1QGVA

Human spliceosomal protein u5-15kd
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
136
structure length
130
Chain Sequence
SYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPLICEOSOMAL PROTEIN U5-15KD
publication title Identification, characterization and crystal structure analysis of the human spliceosomal U5 snRNP-specific 15 kD protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 39
structure length 130
sequence length 136
ec nomenclature
pdb deposition date 1999-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02966 DIM1 Mitosis protein DIM1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1qgvA00
3G7IA 3GX8A 3CRUA 1TRWA 1YF1A 3KMOA 1K0NA 5G2ZA 2F8AA 3ZFLA 5ECPB 6GSSA 3MNGA 4WKWA 4GQCA 3D4MA 1UN2A 2QGVA 4D73B 3TKQA 3ZFBA 4MABA 2YWOA 4EDZA 3FR3A 1A2LA 4ECIA 4IBPA 2AUVA 2LNTA 3VPQA 3VI5A 1WIKA 2FNOA 3EWLA 2WJUA 2X64A 4F2IA 3HVVA 4TXVA 4LMVA 2GQLA 2EIRA 3WGDA 1EGOA 1R5AA 1DE2A 4X43A 5DVBA 5D96A 3ME7A 1KTEA 1XWGA 2RM6A 3UBLA 3ZYWA 1R26A 2E7PA 2OJLA 4G2EA 2WULA 2C80A 2GLRA 3M9KA 2VLVA 4I8BA 1G0TA 3Q74A 1FHEA 3QR6A 5IPHA 3IDVA 1Z6MA 1ZYQB 1OC9A 4L8EA 2K8SA 1DBYA 4HUAA 1XWBA 5EY6A 4DSSB 2N5BA 2MMAA 2NBSA 3TJBA 1OE8A 4AJ6A 1FO5A 1GSSA 3GURA 1USBA 1JHBA 4ZL8A 3FZ9A 3BBYA 4FYBA 3CTFA 1V9WA 2IJYA 1M0UA 2LRCA 4FYUA 1TW9A 1AQXA 4OFMA 4OO5A 4ZBAA 1XBSA 4JZQA 2I4AA 1BJXA 2PMTA 3KH9A 4NV5A 4ZILA 1GSYA 3A3TA 4EL1A 4JRRA 2P31A 2PPTA 2FA8A 5ID2A 2O89A 3BCKA 3D21A 1ZCPA 2X99A 3ZL5A 3HDCA 1ZOFA 2H30A 2WS2A 1OKTA 2ZNMA 2P0GA 3QOUA 3CBUA 2H66A 4LL1B 1J08A 1GTIA 4XS4A 2BMXA 1B4PA 3KH7A 4X0XA 5JWOB 2L5OA 4PQIA 4PUAA 4N11A 4D73A 2HNLA 3HJOA 3GL3A 2CT6A 3KIJA 2RUEA 4KSOA 5JCWA 3GKMA 4G19A 4P3YB 4TR3A 1MDIA 2WDUA 2VLTA 1SK0A 2LJKA 2H19A 2R2JA 2GSRA 2L6DA 4MZBA 3UVHA 3QPMA 1K0OA 1J0FA 4EVMA 2DMLA 5H5RA 5FT3A 2FY6A 3A2XA 3GSSA 2B5XA 1U6TA 3FRCA 5ELGA 4ZBBA 3TKSC 3F3RA 1KEBA 1GSEA 1GL8A 1E6BA 2B6MA 1SK1A 1SL0B 4PNFA 1GUHA 12GSA 1ERVA 2X8CA 3N5OA 2FGXA 4WR4A 3LJRA 2CZ3A 2V1MA 1JLWA 4EUYA 3E9JB 1YF0A 1GLPA 2DJ0A 5IMVA 1XWCA 5IOXA 4V1Ag 3WT1A 3TGZA 1QFNA 1VF3A 1F37A 2CQ9A 2WZ9A 1SU9A 1SYXA 5H5SA 4XS6A 4MH2A 2GGTA 3FW2A 3GFKA 4TW5A 1H4OA 1TP9A 5E4WA 5B7CA 5D9XA 3TUEA 3M0FA 2H0HA 2LQOA 5CAXA 1ACVA 1R4WA 4OCFA 5IOWA 1HD2A 1RK4A 2XBIA 2LKUA 2XBQA 2VLUA 2WRTA 4GSTA 4CDOA 5ECNB 1K0MA 4ZL9A 1X5CA 4KDYA 1V2AA 3S9FA 5A5KA 3DMLA 5KN2A 1O7UA 1GTAA 1K3LA 4V2NA 1EEJA 1WWJA 4OWYA 3FR9A 3GKNA 1K3OA 1NSWA 5D9VA 5GZZB 2HLSA 2B7JA 4POBA 2LSTA 3VWVA 5AN1A 1JZRA 1XW9A 3FZ5A 4L5LA 4ECCA 3KTLA 1S3CA 3KTBA 1JZWA 5CP1A 18GSA 4JR4A 2JADA 4TOPA 2LRNA 16GSA 5AIVA 3UARA 3D22A 1SKWB 2OE1A 5IMFA 4YQVA 1V57A 5HR2A 3IPZA 1OC3A 3KMNA 1EP7A 3I43A 3DKSA 1O81A 1A0FA 2DJ2A 1QMVA 1SJIA 2MMNA 2C3QA 1S3AA 2LRTA 2N5FA 3ZIVA 3CTGA 3QAVA 4HDEA 1NHOA 6GSYA 1O8XA 2JZSA 3UBKA 4BL7A 5CNWA 3ZRDA 3M8NA 5KN3A 3ZMLA 4IQ1A 5B8AA 3CSJA 2C3NA 3HVSA 3IV4A 1WJKA 2CVDA 2DLXA 3GN3A 2ALBA 4PNGA 2LQQA 2CV4A 1GSFA 2VO4A 1GWCA 4IVFA 1X9SB 3KD0A 3O6TA 1X9MB 3MSZA 4EF0A 4K0NA 4ID0A 4KX4A 3KEBA 1F3AA 3C1RA 2WB9A 4IJ3A 2AHEA 2DC5A 4YAPA 1XPVA 4KCAA 5DAKA 2PN8A 1T8EB 4O7HA 5FHIA 3F9UA 4CW9A 3G7JA 5G5FA 2IFQB 4LMWA 1TK8B 3UIWA 2YV9A 4JE1A 1I9DA 1YZXA 1JFUA 3TKSE 2PU9C 2FCHA 4AGSA 5AISA 4HQZA 4ECJA 3VFIA 1TRVA 1FVJA 1GULA 1XZOA 1ZL9A 1SYRA 2JL4A 4XRAA 2KUCA 2VL2A 3GX0A 2GZPA 4OCEA 3DVWA 2H70A 1XOBA 2DSAA 4K7OA 2I9HA 3GTUA 4JEDA 2AB6A 3TJFA 4F03A 5G1KA 5D93A 3DD3A 1F3BA 19GSA 2GSTA 4NAXA 3SWLA 1FB0A 3F4SA 4AJ7A 2VCXA 2F3MA 3HXSA 5LNKe 5IMCA 2VCZA 3WGXA 1TK0B 2YJHA 5HFGA 2FLSA 4G9HA 4YAVA 1PA3A 2VCQA 5ECLB 4WBRD 2IMFA 4G10A 4IW9A 4IGJA 6GSVA 2LV3A 1PRXA 1Q4JA 2H6XA 3FHKA 3L9VA 4PUFC 4BPYA 1GH2A 1H75A 2FD3A 3D0ZA 2PUKC 2C0EA 4GWRA 1KBNA 2XC2A 2YN1A 1MD3A 3GRXA 4PQHA 5HR1A 3RHCA 3VWWA 4GQFA 3U5RE 5J5NA 3C1SA 1O73A 1EEMA 1O6JA 2A2RA 3DEXA 3IHQA 2C0GA 3CSIA 2IWTA 1B4QA 2MZCA 5JWRB 2H1GA 2VIMA 2HSYA 2XHFA 2CX3A 1TDIA 2KOKA 1AC1A 3Q19A 3CRTA 2C8UA 3RPPA 5B6NA 3UL3A 2R4VA 2YWMA 1U3AA 4PX1A 4LL4B 1F9MA 4XRDA 4I5QA 2DJ3A 1XW5A 1XVQA 5AGYA 1YEXA 4KDXA 4ZIJA 3JCML 2QSIA 2VL9A 4MMMA 5GAND 2EIOA 3M3MA 2VM2A 1BQ7A 2QC7A 2CVBA 1ABAA 3HJPA 1TU8A 1Z3EA 5KEJA 3ERWA 3KP9A 3PR8A 3P8WA 1SJ6A 2M80A 3ZREA 3GA4A 2K9FA 2GSSA 2HE3A 3TJGA 3IK9A 4EE0A 1U87A 2GZZA 5EVOA 1BAYA 2C0DA 4MK3A 4PURA 4TXOB 5IO2A 2CAIA 3IR4A 1G6WA 2E2MA 3FEUA 4N10A 3IXRA 4JU5A 1F2EA 3QAWA 2FHEA 2ON5A 2WFCA 1GP1A 2TRCP 3QDNA 1T00A 4E8HA 2IPAA 2NDOA 5DBQA 2R5GA 3IK7A 2PBJA 4TN8A 1X9WB 3HJMA 2XPEA 2HZEB 1AIUA 1GTUA 4Z7XA 4X1UA 1EOHA 3VPTA 2DMMA 2D2ZA 2FWFA 3DXBA 5ECRB 2GSQA 4TKYA 3NIVA 1XWAA 1LJRA 3I69A 2REMA 1AAZA 5D73A 3VWXA 1TK5B 4TR1A 3FYGA 1MEKA 2KP1A 2GTUA 2YP6A 3E0UA 4MJBA 1VGLA 4WF4A 4ULXA 4IS0A 4K8MA 5IMZA 2HFDA 1PMTA 2YPMA 5DCGA 2YZHA 3QFAC 1FB6A 5D9TA 5D8IA 4MDCA 2O8VB 4BWSA 4WBJA 1TXXA 1UC7A 5KN1A 4MJCA 5HR3A 3EVIA 3G9BA 2FA4A 4XIHA 4ML6A 1TRSA 5CRGA 3TDGA 1PL2A 2AYTA 2C1YA 3UOMA 1YY7A 4WXTA 1EGRA 1FAAA 3GYKA 4MPFA 3LGCA 1A24A 4MH3A 5EPFA 1TI1A 4OFNA 4KNDA 3ZITA 3W8SA 2M72A 2I1UA 3EU4A 3ZVJD 1E2YA 4GXZA 2H01A 2O87A 3F4TA 4ILFA 2HSHA 5CRHA 4DEJA 5DDLA 1TRUA 2YWIA 2L4CA 3GL5A 1K0DA 3ERFA 1URMA 2PVQA 1PX6A 4HJMA 2EC4A 1F6MC 2FUG2 4TVEA 1M9AA 2V41A 2B5YA 4RUVA 4HOJA 2WCIA 5IMDA 3QAGA 1ILOA 2NPBA 3N9JA 4F0BA 4ZBDA 4DSSA 2H1BA 3APSA 5A4WA 5F06A 3DRNA 3ZTLA 5ECHB 3QD9A 3US3A 1O8WA 1Q98A 4I97A 3A2VA 3EMXA 5ECQB 4DVCA 17GSA 3I6AA 2HZEA 1EWXA 3PGTA 3CMIA 4O32A 3HKRA 3MDKA 4TR4A 2IN3A 5LCZA 1HYUA 3HD5A 1LBKA 1BG5A 4POLA 2I81A 4ZB8A 1C72A 5JCUA 1SKSB 2HRNA 4GTUA 3C7MA 3H93A 3GSTA 1RQMA 4J2FA 3NOFA 3F0IA 5DJLA 3K8NA 4V2LA 5ECIB 2B1KA 2IMDA 1FOVA 4NPBA 3LEFA 1GUKA 2IL3A 1Z6NA 4K1FA 1IYHA 4K0GA 5DALB 2VCTA 1AQWA 5CRWA 4QQ7A 2GQMA 4HS1A 5IIZA 1OVNA 1GSDA 4I6XA 3VURA 1DSBA 1FW1A 3FY7A 5LD0A 4XS1A 3P90A 4K2DA 2L6CA 4H86A 1DE1A 5CREA 1B9YC 3QCPA 5C04A 3H79A 2KP2A 4DSRA 4JR6A 1XVWA 3LG6A 2NTOA 4MF7A 3RPNA 2B5EA 1Z7PA 1PSQA 2H71A 1QK8A 4AF2A 4BWQA 5ABRA 4I2TA 5F05A 3AY8A 3HHVA 1Z7RA 2H8LA 3HA9A 4POKA 3CSHA 2A4VA 2R37A 4KGIA 1VRSD 3WYWA 4YQMA 1GLQA 3TKRA 4O5RA 3D5JA 1GTBA 1GNEA 3HYPA 3IRAA 3WD6A 1A8YA 2AV4A 3C8EA 3KP8A 3KZQA 4MA9A 2C0FA 5E59A 3H4KA 3IE3A 3C73A 5G30A 3QFBC 2MBSA 1G7EA 4L0WA 4HZ4A 3DIEA 3O3TA 4N0VA 2HYXA 3F8UA 2L59A 3EYTA 3EU3A 3PINA 4IELA 4EC0A 4KE3A 4KUNA 1O85A 5IPGA 2DJKA 1MDKA 1ML6A 2XPDA 2K8VA 3UEMA 3GV1A 4KH7A 2V6OA 1HNAA 4MF5A 2DJJA 1CQHA 5J9CA 2GVPA 3A2WA 1YEPA 4ZL7A 2OA7A 5COHA 4V2MA 3HY2A 2JZRA 11GSA 5A4VA 4EKZA 2P5QA 2NVLA 4WF5A 3EC3A 2QKEA 2KLXA 3GH9A 3P2AA 3GMFA 4OO4A 5J9BA 4KAEA 3LYPA 3TCOA 2CZ2A 1M99A 2MMZA 2K18A 2IMKA 3TOTA 2CVKA 3GKXA 2ES7A 3LWAA 4WETA 3BOAA 1R7HA 1YKCA 5FWGA 4FIWA 1OC9B 14GSA 4NV2A 4NHZA 3MAKA 4KSMA 1ERUA 4MLYA 2LNSA 2BJXA 4GSSA 1ST9A 3L78A 1XCCA 3BCIA 2H0GA 2J9HA 2FWHA 4OFTA 4HQSA 4RI6A 3APOA 4N0ZA 3ZLPA 3FZ4A 1R5PA 3TB2A 3U6VA 2VL2C 3IBHA 3O76A 1U3IA 3J7Yb 1ON4A 1SD9A 1XWKA 1VF4A 3RBTA 3FK8A 3I9V2 3L4NA 3F4RA 5ELAA 1OAZA 4HU7A 5ECOB 3SBCA 4QL7A 2DIZA 2V2GA 4Q5QA 8GSSA 6GSXA 2O85A 1WP0A 4GRFA 4GF0A 2YANA 3GH6A 2H0IA 1B9XC 4XS4B 1PD21 4HZ2A 3V1WA 3Q6OA 1SL2B 3LXTA 1VF1A 3ME8A 1V40A 4WEYA 5L71A 2RIIA 3TOUA 3LXZA 3ZZXA 4L0UA 5J4UA 4MCUA 4POMA 2IFQA 4V1Ap 3CXGA 1M7TA 2ZUPA 1K0CA 2G2QA 6GSUA 2P5RA 4ZB9A 1GRXA 4IQAA 4F9ZA 5F07A 5GAPD 4K7NA 2OADA 1HQOA 2J23A 1WPIA 4XCSA 2H1AA 2VCWA 2JU5A 1TOFA 3KJYA 1Z5YE 2H76A 5ECSA 5HR0A 3W6GA 3ZMKA 4PGTA 1M2DA 4K7IA 5G5EA 2GT5A 2RUFA 5IM9A 6GSTA 1K0AA 2H74A 2M46A 2ZCTA 1B8XA 1HNBA 1W89A 1PL1A 20GSA 2OACA 4IKHA 5C00A 3LORA 2YWNA 1K3YA 2OE3A 4ZXGA 4I2UA 2LJAA 4OD7A 3VLNA 1K0BA 3APQA 4EO3A 1T4YA 4ML1A 3WT2A 2CX4A 1AQVA 3C71A 4MZCA 1WE0A 2PERA 3L0HA 1G7OA 1PQNA 1AXDA 3GUSA 2H75A 4ISDA 3UMAA 1OC8A 4KCEA 4F0CA 1ZYEA 5B6MA 1GNWA 4MPGA 3UJ1A 1SKRB 5F8BA 1OYJA 4RI7A 5HFIA 3HCZA 4IHUA 3F63A 2IMEA 4K6XA 2GS3A 5IO0A 3EE2A 2A2SA 1XW6A 3Q18A 3IC4A 4F82A 2HXKA 2FWGA 2K6VA 4NHWA 3EURA 1ERWA 3KGKA 5J3RA 5CO3A 3VWUA 1YQ1A 2PWJA 5IQYA 2IIYA 1QXHA 4GSNA 5HQPA 2L4QA 4J56E 2F8FA 2E2GA 4AJ8A 9GSSA 1EZKA 1JZOA 2KHPA 2H6YA 2PGTA 3E3EA 1ERTA 4FYCA 5DQYA 1YDKA 3GNJA 1I5GA 2CAQA 2L57A 1GSQA 3MWHA 3DYRA 1X5DA 3TKSA 3BD2A 2LS5A 1NW2A 4NXIA 5ENUA 3QMXA 3RAZA 1V98A 2JZTA 2X8HA 3DWVA 1NM3A 1S3DA 2DBCA 2VAFA 4IJIA 2OBKA 4O92A 5DCHA 1KNGA 2I3YA 4RQXA 5INYA 4LA1A 1FG4A 2RM5A 3LSZA 1PGTA 5DJMA 1TKDB 1GSUA 1JLVA 1Y6EA 3TKPA 4WR5A 1N8JA 3PH9A 4HU9A 1M2AA 4DSQA 2V6KA 3EINA 1RW1A 3HZ4A 3P7XA 4Q5NA 2H73A 4TXOA 2H1DA 4CHSA 4E8EA 1B48A 3TJJA 1OE7A 3G7YA 2GQKA 3R2QA 2V32A 3TRQA 5G31A 3DGQA 4GCIA 1EP8A 2MBTA 1XFLA 4ZB6A 2FWEA 5CYYA 5A4UA 5KN0A 1THXA 2LUSA 3F6FA 5DAKB 3ZVJA 2H6ZA 3KXOA 5J41A 2PVOC 4PQ1A 1MTCA 3DVXA 1HNCA 2MMOA 2VL3A 4YH2A 2YV7A 1PX7A 2OKAA 2JSYA 4BA7A 4L5OA 5ECKB 1IYIA 3HZ8A 5H5QA 1OKDA 2YJ7A 4RQRA 3A5WA 2G0FA 1ZGNA 2R3XA 3TRPA 2IMIA 2ON7A 2HRFA 3UAPA 3W8JA 1WRYA 6GSWA 3D4TA 4Q5RA 4ACSA 2VD1A 5B8BA 2X8GA 2C4JA 5D9WA 1XXUA 1PKZA 3LQ7A 2L5LA 2RLIA 4KDUA 4JBBA 3ISOA 2TIRA 4N30A 4MJAA 2B7KA 2VCVA 1T3BA 3GTUB 1A2JA 2GDRA 4XHMA 1EV4A 2MYGA 3ZIJA 3L9UA 4KW6A 2DJ1A 2WGRA 1DUGA 2AAWA 2OBIA 2YZUA 3FKFA 4KA0A 1LU4A 1QUWA 2HT9A 3LYKA 2HI7A 4EDYA 1M9BA 1T4ZA 4Q5FA 3RHBA 4MZWA 3GHAA 3HVXA 4NWYA 1THOA 1X5EA 1A2MA 3M1GA 2HZFA 2AJQB 1NHYA 2LTKA 3KM6A 3H1NA 1WOUA 3LFLA 1Y25A 2JACA 3CYNA 1M2BA 3OR5A 5F0GA 1A8LA 5IMAA 1VF2A 1BX9A 4MF6A 3IOSA 5AIXA 3VK9A 2GT6A 10GSA 3VI7A 2LEGA 3F6DA 2R6KA 3GKKA 3RDWA 4FH8A 4BVYA 2VOCA 2N5AA 4TR0A 1G6YA 1BYEA 4HJ2A 1MD4A 1WMJA 1EV9A 4PXOA 2EIQA 2B1LA 1A0RP 5JCGA 1W4VA 2YCDA 4HI7A 2YNXA 5DQSA 4TRXA 3FZAA 2VD0A 3NZNA 3ERGA 3IA1A 13GSA 2F51A 2LJRA 3D6IA 1UVZA 2C3TA 4J57E 2Z9SA 1TI3A 4IN0A 4IP1A 3M9JA 1Z9HA 4OMVA 4LLRA 4MP4A 3BJ5A 1EOGA 5JWQB 1FVKA 5ECMB 4ECBA 5CRDA 4XTSA 3J7Yk 5GSTA 2OE0A 4HEA2 1SL1B 1SK2A 1UA5A 1AW9A 1J9BA 2B3SA 1SENA 2GZYA 4NMUA 1XOAA 1V58A 3GIXA 5DALA 1YJ6A 5GSSA 22GSA 5HFKA 2TRXA 3IAM2 3TRXA 2DIYA 4K9ZA 4FO5A 1PKWA 1SJZA 1PN9A 4BVXA 1TJDA 3EMPA 1MDJA 1ZZYA 1QGVA 1JZDA 3L9SA 1XIYA 3WGEA 2BTOT 1GUMA 1U88A 1YKAA 4MJEA 1X0RA 4IP6A 5EL8A 3ED3A 2CA8A 2F9SA 2YOIA 1N2AA 2E0QA 4GLTA 1SD8A 5G1LA 1BEDA 1T7PB 3F3QA 3UVTA 3TJKA 3H8QA 7GSSA 1CQGA 3FR6A 2VUPA 1A23A 2JSZA 4TR1B 4QL9A 2H72A 5ID2B 4EXJA 1AUCA 1TU7A 1ZMAA 3KCMA 1T1VA 4KB3A 2VM1A 2O7KA 1TTZA 3IAS2 4YQUA 1QQ2A
chains in the Genus database with same CATH superfamily
3G7IA 3GX8A 3CRUA 1TRWA 1YF1A 3KMOA 1K0NA 5G2ZA 2F8AA 3ZFLA 5ECPB 6GSSA 3MNGA 4WKWA 4GQCA 2HRKA 3D4MA 1UN2A 2QGVA 4D73B 3TKQA 3ZFBA 4MABA 2YWOA 4EDZA 3FR3A 2DKIA 1A2LA 4ECIA 4IBPA 2AUVA 2LNTA 4HSCX 3VPQA 3VI5A 1WIKA 2FNOA 3EWLA 2WJUA 2X64A 4F2IA 3HVVA 4TXVA 4LMVA 2GQLA 2EIRA 3WGDA 1EGOA 1R5AA 1DE2A 4X43A 5DVBA 5D96A 3ME7A 1KTEA 1XWGA 2RM6A 3UBLA 3ZYWA 1R26A 2E7PA 2OJLA 4Z2TA 4G2EA 4K2XA 2WULA 2C80A 2GLRA 3M9KA 2VLVA 4I8BA 1G0TA 3Q74A 1FHEA 3QR6A 5IPHA 3IDVA 1Z6MA 1ZYQB 1OC9A 4L8EA 2K8SA 1DBYA 4HUAA 1XWBA 5EY6A 4DSSB 3MIXA 2N5BA 2MMAA 2NBSA 3TJBA 1OE8A 4AJ6A 1FO5A 1GSSA 3GURA 1USBA 1JHBA 4ZL8A 3FZ9A 3BBYA 4FYBA 3CTFA 1V9WA 2IJYA 1M0UA 2LRCA 4FYUA 1TW9A 1AQXA 4OFMA 4OO5A 4ZBAA 1XBSA 3MYDA 2I4AA 4JZQA 1BJXA 2PMTA 3KH9A 4NV5A 4ZILA 1GSYA 3A3TA 4EL1A 4JRRA 2P31A 2PPTA 2FA8A 5ID2A 2O89A 3BCKA 3D21A 1ZCPA 2X99A 3ZL5A 3HDCA 1ZOFA 2H30A 2WS2A 3FMWA 1OKTA 2ZNMA 2P0GA 3QOUA 3CBUA 2H66A 4LL1B 1J08A 1GTIA 4XS4A 2BMXA 1B4PA 3KH7A 4X0XA 5JWOB 2L5OA 4PQIA 4PUAA 4N11A 4D73A 2HNLA 3HJOA 3GL3A 2CT6A 3KIJA 2RUEA 4KSOA 5JCWA 3GKMA 4G19A 4P3YB 4TR3A 1MDIA 2WDUA 2VLTA 1SK0A 2LJKA 4MNNA 2H19A 2R2JA 2GSRA 2L6DA 1ZYNA 4MZBA 3UVHA 3QPMA 4FQUA 1K0OA 1J0FA 2A2PA 4EVMA 2DMLA 5H5RA 5FT3A 2FY6A 3A2XA 3GSSA 2B5XA 1U6TA 3IHGA 3FRCA 5ELGA 4ZBBA 3TKSC 3F3RA 1KEBA 1GSEA 1GL8A 3HVNA 1E6BA 2B6MA 1SK1A 1SL0B 4PNFA 1GUHA 12GSA 1ERVA 2X8CA 3N5OA 2FGXA 4WR4A 3LJRA 2CZ3A 2V1MA 1JLWA 4EUYA 3E9JB 1YF0A 1GLPA 2DJ0A 5IMVA 1XWCA 5IOXA 4V1Ag 3WT1A 3TGZA 1QFNA 1VF3A 1F37A 2CQ9A 2WZ9A 1SU9A 1SYXA 5H5SA 4XS6A 4MH2A 2GGTA 3FW2A 3GFKA 4TW5A 1H4OA 1TP9A 5E4WA 5B7CA 5D9XA 3TUEA 3M0FA 2H0HA 2LQOA 5CAXA 1ACVA 1R4WA 4OCFA 5IOWA 1HD2A 1RK4A 2XBIA 2LKUA 2XBQA 2VLUA 2WRTA 4GSTA 4CDOA 5ECNB 1K0MA 4ZL9A 1X5CA 4KDYA 1V2AA 3S9FA 5A5KA 3DMLA 5KN2A 1O7UA 1GTAA 1K3LA 4V2NA 1EEJA 1WWJA 4OWYA 3FR9A 3GKNA 1K3OA 1NSWA 5D9VA 5GZZB 2HLSA 2B7JA 4POBA 2LSTA 3VWVA 5AN1A 1JZRA 1XW9A 3FZ5A 4L5LA 4ECCA 3KTLA 4KF9A 1S3CA 3KTBA 1JZWA 5CP1A 18GSA 4JR4A 2JADA 4TOPA 2LRNA 16GSA 5AIVA 3UARA 3D22A 1SKWB 2OE1A 5IMFA 4YQVA 1V57A 5HR2A 3IPZA 1OC3A 3KMNA 1EP7A 3I43A 3DKSA 1O81A 1A0FA 2DJ2A 1QMVA 1SJIA 2MMNA 2C3QA 1S3AA 2LRTA 2N5FA 3ZIVA 3CTGA 3QAVA 4HDEA 1NHOA 6GSYA 1O8XA 2JZSA 3UBKA 4BL7A 5CNWA 3ZRDA 3M8NA 5KN3A 3ZMLA 4IQ1A 5B8AA 3CSJA 2C3NA 3HVSA 3IV4A 1WJKA 2CVDA 2DLXA 3GN3A 2ALBA 4PNGA 2LQQA 2CV4A 1GSFA 2VO4A 1GWCA 4IVFA 1X9SB 3KD0A 3O6TA 1X9MB 3MSZA 1M3IA 4EF0A 4K0NA 4ID0A 4KX4A 3KEBA 1F3AA 3C1RA 2WB9A 4IJ3A 2AHEA 2DC5A 4YAPA 1XPVA 4KCAA 5DAKA 2PN8A 1T8EB 4O7HA 5FHIA 3F9UA 4CW9A 3G7JA 5BMUA 2QA1A 4G0LA 5G5FA 2IFQB 4LMWA 1TK8B 3UIWA 2YV9A 4JE1A 1I9DA 1YZXA 1JFUA 3TKSE 2PU9C 2FCHA 4AGSA 5AISA 4HQZA 4CY6A 4ECJA 3VFIA 1TRVA 1FVJA 2X49A 1GULA 1XZOA 1ZL9A 1SYRA 2JL4A 4XRAA 2KUCA 2VL2A 3GX0A 2GZPA 4OCEA 3DVWA 2H70A 1XOBA 2DSAA 4K7OA 2I9HA 3GTUA 4JEDA 2AB6A 2R0CA 3TJFA 4F03A 5G1KA 5D93A 3DD3A 1F3BA 19GSA 2GSTA 4NAXA 3SWLA 1FB0A 3F4SA 4AJ7A 2VCXA 2F3MA 3HXSA 5LNKe 5IMCA 2VCZA 3WGXA 1TK0B 2YJHA 5HFGA 2FLSA 4G9HA 4YAVA 1PA3A 2VCQA 5ECLB 4WBRD 2IMFA 4G10A 4IW9A 4IGJA 6GSVA 2LV3A 1PRXA 1Q4JA 2H6XA 3FHKA 3L9VA 4PUFC 4BPYA 1GH2A 1H75A 2FD3A 3D0ZA 2PUKC 2C0EA 4GWRA 1KBNA 2XC2A 2YN1A 1MD3A 3GRXA 4PQHA 5HR1A 3RHCA 3VWWA 4GQFA 4BIKA 3U5RE 5J5NA 3C1SA 1O73A 1EEMA 1O6JA 2A2RA 3DEXA 3IHQA 2C0GA 4O5QA 3CSIA 2IWTA 1B4QA 2MZCA 5JWRB 2H1GA 2VIMA 2HSYA 2XHFA 2CX3A 1TDIA 2KOKA 1AC1A 3Q19A 3CRTA 2C8UA 3RPPA 5B6NA 3UL3A 2R4VA 2YWMA 1U3AA 4PX1A 4LL4B 1F9MA 4XRDA 4I5QA 2DJ3A 1XW5A 1XVQA 5AGYA 1YEXA 4KDXA 4ZIJA 3JCML 2QSIA 2VL9A 4MMMA 5GAND 2EIOA 3M3MA 2VM2A 1BQ7A 2QC7A 2CVBA 1ABAA 3HJPA 1TU8A 1Z3EA 5KEJA 3ERWA 3KP9A 3PR8A 3P8WA 1SJ6A 2M80A 3ZREA 3GA4A 2K9FA 2GSSA 2HE3A 3TJGA 3IK9A 4EE0A 1U87A 1S3RA 2GZZA 5EVOA 2X4AA 1BAYA 2C0DA 4MK3A 4PURA 4TXOB 5IO2A 2CAIA 3IR4A 1G6WA 1PN0A 2E2MA 3FEUA 4N10A 3IXRA 4JU5A 1F2EA 3QAWA 2FHEA 2ON5A 2WFCA 1GP1A 2TRCP 3QDNA 1T00A 4E8HA 2IPAA 2NDOA 5DBQA 2R5GA 3IK7A 2PBJA 4TN8A 1X9WB 3HJMA 2XPEA 2HZEB 1AIUA 1GTUA 4Z7XA 4X1UA 1EOHA 3VPTA 2DMMA 2D2ZA 2FWFA 3DXBA 5ECRB 2GSQA 4TKYA 3NIVA 1XWAA 5BRTA 1LJRA 3I69A 2REMA 4EIQA 1AAZA 5D73A 3VWXA 1TK5B 4TR1A 4Z2UA 3FYGA 1MEKA 2KP1A 2GTUA 2YP6A 3E0UA 4MJBA 1VGLA 4WF4A 4ULXA 4IS0A 4K8MA 5IMZA 2HFDA 1PMTA 2YPMA 5DCGA 3PPUA 2YZHA 3QFAC 1FB6A 5D9TA 5D8IA 4MDCA 2O8VB 4BWSA 4WBJA 1TXXA 1UC7A 5KN1A 4MJCA 5HR3A 3EVIA 3G9BA 2FA4A 4XIHA 4ML6A 1TRSA 5CRGA 3TDGA 1PL2A 2AYTA 2C1YA 3UOMA 1YY7A 4WXTA 1EGRA 1FAAA 3GYKA 4MPFA 3LGCA 1A24A 4MH3A 5EPFA 1TI1A 4OFNA 4KNDA 3ZITA 3W8SA 2M72A 2I1UA 3EU4A 3ZVJD 1E2YA 4GXZA 2H01A 2O87A 3F4TA 4ILFA 2HSHA 5CRHA 4DEJA 5DDLA 1TRUA 2YWIA 2L4CA 3GL5A 1K0DA 3ERFA 1URMA 2PVQA 1PX6A 4HJMA 2EC4A 1F6MC 2FUG2 4TVEA 1M9AA 2V41A 2B5YA 4RUVA 4HOJA 2WCIA 5IMDA 3QAGA 1ILOA 2NPBA 4BVYB 3N9JA 4F0BA 4ZBDA 4DSSA 2H1BA 3APSA 5A4WA 5F06A 3DRNA 3ZTLA 5ECHB 5KOWA 3QD9A 3US3A 1O8WA 1Q98A 4I97A 5KOXA 3A2VA 3EMXA 5ECQB 4DVCA 17GSA 3I6AA 2HZEA 1EWXA 3PGTA 3CMIA 4O32A 3HKRA 3MDKA 4CY8A 4TR4A 2IN3A 5LCZA 1HYUA 3HD5A 1LBKA 1BG5A 4POLA 2I81A 4ZB8A 1C72A 5JCUA 1SKSB 2HRNA 4GTUA 2HSMA 3C7MA 3H93A 3GSTA 1RQMA 4J2FA 3NOFA 3F0IA 5DJLA 3K8NA 4V2LA 5ECIB 2B1KA 2IMDA 1FOVA 4NPBA 3LEFA 1GUKA 2IL3A 1Z6NA 4K1FA 1IYHA 4K0GA 5DALB 2VCTA 1AQWA 5CRWA 4O5UA 4QQ7A 2GQMA 4HS1A 5IIZA 1OVNA 1GSDA 4I6XA 3VURA 1DSBA 1FW1A 3FY7A 5LD0A 4XS1A 3P90A 4BVXB 4K2DA 2A4HA 2L6CA 4H86A 1DE1A 5CREA 1B9YC 3QCPA 5C04A 3H79A 2KP2A 4DSRA 4JR6A 1XVWA 3LG6A 2NTOA 4MF7A 3RPNA 2B5EA 1Z7PA 1PSQA 2H71A 1QK8A 4AF2A 4BWQA 5ABRA 4I2TA 5F05A 3AY8A 3HHVA 1Z7RA 2H8LA 3HA9A 4POKA 3CSHA 2A4VA 2R37A 4KGIA 1VRSD 3WYWA 4YQMA 1GLQA 3TKRA 4O5RA 3D5JA 1GTBA 1GNEA 3HYPA 3IRAA 3WD6A 1A8YA 2AV4A 3C8EA 3KP8A 3KZQA 4MA9A 2C0FA 5E59A 3H4KA 3IE3A 3C73A 5G30A 3QFBC 2MBSA 1G7EA 4L0WA 4HZ4A 3DIEA 3O3TA 4N0VA 2HYXA 3F8UA 2L59A 3EYTA 3EU3A 3PINA 4IELA 4EC0A 4KE3A 4KUNA 1O85A 5IPGA 2DJKA 1MDKA 1ML6A 2XPDA 2K8VA 3UEMA 3GV1A 4KH7A 2V6OA 1HNAA 4MF5A 2DJJA 1CQHA 5J9CA 2GVPA 3A2WA 1YEPA 4ZL7A 2OA7A 5COHA 4V2MA 3HY2A 2JZRA 4G0IA 11GSA 5A4VA 4EKZA 2P5QA 2NVLA 4WF5A 3EC3A 2QKEA 3P2AA 2KLXA 3GH9A 3GMFA 4OO4A 5J9BA 4KAEA 3LYPA 3TCOA 2CZ2A 1M99A 2MMZA 2K18A 2IMKA 3TOTA 2CVKA 3GKXA 2ES7A 3LWAA 4WETA 3BOAA 1R7HA 1YKCA 5FWGA 4FIWA 1OC9B 14GSA 4NV2A 4NHZA 3MAKA 4KSMA 1ERUA 4MLYA 2LNSA 2BJXA 4GSSA 1ST9A 1M3JA 3L78A 1XCCA 3BCIA 2H0GA 2J9HA 2FWHA 4OFTA 4HQSA 4RI6A 3APOA 4N0ZA 3ZLPA 3FZ4A 1R5PA 3TB2A 3U6VA 2VL2C 3IBHA 3O76A 1U3IA 3J7Yb 1ON4A 1SD9A 1XWKA 1VF4A 3RBTA 3IC8A 3FK8A 3I9V2 3L4NA 3F4RA 5ELAA 1OAZA 4HU7A 5ECOB 3SBCA 4QL7A 2DIZA 2V2GA 4Q5QA 8GSSA 3EPTA 6GSXA 4EIPA 2O85A 1WP0A 4GRFA 4GF0A 2YANA 3GH6A 2H0IA 1B9XC 4XS4B 1PD21 4HZ2A 3V1WA 3Q6OA 1SL2B 3LXTA 1VF1A 3ME8A 1V40A 4WEYA 3R3EA 5L71A 2RIIA 3TOUA 3LXZA 3ZZXA 4L0UA 5J4UA 4MCUA 4POMA 2IFQA 4V1Ap 3CXGA 1M7TA 2ZUPA 1K0CA 2G2QA 6GSUA 2P5RA 4ZB9A 1GRXA 4IQAA 4A5PA 4F9ZA 5F07A 5GAPD 4K7NA 2OADA 1HQOA 2J23A 1WPIA 3A5IA 4XCSA 2H1AA 2VCWA 2JU5A 1TOFA 3KJYA 1Z5YE 2H76A 5ECSA 5HR0A 3W6GA 3ZMKA 4PGTA 1M2DA 4K7IA 5G5EA 2GT5A 2RUFA 5IM9A 6GSTA 1K0AA 2H74A 2M46A 2ZCTA 1B8XA 1HNBA 1W89A 1PL1A 20GSA 2OACA 4IKHA 5C00A 3LORA 2YWNA 1K3YA 2OE3A 1ZYPA 4ZXGA 4I2UA 2LJAA 4OD7A 3VLNA 1K0BA 3APQA 4EO3A 1T4YA 4ML1A 3WT2A 2CX4A 1AQVA 3C71A 4MZCA 1WE0A 2PERA 3L0HA 1G7OA 1PQNA 1AXDA 3GUSA 2H75A 4ISDA 3UMAA 1OC8A 4KCEA 4F0CA 1ZYEA 5B6MA 1GNWA 4MPGA 3UJ1A 1SKRB 5F8BA 1OYJA 4RI7A 5HFIA 3HCZA 4IHUA 3F63A 2IMEA 4K6XA 2R0PA 2HRAA 2GS3A 5IO0A 3EE2A 1XG8A 4ICYA 2A2SA 1XW6A 3Q18A 3IC4A 4F82A 2HXKA 2FWGA 2K6VA 4NHWA 3EURA 1ERWA 3KGKA 5J3RA 5CO3A 3VWUA 1YQ1A 2PWJA 5IQYA 2IIYA 1QXHA 4GSNA 5HQPA 2L4QA 4J56E 2F8FA 2E2GA 4AJ8A 9GSSA 1EZKA 1JZOA 2KHPA 2H6YA 2PGTA 3E3EA 4Z2RA 1ERTA 4FYCA 5DQYA 1YDKA 3GNJA 1I5GA 2CAQA 2L57A 1GSQA 3MWHA 3DYRA 1X5DA 3TKSA 3BD2A 2LS5A 4K5RA 1NW2A 4NXIA 5ENUA 3QMXA 3RAZA 1V98A 2JZTA 2X8HA 3DWVA 1NM3A 1S3DA 2DBCA 2VAFA 4IJIA 2OBKA 4O92A 4PTSA 5DCHA 1KNGA 2I3YA 4RQXA 5INYA 4LA1A 1FG4A 2RM5A 3LSZA 4X4JA 1PGTA 5DJMA 1TKDB 1GSUA 1JLVA 1Y6EA 3TKPA 4WR5A 1N8JA 3PH9A 4HU9A 1M2AA 4BL7B 4DSQA 2V6KA 3EINA 1RW1A 3HZ4A 3P7XA 4Q5NA 2H73A 4TXOA 2H1DA 4CHSA 4E8EA 1B48A 3TJJA 1OE7A 3G7YA 1FOHA 2GQKA 3R2QA 2V32A 3TRQA 5G31A 3DGQA 4GCIA 1EP8A 2MBTA 1XFLA 4ZB6A 2FWEA 5CYYA 5A4UA 5KN0A 1THXA 2LUSA 3F6FA 5DAKB 3ZVJA 2H6ZA 3KXOA 5J41A 2PVOC 4PQ1A 1MTCA 3DVXA 1HNCA 2MMOA 3CQFA 2VL3A 4YH2A 2YV7A 1PX7A 2QA2A 2OKAA 4YKFA 2JSYA 4BA7A 4L5OA 5ECKB 1IYIA 3HZ8A 5H5QA 1OKDA 2YJ7A 4RQRA 3A5WA 2G0FA 1ZGNA 2R3XA 3TRPA 2IMIA 2ON7A 2HRFA 4USSA 3UAPA 3W8JA 1WRYA 6GSWA 3D4TA 4Q5RA 4ACSA 2VD1A 5B8BA 2X8GA 2UZ8A 2C4JA 5D9WA 1XXUA 1PKZA 3LQ7A 2L5LA 2RLIA 4KDUA 4JBBA 3ISOA 4N30A 2TIRA 4MJAA 2B7KA 2VCVA 1T3BA 4G0KA 3GTUB 1A2JA 2GDRA 4XHMA 3LW9A 1EV4A 2MYGA 3ZIJA 3L9UA 4KW6A 2DJ1A 2WGRA 1DUGA 2AAWA 2OBIA 2YZUA 3FKFA 4KA0A 1LU4A 1QUWA 2HT9A 3LYKA 2HI7A 4EDYA 1M9BA 1T4ZA 4Q5FA 3RHBA 4MZWA 3GHAA 3HVXA 4NWYA 1THOA 2R0GA 1X5EA 1A2MA 3M1GA 2HZFA 2AJQB 1NHYA 2LTKA 3KM6A 3H1NA 1WOUA 3LFLA 1Y25A 2JACA 3CYNA 1M2BA 3OR5A 5F0GA 1A8LA 5IMAA 1VF2A 1BX9A 4MF6A 3IOSA 5AIXA 3VK9A 2GT6A 10GSA 3VI7A 2LEGA 3F6DA 2R6KA 3GKKA 4K5SA 3RDWA 4FH8A 4BVYA 2VOCA 2N5AA 2DKHA 4TR0A 1G6YA 1BYEA 4HJ2A 1MD4A 1WMJA 1EV9A 4PXOA 2EIQA 2B1LA 1A0RP 5JCGA 1W4VA 2YCDA 4HI7A 2YNXA 5DQSA 4TRXA 3FZAA 2VD0A 3NZNA 3ERGA 3IA1A 13GSA 2F51A 2LJRA 3D6IA 1UVZA 2C3TA 4J57E 2Z9SA 1TI3A 4IN0A 4IP1A 3M9JA 1Z9HA 4OMVA 4LLRA 4MP4A 3BJ5A 1EOGA 5JWQB 1FVKA 5ECMB 4ECBA 5CRDA 4XTSA 3J7Yk 5GSTA 2OE0A 4HEA2 1SL1B 1SK2A 1UA5A 1AW9A 1J9BA 2B3SA 1SENA 2GZYA 4NMUA 1XOAA 1V58A 3GIXA 5DALA 1YJ6A 5GSSA 22GSA 5HFKA 2TRXA 3IAM2 3TRXA 2DIYA 4K9ZA 4FO5A 1PKWA 1SJZA 1PN9A 4BVXA 1TJDA 3EMPA 1MDJA 1ZZYA 1QGVA 1JZDA 3L9SA 1XIYA 3WGEA 2BTOT 1GUMA 1U88A 1YKAA 4MJEA 1X0RA 4IP6A 5EL8A 3ED3A 2CA8A 2F9SA 2YOIA 1N2AA 2E0QA 4GLTA 1SD8A 5G1LA 1BEDA 1T7PB 3F3QA 3UVTA 3TJKA 3H8QA 7GSSA 1CQGA 3FR6A 2VUPA 1A23A 2JSZA 4TR1B 4QL9A 4YKGA 2H72A 5ID2B 4EXJA 1AUCA 1TU7A 1ZMAA 3KCMA 1T1VA 4KB3A 2VM1A 2O7KA 1TTZA 3IAS2 4YQUA 1QQ2A 1PFOA
chains in the Genus database with same CATH topology
3G7IA 3GX8A 3CRUA 1TRWA 1YF1A 3KMOA 1K0NA 5G2ZA 2F8AA 3ZFLA 5ECPB 6GSSA 3MNGA 4WKWA 4GQCA 2HRKA 3D4MA 1UN2A 2QGVA 4D73B 3TKQA 3ZFBA 4MABA 2YWOA 4EDZA 3FR3A 2DKIA 1A2LA 4ECIA 4IBPA 2AUVA 2LNTA 3VPQA 3VI5A 1WIKA 2FNOA 3EWLA 2WJUA 2X64A 4F2IA 3HVVA 4TXVA 4LMVA 2GQLA 2EIRA 3WGDA 1EGOA 1R5AA 1DE2A 4X43A 5DVBA 5D96A 3ME7A 1KTEA 1XWGA 2RM6A 3UBLA 3ZYWA 1R26A 2E7PA 2OJLA 4Z2TA 4G2EA 4K2XA 2WULA 2C80A 2GLRA 3M9KA 2VLVA 4I8BA 1G0TA 3Q74A 1FHEA 3QR6A 5IPHA 3IDVA 1Z6MA 1ZYQB 1OC9A 4L8EA 2K8SA 1DBYA 4HUAA 1XWBA 5EY6A 4DSSB 3MIXA 2N5BA 2MMAA 2NBSA 3TJBA 1OE8A 4AJ6A 1FO5A 1GSSA 3GURA 1USBA 1JHBA 4ZL8A 3FZ9A 3BBYA 4FYBA 3CTFA 1V9WA 2IJYA 1M0UA 2LRCA 4FYUA 1TW9A 1AQXA 4OFMA 4OO5A 4ZBAA 1XBSA 3MYDA 2I4AA 4JZQA 1BJXA 2PMTA 3KH9A 4NV5A 4ZILA 1GSYA 3A3TA 4EL1A 4JRRA 2P31A 2PPTA 2FA8A 5ID2A 2O89A 3BCKA 3D21A 1ZCPA 2X99A 3ZL5A 3HDCA 1ZOFA 2H30A 2WS2A 3FMWA 1OKTA 2ZNMA 2P0GA 3QOUA 3CBUA 2H66A 4LL1B 1J08A 1GTIA 4XS4A 2BMXA 1B4PA 3KH7A 4X0XA 5JWOB 2L5OA 4PQIA 4PUAA 4N11A 4D73A 2HNLA 3HJOA 3GL3A 2CT6A 3KIJA 2RUEA 4KSOA 5JCWA 3GKMA 4G19A 4P3YB 4TR3A 1MDIA 2WDUA 2VLTA 1SK0A 2LJKA 4MNNA 2H19A 2R2JA 2GSRA 2L6DA 1ZYNA 4MZBA 3UVHA 3QPMA 4FQUA 1K0OA 1J0FA 2A2PA 4EVMA 2DMLA 5H5RA 5FT3A 2FY6A 3A2XA 3GSSA 2B5XA 1U6TA 3IHGA 3FRCA 5ELGA 4ZBBA 3TKSC 3F3RA 1KEBA 1GSEA 1GL8A 1E6BA 2B6MA 1SK1A 1SL0B 4PNFA 1GUHA 12GSA 1ERVA 2X8CA 3N5OA 2FGXA 4WR4A 3LJRA 2CZ3A 2V1MA 1JLWA 4EUYA 3E9JB 1YF0A 1GLPA 2DJ0A 5IMVA 1XWCA 5IOXA 4V1Ag 3WT1A 3TGZA 1QFNA 1VF3A 1F37A 2CQ9A 2WZ9A 1SU9A 1SYXA 5H5SA 4XS6A 4MH2A 2GGTA 3FW2A 3GFKA 4TW5A 1H4OA 1TP9A 5E4WA 5B7CA 5D9XA 3TUEA 3M0FA 2H0HA 2LQOA 5CAXA 1ACVA 1R4WA 4OCFA 5IOWA 1HD2A 1RK4A 2XBIA 2LKUA 2XBQA 2VLUA 2WRTA 4GSTA 4CDOA 5ECNB 1K0MA 4ZL9A 1X5CA 4KDYA 1V2AA 3S9FA 5A5KA 3DMLA 5KN2A 1O7UA 1GTAA 1K3LA 4V2NA 1EEJA 1WWJA 4OWYA 3FR9A 3GKNA 1K3OA 1NSWA 5D9VA 5GZZB 2HLSA 2B7JA 4POBA 2LSTA 3VWVA 5AN1A 1JZRA 1XW9A 3FZ5A 4L5LA 4ECCA 3KTLA 4KF9A 1S3CA 3KTBA 1JZWA 5CP1A 18GSA 4JR4A 2JADA 4TOPA 2LRNA 16GSA 5AIVA 3UARA 3D22A 1SKWB 2OE1A 5IMFA 4YQVA 1V57A 5HR2A 3IPZA 1OC3A 3KMNA 1EP7A 3I43A 3DKSA 1O81A 1A0FA 2DJ2A 1QMVA 1SJIA 2MMNA 2C3QA 1S3AA 2LRTA 2N5FA 3ZIVA 3CTGA 3QAVA 4HDEA 1NHOA 6GSYA 1O8XA 2JZSA 3UBKA 4BL7A 5CNWA 3ZRDA 3M8NA 5KN3A 3ZMLA 4IQ1A 5B8AA 3CSJA 2C3NA 3HVSA 3IV4A 1WJKA 2CVDA 2DLXA 3GN3A 2ALBA 4PNGA 2LQQA 2CV4A 1GSFA 2VO4A 1GWCA 4IVFA 1X9SB 3KD0A 3O6TA 1X9MB 3MSZA 4EF0A 4K0NA 4ID0A 4KX4A 3KEBA 1F3AA 3C1RA 2WB9A 4IJ3A 2AHEA 2DC5A 4YAPA 1XPVA 4KCAA 5DAKA 2PN8A 1T8EB 4O7HA 5FHIA 3F9UA 4CW9A 3G7JA 5BMUA 2QA1A 4G0LA 5G5FA 2IFQB 4LMWA 1TK8B 3UIWA 2YV9A 4JE1A 1I9DA 1YZXA 1JFUA 3TKSE 2PU9C 2FCHA 4AGSA 5AISA 4HQZA 4CY6A 4ECJA 3VFIA 1TRVA 1FVJA 2X49A 1GULA 1XZOA 1ZL9A 1SYRA 2JL4A 4XRAA 2KUCA 2VL2A 3GX0A 2GZPA 4OCEA 3DVWA 2H70A 1XOBA 2DSAA 4K7OA 2I9HA 3GTUA 4JEDA 2AB6A 2R0CA 3TJFA 4F03A 5G1KA 5D93A 3DD3A 1F3BA 19GSA 2GSTA 4NAXA 3SWLA 1FB0A 3F4SA 4AJ7A 2VCXA 2F3MA 3HXSA 5LNKe 5IMCA 2VCZA 3WGXA 1TK0B 2YJHA 5HFGA 2FLSA 4G9HA 4YAVA 1PA3A 2VCQA 5ECLB 4WBRD 2IMFA 4G10A 4IW9A 4IGJA 6GSVA 2LV3A 1PRXA 1Q4JA 2H6XA 3FHKA 3L9VA 4PUFC 4BPYA 1GH2A 1H75A 2FD3A 3D0ZA 2PUKC 2C0EA 4GWRA 1KBNA 2XC2A 2YN1A 1MD3A 3GRXA 4PQHA 5HR1A 3RHCA 3VWWA 4GQFA 3U5RE 5J5NA 3C1SA 1O73A 1EEMA 1O6JA 2A2RA 3DEXA 3IHQA 2C0GA 4O5QA 3CSIA 2IWTA 1B4QA 2MZCA 5JWRB 2H1GA 2VIMA 2HSYA 2XHFA 2CX3A 1TDIA 2KOKA 1AC1A 3Q19A 3CRTA 2C8UA 3RPPA 5B6NA 3UL3A 2R4VA 2YWMA 1U3AA 4PX1A 4LL4B 1F9MA 4XRDA 4I5QA 2DJ3A 1XW5A 1XVQA 5AGYA 1YEXA 4KDXA 4ZIJA 3JCML 2QSIA 2VL9A 4MMMA 5GAND 2EIOA 3M3MA 2VM2A 1BQ7A 2QC7A 2CVBA 1ABAA 3HJPA 1TU8A 1Z3EA 5KEJA 3ERWA 3KP9A 3PR8A 3P8WA 1SJ6A 2M80A 3ZREA 3GA4A 2K9FA 2GSSA 2HE3A 3TJGA 3IK9A 4EE0A 1U87A 2GZZA 5EVOA 2X4AA 1BAYA 2C0DA 4MK3A 4PURA 4TXOB 5IO2A 2CAIA 3IR4A 1G6WA 1PN0A 2E2MA 3FEUA 4N10A 3IXRA 4JU5A 1F2EA 3QAWA 2FHEA 2ON5A 2WFCA 1GP1A 2TRCP 3QDNA 1T00A 4E8HA 2IPAA 2NDOA 5DBQA 2R5GA 3IK7A 2PBJA 4TN8A 1X9WB 3HJMA 2XPEA 2HZEB 1AIUA 1GTUA 4Z7XA 4X1UA 1EOHA 3VPTA 2DMMA 2D2ZA 2FWFA 3DXBA 5ECRB 2GSQA 4TKYA 3NIVA 1XWAA 5BRTA 1LJRA 3I69A 2REMA 4EIQA 1AAZA 5D73A 3VWXA 1TK5B 4TR1A 4Z2UA 3FYGA 1MEKA 2KP1A 2GTUA 2YP6A 3E0UA 4MJBA 1VGLA 4WF4A 4ULXA 4IS0A 4K8MA 5IMZA 2HFDA 1PMTA 2YPMA 5DCGA 3PPUA 2YZHA 3QFAC 1FB6A 5D9TA 5D8IA 4MDCA 2O8VB 4BWSA 4WBJA 1TXXA 1UC7A 5KN1A 4MJCA 5HR3A 3EVIA 3G9BA 2FA4A 4XIHA 4ML6A 1TRSA 5CRGA 3TDGA 1PL2A 2AYTA 2C1YA 3UOMA 1YY7A 4WXTA 1EGRA 1FAAA 3GYKA 4MPFA 3LGCA 1A24A 4MH3A 5EPFA 1TI1A 4OFNA 4KNDA 3ZITA 3W8SA 2M72A 2I1UA 3EU4A 3ZVJD 1E2YA 4GXZA 2H01A 2O87A 3F4TA 4ILFA 2HSHA 5CRHA 4DEJA 5DDLA 1TRUA 2YWIA 2L4CA 3GL5A 1K0DA 3ERFA 1URMA 2PVQA 1PX6A 4HJMA 2EC4A 1F6MC 2FUG2 4TVEA 1M9AA 2V41A 2B5YA 4RUVA 4HOJA 2WCIA 5IMDA 3QAGA 1ILOA 2NPBA 4BVYB 3N9JA 4F0BA 4ZBDA 4DSSA 2H1BA 3APSA 5A4WA 5F06A 3DRNA 3ZTLA 5ECHB 5KOWA 3QD9A 3US3A 1O8WA 1Q98A 4I97A 5KOXA 3A2VA 3EMXA 5ECQB 4DVCA 17GSA 3I6AA 2HZEA 1EWXA 3PGTA 3CMIA 4O32A 3HKRA 3MDKA 4CY8A 4TR4A 2IN3A 5LCZA 1HYUA 3HD5A 1LBKA 1BG5A 4POLA 2I81A 4ZB8A 1C72A 5JCUA 1SKSB 2HRNA 4GTUA 2HSMA 3C7MA 3H93A 3GSTA 1RQMA 4J2FA 3NOFA 3F0IA 5DJLA 3K8NA 4V2LA 5ECIB 2B1KA 2IMDA 1FOVA 4NPBA 3LEFA 1GUKA 2IL3A 1Z6NA 4K1FA 1IYHA 4K0GA 5DALB 2VCTA 1AQWA 5CRWA 4O5UA 4QQ7A 2GQMA 4HS1A 5IIZA 1OVNA 1GSDA 4I6XA 3VURA 1DSBA 1FW1A 3FY7A 5LD0A 4XS1A 3P90A 4BVXB 4K2DA 2A4HA 2L6CA 4H86A 1DE1A 5CREA 1B9YC 3QCPA 5C04A 3H79A 2KP2A 4DSRA 4JR6A 1XVWA 3LG6A 2NTOA 4MF7A 3RPNA 2B5EA 1Z7PA 1PSQA 2H71A 1QK8A 4AF2A 4BWQA 5ABRA 4I2TA 5F05A 3AY8A 3HHVA 1Z7RA 2H8LA 3HA9A 4POKA 3CSHA 2A4VA 2R37A 4KGIA 1VRSD 3WYWA 4YQMA 1GLQA 3TKRA 4O5RA 3D5JA 1GTBA 1GNEA 3HYPA 3IRAA 3WD6A 1A8YA 2AV4A 3C8EA 3KP8A 3KZQA 4MA9A 2C0FA 5E59A 3H4KA 3IE3A 3C73A 5G30A 3QFBC 2MBSA 1G7EA 4L0WA 4HZ4A 3DIEA 3O3TA 4N0VA 2HYXA 3F8UA 2L59A 3EYTA 3EU3A 3PINA 4IELA 4EC0A 4KE3A 4KUNA 1O85A 5IPGA 2DJKA 1MDKA 1ML6A 2XPDA 2K8VA 3UEMA 3GV1A 4KH7A 2V6OA 1HNAA 4MF5A 2DJJA 1CQHA 5J9CA 2GVPA 3A2WA 1YEPA 4ZL7A 2OA7A 5COHA 4V2MA 3HY2A 2JZRA 4G0IA 11GSA 5A4VA 4EKZA 2P5QA 2NVLA 4WF5A 3EC3A 2QKEA 3P2AA 2KLXA 3GH9A 3GMFA 4OO4A 5J9BA 4KAEA 3LYPA 3TCOA 2CZ2A 1M99A 2MMZA 2K18A 2IMKA 3TOTA 2CVKA 3GKXA 2ES7A 3LWAA 4WETA 3BOAA 1R7HA 1YKCA 5FWGA 4FIWA 1OC9B 14GSA 4NV2A 4NHZA 3MAKA 4KSMA 1ERUA 4MLYA 2LNSA 2BJXA 4GSSA 1ST9A 3L78A 1XCCA 3BCIA 2H0GA 2J9HA 2FWHA 4OFTA 4HQSA 4RI6A 3APOA 4N0ZA 3ZLPA 3FZ4A 1R5PA 3TB2A 3U6VA 2VL2C 3IBHA 3O76A 1U3IA 3J7Yb 1ON4A 1SD9A 1XWKA 1VF4A 3RBTA 3IC8A 3FK8A 3I9V2 3L4NA 3F4RA 5ELAA 1OAZA 4HU7A 5ECOB 3SBCA 4QL7A 2DIZA 2V2GA 4Q5QA 8GSSA 3EPTA 6GSXA 4EIPA 2O85A 1WP0A 4GRFA 4GF0A 2YANA 3GH6A 2H0IA 1B9XC 4XS4B 1PD21 4HZ2A 3V1WA 3Q6OA 1SL2B 3LXTA 1VF1A 3ME8A 1V40A 4WEYA 3R3EA 5L71A 2RIIA 3TOUA 3LXZA 3ZZXA 4L0UA 5J4UA 4MCUA 4POMA 2IFQA 4V1Ap 3CXGA 1M7TA 2ZUPA 1K0CA 2G2QA 6GSUA 2P5RA 4ZB9A 1GRXA 4IQAA 4A5PA 4F9ZA 5F07A 5GAPD 4K7NA 2OADA 1HQOA 2J23A 1WPIA 3A5IA 4XCSA 2H1AA 2VCWA 2JU5A 1TOFA 3KJYA 1Z5YE 2H76A 5ECSA 5HR0A 3W6GA 3ZMKA 4PGTA 1M2DA 4K7IA 5G5EA 2GT5A 2RUFA 5IM9A 6GSTA 1K0AA 2H74A 2M46A 2ZCTA 1B8XA 1HNBA 1W89A 1PL1A 20GSA 2OACA 4IKHA 5C00A 3LORA 2YWNA 1K3YA 2OE3A 1ZYPA 4ZXGA 4I2UA 2LJAA 4OD7A 3VLNA 1K0BA 3APQA 4EO3A 1T4YA 4ML1A 3WT2A 2CX4A 1AQVA 3C71A 4MZCA 1WE0A 2PERA 3L0HA 1G7OA 1PQNA 1AXDA 3GUSA 2H75A 4ISDA 3UMAA 1OC8A 4KCEA 4F0CA 1ZYEA 5B6MA 1GNWA 4MPGA 3UJ1A 1SKRB 5F8BA 1OYJA 4RI7A 5HFIA 3HCZA 4IHUA 3F63A 2IMEA 4K6XA 2R0PA 2HRAA 2GS3A 5IO0A 3EE2A 4ICYA 2A2SA 1XW6A 3Q18A 3IC4A 4F82A 2HXKA 2FWGA 2K6VA 4NHWA 3EURA 1ERWA 3KGKA 5J3RA 5CO3A 3VWUA 1YQ1A 2PWJA 5IQYA 2IIYA 1QXHA 4GSNA 5HQPA 2L4QA 4J56E 2F8FA 2E2GA 4AJ8A 9GSSA 1EZKA 1JZOA 2KHPA 2H6YA 2PGTA 3E3EA 4Z2RA 1ERTA 4FYCA 5DQYA 1YDKA 3GNJA 1I5GA 2CAQA 2L57A 1GSQA 3MWHA 3DYRA 1X5DA 3TKSA 3BD2A 2LS5A 4K5RA 1NW2A 4NXIA 5ENUA 3QMXA 3RAZA 1V98A 2JZTA 2X8HA 3DWVA 1NM3A 1S3DA 2DBCA 2VAFA 4IJIA 2OBKA 4O92A 4PTSA 5DCHA 1KNGA 2I3YA 4RQXA 5INYA 4LA1A 1FG4A 2RM5A 3LSZA 4X4JA 1PGTA 5DJMA 1TKDB 1GSUA 1JLVA 1Y6EA 3TKPA 4WR5A 1N8JA 3PH9A 4HU9A 1M2AA 4BL7B 4DSQA 2V6KA 3EINA 1RW1A 3HZ4A 3P7XA 4Q5NA 2H73A 4TXOA 2H1DA 4CHSA 4E8EA 1B48A 3TJJA 1OE7A 3G7YA 1FOHA 2GQKA 3R2QA 2V32A 3TRQA 5G31A 3DGQA 4GCIA 1EP8A 2MBTA 1XFLA 4ZB6A 2FWEA 5CYYA 5A4UA 5KN0A 1THXA 2LUSA 3F6FA 5DAKB 3ZVJA 2H6ZA 3KXOA 5J41A 2PVOC 4PQ1A 1MTCA 3DVXA 1HNCA 2MMOA 2VL3A 4YH2A 2YV7A 1PX7A 2QA2A 2OKAA 4YKFA 2JSYA 4BA7A 4L5OA 5ECKB 1IYIA 3HZ8A 5H5QA 1OKDA 2YJ7A 4RQRA 3A5WA 2G0FA 1ZGNA 2R3XA 3TRPA 2IMIA 2ON7A 2HRFA 4USSA 3UAPA 3W8JA 1WRYA 6GSWA 3D4TA 4Q5RA 4ACSA 2VD1A 5B8BA 2X8GA 2UZ8A 2C4JA 5D9WA 1XXUA 1PKZA 3LQ7A 2L5LA 2RLIA 4KDUA 4JBBA 3ISOA 4N30A 2TIRA 4MJAA 2B7KA 2VCVA 1T3BA 4G0KA 3GTUB 1A2JA 2GDRA 4XHMA 3LW9A 1EV4A 2MYGA 3ZIJA 3L9UA 4KW6A 2DJ1A 2WGRA 1DUGA 2AAWA 2OBIA 2YZUA 3FKFA 4KA0A 1LU4A 1QUWA 2HT9A 3LYKA 2HI7A 4EDYA 1M9BA 1T4ZA 4Q5FA 3RHBA 4MZWA 3GHAA 3HVXA 4NWYA 1THOA 2R0GA 1X5EA 1A2MA 3M1GA 2HZFA 2AJQB 1NHYA 2LTKA 3KM6A 3H1NA 1WOUA 3LFLA 1Y25A 2JACA 3CYNA 1M2BA 3OR5A 5F0GA 1A8LA 5IMAA 1VF2A 1BX9A 4MF6A 3IOSA 5AIXA 3VK9A 2GT6A 10GSA 3VI7A 2LEGA 3F6DA 2R6KA 3GKKA 4K5SA 3RDWA 4FH8A 4BVYA 2VOCA 2N5AA 2DKHA 4TR0A 1G6YA 1BYEA 4HJ2A 1MD4A 1WMJA 1EV9A 4PXOA 2EIQA 2B1LA 1A0RP 5JCGA 1W4VA 2YCDA 4HI7A 2YNXA 5DQSA 4TRXA 3FZAA 2VD0A 3NZNA 3ERGA 3IA1A 13GSA 2F51A 2LJRA 3D6IA 1UVZA 2C3TA 4J57E 2Z9SA 1TI3A 4IN0A 4IP1A 3M9JA 1Z9HA 4OMVA 4LLRA 4MP4A 3BJ5A 1EOGA 5JWQB 1FVKA 5ECMB 4ECBA 5CRDA 4XTSA 3J7Yk 5GSTA 2OE0A 4HEA2 1SL1B 1SK2A 1UA5A 1AW9A 1J9BA 2B3SA 1SENA 2GZYA 4NMUA 1XOAA 1V58A 3GIXA 5DALA 1YJ6A 5GSSA 22GSA 5HFKA 2TRXA 3IAM2 3TRXA 2DIYA 4K9ZA 4FO5A 1PKWA 1SJZA 1PN9A 4BVXA 1TJDA 3EMPA 1MDJA 1ZZYA 1QGVA 1JZDA 3L9SA 1XIYA 3WGEA 2BTOT 1GUMA 1U88A 1YKAA 4MJEA 1X0RA 4IP6A 5EL8A 3ED3A 2CA8A 2F9SA 2YOIA 1N2AA 2E0QA 4GLTA 1SD8A 5G1LA 1BEDA 1T7PB 3F3QA 3UVTA 3TJKA 3H8QA 7GSSA 1CQGA 3FR6A 2VUPA 1A23A 2JSZA 4TR1B 4QL9A 4YKGA 2H72A 5ID2B 4EXJA 1AUCA 1TU7A 1ZMAA 3KCMA 1T1VA 4KB3A 2VM1A 2O7KA 1TTZA 3IAS2 4YQUA 1QQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G7I A;  3GX8 A;  3CRU A;  1TRW A;  1YF1 A;  3KMO A;  1K0N A;  5G2Z A;  2F8A A;  3ZFL A;  5ECP B;  6GSS A;  3MNG A;  4WKW A;  4GQC A;  3D4M A;  1UN2 A;  2QGV A;  4D73 B;  3TKQ A;  3ZFB A;  4MAB A;  2YWO A;  4EDZ A;  3FR3 A;  1A2L A;  4ECI A;  4IBP A;  2AUV A;  2LNT A;  3VPQ A;  3VI5 A;  1WIK A;  2FNO A;  3EWL A;  2WJU A;  2X64 A;  4F2I A;  3HVV A;  4TXV A;  4LMV A;  2GQL A;  2EIR A;  3WGD A;  1EGO A;  1R5A A;  1DE2 A;  4X43 A;  5DVB A;  5D96 A;  3ME7 A;  1KTE A;  1XWG A;  2RM6 A;  3UBL A;  3ZYW A;  1R26 A;  2E7P A;  2OJL A;  4G2E A;  2WUL A;  2C80 A;  2GLR A;  3M9K A;  2VLV A;  4I8B A;  1G0T A;  3Q74 A;  1FHE A;  3QR6 A;  5IPH A;  3IDV A;  1Z6M A;  1ZYQ B;  1OC9 A;  4L8E A;  2K8S A;  1DBY A;  4HUA A;  1XWB A;  5EY6 A;  4DSS B;  2N5B A;  2MMA A;  2NBS A;  3TJB A;  1OE8 A;  4AJ6 A;  1FO5 A;  1GSS A;  3GUR A;  1USB A;  1JHB A;  4ZL8 A;  3FZ9 A;  3BBY A;  4FYB A;  3CTF A;  1V9W A;  2IJY A;  1M0U A;  2LRC A;  4FYU A;  1TW9 A;  1AQX A;  4OFM A;  4OO5 A;  4ZBA A;  1XBS A;  4JZQ A;  2I4A A;  1BJX A;  2PMT A;  3KH9 A;  4NV5 A;  4ZIL A;  1GSY A;  3A3T A;  4EL1 A;  4JRR A;  2P31 A;  2PPT A;  2FA8 A;  5ID2 A;  2O89 A;  3BCK A;  3D21 A;  1ZCP A;  2X99 A;  3ZL5 A;  3HDC A;  1ZOF A;  2H30 A;  2WS2 A;  1OKT A;  2ZNM A;  2P0G A;  3QOU A;  3CBU A;  2H66 A;  4LL1 B;  1J08 A;  1GTI A;  4XS4 A;  2BMX A;  1B4P A;  3KH7 A;  4X0X A;  5JWO B;  2L5O A;  4PQI A;  4PUA A;  4N11 A;  4D73 A;  2HNL A;  3HJO A;  3GL3 A;  2CT6 A;  3KIJ A;  2RUE A;  4KSO A;  5JCW A;  3GKM A;  4G19 A;  4P3Y B;  4TR3 A;  1MDI A;  2WDU A;  2VLT A;  1SK0 A;  2LJK A;  2H19 A;  2R2J A;  2GSR A;  2L6D A;  4MZB A;  3UVH A;  3QPM A;  1K0O A;  1J0F A;  4EVM A;  2DML A;  5H5R A;  5FT3 A;  2FY6 A;  3A2X A;  3GSS A;  2B5X A;  1U6T A;  3FRC A;  5ELG A;  4ZBB A;  3TKS C;  3F3R A;  1KEB A;  1GSE A;  1GL8 A;  1E6B A;  2B6M A;  1SK1 A;  1SL0 B;  4PNF A;  1GUH A;  12GS A;  1ERV A;  2X8C A;  3N5O A;  2FGX A;  4WR4 A;  3LJR A;  2CZ3 A;  2V1M A;  1JLW A;  4EUY A;  3E9J B;  1YF0 A;  1GLP A;  2DJ0 A;  5IMV A;  1XWC A;  5IOX A;  4V1A g;  3WT1 A;  3TGZ A;  1QFN A;  1VF3 A;  1F37 A;  2CQ9 A;  2WZ9 A;  1SU9 A;  1SYX A;  5H5S A;  4XS6 A;  4MH2 A;  2GGT A;  3FW2 A;  3GFK A;  4TW5 A;  1H4O A;  1TP9 A;  5E4W A;  5B7C A;  5D9X A;  3TUE A;  3M0F A;  2H0H A;  2LQO A;  5CAX A;  1ACV A;  1R4W A;  4OCF A;  5IOW A;  1HD2 A;  1RK4 A;  2XBI A;  2LKU A;  2XBQ A;  2VLU A;  2WRT A;  4GST A;  4CDO A;  5ECN B;  1K0M A;  4ZL9 A;  1X5C A;  4KDY A;  1V2A A;  3S9F A;  5A5K A;  3DML A;  5KN2 A;  1O7U A;  1GTA A;  1K3L A;  4V2N A;  1EEJ A;  1WWJ A;  4OWY A;  3FR9 A;  3GKN A;  1K3O A;  1NSW A;  5D9V A;  5GZZ B;  2HLS A;  2B7J A;  4POB A;  2LST A;  3VWV A;  5AN1 A;  1JZR A;  1XW9 A;  3FZ5 A;  4L5L A;  4ECC A;  3KTL A;  1S3C A;  3KTB A;  1JZW A;  5CP1 A;  18GS A;  4JR4 A;  2JAD A;  4TOP A;  2LRN A;  16GS A;  5AIV A;  3UAR A;  3D22 A;  1SKW B;  2OE1 A;  5IMF A;  4YQV A;  1V57 A;  5HR2 A;  3IPZ A;  1OC3 A;  3KMN A;  1EP7 A;  3I43 A;  3DKS A;  1O81 A;  1A0F A;  2DJ2 A;  1QMV A;  1SJI A;  2MMN A;  2C3Q A;  1S3A A;  2LRT A;  2N5F A;  3ZIV A;  3CTG A;  3QAV A;  4HDE A;  1NHO A;  6GSY A;  1O8X A;  2JZS A;  3UBK A;  4BL7 A;  5CNW A;  3ZRD A;  3M8N A;  5KN3 A;  3ZML A;  4IQ1 A;  5B8A A;  3CSJ A;  2C3N A;  3HVS A;  3IV4 A;  1WJK A;  2CVD A;  2DLX A;  3GN3 A;  2ALB A;  4PNG A;  2LQQ A;  2CV4 A;  1GSF A;  2VO4 A;  1GWC A;  4IVF A;  1X9S B;  3KD0 A;  3O6T A;  1X9M B;  3MSZ A;  4EF0 A;  4K0N A;  4ID0 A;  4KX4 A;  3KEB A;  1F3A A;  3C1R A;  2WB9 A;  4IJ3 A;  2AHE A;  2DC5 A;  4YAP A;  1XPV A;  4KCA A;  5DAK A;  2PN8 A;  1T8E B;  4O7H A;  5FHI A;  3F9U A;  4CW9 A;  3G7J A;  5G5F A;  2IFQ B;  4LMW A;  1TK8 B;  3UIW A;  2YV9 A;  4JE1 A;  1I9D A;  1YZX A;  1JFU A;  3TKS E;  2PU9 C;  2FCH A;  4AGS A;  5AIS A;  4HQZ A;  4ECJ A;  3VFI A;  1TRV A;  1FVJ A;  1GUL A;  1XZO A;  1ZL9 A;  1SYR A;  2JL4 A;  4XRA A;  2KUC A;  2VL2 A;  3GX0 A;  2GZP A;  4OCE A;  3DVW A;  2H70 A;  1XOB A;  2DSA A;  4K7O A;  2I9H A;  3GTU A;  4JED A;  2AB6 A;  3TJF A;  4F03 A;  5G1K A;  5D93 A;  3DD3 A;  1F3B A;  19GS A;  2GST A;  4NAX A;  3SWL A;  1FB0 A;  3F4S A;  4AJ7 A;  2VCX A;  2F3M A;  3HXS A;  5LNK e;  5IMC A;  2VCZ A;  3WGX A;  1TK0 B;  2YJH A;  5HFG A;  2FLS A;  4G9H A;  4YAV A;  1PA3 A;  2VCQ A;  5ECL B;  4WBR D;  2IMF A;  4G10 A;  4IW9 A;  4IGJ A;  6GSV A;  2LV3 A;  1PRX A;  1Q4J A;  2H6X A;  3FHK A;  3L9V A;  4PUF C;  4BPY A;  1GH2 A;  1H75 A;  2FD3 A;  3D0Z A;  2PUK C;  2C0E A;  4GWR A;  1KBN A;  2XC2 A;  2YN1 A;  1MD3 A;  3GRX A;  4PQH A;  5HR1 A;  3RHC A;  3VWW A;  4GQF A;  3U5R E;  5J5N A;  3C1S A;  1O73 A;  1EEM A;  1O6J A;  2A2R A;  3DEX A;  3IHQ A;  2C0G A;  3CSI A;  2IWT A;  1B4Q A;  2MZC A;  5JWR B;  2H1G A;  2VIM A;  2HSY A;  2XHF A;  2CX3 A;  1TDI A;  2KOK A;  1AC1 A;  3Q19 A;  3CRT A;  2C8U A;  3RPP A;  5B6N A;  3UL3 A;  2R4V A;  2YWM A;  1U3A A;  4PX1 A;  4LL4 B;  1F9M A;  4XRD A;  4I5Q A;  2DJ3 A;  1XW5 A;  1XVQ A;  5AGY A;  1YEX A;  4KDX A;  4ZIJ A;  3JCM L;  2QSI A;  2VL9 A;  4MMM A;  5GAN D;  2EIO A;  3M3M A;  2VM2 A;  1BQ7 A;  2QC7 A;  2CVB A;  1ABA A;  3HJP A;  1TU8 A;  1Z3E A;  5KEJ A;  3ERW A;  3KP9 A;  3PR8 A;  3P8W A;  1SJ6 A;  2M80 A;  3ZRE A;  3GA4 A;  2K9F A;  2GSS A;  2HE3 A;  3TJG A;  3IK9 A;  4EE0 A;  1U87 A;  2GZZ A;  5EVO A;  1BAY A;  2C0D A;  4MK3 A;  4PUR A;  4TXO B;  5IO2 A;  2CAI A;  3IR4 A;  1G6W A;  2E2M A;  3FEU A;  4N10 A;  3IXR A;  4JU5 A;  1F2E A;  3QAW A;  2FHE A;  2ON5 A;  2WFC A;  1GP1 A;  2TRC P;  3QDN A;  1T00 A;  4E8H A;  2IPA A;  2NDO A;  5DBQ A;  2R5G A;  3IK7 A;  2PBJ A;  4TN8 A;  1X9W B;  3HJM A;  2XPE A;  2HZE B;  1AIU A;  1GTU A;  4Z7X A;  4X1U A;  1EOH A;  3VPT A;  2DMM A;  2D2Z A;  2FWF A;  3DXB A;  5ECR B;  2GSQ A;  4TKY A;  3NIV A;  1XWA A;  1LJR A;  3I69 A;  2REM A;  1AAZ A;  5D73 A;  3VWX A;  1TK5 B;  4TR1 A;  3FYG A;  1MEK A;  2KP1 A;  2GTU A;  2YP6 A;  3E0U A;  4MJB A;  1VGL A;  4WF4 A;  4ULX A;  4IS0 A;  4K8M A;  5IMZ A;  2HFD A;  1PMT A;  2YPM A;  5DCG A;  2YZH A;  3QFA C;  1FB6 A;  5D9T A;  5D8I A;  4MDC A;  2O8V B;  4BWS A;  4WBJ A;  1TXX A;  1UC7 A;  5KN1 A;  4MJC A;  5HR3 A;  3EVI A;  3G9B A;  2FA4 A;  4XIH A;  4ML6 A;  1TRS A;  5CRG A;  3TDG A;  1PL2 A;  2AYT A;  2C1Y A;  3UOM A;  1YY7 A;  4WXT A;  1EGR A;  1FAA A;  3GYK A;  4MPF A;  3LGC A;  1A24 A;  4MH3 A;  5EPF A;  1TI1 A;  4OFN A;  4KND A;  3ZIT A;  3W8S A;  2M72 A;  2I1U A;  3EU4 A;  3ZVJ D;  1E2Y A;  4GXZ A;  2H01 A;  2O87 A;  3F4T A;  4ILF A;  2HSH A;  5CRH A;  4DEJ A;  5DDL A;  1TRU A;  2YWI A;  2L4C A;  3GL5 A;  1K0D A;  3ERF A;  1URM A;  2PVQ A;  1PX6 A;  4HJM A;  2EC4 A;  1F6M C;  2FUG 2;  4TVE A;  1M9A A;  2V41 A;  2B5Y A;  4RUV A;  4HOJ A;  2WCI A;  5IMD A;  3QAG A;  1ILO A;  2NPB A;  3N9J A;  4F0B A;  4ZBD A;  4DSS A;  2H1B A;  3APS A;  5A4W A;  5F06 A;  3DRN A;  3ZTL A;  5ECH B;  3QD9 A;  3US3 A;  1O8W A;  1Q98 A;  4I97 A;  3A2V A;  3EMX A;  5ECQ B;  4DVC A;  17GS A;  3I6A A;  2HZE A;  1EWX A;  3PGT A;  3CMI A;  4O32 A;  3HKR A;  3MDK A;  4TR4 A;  2IN3 A;  5LCZ A;  1HYU A;  3HD5 A;  1LBK A;  1BG5 A;  4POL A;  2I81 A;  4ZB8 A;  1C72 A;  5JCU A;  1SKS B;  2HRN A;  4GTU A;  3C7M A;  3H93 A;  3GST A;  1RQM A;  4J2F A;  3NOF A;  3F0I A;  5DJL A;  3K8N A;  4V2L A;  5ECI B;  2B1K A;  2IMD A;  1FOV A;  4NPB A;  3LEF A;  1GUK A;  2IL3 A;  1Z6N A;  4K1F A;  1IYH A;  4K0G A;  5DAL B;  2VCT A;  1AQW A;  5CRW A;  4QQ7 A;  2GQM A;  4HS1 A;  5IIZ A;  1OVN A;  1GSD A;  4I6X A;  3VUR A;  1DSB A;  1FW1 A;  3FY7 A;  5LD0 A;  4XS1 A;  3P90 A;  4K2D A;  2L6C A;  4H86 A;  1DE1 A;  5CRE A;  1B9Y C;  3QCP A;  5C04 A;  3H79 A;  2KP2 A;  4DSR A;  4JR6 A;  1XVW A;  3LG6 A;  2NTO A;  4MF7 A;  3RPN A;  2B5E A;  1Z7P A;  1PSQ A;  2H71 A;  1QK8 A;  4AF2 A;  4BWQ A;  5ABR A;  4I2T A;  5F05 A;  3AY8 A;  3HHV A;  1Z7R A;  2H8L A;  3HA9 A;  4POK A;  3CSH A;  2A4V A;  2R37 A;  4KGI A;  1VRS D;  3WYW A;  4YQM A;  1GLQ A;  3TKR A;  4O5R A;  3D5J A;  1GTB A;  1GNE A;  3HYP A;  3IRA A;  3WD6 A;  1A8Y A;  2AV4 A;  3C8E A;  3KP8 A;  3KZQ A;  4MA9 A;  2C0F A;  5E59 A;  3H4K A;  3IE3 A;  3C73 A;  5G30 A;  3QFB C;  2MBS A;  1G7E A;  4L0W A;  4HZ4 A;  3DIE A;  3O3T A;  4N0V A;  2HYX A;  3F8U A;  2L59 A;  3EYT A;  3EU3 A;  3PIN A;  4IEL A;  4EC0 A;  4KE3 A;  4KUN A;  1O85 A;  5IPG A;  2DJK A;  1MDK A;  1ML6 A;  2XPD A;  2K8V A;  3UEM A;  3GV1 A;  4KH7 A;  2V6O A;  1HNA A;  4MF5 A;  2DJJ A;  1CQH A;  5J9C A;  2GVP A;  3A2W A;  1YEP A;  4ZL7 A;  2OA7 A;  5COH A;  4V2M A;  3HY2 A;  2JZR A;  11GS A;  5A4V A;  4EKZ A;  2P5Q A;  2NVL A;  4WF5 A;  3EC3 A;  2QKE A;  2KLX A;  3GH9 A;  3P2A A;  3GMF A;  4OO4 A;  5J9B A;  4KAE A;  3LYP A;  3TCO A;  2CZ2 A;  1M99 A;  2MMZ A;  2K18 A;  2IMK A;  3TOT A;  2CVK A;  3GKX A;  2ES7 A;  3LWA A;  4WET A;  3BOA A;  1R7H A;  1YKC A;  5FWG A;  4FIW A;  1OC9 B;  14GS A;  4NV2 A;  4NHZ A;  3MAK A;  4KSM A;  1ERU A;  4MLY A;  2LNS A;  2BJX A;  4GSS A;  1ST9 A;  3L78 A;  1XCC A;  3BCI A;  2H0G A;  2J9H A;  2FWH A;  4OFT A;  4HQS A;  4RI6 A;  3APO A;  4N0Z A;  3ZLP A;  3FZ4 A;  1R5P A;  3TB2 A;  3U6V A;  2VL2 C;  3IBH A;  3O76 A;  1U3I A;  3J7Y b;  1ON4 A;  1SD9 A;  1XWK A;  1VF4 A;  3RBT A;  3FK8 A;  3I9V 2;  3L4N A;  3F4R A;  5ELA A;  1OAZ A;  4HU7 A;  5ECO B;  3SBC A;  4QL7 A;  2DIZ A;  2V2G A;  4Q5Q A;  8GSS A;  6GSX A;  2O85 A;  1WP0 A;  4GRF A;  4GF0 A;  2YAN A;  3GH6 A;  2H0I A;  1B9X C;  4XS4 B;  1PD2 1;  4HZ2 A;  3V1W A;  3Q6O A;  1SL2 B;  3LXT A;  1VF1 A;  3ME8 A;  1V40 A;  4WEY A;  5L71 A;  2RII A;  3TOU A;  3LXZ A;  3ZZX A;  4L0U A;  5J4U A;  4MCU A;  4POM A;  2IFQ A;  4V1A p;  3CXG A;  1M7T A;  2ZUP A;  1K0C A;  2G2Q A;  6GSU A;  2P5R A;  4ZB9 A;  1GRX A;  4IQA A;  4F9Z A;  5F07 A;  5GAP D;  4K7N A;  2OAD A;  1HQO A;  2J23 A;  1WPI A;  4XCS A;  2H1A A;  2VCW A;  2JU5 A;  1TOF A;  3KJY A;  1Z5Y E;  2H76 A;  5ECS A;  5HR0 A;  3W6G A;  3ZMK A;  4PGT A;  1M2D A;  4K7I A;  5G5E A;  2GT5 A;  2RUF A;  5IM9 A;  6GST A;  1K0A A;  2H74 A;  2M46 A;  2ZCT A;  1B8X A;  1HNB A;  1W89 A;  1PL1 A;  20GS A;  2OAC A;  4IKH A;  5C00 A;  3LOR A;  2YWN A;  1K3Y A;  2OE3 A;  4ZXG A;  4I2U A;  2LJA A;  4OD7 A;  3VLN A;  1K0B A;  3APQ A;  4EO3 A;  1T4Y A;  4ML1 A;  3WT2 A;  2CX4 A;  1AQV A;  3C71 A;  4MZC A;  1WE0 A;  2PER A;  3L0H A;  1G7O A;  1PQN A;  1AXD A;  3GUS A;  2H75 A;  4ISD A;  3UMA A;  1OC8 A;  4KCE A;  4F0C A;  1ZYE A;  5B6M A;  1GNW A;  4MPG A;  3UJ1 A;  1SKR B;  5F8B A;  1OYJ A;  4RI7 A;  5HFI A;  3HCZ A;  4IHU A;  3F63 A;  2IME A;  4K6X A;  2GS3 A;  5IO0 A;  3EE2 A;  2A2S A;  1XW6 A;  3Q18 A;  3IC4 A;  4F82 A;  2HXK A;  2FWG A;  2K6V A;  4NHW A;  3EUR A;  1ERW A;  3KGK A;  5J3R A;  5CO3 A;  3VWU A;  1YQ1 A;  2PWJ A;  5IQY A;  2IIY A;  1QXH A;  4GSN A;  5HQP A;  2L4Q A;  4J56 E;  2F8F A;  2E2G A;  4AJ8 A;  9GSS A;  1EZK A;  1JZO A;  2KHP A;  2H6Y A;  2PGT A;  3E3E A;  1ERT A;  4FYC A;  5DQY A;  1YDK A;  3GNJ A;  1I5G A;  2CAQ A;  2L57 A;  1GSQ A;  3MWH A;  3DYR A;  1X5D A;  3TKS A;  3BD2 A;  2LS5 A;  1NW2 A;  4NXI A;  5ENU A;  3QMX A;  3RAZ A;  1V98 A;  2JZT A;  2X8H A;  3DWV A;  1NM3 A;  1S3D A;  2DBC A;  2VAF A;  4IJI A;  2OBK A;  4O92 A;  5DCH A;  1KNG A;  2I3Y A;  4RQX A;  5INY A;  4LA1 A;  1FG4 A;  2RM5 A;  3LSZ A;  1PGT A;  5DJM A;  1TKD B;  1GSU A;  1JLV A;  1Y6E A;  3TKP A;  4WR5 A;  1N8J A;  3PH9 A;  4HU9 A;  1M2A A;  4DSQ A;  2V6K A;  3EIN A;  1RW1 A;  3HZ4 A;  3P7X A;  4Q5N A;  2H73 A;  4TXO A;  2H1D A;  4CHS A;  4E8E A;  1B48 A;  3TJJ A;  1OE7 A;  3G7Y A;  2GQK A;  3R2Q A;  2V32 A;  3TRQ A;  5G31 A;  3DGQ A;  4GCI A;  1EP8 A;  2MBT A;  1XFL A;  4ZB6 A;  2FWE A;  5CYY A;  5A4U A;  5KN0 A;  1THX A;  2LUS A;  3F6F A;  5DAK B;  3ZVJ A;  2H6Z A;  3KXO A;  5J41 A;  2PVO C;  4PQ1 A;  1MTC A;  3DVX A;  1HNC A;  2MMO A;  2VL3 A;  4YH2 A;  2YV7 A;  1PX7 A;  2OKA A;  2JSY A;  4BA7 A;  4L5O A;  5ECK B;  1IYI A;  3HZ8 A;  5H5Q A;  1OKD A;  2YJ7 A;  4RQR A;  3A5W A;  2G0F A;  1ZGN A;  2R3X A;  3TRP A;  2IMI A;  2ON7 A;  2HRF A;  3UAP A;  3W8J A;  1WRY A;  6GSW A;  3D4T A;  4Q5R A;  4ACS A;  2VD1 A;  5B8B A;  2X8G A;  2C4J A;  5D9W A;  1XXU A;  1PKZ A;  3LQ7 A;  2L5L A;  2RLI A;  4KDU A;  4JBB A;  3ISO A;  2TIR A;  4N30 A;  4MJA A;  2B7K A;  2VCV A;  1T3B A;  3GTU B;  1A2J A;  2GDR A;  4XHM A;  1EV4 A;  2MYG A;  3ZIJ A;  3L9U A;  4KW6 A;  2DJ1 A;  2WGR A;  1DUG A;  2AAW A;  2OBI A;  2YZU A;  3FKF A;  4KA0 A;  1LU4 A;  1QUW A;  2HT9 A;  3LYK A;  2HI7 A;  4EDY A;  1M9B A;  1T4Z A;  4Q5F A;  3RHB A;  4MZW A;  3GHA A;  3HVX A;  4NWY A;  1THO A;  1X5E A;  1A2M A;  3M1G A;  2HZF A;  2AJQ B;  1NHY A;  2LTK A;  3KM6 A;  3H1N A;  1WOU A;  3LFL A;  1Y25 A;  2JAC A;  3CYN A;  1M2B A;  3OR5 A;  5F0G A;  1A8L A;  5IMA A;  1VF2 A;  1BX9 A;  4MF6 A;  3IOS A;  5AIX A;  3VK9 A;  2GT6 A;  10GS A;  3VI7 A;  2LEG A;  3F6D A;  2R6K A;  3GKK A;  3RDW A;  4FH8 A;  4BVY A;  2VOC A;  2N5A A;  4TR0 A;  1G6Y A;  1BYE A;  4HJ2 A;  1MD4 A;  1WMJ A;  1EV9 A;  4PXO A;  2EIQ A;  2B1L A;  1A0R P;  5JCG A;  1W4V A;  2YCD A;  4HI7 A;  2YNX A;  5DQS A;  4TRX A;  3FZA A;  2VD0 A;  3NZN A;  3ERG A;  3IA1 A;  13GS A;  2F51 A;  2LJR A;  3D6I A;  1UVZ A;  2C3T A;  4J57 E;  2Z9S A;  1TI3 A;  4IN0 A;  4IP1 A;  3M9J A;  1Z9H A;  4OMV A;  4LLR A;  4MP4 A;  3BJ5 A;  1EOG A;  5JWQ B;  1FVK A;  5ECM B;  4ECB A;  5CRD A;  4XTS A;  3J7Y k;  5GST A;  2OE0 A;  4HEA 2;  1SL1 B;  1SK2 A;  1UA5 A;  1AW9 A;  1J9B A;  2B3S A;  1SEN A;  2GZY A;  4NMU A;  1XOA A;  1V58 A;  3GIX A;  5DAL A;  1YJ6 A;  5GSS A;  22GS A;  5HFK A;  2TRX A;  3IAM 2;  3TRX A;  2DIY A;  4K9Z A;  4FO5 A;  1PKW A;  1SJZ A;  1PN9 A;  4BVX A;  1TJD A;  3EMP A;  1MDJ A;  1ZZY A;  1QGV A;  1JZD A;  3L9S A;  1XIY A;  3WGE A;  2BTO T;  1GUM A;  1U88 A;  1YKA A;  4MJE A;  1X0R A;  4IP6 A;  5EL8 A;  3ED3 A;  2CA8 A;  2F9S A;  2YOI A;  1N2A A;  2E0Q A;  4GLT A;  1SD8 A;  5G1L A;  1BED A;  1T7P B;  3F3Q A;  3UVT A;  3TJK A;  3H8Q A;  7GSS A;  1CQG A;  3FR6 A;  2VUP A;  1A23 A;  2JSZ A;  4TR1 B;  4QL9 A;  2H72 A;  5ID2 B;  4EXJ A;  1AUC A;  1TU7 A;  1ZMA A;  3KCM A;  1T1V A;  4KB3 A;  2VM1 A;  2O7K A;  1TTZ A;  3IAS 2;  4YQU A;  1QQ2 A; 
#chains in the Genus database with same CATH topology
 3G7I A;  3GX8 A;  3CRU A;  1TRW A;  1YF1 A;  3KMO A;  1K0N A;  5G2Z A;  2F8A A;  3ZFL A;  5ECP B;  6GSS A;  3MNG A;  4WKW A;  4GQC A;  2HRK A;  3D4M A;  1UN2 A;  2QGV A;  4D73 B;  3TKQ A;  3ZFB A;  4MAB A;  2YWO A;  4EDZ A;  3FR3 A;  2DKI A;  1A2L A;  4ECI A;  4IBP A;  2AUV A;  2LNT A;  4HSC X;  3VPQ A;  3VI5 A;  1WIK A;  2FNO A;  3EWL A;  2WJU A;  2X64 A;  4F2I A;  3HVV A;  4TXV A;  4LMV A;  2GQL A;  2EIR A;  3WGD A;  1EGO A;  1R5A A;  1DE2 A;  4X43 A;  5DVB A;  5D96 A;  3ME7 A;  1KTE A;  1XWG A;  2RM6 A;  3UBL A;  3ZYW A;  1R26 A;  2E7P A;  2OJL A;  4Z2T A;  4G2E A;  4K2X A;  2WUL A;  2C80 A;  2GLR A;  3M9K A;  2VLV A;  4I8B A;  1G0T A;  3Q74 A;  1FHE A;  3QR6 A;  5IPH A;  3IDV A;  1Z6M A;  1ZYQ B;  1OC9 A;  4L8E A;  2K8S A;  1DBY A;  4HUA A;  1XWB A;  5EY6 A;  4DSS B;  3MIX A;  2N5B A;  2MMA A;  2NBS A;  3TJB A;  1OE8 A;  4AJ6 A;  1FO5 A;  1GSS A;  3GUR A;  1USB A;  1JHB A;  4ZL8 A;  3FZ9 A;  3BBY A;  4FYB A;  3CTF A;  1V9W A;  2IJY A;  1M0U A;  2LRC A;  4FYU A;  1TW9 A;  1AQX A;  4OFM A;  4OO5 A;  4ZBA A;  1XBS A;  3MYD A;  2I4A A;  4JZQ A;  1BJX A;  2PMT A;  3KH9 A;  4NV5 A;  4ZIL A;  1GSY A;  3A3T A;  4EL1 A;  4JRR A;  2P31 A;  2PPT A;  2FA8 A;  5ID2 A;  2O89 A;  3BCK A;  3D21 A;  1ZCP A;  2X99 A;  3ZL5 A;  3HDC A;  1ZOF A;  2H30 A;  2WS2 A;  3FMW A;  1OKT A;  2ZNM A;  2P0G A;  3QOU A;  3CBU A;  2H66 A;  4LL1 B;  1J08 A;  1GTI A;  4XS4 A;  2BMX A;  1B4P A;  3KH7 A;  4X0X A;  5JWO B;  2L5O A;  4PQI A;  4PUA A;  4N11 A;  4D73 A;  2HNL A;  3HJO A;  3GL3 A;  2CT6 A;  3KIJ A;  2RUE A;  4KSO A;  5JCW A;  3GKM A;  4G19 A;  4P3Y B;  4TR3 A;  1MDI A;  2WDU A;  2VLT A;  1SK0 A;  2LJK A;  4MNN A;  2H19 A;  2R2J A;  2GSR A;  2L6D A;  1ZYN A;  4MZB A;  3UVH A;  3QPM A;  4FQU A;  1K0O A;  1J0F A;  2A2P A;  4EVM A;  2DML A;  5H5R A;  5FT3 A;  2FY6 A;  3A2X A;  3GSS A;  2B5X A;  1U6T A;  3IHG A;  3FRC A;  5ELG A;  4ZBB A;  3TKS C;  3F3R A;  1KEB A;  1GSE A;  1GL8 A;  3HVN A;  1E6B A;  2B6M A;  1SK1 A;  1SL0 B;  4PNF A;  1GUH A;  12GS A;  1ERV A;  2X8C A;  3N5O A;  2FGX A;  4WR4 A;  3LJR A;  2CZ3 A;  2V1M A;  1JLW A;  4EUY A;  3E9J B;  1YF0 A;  1GLP A;  2DJ0 A;  5IMV A;  1XWC A;  5IOX A;  4V1A g;  3WT1 A;  3TGZ A;  1QFN A;  1VF3 A;  1F37 A;  2CQ9 A;  2WZ9 A;  1SU9 A;  1SYX A;  5H5S A;  4XS6 A;  4MH2 A;  2GGT A;  3FW2 A;  3GFK A;  4TW5 A;  1H4O A;  1TP9 A;  5E4W A;  5B7C A;  5D9X A;  3TUE A;  3M0F A;  2H0H A;  2LQO A;  5CAX A;  1ACV A;  1R4W A;  4OCF A;  5IOW A;  1HD2 A;  1RK4 A;  2XBI A;  2LKU A;  2XBQ A;  2VLU A;  2WRT A;  4GST A;  4CDO A;  5ECN B;  1K0M A;  4ZL9 A;  1X5C A;  4KDY A;  1V2A A;  3S9F A;  5A5K A;  3DML A;  5KN2 A;  1O7U A;  1GTA A;  1K3L A;  4V2N A;  1EEJ A;  1WWJ A;  4OWY A;  3FR9 A;  3GKN A;  1K3O A;  1NSW A;  5D9V A;  5GZZ B;  2HLS A;  2B7J A;  4POB A;  2LST A;  3VWV A;  5AN1 A;  1JZR A;  1XW9 A;  3FZ5 A;  4L5L A;  4ECC A;  3KTL A;  4KF9 A;  1S3C A;  3KTB A;  1JZW A;  5CP1 A;  18GS A;  4JR4 A;  2JAD A;  4TOP A;  2LRN A;  16GS A;  5AIV A;  3UAR A;  3D22 A;  1SKW B;  2OE1 A;  5IMF A;  4YQV A;  1V57 A;  5HR2 A;  3IPZ A;  1OC3 A;  3KMN A;  1EP7 A;  3I43 A;  3DKS A;  1O81 A;  1A0F A;  2DJ2 A;  1QMV A;  1SJI A;  2MMN A;  2C3Q A;  1S3A A;  2LRT A;  2N5F A;  3ZIV A;  3CTG A;  3QAV A;  4HDE A;  1NHO A;  6GSY A;  1O8X A;  2JZS A;  3UBK A;  4BL7 A;  5CNW A;  3ZRD A;  3M8N A;  5KN3 A;  3ZML A;  4IQ1 A;  5B8A A;  3CSJ A;  2C3N A;  3HVS A;  3IV4 A;  1WJK A;  2CVD A;  2DLX A;  3GN3 A;  2ALB A;  4PNG A;  2LQQ A;  2CV4 A;  1GSF A;  2VO4 A;  1GWC A;  4IVF A;  1X9S B;  3KD0 A;  3O6T A;  1X9M B;  3MSZ A;  1M3I A;  4EF0 A;  4K0N A;  4ID0 A;  4KX4 A;  3KEB A;  1F3A A;  3C1R A;  2WB9 A;  4IJ3 A;  2AHE A;  2DC5 A;  4YAP A;  1XPV A;  4KCA A;  5DAK A;  2PN8 A;  1T8E B;  4O7H A;  5FHI A;  3F9U A;  4CW9 A;  3G7J A;  5BMU A;  2QA1 A;  4G0L A;  5G5F A;  2IFQ B;  4LMW A;  1TK8 B;  3UIW A;  2YV9 A;  4JE1 A;  1I9D A;  1YZX A;  1JFU A;  3TKS E;  2PU9 C;  2FCH A;  4AGS A;  5AIS A;  4HQZ A;  4CY6 A;  4ECJ A;  3VFI A;  1TRV A;  1FVJ A;  2X49 A;  1GUL A;  1XZO A;  1ZL9 A;  1SYR A;  2JL4 A;  4XRA A;  2KUC A;  2VL2 A;  3GX0 A;  2GZP A;  4OCE A;  3DVW A;  2H70 A;  1XOB A;  2DSA A;  4K7O A;  2I9H A;  3GTU A;  4JED A;  2AB6 A;  2R0C A;  3TJF A;  4F03 A;  5G1K A;  5D93 A;  3DD3 A;  1F3B A;  19GS A;  2GST A;  4NAX A;  3SWL A;  1FB0 A;  3F4S A;  4AJ7 A;  2VCX A;  2F3M A;  3HXS A;  5LNK e;  5IMC A;  2VCZ A;  3WGX A;  1TK0 B;  2YJH A;  5HFG A;  2FLS A;  4G9H A;  4YAV A;  1PA3 A;  2VCQ A;  5ECL B;  4WBR D;  2IMF A;  4G10 A;  4IW9 A;  4IGJ A;  6GSV A;  2LV3 A;  1PRX A;  1Q4J A;  2H6X A;  3FHK A;  3L9V A;  4PUF C;  4BPY A;  1GH2 A;  1H75 A;  2FD3 A;  3D0Z A;  2PUK C;  2C0E A;  4GWR A;  1KBN A;  2XC2 A;  2YN1 A;  1MD3 A;  3GRX A;  4PQH A;  5HR1 A;  3RHC A;  3VWW A;  4GQF A;  4BIK A;  3U5R E;  5J5N A;  3C1S A;  1O73 A;  1EEM A;  1O6J A;  2A2R A;  3DEX A;  3IHQ A;  2C0G A;  4O5Q A;  3CSI A;  2IWT A;  1B4Q A;  2MZC A;  5JWR B;  2H1G A;  2VIM A;  2HSY A;  2XHF A;  2CX3 A;  1TDI A;  2KOK A;  1AC1 A;  3Q19 A;  3CRT A;  2C8U A;  3RPP A;  5B6N A;  3UL3 A;  2R4V A;  2YWM A;  1U3A A;  4PX1 A;  4LL4 B;  1F9M A;  4XRD A;  4I5Q A;  2DJ3 A;  1XW5 A;  1XVQ A;  5AGY A;  1YEX A;  4KDX A;  4ZIJ A;  3JCM L;  2QSI A;  2VL9 A;  4MMM A;  5GAN D;  2EIO A;  3M3M A;  2VM2 A;  1BQ7 A;  2QC7 A;  2CVB A;  1ABA A;  3HJP A;  1TU8 A;  1Z3E A;  5KEJ A;  3ERW A;  3KP9 A;  3PR8 A;  3P8W A;  1SJ6 A;  2M80 A;  3ZRE A;  3GA4 A;  2K9F A;  2GSS A;  2HE3 A;  3TJG A;  3IK9 A;  4EE0 A;  1U87 A;  1S3R A;  2GZZ A;  5EVO A;  2X4A A;  1BAY A;  2C0D A;  4MK3 A;  4PUR A;  4TXO B;  5IO2 A;  2CAI A;  3IR4 A;  1G6W A;  1PN0 A;  2E2M A;  3FEU A;  4N10 A;  3IXR A;  4JU5 A;  1F2E A;  3QAW A;  2FHE A;  2ON5 A;  2WFC A;  1GP1 A;  2TRC P;  3QDN A;  1T00 A;  4E8H A;  2IPA A;  2NDO A;  5DBQ A;  2R5G A;  3IK7 A;  2PBJ A;  4TN8 A;  1X9W B;  3HJM A;  2XPE A;  2HZE B;  1AIU A;  1GTU A;  4Z7X A;  4X1U A;  1EOH A;  3VPT A;  2DMM A;  2D2Z A;  2FWF A;  3DXB A;  5ECR B;  2GSQ A;  4TKY A;  3NIV A;  1XWA A;  5BRT A;  1LJR A;  3I69 A;  2REM A;  4EIQ A;  1AAZ A;  5D73 A;  3VWX A;  1TK5 B;  4TR1 A;  4Z2U A;  3FYG A;  1MEK A;  2KP1 A;  2GTU A;  2YP6 A;  3E0U A;  4MJB A;  1VGL A;  4WF4 A;  4ULX A;  4IS0 A;  4K8M A;  5IMZ A;  2HFD A;  1PMT A;  2YPM A;  5DCG A;  3PPU A;  2YZH A;  3QFA C;  1FB6 A;  5D9T A;  5D8I A;  4MDC A;  2O8V B;  4BWS A;  4WBJ A;  1TXX A;  1UC7 A;  5KN1 A;  4MJC A;  5HR3 A;  3EVI A;  3G9B A;  2FA4 A;  4XIH A;  4ML6 A;  1TRS A;  5CRG A;  3TDG A;  1PL2 A;  2AYT A;  2C1Y A;  3UOM A;  1YY7 A;  4WXT A;  1EGR A;  1FAA A;  3GYK A;  4MPF A;  3LGC A;  1A24 A;  4MH3 A;  5EPF A;  1TI1 A;  4OFN A;  4KND A;  3ZIT A;  3W8S A;  2M72 A;  2I1U A;  3EU4 A;  3ZVJ D;  1E2Y A;  4GXZ A;  2H01 A;  2O87 A;  3F4T A;  4ILF A;  2HSH A;  5CRH A;  4DEJ A;  5DDL A;  1TRU A;  2YWI A;  2L4C A;  3GL5 A;  1K0D A;  3ERF A;  1URM A;  2PVQ A;  1PX6 A;  4HJM A;  2EC4 A;  1F6M C;  2FUG 2;  4TVE A;  1M9A A;  2V41 A;  2B5Y A;  4RUV A;  4HOJ A;  2WCI A;  5IMD A;  3QAG A;  1ILO A;  2NPB A;  4BVY B;  3N9J A;  4F0B A;  4ZBD A;  4DSS A;  2H1B A;  3APS A;  5A4W A;  5F06 A;  3DRN A;  3ZTL A;  5ECH B;  5KOW A;  3QD9 A;  3US3 A;  1O8W A;  1Q98 A;  4I97 A;  5KOX A;  3A2V A;  3EMX A;  5ECQ B;  4DVC A;  17GS A;  3I6A A;  2HZE A;  1EWX A;  3PGT A;  3CMI A;  4O32 A;  3HKR A;  3MDK A;  4CY8 A;  4TR4 A;  2IN3 A;  5LCZ A;  1HYU A;  3HD5 A;  1LBK A;  1BG5 A;  4POL A;  2I81 A;  4ZB8 A;  1C72 A;  5JCU A;  1SKS B;  2HRN A;  4GTU A;  2HSM A;  3C7M A;  3H93 A;  3GST A;  1RQM A;  4J2F A;  3NOF A;  3F0I A;  5DJL A;  3K8N A;  4V2L A;  5ECI B;  2B1K A;  2IMD A;  1FOV A;  4NPB A;  3LEF A;  1GUK A;  2IL3 A;  1Z6N A;  4K1F A;  1IYH A;  4K0G A;  5DAL B;  2VCT A;  1AQW A;  5CRW A;  4O5U A;  4QQ7 A;  2GQM A;  4HS1 A;  5IIZ A;  1OVN A;  1GSD A;  4I6X A;  3VUR A;  1DSB A;  1FW1 A;  3FY7 A;  5LD0 A;  4XS1 A;  3P90 A;  4BVX B;  4K2D A;  2A4H A;  2L6C A;  4H86 A;  1DE1 A;  5CRE A;  1B9Y C;  3QCP A;  5C04 A;  3H79 A;  2KP2 A;  4DSR A;  4JR6 A;  1XVW A;  3LG6 A;  2NTO A;  4MF7 A;  3RPN A;  2B5E A;  1Z7P A;  1PSQ A;  2H71 A;  1QK8 A;  4AF2 A;  4BWQ A;  5ABR A;  4I2T A;  5F05 A;  3AY8 A;  3HHV A;  1Z7R A;  2H8L A;  3HA9 A;  4POK A;  3CSH A;  2A4V A;  2R37 A;  4KGI A;  1VRS D;  3WYW A;  4YQM A;  1GLQ A;  3TKR A;  4O5R A;  3D5J A;  1GTB A;  1GNE A;  3HYP A;  3IRA A;  3WD6 A;  1A8Y A;  2AV4 A;  3C8E A;  3KP8 A;  3KZQ A;  4MA9 A;  2C0F A;  5E59 A;  3H4K A;  3IE3 A;  3C73 A;  5G30 A;  3QFB C;  2MBS A;  1G7E A;  4L0W A;  4HZ4 A;  3DIE A;  3O3T A;  4N0V A;  2HYX A;  3F8U A;  2L59 A;  3EYT A;  3EU3 A;  3PIN A;  4IEL A;  4EC0 A;  4KE3 A;  4KUN A;  1O85 A;  5IPG A;  2DJK A;  1MDK A;  1ML6 A;  2XPD A;  2K8V A;  3UEM A;  3GV1 A;  4KH7 A;  2V6O A;  1HNA A;  4MF5 A;  2DJJ A;  1CQH A;  5J9C A;  2GVP A;  3A2W A;  1YEP A;  4ZL7 A;  2OA7 A;  5COH A;  4V2M A;  3HY2 A;  2JZR A;  4G0I A;  11GS A;  5A4V A;  4EKZ A;  2P5Q A;  2NVL A;  4WF5 A;  3EC3 A;  2QKE A;  3P2A A;  2KLX A;  3GH9 A;  3GMF A;  4OO4 A;  5J9B A;  4KAE A;  3LYP A;  3TCO A;  2CZ2 A;  1M99 A;  2MMZ A;  2K18 A;  2IMK A;  3TOT A;  2CVK A;  3GKX A;  2ES7 A;  3LWA A;  4WET A;  3BOA A;  1R7H A;  1YKC A;  5FWG A;  4FIW A;  1OC9 B;  14GS A;  4NV2 A;  4NHZ A;  3MAK A;  4KSM A;  1ERU A;  4MLY A;  2LNS A;  2BJX A;  4GSS A;  1ST9 A;  1M3J A;  3L78 A;  1XCC A;  3BCI A;  2H0G A;  2J9H A;  2FWH A;  4OFT A;  4HQS A;  4RI6 A;  3APO A;  4N0Z A;  3ZLP A;  3FZ4 A;  1R5P A;  3TB2 A;  3U6V A;  2VL2 C;  3IBH A;  3O76 A;  1U3I A;  3J7Y b;  1ON4 A;  1SD9 A;  1XWK A;  1VF4 A;  3RBT A;  3IC8 A;  3FK8 A;  3I9V 2;  3L4N A;  3F4R A;  5ELA A;  1OAZ A;  4HU7 A;  5ECO B;  3SBC A;  4QL7 A;  2DIZ A;  2V2G A;  4Q5Q A;  8GSS A;  3EPT A;  6GSX A;  4EIP A;  2O85 A;  1WP0 A;  4GRF A;  4GF0 A;  2YAN A;  3GH6 A;  2H0I A;  1B9X C;  4XS4 B;  1PD2 1;  4HZ2 A;  3V1W A;  3Q6O A;  1SL2 B;  3LXT A;  1VF1 A;  3ME8 A;  1V40 A;  4WEY A;  3R3E A;  5L71 A;  2RII A;  3TOU A;  3LXZ A;  3ZZX A;  4L0U A;  5J4U A;  4MCU A;  4POM A;  2IFQ A;  4V1A p;  3CXG A;  1M7T A;  2ZUP A;  1K0C A;  2G2Q A;  6GSU A;  2P5R A;  4ZB9 A;  1GRX A;  4IQA A;  4A5P A;  4F9Z A;  5F07 A;  5GAP D;  4K7N A;  2OAD A;  1HQO A;  2J23 A;  1WPI A;  3A5I A;  4XCS A;  2H1A A;  2VCW A;  2JU5 A;  1TOF A;  3KJY A;  1Z5Y E;  2H76 A;  5ECS A;  5HR0 A;  3W6G A;  3ZMK A;  4PGT A;  1M2D A;  4K7I A;  5G5E A;  2GT5 A;  2RUF A;  5IM9 A;  6GST A;  1K0A A;  2H74 A;  2M46 A;  2ZCT A;  1B8X A;  1HNB A;  1W89 A;  1PL1 A;  20GS A;  2OAC A;  4IKH A;  5C00 A;  3LOR A;  2YWN A;  1K3Y A;  2OE3 A;  1ZYP A;  4ZXG A;  4I2U A;  2LJA A;  4OD7 A;  3VLN A;  1K0B A;  3APQ A;  4EO3 A;  1T4Y A;  4ML1 A;  3WT2 A;  2CX4 A;  1AQV A;  3C71 A;  4MZC A;  1WE0 A;  2PER A;  3L0H A;  1G7O A;  1PQN A;  1AXD A;  3GUS A;  2H75 A;  4ISD A;  3UMA A;  1OC8 A;  4KCE A;  4F0C A;  1ZYE A;  5B6M A;  1GNW A;  4MPG A;  3UJ1 A;  1SKR B;  5F8B A;  1OYJ A;  4RI7 A;  5HFI A;  3HCZ A;  4IHU A;  3F63 A;  2IME A;  4K6X A;  2R0P A;  2HRA A;  2GS3 A;  5IO0 A;  3EE2 A;  1XG8 A;  4ICY A;  2A2S A;  1XW6 A;  3Q18 A;  3IC4 A;  4F82 A;  2HXK A;  2FWG A;  2K6V A;  4NHW A;  3EUR A;  1ERW A;  3KGK A;  5J3R A;  5CO3 A;  3VWU A;  1YQ1 A;  2PWJ A;  5IQY A;  2IIY A;  1QXH A;  4GSN A;  5HQP A;  2L4Q A;  4J56 E;  2F8F A;  2E2G A;  4AJ8 A;  9GSS A;  1EZK A;  1JZO A;  2KHP A;  2H6Y A;  2PGT A;  3E3E A;  4Z2R A;  1ERT A;  4FYC A;  5DQY A;  1YDK A;  3GNJ A;  1I5G A;  2CAQ A;  2L57 A;  1GSQ A;  3MWH A;  3DYR A;  1X5D A;  3TKS A;  3BD2 A;  2LS5 A;  4K5R A;  1NW2 A;  4NXI A;  5ENU A;  3QMX A;  3RAZ A;  1V98 A;  2JZT A;  2X8H A;  3DWV A;  1NM3 A;  1S3D A;  2DBC A;  2VAF A;  4IJI A;  2OBK A;  4O92 A;  4PTS A;  5DCH A;  1KNG A;  2I3Y A;  4RQX A;  5INY A;  4LA1 A;  1FG4 A;  2RM5 A;  3LSZ A;  4X4J A;  1PGT A;  5DJM A;  1TKD B;  1GSU A;  1JLV A;  1Y6E A;  3TKP A;  4WR5 A;  1N8J A;  3PH9 A;  4HU9 A;  1M2A A;  4BL7 B;  4DSQ A;  2V6K A;  3EIN A;  1RW1 A;  3HZ4 A;  3P7X A;  4Q5N A;  2H73 A;  4TXO A;  2H1D A;  4CHS A;  4E8E A;  1B48 A;  3TJJ A;  1OE7 A;  3G7Y A;  1FOH A;  2GQK A;  3R2Q A;  2V32 A;  3TRQ A;  5G31 A;  3DGQ A;  4GCI A;  1EP8 A;  2MBT A;  1XFL A;  4ZB6 A;  2FWE A;  5CYY A;  5A4U A;  5KN0 A;  1THX A;  2LUS A;  3F6F A;  5DAK B;  3ZVJ A;  2H6Z A;  3KXO A;  5J41 A;  2PVO C;  4PQ1 A;  1MTC A;  3DVX A;  1HNC A;  2MMO A;  3CQF A;  2VL3 A;  4YH2 A;  2YV7 A;  1PX7 A;  2QA2 A;  2OKA A;  4YKF A;  2JSY A;  4BA7 A;  4L5O A;  5ECK B;  1IYI A;  3HZ8 A;  5H5Q A;  1OKD A;  2YJ7 A;  4RQR A;  3A5W A;  2G0F A;  1ZGN A;  2R3X A;  3TRP A;  2IMI A;  2ON7 A;  2HRF A;  4USS A;  3UAP A;  3W8J A;  1WRY A;  6GSW A;  3D4T A;  4Q5R A;  4ACS A;  2VD1 A;  5B8B A;  2X8G A;  2UZ8 A;  2C4J A;  5D9W A;  1XXU A;  1PKZ A;  3LQ7 A;  2L5L A;  2RLI A;  4KDU A;  4JBB A;  3ISO A;  4N30 A;  2TIR A;  4MJA A;  2B7K A;  2VCV A;  1T3B A;  4G0K A;  3GTU B;  1A2J A;  2GDR A;  4XHM A;  3LW9 A;  1EV4 A;  2MYG A;  3ZIJ A;  3L9U A;  4KW6 A;  2DJ1 A;  2WGR A;  1DUG A;  2AAW A;  2OBI A;  2YZU A;  3FKF A;  4KA0 A;  1LU4 A;  1QUW A;  2HT9 A;  3LYK A;  2HI7 A;  4EDY A;  1M9B A;  1T4Z A;  4Q5F A;  3RHB A;  4MZW A;  3GHA A;  3HVX A;  4NWY A;  1THO A;  2R0G A;  1X5E A;  1A2M A;  3M1G A;  2HZF A;  2AJQ B;  1NHY A;  2LTK A;  3KM6 A;  3H1N A;  1WOU A;  3LFL A;  1Y25 A;  2JAC A;  3CYN A;  1M2B A;  3OR5 A;  5F0G A;  1A8L A;  5IMA A;  1VF2 A;  1BX9 A;  4MF6 A;  3IOS A;  5AIX A;  3VK9 A;  2GT6 A;  10GS A;  3VI7 A;  2LEG A;  3F6D A;  2R6K A;  3GKK A;  4K5S A;  3RDW A;  4FH8 A;  4BVY A;  2VOC A;  2N5A A;  2DKH A;  4TR0 A;  1G6Y A;  1BYE A;  4HJ2 A;  1MD4 A;  1WMJ A;  1EV9 A;  4PXO A;  2EIQ A;  2B1L A;  1A0R P;  5JCG A;  1W4V A;  2YCD A;  4HI7 A;  2YNX A;  5DQS A;  4TRX A;  3FZA A;  2VD0 A;  3NZN A;  3ERG A;  3IA1 A;  13GS A;  2F51 A;  2LJR A;  3D6I A;  1UVZ A;  2C3T A;  4J57 E;  2Z9S A;  1TI3 A;  4IN0 A;  4IP1 A;  3M9J A;  1Z9H A;  4OMV A;  4LLR A;  4MP4 A;  3BJ5 A;  1EOG A;  5JWQ B;  1FVK A;  5ECM B;  4ECB A;  5CRD A;  4XTS A;  3J7Y k;  5GST A;  2OE0 A;  4HEA 2;  1SL1 B;  1SK2 A;  1UA5 A;  1AW9 A;  1J9B A;  2B3S A;  1SEN A;  2GZY A;  4NMU A;  1XOA A;  1V58 A;  3GIX A;  5DAL A;  1YJ6 A;  5GSS A;  22GS A;  5HFK A;  2TRX A;  3IAM 2;  3TRX A;  2DIY A;  4K9Z A;  4FO5 A;  1PKW A;  1SJZ A;  1PN9 A;  4BVX A;  1TJD A;  3EMP A;  1MDJ A;  1ZZY A;  1QGV A;  1JZD A;  3L9S A;  1XIY A;  3WGE A;  2BTO T;  1GUM A;  1U88 A;  1YKA A;  4MJE A;  1X0R A;  4IP6 A;  5EL8 A;  3ED3 A;  2CA8 A;  2F9S A;  2YOI A;  1N2A A;  2E0Q A;  4GLT A;  1SD8 A;  5G1L A;  1BED A;  1T7P B;  3F3Q A;  3UVT A;  3TJK A;  3H8Q A;  7GSS A;  1CQG A;  3FR6 A;  2VUP A;  1A23 A;  2JSZ A;  4TR1 B;  4QL9 A;  4YKG A;  2H72 A;  5ID2 B;  4EXJ A;  1AUC A;  1TU7 A;  1ZMA A;  3KCM A;  1T1V A;  4KB3 A;  2VM1 A;  2O7K A;  1TTZ A;  3IAS 2;  4YQU A;  1QQ2 A;  1PFO A; 
#chains in the Genus database with same CATH homology
 3G7I A;  3GX8 A;  3CRU A;  1TRW A;  1YF1 A;  3KMO A;  1K0N A;  5G2Z A;  2F8A A;  3ZFL A;  5ECP B;  6GSS A;  3MNG A;  4WKW A;  4GQC A;  2HRK A;  3D4M A;  1UN2 A;  2QGV A;  4D73 B;  3TKQ A;  3ZFB A;  4MAB A;  2YWO A;  4EDZ A;  3FR3 A;  2DKI A;  1A2L A;  4ECI A;  4IBP A;  2AUV A;  2LNT A;  3VPQ A;  3VI5 A;  1WIK A;  2FNO A;  3EWL A;  2WJU A;  2X64 A;  4F2I A;  3HVV A;  4TXV A;  4LMV A;  2GQL A;  2EIR A;  3WGD A;  1EGO A;  1R5A A;  1DE2 A;  4X43 A;  5DVB A;  5D96 A;  3ME7 A;  1KTE A;  1XWG A;  2RM6 A;  3UBL A;  3ZYW A;  1R26 A;  2E7P A;  2OJL A;  4Z2T A;  4G2E A;  4K2X A;  2WUL A;  2C80 A;  2GLR A;  3M9K A;  2VLV A;  4I8B A;  1G0T A;  3Q74 A;  1FHE A;  3QR6 A;  5IPH A;  3IDV A;  1Z6M A;  1ZYQ B;  1OC9 A;  4L8E A;  2K8S A;  1DBY A;  4HUA A;  1XWB A;  5EY6 A;  4DSS B;  3MIX A;  2N5B A;  2MMA A;  2NBS A;  3TJB A;  1OE8 A;  4AJ6 A;  1FO5 A;  1GSS A;  3GUR A;  1USB A;  1JHB A;  4ZL8 A;  3FZ9 A;  3BBY A;  4FYB A;  3CTF A;  1V9W A;  2IJY A;  1M0U A;  2LRC A;  4FYU A;  1TW9 A;  1AQX A;  4OFM A;  4OO5 A;  4ZBA A;  1XBS A;  3MYD A;  2I4A A;  4JZQ A;  1BJX A;  2PMT A;  3KH9 A;  4NV5 A;  4ZIL A;  1GSY A;  3A3T A;  4EL1 A;  4JRR A;  2P31 A;  2PPT A;  2FA8 A;  5ID2 A;  2O89 A;  3BCK A;  3D21 A;  1ZCP A;  2X99 A;  3ZL5 A;  3HDC A;  1ZOF A;  2H30 A;  2WS2 A;  3FMW A;  1OKT A;  2ZNM A;  2P0G A;  3QOU A;  3CBU A;  2H66 A;  4LL1 B;  1J08 A;  1GTI A;  4XS4 A;  2BMX A;  1B4P A;  3KH7 A;  4X0X A;  5JWO B;  2L5O A;  4PQI A;  4PUA A;  4N11 A;  4D73 A;  2HNL A;  3HJO A;  3GL3 A;  2CT6 A;  3KIJ A;  2RUE A;  4KSO A;  5JCW A;  3GKM A;  4G19 A;  4P3Y B;  4TR3 A;  1MDI A;  2WDU A;  2VLT A;  1SK0 A;  2LJK A;  4MNN A;  2H19 A;  2R2J A;  2GSR A;  2L6D A;  1ZYN A;  4MZB A;  3UVH A;  3QPM A;  4FQU A;  1K0O A;  1J0F A;  2A2P A;  4EVM A;  2DML A;  5H5R A;  5FT3 A;  2FY6 A;  3A2X A;  3GSS A;  2B5X A;  1U6T A;  3IHG A;  3FRC A;  5ELG A;  4ZBB A;  3TKS C;  3F3R A;  1KEB A;  1GSE A;  1GL8 A;  1E6B A;  2B6M A;  1SK1 A;  1SL0 B;  4PNF A;  1GUH A;  12GS A;  1ERV A;  2X8C A;  3N5O A;  2FGX A;  4WR4 A;  3LJR A;  2CZ3 A;  2V1M A;  1JLW A;  4EUY A;  3E9J B;  1YF0 A;  1GLP A;  2DJ0 A;  5IMV A;  1XWC A;  5IOX A;  4V1A g;  3WT1 A;  3TGZ A;  1QFN A;  1VF3 A;  1F37 A;  2CQ9 A;  2WZ9 A;  1SU9 A;  1SYX A;  5H5S A;  4XS6 A;  4MH2 A;  2GGT A;  3FW2 A;  3GFK A;  4TW5 A;  1H4O A;  1TP9 A;  5E4W A;  5B7C A;  5D9X A;  3TUE A;  3M0F A;  2H0H A;  2LQO A;  5CAX A;  1ACV A;  1R4W A;  4OCF A;  5IOW A;  1HD2 A;  1RK4 A;  2XBI A;  2LKU A;  2XBQ A;  2VLU A;  2WRT A;  4GST A;  4CDO A;  5ECN B;  1K0M A;  4ZL9 A;  1X5C A;  4KDY A;  1V2A A;  3S9F A;  5A5K A;  3DML A;  5KN2 A;  1O7U A;  1GTA A;  1K3L A;  4V2N A;  1EEJ A;  1WWJ A;  4OWY A;  3FR9 A;  3GKN A;  1K3O A;  1NSW A;  5D9V A;  5GZZ B;  2HLS A;  2B7J A;  4POB A;  2LST A;  3VWV A;  5AN1 A;  1JZR A;  1XW9 A;  3FZ5 A;  4L5L A;  4ECC A;  3KTL A;  4KF9 A;  1S3C A;  3KTB A;  1JZW A;  5CP1 A;  18GS A;  4JR4 A;  2JAD A;  4TOP A;  2LRN A;  16GS A;  5AIV A;  3UAR A;  3D22 A;  1SKW B;  2OE1 A;  5IMF A;  4YQV A;  1V57 A;  5HR2 A;  3IPZ A;  1OC3 A;  3KMN A;  1EP7 A;  3I43 A;  3DKS A;  1O81 A;  1A0F A;  2DJ2 A;  1QMV A;  1SJI A;  2MMN A;  2C3Q A;  1S3A A;  2LRT A;  2N5F A;  3ZIV A;  3CTG A;  3QAV A;  4HDE A;  1NHO A;  6GSY A;  1O8X A;  2JZS A;  3UBK A;  4BL7 A;  5CNW A;  3ZRD A;  3M8N A;  5KN3 A;  3ZML A;  4IQ1 A;  5B8A A;  3CSJ A;  2C3N A;  3HVS A;  3IV4 A;  1WJK A;  2CVD A;  2DLX A;  3GN3 A;  2ALB A;  4PNG A;  2LQQ A;  2CV4 A;  1GSF A;  2VO4 A;  1GWC A;  4IVF A;  1X9S B;  3KD0 A;  3O6T A;  1X9M B;  3MSZ A;  4EF0 A;  4K0N A;  4ID0 A;  4KX4 A;  3KEB A;  1F3A A;  3C1R A;  2WB9 A;  4IJ3 A;  2AHE A;  2DC5 A;  4YAP A;  1XPV A;  4KCA A;  5DAK A;  2PN8 A;  1T8E B;  4O7H A;  5FHI A;  3F9U A;  4CW9 A;  3G7J A;  5BMU A;  2QA1 A;  4G0L A;  5G5F A;  2IFQ B;  4LMW A;  1TK8 B;  3UIW A;  2YV9 A;  4JE1 A;  1I9D A;  1YZX A;  1JFU A;  3TKS E;  2PU9 C;  2FCH A;  4AGS A;  5AIS A;  4HQZ A;  4CY6 A;  4ECJ A;  3VFI A;  1TRV A;  1FVJ A;  2X49 A;  1GUL A;  1XZO A;  1ZL9 A;  1SYR A;  2JL4 A;  4XRA A;  2KUC A;  2VL2 A;  3GX0 A;  2GZP A;  4OCE A;  3DVW A;  2H70 A;  1XOB A;  2DSA A;  4K7O A;  2I9H A;  3GTU A;  4JED A;  2AB6 A;  2R0C A;  3TJF A;  4F03 A;  5G1K A;  5D93 A;  3DD3 A;  1F3B A;  19GS A;  2GST A;  4NAX A;  3SWL A;  1FB0 A;  3F4S A;  4AJ7 A;  2VCX A;  2F3M A;  3HXS A;  5LNK e;  5IMC A;  2VCZ A;  3WGX A;  1TK0 B;  2YJH A;  5HFG A;  2FLS A;  4G9H A;  4YAV A;  1PA3 A;  2VCQ A;  5ECL B;  4WBR D;  2IMF A;  4G10 A;  4IW9 A;  4IGJ A;  6GSV A;  2LV3 A;  1PRX A;  1Q4J A;  2H6X A;  3FHK A;  3L9V A;  4PUF C;  4BPY A;  1GH2 A;  1H75 A;  2FD3 A;  3D0Z A;  2PUK C;  2C0E A;  4GWR A;  1KBN A;  2XC2 A;  2YN1 A;  1MD3 A;  3GRX A;  4PQH A;  5HR1 A;  3RHC A;  3VWW A;  4GQF A;  3U5R E;  5J5N A;  3C1S A;  1O73 A;  1EEM A;  1O6J A;  2A2R A;  3DEX A;  3IHQ A;  2C0G A;  4O5Q A;  3CSI A;  2IWT A;  1B4Q A;  2MZC A;  5JWR B;  2H1G A;  2VIM A;  2HSY A;  2XHF A;  2CX3 A;  1TDI A;  2KOK A;  1AC1 A;  3Q19 A;  3CRT A;  2C8U A;  3RPP A;  5B6N A;  3UL3 A;  2R4V A;  2YWM A;  1U3A A;  4PX1 A;  4LL4 B;  1F9M A;  4XRD A;  4I5Q A;  2DJ3 A;  1XW5 A;  1XVQ A;  5AGY A;  1YEX A;  4KDX A;  4ZIJ A;  3JCM L;  2QSI A;  2VL9 A;  4MMM A;  5GAN D;  2EIO A;  3M3M A;  2VM2 A;  1BQ7 A;  2QC7 A;  2CVB A;  1ABA A;  3HJP A;  1TU8 A;  1Z3E A;  5KEJ A;  3ERW A;  3KP9 A;  3PR8 A;  3P8W A;  1SJ6 A;  2M80 A;  3ZRE A;  3GA4 A;  2K9F A;  2GSS A;  2HE3 A;  3TJG A;  3IK9 A;  4EE0 A;  1U87 A;  2GZZ A;  5EVO A;  2X4A A;  1BAY A;  2C0D A;  4MK3 A;  4PUR A;  4TXO B;  5IO2 A;  2CAI A;  3IR4 A;  1G6W A;  1PN0 A;  2E2M A;  3FEU A;  4N10 A;  3IXR A;  4JU5 A;  1F2E A;  3QAW A;  2FHE A;  2ON5 A;  2WFC A;  1GP1 A;  2TRC P;  3QDN A;  1T00 A;  4E8H A;  2IPA A;  2NDO A;  5DBQ A;  2R5G A;  3IK7 A;  2PBJ A;  4TN8 A;  1X9W B;  3HJM A;  2XPE A;  2HZE B;  1AIU A;  1GTU A;  4Z7X A;  4X1U A;  1EOH A;  3VPT A;  2DMM A;  2D2Z A;  2FWF A;  3DXB A;  5ECR B;  2GSQ A;  4TKY A;  3NIV A;  1XWA A;  5BRT A;  1LJR A;  3I69 A;  2REM A;  4EIQ A;  1AAZ A;  5D73 A;  3VWX A;  1TK5 B;  4TR1 A;  4Z2U A;  3FYG A;  1MEK A;  2KP1 A;  2GTU A;  2YP6 A;  3E0U A;  4MJB A;  1VGL A;  4WF4 A;  4ULX A;  4IS0 A;  4K8M A;  5IMZ A;  2HFD A;  1PMT A;  2YPM A;  5DCG A;  3PPU A;  2YZH A;  3QFA C;  1FB6 A;  5D9T A;  5D8I A;  4MDC A;  2O8V B;  4BWS A;  4WBJ A;  1TXX A;  1UC7 A;  5KN1 A;  4MJC A;  5HR3 A;  3EVI A;  3G9B A;  2FA4 A;  4XIH A;  4ML6 A;  1TRS A;  5CRG A;  3TDG A;  1PL2 A;  2AYT A;  2C1Y A;  3UOM A;  1YY7 A;  4WXT A;  1EGR A;  1FAA A;  3GYK A;  4MPF A;  3LGC A;  1A24 A;  4MH3 A;  5EPF A;  1TI1 A;  4OFN A;  4KND A;  3ZIT A;  3W8S A;  2M72 A;  2I1U A;  3EU4 A;  3ZVJ D;  1E2Y A;  4GXZ A;  2H01 A;  2O87 A;  3F4T A;  4ILF A;  2HSH A;  5CRH A;  4DEJ A;  5DDL A;  1TRU A;  2YWI A;  2L4C A;  3GL5 A;  1K0D A;  3ERF A;  1URM A;  2PVQ A;  1PX6 A;  4HJM A;  2EC4 A;  1F6M C;  2FUG 2;  4TVE A;  1M9A A;  2V41 A;  2B5Y A;  4RUV A;  4HOJ A;  2WCI A;  5IMD A;  3QAG A;  1ILO A;  2NPB A;  4BVY B;  3N9J A;  4F0B A;  4ZBD A;  4DSS A;  2H1B A;  3APS A;  5A4W A;  5F06 A;  3DRN A;  3ZTL A;  5ECH B;  5KOW A;  3QD9 A;  3US3 A;  1O8W A;  1Q98 A;  4I97 A;  5KOX A;  3A2V A;  3EMX A;  5ECQ B;  4DVC A;  17GS A;  3I6A A;  2HZE A;  1EWX A;  3PGT A;  3CMI A;  4O32 A;  3HKR A;  3MDK A;  4CY8 A;  4TR4 A;  2IN3 A;  5LCZ A;  1HYU A;  3HD5 A;  1LBK A;  1BG5 A;  4POL A;  2I81 A;  4ZB8 A;  1C72 A;  5JCU A;  1SKS B;  2HRN A;  4GTU A;  2HSM A;  3C7M A;  3H93 A;  3GST A;  1RQM A;  4J2F A;  3NOF A;  3F0I A;  5DJL A;  3K8N A;  4V2L A;  5ECI B;  2B1K A;  2IMD A;  1FOV A;  4NPB A;  3LEF A;  1GUK A;  2IL3 A;  1Z6N A;  4K1F A;  1IYH A;  4K0G A;  5DAL B;  2VCT A;  1AQW A;  5CRW A;  4O5U A;  4QQ7 A;  2GQM A;  4HS1 A;  5IIZ A;  1OVN A;  1GSD A;  4I6X A;  3VUR A;  1DSB A;  1FW1 A;  3FY7 A;  5LD0 A;  4XS1 A;  3P90 A;  4BVX B;  4K2D A;  2A4H A;  2L6C A;  4H86 A;  1DE1 A;  5CRE A;  1B9Y C;  3QCP A;  5C04 A;  3H79 A;  2KP2 A;  4DSR A;  4JR6 A;  1XVW A;  3LG6 A;  2NTO A;  4MF7 A;  3RPN A;  2B5E A;  1Z7P A;  1PSQ A;  2H71 A;  1QK8 A;  4AF2 A;  4BWQ A;  5ABR A;  4I2T A;  5F05 A;  3AY8 A;  3HHV A;  1Z7R A;  2H8L A;  3HA9 A;  4POK A;  3CSH A;  2A4V A;  2R37 A;  4KGI A;  1VRS D;  3WYW A;  4YQM A;  1GLQ A;  3TKR A;  4O5R A;  3D5J A;  1GTB A;  1GNE A;  3HYP A;  3IRA A;  3WD6 A;  1A8Y A;  2AV4 A;  3C8E A;  3KP8 A;  3KZQ A;  4MA9 A;  2C0F A;  5E59 A;  3H4K A;  3IE3 A;  3C73 A;  5G30 A;  3QFB C;  2MBS A;  1G7E A;  4L0W A;  4HZ4 A;  3DIE A;  3O3T A;  4N0V A;  2HYX A;  3F8U A;  2L59 A;  3EYT A;  3EU3 A;  3PIN A;  4IEL A;  4EC0 A;  4KE3 A;  4KUN A;  1O85 A;  5IPG A;  2DJK A;  1MDK A;  1ML6 A;  2XPD A;  2K8V A;  3UEM A;  3GV1 A;  4KH7 A;  2V6O A;  1HNA A;  4MF5 A;  2DJJ A;  1CQH A;  5J9C A;  2GVP A;  3A2W A;  1YEP A;  4ZL7 A;  2OA7 A;  5COH A;  4V2M A;  3HY2 A;  2JZR A;  4G0I A;  11GS A;  5A4V A;  4EKZ A;  2P5Q A;  2NVL A;  4WF5 A;  3EC3 A;  2QKE A;  3P2A A;  2KLX A;  3GH9 A;  3GMF A;  4OO4 A;  5J9B A;  4KAE A;  3LYP A;  3TCO A;  2CZ2 A;  1M99 A;  2MMZ A;  2K18 A;  2IMK A;  3TOT A;  2CVK A;  3GKX A;  2ES7 A;  3LWA A;  4WET A;  3BOA A;  1R7H A;  1YKC A;  5FWG A;  4FIW A;  1OC9 B;  14GS A;  4NV2 A;  4NHZ A;  3MAK A;  4KSM A;  1ERU A;  4MLY A;  2LNS A;  2BJX A;  4GSS A;  1ST9 A;  3L78 A;  1XCC A;  3BCI A;  2H0G A;  2J9H A;  2FWH A;  4OFT A;  4HQS A;  4RI6 A;  3APO A;  4N0Z A;  3ZLP A;  3FZ4 A;  1R5P A;  3TB2 A;  3U6V A;  2VL2 C;  3IBH A;  3O76 A;  1U3I A;  3J7Y b;  1ON4 A;  1SD9 A;  1XWK A;  1VF4 A;  3RBT A;  3IC8 A;  3FK8 A;  3I9V 2;  3L4N A;  3F4R A;  5ELA A;  1OAZ A;  4HU7 A;  5ECO B;  3SBC A;  4QL7 A;  2DIZ A;  2V2G A;  4Q5Q A;  8GSS A;  3EPT A;  6GSX A;  4EIP A;  2O85 A;  1WP0 A;  4GRF A;  4GF0 A;  2YAN A;  3GH6 A;  2H0I A;  1B9X C;  4XS4 B;  1PD2 1;  4HZ2 A;  3V1W A;  3Q6O A;  1SL2 B;  3LXT A;  1VF1 A;  3ME8 A;  1V40 A;  4WEY A;  3R3E A;  5L71 A;  2RII A;  3TOU A;  3LXZ A;  3ZZX A;  4L0U A;  5J4U A;  4MCU A;  4POM A;  2IFQ A;  4V1A p;  3CXG A;  1M7T A;  2ZUP A;  1K0C A;  2G2Q A;  6GSU A;  2P5R A;  4ZB9 A;  1GRX A;  4IQA A;  4A5P A;  4F9Z A;  5F07 A;  5GAP D;  4K7N A;  2OAD A;  1HQO A;  2J23 A;  1WPI A;  3A5I A;  4XCS A;  2H1A A;  2VCW A;  2JU5 A;  1TOF A;  3KJY A;  1Z5Y E;  2H76 A;  5ECS A;  5HR0 A;  3W6G A;  3ZMK A;  4PGT A;  1M2D A;  4K7I A;  5G5E A;  2GT5 A;  2RUF A;  5IM9 A;  6GST A;  1K0A A;  2H74 A;  2M46 A;  2ZCT A;  1B8X A;  1HNB A;  1W89 A;  1PL1 A;  20GS A;  2OAC A;  4IKH A;  5C00 A;  3LOR A;  2YWN A;  1K3Y A;  2OE3 A;  1ZYP A;  4ZXG A;  4I2U A;  2LJA A;  4OD7 A;  3VLN A;  1K0B A;  3APQ A;  4EO3 A;  1T4Y A;  4ML1 A;  3WT2 A;  2CX4 A;  1AQV A;  3C71 A;  4MZC A;  1WE0 A;  2PER A;  3L0H A;  1G7O A;  1PQN A;  1AXD A;  3GUS A;  2H75 A;  4ISD A;  3UMA A;  1OC8 A;  4KCE A;  4F0C A;  1ZYE A;  5B6M A;  1GNW A;  4MPG A;  3UJ1 A;  1SKR B;  5F8B A;  1OYJ A;  4RI7 A;  5HFI A;  3HCZ A;  4IHU A;  3F63 A;  2IME A;  4K6X A;  2R0P A;  2HRA A;  2GS3 A;  5IO0 A;  3EE2 A;  4ICY A;  2A2S A;  1XW6 A;  3Q18 A;  3IC4 A;  4F82 A;  2HXK A;  2FWG A;  2K6V A;  4NHW A;  3EUR A;  1ERW A;  3KGK A;  5J3R A;  5CO3 A;  3VWU A;  1YQ1 A;  2PWJ A;  5IQY A;  2IIY A;  1QXH A;  4GSN A;  5HQP A;  2L4Q A;  4J56 E;  2F8F A;  2E2G A;  4AJ8 A;  9GSS A;  1EZK A;  1JZO A;  2KHP A;  2H6Y A;  2PGT A;  3E3E A;  4Z2R A;  1ERT A;  4FYC A;  5DQY A;  1YDK A;  3GNJ A;  1I5G A;  2CAQ A;  2L57 A;  1GSQ A;  3MWH A;  3DYR A;  1X5D A;  3TKS A;  3BD2 A;  2LS5 A;  4K5R A;  1NW2 A;  4NXI A;  5ENU A;  3QMX A;  3RAZ A;  1V98 A;  2JZT A;  2X8H A;  3DWV A;  1NM3 A;  1S3D A;  2DBC A;  2VAF A;  4IJI A;  2OBK A;  4O92 A;  4PTS A;  5DCH A;  1KNG A;  2I3Y A;  4RQX A;  5INY A;  4LA1 A;  1FG4 A;  2RM5 A;  3LSZ A;  4X4J A;  1PGT A;  5DJM A;  1TKD B;  1GSU A;  1JLV A;  1Y6E A;  3TKP A;  4WR5 A;  1N8J A;  3PH9 A;  4HU9 A;  1M2A A;  4BL7 B;  4DSQ A;  2V6K A;  3EIN A;  1RW1 A;  3HZ4 A;  3P7X A;  4Q5N A;  2H73 A;  4TXO A;  2H1D A;  4CHS A;  4E8E A;  1B48 A;  3TJJ A;  1OE7 A;  3G7Y A;  1FOH A;  2GQK A;  3R2Q A;  2V32 A;  3TRQ A;  5G31 A;  3DGQ A;  4GCI A;  1EP8 A;  2MBT A;  1XFL A;  4ZB6 A;  2FWE A;  5CYY A;  5A4U A;  5KN0 A;  1THX A;  2LUS A;  3F6F A;  5DAK B;  3ZVJ A;  2H6Z A;  3KXO A;  5J41 A;  2PVO C;  4PQ1 A;  1MTC A;  3DVX A;  1HNC A;  2MMO A;  2VL3 A;  4YH2 A;  2YV7 A;  1PX7 A;  2QA2 A;  2OKA A;  4YKF A;  2JSY A;  4BA7 A;  4L5O A;  5ECK B;  1IYI A;  3HZ8 A;  5H5Q A;  1OKD A;  2YJ7 A;  4RQR A;  3A5W A;  2G0F A;  1ZGN A;  2R3X A;  3TRP A;  2IMI A;  2ON7 A;  2HRF A;  4USS A;  3UAP A;  3W8J A;  1WRY A;  6GSW A;  3D4T A;  4Q5R A;  4ACS A;  2VD1 A;  5B8B A;  2X8G A;  2UZ8 A;  2C4J A;  5D9W A;  1XXU A;  1PKZ A;  3LQ7 A;  2L5L A;  2RLI A;  4KDU A;  4JBB A;  3ISO A;  4N30 A;  2TIR A;  4MJA A;  2B7K A;  2VCV A;  1T3B A;  4G0K A;  3GTU B;  1A2J A;  2GDR A;  4XHM A;  3LW9 A;  1EV4 A;  2MYG A;  3ZIJ A;  3L9U A;  4KW6 A;  2DJ1 A;  2WGR A;  1DUG A;  2AAW A;  2OBI A;  2YZU A;  3FKF A;  4KA0 A;  1LU4 A;  1QUW A;  2HT9 A;  3LYK A;  2HI7 A;  4EDY A;  1M9B A;  1T4Z A;  4Q5F A;  3RHB A;  4MZW A;  3GHA A;  3HVX A;  4NWY A;  1THO A;  2R0G A;  1X5E A;  1A2M A;  3M1G A;  2HZF A;  2AJQ B;  1NHY A;  2LTK A;  3KM6 A;  3H1N A;  1WOU A;  3LFL A;  1Y25 A;  2JAC A;  3CYN A;  1M2B A;  3OR5 A;  5F0G A;  1A8L A;  5IMA A;  1VF2 A;  1BX9 A;  4MF6 A;  3IOS A;  5AIX A;  3VK9 A;  2GT6 A;  10GS A;  3VI7 A;  2LEG A;  3F6D A;  2R6K A;  3GKK A;  4K5S A;  3RDW A;  4FH8 A;  4BVY A;  2VOC A;  2N5A A;  2DKH A;  4TR0 A;  1G6Y A;  1BYE A;  4HJ2 A;  1MD4 A;  1WMJ A;  1EV9 A;  4PXO A;  2EIQ A;  2B1L A;  1A0R P;  5JCG A;  1W4V A;  2YCD A;  4HI7 A;  2YNX A;  5DQS A;  4TRX A;  3FZA A;  2VD0 A;  3NZN A;  3ERG A;  3IA1 A;  13GS A;  2F51 A;  2LJR A;  3D6I A;  1UVZ A;  2C3T A;  4J57 E;  2Z9S A;  1TI3 A;  4IN0 A;  4IP1 A;  3M9J A;  1Z9H A;  4OMV A;  4LLR A;  4MP4 A;  3BJ5 A;  1EOG A;  5JWQ B;  1FVK A;  5ECM B;  4ECB A;  5CRD A;  4XTS A;  3J7Y k;  5GST A;  2OE0 A;  4HEA 2;  1SL1 B;  1SK2 A;  1UA5 A;  1AW9 A;  1J9B A;  2B3S A;  1SEN A;  2GZY A;  4NMU A;  1XOA A;  1V58 A;  3GIX A;  5DAL A;  1YJ6 A;  5GSS A;  22GS A;  5HFK A;  2TRX A;  3IAM 2;  3TRX A;  2DIY A;  4K9Z A;  4FO5 A;  1PKW A;  1SJZ A;  1PN9 A;  4BVX A;  1TJD A;  3EMP A;  1MDJ A;  1ZZY A;  1QGV A;  1JZD A;  3L9S A;  1XIY A;  3WGE A;  2BTO T;  1GUM A;  1U88 A;  1YKA A;  4MJE A;  1X0R A;  4IP6 A;  5EL8 A;  3ED3 A;  2CA8 A;  2F9S A;  2YOI A;  1N2A A;  2E0Q A;  4GLT A;  1SD8 A;  5G1L A;  1BED A;  1T7P B;  3F3Q A;  3UVT A;  3TJK A;  3H8Q A;  7GSS A;  1CQG A;  3FR6 A;  2VUP A;  1A23 A;  2JSZ A;  4TR1 B;  4QL9 A;  4YKG A;  2H72 A;  5ID2 B;  4EXJ A;  1AUC A;  1TU7 A;  1ZMA A;  3KCM A;  1T1V A;  4KB3 A;  2VM1 A;  2O7K A;  1TTZ A;  3IAS 2;  4YQU A;  1QQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...