 1XXUA 4TR0A 1WPIA 1TU7A 4L0WA 5D73A 2L57A 3KTBA 2K6VA 3FZAA 1QMVA 5FHIA 2H6ZA 1ZOFA 3F4RA 4XS4B 2ON7A 1IYHA 1SJ6A 4MZWA 2H1BA 3RBTA 1M99A 4HU9A 4IHUA 1GH2A 5LD0A 5IIZA 1AUCA 3L78A 4V2LA 2VUPA 1SKRB 1DSBA 2LJAA 1AAZA 2LNSA 1XZOA 4MPGA 4MDCA 1OVNA 2D2ZA 3APSA 2CA8A 1TJDA 2REMA 1PFOA 4KSMA 2R6KA 2H74A 3CTFA 2B7KA 4DSQA 2GTUA 2XBQA 2JL4A 4Q5FA 2ZCTA 4DSRA 3UARA 2KOKA 3ZYWA 3ZL5A 4DSSB 4PQ1A 3FHKA 4XS1A 4KAEA 2I3YA 4V2MA 2H71A 2VCQA 5G1KA 1X5CA 4ISDA 1K3LA 3DVXA 3HXSA 1PX6A 5DQYA 4WR4A 1YQ1A 1NHYA 1J08A 2R37A 5D9TA 3HY2A 2X8HA 3ZTLA 3ERFA 2AV4A 1M3IA 4K0GA 2FWEA 5G31A 4NHZA 4IN0A 4BVXA 3IHQA 1KEBA 2C3NA 4FQUA 4ZB8A 2OE1A 2DJKA 2VLVA 1FOHA 3MIXA 2RUFA 2V1MA 2PMTA 5H5QA 2B5XA 2V6OA 4BVYB 1SL0B 4ZBDA 3L9UA 19GSA 4ZIJA 2EIOA 1O81A 4NHWA 3EMPA 4IP1A 1A23A 1ML6A 2CAQA 5ELAA 1SENA 1Z7PA 1N2AA 2FHEA 2AJQB 4ML6A 4WF5A 2IJYA 2LKUA 1DBYA 4EXJA 5B6MA 1HD2A 4TR3A 3ZVJD 5EPFA 3GTUB 5ECLB 1M9AA 1RW1A 2KHPA 3FKFA 2OADA 1PMTA 2ALBA 2VM2A 1U87A 4BL7A 1BX9A 4LL1B 4F2IA 5B8AA 4F0CA 1K0MA 3HCZA 5LCZA 4IP6A 3GURA 1GUKA 5D96A 4HZ2A 1B8XA 4DEJA 2LJRA 1F3BA 4KX4A 4KW6A 2X49A 4NXIA 4KGIA 1PSQA 3UEMA 1EEMA 2LRTA 5B7CA 3ZMLA 1R7HA 3FZ4A 5B8BA 3P8WA 4MF7A 1U3IA 3FR9A 3KMNA 2EC4A 5ECPB 5KEJA 4IVFA 4XCSA 3TJJA 2YANA 4POMA 1SKWB 4F0BA 5JWRB 4L0UA 3VI5A 1KBNA 3C1SA 7GSSA 4ZILA 4CY8A 1PL1A 1XOAA 2HRKA 4MA9A 1Y25A 2A4VA 3IK9A 1X9MB 1USBA 2WJUA 4IKHA 3TJBA 3A2VA 1MD3A 3EC3A 3IC8A 3W8JA 3DEXA 2R2JA 3IDVA 1KTEA 2FUG2 3M9JA 2G0FA 1ERUA 5CRDA 1BEDA 1M2AA 2L4CA 3CSIA 2VD0A 2DBCA 5KN1A 1ZMAA 4TR4A 3IBHA 1ILOA 3TKSA 1OE8A 2VCZA 1G0TA 4GXZA 2X8CA 4JEDA 2VCVA 2AB6A 4Q5RA 3F63A 5JCUA 2YV9A 4N30A 5J41A 3CXGA 5KOXA 1A24A 1I5GA 2YWOA 2IMIA 1ZL9A 1FG4A 2I1UA 5F06A 3ME7A 4OFMA 4PURA 2L5OA 3GNJA 3ZITA 3QAGA 1MDKA 2B1KA 3H1NA 3MAKA 4TVEA 3D21A 2DJ1A 1XOBA 1QGVA 1SL2B 1THXA 5BRTA 1WP0A 5A5KA 4Z2UA 3C73A 2WB9A 5E4WA 3TGZA 4POBA 2DC5A 1T4ZA 2V2GA 4TXOA 3E0UA 3RAZA 3AY8A 1XWAA 1JFUA 2GVPA 4HI7A 1O73A 3R2QA 3ME8A 3GKKA 2C0DA 1E6BA 2P5RA 4GQFA 1U3AA 2C0EA 3I69A 1Z5YE 1ZCPA 1XCCA 3VI7A 2M46A 3FRCA 4EDYA 4OMVA 4CDOA 3DD3A 1GRXA 3TJFA 5C04A 2E7PA 2LUSA 5DQSA 4IS0A 5ELGA 2JZTA 4KA0A 2R0PA 1GLQA 2WULA 2PVQA 2H72A 2PPTA 4E8EA 3QAVA 4HQZA 5DVBA 3QOUA 3PH9A 3V1WA 1CQHA 1XFLA 1YKCA 2HLSA 1ZZYA 3U6VA 2X4AA 5ECHB 3G9BA 4BVXB 2VCWA 2FWFA 5KN3A 3VURA 6GSVA 5F0GA 1TI1A 2DKIA 2AYTA 4OWYA 3VWVA 3W6GA 3QPMA 2EIQA 4ZBBA 4I6XA 2L5LA 2YJHA 2A2SA 4I2UA 3EU4A 1TW9A 4NV5A 1JZDA 3DYRA 4EC0A 1K0AA 2RIIA 2YP6A 5HFIA 5EVOA 1HYUA 3GA4A 4CY6A 1DUGA 3G7JA 4K7OA 2IMEA 3O76A 1IYIA 4TOPA 2N5AA 3NZNA 3IC4A 5CRGA 2B1LA 1NSWA 2Z9SA 4MH2A 1ABAA 2YN1A 3EMXA 4RQRA 4BL7B 2YWMA 2H6YA 1Q4JA 3HA9A 5AISA 3IK7A 3TDGA 4OFNA 4PNGA 22GSA 1EGOA 3Q19A 2EIRA 4ZL7A 1SD9A 2LRNA 1G6WA 3MSZA 4JRRA 4JBBA 5ECKB 1TDIA 1M7TA 5CYYA 3H79A 2C3TA 2VCXA 1K3YA 3W8SA 1K0OA 4TRXA 1TKDB 3HHVA 3DWVA 1AXDA 1M2BA 4CHSA 3I43A 3GIXA 2DMLA 3LEFA 1TU8A 3RPNA 3GL3A 2FA8A 3UVHA 3CBUA 3E9JB 1GTUA 5E59A 1SD8A 5HFKA 2IMFA 5IPGA 2XPDA 4JE1A 2VL3A 1T8EB 4HUAA 5DBQA 8GSSA 2GSQA 2QKEA 2RM6A 3IR4A 1OC8A 1ZYNA 1WJKA 3ZLPA 4FIWA 5AIVA 2WFCA 2PERA 3GYKA 4EIPA 4MJBA 1JZOA 3TB2A 1B4PA 3M1GA 2GQLA 3P7XA 3GSSA 1GWCA 4F9ZA 1ZGNA 4N10A 5IQYA 2C0FA 2A2PA 2GGTA 1XG8A 4ZL8A 1S3RA 1NM3A 4JR4A 4KDXA 3N9JA 2YPMA 2QC7A 1TTZA 4K1FA 3MNGA 2K9FA 1B48A 18GSA 1O85A 2HSHA 3LYKA 1B9XC 4TW5A 2H30A 4L8EA 5IMDA 3UMAA 3BCKA 3CSJA 3HJMA 3L4NA 2GQKA 3BJ5A 4D73B 4YH2A 2N5BA 2BMXA 1AQVA 2GSSA 4KDUA 5J3RA 4MLYA 2CT6A 2H0IA 1BJXA 3ERGA 1RK4A 1MD4A 1AIUA 4ECBA 4L5OA 1C72A 2XHFA 3IHGA 4OO5A 1SYXA 3WYWA 2OBKA 3TKSE 3UIWA 1SK0A 3IOSA 1XWGA 4RQXA 2OKAA 4TXOB 3PPUA 3CSHA 3FYGA 2AHEA 3HVNA 4IW9A 1M3JA 2IMKA 5L71A 2VIMA 4ID0A 17GSA 4LMVA 3Q74A 4O5UA 2VCTA 2LTKA 4G2EA 3ZVJA 3DRNA 2R3XA 4KCEA 4ECJA 2CVDA 4ZB9A 4BWSA 6GSXA 4YKFA 3WGDA 4ML1A 1AQWA 1EOGA 1V40A 3KM6A 2WRTA 4I97A 4G9HA 2V41A 2R0GA 1WMJA 4YKGA 1FO5A 1H4OA 1WE0A 1PQNA 1AC1A 1OE7A 1RQMA 3QCPA 5DALA 4TR1A 1EV9A 4ICYA 2RUEA 3BD2A 4MJAA 2WGRA 1XWKA 4L5LA 2VL2C 2RLIA 3ZIJA 1Z6MA 4QL7A
chains in the Genus database with same CATH topology
3ISOA 2LQQA 4O5QA 2P5QA 1MTCA 1YEXA 2YJ7A 1OC9A 4JZQA 3KZQA 4GCIA 5IMVA 3FZ9A 3ERWA 1AW9A 2M72A 3ED3A 1XW6A 4OFTA 5HR1A 3Q6OA 4OO4A 2JU5A 2H1AA 1TRUA 3D22A 1TP9A 3QR6A 1XIYA 1PN9A 4YQUA 4PQHA 1VRSD 2LQOA 1PRXA 1O6JA 1BAYA 1JLVA 2B5YA 4RUVA 2H0GA 3A5WA 1O8WA 4GWRA 1BYEA 1H75A 2OBIA 2BTOT 1B9YC 2K8SA 3TUEA 3LG6A 1SU9A 3QFBC 3A3TA 2O7KA 3GFKA 3L0HA 1V2AA 1SK1A 5D93A 4YAPA 2CX3A 3C1RA 3GKNA 3CTGA 4LL4B 5D8IA 2I81A 2H01A 4FO5A 2MMOA 2TIRA 2YZUA 5J9CA 3GH9A 2DLXA 4MH3A 2LRCA 10GSA 5AN1A 1T3BA 1SJIA 4USSA 5IM9A 4AJ7A 1O7UA 1YF0A 2DJJA 4OCFA 2VLUA 1XW5A 2DJ2A 4HJ2A 4F82A 4NV2A 2XBIA 2CV4A 3VK9A 4K8MA 5IMZA 2F51A 2MMAA 3GRXA 4XRDA 2MMZA 3GKXA 1ZYPA 2CAIA 1X0RA 3HJPA 3PINA 3LWAA 3HYPA 2R5GA 1TK8B 2IPAA 5GZZB 3IAS2 1TK5B 1YEPA 1GNWA 5IMCA 1YF1A 2DMMA 2L6DA 4XIHA 4OCEA 5G2ZA 2VM1A 2F9SA 3ZIVA 1LU4A 2NDOA 4PUAA 3HD5A 1GLPA 5F05A 3F3QA 4AGSA 4PX1A 2LJKA 1EV4A 4ZL9A 2LS5A 4WBJA 2V6KA 2HYXA 3HKRA 3GH6A 5B6NA 2F8FA 3F6FA 4RI6A 4PXOA 2C0GA 2H1GA 4TKYA 1BG5A 4HS1A 4EVMA 4GQCA 1GSUA 2M80A 2VL9A 3JCML 3UOMA 2PBJA 5JWOB 3M8NA 1HNAA 1WWJA 5CRHA 3IRAA 1J9BA 5IO2A 5EL8A 5G5EA 4CW9A 3UVTA 1UN2A 4QQ7A 4K6XA 1AQXA 3GX0A 5A4WA 5IOWA 3LGCA 4ZB6A 2DSAA 4IBPA 4Z2TA 3C7MA 1QQ2A 3L9VA 2QGVA 5F07A 3GL5A 4RI7A 5JWQB 2A4HA 4EO3A 3TCOA 3KP9A 12GSA 1A2JA 1TRWA 5FWGA 2VO4A 4MJCA 5D9WA 2E2MA 2JACA 4NPBA 2WDUA 2OE0A 3EE2A 1SJZA 2F3MA 3UBLA 4LLRA 2O89A 4WBRD 5FT3A 2RM5A 4XTSA 2IFQA 1U6TA 3BCIA 4LMWA 2PU9C 2QSIA 1A8LA 3L9SA 5ECQB 3ZMKA 6GSUA 4K7IA 2C80A 5AGYA 4MJEA 2LV3A 1R4WA 2OE3A 3IXRA 5DCHA 1B4QA 4G19A 1O8XA 1YDKA 2X8GA 3U5RE 2R0CA 1MEKA 4TR1B 3MWHA 4AF2A 1OKDA 4AJ8A 1T00A 1R5PA 4XS6A 2V32A 3O3TA 3H93A 4N0VA 4MABA 4GF0A 4EIQA 2DIYA 1UA5A 1UVZA 4G0IA 4NWYA 4PGTA 1MDIA 1SYRA 5ENUA 1PX7A 4V1Ap 5LNKe 1OC3A 4ILFA 2HNLA 1OC9B 2H1DA 2CX4A 1GL8A 1FVJA 5KN0A 3LYPA 3TKQA 3CRTA 3QMXA 5CRWA 4EE0A 5ECIB 1DE1A 4HZ4A 2GSTA 1FVKA 2XC2A 4G0LA 4ECCA 1GSEA 1YJ6A 3EINA 1NHOA 3TJGA 4LA1A 2IMDA 5HQPA 4IELA 2OA7A 4ECIA 4KDYA 1GSFA 5A4UA 3F8UA 2H19A 4PNFA 3IA1A 3KTLA 1TXXA 3FW2A 5HR3A 1J0FA 3LW9A 2C1YA 5DAKA 2MZCA 3UAPA 3Q18A 5D9VA 4MPFA 1K0BA 4G10A 2KUCA 1Q98A 3F9UA 1XPVA 3EPTA 5ABRA 5KN2A 2I9HA 4JR6A 2HRNA 3SBCA 3WD6A 1SK2A 3HVXA 4BWQA 3KH9A 2O87A 4X4JA 1YKAA 2AAWA 4BPYA 2VL2A 3QFAC 5JCWA 3ZZXA 1PKZA 1S3AA 1W4VA 2X64A 1XWBA 1TRVA 3DGQA 2TRCP 1F3AA 2L59A 4JU5A 4DVCA 4KF9A 1OYJA 3WGEA 5IOXA 4J2FA 3GHAA 1Z3EA 2HXKA 1QK8A 3TRPA 4HEA2 2FWHA 5GSTA 3H4KA 4X43A 2ZNMA 5IMFA 5CNWA 3G7IA 4K2DA 16GSA 1M9BA 4N0ZA 4Z7XA 3UL3A 4GSNA 3S9FA 4GLTA 3TKRA 1EZKA 1BQ7A 4YQVA 2J23A 1EEJA 2I4AA 1F2EA 4O7HA 1NW2A 3BOAA 2ON5A 3A2WA 3IE3A 1JZRA 4EF0A 1F9MA 3LFLA 2LSTA 1T7PB 1SL1B 4EDZA 2GT5A 2OACA 9GSSA 5G30A 2HFDA 4GSSA 20GSA 5CREA 3M0FA 5G1LA 2CZ3A 1M0UA 3D5JA 3QAWA 2PVOC 3WT1A 1ERTA 3F6DA 1V57A 4EL1A 5A4VA 1X9WB 1UC7A 2FCHA 3IAM2 5HR0A 1E2YA 3CMIA 2PN8A 1G7OA 1OKTA 2HE3A 3GSTA 3HJOA 1PA3A 2VOCA 3US3A 2FWGA 3IV4A 2C8UA 2MYGA 1V58A 3EWLA 4KUNA 1EGRA 4K2XA 4EUYA 4J56E 3C8EA 4X1UA 1ERWA 2DJ3A 2GS3A 4IQ1A 5HFGA 3LORA 3DXBA 1T1VA 4MCUA 3RHBA 2A2RA 5D9XA 2HSYA 1K0CA 2GZZA 3TOUA 2K8VA 1QUWA 3QDNA 3P90A 2JZRA 2YWNA 2MBSA 2L4QA 2VD1A 1EOHA 3GX8A 3ZRDA 1ZYQB 3LXTA 2PUKC 1ERVA 4A5PA 3HDCA 1PKWA 3HZ8A 5IO0A 3VPTA 3J7Yb 1FHEA 4G0KA 1XW9A 4IQAA 3DMLA 2K18A 4I8BA 3F4SA 2NPBA 1VF2A 4I5QA 5CP1A 2YWIA 3GUSA 2B7JA 2QA2A 2DIZA 4EKZA 2GZYA 3O6TA 1FW1A 5ID2A 4Q5QA 2BJXA 3ZFLA 1G7EA 14GSA 3LXZA 5IMAA 4K5RA 1ZYEA 5J4UA 2GT6A 4NAXA 4J57E 1JLWA 4FYUA 2HZEA 3DVWA 3KH7A 3FY7A 3NIVA 5H5RA 1EP8A 1TRSA 1GUMA 2P0GA 2GSRA 1GTIA 2PWJA 4TN8A 3ZREA 3H8QA 4OD7A 2IFQB 3BBYA 4FYCA 3KIJA 4V2NA 5JCGA 4KB3A 4O92A 2B6MA 4MF6A 3P2AA 2E2GA 5H5SA 1XVQA 4WEYA 4HU7A 1FAAA 4MF5A 1F6MC 1K0DA 1I9DA 4K5SA 3VFIA 5CO3A 4K0NA 4MZBA 1PD21 3FEUA 2MBTA 3WGXA 5KOWA 1X5DA 2OJLA 1FOVA 1WOUA 4MP4A 5DJMA 2H6XA 1S3DA 6GSSA 3TRQA 2R4VA 4YQMA 4MZCA 5BMUA 4PUFC 2UZ8A 4K7NA 2P31A 2IL3A 3FZ5A 3M3MA 4POLA 5EY6A 3NOFA 2FLSA 3WT2A 2H73A 1GTAA 1ACVA 2FY6A 4AJ6A 3I9V2 4IJ3A 2NBSA 2XPEA 1Z9HA 3ZFBA 3FR6A 5CAXA 4YAVA 1QXHA 4XS4A 2GZPA 3KJYA 1XWCA 4QL9A 4FYBA 2B5EA 2YV7A 3EURA 2MMNA 3VPQA 2H70A 2WS2A 2FA4A 3HVSA 2HI7A 1JHBA 2CZ2A 2C4JA 1VGLA 3KD0A 3RHCA 2FNOA 2HT9A 2JZSA 4O32A 1K3OA 1MDJA 5DAKB 5F8BA 5GSSA 1FB0A 3PR8A 1A8YA 4TXVA 4E8HA 1A2MA 4KCAA 1VF4A 1CQGA 4ZBAA 3J7Yk 1TOFA 4WR5A 5ECRB 1OAZA 1K0NA 2IIYA 5INYA 1Y6EA 1WIKA 1R26A 1X9SB 2DKHA 1GSSA 4K9ZA 3FK8A 4IGJA 3GKMA 3A5IA 4WXTA 2CVKA 3R3EA 2KP2A 3CYNA 2QA1A 4WETA 4DSSA 4D73A 3KXOA 1X5EA 3UBKA 1GULA 5ECNB 1GSYA 4PQIA 2IWTA 3CRUA 3RPPA 2VAFA 1JZWA 1V98A 1HQOA 2NVLA 2H66A 4GTUA 2IN3A 3PGTA 1GSDA 3DIEA 2GDRA 2O85A 3E3EA 2KLXA 2B3SA 4KE3A 3UJ1A 3VWXA 4POKA 4MNNA 1F37A 2FGXA 3KEBA 3A2XA 1EP7A 4GRFA 3FMWA 3TJKA 1R5AA 4Z2RA 2JADA 5GAND 3VLNA 2E0QA 2VLTA 4BVYA 3LJRA 1ON4A 2G2QA 1A2LA 1TI3A 5ECSA 4HQSA 3D0ZA 4HDEA 3F4TA 3I6AA 3D4TA 2ES7A 5G5FA 4BA7A 2FD3A 2C3QA 1U88A 2TRXA 3KP8A 1SKSB 4ACSA 2HSMA 3LQ7A 1M2DA 4KNDA 3GTUA 2YCDA 5HR2A 3F0IA 1TK0B 2AUVA 1YZXA 2J9HA 3APQA 3EVIA 1GNEA 2JSYA 3KCMA 4V1Ag 3APOA 3MYDA 2YNXA 2CVBA 3K8NA 2WCIA 1ST9A 3SWLA 1T4YA 3IPZA 1G6YA 1URMA 1N8JA 3FR3A 4XHMA 4F03A 4ZXGA 6GSYA 1V9WA 1WRYA 3EYTA 4XRAA 1VF3A 3F3RA 3GV1A 4FH8A 2HRFA 4MK3A 1LBKA 3D6IA 3LSZA 1A0FA 5C00A 1XBSA 4IJIA 1EWXA 4HOJA 4MMMA 3KGKA 5DALB 2KP1A 1YY7A 4I2TA 3GMFA 3TKSC 2H0HA 2GLRA 1PGTA 3N5OA 2LNTA 1KNGA 2H75A 4ULXA 1S3CA 4P3YB 5GAPD 1HNCA 5ID2B 1Z6NA 2LEGA 1FB6A 2H8LA 3G7YA 3TRXA 5DJLA 1PN0A 1HNBA 3HZ4A 2L6CA 2HZEB 4WF4A 1W89A 4WKWA 3KMOA 2O8VB 4KH7A 2HRAA 3HVVA 2JSZA 2CQ9A 11GSA 2YOIA 4Q5NA 2N5FA 5ECOB 2F8AA 1Z7RA 1DE2A 2ZUPA 5J9BA 2X99A 1PL2A 4N11A 2HZFA 3DKSA 5ECMB 3EU3A 3GN3A 4HJMA 1XVWA 3TOTA 4KSOA 3VWWA 4NMUA 5AIXA 3QD9A 2PGTA 5COHA 4PTSA 1A0RP 1GUHA 3RDWA 2GQMA 1QFNA 1GP1A 6GSWA 3TKPA 2NTOA 2YZHA 1THOA 4O5RA 13GSA 1VF1A 3M9KA 4X0XA 3MDKA 5DCGA 2WZ9A 4H86A 3VWUA 3OR5A 2H76A 4GSTA 5IPHA 2DJ0A 3D4MA 1GTBA 6GSTA 1LJRA 3C71A 5J5NA 1GSQA 5DDLA 1XXUA 4TR0A 1WPIA 1TU7A 4L0WA 5D73A 2L57A 3KTBA 2K6VA 3FZAA 1QMVA 5FHIA 2H6ZA 1ZOFA 3F4RA 4XS4B 2ON7A 1IYHA 1SJ6A 4MZWA 2H1BA 3RBTA 1M99A 4HU9A 4IHUA 1GH2A 5LD0A 5IIZA 1AUCA 3L78A 4V2LA 2VUPA 1SKRB 1DSBA 2LJAA 1AAZA 2LNSA 1XZOA 4MPGA 4MDCA 1OVNA 2D2ZA 3APSA 2CA8A 1TJDA 2REMA 4KSMA 2R6KA 2H74A 3CTFA 2B7KA 4DSQA 2GTUA 2XBQA 2JL4A 4Q5FA 2ZCTA 4DSRA 3UARA 2KOKA 3ZYWA 3ZL5A 4DSSB 4PQ1A 3FHKA 4XS1A 4KAEA 2I3YA 4V2MA 2H71A 2VCQA 5G1KA 1X5CA 4ISDA 1K3LA 3DVXA 3HXSA 1PX6A 5DQYA 4WR4A 1YQ1A 1NHYA 1J08A 2R37A 5D9TA 3HY2A 2X8HA 3ZTLA 3ERFA 2AV4A 4K0GA 2FWEA 5G31A 4NHZA 4IN0A 4BVXA 3IHQA 1KEBA 2C3NA 4FQUA 4ZB8A 2OE1A 2DJKA 2VLVA 1FOHA 3MIXA 2RUFA 2V1MA 2PMTA 5H5QA 2B5XA 2V6OA 4BVYB 1SL0B 4ZBDA 3L9UA 19GSA 4ZIJA 2EIOA 1O81A 4NHWA 3EMPA 4IP1A 1A23A 1ML6A 2CAQA 5ELAA 1SENA 1Z7PA 1N2AA 2FHEA 2AJQB 4ML6A 4WF5A 2IJYA 2LKUA 1DBYA 4EXJA 5B6MA 1HD2A 4TR3A 3ZVJD 5EPFA 3GTUB 5ECLB 1M9AA 1RW1A 2KHPA 3FKFA 2OADA 1PMTA 2ALBA 2VM2A 1U87A 4BL7A 1BX9A 4LL1B 4F2IA 5B8AA 4F0CA 1K0MA 3HCZA 5LCZA 4IP6A 3GURA 1GUKA 5D96A 4HZ2A 1B8XA 4DEJA 2LJRA 1F3BA 4KX4A 4KW6A 2X49A 4NXIA 4KGIA 1PSQA 3UEMA 1EEMA 2LRTA 5B7CA 3ZMLA 1R7HA 3FZ4A 5B8BA 3P8WA 4MF7A 1U3IA 3FR9A 3KMNA 2EC4A 5ECPB 5KEJA 4IVFA 4XCSA 3TJJA 2YANA 4POMA 1SKWB 4F0BA 5JWRB 4L0UA 3VI5A 1KBNA 3C1SA 7GSSA 4ZILA 4CY8A 1PL1A 1XOAA 2HRKA 4MA9A 1Y25A 2A4VA 3IK9A 1X9MB 1USBA 2WJUA 4IKHA 3TJBA 3A2VA 1MD3A 3EC3A 3IC8A 3W8JA 3DEXA 2R2JA 3IDVA 1KTEA 2FUG2 3M9JA 2G0FA 1ERUA 5CRDA 1BEDA 1M2AA 2L4CA 3CSIA 2VD0A 2DBCA 5KN1A 1ZMAA 4TR4A 3IBHA 1ILOA 3TKSA 1OE8A 2VCZA 1G0TA 4GXZA 2X8CA 4JEDA 2VCVA 2AB6A 4Q5RA 3F63A 5JCUA 2YV9A 4N30A 5J41A 3CXGA 5KOXA 1A24A 1I5GA 2YWOA 2IMIA 1ZL9A 1FG4A 2I1UA 5F06A 3ME7A 4OFMA 4PURA 2L5OA 3GNJA 3ZITA 3QAGA 1MDKA 2B1KA 3H1NA 3MAKA 4TVEA 3D21A 2DJ1A 1XOBA 1QGVA 1SL2B 1THXA 5BRTA 1WP0A 5A5KA 4Z2UA 3C73A 2WB9A 5E4WA 3TGZA 4POBA 2DC5A 1T4ZA 2V2GA 4TXOA 3E0UA 3RAZA 3AY8A 1XWAA 1JFUA 2GVPA 4HI7A 1O73A 3R2QA 3ME8A 3GKKA 2C0DA 1E6BA 2P5RA 4GQFA 1U3AA 2C0EA 3I69A 1Z5YE 1ZCPA 1XCCA 3VI7A 2M46A 3FRCA 4EDYA 4OMVA 4CDOA 3DD3A 1GRXA 3TJFA 5C04A 2E7PA 2LUSA 5DQSA 4IS0A 5ELGA 2JZTA 4KA0A 2R0PA 1GLQA 2WULA 2PVQA 2H72A 2PPTA 4E8EA 3QAVA 4HQZA 5DVBA 3QOUA 3PH9A 3V1WA 1CQHA 1XFLA 1YKCA 2HLSA 1ZZYA 3U6VA 2X4AA 5ECHB 3G9BA 4BVXB 2VCWA 2FWFA 5KN3A 3VURA 6GSVA 5F0GA 1TI1A 2DKIA 2AYTA 4OWYA 3VWVA 3W6GA 3QPMA 2EIQA 4ZBBA 4I6XA 2L5LA 2YJHA 2A2SA 4I2UA 3EU4A 1TW9A 4NV5A 1JZDA 3DYRA 4EC0A 1K0AA 2RIIA 2YP6A 5HFIA 5EVOA 1HYUA 3GA4A 4CY6A 1DUGA 3G7JA 4K7OA 2IMEA 3O76A 1IYIA 4TOPA 2N5AA 3NZNA 3IC4A 5CRGA 2B1LA 1NSWA 2Z9SA 4MH2A 1ABAA 2YN1A 3EMXA 4RQRA 4BL7B 2YWMA 2H6YA 1Q4JA 3HA9A 5AISA 3IK7A 3TDGA 4OFNA 4PNGA 22GSA 1EGOA 3Q19A 2EIRA 4ZL7A 1SD9A 2LRNA 1G6WA 3MSZA 4JRRA 4JBBA 5ECKB 1TDIA 1M7TA 5CYYA 3H79A 2C3TA 2VCXA 1K3YA 3W8SA 1K0OA 4TRXA 1TKDB 3HHVA 3DWVA 1AXDA 1M2BA 4CHSA 3I43A 3GIXA 2DMLA 3LEFA 1TU8A 3RPNA 3GL3A 2FA8A 3UVHA 3CBUA 3E9JB 1GTUA 5E59A 1SD8A 5HFKA 2IMFA 5IPGA 2XPDA 4JE1A 2VL3A 1T8EB 4HUAA 5DBQA 8GSSA 2GSQA 2QKEA 2RM6A 3IR4A 1OC8A 1ZYNA 1WJKA 3ZLPA 4FIWA 5AIVA 2WFCA 2PERA 3GYKA 4EIPA 4MJBA 1JZOA 3TB2A 1B4PA 3M1GA 2GQLA 3P7XA 3GSSA 1GWCA 4F9ZA 1ZGNA 4N10A 5IQYA 2C0FA 2A2PA 2GGTA 4ZL8A 1NM3A 4JR4A 4KDXA 3N9JA 2YPMA 2QC7A 1TTZA 4K1FA 3MNGA 2K9FA 1B48A 18GSA 1O85A 2HSHA 3LYKA 1B9XC 4TW5A 2H30A 4L8EA 5IMDA 3UMAA 3BCKA 3CSJA 3HJMA 3L4NA 2GQKA 3BJ5A 4D73B 4YH2A 2N5BA 2BMXA 1AQVA 2GSSA 4KDUA 5J3RA 4MLYA 2CT6A 2H0IA 1BJXA 3ERGA 1RK4A 1MD4A 1AIUA 4ECBA 4L5OA 1C72A 2XHFA 3IHGA 4OO5A 1SYXA 3WYWA 2OBKA 3TKSE 3UIWA 1SK0A 3IOSA 1XWGA 4RQXA 2OKAA 4TXOB 3PPUA 3CSHA 3FYGA 2AHEA 4IW9A 2IMKA 5L71A 2VIMA 4ID0A 17GSA 4LMVA 3Q74A 4O5UA 2VCTA 2LTKA 4G2EA 3ZVJA 3DRNA 2R3XA 4KCEA 4ECJA 2CVDA 4ZB9A 4BWSA 6GSXA 4YKFA 3WGDA 4ML1A 1AQWA 1EOGA 1V40A 3KM6A 2WRTA 4I97A 4G9HA 2V41A 2R0GA 1WMJA 4YKGA 1FO5A 1H4OA 1WE0A 1PQNA 1AC1A 1OE7A 1RQMA 3QCPA 5DALA 4TR1A 1EV9A 4ICYA 2RUEA 3BD2A 4MJAA 2WGRA 1XWKA 4L5LA 2VL2C 2RLIA 3ZIJA 1Z6MA 4QL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ISO A;  2LQQ A;  2P5Q A;  1MTC A;  1YEX A;  2YJ7 A;  1OC9 A;  4JZQ A;  3KZQ A;  4GCI A;  5IMV A;  3FZ9 A;  3ERW A;  1AW9 A;  2M72 A;  3ED3 A;  1XW6 A;  4OFT A;  5HR1 A;  3Q6O A;  4OO4 A;  2JU5 A;  2H1A A;  1TRU A;  3D22 A;  1TP9 A;  3QR6 A;  1XIY A;  1PN9 A;  4YQU A;  4PQH A;  1VRS D;  2LQO A;  1PRX A;  1O6J A;  1BAY A;  1JLV A;  2B5Y A;  4RUV A;  2H0G A;  3A5W A;  1O8W A;  4GWR A;  1BYE A;  1H75 A;  2OBI A;  2BTO T;  1B9Y C;  2K8S A;  3TUE A;  3LG6 A;  1SU9 A;  3QFB C;  3A3T A;  2O7K A;  3GFK A;  3L0H A;  1V2A A;  1SK1 A;  5D93 A;  4YAP A;  2CX3 A;  3C1R A;  3GKN A;  3CTG A;  4LL4 B;  5D8I A;  2I81 A;  2H01 A;  4FO5 A;  2MMO A;  2TIR A;  2YZU A;  5J9C A;  3GH9 A;  2DLX A;  4MH3 A;  2LRC A;  10GS A;  5AN1 A;  1T3B A;  1SJI A;  5IM9 A;  4AJ7 A;  1O7U A;  1YF0 A;  2DJJ A;  4OCF A;  2VLU A;  1XW5 A;  2DJ2 A;  4HJ2 A;  4F82 A;  4NV2 A;  2XBI A;  2CV4 A;  3VK9 A;  4K8M A;  5IMZ A;  2F51 A;  2MMA A;  3GRX A;  4XRD A;  2MMZ A;  3GKX A;  2CAI A;  1X0R A;  3HJP A;  3PIN A;  3LWA A;  3HYP A;  2R5G A;  1TK8 B;  2IPA A;  5GZZ B;  3IAS 2;  1TK5 B;  1YEP A;  1GNW A;  5IMC A;  1YF1 A;  2DMM A;  2L6D A;  4XIH A;  4OCE A;  5G2Z A;  2VM1 A;  2F9S A;  3ZIV A;  1LU4 A;  2NDO A;  4PUA A;  3HD5 A;  1GLP A;  5F05 A;  3F3Q A;  4AGS A;  4PX1 A;  2LJK A;  1EV4 A;  4ZL9 A;  2LS5 A;  4WBJ A;  2V6K A;  2HYX A;  3HKR A;  3GH6 A;  5B6N A;  2F8F A;  3F6F A;  4RI6 A;  4PXO A;  2C0G A;  2H1G A;  4TKY A;  1BG5 A;  4HS1 A;  4EVM A;  4GQC A;  1GSU A;  2M80 A;  2VL9 A;  3JCM L;  3UOM A;  2PBJ A;  5JWO B;  3M8N A;  1HNA A;  1WWJ A;  5CRH A;  3IRA A;  1J9B A;  5IO2 A;  5EL8 A;  5G5E A;  4CW9 A;  3UVT A;  1UN2 A;  4QQ7 A;  4K6X A;  1AQX A;  3GX0 A;  5A4W A;  5IOW A;  3LGC A;  4ZB6 A;  2DSA A;  4IBP A;  3C7M A;  1QQ2 A;  3L9V A;  2QGV A;  5F07 A;  3GL5 A;  4RI7 A;  5JWQ B;  4EO3 A;  3TCO A;  3KP9 A;  12GS A;  1A2J A;  1TRW A;  5FWG A;  2VO4 A;  4MJC A;  5D9W A;  2E2M A;  2JAC A;  4NPB A;  2WDU A;  2OE0 A;  3EE2 A;  1SJZ A;  2F3M A;  3UBL A;  4LLR A;  2O89 A;  4WBR D;  5FT3 A;  2RM5 A;  4XTS A;  2IFQ A;  1U6T A;  3BCI A;  4LMW A;  2PU9 C;  2QSI A;  1A8L A;  3L9S A;  5ECQ B;  3ZMK A;  6GSU A;  4K7I A;  2C80 A;  5AGY A;  4MJE A;  2LV3 A;  1R4W A;  2OE3 A;  3IXR A;  5DCH A;  1B4Q A;  4G19 A;  1O8X A;  1YDK A;  2X8G A;  3U5R E;  1MEK A;  4TR1 B;  3MWH A;  4AF2 A;  1OKD A;  4AJ8 A;  1T00 A;  1R5P A;  4XS6 A;  2V32 A;  3O3T A;  3H93 A;  4N0V A;  4MAB A;  4GF0 A;  2DIY A;  1UA5 A;  1UVZ A;  4NWY A;  4PGT A;  1MDI A;  1SYR A;  5ENU A;  1PX7 A;  4V1A p;  5LNK e;  1OC3 A;  4ILF A;  2HNL A;  1OC9 B;  2H1D A;  2CX4 A;  1GL8 A;  1FVJ A;  5KN0 A;  3LYP A;  3TKQ A;  3CRT A;  3QMX A;  5CRW A;  4EE0 A;  5ECI B;  1DE1 A;  4HZ4 A;  2GST A;  1FVK A;  2XC2 A;  4ECC A;  1GSE A;  1YJ6 A;  3EIN A;  1NHO A;  3TJG A;  4LA1 A;  2IMD A;  5HQP A;  4IEL A;  2OA7 A;  4ECI A;  4KDY A;  1GSF A;  5A4U A;  3F8U A;  2H19 A;  4PNF A;  3IA1 A;  3KTL A;  1TXX A;  3FW2 A;  5HR3 A;  1J0F A;  2C1Y A;  5DAK A;  2MZC A;  3UAP A;  3Q18 A;  5D9V A;  4MPF A;  1K0B A;  4G10 A;  2KUC A;  1Q98 A;  3F9U A;  1XPV A;  5ABR A;  5KN2 A;  2I9H A;  4JR6 A;  2HRN A;  3SBC A;  3WD6 A;  1SK2 A;  3HVX A;  4BWQ A;  3KH9 A;  2O87 A;  1YKA A;  2AAW A;  4BPY A;  2VL2 A;  3QFA C;  5JCW A;  3ZZX A;  1PKZ A;  1S3A A;  1W4V A;  2X64 A;  1XWB A;  1TRV A;  3DGQ A;  2TRC P;  1F3A A;  2L59 A;  4JU5 A;  4DVC A;  3WGE A;  1OYJ A;  5IOX A;  4J2F A;  3GHA A;  1Z3E A;  2HXK A;  1QK8 A;  3TRP A;  4HEA 2;  2FWH A;  5GST A;  3H4K A;  4X43 A;  2ZNM A;  5IMF A;  5CNW A;  3G7I A;  4K2D A;  16GS A;  1M9B A;  4N0Z A;  4Z7X A;  3UL3 A;  4GSN A;  3S9F A;  4GLT A;  3TKR A;  1EZK A;  1BQ7 A;  4YQV A;  2J23 A;  1EEJ A;  2I4A A;  1F2E A;  4O7H A;  1NW2 A;  3BOA A;  2ON5 A;  3A2W A;  3IE3 A;  1JZR A;  4EF0 A;  1F9M A;  3LFL A;  2LST A;  1T7P B;  1SL1 B;  4EDZ A;  2GT5 A;  2OAC A;  9GSS A;  5G30 A;  2HFD A;  4GSS A;  20GS A;  5CRE A;  3M0F A;  5G1L A;  2CZ3 A;  1M0U A;  3D5J A;  3QAW A;  2PVO C;  3WT1 A;  1ERT A;  3F6D A;  1V57 A;  4EL1 A;  5A4V A;  1X9W B;  1UC7 A;  2FCH A;  3IAM 2;  5HR0 A;  1E2Y A;  3CMI A;  2PN8 A;  1G7O A;  1OKT A;  2HE3 A;  3GST A;  3HJO A;  1PA3 A;  2VOC A;  3US3 A;  2FWG A;  3IV4 A;  2C8U A;  2MYG A;  1V58 A;  3EWL A;  4KUN A;  1EGR A;  4EUY A;  4J56 E;  3C8E A;  4X1U A;  1ERW A;  2DJ3 A;  2GS3 A;  4IQ1 A;  5HFG A;  3LOR A;  3DXB A;  1T1V A;  4MCU A;  3RHB A;  2A2R A;  5D9X A;  2HSY A;  1K0C A;  2GZZ A;  3TOU A;  2K8V A;  1QUW A;  3QDN A;  3P90 A;  2JZR A;  2YWN A;  2MBS A;  2L4Q A;  2VD1 A;  1EOH A;  3GX8 A;  3ZRD A;  1ZYQ B;  3LXT A;  2PUK C;  1ERV A;  3HDC A;  1PKW A;  3HZ8 A;  5IO0 A;  3VPT A;  3J7Y b;  1FHE A;  1XW9 A;  4IQA A;  3DML A;  2K18 A;  4I8B A;  3F4S A;  2NPB A;  1VF2 A;  4I5Q A;  5CP1 A;  2YWI A;  3GUS A;  2B7J A;  2DIZ A;  4EKZ A;  2GZY A;  3O6T A;  1FW1 A;  5ID2 A;  4Q5Q A;  2BJX A;  3ZFL A;  1G7E A;  14GS A;  3LXZ A;  5IMA A;  5J4U A;  1ZYE A;  2GT6 A;  4NAX A;  4J57 E;  1JLW A;  4FYU A;  2HZE A;  3DVW A;  3KH7 A;  3FY7 A;  3NIV A;  5H5R A;  1EP8 A;  1TRS A;  1GUM A;  2P0G A;  2GSR A;  1GTI A;  2PWJ A;  4TN8 A;  3ZRE A;  3H8Q A;  4OD7 A;  2IFQ B;  3BBY A;  4FYC A;  3KIJ A;  4V2N A;  5JCG A;  4KB3 A;  4O92 A;  2B6M A;  4MF6 A;  3P2A A;  2E2G A;  5H5S A;  1XVQ A;  4WEY A;  4HU7 A;  1FAA A;  4MF5 A;  1F6M C;  1K0D A;  1I9D A;  3VFI A;  5CO3 A;  4K0N A;  4MZB A;  1PD2 1;  3FEU A;  2MBT A;  3WGX A;  1X5D A;  2OJL A;  1FOV A;  1WOU A;  4MP4 A;  5DJM A;  2H6X A;  1S3D A;  6GSS A;  3TRQ A;  2R4V A;  4YQM A;  4MZC A;  4PUF C;  4K7N A;  2P31 A;  2IL3 A;  3FZ5 A;  3M3M A;  4POL A;  5EY6 A;  3NOF A;  2FLS A;  3WT2 A;  2H73 A;  1GTA A;  1ACV A;  2FY6 A;  4AJ6 A;  3I9V 2;  4IJ3 A;  2NBS A;  2XPE A;  1Z9H A;  3ZFB A;  3FR6 A;  5CAX A;  4YAV A;  1QXH A;  2GZP A;  4XS4 A;  3KJY A;  1XWC A;  4QL9 A;  4FYB A;  2B5E A;  2YV7 A;  3EUR A;  2MMN A;  3VPQ A;  2H70 A;  2WS2 A;  2FA4 A;  3HVS A;  2HI7 A;  1JHB A;  2CZ2 A;  2C4J A;  1VGL A;  3KD0 A;  3RHC A;  2FNO A;  2HT9 A;  2JZS A;  4O32 A;  1K3O A;  1MDJ A;  5DAK B;  5F8B A;  5GSS A;  1FB0 A;  3PR8 A;  1A8Y A;  4TXV A;  4E8H A;  1A2M A;  4KCA A;  1VF4 A;  1CQG A;  4ZBA A;  3J7Y k;  1TOF A;  4WR5 A;  5ECR B;  1OAZ A;  1K0N A;  2IIY A;  5INY A;  1Y6E A;  1WIK A;  1R26 A;  1X9S B;  1GSS A;  4K9Z A;  3FK8 A;  4IGJ A;  3GKM A;  4WXT A;  2CVK A;  2KP2 A;  3CYN A;  4WET A;  4DSS A;  4D73 A;  3KXO A;  1X5E A;  3UBK A;  1GUL A;  5ECN B;  1GSY A;  4PQI A;  2IWT A;  3CRU A;  3RPP A;  2VAF A;  1JZW A;  1V98 A;  1HQO A;  2NVL A;  2H66 A;  4GTU A;  2IN3 A;  3PGT A;  1GSD A;  3DIE A;  2GDR A;  2O85 A;  3E3E A;  2KLX A;  2B3S A;  4KE3 A;  3UJ1 A;  3VWX A;  4POK A;  1F37 A;  2FGX A;  3KEB A;  3A2X A;  1EP7 A;  4GRF A;  3TJK A;  1R5A A;  2JAD A;  5GAN D;  3VLN A;  2E0Q A;  2VLT A;  4BVY A;  3LJR A;  1ON4 A;  2G2Q A;  1A2L A;  1TI3 A;  5ECS A;  4HQS A;  3D0Z A;  4HDE A;  3F4T A;  3I6A A;  3D4T A;  2ES7 A;  5G5F A;  4BA7 A;  2FD3 A;  2C3Q A;  1U88 A;  2TRX A;  3KP8 A;  1SKS B;  4ACS A;  3LQ7 A;  1M2D A;  4KND A;  3GTU A;  2YCD A;  5HR2 A;  3F0I A;  1TK0 B;  2AUV A;  1YZX A;  2J9H A;  3APQ A;  3EVI A;  1GNE A;  2JSY A;  3KCM A;  4V1A g;  3APO A;  2YNX A;  2CVB A;  3K8N A;  2WCI A;  1ST9 A;  3SWL A;  1T4Y A;  3IPZ A;  1G6Y A;  1URM A;  1N8J A;  3FR3 A;  4XHM A;  4F03 A;  4ZXG A;  6GSY A;  1V9W A;  1WRY A;  3EYT A;  4XRA A;  1VF3 A;  3F3R A;  3GV1 A;  4FH8 A;  2HRF A;  4MK3 A;  1LBK A;  3D6I A;  3LSZ A;  1A0F A;  5C00 A;  1XBS A;  4IJI A;  1EWX A;  4HOJ A;  4MMM A;  3KGK A;  5DAL B;  2KP1 A;  1YY7 A;  4I2T A;  3GMF A;  3TKS C;  2H0H A;  2GLR A;  1PGT A;  3N5O A;  2LNT A;  1KNG A;  2H75 A;  4ULX A;  1S3C A;  4P3Y B;  5GAP D;  1HNC A;  5ID2 B;  1Z6N A;  2LEG A;  1FB6 A;  2H8L A;  3G7Y A;  3TRX A;  5DJL A;  1HNB A;  3HZ4 A;  2L6C A;  2HZE B;  4WF4 A;  1W89 A;  4WKW A;  3KMO A;  2O8V B;  4KH7 A;  3HVV A;  2JSZ A;  2CQ9 A;  11GS A;  2YOI A;  4Q5N A;  2N5F A;  5ECO B;  2F8A A;  1Z7R A;  1DE2 A;  2ZUP A;  5J9B A;  2X99 A;  1PL2 A;  4N11 A;  2HZF A;  3DKS A;  5ECM B;  3EU3 A;  3GN3 A;  4HJM A;  1XVW A;  3TOT A;  4KSO A;  3VWW A;  4NMU A;  5AIX A;  3QD9 A;  2PGT A;  5COH A;  1A0R P;  1GUH A;  3RDW A;  2GQM A;  1QFN A;  1GP1 A;  6GSW A;  3TKP A;  2NTO A;  2YZH A;  1THO A;  4O5R A;  13GS A;  1VF1 A;  3M9K A;  5DCG A;  4X0X A;  3MDK A;  2WZ9 A;  4H86 A;  3VWU A;  3OR5 A;  2H76 A;  4GST A;  5IPH A;  2DJ0 A;  3D4M A;  1GTB A;  6GST A;  1LJR A;  3C71 A;  5J5N A;  1GSQ A;  5DDL A;  1XXU A;  4TR0 A;  1WPI A;  1TU7 A;  4L0W A;  5D73 A;  2L57 A;  3KTB A;  2K6V A;  3FZA A;  1QMV A;  5FHI A;  2H6Z A;  1ZOF A;  3F4R A;  4XS4 B;  2ON7 A;  1IYH A;  1SJ6 A;  4MZW A;  2H1B A;  3RBT A;  1M99 A;  4HU9 A;  4IHU A;  1GH2 A;  5LD0 A;  5IIZ A;  1AUC A;  3L78 A;  4V2L A;  2VUP A;  1SKR B;  1DSB A;  2LJA A;  1AAZ A;  2LNS A;  1XZO A;  4MPG A;  4MDC A;  1OVN A;  2D2Z A;  3APS A;  2CA8 A;  1TJD A;  2REM A;  4KSM A;  2R6K A;  2H74 A;  3CTF A;  2B7K A;  4DSQ A;  2GTU A;  2XBQ A;  2JL4 A;  4Q5F A;  2ZCT A;  4DSR A;  3UAR A;  2KOK A;  3ZYW A;  3ZL5 A;  4DSS B;  4PQ1 A;  3FHK A;  4XS1 A;  4KAE A;  2I3Y A;  4V2M A;  2H71 A;  2VCQ A;  5G1K A;  1X5C A;  4ISD A;  1K3L A;  3DVX A;  3HXS A;  1PX6 A;  5DQY A;  4WR4 A;  1YQ1 A;  1NHY A;  1J08 A;  2R37 A;  5D9T A;  3HY2 A;  2X8H A;  3ZTL A;  3ERF A;  2AV4 A;  4K0G A;  2FWE A;  5G31 A;  4NHZ A;  4IN0 A;  4BVX A;  3IHQ A;  1KEB A;  2C3N A;  4ZB8 A;  2OE1 A;  2DJK A;  2VLV A;  2RUF A;  2V1M A;  2PMT A;  5H5Q A;  2B5X A;  2V6O A;  1SL0 B;  4ZBD A;  3L9U A;  19GS A;  4ZIJ A;  2EIO A;  1O81 A;  4NHW A;  3EMP A;  4IP1 A;  1A23 A;  1ML6 A;  2CAQ A;  5ELA A;  1SEN A;  1Z7P A;  1N2A A;  2FHE A;  2AJQ B;  4ML6 A;  4WF5 A;  2IJY A;  2LKU A;  1DBY A;  4EXJ A;  5B6M A;  1HD2 A;  4TR3 A;  3ZVJ D;  5EPF A;  3GTU B;  5ECL B;  1M9A A;  1RW1 A;  2KHP A;  3FKF A;  2OAD A;  1PMT A;  2ALB A;  2VM2 A;  1U87 A;  4BL7 A;  1BX9 A;  4LL1 B;  4F2I A;  5B8A A;  4F0C A;  1K0M A;  3HCZ A;  5LCZ A;  4IP6 A;  3GUR A;  1GUK A;  5D96 A;  4HZ2 A;  1B8X A;  4DEJ A;  2LJR A;  1F3B A;  4KX4 A;  4KW6 A;  4NXI A;  4KGI A;  1PSQ A;  3UEM A;  1EEM A;  2LRT A;  5B7C A;  3ZML A;  1R7H A;  3FZ4 A;  5B8B A;  3P8W A;  4MF7 A;  1U3I A;  3FR9 A;  3KMN A;  2EC4 A;  5ECP B;  5KEJ A;  4IVF A;  4XCS A;  3TJJ A;  2YAN A;  4POM A;  1SKW B;  4F0B A;  5JWR B;  4L0U A;  3VI5 A;  1KBN A;  3C1S A;  7GSS A;  4ZIL A;  1PL1 A;  1XOA A;  4MA9 A;  1Y25 A;  2A4V A;  3IK9 A;  1X9M B;  1USB A;  2WJU A;  4IKH A;  3TJB A;  3A2V A;  1MD3 A;  3EC3 A;  3W8J A;  3DEX A;  2R2J A;  3IDV A;  1KTE A;  2FUG 2;  3M9J A;  2G0F A;  1ERU A;  5CRD A;  1BED A;  1M2A A;  2L4C A;  3CSI A;  2VD0 A;  2DBC A;  5KN1 A;  1ZMA A;  4TR4 A;  3IBH A;  1ILO A;  3TKS A;  1OE8 A;  2VCZ A;  1G0T A;  4GXZ A;  2X8C A;  4JED A;  2VCV A;  2AB6 A;  4Q5R A;  3F63 A;  5JCU A;  2YV9 A;  4N30 A;  5J41 A;  3CXG A;  1A24 A;  1I5G A;  2YWO A;  2IMI A;  1ZL9 A;  1FG4 A;  2I1U A;  5F06 A;  3ME7 A;  4OFM A;  4PUR A;  2L5O A;  3GNJ A;  3ZIT A;  3QAG A;  1MDK A;  2B1K A;  3H1N A;  3MAK A;  4TVE A;  3D21 A;  2DJ1 A;  1XOB A;  1QGV A;  1SL2 B;  1THX A;  1WP0 A;  5A5K A;  3C73 A;  2WB9 A;  5E4W A;  3TGZ A;  4POB A;  2DC5 A;  1T4Z A;  2V2G A;  4TXO A;  3E0U A;  3RAZ A;  3AY8 A;  1XWA A;  1JFU A;  2GVP A;  4HI7 A;  1O73 A;  3R2Q A;  3ME8 A;  3GKK A;  2C0D A;  1E6B A;  2P5R A;  4GQF A;  1U3A A;  2C0E A;  3I69 A;  1Z5Y E;  1ZCP A;  1XCC A;  3VI7 A;  2M46 A;  3FRC A;  4EDY A;  4OMV A;  4CDO A;  3DD3 A;  1GRX A;  3TJF A;  5C04 A;  2E7P A;  2LUS A;  5DQS A;  4IS0 A;  5ELG A;  2JZT A;  4KA0 A;  1GLQ A;  2WUL A;  2PVQ A;  2H72 A;  2PPT A;  4E8E A;  3QAV A;  4HQZ A;  5DVB A;  3QOU A;  3PH9 A;  3V1W A;  1CQH A;  1XFL A;  1YKC A;  2HLS A;  1ZZY A;  3U6V A;  5ECH B;  3G9B A;  2VCW A;  2FWF A;  5KN3 A;  3VUR A;  6GSV A;  5F0G A;  1TI1 A;  2AYT A;  4OWY A;  3VWV A;  3W6G A;  3QPM A;  2EIQ A;  4ZBB A;  4I6X A;  2L5L A;  2YJH A;  2A2S A;  4I2U A;  3EU4 A;  1TW9 A;  4NV5 A;  1JZD A;  3DYR A;  4EC0 A;  1K0A A;  2RII A;  2YP6 A;  5HFI A;  5EVO A;  1HYU A;  3GA4 A;  1DUG A;  3G7J A;  4K7O A;  2IME A;  3O76 A;  1IYI A;  4TOP A;  2N5A A;  3NZN A;  3IC4 A;  5CRG A;  2B1L A;  1NSW A;  2Z9S A;  4MH2 A;  1ABA A;  2YN1 A;  3EMX A;  4RQR A;  2YWM A;  2H6Y A;  1Q4J A;  3HA9 A;  5AIS A;  3IK7 A;  3TDG A;  4OFN A;  4PNG A;  22GS A;  1EGO A;  3Q19 A;  2EIR A;  4ZL7 A;  1SD9 A;  2LRN A;  1G6W A;  3MSZ A;  4JRR A;  4JBB A;  5ECK B;  1TDI A;  1M7T A;  5CYY A;  3H79 A;  2C3T A;  2VCX A;  1K3Y A;  3W8S A;  1K0O A;  4TRX A;  1TKD B;  3HHV A;  3DWV A;  1AXD A;  1M2B A;  4CHS A;  3I43 A;  3GIX A;  2DML A;  3LEF A;  1TU8 A;  3RPN A;  3GL3 A;  2FA8 A;  3UVH A;  3CBU A;  3E9J B;  1GTU A;  5E59 A;  1SD8 A;  5HFK A;  2IMF A;  5IPG A;  2XPD A;  4JE1 A;  2VL3 A;  1T8E B;  4HUA A;  5DBQ A;  8GSS A;  2GSQ A;  2QKE A;  2RM6 A;  3IR4 A;  1OC8 A;  1WJK A;  3ZLP A;  4FIW A;  5AIV A;  2WFC A;  2PER A;  3GYK A;  4MJB A;  1JZO A;  3TB2 A;  1B4P A;  3M1G A;  2GQL A;  3P7X A;  3GSS A;  1GWC A;  4F9Z A;  1ZGN A;  4N10 A;  5IQY A;  2C0F A;  2GGT A;  4ZL8 A;  1NM3 A;  4JR4 A;  4KDX A;  3N9J A;  2YPM A;  2QC7 A;  1TTZ A;  4K1F A;  3MNG A;  2K9F A;  1B48 A;  18GS A;  1O85 A;  2HSH A;  3LYK A;  1B9X C;  4TW5 A;  2H30 A;  4L8E A;  5IMD A;  3UMA A;  3BCK A;  3CSJ A;  3HJM A;  3L4N A;  2GQK A;  3BJ5 A;  4D73 B;  4YH2 A;  2N5B A;  2BMX A;  1AQV A;  2GSS A;  4KDU A;  5J3R A;  4MLY A;  2CT6 A;  2H0I A;  1BJX A;  3ERG A;  1RK4 A;  1MD4 A;  1AIU A;  4ECB A;  4L5O A;  1C72 A;  2XHF A;  4OO5 A;  1SYX A;  3WYW A;  2OBK A;  3TKS E;  3UIW A;  1SK0 A;  3IOS A;  1XWG A;  4RQX A;  2OKA A;  4TXO B;  3CSH A;  3FYG A;  2AHE A;  4IW9 A;  2IMK A;  5L71 A;  2VIM A;  4ID0 A;  17GS A;  4LMV A;  3Q74 A;  2VCT A;  2LTK A;  4G2E A;  3ZVJ A;  3DRN A;  2R3X A;  4KCE A;  4ECJ A;  2CVD A;  4ZB9 A;  4BWS A;  6GSX A;  3WGD A;  4ML1 A;  1AQW A;  1EOG A;  1V40 A;  3KM6 A;  2WRT A;  4I97 A;  4G9H A;  2V41 A;  1WMJ A;  1FO5 A;  1H4O A;  1WE0 A;  1PQN A;  1AC1 A;  1OE7 A;  1RQM A;  3QCP A;  5DAL A;  4TR1 A;  1EV9 A;  2RUE A;  3BD2 A;  4MJA A;  2WGR A;  1XWK A;  4L5L A;  2VL2 C;  2RLI A;  3ZIJ A;  1Z6M A;  4QL7 A; 
#chains in the Genus database with same CATH topology
 3ISO A;  2LQQ A;  4O5Q A;  2P5Q A;  1MTC A;  1YEX A;  2YJ7 A;  1OC9 A;  4JZQ A;  3KZQ A;  4GCI A;  5IMV A;  3FZ9 A;  3ERW A;  1AW9 A;  2M72 A;  4HSC X;  3ED3 A;  1XW6 A;  4OFT A;  5HR1 A;  3Q6O A;  4OO4 A;  2JU5 A;  2H1A A;  1TRU A;  3D22 A;  1TP9 A;  3QR6 A;  1XIY A;  1PN9 A;  4YQU A;  4PQH A;  1VRS D;  2LQO A;  1PRX A;  1O6J A;  1BAY A;  1JLV A;  2B5Y A;  4RUV A;  2H0G A;  3A5W A;  1O8W A;  4GWR A;  1BYE A;  1H75 A;  2OBI A;  2BTO T;  1B9Y C;  2K8S A;  3TUE A;  3LG6 A;  1SU9 A;  3QFB C;  3A3T A;  2O7K A;  3GFK A;  3L0H A;  1V2A A;  1SK1 A;  5D93 A;  4YAP A;  2CX3 A;  3C1R A;  3GKN A;  3CTG A;  4LL4 B;  5D8I A;  2I81 A;  2H01 A;  4FO5 A;  2MMO A;  2TIR A;  2YZU A;  5J9C A;  3GH9 A;  2DLX A;  4MH3 A;  2LRC A;  10GS A;  5AN1 A;  1T3B A;  1SJI A;  4USS A;  5IM9 A;  4AJ7 A;  1O7U A;  1YF0 A;  2DJJ A;  4OCF A;  2VLU A;  1XW5 A;  2DJ2 A;  4HJ2 A;  4F82 A;  4NV2 A;  2XBI A;  2CV4 A;  3VK9 A;  4K8M A;  5IMZ A;  2F51 A;  2MMA A;  3GRX A;  4XRD A;  2MMZ A;  3GKX A;  1ZYP A;  2CAI A;  1X0R A;  3HJP A;  3PIN A;  3LWA A;  3HYP A;  2R5G A;  1TK8 B;  2IPA A;  5GZZ B;  3IAS 2;  1TK5 B;  1YEP A;  1GNW A;  5IMC A;  1YF1 A;  2DMM A;  2L6D A;  4XIH A;  4OCE A;  5G2Z A;  2VM1 A;  2F9S A;  3ZIV A;  1LU4 A;  2NDO A;  4PUA A;  3HD5 A;  1GLP A;  5F05 A;  3F3Q A;  4AGS A;  4PX1 A;  2LJK A;  1EV4 A;  4ZL9 A;  2LS5 A;  4WBJ A;  2V6K A;  2HYX A;  3HKR A;  3GH6 A;  5B6N A;  2F8F A;  3F6F A;  4RI6 A;  4PXO A;  2C0G A;  2H1G A;  4TKY A;  1BG5 A;  4HS1 A;  4EVM A;  4GQC A;  1GSU A;  2M80 A;  2VL9 A;  3JCM L;  3UOM A;  2PBJ A;  5JWO B;  3M8N A;  1HNA A;  1WWJ A;  5CRH A;  3IRA A;  1J9B A;  5IO2 A;  5EL8 A;  5G5E A;  4CW9 A;  3UVT A;  1UN2 A;  4QQ7 A;  4K6X A;  1AQX A;  3GX0 A;  5A4W A;  5IOW A;  3LGC A;  4ZB6 A;  2DSA A;  4IBP A;  4Z2T A;  3C7M A;  1QQ2 A;  3L9V A;  2QGV A;  5F07 A;  3GL5 A;  4RI7 A;  5JWQ B;  2A4H A;  4EO3 A;  3TCO A;  3KP9 A;  12GS A;  1A2J A;  1TRW A;  5FWG A;  2VO4 A;  4MJC A;  5D9W A;  2E2M A;  2JAC A;  4NPB A;  2WDU A;  2OE0 A;  3EE2 A;  1SJZ A;  2F3M A;  3UBL A;  4LLR A;  2O89 A;  4WBR D;  5FT3 A;  2RM5 A;  4XTS A;  2IFQ A;  1U6T A;  3BCI A;  4LMW A;  2PU9 C;  2QSI A;  1A8L A;  3L9S A;  5ECQ B;  3ZMK A;  6GSU A;  4K7I A;  2C80 A;  5AGY A;  4MJE A;  2LV3 A;  1R4W A;  2OE3 A;  3IXR A;  5DCH A;  1B4Q A;  4G19 A;  1O8X A;  1YDK A;  2X8G A;  3U5R E;  2R0C A;  1MEK A;  4TR1 B;  3MWH A;  4AF2 A;  1OKD A;  4AJ8 A;  1T00 A;  1R5P A;  4XS6 A;  2V32 A;  3O3T A;  3H93 A;  4N0V A;  4MAB A;  4GF0 A;  4EIQ A;  2DIY A;  1UA5 A;  1UVZ A;  4G0I A;  4NWY A;  4PGT A;  1MDI A;  1SYR A;  5ENU A;  1PX7 A;  4V1A p;  5LNK e;  1OC3 A;  4ILF A;  2HNL A;  1OC9 B;  2H1D A;  2CX4 A;  1GL8 A;  1FVJ A;  5KN0 A;  3LYP A;  3TKQ A;  3CRT A;  3QMX A;  5CRW A;  4EE0 A;  5ECI B;  1DE1 A;  4HZ4 A;  2GST A;  1FVK A;  2XC2 A;  4G0L A;  4ECC A;  1GSE A;  1YJ6 A;  3EIN A;  1NHO A;  3TJG A;  4LA1 A;  2IMD A;  5HQP A;  4IEL A;  2OA7 A;  4ECI A;  4KDY A;  1GSF A;  5A4U A;  3F8U A;  2H19 A;  4PNF A;  3IA1 A;  3KTL A;  1TXX A;  3FW2 A;  5HR3 A;  1J0F A;  3LW9 A;  2C1Y A;  5DAK A;  2MZC A;  3UAP A;  3Q18 A;  5D9V A;  4MPF A;  1K0B A;  4G10 A;  2KUC A;  1Q98 A;  3F9U A;  1XPV A;  3EPT A;  5ABR A;  5KN2 A;  2I9H A;  4JR6 A;  2HRN A;  3SBC A;  3WD6 A;  1SK2 A;  3HVX A;  4BWQ A;  3KH9 A;  2O87 A;  4X4J A;  1YKA A;  2AAW A;  4BPY A;  2VL2 A;  3QFA C;  5JCW A;  3ZZX A;  1PKZ A;  1S3A A;  1W4V A;  2X64 A;  1XWB A;  1TRV A;  3DGQ A;  2TRC P;  1F3A A;  2L59 A;  4JU5 A;  4DVC A;  4KF9 A;  1OYJ A;  3WGE A;  5IOX A;  4J2F A;  3GHA A;  1Z3E A;  2HXK A;  1QK8 A;  3TRP A;  4HEA 2;  2FWH A;  5GST A;  3H4K A;  4X43 A;  2ZNM A;  5IMF A;  5CNW A;  3G7I A;  4K2D A;  16GS A;  1M9B A;  4N0Z A;  4Z7X A;  3UL3 A;  4GSN A;  3S9F A;  4GLT A;  3TKR A;  1EZK A;  1BQ7 A;  4YQV A;  2J23 A;  1EEJ A;  2I4A A;  1F2E A;  4O7H A;  1NW2 A;  3BOA A;  2ON5 A;  3A2W A;  3IE3 A;  1JZR A;  4EF0 A;  1F9M A;  3LFL A;  2LST A;  1T7P B;  1SL1 B;  4EDZ A;  2GT5 A;  2OAC A;  9GSS A;  5G30 A;  2HFD A;  4GSS A;  20GS A;  5CRE A;  3M0F A;  5G1L A;  2CZ3 A;  1M0U A;  3D5J A;  3QAW A;  2PVO C;  3WT1 A;  1ERT A;  3F6D A;  1V57 A;  4EL1 A;  5A4V A;  1X9W B;  1UC7 A;  2FCH A;  3IAM 2;  5HR0 A;  1E2Y A;  3CMI A;  2PN8 A;  1G7O A;  1OKT A;  2HE3 A;  3GST A;  3HJO A;  1PA3 A;  2VOC A;  3US3 A;  2FWG A;  3IV4 A;  2C8U A;  2MYG A;  1V58 A;  3EWL A;  4KUN A;  1EGR A;  4K2X A;  4EUY A;  4J56 E;  3C8E A;  4X1U A;  1ERW A;  2DJ3 A;  2GS3 A;  4IQ1 A;  5HFG A;  3LOR A;  3DXB A;  1T1V A;  3CQF A;  4MCU A;  3RHB A;  2A2R A;  5D9X A;  2HSY A;  1K0C A;  2GZZ A;  3TOU A;  2K8V A;  1QUW A;  3QDN A;  3P90 A;  2JZR A;  2YWN A;  2MBS A;  2L4Q A;  2VD1 A;  1EOH A;  3GX8 A;  3ZRD A;  1ZYQ B;  3LXT A;  2PUK C;  1ERV A;  4A5P A;  3HDC A;  1PKW A;  3HZ8 A;  5IO0 A;  3VPT A;  3J7Y b;  1FHE A;  4G0K A;  1XW9 A;  4IQA A;  3DML A;  2K18 A;  4I8B A;  3F4S A;  2NPB A;  1VF2 A;  4I5Q A;  5CP1 A;  2YWI A;  3GUS A;  2B7J A;  2QA2 A;  2DIZ A;  4EKZ A;  2GZY A;  3O6T A;  1FW1 A;  5ID2 A;  4Q5Q A;  2BJX A;  3ZFL A;  1G7E A;  14GS A;  3LXZ A;  5IMA A;  4K5R A;  1ZYE A;  5J4U A;  2GT6 A;  4NAX A;  4J57 E;  1JLW A;  4FYU A;  2HZE A;  3DVW A;  3KH7 A;  3FY7 A;  3NIV A;  5H5R A;  1EP8 A;  1TRS A;  1GUM A;  2P0G A;  2GSR A;  1GTI A;  2PWJ A;  4TN8 A;  3ZRE A;  3H8Q A;  4OD7 A;  2IFQ B;  3BBY A;  4FYC A;  3KIJ A;  4V2N A;  5JCG A;  4KB3 A;  4O92 A;  2B6M A;  4MF6 A;  3P2A A;  2E2G A;  5H5S A;  1XVQ A;  4WEY A;  4HU7 A;  1FAA A;  4MF5 A;  1F6M C;  1K0D A;  1I9D A;  4K5S A;  3VFI A;  5CO3 A;  4K0N A;  4MZB A;  1PD2 1;  3FEU A;  2MBT A;  3WGX A;  5KOW A;  1X5D A;  2OJL A;  1FOV A;  1WOU A;  4MP4 A;  5DJM A;  2H6X A;  1S3D A;  6GSS A;  3TRQ A;  2R4V A;  4YQM A;  4MZC A;  5BMU A;  4PUF C;  2UZ8 A;  4K7N A;  2P31 A;  2IL3 A;  3FZ5 A;  3M3M A;  4POL A;  5EY6 A;  3NOF A;  2FLS A;  3WT2 A;  2H73 A;  1GTA A;  1ACV A;  2FY6 A;  4AJ6 A;  3I9V 2;  4IJ3 A;  2NBS A;  2XPE A;  1Z9H A;  3ZFB A;  3FR6 A;  5CAX A;  4YAV A;  1QXH A;  4XS4 A;  2GZP A;  3KJY A;  1XWC A;  4QL9 A;  4FYB A;  2B5E A;  2YV7 A;  3EUR A;  2MMN A;  3VPQ A;  2H70 A;  2WS2 A;  2FA4 A;  3HVS A;  2HI7 A;  1JHB A;  2CZ2 A;  2C4J A;  1VGL A;  3KD0 A;  3RHC A;  2FNO A;  2HT9 A;  2JZS A;  4O32 A;  1K3O A;  1MDJ A;  5DAK B;  5F8B A;  5GSS A;  1FB0 A;  3PR8 A;  1A8Y A;  4TXV A;  4E8H A;  1A2M A;  4KCA A;  1VF4 A;  1CQG A;  4ZBA A;  3J7Y k;  1TOF A;  4WR5 A;  5ECR B;  1OAZ A;  1K0N A;  2IIY A;  5INY A;  1Y6E A;  1WIK A;  1R26 A;  1X9S B;  2DKH A;  1GSS A;  4K9Z A;  3FK8 A;  4IGJ A;  3GKM A;  3A5I A;  4WXT A;  2CVK A;  3R3E A;  2KP2 A;  3CYN A;  2QA1 A;  4WET A;  4DSS A;  4D73 A;  3KXO A;  1X5E A;  3UBK A;  1GUL A;  5ECN B;  1GSY A;  4PQI A;  2IWT A;  3CRU A;  3RPP A;  2VAF A;  1JZW A;  1V98 A;  1HQO A;  2NVL A;  2H66 A;  4GTU A;  2IN3 A;  3PGT A;  1GSD A;  3DIE A;  2GDR A;  2O85 A;  3E3E A;  2KLX A;  2B3S A;  4KE3 A;  3UJ1 A;  3VWX A;  4POK A;  4MNN A;  1F37 A;  2FGX A;  3KEB A;  3A2X A;  1EP7 A;  4GRF A;  3FMW A;  3TJK A;  1R5A A;  4Z2R A;  2JAD A;  5GAN D;  3VLN A;  2E0Q A;  2VLT A;  4BVY A;  3LJR A;  4BIK A;  1ON4 A;  2G2Q A;  1A2L A;  1TI3 A;  5ECS A;  4HQS A;  3D0Z A;  4HDE A;  3F4T A;  3I6A A;  3D4T A;  2ES7 A;  5G5F A;  4BA7 A;  2FD3 A;  2C3Q A;  1U88 A;  2TRX A;  3KP8 A;  1SKS B;  4ACS A;  2HSM A;  3LQ7 A;  1M2D A;  4KND A;  3GTU A;  2YCD A;  5HR2 A;  3F0I A;  1TK0 B;  2AUV A;  1YZX A;  2J9H A;  3APQ A;  3EVI A;  1GNE A;  2JSY A;  3KCM A;  4V1A g;  3APO A;  3MYD A;  2YNX A;  2CVB A;  3K8N A;  2WCI A;  1ST9 A;  3SWL A;  1T4Y A;  3IPZ A;  1G6Y A;  1URM A;  1N8J A;  3FR3 A;  4XHM A;  4F03 A;  4ZXG A;  6GSY A;  1V9W A;  1WRY A;  3EYT A;  4XRA A;  1VF3 A;  3F3R A;  3GV1 A;  4FH8 A;  2HRF A;  4MK3 A;  1LBK A;  3D6I A;  3LSZ A;  1A0F A;  5C00 A;  1XBS A;  4IJI A;  1EWX A;  4HOJ A;  4MMM A;  3KGK A;  5DAL B;  2KP1 A;  1YY7 A;  4I2T A;  3GMF A;  3TKS C;  2H0H A;  2GLR A;  1PGT A;  3N5O A;  2LNT A;  1KNG A;  2H75 A;  4ULX A;  1S3C A;  4P3Y B;  5GAP D;  1HNC A;  5ID2 B;  1Z6N A;  2LEG A;  1FB6 A;  2H8L A;  3G7Y A;  3TRX A;  5DJL A;  1PN0 A;  1HNB A;  3HZ4 A;  2L6C A;  2HZE B;  4WF4 A;  1W89 A;  4WKW A;  3KMO A;  2O8V B;  4KH7 A;  2HRA A;  3HVV A;  2JSZ A;  2CQ9 A;  11GS A;  2YOI A;  4Q5N A;  2N5F A;  5ECO B;  2F8A A;  1Z7R A;  1DE2 A;  2ZUP A;  5J9B A;  2X99 A;  1PL2 A;  4N11 A;  2HZF A;  3DKS A;  5ECM B;  3EU3 A;  3GN3 A;  4HJM A;  1XVW A;  3TOT A;  4KSO A;  3VWW A;  4NMU A;  5AIX A;  3QD9 A;  2PGT A;  5COH A;  4PTS A;  1A0R P;  1GUH A;  3RDW A;  2GQM A;  1QFN A;  1GP1 A;  6GSW A;  3TKP A;  2NTO A;  2YZH A;  1THO A;  4O5R A;  13GS A;  1VF1 A;  3M9K A;  4X0X A;  3MDK A;  5DCG A;  2WZ9 A;  4H86 A;  3VWU A;  3OR5 A;  2H76 A;  4GST A;  5IPH A;  2DJ0 A;  3D4M A;  1GTB A;  6GST A;  1LJR A;  3C71 A;  5J5N A;  1GSQ A;  5DDL A;  1XXU A;  4TR0 A;  1WPI A;  1TU7 A;  4L0W A;  5D73 A;  2L57 A;  3KTB A;  2K6V A;  3FZA A;  1QMV A;  5FHI A;  2H6Z A;  1ZOF A;  3F4R A;  4XS4 B;  2ON7 A;  1IYH A;  1SJ6 A;  4MZW A;  2H1B A;  3RBT A;  1M99 A;  4HU9 A;  4IHU A;  1GH2 A;  5LD0 A;  5IIZ A;  1AUC A;  3L78 A;  4V2L A;  2VUP A;  1SKR B;  1DSB A;  2LJA A;  1AAZ A;  2LNS A;  1XZO A;  4MPG A;  4MDC A;  1OVN A;  2D2Z A;  3APS A;  2CA8 A;  1TJD A;  2REM A;  1PFO A;  4KSM A;  2R6K A;  2H74 A;  3CTF A;  2B7K A;  4DSQ A;  2GTU A;  2XBQ A;  2JL4 A;  4Q5F A;  2ZCT A;  4DSR A;  3UAR A;  2KOK A;  3ZYW A;  3ZL5 A;  4DSS B;  4PQ1 A;  3FHK A;  4XS1 A;  4KAE A;  2I3Y A;  4V2M A;  2H71 A;  2VCQ A;  5G1K A;  1X5C A;  4ISD A;  1K3L A;  3DVX A;  3HXS A;  1PX6 A;  5DQY A;  4WR4 A;  1YQ1 A;  1NHY A;  1J08 A;  2R37 A;  5D9T A;  3HY2 A;  2X8H A;  3ZTL A;  3ERF A;  2AV4 A;  1M3I A;  4K0G A;  2FWE A;  5G31 A;  4NHZ A;  4IN0 A;  4BVX A;  3IHQ A;  1KEB A;  2C3N A;  4FQU A;  4ZB8 A;  2OE1 A;  2DJK A;  2VLV A;  1FOH A;  3MIX A;  2RUF A;  2V1M A;  2PMT A;  5H5Q A;  2B5X A;  2V6O A;  4BVY B;  1SL0 B;  4ZBD A;  3L9U A;  19GS A;  4ZIJ A;  2EIO A;  1O81 A;  4NHW A;  3EMP A;  4IP1 A;  1A23 A;  1ML6 A;  2CAQ A;  5ELA A;  1SEN A;  1Z7P A;  1N2A A;  2FHE A;  2AJQ B;  4ML6 A;  4WF5 A;  2IJY A;  2LKU A;  1DBY A;  4EXJ A;  5B6M A;  1HD2 A;  4TR3 A;  3ZVJ D;  5EPF A;  3GTU B;  5ECL B;  1M9A A;  1RW1 A;  2KHP A;  3FKF A;  2OAD A;  1PMT A;  2ALB A;  2VM2 A;  1U87 A;  4BL7 A;  1BX9 A;  4LL1 B;  4F2I A;  5B8A A;  4F0C A;  1K0M A;  3HCZ A;  5LCZ A;  4IP6 A;  3GUR A;  1GUK A;  5D96 A;  4HZ2 A;  1B8X A;  4DEJ A;  2LJR A;  1F3B A;  4KX4 A;  4KW6 A;  2X49 A;  4NXI A;  4KGI A;  1PSQ A;  3UEM A;  1EEM A;  2LRT A;  5B7C A;  3ZML A;  1R7H A;  3FZ4 A;  5B8B A;  3P8W A;  4MF7 A;  1U3I A;  3FR9 A;  3KMN A;  2EC4 A;  5ECP B;  5KEJ A;  4IVF A;  4XCS A;  3TJJ A;  2YAN A;  4POM A;  1SKW B;  4F0B A;  5JWR B;  4L0U A;  3VI5 A;  1KBN A;  3C1S A;  7GSS A;  4ZIL A;  4CY8 A;  1PL1 A;  1XOA A;  2HRK A;  4MA9 A;  1Y25 A;  2A4V A;  3IK9 A;  1X9M B;  1USB A;  2WJU A;  4IKH A;  3TJB A;  3A2V A;  1MD3 A;  3EC3 A;  3IC8 A;  3W8J A;  3DEX A;  2R2J A;  3IDV A;  1KTE A;  2FUG 2;  3M9J A;  2G0F A;  1ERU A;  5CRD A;  1BED A;  1M2A A;  2L4C A;  3CSI A;  2VD0 A;  2DBC A;  5KN1 A;  1ZMA A;  4TR4 A;  3IBH A;  1ILO A;  3TKS A;  1OE8 A;  2VCZ A;  1G0T A;  4GXZ A;  2X8C A;  4JED A;  2VCV A;  2AB6 A;  4Q5R A;  3F63 A;  5JCU A;  2YV9 A;  4N30 A;  5J41 A;  3CXG A;  5KOX A;  1A24 A;  1I5G A;  2YWO A;  2IMI A;  1ZL9 A;  1FG4 A;  2I1U A;  5F06 A;  3ME7 A;  4OFM A;  4PUR A;  2L5O A;  3GNJ A;  3ZIT A;  3QAG A;  1MDK A;  2B1K A;  3H1N A;  3MAK A;  4TVE A;  3D21 A;  2DJ1 A;  1XOB A;  1QGV A;  1SL2 B;  1THX A;  5BRT A;  1WP0 A;  5A5K A;  4Z2U A;  3C73 A;  2WB9 A;  5E4W A;  3TGZ A;  4POB A;  2DC5 A;  1T4Z A;  2V2G A;  4TXO A;  3E0U A;  3RAZ A;  3AY8 A;  1XWA A;  1JFU A;  2GVP A;  4HI7 A;  1O73 A;  3R2Q A;  3ME8 A;  3GKK A;  2C0D A;  1E6B A;  2P5R A;  4GQF A;  1U3A A;  2C0E A;  3I69 A;  1Z5Y E;  1ZCP A;  1XCC A;  3VI7 A;  2M46 A;  3FRC A;  4EDY A;  4OMV A;  4CDO A;  3DD3 A;  1GRX A;  3TJF A;  5C04 A;  2E7P A;  2LUS A;  5DQS A;  4IS0 A;  5ELG A;  2JZT A;  4KA0 A;  2R0P A;  1GLQ A;  2WUL A;  2PVQ A;  2H72 A;  2PPT A;  4E8E A;  3QAV A;  4HQZ A;  5DVB A;  3QOU A;  3PH9 A;  3V1W A;  1CQH A;  1XFL A;  1YKC A;  2HLS A;  1ZZY A;  3U6V A;  2X4A A;  5ECH B;  3G9B A;  4BVX B;  2VCW A;  2FWF A;  5KN3 A;  3VUR A;  6GSV A;  5F0G A;  1TI1 A;  2DKI A;  2AYT A;  4OWY A;  3VWV A;  3W6G A;  3QPM A;  2EIQ A;  4ZBB A;  4I6X A;  2L5L A;  2YJH A;  2A2S A;  4I2U A;  3EU4 A;  1TW9 A;  4NV5 A;  1JZD A;  3DYR A;  4EC0 A;  1K0A A;  2RII A;  2YP6 A;  5HFI A;  5EVO A;  1HYU A;  3GA4 A;  4CY6 A;  1DUG A;  3G7J A;  4K7O A;  2IME A;  3O76 A;  1IYI A;  4TOP A;  2N5A A;  3NZN A;  3IC4 A;  5CRG A;  2B1L A;  1NSW A;  2Z9S A;  4MH2 A;  1ABA A;  2YN1 A;  3EMX A;  4RQR A;  4BL7 B;  2YWM A;  2H6Y A;  1Q4J A;  3HA9 A;  5AIS A;  3IK7 A;  3TDG A;  4OFN A;  4PNG A;  22GS A;  1EGO A;  3Q19 A;  2EIR A;  4ZL7 A;  1SD9 A;  2LRN A;  1G6W A;  3MSZ A;  4JRR A;  4JBB A;  5ECK B;  1TDI A;  1M7T A;  5CYY A;  3H79 A;  2C3T A;  2VCX A;  1K3Y A;  3W8S A;  1K0O A;  4TRX A;  1TKD B;  3HHV A;  3DWV A;  1AXD A;  1M2B A;  4CHS A;  3I43 A;  3GIX A;  2DML A;  3LEF A;  1TU8 A;  3RPN A;  3GL3 A;  2FA8 A;  3UVH A;  3CBU A;  3E9J B;  1GTU A;  5E59 A;  1SD8 A;  5HFK A;  2IMF A;  5IPG A;  2XPD A;  4JE1 A;  2VL3 A;  1T8E B;  4HUA A;  5DBQ A;  8GSS A;  2GSQ A;  2QKE A;  2RM6 A;  3IR4 A;  1OC8 A;  1ZYN A;  1WJK A;  3ZLP A;  4FIW A;  5AIV A;  2WFC A;  2PER A;  3GYK A;  4EIP A;  4MJB A;  1JZO A;  3TB2 A;  1B4P A;  3M1G A;  2GQL A;  3P7X A;  3GSS A;  1GWC A;  4F9Z A;  1ZGN A;  4N10 A;  5IQY A;  2C0F A;  2A2P A;  2GGT A;  1XG8 A;  4ZL8 A;  1S3R A;  1NM3 A;  4JR4 A;  4KDX A;  3N9J A;  2YPM A;  2QC7 A;  1TTZ A;  4K1F A;  3MNG A;  2K9F A;  1B48 A;  18GS A;  1O85 A;  2HSH A;  3LYK A;  1B9X C;  4TW5 A;  2H30 A;  4L8E A;  5IMD A;  3UMA A;  3BCK A;  3CSJ A;  3HJM A;  3L4N A;  2GQK A;  3BJ5 A;  4D73 B;  4YH2 A;  2N5B A;  2BMX A;  1AQV A;  2GSS A;  4KDU A;  5J3R A;  4MLY A;  2CT6 A;  2H0I A;  1BJX A;  3ERG A;  1RK4 A;  1MD4 A;  1AIU A;  4ECB A;  4L5O A;  1C72 A;  2XHF A;  3IHG A;  4OO5 A;  1SYX A;  3WYW A;  2OBK A;  3TKS E;  3UIW A;  1SK0 A;  3IOS A;  1XWG A;  4RQX A;  2OKA A;  4TXO B;  3PPU A;  3CSH A;  3FYG A;  2AHE A;  3HVN A;  4IW9 A;  1M3J A;  2IMK A;  5L71 A;  2VIM A;  4ID0 A;  17GS A;  4LMV A;  3Q74 A;  4O5U A;  2VCT A;  2LTK A;  4G2E A;  3ZVJ A;  3DRN A;  2R3X A;  4KCE A;  4ECJ A;  2CVD A;  4ZB9 A;  4BWS A;  6GSX A;  4YKF A;  3WGD A;  4ML1 A;  1AQW A;  1EOG A;  1V40 A;  3KM6 A;  2WRT A;  4I97 A;  4G9H A;  2V41 A;  2R0G A;  1WMJ A;  4YKG A;  1FO5 A;  1H4O A;  1WE0 A;  1PQN A;  1AC1 A;  1OE7 A;  1RQM A;  3QCP A;  5DAL A;  4TR1 A;  1EV9 A;  4ICY A;  2RUE A;  3BD2 A;  4MJA A;  2WGR A;  1XWK A;  4L5L A;  2VL2 C;  2RLI A;  3ZIJ A;  1Z6M A;  4QL7 A; 
#chains in the Genus database with same CATH homology
 3ISO A;  2LQQ A;  4O5Q A;  2P5Q A;  1MTC A;  1YEX A;  2YJ7 A;  1OC9 A;  4JZQ A;  3KZQ A;  4GCI A;  5IMV A;  3FZ9 A;  3ERW A;  1AW9 A;  2M72 A;  3ED3 A;  1XW6 A;  4OFT A;  5HR1 A;  3Q6O A;  4OO4 A;  2JU5 A;  2H1A A;  1TRU A;  3D22 A;  1TP9 A;  3QR6 A;  1XIY A;  1PN9 A;  4YQU A;  4PQH A;  1VRS D;  2LQO A;  1PRX A;  1O6J A;  1BAY A;  1JLV A;  2B5Y A;  4RUV A;  2H0G A;  3A5W A;  1O8W A;  4GWR A;  1BYE A;  1H75 A;  2OBI A;  2BTO T;  1B9Y C;  2K8S A;  3TUE A;  3LG6 A;  1SU9 A;  3QFB C;  3A3T A;  2O7K A;  3GFK A;  3L0H A;  1V2A A;  1SK1 A;  5D93 A;  4YAP A;  2CX3 A;  3C1R A;  3GKN A;  3CTG A;  4LL4 B;  5D8I A;  2I81 A;  2H01 A;  4FO5 A;  2MMO A;  2TIR A;  2YZU A;  5J9C A;  3GH9 A;  2DLX A;  4MH3 A;  2LRC A;  10GS A;  5AN1 A;  1T3B A;  1SJI A;  4USS A;  5IM9 A;  4AJ7 A;  1O7U A;  1YF0 A;  2DJJ A;  4OCF A;  2VLU A;  1XW5 A;  2DJ2 A;  4HJ2 A;  4F82 A;  4NV2 A;  2XBI A;  2CV4 A;  3VK9 A;  4K8M A;  5IMZ A;  2F51 A;  2MMA A;  3GRX A;  4XRD A;  2MMZ A;  3GKX A;  1ZYP A;  2CAI A;  1X0R A;  3HJP A;  3PIN A;  3LWA A;  3HYP A;  2R5G A;  1TK8 B;  2IPA A;  5GZZ B;  3IAS 2;  1TK5 B;  1YEP A;  1GNW A;  5IMC A;  1YF1 A;  2DMM A;  2L6D A;  4XIH A;  4OCE A;  5G2Z A;  2VM1 A;  2F9S A;  3ZIV A;  1LU4 A;  2NDO A;  4PUA A;  3HD5 A;  1GLP A;  5F05 A;  3F3Q A;  4AGS A;  4PX1 A;  2LJK A;  1EV4 A;  4ZL9 A;  2LS5 A;  4WBJ A;  2V6K A;  2HYX A;  3HKR A;  3GH6 A;  5B6N A;  2F8F A;  3F6F A;  4RI6 A;  4PXO A;  2C0G A;  2H1G A;  4TKY A;  1BG5 A;  4HS1 A;  4EVM A;  4GQC A;  1GSU A;  2M80 A;  2VL9 A;  3JCM L;  3UOM A;  2PBJ A;  5JWO B;  3M8N A;  1HNA A;  1WWJ A;  5CRH A;  3IRA A;  1J9B A;  5IO2 A;  5EL8 A;  5G5E A;  4CW9 A;  3UVT A;  1UN2 A;  4QQ7 A;  4K6X A;  1AQX A;  3GX0 A;  5A4W A;  5IOW A;  3LGC A;  4ZB6 A;  2DSA A;  4IBP A;  4Z2T A;  3C7M A;  1QQ2 A;  3L9V A;  2QGV A;  5F07 A;  3GL5 A;  4RI7 A;  5JWQ B;  2A4H A;  4EO3 A;  3TCO A;  3KP9 A;  12GS A;  1A2J A;  1TRW A;  5FWG A;  2VO4 A;  4MJC A;  5D9W A;  2E2M A;  2JAC A;  4NPB A;  2WDU A;  2OE0 A;  3EE2 A;  1SJZ A;  2F3M A;  3UBL A;  4LLR A;  2O89 A;  4WBR D;  5FT3 A;  2RM5 A;  4XTS A;  2IFQ A;  1U6T A;  3BCI A;  4LMW A;  2PU9 C;  2QSI A;  1A8L A;  3L9S A;  5ECQ B;  3ZMK A;  6GSU A;  4K7I A;  2C80 A;  5AGY A;  4MJE A;  2LV3 A;  1R4W A;  2OE3 A;  3IXR A;  5DCH A;  1B4Q A;  4G19 A;  1O8X A;  1YDK A;  2X8G A;  3U5R E;  2R0C A;  1MEK A;  4TR1 B;  3MWH A;  4AF2 A;  1OKD A;  4AJ8 A;  1T00 A;  1R5P A;  4XS6 A;  2V32 A;  3O3T A;  3H93 A;  4N0V A;  4MAB A;  4GF0 A;  4EIQ A;  2DIY A;  1UA5 A;  1UVZ A;  4G0I A;  4NWY A;  4PGT A;  1MDI A;  1SYR A;  5ENU A;  1PX7 A;  4V1A p;  5LNK e;  1OC3 A;  4ILF A;  2HNL A;  1OC9 B;  2H1D A;  2CX4 A;  1GL8 A;  1FVJ A;  5KN0 A;  3LYP A;  3TKQ A;  3CRT A;  3QMX A;  5CRW A;  4EE0 A;  5ECI B;  1DE1 A;  4HZ4 A;  2GST A;  1FVK A;  2XC2 A;  4G0L A;  4ECC A;  1GSE A;  1YJ6 A;  3EIN A;  1NHO A;  3TJG A;  4LA1 A;  2IMD A;  5HQP A;  4IEL A;  2OA7 A;  4ECI A;  4KDY A;  1GSF A;  5A4U A;  3F8U A;  2H19 A;  4PNF A;  3IA1 A;  3KTL A;  1TXX A;  3FW2 A;  5HR3 A;  1J0F A;  3LW9 A;  2C1Y A;  5DAK A;  2MZC A;  3UAP A;  3Q18 A;  5D9V A;  4MPF A;  1K0B A;  4G10 A;  2KUC A;  1Q98 A;  3F9U A;  1XPV A;  3EPT A;  5ABR A;  5KN2 A;  2I9H A;  4JR6 A;  2HRN A;  3SBC A;  3WD6 A;  1SK2 A;  3HVX A;  4BWQ A;  3KH9 A;  2O87 A;  4X4J A;  1YKA A;  2AAW A;  4BPY A;  2VL2 A;  3QFA C;  5JCW A;  3ZZX A;  1PKZ A;  1S3A A;  1W4V A;  2X64 A;  1XWB A;  1TRV A;  3DGQ A;  2TRC P;  1F3A A;  2L59 A;  4JU5 A;  4DVC A;  4KF9 A;  1OYJ A;  3WGE A;  5IOX A;  4J2F A;  3GHA A;  1Z3E A;  2HXK A;  1QK8 A;  3TRP A;  4HEA 2;  2FWH A;  5GST A;  3H4K A;  4X43 A;  2ZNM A;  5IMF A;  5CNW A;  3G7I A;  4K2D A;  16GS A;  1M9B A;  4N0Z A;  4Z7X A;  3UL3 A;  4GSN A;  3S9F A;  4GLT A;  3TKR A;  1EZK A;  1BQ7 A;  4YQV A;  2J23 A;  1EEJ A;  2I4A A;  1F2E A;  4O7H A;  1NW2 A;  3BOA A;  2ON5 A;  3A2W A;  3IE3 A;  1JZR A;  4EF0 A;  1F9M A;  3LFL A;  2LST A;  1T7P B;  1SL1 B;  4EDZ A;  2GT5 A;  2OAC A;  9GSS A;  5G30 A;  2HFD A;  4GSS A;  20GS A;  5CRE A;  3M0F A;  5G1L A;  2CZ3 A;  1M0U A;  3D5J A;  3QAW A;  2PVO C;  3WT1 A;  1ERT A;  3F6D A;  1V57 A;  4EL1 A;  5A4V A;  1X9W B;  1UC7 A;  2FCH A;  3IAM 2;  5HR0 A;  1E2Y A;  3CMI A;  2PN8 A;  1G7O A;  1OKT A;  2HE3 A;  3GST A;  3HJO A;  1PA3 A;  2VOC A;  3US3 A;  2FWG A;  3IV4 A;  2C8U A;  2MYG A;  1V58 A;  3EWL A;  4KUN A;  1EGR A;  4K2X A;  4EUY A;  4J56 E;  3C8E A;  4X1U A;  1ERW A;  2DJ3 A;  2GS3 A;  4IQ1 A;  5HFG A;  3LOR A;  3DXB A;  1T1V A;  4MCU A;  3RHB A;  2A2R A;  5D9X A;  2HSY A;  1K0C A;  2GZZ A;  3TOU A;  2K8V A;  1QUW A;  3QDN A;  3P90 A;  2JZR A;  2YWN A;  2MBS A;  2L4Q A;  2VD1 A;  1EOH A;  3GX8 A;  3ZRD A;  1ZYQ B;  3LXT A;  2PUK C;  1ERV A;  4A5P A;  3HDC A;  1PKW A;  3HZ8 A;  5IO0 A;  3VPT A;  3J7Y b;  1FHE A;  4G0K A;  1XW9 A;  4IQA A;  3DML A;  2K18 A;  4I8B A;  3F4S A;  2NPB A;  1VF2 A;  4I5Q A;  5CP1 A;  2YWI A;  3GUS A;  2B7J A;  2QA2 A;  2DIZ A;  4EKZ A;  2GZY A;  3O6T A;  1FW1 A;  5ID2 A;  4Q5Q A;  2BJX A;  3ZFL A;  1G7E A;  14GS A;  3LXZ A;  5IMA A;  4K5R A;  1ZYE A;  5J4U A;  2GT6 A;  4NAX A;  4J57 E;  1JLW A;  4FYU A;  2HZE A;  3DVW A;  3KH7 A;  3FY7 A;  3NIV A;  5H5R A;  1EP8 A;  1TRS A;  1GUM A;  2P0G A;  2GSR A;  1GTI A;  2PWJ A;  4TN8 A;  3ZRE A;  3H8Q A;  4OD7 A;  2IFQ B;  3BBY A;  4FYC A;  3KIJ A;  4V2N A;  5JCG A;  4KB3 A;  4O92 A;  2B6M A;  4MF6 A;  3P2A A;  2E2G A;  5H5S A;  1XVQ A;  4WEY A;  4HU7 A;  1FAA A;  4MF5 A;  1F6M C;  1K0D A;  1I9D A;  4K5S A;  3VFI A;  5CO3 A;  4K0N A;  4MZB A;  1PD2 1;  3FEU A;  2MBT A;  3WGX A;  5KOW A;  1X5D A;  2OJL A;  1FOV A;  1WOU A;  4MP4 A;  5DJM A;  2H6X A;  1S3D A;  6GSS A;  3TRQ A;  2R4V A;  4YQM A;  4MZC A;  5BMU A;  4PUF C;  2UZ8 A;  4K7N A;  2P31 A;  2IL3 A;  3FZ5 A;  3M3M A;  4POL A;  5EY6 A;  3NOF A;  2FLS A;  3WT2 A;  2H73 A;  1GTA A;  1ACV A;  2FY6 A;  4AJ6 A;  3I9V 2;  4IJ3 A;  2NBS A;  2XPE A;  1Z9H A;  3ZFB A;  3FR6 A;  5CAX A;  4YAV A;  1QXH A;  4XS4 A;  2GZP A;  3KJY A;  1XWC A;  4QL9 A;  4FYB A;  2B5E A;  2YV7 A;  3EUR A;  2MMN A;  3VPQ A;  2H70 A;  2WS2 A;  2FA4 A;  3HVS A;  2HI7 A;  1JHB A;  2CZ2 A;  2C4J A;  1VGL A;  3KD0 A;  3RHC A;  2FNO A;  2HT9 A;  2JZS A;  4O32 A;  1K3O A;  1MDJ A;  5DAK B;  5F8B A;  5GSS A;  1FB0 A;  3PR8 A;  1A8Y A;  4TXV A;  4E8H A;  1A2M A;  4KCA A;  1VF4 A;  1CQG A;  4ZBA A;  3J7Y k;  1TOF A;  4WR5 A;  5ECR B;  1OAZ A;  1K0N A;  2IIY A;  5INY A;  1Y6E A;  1WIK A;  1R26 A;  1X9S B;  2DKH A;  1GSS A;  4K9Z A;  3FK8 A;  4IGJ A;  3GKM A;  3A5I A;  4WXT A;  2CVK A;  3R3E A;  2KP2 A;  3CYN A;  2QA1 A;  4WET A;  4DSS A;  4D73 A;  3KXO A;  1X5E A;  3UBK A;  1GUL A;  5ECN B;  1GSY A;  4PQI A;  2IWT A;  3CRU A;  3RPP A;  2VAF A;  1JZW A;  1V98 A;  1HQO A;  2NVL A;  2H66 A;  4GTU A;  2IN3 A;  3PGT A;  1GSD A;  3DIE A;  2GDR A;  2O85 A;  3E3E A;  2KLX A;  2B3S A;  4KE3 A;  3UJ1 A;  3VWX A;  4POK A;  4MNN A;  1F37 A;  2FGX A;  3KEB A;  3A2X A;  1EP7 A;  4GRF A;  3FMW A;  3TJK A;  1R5A A;  4Z2R A;  2JAD A;  5GAN D;  3VLN A;  2E0Q A;  2VLT A;  4BVY A;  3LJR A;  1ON4 A;  2G2Q A;  1A2L A;  1TI3 A;  5ECS A;  4HQS A;  3D0Z A;  4HDE A;  3F4T A;  3I6A A;  3D4T A;  2ES7 A;  5G5F A;  4BA7 A;  2FD3 A;  2C3Q A;  1U88 A;  2TRX A;  3KP8 A;  1SKS B;  4ACS A;  2HSM A;  3LQ7 A;  1M2D A;  4KND A;  3GTU A;  2YCD A;  5HR2 A;  3F0I A;  1TK0 B;  2AUV A;  1YZX A;  2J9H A;  3APQ A;  3EVI A;  1GNE A;  2JSY A;  3KCM A;  4V1A g;  3APO A;  3MYD A;  2YNX A;  2CVB A;  3K8N A;  2WCI A;  1ST9 A;  3SWL A;  1T4Y A;  3IPZ A;  1G6Y A;  1URM A;  1N8J A;  3FR3 A;  4XHM A;  4F03 A;  4ZXG A;  6GSY A;  1V9W A;  1WRY A;  3EYT A;  4XRA A;  1VF3 A;  3F3R A;  3GV1 A;  4FH8 A;  2HRF A;  4MK3 A;  1LBK A;  3D6I A;  3LSZ A;  1A0F A;  5C00 A;  1XBS A;  4IJI A;  1EWX A;  4HOJ A;  4MMM A;  3KGK A;  5DAL B;  2KP1 A;  1YY7 A;  4I2T A;  3GMF A;  3TKS C;  2H0H A;  2GLR A;  1PGT A;  3N5O A;  2LNT A;  1KNG A;  2H75 A;  4ULX A;  1S3C A;  4P3Y B;  5GAP D;  1HNC A;  5ID2 B;  1Z6N A;  2LEG A;  1FB6 A;  2H8L A;  3G7Y A;  3TRX A;  5DJL A;  1PN0 A;  1HNB A;  3HZ4 A;  2L6C A;  2HZE B;  4WF4 A;  1W89 A;  4WKW A;  3KMO A;  2O8V B;  4KH7 A;  2HRA A;  3HVV A;  2JSZ A;  2CQ9 A;  11GS A;  2YOI A;  4Q5N A;  2N5F A;  5ECO B;  2F8A A;  1Z7R A;  1DE2 A;  2ZUP A;  5J9B A;  2X99 A;  1PL2 A;  4N11 A;  2HZF A;  3DKS A;  5ECM B;  3EU3 A;  3GN3 A;  4HJM A;  1XVW A;  3TOT A;  4KSO A;  3VWW A;  4NMU A;  5AIX A;  3QD9 A;  2PGT A;  5COH A;  4PTS A;  1A0R P;  1GUH A;  3RDW A;  2GQM A;  1QFN A;  1GP1 A;  6GSW A;  3TKP A;  2NTO A;  2YZH A;  1THO A;  4O5R A;  13GS A;  1VF1 A;  3M9K A;  4X0X A;  3MDK A;  5DCG A;  2WZ9 A;  4H86 A;  3VWU A;  3OR5 A;  2H76 A;  4GST A;  5IPH A;  2DJ0 A;  3D4M A;  1GTB A;  6GST A;  1LJR A;  3C71 A;  5J5N A;  1GSQ A;  5DDL A;  1XXU A;  4TR0 A;  1WPI A;  1TU7 A;  4L0W A;  5D73 A;  2L57 A;  3KTB A;  2K6V A;  3FZA A;  1QMV A;  5FHI A;  2H6Z A;  1ZOF A;  3F4R A;  4XS4 B;  2ON7 A;  1IYH A;  1SJ6 A;  4MZW A;  2H1B A;  3RBT A;  1M99 A;  4HU9 A;  4IHU A;  1GH2 A;  5LD0 A;  5IIZ A;  1AUC A;  3L78 A;  4V2L A;  2VUP A;  1SKR B;  1DSB A;  2LJA A;  1AAZ A;  2LNS A;  1XZO A;  4MPG A;  4MDC A;  1OVN A;  2D2Z A;  3APS A;  2CA8 A;  1TJD A;  2REM A;  4KSM A;  2R6K A;  2H74 A;  3CTF A;  2B7K A;  4DSQ A;  2GTU A;  2XBQ A;  2JL4 A;  4Q5F A;  2ZCT A;  4DSR A;  3UAR A;  2KOK A;  3ZYW A;  3ZL5 A;  4DSS B;  4PQ1 A;  3FHK A;  4XS1 A;  4KAE A;  2I3Y A;  4V2M A;  2H71 A;  2VCQ A;  5G1K A;  1X5C A;  4ISD A;  1K3L A;  3DVX A;  3HXS A;  1PX6 A;  5DQY A;  4WR4 A;  1YQ1 A;  1NHY A;  1J08 A;  2R37 A;  5D9T A;  3HY2 A;  2X8H A;  3ZTL A;  3ERF A;  2AV4 A;  4K0G A;  2FWE A;  5G31 A;  4NHZ A;  4IN0 A;  4BVX A;  3IHQ A;  1KEB A;  2C3N A;  4FQU A;  4ZB8 A;  2OE1 A;  2DJK A;  2VLV A;  1FOH A;  3MIX A;  2RUF A;  2V1M A;  2PMT A;  5H5Q A;  2B5X A;  2V6O A;  4BVY B;  1SL0 B;  4ZBD A;  3L9U A;  19GS A;  4ZIJ A;  2EIO A;  1O81 A;  4NHW A;  3EMP A;  4IP1 A;  1A23 A;  1ML6 A;  2CAQ A;  5ELA A;  1SEN A;  1Z7P A;  1N2A A;  2FHE A;  2AJQ B;  4ML6 A;  4WF5 A;  2IJY A;  2LKU A;  1DBY A;  4EXJ A;  5B6M A;  1HD2 A;  4TR3 A;  3ZVJ D;  5EPF A;  3GTU B;  5ECL B;  1M9A A;  1RW1 A;  2KHP A;  3FKF A;  2OAD A;  1PMT A;  2ALB A;  2VM2 A;  1U87 A;  4BL7 A;  1BX9 A;  4LL1 B;  4F2I A;  5B8A A;  4F0C A;  1K0M A;  3HCZ A;  5LCZ A;  4IP6 A;  3GUR A;  1GUK A;  5D96 A;  4HZ2 A;  1B8X A;  4DEJ A;  2LJR A;  1F3B A;  4KX4 A;  4KW6 A;  2X49 A;  4NXI A;  4KGI A;  1PSQ A;  3UEM A;  1EEM A;  2LRT A;  5B7C A;  3ZML A;  1R7H A;  3FZ4 A;  5B8B A;  3P8W A;  4MF7 A;  1U3I A;  3FR9 A;  3KMN A;  2EC4 A;  5ECP B;  5KEJ A;  4IVF A;  4XCS A;  3TJJ A;  2YAN A;  4POM A;  1SKW B;  4F0B A;  5JWR B;  4L0U A;  3VI5 A;  1KBN A;  3C1S A;  7GSS A;  4ZIL A;  4CY8 A;  1PL1 A;  1XOA A;  2HRK A;  4MA9 A;  1Y25 A;  2A4V A;  3IK9 A;  1X9M B;  1USB A;  2WJU A;  4IKH A;  3TJB A;  3A2V A;  1MD3 A;  3EC3 A;  3IC8 A;  3W8J A;  3DEX A;  2R2J A;  3IDV A;  1KTE A;  2FUG 2;  3M9J A;  2G0F A;  1ERU A;  5CRD A;  1BED A;  1M2A A;  2L4C A;  3CSI A;  2VD0 A;  2DBC A;  5KN1 A;  1ZMA A;  4TR4 A;  3IBH A;  1ILO A;  3TKS A;  1OE8 A;  2VCZ A;  1G0T A;  4GXZ A;  2X8C A;  4JED A;  2VCV A;  2AB6 A;  4Q5R A;  3F63 A;  5JCU A;  2YV9 A;  4N30 A;  5J41 A;  3CXG A;  5KOX A;  1A24 A;  1I5G A;  2YWO A;  2IMI A;  1ZL9 A;  1FG4 A;  2I1U A;  5F06 A;  3ME7 A;  4OFM A;  4PUR A;  2L5O A;  3GNJ A;  3ZIT A;  3QAG A;  1MDK A;  2B1K A;  3H1N A;  3MAK A;  4TVE A;  3D21 A;  2DJ1 A;  1XOB A;  1QGV A;  1SL2 B;  1THX A;  5BRT A;  1WP0 A;  5A5K A;  4Z2U A;  3C73 A;  2WB9 A;  5E4W A;  3TGZ A;  4POB A;  2DC5 A;  1T4Z A;  2V2G A;  4TXO A;  3E0U A;  3RAZ A;  3AY8 A;  1XWA A;  1JFU A;  2GVP A;  4HI7 A;  1O73 A;  3R2Q A;  3ME8 A;  3GKK A;  2C0D A;  1E6B A;  2P5R A;  4GQF A;  1U3A A;  2C0E A;  3I69 A;  1Z5Y E;  1ZCP A;  1XCC A;  3VI7 A;  2M46 A;  3FRC A;  4EDY A;  4OMV A;  4CDO A;  3DD3 A;  1GRX A;  3TJF A;  5C04 A;  2E7P A;  2LUS A;  5DQS A;  4IS0 A;  5ELG A;  2JZT A;  4KA0 A;  2R0P A;  1GLQ A;  2WUL A;  2PVQ A;  2H72 A;  2PPT A;  4E8E A;  3QAV A;  4HQZ A;  5DVB A;  3QOU A;  3PH9 A;  3V1W A;  1CQH A;  1XFL A;  1YKC A;  2HLS A;  1ZZY A;  3U6V A;  2X4A A;  5ECH B;  3G9B A;  4BVX B;  2VCW A;  2FWF A;  5KN3 A;  3VUR A;  6GSV A;  5F0G A;  1TI1 A;  2DKI A;  2AYT A;  4OWY A;  3VWV A;  3W6G A;  3QPM A;  2EIQ A;  4ZBB A;  4I6X A;  2L5L A;  2YJH A;  2A2S A;  4I2U A;  3EU4 A;  1TW9 A;  4NV5 A;  1JZD A;  3DYR A;  4EC0 A;  1K0A A;  2RII A;  2YP6 A;  5HFI A;  5EVO A;  1HYU A;  3GA4 A;  4CY6 A;  1DUG A;  3G7J A;  4K7O A;  2IME A;  3O76 A;  1IYI A;  4TOP A;  2N5A A;  3NZN A;  3IC4 A;  5CRG A;  2B1L A;  1NSW A;  2Z9S A;  4MH2 A;  1ABA A;  2YN1 A;  3EMX A;  4RQR A;  4BL7 B;  2YWM A;  2H6Y A;  1Q4J A;  3HA9 A;  5AIS A;  3IK7 A;  3TDG A;  4OFN A;  4PNG A;  22GS A;  1EGO A;  3Q19 A;  2EIR A;  4ZL7 A;  1SD9 A;  2LRN A;  1G6W A;  3MSZ A;  4JRR A;  4JBB A;  5ECK B;  1TDI A;  1M7T A;  5CYY A;  3H79 A;  2C3T A;  2VCX A;  1K3Y A;  3W8S A;  1K0O A;  4TRX A;  1TKD B;  3HHV A;  3DWV A;  1AXD A;  1M2B A;  4CHS A;  3I43 A;  3GIX A;  2DML A;  3LEF A;  1TU8 A;  3RPN A;  3GL3 A;  2FA8 A;  3UVH A;  3CBU A;  3E9J B;  1GTU A;  5E59 A;  1SD8 A;  5HFK A;  2IMF A;  5IPG A;  2XPD A;  4JE1 A;  2VL3 A;  1T8E B;  4HUA A;  5DBQ A;  8GSS A;  2GSQ A;  2QKE A;  2RM6 A;  3IR4 A;  1OC8 A;  1ZYN A;  1WJK A;  3ZLP A;  4FIW A;  5AIV A;  2WFC A;  2PER A;  3GYK A;  4EIP A;  4MJB A;  1JZO A;  3TB2 A;  1B4P A;  3M1G A;  2GQL A;  3P7X A;  3GSS A;  1GWC A;  4F9Z A;  1ZGN A;  4N10 A;  5IQY A;  2C0F A;  2A2P A;  2GGT A;  4ZL8 A;  1NM3 A;  4JR4 A;  4KDX A;  3N9J A;  2YPM A;  2QC7 A;  1TTZ A;  4K1F A;  3MNG A;  2K9F A;  1B48 A;  18GS A;  1O85 A;  2HSH A;  3LYK A;  1B9X C;  4TW5 A;  2H30 A;  4L8E A;  5IMD A;  3UMA A;  3BCK A;  3CSJ A;  3HJM A;  3L4N A;  2GQK A;  3BJ5 A;  4D73 B;  4YH2 A;  2N5B A;  2BMX A;  1AQV A;  2GSS A;  4KDU A;  5J3R A;  4MLY A;  2CT6 A;  2H0I A;  1BJX A;  3ERG A;  1RK4 A;  1MD4 A;  1AIU A;  4ECB A;  4L5O A;  1C72 A;  2XHF A;  3IHG A;  4OO5 A;  1SYX A;  3WYW A;  2OBK A;  3TKS E;  3UIW A;  1SK0 A;  3IOS A;  1XWG A;  4RQX A;  2OKA A;  4TXO B;  3PPU A;  3CSH A;  3FYG A;  2AHE A;  4IW9 A;  2IMK A;  5L71 A;  2VIM A;  4ID0 A;  17GS A;  4LMV A;  3Q74 A;  4O5U A;  2VCT A;  2LTK A;  4G2E A;  3ZVJ A;  3DRN A;  2R3X A;  4KCE A;  4ECJ A;  2CVD A;  4ZB9 A;  4BWS A;  6GSX A;  4YKF A;  3WGD A;  4ML1 A;  1AQW A;  1EOG A;  1V40 A;  3KM6 A;  2WRT A;  4I97 A;  4G9H A;  2V41 A;  2R0G A;  1WMJ A;  4YKG A;  1FO5 A;  1H4O A;  1WE0 A;  1PQN A;  1AC1 A;  1OE7 A;  1RQM A;  3QCP A;  5DAL A;  4TR1 A;  1EV9 A;  4ICY A;  2RUE A;  3BD2 A;  4MJA A;  2WGR A;  1XWK A;  4L5L A;  2VL2 C;  2RLI A;  3ZIJ A;  1Z6M A;  4QL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...