1QGVA

Human spliceosomal protein u5-15kd
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
136
structure length
130
Chain Sequence
SYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SPLICEOSOMAL PROTEIN U5-15KD
publication title Identification, characterization and crystal structure analysis of the human spliceosomal U5 snRNP-specific 15 kD protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 130
sequence length 136
ec nomenclature
pdb deposition date 1999-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02966 DIM1 Mitosis protein DIM1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1qgvA00
4WF5A 3A5WA 2YWMA 4F0BA 1G7OA 1MDJA 2RIIA 3GSSA 2H01A 2WS2A 2H1AA 1M9BA 4HQSA 1XVQA 3V1WA 2FY6A 1X9SB 5CYYA 2LQOA 2WULA 3W6GA 1VRSD 2AV4A 2H66A 2C0FA 4OMVA 3SBCA 5G5EA 2DLXA 2JSYA 5DJMA 2IPAA 3KMOA 2H6YA 2RUFA 3TKRA 4EVMA 3FR9A 3KEBA 4IW9A 4KSOA 4RQXA 3P7XA 1JZOA 4PNGA 4O5RA 2AJQB 1TK0B 5HR3A 1BG5A 2FGXA 4K7OA 1S3DA 3GL3A 2I4AA 1MD3A 4XCSA 1T4ZA 2RUEA 1H75A 2HI7A 5ECIB 1GH2A 1GSQA 5IO2A 1OVNA 2GGTA 2YZUA 1PA3A 1GSDA 3ME8A 1VGLA 4MPFA 4WR4A 4OD7A 5IO0A 1QMVA 1GUHA 2I9HA 3GKNA 4N11A 3K8NA 3FYGA 1EWXA 2V6KA 3KJYA 4HI7A 4KX4A 1XBSA 1GSFA 2FCHA 3D5JA 1PQNA 4Q5FA 2HYXA 1K0AA 3CTFA 2FA8A 2PN8A 3L9VA 1QGVA 2IIYA 5JCWA 4K9ZA 1KNGA 3FR6A 2RM5A 3I9V2 3L78A 5D9WA 3TGZA 4ID0A 2FLSA 2PVQA 3CSHA 3H79A 2Z9SA 10GSA 4HZ4A 3HHVA 1C72A 4POMA 1YEXA 5JWRB 1ZCPA 2GSTA 3A2VA 3LORA 3HD5A 1N8JA 4YQMA 3HZ8A 5IMAA 1AXDA 5ECHB 4ZL8A 4EF0A 5IQYA 4KH7A 3FHKA 5F8BA 1GRXA 1SYRA 1LBKA 4GTUA 2DJ2A 1HNAA 4K6XA 2H0GA 2C3TA 2IMKA 5IOWA 1VF1A 3BCKA 2DIZA 2R3XA 4IJIA 3VWWA 2L4QA 2JZTA 2H70A 2MMOA 2MMZA 2O8VB 1M7TA 3KH7A 3ME7A 1XW5A 2LTKA 1FB0A 2I81A 3FW2A 5G5FA 2GZPA 3F8UA 1Z6MA 5DCGA 3KTLA 5HFGA 1W89A 3GKXA 3RHCA 1XXUA 1YQ1A 1AQVA 4IHUA 4MZWA 5CNWA 1GLQA 2VCTA 1OC9B 2GVPA 1AC1A 1QFNA 2R2JA 1ON4A 2HNLA 3QAWA 1SK2A 3FEUA 1YEPA 4NXIA 4K8MA 4MJAA 2JACA 5F06A 3CMIA 2PUKC 5J9CA 1EOHA 1GSEA 2PPTA 1A23A 3D0ZA 2P5RA 1ZZYA 5ECLB 4PXOA 3HYPA 3DRNA 4LL4B 1TI3A 1BX9A 2K6VA 5AN1A 2H6ZA 5ELAA 1R4WA 3KXOA 4YQVA 3QD9A 3P2AA 3HVXA 2JADA 1FVJA 3TKSA 1RQMA 5IMVA 1TKDB 2VAFA 3I69A 3ZYWA 2TRXA 3IR4A 1E6BA 5COHA 3LGCA 3KIJA 1T7PB 1SK1A 1I9DA 2WFCA 4HS1A 2FUG2 4MLYA 5DQYA 4XS1A 3JCML 3BOAA 3TJKA 1DBYA 1TU8A 4NAXA 4PQHA 3J7Yb 2VM2A 3TRQA 4TKYA 2FWHA 2MYGA 5AIXA 2CQ9A 1EGRA 2C0EA 3IDVA 1Z6NA 3WGEA 2L6DA 5AGYA 2LJKA 3KCMA 3F0IA 2KHPA 4MZCA 1K3YA 4TOPA 4ZB8A 3TUEA 1FAAA 5ENUA 2AB6A 4ECCA 4OCEA 2CAQA 2B6MA 3CRUA 3BCIA 2H19A 5ABRA 3IXRA 3US3A 5INYA 3FK8A 2H75A 4TXOB 1J0FA 1XW9A 2I1UA 3W8JA 1E2YA 4J57E 3Q19A 5JCGA 2C8UA 2KP2A 1GSUA 1ML6A 2H72A 1X0RA 2K8VA 2FA4A 3IA1A 4N10A 2X64A 4XRAA 3GH9A 2IN3A 2PU9C 5E59A 3DD3A 4TN8A 4IKHA 2GQMA 4I2TA 4NMUA 4EDYA 4MZBA 4QL9A 3GMFA 2VIMA 4TXOA 4OFNA 1O6JA 2JZRA 3G7YA 4WBJA 3ERGA 3LG6A 5ECNB 3W8SA 1OE8A 1DE1A 3O3TA 5ECKB 3F63A 2G0FA 5IMDA 2O7KA 4IBPA 4NWYA 1XWKA 1B48A 1O81A 3UL3A 3VWUA 2H0IA 4JBBA 4PQ1A 2BJXA 4EE0A 3HDCA 2CAIA 4HJMA 2K8SA 4POBA 1J08A 2LRNA 2K9FA 4PGTA 2EC4A 4ZILA 4EO3A 5ID2B 2IMFA 4MJBA 4RQRA 4WKWA 4O32A 3TKQA 4V2NA 1JLVA 2FD3A 1Y25A 1TRVA 20GSA 3UBKA 5F0GA 9GSSA 4K0NA 1TI1A 4BWSA 4MPGA 2YOIA 1R5AA 3CXGA 4GSNA 3GSTA 3QAGA 4RI6A 4KE3A 5J4UA 3ZITA 3APOA 2AHEA 2B7JA 3EURA 1R7HA 3C71A 5GZZB 2IMIA 1Y6EA 2OA7A 4OFTA 6GSVA 2X8CA 1X9MB 4ZL9A 3HKRA 3C1SA 5EVOA 5CRWA 5ID2A 2CZ3A 3DYRA 3IV4A 2NTOA 4AJ7A 4D73A 3RPPA 2BTOT 1QXHA 2E0QA 4PQIA 3HCZA 4ML1A 3TB2A 2LSTA 3VPTA 1AUCA 5CRGA 3LXZA 3ZL5A 5IOXA 2AUVA 2H1GA 2NDOA 4PUAA 1GTUA 11GSA 1OC3A 1B9XC 3QR6A 3D22A 4GF0A 2HSHA 3Q18A 2KLXA 5DALA 1VF4A 2QSIA 1GSYA 4YQUA 1FOVA 1G7EA 4LMWA 2GS3A 1S3CA 4LL1B 2LUSA 4IJ3A 2IL3A 4XIHA 1FG4A 2YNXA 2VL3A 2CA8A 2OBKA 3MDKA 2VM1A 2YANA 4XRDA 1SL0B 4DSSB 3C7MA 3TOTA 2IFQA 3ZFLA 1USBA 4CDOA 4RI7A 1WJKA 1TDIA 3APQA 4JRRA 1A2LA 3UVTA 1PX6A 1J9BA 1XZOA 4X43A 2VCXA 4TVEA 2WJUA 1M2AA 4V2LA 2LRTA 2VLVA 1DUGA 1R5PA 4G19A 4DSSA 3UARA 1ZGNA 5FHIA 1OC8A 4N0ZA 1HNCA 2XPDA 2J23A 1ERVA 2ZUPA 4TXVA 1FO5A 1EV4A 1CQHA 3FZ9A 5LCZA 2MMAA 5B6NA 2DJJA 4GCIA 1M0UA 4KW6A 4L8EA 5DAKA 5D9VA 2VLTA 2F8FA 2WB9A 3CYNA 1EGOA 4ECJA 1TRUA 3ISOA 3WT2A 4MF7A 2HLSA 3DVXA 4X1UA 5A4VA 3GL5A 1NSWA 4ZXGA 1WWJA 4IP1A 3LJRA 2XPEA 4FIWA 1Z7RA 1SL2B 5G31A 4TR0A 5G1LA 2K18A 2CX4A 3CRTA 2C3QA 4BWQA 2P5QA 4I2UA 1GSSA 7GSSA 1SD9A 1F3AA 1X5CA 3QCPA 4BL7A 4AJ6A 4Q5NA 5DQSA 5DDLA 2N5BA 1WE0A 3ZRDA 5IMZA 4V1Ag 4GQFA 4KDYA 2VL2A 3ZIJA 5C04A 5D9XA 1FHEA 4KNDA 2PERA 2YWIA 3ZVJA 2FWFA 3VFIA 2F8AA 2PWJA 2LEGA 3P8WA 3C8EA 3GURA 1SYXA 3ED3A 2GT6A 2YWOA 2VCQA 2PBJA 3F3QA 4WR5A 2KP1A 3F4TA 2V1MA 1TOFA 3N5OA 1BYEA 4MF6A 3DIEA 5D73A 2O87A 1MDKA 1NW2A 4L5LA 3GRXA 1PGTA 2X8GA 2ALBA 3NZNA 3VK9A 5A4WA 1ST9A 2GT5A 2E2GA 4KDUA 3VI7A 4WEYA 1XWAA 2HRFA 1GTBA 4KCEA 1BQ7A 1EEMA 2DC5A 4NHWA 5EY6A 5KN1A 4HJ2A 3PINA 2JZSA 5L71A 2YCDA 3E0UA 1EOGA 4K7NA 4QL7A 2C4JA 5F07A 1U3AA 5IPHA 2LNSA 3IK7A 3GTUA 4GXZA 2PMTA 4DEJA 5GAND 2GSQA 1V9WA 4DSQA 2B1KA 2MZCA 3ZIVA 1AQWA 3C1RA 4AF2A 3FZAA 2VCZA 3HA9A 2XHFA 2V2GA 3TKSE 4POLA 6GSTA 3ZVJD 3NOFA 3GUSA 3D21A 4F2IA 1K3OA 1K0CA 1Q4JA 2N5FA 2IMDA 3I43A 5JCUA 3IPZA 1PMTA 2FWEA 2YV9A 4AGSA 1N2AA 3BBYA 4WBRD 1M2DA 6GSWA 2VLUA 2MBSA 5H5SA 2A2SA 2HZEA 4J2FA 1OKDA 2DJ1A 4ZBDA 4JR6A 1K0DA 3RAZA 3F3RA 1TXXA 1U87A 4K1FA 1SU9A 4Z7XA 5J3RA 4XTSA 4TR1A 2YJHA 4PUFC 4JZQA 1XCCA 4E8HA 2V32A 2IJYA 3AY8A 1B4QA 3O6TA 3PGTA 1THOA 1ACVA 4ZB9A 1YKCA 1YY7A 1K0MA 2WRTA 4MMMA 3S9FA 1GP1A 2L57A 2P0GA 5LD0A 1V58A 1AIUA 1JLWA 4KA0A 2YV7A 4Q5RA 4TW5A 4FO5A 4NHZA 4WETA 3CSIA 3G7IA 1X5EA 2G2QA 1OKTA 2EIRA 3KP8A 3CTGA 2HT9A 2OKAA 4GQCA 1FB6A 3MNGA 3TRPA 4H86A 3DMLA 4G2EA 2FWGA 3ZREA 3SWLA 3GFKA 2CVDA 1X5DA 2WDUA 4JR4A 4LLRA 4ZB6A 2H0HA 4I5QA 5DBQA 4ECBA 3KD0A 3WGXA 1YZXA 1XVWA 1F37A 2JU5A 3DWVA 2DJ3A 3MSZA 4KCAA 4CHSA 3E3EA 1F9MA 1BEDA 4GLTA 4EDZA 6GSXA 4F0CA 3GKMA 4F9ZA 1A8LA 3M8NA 1XWBA 3WT1A 2HE3A 1G6YA 4JE1A 2CT6A 3DKSA 4PNFA 3VI5A 3ZLPA 4JEDA 3Q6OA 5H5QA 3UAPA 5CRDA 1A24A 4CW9A 1QQ2A 2DMLA 1GWCA 4NPBA 2CVBA 3M3MA 4FYBA 4G9HA 1A0RP 1XFLA 1M9AA 3FY7A 2TRCP 3IAM2 3NIVA 3LFLA 4IN0A 2C3NA 5B8BA 2C0DA 1PN9A 3F6DA 2H74A 4V2MA 1LU4A 3U6VA 3UMAA 5ECOB 4KDXA 2L59A 3LQ7A 1JFUA 1V2AA 2X8HA 5J5NA 2AYTA 2V41A 4BA7A 1U6TA 1TK8B 2GLRA 2AAWA 4QQ7A 1O8XA 1RK4A 2N5AA 2NBSA 2GSRA 4D73B 5JWOB 5ECQB 2HFDA 4WXTA 1UA5A 2R5GA 1SKSB 5HR1A 1MDIA 1EV9A 3TJGA 5KN2A 2L5OA 3EVIA 3HY2A 2GDRA 1R26A 4NV2A 2DIYA 4XS4A 2VCVA 1NM3A 3LYKA 14GSA 4MF5A 4X0XA 5B7CA 2YN1A 3ERFA 4JU5A 5KN0A 5DALB 4KSMA 5FT3A 3LYPA 4ZBAA 3LSZA 2GQLA 2KUCA 1Z7PA 1A2MA 1UN2A 4MJCA 4DSRA 3DGQA 1EP8A 1K3LA 2H71A 4O7HA 3PR8A 5A5KA 2FNOA 4KAEA 5D8IA 2D2ZA 3GV1A 1SKWB 1DSBA 5F05A 2IFQB 2VO4A 2VUPA 12GSA 1JZDA 3QPMA 2OADA 3N9JA 1XIYA 3H1NA 1VF2A 3F9UA 1EP7A 2CVKA 1ZYQB 2EIQA 3QFBC 3WYWA 1A8YA 1XOBA 3IOSA 3FR3A 3FZ5A 3IC4A 1SK0A 1T8EB 3H4KA 3EMXA 2CX3A 2M46A 4IELA 1BAYA 3MWHA 1TP9A 4E8EA 2YJ7A 5J9BA 3J7Yk 2H76A 2XBQA 2MMNA 1I5GA 3EINA 1Z5YE 3TOUA 1PKWA 1PRXA 2VD1A 3L9SA 1T3BA 1MEKA 1ERUA 4HZ2A 2IWTA 3KTBA 4IQAA 4YH2A 5DAKB 1AW9A 5EL8A 1XWGA 2B1LA 19GSA 2B5EA 1SENA 1WRYA 2O85A 3HVSA 1U3IA 4L0WA 3CBUA 2EIOA 2NPBA 1ZL9A 1W4VA 2XBIA 3TKPA 5H5RA 4MK3A 3M0FA 1KEBA 4G10A 1GTIA 2RM6A 4MH2A 1NHOA 3FZ4A 5HQPA 2HSYA 4HU7A 3TKSC 8GSSA 5J41A 1B9YC 3F6FA 3EU3A 4GSTA 1Q98A 2CZ2A 5HFKA 5ECPB 1T4YA 1YF1A 4KUNA 1LJRA 1AQXA 2F51A 2GZZA 4MA9A 4ILFA 1B8XA 1HYUA 3HXSA 2LNTA 3GHAA 4K7IA 22GSA 4MH3A 4FYUA 3KP9A 4GSSA 2M80A 3Q74A 3D6IA 3I6AA 3WGDA 4XHMA 3GX0A 3VLNA 4OFMA 3IBHA 1OAZA 3EYTA 5CO3A 1TTZA 3HVVA 3VWXA 2B5XA 2I3YA 1GUMA 4POKA 5DVBA 2B5YA 2E2MA 1O73A 2OE0A 3EMPA 5IM9A 1PL2A 5A4UA 1Z3EA 5HR2A 3EC3A 1NHYA 2QKEA 1UC7A 3KM6A 1TU7A 2O89A 1XW6A 2V6OA 1QUWA 2ZNMA 4GRFA 2QC7A 2TIRA 3IAS2 5G30A 2GQKA 4YAVA 4OO5A 3PH9A 1HNBA 3L9UA 1THXA 4MCUA 3GNJA 2LJAA 3GYKA 3D4MA 2WCIA 1CQGA 4L0UA 2LKUA 2VL9A 3VURA 1FVKA 3QFAC 5B6MA 3LWAA 3DVWA 5GSTA 3EE2A 1X9WB 2PVOC 4EL1A 3O76A 1YJ6A 1K0OA 1GTAA 3VPQA 16GSA 2ON7A 1O85A 2H8LA 1GL8A 5D93A 3GTUB 3A2XA 3R2QA 4PX1A 3UBLA 2C1YA 2GZYA 1KBNA 1ABAA 2R4VA 4XS6A 6GSSA 5IIZA 3EWLA 5IMFA 2DMMA 1A0FA 3KGKA 2VD0A 3LEFA 1PD21 1H4OA 4MJEA 17GSA 1WIKA 2L6CA 4RUVA 4ECIA 2B3SA 2A4VA 3UVHA 2MBTA 4I97A 3F4RA 1XOAA 3OR5A 4IP6A 3FKFA 4LMVA 3U5RE 3HJOA 4GWRA 2HZEB 1F6MC 3M1GA 1G0TA 4FYCA 3TCOA 3FRCA 4OWYA 3TJFA 3IE3A 4HDEA 2DBCA 4ACSA 5G2ZA 3A3TA 4TR1B 3APSA 2E7PA 1GUKA 3C73A 4EC0A 1IYHA 1TRWA 3M9KA 5ECSA 2NVLA 5DCHA 3BD2A 4IVFA 1TRSA 1YKAA 2GTUA 4P3YB 1SKRB 1MTCA 2LS5A 3E9JB 2OE3A 1SJIA 1B4PA 3HJMA 2H1BA 1OC9A 5IPGA 1JHBA 3KZQA 2ES7A 4I8BA 2RLIA 4HEA2 2M72A 4Q5QA 2R37A 1PX7A 2KOKA 5ELGA 1GULA 1A2JA 5CP1A 1HD2A 1O7UA 4OO4A 1YDKA 2WZ9A 1HQOA 1RW1A 3QMXA 2WGRA 4YAPA 1WPIA 1SL1B 4BVYA 4K2DA 1T1VA 5GSSA 2H6XA 1ZMAA 4FH8A 13GSA 2X99A 1PKZA 2PGTA 2HZFA 4MDCA 4L5OA 5FWGA 4F03A 2C0GA 3ZZXA 2OBIA 4TR4A 5DJLA 3UEMA 5ECRB 5LNKe 4TRXA 4IS0A 3UJ1A 1FW1A 1WP0A 1F3BA 1O8WA 1SD8A 4ULXA 4ZL7A 2P31A 1VF3A 5D9TA 3KMNA 1OYJA 2LV3A 3RDWA 5B8AA 2XC2A 4O92A 5EPFA 2HXKA 5AISA 1ERWA 1TK5B 2JL4A 1DE2A 1PSQA 4EUYA 3M9JA 1AAZA 3CSJA 1URMA 3TDGA 1T00A 2CV4A 4ZIJA 3HJPA 4K0GA 6GSYA 5KEJA 4N0VA 3GA4A 1G6WA 1GLPA 1EZKA 4KB3A 1WMJA 4AJ8A 3TRXA 2IMEA 2LJRA 1K0NA 3IK9A 5C00A 1TW9A 3A2WA 3G7JA 3GN3A 3KH9A 5CRHA 2H73A 2LRCA 2L5LA 5ECMB 3H8QA 1QK8A 1K0BA 4NV5A 4F82A 6GSUA 2YP6A 3BJ5A 3IHQA 5E4WA 5G1KA 2YPMA 4J56E 4XS4B 2JSZA 1Z9HA 4OCFA 3ZFBA 2L4CA 5KN3A 3DEXA 2LQQA 3P90A 4I6XA 2VCWA 2OACA 2QGVA 4TR3A 4ML6A 2B7KA 1S3AA 1EEJA 2R6KA 2DSAA 2ON5A 1OE7A 1M99A 1ZOFA 1ILOA 1WOUA 3VWVA 1UVZA 3GX8A 5IMCA 2REMA 4BVXA 4IQ1A 1IYIA 5CAXA 1JZWA 1MD4A 2YWNA 4LA1A 3ZTLA 4V1Ap 1ZYEA 1M2BA 3ERWA 3WD6A 2OJLA 1F2EA 1TJDA 1V98A 18GSA 1PL1A 5HFIA 4MP4A 4HQZA 4DVCA 3LXTA 3L0HA 1SJ6A 1GNWA 3G9BA 3HZ4A 3EU4A 2J9HA 2A2RA 4EKZA 2VL2C 1XWCA 1JZRA 4HOJA 4HU9A 2F9SA 3GKKA 3QOUA 3GIXA 2FHEA 3QAVA 5AIVA 3RPNA 2H1DA 4EXJA 2VOCA 1U88A 3RBTA 1ERTA 2OE1A 2HRNA 3UIWA 2GSSA 1V57A 5CREA 1YF0A 3RHBA 5HR0A 3H93A 3IRAA 2DJ0A 4N30A 2DJKA 2BMXA 4HUAA 3GH6A 2C80A 5GAPD 4IGJA 1XPVA 4ZBBA 3MAKA 4ISDA 4PURA 3UOMA 4BPYA 4WF4A 2F3MA 3TJJA 2ZCTA 3D4TA 3ZMLA 3ZMKA 3F4SA 1SJZA 1BJXA 2H30A 2YZHA 3QDNA 5D96A 3DXBA 3L4NA 4KGIA 1V40A 4MABA 1GNEA 3TJBA 5JWQB 1KTEA
chains in the Genus database with same CATH superfamily
4WF5A 3A5WA 2YWMA 4F0BA 1G7OA 1MDJA 2RIIA 3GSSA 2H01A 2WS2A 2H1AA 1M9BA 4HQSA 1XVQA 3V1WA 2FY6A 1X9SB 2X4AA 5CYYA 2LQOA 2WULA 3W6GA 1VRSD 2AV4A 2H66A 2C0FA 4OMVA 3SBCA 5G5EA 2DLXA 2JSYA 5DJMA 2IPAA 3KMOA 2H6YA 2RUFA 3TKRA 4EVMA 3FR9A 3KEBA 4IW9A 4KSOA 4RQXA 3P7XA 1JZOA 4Z2UA 4PNGA 4O5RA 2AJQB 1TK0B 5HR3A 1BG5A 2FGXA 4K7OA 1S3DA 3GL3A 2I4AA 1MD3A 4XCSA 1T4ZA 2RUEA 1H75A 2HI7A 5ECIB 1GH2A 1GSQA 5IO2A 1OVNA 2GGTA 2YZUA 1PA3A 1GSDA 3ME8A 1VGLA 4MPFA 4WR4A 4OD7A 5IO0A 1QMVA 1GUHA 2I9HA 3GKNA 4N11A 1M3IA 3K8NA 3FYGA 1EWXA 2V6KA 3KJYA 4HI7A 4KX4A 1XBSA 1GSFA 2FCHA 3D5JA 1PQNA 4Q5FA 2HYXA 1K0AA 3CTFA 2FA8A 2PN8A 3L9VA 1QGVA 2IIYA 5JCWA 4K9ZA 4Z2TA 1KNGA 3FR6A 2RM5A 3I9V2 3L78A 5D9WA 3TGZA 4ID0A 2FLSA 2PVQA 3CSHA 3H79A 2Z9SA 10GSA 4HZ4A 3HHVA 1C72A 4POMA 1YEXA 3PPUA 5JWRB 1ZCPA 2GSTA 3A2VA 3LORA 3HD5A 1N8JA 4YQMA 3HZ8A 5IMAA 1AXDA 5ECHB 4ZL8A 4EF0A 5IQYA 4KH7A 3FHKA 5F8BA 1GRXA 1SYRA 1LBKA 4GTUA 2DJ2A 1HNAA 4K6XA 2H0GA 2C3TA 2IMKA 5IOWA 1VF1A 3BCKA 2DIZA 2R3XA 4IJIA 3VWWA 2L4QA 2JZTA 2H70A 2MMOA 2MMZA 2O8VB 1M7TA 3KH7A 3ME7A 1XW5A 2LTKA 1FB0A 2I81A 1FOHA 4YKFA 3FW2A 5G5FA 2GZPA 3F8UA 1Z6MA 5DCGA 3KTLA 5HFGA 1W89A 3GKXA 3RHCA 1XXUA 4ICYA 1YQ1A 1AQVA 4IHUA 4MZWA 5CNWA 1GLQA 2VCTA 1OC9B 2GVPA 1AC1A 1QFNA 2R2JA 1ON4A 2HNLA 3QAWA 1SK2A 3FEUA 1YEPA 4NXIA 4K8MA 4MJAA 2JACA 5F06A 3CMIA 2PUKC 5J9CA 1EOHA 1GSEA 2PPTA 1A23A 3D0ZA 2P5RA 1ZZYA 5ECLB 4BVYB 4PXOA 3HYPA 4G0IA 3DRNA 4LL4B 1TI3A 1BX9A 2K6VA 5AN1A 2H6ZA 5ELAA 1R4WA 3KXOA 4YQVA 3QD9A 3P2AA 3HVXA 2JADA 1FVJA 3TKSA 1RQMA 5IMVA 1TKDB 2VAFA 3I69A 3ZYWA 2TRXA 3IR4A 1E6BA 5COHA 3LGCA 3KIJA 1T7PB 1SK1A 1I9DA 2WFCA 4HS1A 2FUG2 4MLYA 5DQYA 4XS1A 3JCML 3BOAA 3TJKA 2QA1A 1DBYA 1TU8A 4NAXA 4PQHA 3J7Yb 2VM2A 3TRQA 4TKYA 2FWHA 2MYGA 5AIXA 2CQ9A 1EGRA 2C0EA 3IDVA 3MIXA 1Z6NA 3WGEA 2L6DA 5AGYA 2LJKA 3KCMA 3F0IA 2KHPA 4MZCA 1K3YA 4TOPA 4ZB8A 3TUEA 1FAAA 2AB6A 5ENUA 4ECCA 4OCEA 2CAQA 2B6MA 3CRUA 3BCIA 2H19A 5ABRA 3IXRA 3US3A 5INYA 3FK8A 2H75A 4TXOB 1J0FA 1XW9A 2I1UA 3W8JA 1E2YA 4USSA 4J57E 3Q19A 5JCGA 5KOWA 2C8UA 2KP2A 1GSUA 4A5PA 1ML6A 2H72A 1X0RA 2K8VA 2FA4A 3IA1A 2UZ8A 4N10A 2X64A 4XRAA 3GH9A 3EPTA 2IN3A 2PU9C 5E59A 3DD3A 4TN8A 4IKHA 2GQMA 4I2TA 4NMUA 4EDYA 4MZBA 4QL9A 3GMFA 2VIMA 4TXOA 4OFNA 3IC8A 1O6JA 2JZRA 3G7YA 4WBJA 5BRTA 3ERGA 3LG6A 5ECNB 4BVXB 3W8SA 1OE8A 1DE1A 3MYDA 3O3TA 5ECKB 3F63A 2G0FA 5IMDA 2O7KA 4IBPA 1ZYNA 4NWYA 1XWKA 1B48A 1O81A 4CY8A 3UL3A 3VWUA 2H0IA 4JBBA 4PQ1A 5BMUA 2BJXA 4EE0A 3HDCA 2CAIA 4HJMA 2K8SA 4POBA 1J08A 2LRNA 2K9FA 4PGTA 2EC4A 4ZILA 4EO3A 5ID2B 2IMFA 4MJBA 4RQRA 4WKWA 4O32A 3TKQA 4V2NA 1JLVA 2FD3A 1Y25A 1TRVA 20GSA 3UBKA 5F0GA 9GSSA 4K0NA 1TI1A 4BWSA 4MPGA 2YOIA 1R5AA 3CXGA 4GSNA 3GSTA 3QAGA 4RI6A 4KE3A 5J4UA 3ZITA 3APOA 2AHEA 2B7JA 3EURA 1R7HA 3C71A 5GZZB 2IMIA 1Y6EA 2OA7A 4OFTA 2R0PA 6GSVA 2X8CA 1X9MB 4ZL9A 3HKRA 3C1SA 5EVOA 5CRWA 5ID2A 2CZ3A 3FMWA 3DYRA 3IV4A 2NTOA 4AJ7A 4D73A 3RPPA 2BTOT 1QXHA 2E0QA 4PQIA 3HCZA 4ML1A 3TB2A 2LSTA 3VPTA 1AUCA 5CRGA 3LXZA 3ZL5A 5IOXA 2AUVA 2H1GA 2NDOA 4PUAA 1GTUA 11GSA 1OC3A 1B9XC 3QR6A 3D22A 4GF0A 2HSHA 3Q18A 2KLXA 5DALA 1VF4A 2QSIA 1GSYA 4YQUA 1FOVA 1G7EA 4LMWA 3A5IA 2GS3A 1S3CA 4LL1B 2LUSA 4IJ3A 2IL3A 4XIHA 1FG4A 2YNXA 2VL3A 2CA8A 2OBKA 3MDKA 2VM1A 2YANA 4XRDA 1SL0B 4DSSB 3C7MA 3TOTA 2IFQA 3ZFLA 1USBA 4CDOA 4RI7A 1WJKA 1TDIA 3APQA 4JRRA 1A2LA 3UVTA 1PX6A 1J9BA 1XZOA 4X43A 2VCXA 4TVEA 2WJUA 1M2AA 4V2LA 2LRTA 2VLVA 1DUGA 1R5PA 4G19A 4DSSA 3UARA 1ZGNA 5FHIA 1OC8A 4N0ZA 1HNCA 2XPDA 2J23A 1ERVA 2ZUPA 4TXVA 1FO5A 1EV4A 1CQHA 3FZ9A 4HSCX 5LCZA 2MMAA 5B6NA 2DJJA 4GCIA 1M0UA 4KW6A 4L8EA 5DAKA 5D9VA 2VLTA 2F8FA 2WB9A 3CYNA 1EGOA 4ECJA 1TRUA 3ISOA 3WT2A 4MF7A 2HLSA 3DVXA 4X1UA 4BL7B 5A4VA 3GL5A 1NSWA 4ZXGA 1WWJA 4IP1A 3LJRA 2XPEA 4FIWA 1Z7RA 1SL2B 5G31A 4TR0A 5G1LA 2K18A 2CX4A 3CRTA 2C3QA 4BWQA 2P5QA 4I2UA 1GSSA 7GSSA 1SD9A 1F3AA 1X5CA 3QCPA 4BL7A 4AJ6A 4Q5NA 5DQSA 5DDLA 2N5BA 1WE0A 3ZRDA 5IMZA 4V1Ag 4GQFA 4KDYA 2VL2A 3ZIJA 5C04A 5D9XA 1FHEA 1PN0A 4KNDA 2PERA 2YWIA 3ZVJA 2FWFA 3VFIA 2F8AA 2PWJA 2LEGA 3P8WA 3C8EA 3GURA 1SYXA 3ED3A 2GT6A 2YWOA 2VCQA 2PBJA 3F3QA 4WR5A 2KP1A 3F4TA 2V1MA 1TOFA 3N5OA 1BYEA 4MF6A 2DKIA 3DIEA 5D73A 2O87A 1MDKA 1NW2A 4L5LA 3GRXA 1PGTA 2X8GA 2ALBA 3NZNA 3VK9A 5A4WA 1ST9A 2GT5A 2E2GA 4KDUA 2DKHA 3VI7A 4WEYA 1XWAA 2HRFA 1GTBA 4KCEA 1BQ7A 1EEMA 2DC5A 4NHWA 5EY6A 5KN1A 4HJ2A 3PINA 2JZSA 5L71A 2YCDA 3E0UA 1EOGA 4K7NA 4QL7A 2C4JA 5F07A 1U3AA 5IPHA 2LNSA 3IK7A 3GTUA 4GXZA 2PMTA 4DEJA 5GAND 2GSQA 1V9WA 4DSQA 2B1KA 2MZCA 3ZIVA 1AQWA 3C1RA 4AF2A 3FZAA 5KOXA 2VCZA 3HA9A 2XHFA 2V2GA 3TKSE 4POLA 6GSTA 3ZVJD 4KF9A 3NOFA 3GUSA 3D21A 4F2IA 1K3OA 1K0CA 1Q4JA 2N5FA 2IMDA 3I43A 5JCUA 3IPZA 1PMTA 2FWEA 2YV9A 4AGSA 1N2AA 3BBYA 4WBRD 1M2DA 6GSWA 2VLUA 2MBSA 5H5SA 2A2SA 2HZEA 4J2FA 1OKDA 2DJ1A 4ZBDA 4JR6A 1K0DA 3RAZA 3F3RA 1TXXA 1U87A 4K1FA 1SU9A 4Z7XA 4MNNA 5J3RA 4XTSA 4TR1A 2YJHA 4PUFC 4JZQA 1XCCA 4E8HA 2V32A 2IJYA 3AY8A 1B4QA 3O6TA 3PGTA 1THOA 1ACVA 4ZB9A 1YKCA 1M3JA 1YY7A 1K0MA 2WRTA 4K2XA 4MMMA 3S9FA 1GP1A 2L57A 2P0GA 5LD0A 1V58A 1AIUA 1JLWA 4KA0A 2YV7A 4Q5RA 4TW5A 4FO5A 4NHZA 4WETA 3CSIA 3G7IA 4Z2RA 1X5EA 2G2QA 4K5SA 4K5RA 1OKTA 2EIRA 3KP8A 3CTGA 2HT9A 2OKAA 4GQCA 1FB6A 3MNGA 3TRPA 4H86A 3DMLA 4G2EA 2FWGA 3ZREA 3SWLA 3GFKA 2CVDA 1X5DA 2WDUA 4JR4A 4LLRA 4ZB6A 2H0HA 4I5QA 5DBQA 4ECBA 3KD0A 3WGXA 1YZXA 1XVWA 1F37A 2JU5A 3DWVA 2DJ3A 3MSZA 4KCAA 4CHSA 3E3EA 1F9MA 1BEDA 4GLTA 4EDZA 6GSXA 4F0CA 3GKMA 4F9ZA 1A8LA 3M8NA 1XWBA 3WT1A 2HE3A 1G6YA 4JE1A 2CT6A 3DKSA 4PNFA 3VI5A 4FQUA 3ZLPA 4JEDA 3Q6OA 5H5QA 3UAPA 5CRDA 1A24A 4CW9A 1QQ2A 2DMLA 1GWCA 4NPBA 2CVBA 3M3MA 4FYBA 4G9HA 1A0RP 1XFLA 1M9AA 3FY7A 2TRCP 3IAM2 3NIVA 3LFLA 4IN0A 2C3NA 5B8BA 2C0DA 1PN9A 3F6DA 2H74A 4V2MA 1LU4A 3U6VA 3UMAA 5ECOB 2A2PA 2L59A 4KDXA 3LQ7A 2R0CA 1JFUA 1V2AA 2X8HA 5J5NA 2AYTA 2V41A 4BA7A 1U6TA 1TK8B 2GLRA 2AAWA 4QQ7A 1O8XA 1RK4A 2N5AA 2NBSA 2GSRA 4D73B 5JWOB 5ECQB 2HFDA 4WXTA 1UA5A 2R5GA 1SKSB 5HR1A 1MDIA 1EV9A 3TJGA 5KN2A 2L5OA 3EVIA 3HY2A 2GDRA 1R26A 2HSMA 4NV2A 2DIYA 4XS4A 2VCVA 1NM3A 3LYKA 14GSA 4MF5A 4X0XA 5B7CA 2YN1A 3ERFA 4JU5A 5KN0A 5DALB 4KSMA 5FT3A 3LYPA 4ZBAA 3LSZA 2GQLA 2KUCA 1Z7PA 1A2MA 1UN2A 4MJCA 4DSRA 3DGQA 1EP8A 1K3LA 2H71A 4O7HA 3PR8A 5A5KA 2FNOA 4KAEA 5D8IA 2D2ZA 3GV1A 1SKWB 1DSBA 5F05A 2IFQB 2VO4A 2VUPA 12GSA 1JZDA 3QPMA 2OADA 3N9JA 1XIYA 3H1NA 1VF2A 3F9UA 1EP7A 4X4JA 2CVKA 1ZYQB 2EIQA 3QFBC 3WYWA 1A8YA 1XOBA 3IOSA 3FR3A 3FZ5A 3IC4A 1SK0A 1T8EB 3H4KA 3EMXA 2CX3A 2M46A 4IELA 1BAYA 3MWHA 1TP9A 4E8EA 2YJ7A 5J9BA 3J7Yk 2H76A 2XBQA 2MMNA 1I5GA 3EINA 1Z5YE 3TOUA 1PKWA 1PRXA 2VD1A 3L9SA 1T3BA 1MEKA 1ERUA 4HZ2A 2IWTA 3KTBA 4IQAA 4YH2A 5DAKB 1AW9A 5EL8A 1XWGA 2B1LA 19GSA 2B5EA 1SENA 1WRYA 2O85A 3HVSA 1U3IA 4L0WA 3CBUA 2EIOA 2NPBA 1ZL9A 1W4VA 1ZYPA 2XBIA 3TKPA 5H5RA 4MK3A 3M0FA 1KEBA 4G10A 1GTIA 2RM6A 4MH2A 1NHOA 3FZ4A 5HQPA 2HSYA 4HU7A 3TKSC 8GSSA 5J41A 1B9YC 3F6FA 3EU3A 4GSTA 1Q98A 2CZ2A 5HFKA 5ECPB 1T4YA 1YF1A 4KUNA 1LJRA 1AQXA 2F51A 2GZZA 4MA9A 4ILFA 1B8XA 1HYUA 4CY6A 3HXSA 2LNTA 3GHAA 4K7IA 22GSA 4O5QA 4MH3A 4FYUA 3KP9A 4GSSA 2M80A 3Q74A 3D6IA 3I6AA 3WGDA 4XHMA 3GX0A 3VLNA 4G0LA 4OFMA 3IBHA 1OAZA 3EYTA 5CO3A 1TTZA 3HVVA 3VWXA 3IHGA 2B5XA 2I3YA 1GUMA 4POKA 5DVBA 2B5YA 2E2MA 1O73A 2OE0A 3EMPA 5IM9A 1PL2A 5A4UA 1Z3EA 5HR2A 3EC3A 1NHYA 2QKEA 1UC7A 3KM6A 1TU7A 2O89A 1XW6A 2V6OA 1QUWA 2ZNMA 4GRFA 2QC7A 2TIRA 3IAS2 5G30A 2GQKA 4YAVA 4OO5A 3PH9A 1HNBA 3L9UA 1THXA 4MCUA 3GNJA 2LJAA 3GYKA 3D4MA 2WCIA 1CQGA 4L0UA 2LKUA 2VL9A 3VURA 1FVKA 3QFAC 5B6MA 3LWAA 3DVWA 5GSTA 3EE2A 1X9WB 2PVOC 4EL1A 3O76A 1YJ6A 1K0OA 1GTAA 3VPQA 16GSA 2ON7A 1O85A 2H8LA 1GL8A 5D93A 3GTUB 3CQFA 3A2XA 3R2QA 4PX1A 3UBLA 2C1YA 2GZYA 2X49A 1KBNA 1ABAA 2R4VA 4XS6A 6GSSA 5IIZA 3EWLA 5IMFA 2DMMA 1A0FA 3KGKA 2VD0A 3LEFA 1PD21 1H4OA 4MJEA 17GSA 1WIKA 2L6CA 4RUVA 4ECIA 2B3SA 2A4VA 3UVHA 2MBTA 4I97A 3F4RA 1XOAA 3OR5A 4IP6A 3FKFA 4LMVA 3U5RE 3HJOA 4GWRA 2HZEB 1F6MC 3M1GA 1G0TA 4FYCA 3TCOA 3FRCA 4OWYA 3TJFA 3LW9A 3IE3A 4HDEA 2DBCA 4ACSA 5G2ZA 3A3TA 4TR1B 3APSA 2E7PA 1GUKA 3C73A 4EC0A 1IYHA 1TRWA 3M9KA 5ECSA 2NVLA 5DCHA 3BD2A 4IVFA 1TRSA 1YKAA 2GTUA 4P3YB 1SKRB 1MTCA 2LS5A 3E9JB 2A4HA 2OE3A 1SJIA 1B4PA 3HJMA 2H1BA 1OC9A 5IPGA 1JHBA 3KZQA 2ES7A 4I8BA 2RLIA 4HEA2 2M72A 4Q5QA 2R37A 1PX7A 2QA2A 2KOKA 4G0KA 5ELGA 1GULA 1A2JA 5CP1A 1HD2A 1O7UA 4OO4A 1YDKA 2WZ9A 1HQOA 1RW1A 3QMXA 2WGRA 4YAPA 1WPIA 1SL1B 4BVYA 4K2DA 1T1VA 5GSSA 2H6XA 1ZMAA 4FH8A 13GSA 2X99A 1PKZA 2PGTA 4PTSA 2HRKA 2HZFA 4MDCA 4L5OA 5FWGA 4F03A 2C0GA 3ZZXA 2OBIA 4TR4A 5DJLA 3UEMA 5ECRB 5LNKe 4TRXA 4IS0A 3UJ1A 1FW1A 1WP0A 1F3BA 1O8WA 1SD8A 4ULXA 4ZL7A 2P31A 4EIQA 1VF3A 5D9TA 3KMNA 1OYJA 2LV3A 3RDWA 5B8AA 2XC2A 4O92A 5EPFA 2HXKA 5AISA 1ERWA 1TK5B 2JL4A 1DE2A 1PSQA 4EUYA 3M9JA 1AAZA 3CSJA 1URMA 3TDGA 1T00A 2CV4A 4ZIJA 3HJPA 4K0GA 6GSYA 5KEJA 4N0VA 3GA4A 1G6WA 1GLPA 1EZKA 4KB3A 1WMJA 4AJ8A 3TRXA 2IMEA 2LJRA 1K0NA 3IK9A 5C00A 1TW9A 3A2WA 3G7JA 3GN3A 3R3EA 3KH9A 5CRHA 2H73A 2LRCA 1S3RA 2L5LA 5ECMB 3H8QA 1QK8A 1K0BA 4NV5A 4F82A 6GSUA 2YP6A 3BJ5A 3IHQA 5E4WA 5G1KA 2YPMA 4J56E 4XS4B 2JSZA 1Z9HA 4OCFA 3ZFBA 2L4CA 5KN3A 3DEXA 2LQQA 3P90A 4I6XA 2R0GA 2VCWA 2OACA 2QGVA 4TR3A 4ML6A 2B7KA 1S3AA 1EEJA 2R6KA 2DSAA 2HRAA 2ON5A 1OE7A 1M99A 1ZOFA 1ILOA 1WOUA 3VWVA 1UVZA 3GX8A 5IMCA 2REMA 4BVXA 4IQ1A 1IYIA 5CAXA 1JZWA 1MD4A 2YWNA 4LA1A 3ZTLA 4V1Ap 1ZYEA 1M2BA 3ERWA 3WD6A 2OJLA 1F2EA 4EIPA 1TJDA 1V98A 18GSA 1PL1A 3HVNA 5HFIA 4MP4A 4HQZA 4DVCA 3LXTA 3L0HA 1SJ6A 1GNWA 3G9BA 3HZ4A 3EU4A 2J9HA 2A2RA 4EKZA 2VL2C 1XWCA 1JZRA 4HOJA 4HU9A 2F9SA 3GKKA 3QOUA 3GIXA 2FHEA 3QAVA 5AIVA 3RPNA 2H1DA 1PFOA 4EXJA 2VOCA 1U88A 3RBTA 1ERTA 4YKGA 2OE1A 2HRNA 3UIWA 2GSSA 1V57A 5CREA 1YF0A 3RHBA 5HR0A 3H93A 3IRAA 2DJ0A 4BIKA 4N30A 2DJKA 2BMXA 4HUAA 3GH6A 2C80A 5GAPD 4IGJA 1XPVA 4ZBBA 3MAKA 4ISDA 4PURA 3UOMA 4BPYA 4WF4A 1XG8A 2F3MA 3TJJA 2ZCTA 3D4TA 3ZMLA 4O5UA 3ZMKA 3F4SA 1SJZA 1BJXA 2H30A 2YZHA 3QDNA 5D96A 3DXBA 3L4NA 4KGIA 1V40A 4MABA 1GNEA 3TJBA 5JWQB 1KTEA
chains in the Genus database with same CATH topology
4WF5A 3A5WA 2YWMA 4F0BA 1G7OA 1MDJA 2RIIA 3GSSA 2H01A 2WS2A 2H1AA 1M9BA 4HQSA 1XVQA 3V1WA 2FY6A 1X9SB 2X4AA 5CYYA 2LQOA 2WULA 3W6GA 1VRSD 2AV4A 2H66A 2C0FA 4OMVA 3SBCA 5G5EA 2DLXA 2JSYA 5DJMA 2IPAA 3KMOA 2H6YA 2RUFA 3TKRA 4EVMA 3FR9A 3KEBA 4IW9A 4KSOA 4RQXA 3P7XA 1JZOA 4Z2UA 4PNGA 4O5RA 2AJQB 1TK0B 5HR3A 1BG5A 2FGXA 4K7OA 1S3DA 3GL3A 2I4AA 1MD3A 4XCSA 1T4ZA 2RUEA 1H75A 2HI7A 5ECIB 1GH2A 1GSQA 5IO2A 1OVNA 2GGTA 2YZUA 1PA3A 1GSDA 3ME8A 1VGLA 4MPFA 4WR4A 4OD7A 5IO0A 1QMVA 1GUHA 2I9HA 3GKNA 4N11A 3K8NA 3FYGA 1EWXA 2V6KA 3KJYA 4HI7A 4KX4A 1XBSA 1GSFA 2FCHA 3D5JA 1PQNA 4Q5FA 2HYXA 1K0AA 3CTFA 2FA8A 2PN8A 3L9VA 1QGVA 2IIYA 5JCWA 4K9ZA 4Z2TA 1KNGA 3FR6A 2RM5A 3I9V2 3L78A 5D9WA 3TGZA 4ID0A 2FLSA 2PVQA 3CSHA 3H79A 2Z9SA 10GSA 4HZ4A 3HHVA 1C72A 4POMA 1YEXA 3PPUA 5JWRB 1ZCPA 2GSTA 3A2VA 3LORA 3HD5A 1N8JA 4YQMA 3HZ8A 5IMAA 1AXDA 5ECHB 4ZL8A 4EF0A 5IQYA 4KH7A 3FHKA 5F8BA 1GRXA 1SYRA 1LBKA 4GTUA 2DJ2A 1HNAA 4K6XA 2H0GA 2C3TA 2IMKA 5IOWA 1VF1A 3BCKA 2DIZA 2R3XA 4IJIA 3VWWA 2L4QA 2JZTA 2H70A 2MMOA 2MMZA 2O8VB 1M7TA 3KH7A 3ME7A 1XW5A 2LTKA 1FB0A 2I81A 1FOHA 4YKFA 3FW2A 5G5FA 2GZPA 3F8UA 1Z6MA 5DCGA 3KTLA 5HFGA 1W89A 3GKXA 3RHCA 1XXUA 4ICYA 1YQ1A 1AQVA 4IHUA 4MZWA 5CNWA 1GLQA 2VCTA 1OC9B 2GVPA 1AC1A 1QFNA 2R2JA 1ON4A 2HNLA 3QAWA 1SK2A 3FEUA 1YEPA 4NXIA 4K8MA 4MJAA 2JACA 5F06A 3CMIA 2PUKC 5J9CA 1EOHA 1GSEA 2PPTA 1A23A 3D0ZA 2P5RA 1ZZYA 5ECLB 4BVYB 4PXOA 3HYPA 4G0IA 3DRNA 4LL4B 1TI3A 1BX9A 2K6VA 5AN1A 2H6ZA 5ELAA 1R4WA 3KXOA 4YQVA 3QD9A 3P2AA 3HVXA 2JADA 1FVJA 3TKSA 1RQMA 5IMVA 1TKDB 2VAFA 3I69A 3ZYWA 2TRXA 3IR4A 1E6BA 5COHA 3LGCA 3KIJA 1T7PB 1SK1A 1I9DA 2WFCA 4HS1A 2FUG2 4MLYA 5DQYA 4XS1A 3JCML 3BOAA 3TJKA 2QA1A 1DBYA 1TU8A 4NAXA 4PQHA 3J7Yb 2VM2A 3TRQA 4TKYA 2FWHA 2MYGA 5AIXA 2CQ9A 1EGRA 2C0EA 3IDVA 3MIXA 1Z6NA 3WGEA 2L6DA 5AGYA 2LJKA 3KCMA 3F0IA 2KHPA 4MZCA 1K3YA 4TOPA 4ZB8A 3TUEA 1FAAA 2AB6A 5ENUA 4ECCA 4OCEA 2CAQA 2B6MA 3CRUA 3BCIA 2H19A 5ABRA 3IXRA 3US3A 5INYA 3FK8A 2H75A 4TXOB 1J0FA 1XW9A 2I1UA 3W8JA 1E2YA 4USSA 4J57E 3Q19A 5JCGA 5KOWA 2C8UA 2KP2A 1GSUA 4A5PA 1ML6A 2H72A 1X0RA 2K8VA 2FA4A 3IA1A 2UZ8A 4N10A 2X64A 4XRAA 3GH9A 3EPTA 2IN3A 2PU9C 5E59A 3DD3A 4TN8A 4IKHA 2GQMA 4I2TA 4NMUA 4EDYA 4MZBA 4QL9A 3GMFA 2VIMA 4TXOA 4OFNA 3IC8A 1O6JA 2JZRA 3G7YA 4WBJA 5BRTA 3ERGA 3LG6A 5ECNB 4BVXB 3W8SA 1OE8A 1DE1A 3MYDA 3O3TA 5ECKB 3F63A 2G0FA 5IMDA 2O7KA 4IBPA 1ZYNA 4NWYA 1XWKA 1B48A 1O81A 4CY8A 3UL3A 3VWUA 2H0IA 4JBBA 4PQ1A 5BMUA 2BJXA 4EE0A 3HDCA 2CAIA 4HJMA 2K8SA 4POBA 1J08A 2LRNA 2K9FA 4PGTA 2EC4A 4ZILA 4EO3A 5ID2B 2IMFA 4MJBA 4RQRA 4WKWA 4O32A 3TKQA 4V2NA 1JLVA 2FD3A 1Y25A 1TRVA 20GSA 3UBKA 5F0GA 9GSSA 4K0NA 1TI1A 4BWSA 4MPGA 2YOIA 1R5AA 3CXGA 4GSNA 3GSTA 3QAGA 4RI6A 4KE3A 5J4UA 3ZITA 3APOA 2AHEA 2B7JA 3EURA 1R7HA 3C71A 5GZZB 2IMIA 1Y6EA 2OA7A 4OFTA 2R0PA 6GSVA 2X8CA 1X9MB 4ZL9A 3HKRA 3C1SA 5EVOA 5CRWA 5ID2A 2CZ3A 3FMWA 3DYRA 3IV4A 2NTOA 4AJ7A 4D73A 3RPPA 2BTOT 1QXHA 2E0QA 4PQIA 3HCZA 4ML1A 3TB2A 2LSTA 3VPTA 1AUCA 5CRGA 3LXZA 3ZL5A 5IOXA 2AUVA 2H1GA 2NDOA 4PUAA 1GTUA 11GSA 1OC3A 1B9XC 3QR6A 3D22A 4GF0A 2HSHA 3Q18A 2KLXA 5DALA 1VF4A 2QSIA 1GSYA 4YQUA 1FOVA 1G7EA 4LMWA 3A5IA 2GS3A 1S3CA 4LL1B 2LUSA 4IJ3A 2IL3A 4XIHA 1FG4A 2YNXA 2VL3A 2CA8A 2OBKA 3MDKA 2VM1A 2YANA 4XRDA 1SL0B 4DSSB 3C7MA 3TOTA 2IFQA 3ZFLA 1USBA 4CDOA 4RI7A 1WJKA 1TDIA 3APQA 4JRRA 1A2LA 3UVTA 1PX6A 1J9BA 1XZOA 4X43A 2VCXA 4TVEA 2WJUA 1M2AA 4V2LA 2LRTA 2VLVA 1DUGA 1R5PA 4G19A 4DSSA 3UARA 1ZGNA 5FHIA 1OC8A 4N0ZA 1HNCA 2XPDA 2J23A 1ERVA 2ZUPA 4TXVA 1FO5A 1EV4A 1CQHA 3FZ9A 5LCZA 2MMAA 5B6NA 2DJJA 4GCIA 1M0UA 4KW6A 4L8EA 5DAKA 5D9VA 2VLTA 2F8FA 2WB9A 3CYNA 1EGOA 4ECJA 1TRUA 3ISOA 3WT2A 4MF7A 2HLSA 3DVXA 4X1UA 4BL7B 5A4VA 3GL5A 1NSWA 4ZXGA 1WWJA 4IP1A 3LJRA 2XPEA 4FIWA 1Z7RA 1SL2B 5G31A 4TR0A 5G1LA 2K18A 2CX4A 3CRTA 2C3QA 4BWQA 2P5QA 4I2UA 1GSSA 7GSSA 1SD9A 1F3AA 1X5CA 3QCPA 4BL7A 4AJ6A 4Q5NA 5DQSA 5DDLA 2N5BA 1WE0A 3ZRDA 5IMZA 4V1Ag 4GQFA 4KDYA 2VL2A 3ZIJA 5C04A 5D9XA 1FHEA 1PN0A 4KNDA 2PERA 2YWIA 3ZVJA 2FWFA 3VFIA 2F8AA 2PWJA 2LEGA 3P8WA 3C8EA 3GURA 1SYXA 3ED3A 2GT6A 2YWOA 2VCQA 2PBJA 3F3QA 4WR5A 2KP1A 3F4TA 2V1MA 1TOFA 3N5OA 1BYEA 4MF6A 2DKIA 3DIEA 5D73A 2O87A 1MDKA 1NW2A 4L5LA 3GRXA 1PGTA 2X8GA 2ALBA 3NZNA 3VK9A 5A4WA 1ST9A 2GT5A 2E2GA 4KDUA 2DKHA 3VI7A 4WEYA 1XWAA 2HRFA 1GTBA 4KCEA 1BQ7A 1EEMA 2DC5A 4NHWA 5EY6A 5KN1A 4HJ2A 3PINA 2JZSA 5L71A 2YCDA 3E0UA 1EOGA 4K7NA 4QL7A 2C4JA 5F07A 1U3AA 5IPHA 2LNSA 3IK7A 3GTUA 4GXZA 2PMTA 4DEJA 5GAND 2GSQA 1V9WA 4DSQA 2B1KA 2MZCA 3ZIVA 1AQWA 3C1RA 4AF2A 3FZAA 5KOXA 2VCZA 3HA9A 2XHFA 2V2GA 3TKSE 4POLA 6GSTA 3ZVJD 4KF9A 3NOFA 3GUSA 3D21A 4F2IA 1K3OA 1K0CA 1Q4JA 2N5FA 2IMDA 3I43A 5JCUA 3IPZA 1PMTA 2FWEA 2YV9A 4AGSA 1N2AA 3BBYA 4WBRD 1M2DA 6GSWA 2VLUA 2MBSA 5H5SA 2A2SA 2HZEA 4J2FA 1OKDA 2DJ1A 4ZBDA 4JR6A 1K0DA 3RAZA 3F3RA 1TXXA 1U87A 4K1FA 1SU9A 4Z7XA 4MNNA 5J3RA 4XTSA 4TR1A 2YJHA 4PUFC 4JZQA 1XCCA 4E8HA 2V32A 2IJYA 3AY8A 1B4QA 3O6TA 3PGTA 1THOA 1ACVA 4ZB9A 1YKCA 1YY7A 1K0MA 2WRTA 4K2XA 4MMMA 3S9FA 1GP1A 2L57A 2P0GA 5LD0A 1V58A 1AIUA 1JLWA 4KA0A 2YV7A 4Q5RA 4TW5A 4FO5A 4NHZA 4WETA 3CSIA 3G7IA 4Z2RA 1X5EA 2G2QA 4K5SA 4K5RA 1OKTA 2EIRA 3KP8A 3CTGA 2HT9A 2OKAA 4GQCA 1FB6A 3MNGA 3TRPA 4H86A 3DMLA 4G2EA 2FWGA 3ZREA 3SWLA 3GFKA 2CVDA 1X5DA 2WDUA 4JR4A 4LLRA 4ZB6A 2H0HA 4I5QA 5DBQA 4ECBA 3KD0A 3WGXA 1YZXA 1XVWA 1F37A 2JU5A 3DWVA 2DJ3A 3MSZA 4KCAA 4CHSA 3E3EA 1F9MA 1BEDA 4GLTA 4EDZA 6GSXA 4F0CA 3GKMA 4F9ZA 1A8LA 3M8NA 1XWBA 3WT1A 2HE3A 1G6YA 4JE1A 2CT6A 3DKSA 4PNFA 3VI5A 4FQUA 3ZLPA 4JEDA 3Q6OA 5H5QA 3UAPA 5CRDA 1A24A 4CW9A 1QQ2A 2DMLA 1GWCA 4NPBA 2CVBA 3M3MA 4FYBA 4G9HA 1A0RP 1XFLA 1M9AA 3FY7A 2TRCP 3IAM2 3NIVA 3LFLA 4IN0A 2C3NA 5B8BA 2C0DA 1PN9A 3F6DA 2H74A 4V2MA 1LU4A 3U6VA 3UMAA 5ECOB 2A2PA 2L59A 4KDXA 3LQ7A 2R0CA 1JFUA 1V2AA 2X8HA 5J5NA 2AYTA 2V41A 4BA7A 1U6TA 1TK8B 2GLRA 2AAWA 4QQ7A 1O8XA 1RK4A 2N5AA 2NBSA 2GSRA 4D73B 5JWOB 5ECQB 2HFDA 4WXTA 1UA5A 2R5GA 1SKSB 5HR1A 1MDIA 1EV9A 3TJGA 5KN2A 2L5OA 3EVIA 3HY2A 2GDRA 1R26A 2HSMA 4NV2A 2DIYA 4XS4A 2VCVA 1NM3A 3LYKA 14GSA 4MF5A 4X0XA 5B7CA 2YN1A 3ERFA 4JU5A 5KN0A 5DALB 4KSMA 5FT3A 3LYPA 4ZBAA 3LSZA 2GQLA 2KUCA 1Z7PA 1A2MA 1UN2A 4MJCA 4DSRA 3DGQA 1EP8A 1K3LA 2H71A 4O7HA 3PR8A 5A5KA 2FNOA 4KAEA 5D8IA 2D2ZA 3GV1A 1SKWB 1DSBA 5F05A 2IFQB 2VO4A 2VUPA 12GSA 1JZDA 3QPMA 2OADA 3N9JA 1XIYA 3H1NA 1VF2A 3F9UA 1EP7A 4X4JA 2CVKA 1ZYQB 2EIQA 3QFBC 3WYWA 1A8YA 1XOBA 3IOSA 3FR3A 3FZ5A 3IC4A 1SK0A 1T8EB 3H4KA 3EMXA 2CX3A 2M46A 4IELA 1BAYA 3MWHA 1TP9A 4E8EA 2YJ7A 5J9BA 3J7Yk 2H76A 2XBQA 2MMNA 1I5GA 3EINA 1Z5YE 3TOUA 1PKWA 1PRXA 2VD1A 3L9SA 1T3BA 1MEKA 1ERUA 4HZ2A 2IWTA 3KTBA 4IQAA 4YH2A 5DAKB 1AW9A 5EL8A 1XWGA 2B1LA 19GSA 2B5EA 1SENA 1WRYA 2O85A 3HVSA 1U3IA 4L0WA 3CBUA 2EIOA 2NPBA 1ZL9A 1W4VA 1ZYPA 2XBIA 3TKPA 5H5RA 4MK3A 3M0FA 1KEBA 4G10A 1GTIA 2RM6A 4MH2A 1NHOA 3FZ4A 5HQPA 2HSYA 4HU7A 3TKSC 8GSSA 5J41A 1B9YC 3F6FA 3EU3A 4GSTA 1Q98A 2CZ2A 5HFKA 5ECPB 1T4YA 1YF1A 4KUNA 1LJRA 1AQXA 2F51A 2GZZA 4MA9A 4ILFA 1B8XA 1HYUA 4CY6A 3HXSA 2LNTA 3GHAA 4K7IA 22GSA 4O5QA 4MH3A 4FYUA 3KP9A 4GSSA 2M80A 3Q74A 3D6IA 3I6AA 3WGDA 4XHMA 3GX0A 3VLNA 4G0LA 4OFMA 3IBHA 1OAZA 3EYTA 5CO3A 1TTZA 3HVVA 3VWXA 3IHGA 2B5XA 2I3YA 1GUMA 4POKA 5DVBA 2B5YA 2E2MA 1O73A 2OE0A 3EMPA 5IM9A 1PL2A 5A4UA 1Z3EA 5HR2A 3EC3A 1NHYA 2QKEA 1UC7A 3KM6A 1TU7A 2O89A 1XW6A 2V6OA 1QUWA 2ZNMA 4GRFA 2QC7A 2TIRA 3IAS2 5G30A 2GQKA 4YAVA 4OO5A 3PH9A 1HNBA 3L9UA 1THXA 4MCUA 3GNJA 2LJAA 3GYKA 3D4MA 2WCIA 1CQGA 4L0UA 2LKUA 2VL9A 3VURA 1FVKA 3QFAC 5B6MA 3LWAA 3DVWA 5GSTA 3EE2A 1X9WB 2PVOC 4EL1A 3O76A 1YJ6A 1K0OA 1GTAA 3VPQA 16GSA 2ON7A 1O85A 2H8LA 1GL8A 5D93A 3GTUB 3A2XA 3R2QA 4PX1A 3UBLA 2C1YA 2GZYA 2X49A 1KBNA 1ABAA 2R4VA 4XS6A 6GSSA 5IIZA 3EWLA 5IMFA 2DMMA 1A0FA 3KGKA 2VD0A 3LEFA 1PD21 1H4OA 4MJEA 17GSA 1WIKA 2L6CA 4RUVA 4ECIA 2B3SA 2A4VA 3UVHA 2MBTA 4I97A 3F4RA 1XOAA 3OR5A 4IP6A 3FKFA 4LMVA 3U5RE 3HJOA 4GWRA 2HZEB 1F6MC 3M1GA 1G0TA 4FYCA 3TCOA 3FRCA 4OWYA 3TJFA 3LW9A 3IE3A 4HDEA 2DBCA 4ACSA 5G2ZA 3A3TA 4TR1B 3APSA 2E7PA 1GUKA 3C73A 4EC0A 1IYHA 1TRWA 3M9KA 5ECSA 2NVLA 5DCHA 3BD2A 4IVFA 1TRSA 1YKAA 2GTUA 4P3YB 1SKRB 1MTCA 2LS5A 3E9JB 2A4HA 2OE3A 1SJIA 1B4PA 3HJMA 2H1BA 1OC9A 5IPGA 1JHBA 3KZQA 2ES7A 4I8BA 2RLIA 4HEA2 2M72A 4Q5QA 2R37A 1PX7A 2QA2A 2KOKA 4G0KA 5ELGA 1GULA 1A2JA 5CP1A 1HD2A 1O7UA 4OO4A 1YDKA 2WZ9A 1HQOA 1RW1A 3QMXA 2WGRA 4YAPA 1WPIA 1SL1B 4BVYA 4K2DA 1T1VA 5GSSA 2H6XA 1ZMAA 4FH8A 13GSA 2X99A 1PKZA 2PGTA 4PTSA 2HRKA 2HZFA 4MDCA 4L5OA 5FWGA 4F03A 2C0GA 3ZZXA 2OBIA 4TR4A 5DJLA 3UEMA 5ECRB 5LNKe 4TRXA 4IS0A 3UJ1A 1FW1A 1WP0A 1F3BA 1O8WA 1SD8A 4ULXA 4ZL7A 2P31A 4EIQA 1VF3A 5D9TA 3KMNA 1OYJA 2LV3A 3RDWA 5B8AA 2XC2A 4O92A 5EPFA 2HXKA 5AISA 1ERWA 1TK5B 2JL4A 1DE2A 1PSQA 4EUYA 3M9JA 1AAZA 3CSJA 1URMA 3TDGA 1T00A 2CV4A 4ZIJA 3HJPA 4K0GA 6GSYA 5KEJA 4N0VA 3GA4A 1G6WA 1GLPA 1EZKA 4KB3A 1WMJA 4AJ8A 3TRXA 2IMEA 2LJRA 1K0NA 3IK9A 5C00A 1TW9A 3A2WA 3G7JA 3GN3A 3R3EA 3KH9A 5CRHA 2H73A 2LRCA 2L5LA 5ECMB 3H8QA 1QK8A 1K0BA 4NV5A 4F82A 6GSUA 2YP6A 3BJ5A 3IHQA 5E4WA 5G1KA 2YPMA 4J56E 4XS4B 2JSZA 1Z9HA 4OCFA 3ZFBA 2L4CA 5KN3A 3DEXA 2LQQA 3P90A 4I6XA 2R0GA 2VCWA 2OACA 2QGVA 4TR3A 4ML6A 2B7KA 1S3AA 1EEJA 2R6KA 2DSAA 2HRAA 2ON5A 1OE7A 1M99A 1ZOFA 1ILOA 1WOUA 3VWVA 1UVZA 3GX8A 5IMCA 2REMA 4BVXA 4IQ1A 1IYIA 5CAXA 1JZWA 1MD4A 2YWNA 4LA1A 3ZTLA 4V1Ap 1ZYEA 1M2BA 3ERWA 3WD6A 2OJLA 1F2EA 4EIPA 1TJDA 1V98A 18GSA 1PL1A 5HFIA 4MP4A 4HQZA 4DVCA 3LXTA 3L0HA 1SJ6A 1GNWA 3G9BA 3HZ4A 3EU4A 2J9HA 2A2RA 4EKZA 2VL2C 1XWCA 1JZRA 4HOJA 4HU9A 2F9SA 3GKKA 3QOUA 3GIXA 2FHEA 3QAVA 5AIVA 3RPNA 2H1DA 4EXJA 2VOCA 1U88A 3RBTA 1ERTA 4YKGA 2OE1A 2HRNA 3UIWA 2GSSA 1V57A 5CREA 1YF0A 3RHBA 5HR0A 3H93A 3IRAA 2DJ0A 4N30A 2DJKA 2BMXA 4HUAA 3GH6A 2C80A 5GAPD 4IGJA 1XPVA 4ZBBA 3MAKA 4ISDA 4PURA 3UOMA 4BPYA 4WF4A 2F3MA 3TJJA 2ZCTA 3D4TA 3ZMLA 4O5UA 3ZMKA 3F4SA 1SJZA 1BJXA 2H30A 2YZHA 3QDNA 5D96A 3DXBA 3L4NA 4KGIA 1V40A 4MABA 1GNEA 3TJBA 5JWQB 1KTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WF5 A;  3A5W A;  2YWM A;  4F0B A;  1G7O A;  1MDJ A;  2RII A;  3GSS A;  2H01 A;  2WS2 A;  2H1A A;  1M9B A;  4HQS A;  1XVQ A;  3V1W A;  2FY6 A;  1X9S B;  5CYY A;  2LQO A;  2WUL A;  3W6G A;  1VRS D;  2AV4 A;  2H66 A;  2C0F A;  4OMV A;  3SBC A;  5G5E A;  2DLX A;  2JSY A;  5DJM A;  2IPA A;  3KMO A;  2H6Y A;  2RUF A;  3TKR A;  4EVM A;  3FR9 A;  3KEB A;  4IW9 A;  4KSO A;  4RQX A;  3P7X A;  1JZO A;  4PNG A;  4O5R A;  2AJQ B;  1TK0 B;  5HR3 A;  1BG5 A;  2FGX A;  4K7O A;  1S3D A;  3GL3 A;  2I4A A;  1MD3 A;  4XCS A;  1T4Z A;  2RUE A;  1H75 A;  2HI7 A;  5ECI B;  1GH2 A;  1GSQ A;  5IO2 A;  1OVN A;  2GGT A;  2YZU A;  1PA3 A;  1GSD A;  3ME8 A;  1VGL A;  4MPF A;  4WR4 A;  4OD7 A;  5IO0 A;  1QMV A;  1GUH A;  2I9H A;  3GKN A;  4N11 A;  3K8N A;  3FYG A;  1EWX A;  2V6K A;  3KJY A;  4HI7 A;  4KX4 A;  1XBS A;  1GSF A;  2FCH A;  3D5J A;  1PQN A;  4Q5F A;  2HYX A;  1K0A A;  3CTF A;  2FA8 A;  2PN8 A;  3L9V A;  1QGV A;  2IIY A;  5JCW A;  4K9Z A;  1KNG A;  3FR6 A;  2RM5 A;  3I9V 2;  3L78 A;  5D9W A;  3TGZ A;  4ID0 A;  2FLS A;  2PVQ A;  3CSH A;  3H79 A;  2Z9S A;  10GS A;  4HZ4 A;  3HHV A;  1C72 A;  4POM A;  1YEX A;  5JWR B;  1ZCP A;  2GST A;  3A2V A;  3LOR A;  3HD5 A;  1N8J A;  4YQM A;  3HZ8 A;  5IMA A;  1AXD A;  5ECH B;  4ZL8 A;  4EF0 A;  5IQY A;  4KH7 A;  3FHK A;  5F8B A;  1GRX A;  1SYR A;  1LBK A;  4GTU A;  2DJ2 A;  1HNA A;  4K6X A;  2H0G A;  2C3T A;  2IMK A;  5IOW A;  1VF1 A;  3BCK A;  2DIZ A;  2R3X A;  4IJI A;  3VWW A;  2L4Q A;  2JZT A;  2H70 A;  2MMO A;  2MMZ A;  2O8V B;  1M7T A;  3KH7 A;  3ME7 A;  1XW5 A;  2LTK A;  1FB0 A;  2I81 A;  3FW2 A;  5G5F A;  2GZP A;  3F8U A;  1Z6M A;  5DCG A;  3KTL A;  5HFG A;  1W89 A;  3GKX A;  3RHC A;  1XXU A;  1YQ1 A;  1AQV A;  4IHU A;  4MZW A;  5CNW A;  1GLQ A;  2VCT A;  1OC9 B;  2GVP A;  1AC1 A;  1QFN A;  2R2J A;  1ON4 A;  2HNL A;  3QAW A;  1SK2 A;  3FEU A;  1YEP A;  4NXI A;  4K8M A;  4MJA A;  2JAC A;  5F06 A;  3CMI A;  2PUK C;  5J9C A;  1EOH A;  1GSE A;  2PPT A;  1A23 A;  3D0Z A;  2P5R A;  1ZZY A;  5ECL B;  4PXO A;  3HYP A;  3DRN A;  4LL4 B;  1TI3 A;  1BX9 A;  2K6V A;  5AN1 A;  2H6Z A;  5ELA A;  1R4W A;  3KXO A;  4YQV A;  3QD9 A;  3P2A A;  3HVX A;  2JAD A;  1FVJ A;  3TKS A;  1RQM A;  5IMV A;  1TKD B;  2VAF A;  3I69 A;  3ZYW A;  2TRX A;  3IR4 A;  1E6B A;  5COH A;  3LGC A;  3KIJ A;  1T7P B;  1SK1 A;  1I9D A;  2WFC A;  4HS1 A;  2FUG 2;  4MLY A;  5DQY A;  4XS1 A;  3JCM L;  3BOA A;  3TJK A;  1DBY A;  1TU8 A;  4NAX A;  4PQH A;  3J7Y b;  2VM2 A;  3TRQ A;  4TKY A;  2FWH A;  2MYG A;  5AIX A;  2CQ9 A;  1EGR A;  2C0E A;  3IDV A;  1Z6N A;  3WGE A;  2L6D A;  5AGY A;  2LJK A;  3KCM A;  3F0I A;  2KHP A;  4MZC A;  1K3Y A;  4TOP A;  4ZB8 A;  3TUE A;  1FAA A;  5ENU A;  2AB6 A;  4ECC A;  4OCE A;  2CAQ A;  2B6M A;  3CRU A;  3BCI A;  2H19 A;  5ABR A;  3IXR A;  3US3 A;  5INY A;  3FK8 A;  2H75 A;  4TXO B;  1J0F A;  1XW9 A;  2I1U A;  3W8J A;  1E2Y A;  4J57 E;  3Q19 A;  5JCG A;  2C8U A;  2KP2 A;  1GSU A;  1ML6 A;  2H72 A;  1X0R A;  2K8V A;  2FA4 A;  3IA1 A;  4N10 A;  2X64 A;  4XRA A;  3GH9 A;  2IN3 A;  2PU9 C;  5E59 A;  3DD3 A;  4TN8 A;  4IKH A;  2GQM A;  4I2T A;  4NMU A;  4EDY A;  4MZB A;  4QL9 A;  3GMF A;  2VIM A;  4TXO A;  4OFN A;  1O6J A;  2JZR A;  3G7Y A;  4WBJ A;  3ERG A;  3LG6 A;  5ECN B;  3W8S A;  1OE8 A;  1DE1 A;  3O3T A;  5ECK B;  3F63 A;  2G0F A;  5IMD A;  2O7K A;  4IBP A;  4NWY A;  1XWK A;  1B48 A;  1O81 A;  3UL3 A;  3VWU A;  2H0I A;  4JBB A;  4PQ1 A;  2BJX A;  4EE0 A;  3HDC A;  2CAI A;  4HJM A;  2K8S A;  4POB A;  1J08 A;  2LRN A;  2K9F A;  4PGT A;  2EC4 A;  4ZIL A;  4EO3 A;  5ID2 B;  2IMF A;  4MJB A;  4RQR A;  4WKW A;  4O32 A;  3TKQ A;  4V2N A;  1JLV A;  2FD3 A;  1Y25 A;  1TRV A;  20GS A;  3UBK A;  5F0G A;  9GSS A;  4K0N A;  1TI1 A;  4BWS A;  4MPG A;  2YOI A;  1R5A A;  3CXG A;  4GSN A;  3GST A;  3QAG A;  4RI6 A;  4KE3 A;  5J4U A;  3ZIT A;  3APO A;  2AHE A;  2B7J A;  3EUR A;  1R7H A;  3C71 A;  5GZZ B;  2IMI A;  1Y6E A;  2OA7 A;  4OFT A;  6GSV A;  2X8C A;  1X9M B;  4ZL9 A;  3HKR A;  3C1S A;  5EVO A;  5CRW A;  5ID2 A;  2CZ3 A;  3DYR A;  3IV4 A;  2NTO A;  4AJ7 A;  4D73 A;  3RPP A;  2BTO T;  1QXH A;  2E0Q A;  4PQI A;  3HCZ A;  4ML1 A;  3TB2 A;  2LST A;  3VPT A;  1AUC A;  5CRG A;  3LXZ A;  3ZL5 A;  5IOX A;  2AUV A;  2H1G A;  2NDO A;  4PUA A;  1GTU A;  11GS A;  1OC3 A;  1B9X C;  3QR6 A;  3D22 A;  4GF0 A;  2HSH A;  3Q18 A;  2KLX A;  5DAL A;  1VF4 A;  2QSI A;  1GSY A;  4YQU A;  1FOV A;  1G7E A;  4LMW A;  2GS3 A;  1S3C A;  4LL1 B;  2LUS A;  4IJ3 A;  2IL3 A;  4XIH A;  1FG4 A;  2YNX A;  2VL3 A;  2CA8 A;  2OBK A;  3MDK A;  2VM1 A;  2YAN A;  4XRD A;  1SL0 B;  4DSS B;  3C7M A;  3TOT A;  2IFQ A;  3ZFL A;  1USB A;  4CDO A;  4RI7 A;  1WJK A;  1TDI A;  3APQ A;  4JRR A;  1A2L A;  3UVT A;  1PX6 A;  1J9B A;  1XZO A;  4X43 A;  2VCX A;  4TVE A;  2WJU A;  1M2A A;  4V2L A;  2LRT A;  2VLV A;  1DUG A;  1R5P A;  4G19 A;  4DSS A;  3UAR A;  1ZGN A;  5FHI A;  1OC8 A;  4N0Z A;  1HNC A;  2XPD A;  2J23 A;  1ERV A;  2ZUP A;  4TXV A;  1FO5 A;  1EV4 A;  1CQH A;  3FZ9 A;  5LCZ A;  2MMA A;  5B6N A;  2DJJ A;  4GCI A;  1M0U A;  4KW6 A;  4L8E A;  5DAK A;  5D9V A;  2VLT A;  2F8F A;  2WB9 A;  3CYN A;  1EGO A;  4ECJ A;  1TRU A;  3ISO A;  3WT2 A;  4MF7 A;  2HLS A;  3DVX A;  4X1U A;  5A4V A;  3GL5 A;  1NSW A;  4ZXG A;  1WWJ A;  4IP1 A;  3LJR A;  2XPE A;  4FIW A;  1Z7R A;  1SL2 B;  5G31 A;  4TR0 A;  5G1L A;  2K18 A;  2CX4 A;  3CRT A;  2C3Q A;  4BWQ A;  2P5Q A;  4I2U A;  1GSS A;  7GSS A;  1SD9 A;  1F3A A;  1X5C A;  3QCP A;  4BL7 A;  4AJ6 A;  4Q5N A;  5DQS A;  5DDL A;  2N5B A;  1WE0 A;  3ZRD A;  5IMZ A;  4V1A g;  4GQF A;  4KDY A;  2VL2 A;  3ZIJ A;  5C04 A;  5D9X A;  1FHE A;  4KND A;  2PER A;  2YWI A;  3ZVJ A;  2FWF A;  3VFI A;  2F8A A;  2PWJ A;  2LEG A;  3P8W A;  3C8E A;  3GUR A;  1SYX A;  3ED3 A;  2GT6 A;  2YWO A;  2VCQ A;  2PBJ A;  3F3Q A;  4WR5 A;  2KP1 A;  3F4T A;  2V1M A;  1TOF A;  3N5O A;  1BYE A;  4MF6 A;  3DIE A;  5D73 A;  2O87 A;  1MDK A;  1NW2 A;  4L5L A;  3GRX A;  1PGT A;  2X8G A;  2ALB A;  3NZN A;  3VK9 A;  5A4W A;  1ST9 A;  2GT5 A;  2E2G A;  4KDU A;  3VI7 A;  4WEY A;  1XWA A;  2HRF A;  1GTB A;  4KCE A;  1BQ7 A;  1EEM A;  2DC5 A;  4NHW A;  5EY6 A;  5KN1 A;  4HJ2 A;  3PIN A;  2JZS A;  5L71 A;  2YCD A;  3E0U A;  1EOG A;  4K7N A;  4QL7 A;  2C4J A;  5F07 A;  1U3A A;  5IPH A;  2LNS A;  3IK7 A;  3GTU A;  4GXZ A;  2PMT A;  4DEJ A;  5GAN D;  2GSQ A;  1V9W A;  4DSQ A;  2B1K A;  2MZC A;  3ZIV A;  1AQW A;  3C1R A;  4AF2 A;  3FZA A;  2VCZ A;  3HA9 A;  2XHF A;  2V2G A;  3TKS E;  4POL A;  6GST A;  3ZVJ D;  3NOF A;  3GUS A;  3D21 A;  4F2I A;  1K3O A;  1K0C A;  1Q4J A;  2N5F A;  2IMD A;  3I43 A;  5JCU A;  3IPZ A;  1PMT A;  2FWE A;  2YV9 A;  4AGS A;  1N2A A;  3BBY A;  4WBR D;  1M2D A;  6GSW A;  2VLU A;  2MBS A;  5H5S A;  2A2S A;  2HZE A;  4J2F A;  1OKD A;  2DJ1 A;  4ZBD A;  4JR6 A;  1K0D A;  3RAZ A;  3F3R A;  1TXX A;  1U87 A;  4K1F A;  1SU9 A;  4Z7X A;  5J3R A;  4XTS A;  4TR1 A;  2YJH A;  4PUF C;  4JZQ A;  1XCC A;  4E8H A;  2V32 A;  2IJY A;  3AY8 A;  1B4Q A;  3O6T A;  3PGT A;  1THO A;  1ACV A;  4ZB9 A;  1YKC A;  1YY7 A;  1K0M A;  2WRT A;  4MMM A;  3S9F A;  1GP1 A;  2L57 A;  2P0G A;  5LD0 A;  1V58 A;  1AIU A;  1JLW A;  4KA0 A;  2YV7 A;  4Q5R A;  4TW5 A;  4FO5 A;  4NHZ A;  4WET A;  3CSI A;  3G7I A;  1X5E A;  2G2Q A;  1OKT A;  2EIR A;  3KP8 A;  3CTG A;  2HT9 A;  2OKA A;  4GQC A;  1FB6 A;  3MNG A;  3TRP A;  4H86 A;  3DML A;  4G2E A;  2FWG A;  3ZRE A;  3SWL A;  3GFK A;  2CVD A;  1X5D A;  2WDU A;  4JR4 A;  4LLR A;  4ZB6 A;  2H0H A;  4I5Q A;  5DBQ A;  4ECB A;  3KD0 A;  3WGX A;  1YZX A;  1XVW A;  1F37 A;  2JU5 A;  3DWV A;  2DJ3 A;  3MSZ A;  4KCA A;  4CHS A;  3E3E A;  1F9M A;  1BED A;  4GLT A;  4EDZ A;  6GSX A;  4F0C A;  3GKM A;  4F9Z A;  1A8L A;  3M8N A;  1XWB A;  3WT1 A;  2HE3 A;  1G6Y A;  4JE1 A;  2CT6 A;  3DKS A;  4PNF A;  3VI5 A;  3ZLP A;  4JED A;  3Q6O A;  5H5Q A;  3UAP A;  5CRD A;  1A24 A;  4CW9 A;  1QQ2 A;  2DML A;  1GWC A;  4NPB A;  2CVB A;  3M3M A;  4FYB A;  4G9H A;  1A0R P;  1XFL A;  1M9A A;  3FY7 A;  2TRC P;  3IAM 2;  3NIV A;  3LFL A;  4IN0 A;  2C3N A;  5B8B A;  2C0D A;  1PN9 A;  3F6D A;  2H74 A;  4V2M A;  1LU4 A;  3U6V A;  3UMA A;  5ECO B;  4KDX A;  2L59 A;  3LQ7 A;  1JFU A;  1V2A A;  2X8H A;  5J5N A;  2AYT A;  2V41 A;  4BA7 A;  1U6T A;  1TK8 B;  2GLR A;  2AAW A;  4QQ7 A;  1O8X A;  1RK4 A;  2N5A A;  2NBS A;  2GSR A;  4D73 B;  5JWO B;  5ECQ B;  2HFD A;  4WXT A;  1UA5 A;  2R5G A;  1SKS B;  5HR1 A;  1MDI A;  1EV9 A;  3TJG A;  5KN2 A;  2L5O A;  3EVI A;  3HY2 A;  2GDR A;  1R26 A;  4NV2 A;  2DIY A;  4XS4 A;  2VCV A;  1NM3 A;  3LYK A;  14GS A;  4MF5 A;  4X0X A;  5B7C A;  2YN1 A;  3ERF A;  4JU5 A;  5KN0 A;  5DAL B;  4KSM A;  5FT3 A;  3LYP A;  4ZBA A;  3LSZ A;  2GQL A;  2KUC A;  1Z7P A;  1A2M A;  1UN2 A;  4MJC A;  4DSR A;  3DGQ A;  1EP8 A;  1K3L A;  2H71 A;  4O7H A;  3PR8 A;  5A5K A;  2FNO A;  4KAE A;  5D8I A;  2D2Z A;  3GV1 A;  1SKW B;  1DSB A;  5F05 A;  2IFQ B;  2VO4 A;  2VUP A;  12GS A;  1JZD A;  3QPM A;  2OAD A;  3N9J A;  1XIY A;  3H1N A;  1VF2 A;  3F9U A;  1EP7 A;  2CVK A;  1ZYQ B;  2EIQ A;  3QFB C;  3WYW A;  1A8Y A;  1XOB A;  3IOS A;  3FR3 A;  3FZ5 A;  3IC4 A;  1SK0 A;  1T8E B;  3H4K A;  3EMX A;  2CX3 A;  2M46 A;  4IEL A;  1BAY A;  3MWH A;  1TP9 A;  4E8E A;  2YJ7 A;  5J9B A;  3J7Y k;  2H76 A;  2XBQ A;  2MMN A;  1I5G A;  3EIN A;  1Z5Y E;  3TOU A;  1PKW A;  1PRX A;  2VD1 A;  3L9S A;  1T3B A;  1MEK A;  1ERU A;  4HZ2 A;  2IWT A;  3KTB A;  4IQA A;  4YH2 A;  5DAK B;  1AW9 A;  5EL8 A;  1XWG A;  2B1L A;  19GS A;  2B5E A;  1SEN A;  1WRY A;  2O85 A;  3HVS A;  1U3I A;  4L0W A;  3CBU A;  2EIO A;  2NPB A;  1ZL9 A;  1W4V A;  2XBI A;  3TKP A;  5H5R A;  4MK3 A;  3M0F A;  1KEB A;  4G10 A;  1GTI A;  2RM6 A;  4MH2 A;  1NHO A;  3FZ4 A;  5HQP A;  2HSY A;  4HU7 A;  3TKS C;  8GSS A;  5J41 A;  1B9Y C;  3F6F A;  3EU3 A;  4GST A;  1Q98 A;  2CZ2 A;  5HFK A;  5ECP B;  1T4Y A;  1YF1 A;  4KUN A;  1LJR A;  1AQX A;  2F51 A;  2GZZ A;  4MA9 A;  4ILF A;  1B8X A;  1HYU A;  3HXS A;  2LNT A;  3GHA A;  4K7I A;  22GS A;  4MH3 A;  4FYU A;  3KP9 A;  4GSS A;  2M80 A;  3Q74 A;  3D6I A;  3I6A A;  3WGD A;  4XHM A;  3GX0 A;  3VLN A;  4OFM A;  3IBH A;  1OAZ A;  3EYT A;  5CO3 A;  1TTZ A;  3HVV A;  3VWX A;  2B5X A;  2I3Y A;  1GUM A;  4POK A;  5DVB A;  2B5Y A;  2E2M A;  1O73 A;  2OE0 A;  3EMP A;  5IM9 A;  1PL2 A;  5A4U A;  1Z3E A;  5HR2 A;  3EC3 A;  1NHY A;  2QKE A;  1UC7 A;  3KM6 A;  1TU7 A;  2O89 A;  1XW6 A;  2V6O A;  1QUW A;  2ZNM A;  4GRF A;  2QC7 A;  2TIR A;  3IAS 2;  5G30 A;  2GQK A;  4YAV A;  4OO5 A;  3PH9 A;  1HNB A;  3L9U A;  1THX A;  4MCU A;  3GNJ A;  2LJA A;  3GYK A;  3D4M A;  2WCI A;  1CQG A;  4L0U A;  2LKU A;  2VL9 A;  3VUR A;  1FVK A;  3QFA C;  5B6M A;  3LWA A;  3DVW A;  5GST A;  3EE2 A;  1X9W B;  2PVO C;  4EL1 A;  3O76 A;  1YJ6 A;  1K0O A;  1GTA A;  3VPQ A;  16GS A;  2ON7 A;  1O85 A;  2H8L A;  1GL8 A;  5D93 A;  3GTU B;  3A2X A;  3R2Q A;  4PX1 A;  3UBL A;  2C1Y A;  2GZY A;  1KBN A;  1ABA A;  2R4V A;  4XS6 A;  6GSS A;  5IIZ A;  3EWL A;  5IMF A;  2DMM A;  1A0F A;  3KGK A;  2VD0 A;  3LEF A;  1PD2 1;  1H4O A;  4MJE A;  17GS A;  1WIK A;  2L6C A;  4RUV A;  4ECI A;  2B3S A;  2A4V A;  3UVH A;  2MBT A;  4I97 A;  3F4R A;  1XOA A;  3OR5 A;  4IP6 A;  3FKF A;  4LMV A;  3U5R E;  3HJO A;  4GWR A;  2HZE B;  1F6M C;  3M1G A;  1G0T A;  4FYC A;  3TCO A;  3FRC A;  4OWY A;  3TJF A;  3IE3 A;  4HDE A;  2DBC A;  4ACS A;  5G2Z A;  3A3T A;  4TR1 B;  3APS A;  2E7P A;  1GUK A;  3C73 A;  4EC0 A;  1IYH A;  1TRW A;  3M9K A;  5ECS A;  2NVL A;  5DCH A;  3BD2 A;  4IVF A;  1TRS A;  1YKA A;  2GTU A;  4P3Y B;  1SKR B;  1MTC A;  2LS5 A;  3E9J B;  2OE3 A;  1SJI A;  1B4P A;  3HJM A;  2H1B A;  1OC9 A;  5IPG A;  1JHB A;  3KZQ A;  2ES7 A;  4I8B A;  2RLI A;  4HEA 2;  2M72 A;  4Q5Q A;  2R37 A;  1PX7 A;  2KOK A;  5ELG A;  1GUL A;  1A2J A;  5CP1 A;  1HD2 A;  1O7U A;  4OO4 A;  1YDK A;  2WZ9 A;  1HQO A;  1RW1 A;  3QMX A;  2WGR A;  4YAP A;  1WPI A;  1SL1 B;  4BVY A;  4K2D A;  1T1V A;  5GSS A;  2H6X A;  1ZMA A;  4FH8 A;  13GS A;  2X99 A;  1PKZ A;  2PGT A;  2HZF A;  4MDC A;  4L5O A;  5FWG A;  4F03 A;  2C0G A;  3ZZX A;  2OBI A;  4TR4 A;  5DJL A;  3UEM A;  5ECR B;  5LNK e;  4TRX A;  4IS0 A;  3UJ1 A;  1FW1 A;  1WP0 A;  1F3B A;  1O8W A;  1SD8 A;  4ULX A;  4ZL7 A;  2P31 A;  1VF3 A;  5D9T A;  3KMN A;  1OYJ A;  2LV3 A;  3RDW A;  5B8A A;  2XC2 A;  4O92 A;  5EPF A;  2HXK A;  5AIS A;  1ERW A;  1TK5 B;  2JL4 A;  1DE2 A;  1PSQ A;  4EUY A;  3M9J A;  1AAZ A;  3CSJ A;  1URM A;  3TDG A;  1T00 A;  2CV4 A;  4ZIJ A;  3HJP A;  4K0G A;  6GSY A;  5KEJ A;  4N0V A;  3GA4 A;  1G6W A;  1GLP A;  1EZK A;  4KB3 A;  1WMJ A;  4AJ8 A;  3TRX A;  2IME A;  2LJR A;  1K0N A;  3IK9 A;  5C00 A;  1TW9 A;  3A2W A;  3G7J A;  3GN3 A;  3KH9 A;  5CRH A;  2H73 A;  2LRC A;  2L5L A;  5ECM B;  3H8Q A;  1QK8 A;  1K0B A;  4NV5 A;  4F82 A;  6GSU A;  2YP6 A;  3BJ5 A;  3IHQ A;  5E4W A;  5G1K A;  2YPM A;  4J56 E;  4XS4 B;  2JSZ A;  1Z9H A;  4OCF A;  3ZFB A;  2L4C A;  5KN3 A;  3DEX A;  2LQQ A;  3P90 A;  4I6X A;  2VCW A;  2OAC A;  2QGV A;  4TR3 A;  4ML6 A;  2B7K A;  1S3A A;  1EEJ A;  2R6K A;  2DSA A;  2ON5 A;  1OE7 A;  1M99 A;  1ZOF A;  1ILO A;  1WOU A;  3VWV A;  1UVZ A;  3GX8 A;  5IMC A;  2REM A;  4BVX A;  4IQ1 A;  1IYI A;  5CAX A;  1JZW A;  1MD4 A;  2YWN A;  4LA1 A;  3ZTL A;  4V1A p;  1ZYE A;  1M2B A;  3ERW A;  3WD6 A;  2OJL A;  1F2E A;  1TJD A;  1V98 A;  18GS A;  1PL1 A;  5HFI A;  4MP4 A;  4HQZ A;  4DVC A;  3LXT A;  3L0H A;  1SJ6 A;  1GNW A;  3G9B A;  3HZ4 A;  3EU4 A;  2J9H A;  2A2R A;  4EKZ A;  2VL2 C;  1XWC A;  1JZR A;  4HOJ A;  4HU9 A;  2F9S A;  3GKK A;  3QOU A;  3GIX A;  2FHE A;  3QAV A;  5AIV A;  3RPN A;  2H1D A;  4EXJ A;  2VOC A;  1U88 A;  3RBT A;  1ERT A;  2OE1 A;  2HRN A;  3UIW A;  2GSS A;  1V57 A;  5CRE A;  1YF0 A;  3RHB A;  5HR0 A;  3H93 A;  3IRA A;  2DJ0 A;  4N30 A;  2DJK A;  2BMX A;  4HUA A;  3GH6 A;  2C80 A;  5GAP D;  4IGJ A;  1XPV A;  4ZBB A;  3MAK A;  4ISD A;  4PUR A;  3UOM A;  4BPY A;  4WF4 A;  2F3M A;  3TJJ A;  2ZCT A;  3D4T A;  3ZML A;  3ZMK A;  3F4S A;  1SJZ A;  1BJX A;  2H30 A;  2YZH A;  3QDN A;  5D96 A;  3DXB A;  3L4N A;  4KGI A;  1V40 A;  4MAB A;  1GNE A;  3TJB A;  5JWQ B;  1KTE A; 
#chains in the Genus database with same CATH topology
 4WF5 A;  3A5W A;  2YWM A;  4F0B A;  1G7O A;  1MDJ A;  2RII A;  3GSS A;  2H01 A;  2WS2 A;  2H1A A;  1M9B A;  4HQS A;  1XVQ A;  3V1W A;  2FY6 A;  1X9S B;  2X4A A;  5CYY A;  2LQO A;  2WUL A;  3W6G A;  1VRS D;  2AV4 A;  2H66 A;  2C0F A;  4OMV A;  3SBC A;  5G5E A;  2DLX A;  2JSY A;  5DJM A;  2IPA A;  3KMO A;  2H6Y A;  2RUF A;  3TKR A;  4EVM A;  3FR9 A;  3KEB A;  4IW9 A;  4KSO A;  4RQX A;  3P7X A;  1JZO A;  4Z2U A;  4PNG A;  4O5R A;  2AJQ B;  1TK0 B;  5HR3 A;  1BG5 A;  2FGX A;  4K7O A;  1S3D A;  3GL3 A;  2I4A A;  1MD3 A;  4XCS A;  1T4Z A;  2RUE A;  1H75 A;  2HI7 A;  5ECI B;  1GH2 A;  1GSQ A;  5IO2 A;  1OVN A;  2GGT A;  2YZU A;  1PA3 A;  1GSD A;  3ME8 A;  1VGL A;  4MPF A;  4WR4 A;  4OD7 A;  5IO0 A;  1QMV A;  1GUH A;  2I9H A;  3GKN A;  4N11 A;  1M3I A;  3K8N A;  3FYG A;  1EWX A;  2V6K A;  3KJY A;  4HI7 A;  4KX4 A;  1XBS A;  1GSF A;  2FCH A;  3D5J A;  1PQN A;  4Q5F A;  2HYX A;  1K0A A;  3CTF A;  2FA8 A;  2PN8 A;  3L9V A;  1QGV A;  2IIY A;  5JCW A;  4K9Z A;  4Z2T A;  1KNG A;  3FR6 A;  2RM5 A;  3I9V 2;  3L78 A;  5D9W A;  3TGZ A;  4ID0 A;  2FLS A;  2PVQ A;  3CSH A;  3H79 A;  2Z9S A;  10GS A;  4HZ4 A;  3HHV A;  1C72 A;  4POM A;  1YEX A;  3PPU A;  5JWR B;  1ZCP A;  2GST A;  3A2V A;  3LOR A;  3HD5 A;  1N8J A;  4YQM A;  3HZ8 A;  5IMA A;  1AXD A;  5ECH B;  4ZL8 A;  4EF0 A;  5IQY A;  4KH7 A;  3FHK A;  5F8B A;  1GRX A;  1SYR A;  1LBK A;  4GTU A;  2DJ2 A;  1HNA A;  4K6X A;  2H0G A;  2C3T A;  2IMK A;  5IOW A;  1VF1 A;  3BCK A;  2DIZ A;  2R3X A;  4IJI A;  3VWW A;  2L4Q A;  2JZT A;  2H70 A;  2MMO A;  2MMZ A;  2O8V B;  1M7T A;  3KH7 A;  3ME7 A;  1XW5 A;  2LTK A;  1FB0 A;  2I81 A;  1FOH A;  4YKF A;  3FW2 A;  5G5F A;  2GZP A;  3F8U A;  1Z6M A;  5DCG A;  3KTL A;  5HFG A;  1W89 A;  3GKX A;  3RHC A;  1XXU A;  4ICY A;  1YQ1 A;  1AQV A;  4IHU A;  4MZW A;  5CNW A;  1GLQ A;  2VCT A;  1OC9 B;  2GVP A;  1AC1 A;  1QFN A;  2R2J A;  1ON4 A;  2HNL A;  3QAW A;  1SK2 A;  3FEU A;  1YEP A;  4NXI A;  4K8M A;  4MJA A;  2JAC A;  5F06 A;  3CMI A;  2PUK C;  5J9C A;  1EOH A;  1GSE A;  2PPT A;  1A23 A;  3D0Z A;  2P5R A;  1ZZY A;  5ECL B;  4BVY B;  4PXO A;  3HYP A;  4G0I A;  3DRN A;  4LL4 B;  1TI3 A;  1BX9 A;  2K6V A;  5AN1 A;  2H6Z A;  5ELA A;  1R4W A;  3KXO A;  4YQV A;  3QD9 A;  3P2A A;  3HVX A;  2JAD A;  1FVJ A;  3TKS A;  1RQM A;  5IMV A;  1TKD B;  2VAF A;  3I69 A;  3ZYW A;  2TRX A;  3IR4 A;  1E6B A;  5COH A;  3LGC A;  3KIJ A;  1T7P B;  1SK1 A;  1I9D A;  2WFC A;  4HS1 A;  2FUG 2;  4MLY A;  5DQY A;  4XS1 A;  3JCM L;  3BOA A;  3TJK A;  2QA1 A;  1DBY A;  1TU8 A;  4NAX A;  4PQH A;  3J7Y b;  2VM2 A;  3TRQ A;  4TKY A;  2FWH A;  2MYG A;  5AIX A;  2CQ9 A;  1EGR A;  2C0E A;  3IDV A;  3MIX A;  1Z6N A;  3WGE A;  2L6D A;  5AGY A;  2LJK A;  3KCM A;  3F0I A;  2KHP A;  4MZC A;  1K3Y A;  4TOP A;  4ZB8 A;  3TUE A;  1FAA A;  2AB6 A;  5ENU A;  4ECC A;  4OCE A;  2CAQ A;  2B6M A;  3CRU A;  3BCI A;  2H19 A;  5ABR A;  3IXR A;  3US3 A;  5INY A;  3FK8 A;  2H75 A;  4TXO B;  1J0F A;  1XW9 A;  2I1U A;  3W8J A;  1E2Y A;  4USS A;  4J57 E;  3Q19 A;  5JCG A;  5KOW A;  2C8U A;  2KP2 A;  1GSU A;  4A5P A;  1ML6 A;  2H72 A;  1X0R A;  2K8V A;  2FA4 A;  3IA1 A;  2UZ8 A;  4N10 A;  2X64 A;  4XRA A;  3GH9 A;  3EPT A;  2IN3 A;  2PU9 C;  5E59 A;  3DD3 A;  4TN8 A;  4IKH A;  2GQM A;  4I2T A;  4NMU A;  4EDY A;  4MZB A;  4QL9 A;  3GMF A;  2VIM A;  4TXO A;  4OFN A;  3IC8 A;  1O6J A;  2JZR A;  3G7Y A;  4WBJ A;  5BRT A;  3ERG A;  3LG6 A;  5ECN B;  4BVX B;  3W8S A;  1OE8 A;  1DE1 A;  3MYD A;  3O3T A;  5ECK B;  3F63 A;  2G0F A;  5IMD A;  2O7K A;  4IBP A;  1ZYN A;  4NWY A;  1XWK A;  1B48 A;  1O81 A;  4CY8 A;  3UL3 A;  3VWU A;  2H0I A;  4JBB A;  4PQ1 A;  5BMU A;  2BJX A;  4EE0 A;  3HDC A;  2CAI A;  4HJM A;  2K8S A;  4POB A;  1J08 A;  2LRN A;  2K9F A;  4PGT A;  2EC4 A;  4ZIL A;  4EO3 A;  5ID2 B;  2IMF A;  4MJB A;  4RQR A;  4WKW A;  4O32 A;  3TKQ A;  4V2N A;  1JLV A;  2FD3 A;  1Y25 A;  1TRV A;  20GS A;  3UBK A;  5F0G A;  9GSS A;  4K0N A;  1TI1 A;  4BWS A;  4MPG A;  2YOI A;  1R5A A;  3CXG A;  4GSN A;  3GST A;  3QAG A;  4RI6 A;  4KE3 A;  5J4U A;  3ZIT A;  3APO A;  2AHE A;  2B7J A;  3EUR A;  1R7H A;  3C71 A;  5GZZ B;  2IMI A;  1Y6E A;  2OA7 A;  4OFT A;  2R0P A;  6GSV A;  2X8C A;  1X9M B;  4ZL9 A;  3HKR A;  3C1S A;  5EVO A;  5CRW A;  5ID2 A;  2CZ3 A;  3FMW A;  3DYR A;  3IV4 A;  2NTO A;  4AJ7 A;  4D73 A;  3RPP A;  2BTO T;  1QXH A;  2E0Q A;  4PQI A;  3HCZ A;  4ML1 A;  3TB2 A;  2LST A;  3VPT A;  1AUC A;  5CRG A;  3LXZ A;  3ZL5 A;  5IOX A;  2AUV A;  2H1G A;  2NDO A;  4PUA A;  1GTU A;  11GS A;  1OC3 A;  1B9X C;  3QR6 A;  3D22 A;  4GF0 A;  2HSH A;  3Q18 A;  2KLX A;  5DAL A;  1VF4 A;  2QSI A;  1GSY A;  4YQU A;  1FOV A;  1G7E A;  4LMW A;  3A5I A;  2GS3 A;  1S3C A;  4LL1 B;  2LUS A;  4IJ3 A;  2IL3 A;  4XIH A;  1FG4 A;  2YNX A;  2VL3 A;  2CA8 A;  2OBK A;  3MDK A;  2VM1 A;  2YAN A;  4XRD A;  1SL0 B;  4DSS B;  3C7M A;  3TOT A;  2IFQ A;  3ZFL A;  1USB A;  4CDO A;  4RI7 A;  1WJK A;  1TDI A;  3APQ A;  4JRR A;  1A2L A;  3UVT A;  1PX6 A;  1J9B A;  1XZO A;  4X43 A;  2VCX A;  4TVE A;  2WJU A;  1M2A A;  4V2L A;  2LRT A;  2VLV A;  1DUG A;  1R5P A;  4G19 A;  4DSS A;  3UAR A;  1ZGN A;  5FHI A;  1OC8 A;  4N0Z A;  1HNC A;  2XPD A;  2J23 A;  1ERV A;  2ZUP A;  4TXV A;  1FO5 A;  1EV4 A;  1CQH A;  3FZ9 A;  4HSC X;  5LCZ A;  2MMA A;  5B6N A;  2DJJ A;  4GCI A;  1M0U A;  4KW6 A;  4L8E A;  5DAK A;  5D9V A;  2VLT A;  2F8F A;  2WB9 A;  3CYN A;  1EGO A;  4ECJ A;  1TRU A;  3ISO A;  3WT2 A;  4MF7 A;  2HLS A;  3DVX A;  4X1U A;  4BL7 B;  5A4V A;  3GL5 A;  1NSW A;  4ZXG A;  1WWJ A;  4IP1 A;  3LJR A;  2XPE A;  4FIW A;  1Z7R A;  1SL2 B;  5G31 A;  4TR0 A;  5G1L A;  2K18 A;  2CX4 A;  3CRT A;  2C3Q A;  4BWQ A;  2P5Q A;  4I2U A;  1GSS A;  7GSS A;  1SD9 A;  1F3A A;  1X5C A;  3QCP A;  4BL7 A;  4AJ6 A;  4Q5N A;  5DQS A;  5DDL A;  2N5B A;  1WE0 A;  3ZRD A;  5IMZ A;  4V1A g;  4GQF A;  4KDY A;  2VL2 A;  3ZIJ A;  5C04 A;  5D9X A;  1FHE A;  1PN0 A;  4KND A;  2PER A;  2YWI A;  3ZVJ A;  2FWF A;  3VFI A;  2F8A A;  2PWJ A;  2LEG A;  3P8W A;  3C8E A;  3GUR A;  1SYX A;  3ED3 A;  2GT6 A;  2YWO A;  2VCQ A;  2PBJ A;  3F3Q A;  4WR5 A;  2KP1 A;  3F4T A;  2V1M A;  1TOF A;  3N5O A;  1BYE A;  4MF6 A;  2DKI A;  3DIE A;  5D73 A;  2O87 A;  1MDK A;  1NW2 A;  4L5L A;  3GRX A;  1PGT A;  2X8G A;  2ALB A;  3NZN A;  3VK9 A;  5A4W A;  1ST9 A;  2GT5 A;  2E2G A;  4KDU A;  2DKH A;  3VI7 A;  4WEY A;  1XWA A;  2HRF A;  1GTB A;  4KCE A;  1BQ7 A;  1EEM A;  2DC5 A;  4NHW A;  5EY6 A;  5KN1 A;  4HJ2 A;  3PIN A;  2JZS A;  5L71 A;  2YCD A;  3E0U A;  1EOG A;  4K7N A;  4QL7 A;  2C4J A;  5F07 A;  1U3A A;  5IPH A;  2LNS A;  3IK7 A;  3GTU A;  4GXZ A;  2PMT A;  4DEJ A;  5GAN D;  2GSQ A;  1V9W A;  4DSQ A;  2B1K A;  2MZC A;  3ZIV A;  1AQW A;  3C1R A;  4AF2 A;  3FZA A;  5KOX A;  2VCZ A;  3HA9 A;  2XHF A;  2V2G A;  3TKS E;  4POL A;  6GST A;  3ZVJ D;  4KF9 A;  3NOF A;  3GUS A;  3D21 A;  4F2I A;  1K3O A;  1K0C A;  1Q4J A;  2N5F A;  2IMD A;  3I43 A;  5JCU A;  3IPZ A;  1PMT A;  2FWE A;  2YV9 A;  4AGS A;  1N2A A;  3BBY A;  4WBR D;  1M2D A;  6GSW A;  2VLU A;  2MBS A;  5H5S A;  2A2S A;  2HZE A;  4J2F A;  1OKD A;  2DJ1 A;  4ZBD A;  4JR6 A;  1K0D A;  3RAZ A;  3F3R A;  1TXX A;  1U87 A;  4K1F A;  1SU9 A;  4Z7X A;  4MNN A;  5J3R A;  4XTS A;  4TR1 A;  2YJH A;  4PUF C;  4JZQ A;  1XCC A;  4E8H A;  2V32 A;  2IJY A;  3AY8 A;  1B4Q A;  3O6T A;  3PGT A;  1THO A;  1ACV A;  4ZB9 A;  1YKC A;  1M3J A;  1YY7 A;  1K0M A;  2WRT A;  4K2X A;  4MMM A;  3S9F A;  1GP1 A;  2L57 A;  2P0G A;  5LD0 A;  1V58 A;  1AIU A;  1JLW A;  4KA0 A;  2YV7 A;  4Q5R A;  4TW5 A;  4FO5 A;  4NHZ A;  4WET A;  3CSI A;  3G7I A;  4Z2R A;  1X5E A;  2G2Q A;  4K5S A;  4K5R A;  1OKT A;  2EIR A;  3KP8 A;  3CTG A;  2HT9 A;  2OKA A;  4GQC A;  1FB6 A;  3MNG A;  3TRP A;  4H86 A;  3DML A;  4G2E A;  2FWG A;  3ZRE A;  3SWL A;  3GFK A;  2CVD A;  1X5D A;  2WDU A;  4JR4 A;  4LLR A;  4ZB6 A;  2H0H A;  4I5Q A;  5DBQ A;  4ECB A;  3KD0 A;  3WGX A;  1YZX A;  1XVW A;  1F37 A;  2JU5 A;  3DWV A;  2DJ3 A;  3MSZ A;  4KCA A;  4CHS A;  3E3E A;  1F9M A;  1BED A;  4GLT A;  4EDZ A;  6GSX A;  4F0C A;  3GKM A;  4F9Z A;  1A8L A;  3M8N A;  1XWB A;  3WT1 A;  2HE3 A;  1G6Y A;  4JE1 A;  2CT6 A;  3DKS A;  4PNF A;  3VI5 A;  4FQU A;  3ZLP A;  4JED A;  3Q6O A;  5H5Q A;  3UAP A;  5CRD A;  1A24 A;  4CW9 A;  1QQ2 A;  2DML A;  1GWC A;  4NPB A;  2CVB A;  3M3M A;  4FYB A;  4G9H A;  1A0R P;  1XFL A;  1M9A A;  3FY7 A;  2TRC P;  3IAM 2;  3NIV A;  3LFL A;  4IN0 A;  2C3N A;  5B8B A;  2C0D A;  1PN9 A;  3F6D A;  2H74 A;  4V2M A;  1LU4 A;  3U6V A;  3UMA A;  5ECO B;  2A2P A;  2L59 A;  4KDX A;  3LQ7 A;  2R0C A;  1JFU A;  1V2A A;  2X8H A;  5J5N A;  2AYT A;  2V41 A;  4BA7 A;  1U6T A;  1TK8 B;  2GLR A;  2AAW A;  4QQ7 A;  1O8X A;  1RK4 A;  2N5A A;  2NBS A;  2GSR A;  4D73 B;  5JWO B;  5ECQ B;  2HFD A;  4WXT A;  1UA5 A;  2R5G A;  1SKS B;  5HR1 A;  1MDI A;  1EV9 A;  3TJG A;  5KN2 A;  2L5O A;  3EVI A;  3HY2 A;  2GDR A;  1R26 A;  2HSM A;  4NV2 A;  2DIY A;  4XS4 A;  2VCV A;  1NM3 A;  3LYK A;  14GS A;  4MF5 A;  4X0X A;  5B7C A;  2YN1 A;  3ERF A;  4JU5 A;  5KN0 A;  5DAL B;  4KSM A;  5FT3 A;  3LYP A;  4ZBA A;  3LSZ A;  2GQL A;  2KUC A;  1Z7P A;  1A2M A;  1UN2 A;  4MJC A;  4DSR A;  3DGQ A;  1EP8 A;  1K3L A;  2H71 A;  4O7H A;  3PR8 A;  5A5K A;  2FNO A;  4KAE A;  5D8I A;  2D2Z A;  3GV1 A;  1SKW B;  1DSB A;  5F05 A;  2IFQ B;  2VO4 A;  2VUP A;  12GS A;  1JZD A;  3QPM A;  2OAD A;  3N9J A;  1XIY A;  3H1N A;  1VF2 A;  3F9U A;  1EP7 A;  4X4J A;  2CVK A;  1ZYQ B;  2EIQ A;  3QFB C;  3WYW A;  1A8Y A;  1XOB A;  3IOS A;  3FR3 A;  3FZ5 A;  3IC4 A;  1SK0 A;  1T8E B;  3H4K A;  3EMX A;  2CX3 A;  2M46 A;  4IEL A;  1BAY A;  3MWH A;  1TP9 A;  4E8E A;  2YJ7 A;  5J9B A;  3J7Y k;  2H76 A;  2XBQ A;  2MMN A;  1I5G A;  3EIN A;  1Z5Y E;  3TOU A;  1PKW A;  1PRX A;  2VD1 A;  3L9S A;  1T3B A;  1MEK A;  1ERU A;  4HZ2 A;  2IWT A;  3KTB A;  4IQA A;  4YH2 A;  5DAK B;  1AW9 A;  5EL8 A;  1XWG A;  2B1L A;  19GS A;  2B5E A;  1SEN A;  1WRY A;  2O85 A;  3HVS A;  1U3I A;  4L0W A;  3CBU A;  2EIO A;  2NPB A;  1ZL9 A;  1W4V A;  1ZYP A;  2XBI A;  3TKP A;  5H5R A;  4MK3 A;  3M0F A;  1KEB A;  4G10 A;  1GTI A;  2RM6 A;  4MH2 A;  1NHO A;  3FZ4 A;  5HQP A;  2HSY A;  4HU7 A;  3TKS C;  8GSS A;  5J41 A;  1B9Y C;  3F6F A;  3EU3 A;  4GST A;  1Q98 A;  2CZ2 A;  5HFK A;  5ECP B;  1T4Y A;  1YF1 A;  4KUN A;  1LJR A;  1AQX A;  2F51 A;  2GZZ A;  4MA9 A;  4ILF A;  1B8X A;  1HYU A;  4CY6 A;  3HXS A;  2LNT A;  3GHA A;  4K7I A;  22GS A;  4O5Q A;  4MH3 A;  4FYU A;  3KP9 A;  4GSS A;  2M80 A;  3Q74 A;  3D6I A;  3I6A A;  3WGD A;  4XHM A;  3GX0 A;  3VLN A;  4G0L A;  4OFM A;  3IBH A;  1OAZ A;  3EYT A;  5CO3 A;  1TTZ A;  3HVV A;  3VWX A;  3IHG A;  2B5X A;  2I3Y A;  1GUM A;  4POK A;  5DVB A;  2B5Y A;  2E2M A;  1O73 A;  2OE0 A;  3EMP A;  5IM9 A;  1PL2 A;  5A4U A;  1Z3E A;  5HR2 A;  3EC3 A;  1NHY A;  2QKE A;  1UC7 A;  3KM6 A;  1TU7 A;  2O89 A;  1XW6 A;  2V6O A;  1QUW A;  2ZNM A;  4GRF A;  2QC7 A;  2TIR A;  3IAS 2;  5G30 A;  2GQK A;  4YAV A;  4OO5 A;  3PH9 A;  1HNB A;  3L9U A;  1THX A;  4MCU A;  3GNJ A;  2LJA A;  3GYK A;  3D4M A;  2WCI A;  1CQG A;  4L0U A;  2LKU A;  2VL9 A;  3VUR A;  1FVK A;  3QFA C;  5B6M A;  3LWA A;  3DVW A;  5GST A;  3EE2 A;  1X9W B;  2PVO C;  4EL1 A;  3O76 A;  1YJ6 A;  1K0O A;  1GTA A;  3VPQ A;  16GS A;  2ON7 A;  1O85 A;  2H8L A;  1GL8 A;  5D93 A;  3GTU B;  3CQF A;  3A2X A;  3R2Q A;  4PX1 A;  3UBL A;  2C1Y A;  2GZY A;  2X49 A;  1KBN A;  1ABA A;  2R4V A;  4XS6 A;  6GSS A;  5IIZ A;  3EWL A;  5IMF A;  2DMM A;  1A0F A;  3KGK A;  2VD0 A;  3LEF A;  1PD2 1;  1H4O A;  4MJE A;  17GS A;  1WIK A;  2L6C A;  4RUV A;  4ECI A;  2B3S A;  2A4V A;  3UVH A;  2MBT A;  4I97 A;  3F4R A;  1XOA A;  3OR5 A;  4IP6 A;  3FKF A;  4LMV A;  3U5R E;  3HJO A;  4GWR A;  2HZE B;  1F6M C;  3M1G A;  1G0T A;  4FYC A;  3TCO A;  3FRC A;  4OWY A;  3TJF A;  3LW9 A;  3IE3 A;  4HDE A;  2DBC A;  4ACS A;  5G2Z A;  3A3T A;  4TR1 B;  3APS A;  2E7P A;  1GUK A;  3C73 A;  4EC0 A;  1IYH A;  1TRW A;  3M9K A;  5ECS A;  2NVL A;  5DCH A;  3BD2 A;  4IVF A;  1TRS A;  1YKA A;  2GTU A;  4P3Y B;  1SKR B;  1MTC A;  2LS5 A;  3E9J B;  2A4H A;  2OE3 A;  1SJI A;  1B4P A;  3HJM A;  2H1B A;  1OC9 A;  5IPG A;  1JHB A;  3KZQ A;  2ES7 A;  4I8B A;  2RLI A;  4HEA 2;  2M72 A;  4Q5Q A;  2R37 A;  1PX7 A;  2QA2 A;  2KOK A;  4G0K A;  5ELG A;  1GUL A;  1A2J A;  5CP1 A;  1HD2 A;  1O7U A;  4OO4 A;  1YDK A;  2WZ9 A;  1HQO A;  1RW1 A;  3QMX A;  2WGR A;  4YAP A;  1WPI A;  1SL1 B;  4BVY A;  4K2D A;  1T1V A;  5GSS A;  2H6X A;  1ZMA A;  4FH8 A;  13GS A;  2X99 A;  1PKZ A;  2PGT A;  4PTS A;  2HRK A;  2HZF A;  4MDC A;  4L5O A;  5FWG A;  4F03 A;  2C0G A;  3ZZX A;  2OBI A;  4TR4 A;  5DJL A;  3UEM A;  5ECR B;  5LNK e;  4TRX A;  4IS0 A;  3UJ1 A;  1FW1 A;  1WP0 A;  1F3B A;  1O8W A;  1SD8 A;  4ULX A;  4ZL7 A;  2P31 A;  4EIQ A;  1VF3 A;  5D9T A;  3KMN A;  1OYJ A;  2LV3 A;  3RDW A;  5B8A A;  2XC2 A;  4O92 A;  5EPF A;  2HXK A;  5AIS A;  1ERW A;  1TK5 B;  2JL4 A;  1DE2 A;  1PSQ A;  4EUY A;  3M9J A;  1AAZ A;  3CSJ A;  1URM A;  3TDG A;  1T00 A;  2CV4 A;  4ZIJ A;  3HJP A;  4K0G A;  6GSY A;  5KEJ A;  4N0V A;  3GA4 A;  1G6W A;  1GLP A;  1EZK A;  4KB3 A;  1WMJ A;  4AJ8 A;  3TRX A;  2IME A;  2LJR A;  1K0N A;  3IK9 A;  5C00 A;  1TW9 A;  3A2W A;  3G7J A;  3GN3 A;  3R3E A;  3KH9 A;  5CRH A;  2H73 A;  2LRC A;  1S3R A;  2L5L A;  5ECM B;  3H8Q A;  1QK8 A;  1K0B A;  4NV5 A;  4F82 A;  6GSU A;  2YP6 A;  3BJ5 A;  3IHQ A;  5E4W A;  5G1K A;  2YPM A;  4J56 E;  4XS4 B;  2JSZ A;  1Z9H A;  4OCF A;  3ZFB A;  2L4C A;  5KN3 A;  3DEX A;  2LQQ A;  3P90 A;  4I6X A;  2R0G A;  2VCW A;  2OAC A;  2QGV A;  4TR3 A;  4ML6 A;  2B7K A;  1S3A A;  1EEJ A;  2R6K A;  2DSA A;  2HRA A;  2ON5 A;  1OE7 A;  1M99 A;  1ZOF A;  1ILO A;  1WOU A;  3VWV A;  1UVZ A;  3GX8 A;  5IMC A;  2REM A;  4BVX A;  4IQ1 A;  1IYI A;  5CAX A;  1JZW A;  1MD4 A;  2YWN A;  4LA1 A;  3ZTL A;  4V1A p;  1ZYE A;  1M2B A;  3ERW A;  3WD6 A;  2OJL A;  1F2E A;  4EIP A;  1TJD A;  1V98 A;  18GS A;  1PL1 A;  3HVN A;  5HFI A;  4MP4 A;  4HQZ A;  4DVC A;  3LXT A;  3L0H A;  1SJ6 A;  1GNW A;  3G9B A;  3HZ4 A;  3EU4 A;  2J9H A;  2A2R A;  4EKZ A;  2VL2 C;  1XWC A;  1JZR A;  4HOJ A;  4HU9 A;  2F9S A;  3GKK A;  3QOU A;  3GIX A;  2FHE A;  3QAV A;  5AIV A;  3RPN A;  2H1D A;  1PFO A;  4EXJ A;  2VOC A;  1U88 A;  3RBT A;  1ERT A;  4YKG A;  2OE1 A;  2HRN A;  3UIW A;  2GSS A;  1V57 A;  5CRE A;  1YF0 A;  3RHB A;  5HR0 A;  3H93 A;  3IRA A;  2DJ0 A;  4BIK A;  4N30 A;  2DJK A;  2BMX A;  4HUA A;  3GH6 A;  2C80 A;  5GAP D;  4IGJ A;  1XPV A;  4ZBB A;  3MAK A;  4ISD A;  4PUR A;  3UOM A;  4BPY A;  4WF4 A;  1XG8 A;  2F3M A;  3TJJ A;  2ZCT A;  3D4T A;  3ZML A;  4O5U A;  3ZMK A;  3F4S A;  1SJZ A;  1BJX A;  2H30 A;  2YZH A;  3QDN A;  5D96 A;  3DXB A;  3L4N A;  4KGI A;  1V40 A;  4MAB A;  1GNE A;  3TJB A;  5JWQ B;  1KTE A; 
#chains in the Genus database with same CATH homology
 4WF5 A;  3A5W A;  2YWM A;  4F0B A;  1G7O A;  1MDJ A;  2RII A;  3GSS A;  2H01 A;  2WS2 A;  2H1A A;  1M9B A;  4HQS A;  1XVQ A;  3V1W A;  2FY6 A;  1X9S B;  2X4A A;  5CYY A;  2LQO A;  2WUL A;  3W6G A;  1VRS D;  2AV4 A;  2H66 A;  2C0F A;  4OMV A;  3SBC A;  5G5E A;  2DLX A;  2JSY A;  5DJM A;  2IPA A;  3KMO A;  2H6Y A;  2RUF A;  3TKR A;  4EVM A;  3FR9 A;  3KEB A;  4IW9 A;  4KSO A;  4RQX A;  3P7X A;  1JZO A;  4Z2U A;  4PNG A;  4O5R A;  2AJQ B;  1TK0 B;  5HR3 A;  1BG5 A;  2FGX A;  4K7O A;  1S3D A;  3GL3 A;  2I4A A;  1MD3 A;  4XCS A;  1T4Z A;  2RUE A;  1H75 A;  2HI7 A;  5ECI B;  1GH2 A;  1GSQ A;  5IO2 A;  1OVN A;  2GGT A;  2YZU A;  1PA3 A;  1GSD A;  3ME8 A;  1VGL A;  4MPF A;  4WR4 A;  4OD7 A;  5IO0 A;  1QMV A;  1GUH A;  2I9H A;  3GKN A;  4N11 A;  3K8N A;  3FYG A;  1EWX A;  2V6K A;  3KJY A;  4HI7 A;  4KX4 A;  1XBS A;  1GSF A;  2FCH A;  3D5J A;  1PQN A;  4Q5F A;  2HYX A;  1K0A A;  3CTF A;  2FA8 A;  2PN8 A;  3L9V A;  1QGV A;  2IIY A;  5JCW A;  4K9Z A;  4Z2T A;  1KNG A;  3FR6 A;  2RM5 A;  3I9V 2;  3L78 A;  5D9W A;  3TGZ A;  4ID0 A;  2FLS A;  2PVQ A;  3CSH A;  3H79 A;  2Z9S A;  10GS A;  4HZ4 A;  3HHV A;  1C72 A;  4POM A;  1YEX A;  3PPU A;  5JWR B;  1ZCP A;  2GST A;  3A2V A;  3LOR A;  3HD5 A;  1N8J A;  4YQM A;  3HZ8 A;  5IMA A;  1AXD A;  5ECH B;  4ZL8 A;  4EF0 A;  5IQY A;  4KH7 A;  3FHK A;  5F8B A;  1GRX A;  1SYR A;  1LBK A;  4GTU A;  2DJ2 A;  1HNA A;  4K6X A;  2H0G A;  2C3T A;  2IMK A;  5IOW A;  1VF1 A;  3BCK A;  2DIZ A;  2R3X A;  4IJI A;  3VWW A;  2L4Q A;  2JZT A;  2H70 A;  2MMO A;  2MMZ A;  2O8V B;  1M7T A;  3KH7 A;  3ME7 A;  1XW5 A;  2LTK A;  1FB0 A;  2I81 A;  1FOH A;  4YKF A;  3FW2 A;  5G5F A;  2GZP A;  3F8U A;  1Z6M A;  5DCG A;  3KTL A;  5HFG A;  1W89 A;  3GKX A;  3RHC A;  1XXU A;  4ICY A;  1YQ1 A;  1AQV A;  4IHU A;  4MZW A;  5CNW A;  1GLQ A;  2VCT A;  1OC9 B;  2GVP A;  1AC1 A;  1QFN A;  2R2J A;  1ON4 A;  2HNL A;  3QAW A;  1SK2 A;  3FEU A;  1YEP A;  4NXI A;  4K8M A;  4MJA A;  2JAC A;  5F06 A;  3CMI A;  2PUK C;  5J9C A;  1EOH A;  1GSE A;  2PPT A;  1A23 A;  3D0Z A;  2P5R A;  1ZZY A;  5ECL B;  4BVY B;  4PXO A;  3HYP A;  4G0I A;  3DRN A;  4LL4 B;  1TI3 A;  1BX9 A;  2K6V A;  5AN1 A;  2H6Z A;  5ELA A;  1R4W A;  3KXO A;  4YQV A;  3QD9 A;  3P2A A;  3HVX A;  2JAD A;  1FVJ A;  3TKS A;  1RQM A;  5IMV A;  1TKD B;  2VAF A;  3I69 A;  3ZYW A;  2TRX A;  3IR4 A;  1E6B A;  5COH A;  3LGC A;  3KIJ A;  1T7P B;  1SK1 A;  1I9D A;  2WFC A;  4HS1 A;  2FUG 2;  4MLY A;  5DQY A;  4XS1 A;  3JCM L;  3BOA A;  3TJK A;  2QA1 A;  1DBY A;  1TU8 A;  4NAX A;  4PQH A;  3J7Y b;  2VM2 A;  3TRQ A;  4TKY A;  2FWH A;  2MYG A;  5AIX A;  2CQ9 A;  1EGR A;  2C0E A;  3IDV A;  3MIX A;  1Z6N A;  3WGE A;  2L6D A;  5AGY A;  2LJK A;  3KCM A;  3F0I A;  2KHP A;  4MZC A;  1K3Y A;  4TOP A;  4ZB8 A;  3TUE A;  1FAA A;  2AB6 A;  5ENU A;  4ECC A;  4OCE A;  2CAQ A;  2B6M A;  3CRU A;  3BCI A;  2H19 A;  5ABR A;  3IXR A;  3US3 A;  5INY A;  3FK8 A;  2H75 A;  4TXO B;  1J0F A;  1XW9 A;  2I1U A;  3W8J A;  1E2Y A;  4USS A;  4J57 E;  3Q19 A;  5JCG A;  5KOW A;  2C8U A;  2KP2 A;  1GSU A;  4A5P A;  1ML6 A;  2H72 A;  1X0R A;  2K8V A;  2FA4 A;  3IA1 A;  2UZ8 A;  4N10 A;  2X64 A;  4XRA A;  3GH9 A;  3EPT A;  2IN3 A;  2PU9 C;  5E59 A;  3DD3 A;  4TN8 A;  4IKH A;  2GQM A;  4I2T A;  4NMU A;  4EDY A;  4MZB A;  4QL9 A;  3GMF A;  2VIM A;  4TXO A;  4OFN A;  3IC8 A;  1O6J A;  2JZR A;  3G7Y A;  4WBJ A;  5BRT A;  3ERG A;  3LG6 A;  5ECN B;  4BVX B;  3W8S A;  1OE8 A;  1DE1 A;  3MYD A;  3O3T A;  5ECK B;  3F63 A;  2G0F A;  5IMD A;  2O7K A;  4IBP A;  1ZYN A;  4NWY A;  1XWK A;  1B48 A;  1O81 A;  4CY8 A;  3UL3 A;  3VWU A;  2H0I A;  4JBB A;  4PQ1 A;  5BMU A;  2BJX A;  4EE0 A;  3HDC A;  2CAI A;  4HJM A;  2K8S A;  4POB A;  1J08 A;  2LRN A;  2K9F A;  4PGT A;  2EC4 A;  4ZIL A;  4EO3 A;  5ID2 B;  2IMF A;  4MJB A;  4RQR A;  4WKW A;  4O32 A;  3TKQ A;  4V2N A;  1JLV A;  2FD3 A;  1Y25 A;  1TRV A;  20GS A;  3UBK A;  5F0G A;  9GSS A;  4K0N A;  1TI1 A;  4BWS A;  4MPG A;  2YOI A;  1R5A A;  3CXG A;  4GSN A;  3GST A;  3QAG A;  4RI6 A;  4KE3 A;  5J4U A;  3ZIT A;  3APO A;  2AHE A;  2B7J A;  3EUR A;  1R7H A;  3C71 A;  5GZZ B;  2IMI A;  1Y6E A;  2OA7 A;  4OFT A;  2R0P A;  6GSV A;  2X8C A;  1X9M B;  4ZL9 A;  3HKR A;  3C1S A;  5EVO A;  5CRW A;  5ID2 A;  2CZ3 A;  3FMW A;  3DYR A;  3IV4 A;  2NTO A;  4AJ7 A;  4D73 A;  3RPP A;  2BTO T;  1QXH A;  2E0Q A;  4PQI A;  3HCZ A;  4ML1 A;  3TB2 A;  2LST A;  3VPT A;  1AUC A;  5CRG A;  3LXZ A;  3ZL5 A;  5IOX A;  2AUV A;  2H1G A;  2NDO A;  4PUA A;  1GTU A;  11GS A;  1OC3 A;  1B9X C;  3QR6 A;  3D22 A;  4GF0 A;  2HSH A;  3Q18 A;  2KLX A;  5DAL A;  1VF4 A;  2QSI A;  1GSY A;  4YQU A;  1FOV A;  1G7E A;  4LMW A;  3A5I A;  2GS3 A;  1S3C A;  4LL1 B;  2LUS A;  4IJ3 A;  2IL3 A;  4XIH A;  1FG4 A;  2YNX A;  2VL3 A;  2CA8 A;  2OBK A;  3MDK A;  2VM1 A;  2YAN A;  4XRD A;  1SL0 B;  4DSS B;  3C7M A;  3TOT A;  2IFQ A;  3ZFL A;  1USB A;  4CDO A;  4RI7 A;  1WJK A;  1TDI A;  3APQ A;  4JRR A;  1A2L A;  3UVT A;  1PX6 A;  1J9B A;  1XZO A;  4X43 A;  2VCX A;  4TVE A;  2WJU A;  1M2A A;  4V2L A;  2LRT A;  2VLV A;  1DUG A;  1R5P A;  4G19 A;  4DSS A;  3UAR A;  1ZGN A;  5FHI A;  1OC8 A;  4N0Z A;  1HNC A;  2XPD A;  2J23 A;  1ERV A;  2ZUP A;  4TXV A;  1FO5 A;  1EV4 A;  1CQH A;  3FZ9 A;  5LCZ A;  2MMA A;  5B6N A;  2DJJ A;  4GCI A;  1M0U A;  4KW6 A;  4L8E A;  5DAK A;  5D9V A;  2VLT A;  2F8F A;  2WB9 A;  3CYN A;  1EGO A;  4ECJ A;  1TRU A;  3ISO A;  3WT2 A;  4MF7 A;  2HLS A;  3DVX A;  4X1U A;  4BL7 B;  5A4V A;  3GL5 A;  1NSW A;  4ZXG A;  1WWJ A;  4IP1 A;  3LJR A;  2XPE A;  4FIW A;  1Z7R A;  1SL2 B;  5G31 A;  4TR0 A;  5G1L A;  2K18 A;  2CX4 A;  3CRT A;  2C3Q A;  4BWQ A;  2P5Q A;  4I2U A;  1GSS A;  7GSS A;  1SD9 A;  1F3A A;  1X5C A;  3QCP A;  4BL7 A;  4AJ6 A;  4Q5N A;  5DQS A;  5DDL A;  2N5B A;  1WE0 A;  3ZRD A;  5IMZ A;  4V1A g;  4GQF A;  4KDY A;  2VL2 A;  3ZIJ A;  5C04 A;  5D9X A;  1FHE A;  1PN0 A;  4KND A;  2PER A;  2YWI A;  3ZVJ A;  2FWF A;  3VFI A;  2F8A A;  2PWJ A;  2LEG A;  3P8W A;  3C8E A;  3GUR A;  1SYX A;  3ED3 A;  2GT6 A;  2YWO A;  2VCQ A;  2PBJ A;  3F3Q A;  4WR5 A;  2KP1 A;  3F4T A;  2V1M A;  1TOF A;  3N5O A;  1BYE A;  4MF6 A;  2DKI A;  3DIE A;  5D73 A;  2O87 A;  1MDK A;  1NW2 A;  4L5L A;  3GRX A;  1PGT A;  2X8G A;  2ALB A;  3NZN A;  3VK9 A;  5A4W A;  1ST9 A;  2GT5 A;  2E2G A;  4KDU A;  2DKH A;  3VI7 A;  4WEY A;  1XWA A;  2HRF A;  1GTB A;  4KCE A;  1BQ7 A;  1EEM A;  2DC5 A;  4NHW A;  5EY6 A;  5KN1 A;  4HJ2 A;  3PIN A;  2JZS A;  5L71 A;  2YCD A;  3E0U A;  1EOG A;  4K7N A;  4QL7 A;  2C4J A;  5F07 A;  1U3A A;  5IPH A;  2LNS A;  3IK7 A;  3GTU A;  4GXZ A;  2PMT A;  4DEJ A;  5GAN D;  2GSQ A;  1V9W A;  4DSQ A;  2B1K A;  2MZC A;  3ZIV A;  1AQW A;  3C1R A;  4AF2 A;  3FZA A;  5KOX A;  2VCZ A;  3HA9 A;  2XHF A;  2V2G A;  3TKS E;  4POL A;  6GST A;  3ZVJ D;  4KF9 A;  3NOF A;  3GUS A;  3D21 A;  4F2I A;  1K3O A;  1K0C A;  1Q4J A;  2N5F A;  2IMD A;  3I43 A;  5JCU A;  3IPZ A;  1PMT A;  2FWE A;  2YV9 A;  4AGS A;  1N2A A;  3BBY A;  4WBR D;  1M2D A;  6GSW A;  2VLU A;  2MBS A;  5H5S A;  2A2S A;  2HZE A;  4J2F A;  1OKD A;  2DJ1 A;  4ZBD A;  4JR6 A;  1K0D A;  3RAZ A;  3F3R A;  1TXX A;  1U87 A;  4K1F A;  1SU9 A;  4Z7X A;  4MNN A;  5J3R A;  4XTS A;  4TR1 A;  2YJH A;  4PUF C;  4JZQ A;  1XCC A;  4E8H A;  2V32 A;  2IJY A;  3AY8 A;  1B4Q A;  3O6T A;  3PGT A;  1THO A;  1ACV A;  4ZB9 A;  1YKC A;  1YY7 A;  1K0M A;  2WRT A;  4K2X A;  4MMM A;  3S9F A;  1GP1 A;  2L57 A;  2P0G A;  5LD0 A;  1V58 A;  1AIU A;  1JLW A;  4KA0 A;  2YV7 A;  4Q5R A;  4TW5 A;  4FO5 A;  4NHZ A;  4WET A;  3CSI A;  3G7I A;  4Z2R A;  1X5E A;  2G2Q A;  4K5S A;  4K5R A;  1OKT A;  2EIR A;  3KP8 A;  3CTG A;  2HT9 A;  2OKA A;  4GQC A;  1FB6 A;  3MNG A;  3TRP A;  4H86 A;  3DML A;  4G2E A;  2FWG A;  3ZRE A;  3SWL A;  3GFK A;  2CVD A;  1X5D A;  2WDU A;  4JR4 A;  4LLR A;  4ZB6 A;  2H0H A;  4I5Q A;  5DBQ A;  4ECB A;  3KD0 A;  3WGX A;  1YZX A;  1XVW A;  1F37 A;  2JU5 A;  3DWV A;  2DJ3 A;  3MSZ A;  4KCA A;  4CHS A;  3E3E A;  1F9M A;  1BED A;  4GLT A;  4EDZ A;  6GSX A;  4F0C A;  3GKM A;  4F9Z A;  1A8L A;  3M8N A;  1XWB A;  3WT1 A;  2HE3 A;  1G6Y A;  4JE1 A;  2CT6 A;  3DKS A;  4PNF A;  3VI5 A;  4FQU A;  3ZLP A;  4JED A;  3Q6O A;  5H5Q A;  3UAP A;  5CRD A;  1A24 A;  4CW9 A;  1QQ2 A;  2DML A;  1GWC A;  4NPB A;  2CVB A;  3M3M A;  4FYB A;  4G9H A;  1A0R P;  1XFL A;  1M9A A;  3FY7 A;  2TRC P;  3IAM 2;  3NIV A;  3LFL A;  4IN0 A;  2C3N A;  5B8B A;  2C0D A;  1PN9 A;  3F6D A;  2H74 A;  4V2M A;  1LU4 A;  3U6V A;  3UMA A;  5ECO B;  2A2P A;  2L59 A;  4KDX A;  3LQ7 A;  2R0C A;  1JFU A;  1V2A A;  2X8H A;  5J5N A;  2AYT A;  2V41 A;  4BA7 A;  1U6T A;  1TK8 B;  2GLR A;  2AAW A;  4QQ7 A;  1O8X A;  1RK4 A;  2N5A A;  2NBS A;  2GSR A;  4D73 B;  5JWO B;  5ECQ B;  2HFD A;  4WXT A;  1UA5 A;  2R5G A;  1SKS B;  5HR1 A;  1MDI A;  1EV9 A;  3TJG A;  5KN2 A;  2L5O A;  3EVI A;  3HY2 A;  2GDR A;  1R26 A;  2HSM A;  4NV2 A;  2DIY A;  4XS4 A;  2VCV A;  1NM3 A;  3LYK A;  14GS A;  4MF5 A;  4X0X A;  5B7C A;  2YN1 A;  3ERF A;  4JU5 A;  5KN0 A;  5DAL B;  4KSM A;  5FT3 A;  3LYP A;  4ZBA A;  3LSZ A;  2GQL A;  2KUC A;  1Z7P A;  1A2M A;  1UN2 A;  4MJC A;  4DSR A;  3DGQ A;  1EP8 A;  1K3L A;  2H71 A;  4O7H A;  3PR8 A;  5A5K A;  2FNO A;  4KAE A;  5D8I A;  2D2Z A;  3GV1 A;  1SKW B;  1DSB A;  5F05 A;  2IFQ B;  2VO4 A;  2VUP A;  12GS A;  1JZD A;  3QPM A;  2OAD A;  3N9J A;  1XIY A;  3H1N A;  1VF2 A;  3F9U A;  1EP7 A;  4X4J A;  2CVK A;  1ZYQ B;  2EIQ A;  3QFB C;  3WYW A;  1A8Y A;  1XOB A;  3IOS A;  3FR3 A;  3FZ5 A;  3IC4 A;  1SK0 A;  1T8E B;  3H4K A;  3EMX A;  2CX3 A;  2M46 A;  4IEL A;  1BAY A;  3MWH A;  1TP9 A;  4E8E A;  2YJ7 A;  5J9B A;  3J7Y k;  2H76 A;  2XBQ A;  2MMN A;  1I5G A;  3EIN A;  1Z5Y E;  3TOU A;  1PKW A;  1PRX A;  2VD1 A;  3L9S A;  1T3B A;  1MEK A;  1ERU A;  4HZ2 A;  2IWT A;  3KTB A;  4IQA A;  4YH2 A;  5DAK B;  1AW9 A;  5EL8 A;  1XWG A;  2B1L A;  19GS A;  2B5E A;  1SEN A;  1WRY A;  2O85 A;  3HVS A;  1U3I A;  4L0W A;  3CBU A;  2EIO A;  2NPB A;  1ZL9 A;  1W4V A;  1ZYP A;  2XBI A;  3TKP A;  5H5R A;  4MK3 A;  3M0F A;  1KEB A;  4G10 A;  1GTI A;  2RM6 A;  4MH2 A;  1NHO A;  3FZ4 A;  5HQP A;  2HSY A;  4HU7 A;  3TKS C;  8GSS A;  5J41 A;  1B9Y C;  3F6F A;  3EU3 A;  4GST A;  1Q98 A;  2CZ2 A;  5HFK A;  5ECP B;  1T4Y A;  1YF1 A;  4KUN A;  1LJR A;  1AQX A;  2F51 A;  2GZZ A;  4MA9 A;  4ILF A;  1B8X A;  1HYU A;  4CY6 A;  3HXS A;  2LNT A;  3GHA A;  4K7I A;  22GS A;  4O5Q A;  4MH3 A;  4FYU A;  3KP9 A;  4GSS A;  2M80 A;  3Q74 A;  3D6I A;  3I6A A;  3WGD A;  4XHM A;  3GX0 A;  3VLN A;  4G0L A;  4OFM A;  3IBH A;  1OAZ A;  3EYT A;  5CO3 A;  1TTZ A;  3HVV A;  3VWX A;  3IHG A;  2B5X A;  2I3Y A;  1GUM A;  4POK A;  5DVB A;  2B5Y A;  2E2M A;  1O73 A;  2OE0 A;  3EMP A;  5IM9 A;  1PL2 A;  5A4U A;  1Z3E A;  5HR2 A;  3EC3 A;  1NHY A;  2QKE A;  1UC7 A;  3KM6 A;  1TU7 A;  2O89 A;  1XW6 A;  2V6O A;  1QUW A;  2ZNM A;  4GRF A;  2QC7 A;  2TIR A;  3IAS 2;  5G30 A;  2GQK A;  4YAV A;  4OO5 A;  3PH9 A;  1HNB A;  3L9U A;  1THX A;  4MCU A;  3GNJ A;  2LJA A;  3GYK A;  3D4M A;  2WCI A;  1CQG A;  4L0U A;  2LKU A;  2VL9 A;  3VUR A;  1FVK A;  3QFA C;  5B6M A;  3LWA A;  3DVW A;  5GST A;  3EE2 A;  1X9W B;  2PVO C;  4EL1 A;  3O76 A;  1YJ6 A;  1K0O A;  1GTA A;  3VPQ A;  16GS A;  2ON7 A;  1O85 A;  2H8L A;  1GL8 A;  5D93 A;  3GTU B;  3A2X A;  3R2Q A;  4PX1 A;  3UBL A;  2C1Y A;  2GZY A;  2X49 A;  1KBN A;  1ABA A;  2R4V A;  4XS6 A;  6GSS A;  5IIZ A;  3EWL A;  5IMF A;  2DMM A;  1A0F A;  3KGK A;  2VD0 A;  3LEF A;  1PD2 1;  1H4O A;  4MJE A;  17GS A;  1WIK A;  2L6C A;  4RUV A;  4ECI A;  2B3S A;  2A4V A;  3UVH A;  2MBT A;  4I97 A;  3F4R A;  1XOA A;  3OR5 A;  4IP6 A;  3FKF A;  4LMV A;  3U5R E;  3HJO A;  4GWR A;  2HZE B;  1F6M C;  3M1G A;  1G0T A;  4FYC A;  3TCO A;  3FRC A;  4OWY A;  3TJF A;  3LW9 A;  3IE3 A;  4HDE A;  2DBC A;  4ACS A;  5G2Z A;  3A3T A;  4TR1 B;  3APS A;  2E7P A;  1GUK A;  3C73 A;  4EC0 A;  1IYH A;  1TRW A;  3M9K A;  5ECS A;  2NVL A;  5DCH A;  3BD2 A;  4IVF A;  1TRS A;  1YKA A;  2GTU A;  4P3Y B;  1SKR B;  1MTC A;  2LS5 A;  3E9J B;  2A4H A;  2OE3 A;  1SJI A;  1B4P A;  3HJM A;  2H1B A;  1OC9 A;  5IPG A;  1JHB A;  3KZQ A;  2ES7 A;  4I8B A;  2RLI A;  4HEA 2;  2M72 A;  4Q5Q A;  2R37 A;  1PX7 A;  2QA2 A;  2KOK A;  4G0K A;  5ELG A;  1GUL A;  1A2J A;  5CP1 A;  1HD2 A;  1O7U A;  4OO4 A;  1YDK A;  2WZ9 A;  1HQO A;  1RW1 A;  3QMX A;  2WGR A;  4YAP A;  1WPI A;  1SL1 B;  4BVY A;  4K2D A;  1T1V A;  5GSS A;  2H6X A;  1ZMA A;  4FH8 A;  13GS A;  2X99 A;  1PKZ A;  2PGT A;  4PTS A;  2HRK A;  2HZF A;  4MDC A;  4L5O A;  5FWG A;  4F03 A;  2C0G A;  3ZZX A;  2OBI A;  4TR4 A;  5DJL A;  3UEM A;  5ECR B;  5LNK e;  4TRX A;  4IS0 A;  3UJ1 A;  1FW1 A;  1WP0 A;  1F3B A;  1O8W A;  1SD8 A;  4ULX A;  4ZL7 A;  2P31 A;  4EIQ A;  1VF3 A;  5D9T A;  3KMN A;  1OYJ A;  2LV3 A;  3RDW A;  5B8A A;  2XC2 A;  4O92 A;  5EPF A;  2HXK A;  5AIS A;  1ERW A;  1TK5 B;  2JL4 A;  1DE2 A;  1PSQ A;  4EUY A;  3M9J A;  1AAZ A;  3CSJ A;  1URM A;  3TDG A;  1T00 A;  2CV4 A;  4ZIJ A;  3HJP A;  4K0G A;  6GSY A;  5KEJ A;  4N0V A;  3GA4 A;  1G6W A;  1GLP A;  1EZK A;  4KB3 A;  1WMJ A;  4AJ8 A;  3TRX A;  2IME A;  2LJR A;  1K0N A;  3IK9 A;  5C00 A;  1TW9 A;  3A2W A;  3G7J A;  3GN3 A;  3R3E A;  3KH9 A;  5CRH A;  2H73 A;  2LRC A;  2L5L A;  5ECM B;  3H8Q A;  1QK8 A;  1K0B A;  4NV5 A;  4F82 A;  6GSU A;  2YP6 A;  3BJ5 A;  3IHQ A;  5E4W A;  5G1K A;  2YPM A;  4J56 E;  4XS4 B;  2JSZ A;  1Z9H A;  4OCF A;  3ZFB A;  2L4C A;  5KN3 A;  3DEX A;  2LQQ A;  3P90 A;  4I6X A;  2R0G A;  2VCW A;  2OAC A;  2QGV A;  4TR3 A;  4ML6 A;  2B7K A;  1S3A A;  1EEJ A;  2R6K A;  2DSA A;  2HRA A;  2ON5 A;  1OE7 A;  1M99 A;  1ZOF A;  1ILO A;  1WOU A;  3VWV A;  1UVZ A;  3GX8 A;  5IMC A;  2REM A;  4BVX A;  4IQ1 A;  1IYI A;  5CAX A;  1JZW A;  1MD4 A;  2YWN A;  4LA1 A;  3ZTL A;  4V1A p;  1ZYE A;  1M2B A;  3ERW A;  3WD6 A;  2OJL A;  1F2E A;  4EIP A;  1TJD A;  1V98 A;  18GS A;  1PL1 A;  5HFI A;  4MP4 A;  4HQZ A;  4DVC A;  3LXT A;  3L0H A;  1SJ6 A;  1GNW A;  3G9B A;  3HZ4 A;  3EU4 A;  2J9H A;  2A2R A;  4EKZ A;  2VL2 C;  1XWC A;  1JZR A;  4HOJ A;  4HU9 A;  2F9S A;  3GKK A;  3QOU A;  3GIX A;  2FHE A;  3QAV A;  5AIV A;  3RPN A;  2H1D A;  4EXJ A;  2VOC A;  1U88 A;  3RBT A;  1ERT A;  4YKG A;  2OE1 A;  2HRN A;  3UIW A;  2GSS A;  1V57 A;  5CRE A;  1YF0 A;  3RHB A;  5HR0 A;  3H93 A;  3IRA A;  2DJ0 A;  4N30 A;  2DJK A;  2BMX A;  4HUA A;  3GH6 A;  2C80 A;  5GAP D;  4IGJ A;  1XPV A;  4ZBB A;  3MAK A;  4ISD A;  4PUR A;  3UOM A;  4BPY A;  4WF4 A;  2F3M A;  3TJJ A;  2ZCT A;  3D4T A;  3ZML A;  4O5U A;  3ZMK A;  3F4S A;  1SJZ A;  1BJX A;  2H30 A;  2YZH A;  3QDN A;  5D96 A;  3DXB A;  3L4N A;  4KGI A;  1V40 A;  4MAB A;  1GNE A;  3TJB A;  5JWQ B;  1KTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...