3HVVA

Escherichia coli thiol peroxidase (tpx) peroxidatic cysteine to serine mutant (c61s)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
167
structure length
167
Chain Sequence
SQTVHFQGNPVTVANSIPQAGSKAQTFTLVAKDLSDVTLGQFAGKRKVLNIFPSIDTGVSAASVRKFNQLATEIDNTVVLCISADLPFAQSRFCGAEGLNNVITLSTFRNAEFLQAYGVAIADGPLKGLAARAVVVIDENDNVIFSQLVDEITTEPDYEAALAVLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol peroxidase
publication title Structural changes common to catalysis in the Tpx peroxiredoxin subfamily.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 52
structure length 167
sequence length 167
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3hvvA00
5B6NA 2FHEA 5G1KA 4XRAA 5ECQB 3TB2A 4JZQA 3M1GA 3M9JA 3RAZA 1ERVA 5J5NA 1O6JA 1GL8A 2FA8A 3F4TA 2H01A 4GSTA 3LQ7A 4PQIA 1KNGA 5JCGA 1GUHA 1J08A 2ZNMA 1SD8A 2LNTA 1M9AA 2L4CA 1Q4JA 4BL7A 5GAPD 4ECJA 2M72A 5GSTA 1CQGA 1WE0A 4EF0A 3IAM2 2WB9A 1B4QA 14GSA 3HVSA 4ZB8A 3VLNA 2HSHA 2HZFA 3ME8A 3PR8A 5H5RA 1GTAA 3L9VA 2YWIA 1A24A 3HJOA 2N5FA 3HVXA 4FYUA 4ECBA 2O87A 4X43A 4G2EA 2XPDA 17GSA 2H6ZA 3K8NA 4AGSA 4OCFA 2AHEA 1WP0A 1PRXA 5KEJA 3CMIA 4GF0A 1UN2A 3UVHA 4O5RA 3FR3A 3HKRA 2H8LA 3QOUA 1B9XC 2VL2A 4MK3A 2VLVA 3H4KA 1MTCA 2BJXA 1T8EB 1Z6NA 2JZTA 1Z5YE 2VCWA 4JE1A 3I69A 4OO5A 6GSXA 4L8EA 2NPBA 2NDOA 4IVFA 3ME7A 2PERA 1QXHA 3EMPA 5B8AA 1TK5B 1HNAA 3DKSA 4TR1B 4Q5NA 4WETA 1J0FA 3UVTA 4NV5A 1GSDA 3LG6A 4HDEA 2LRTA 2K6VA 5G1LA 5CRGA 3MAKA 1SENA 4K2DA 4PNGA 2TIRA 4PQ1A 2IIYA 4FH8A 4ZBBA 2ON5A 1URMA 4RQXA 1QFNA 3W8SA 5CO3A 4GQFA 2GSQA 1HNCA 3N9JA 3VWWA 3GN3A 5HR3A 5G2ZA 1HNBA 1QK8A 4N0VA 3ZVJA 1JFUA 3DVXA 2E7PA 4EXJA 3OR5A 2DJ2A 4XS1A 3I6AA 2FY6A 3EU4A 2FA4A 2LNSA 2VIMA 2QKEA 2YWOA 3BJ5A 1WOUA 1OC9A 3I9V2 1GUMA 1ZCPA 5AIVA 4MZWA 2WDUA 2JU5A 22GSA 1VF4A 4GSNA 2LSTA 1YY7A 1SK1A 5IO0A 3GSSA 1ZL9A 2C3QA 1M7TA 4V2MA 1B9YC 2CZ2A 2WJUA 1A0RP 4TR1A 4J2FA 1TRWA 5ECIB 1IYHA 4F9ZA 2XHFA 5FT3A 5LD0A 1X9WB 5GAND 5A4WA 3GKNA 1SKRB 4TKYA 2H71A 2RM5A 2H6XA 4ZB9A 1ON4A 1OC3A 4KH7A 1QGVA 3IAS2 4PURA 18GSA 2I9HA 4WF4A 5IMFA 3RBTA 1DSBA 3D0ZA 9GSSA 3BBYA 3QDNA 3F8UA 1PGTA 2LKUA 3FEUA 2H1BA 3ZIJA 3TGZA 1T4YA 1EP7A 2HRNA 2R6KA 2H1DA 1GSEA 2VAFA 2IMDA 4OWYA 4EE0A 20GSA 3LJRA 5E59A 1A2JA 2AYTA 1RK4A 2GZZA 1V9WA 5ECNB 4KCAA 3FW2A 1F3BA 3L4NA 1T3BA 4KGIA 4RI6A 2JL4A 5IPGA 1PX6A 1FO5A 5JCWA 2V2GA 4X0XA 3U5RE 2LEGA 3IC4A 3TJFA 4MP4A 4MMMA 2WRTA 2ZCTA 2EIQA 4J56E 1G7EA 2YCDA 2MBTA 1TI1A 2JSYA 4EC0A 1GLQA 4O92A 1H4OA 3ZFLA 2I4AA 2DLXA 4ZBDA 1AQVA 1FB0A 2V6KA 4KDYA 4NMUA 5G31A 2CV4A 1JLVA 2LRCA 2DJ1A 2VUPA 5ID2B 3UAPA 2TRCP 1ZOFA 2H1GA 5DDLA 1LJRA 3U6VA 3VFIA 4BA7A 4E8EA 5G5FA 4GRFA 3MNGA 5IMAA 1HQOA 3ZTLA 2YNXA 3KMNA 1NHOA 3C1SA 3UOMA 3WGEA 1Z9HA 5DQSA 2PMTA 1X5CA 1GLPA 6GSVA 2OE0A 3Q74A 2REMA 1V2AA 4ML6A 5DVBA 3H79A 4IELA 2IMKA 2VM2A 1LBKA 5IMZA 3EMXA 4IKHA 4GSSA 3J7Yb 3C1RA 1ZZYA 3DRNA 3CSIA 4K0GA 1WRYA 3EE2A 2P5RA 3GL5A 4HUAA 2PPTA 5DCHA 2GT5A 4V1Ap 1EZKA 2C80A 1E6BA 3HZ8A 2PVOC 5D96A 1TU8A 4Q5RA 3DD3A 1B4PA 4PX1A 2H66A 3ERGA 2PGTA 1XFLA 1Q98A 2DIZA 3VK9A 3WGXA 4HQZA 3APOA 4JEDA 1M2AA 3QAVA 3KD0A 1PMTA 3IR4A 3O76A 4EDZA 3WYWA 4I8BA 3BCKA 2CVDA 4JR4A 4PUAA 2MYGA 4WBJA 3PINA 1PSQA 1YJ6A 4AJ8A 4XS4A 4NXIA 3DWVA 3APSA 4MZCA 1AUCA 5JCUA 1JZOA 4MJAA 1M9BA 1TXXA 3P7XA 4RUVA 2KHPA 2G2QA 2I1UA 2X8GA 3KGKA 1G7OA 5LCZA 1GP1A 2IMFA 4NHWA 2GSTA 3GHAA 1KTEA 2DJ0A 4FIWA 4PXOA 3ZYWA 3DVWA 4FYCA 1AXDA 4AJ7A 1WJKA 3QPMA 2LV3A 4OO4A 5COHA 2DJ3A 1TKDB 1A8LA 3E0UA 2HE3A 1SJIA 4V2NA 3UMAA 2RIIA 5CAXA 4IQ1A 1W4VA 4HEA2 1XBSA 3ED3A 1PD21 3CSJA 2YP6A 1GH2A 3M9KA 2GS3A 2H30A 1EWXA 1XWBA 3C71A 3W8JA 2FUG2 4POLA 3WGDA 5IOWA 3H93A 1UC7A 1XW6A 4KUNA 2CVKA 3KTLA 2VLUA 2DIYA 3KP9A 3E3EA 1LU4A 4I97A 4IP6A 4ZXGA 2B5EA 3HJMA 1TU7A 4IW9A 2B3SA 2RM6A 2V41A 1GTBA 3CTFA 2YANA 2CZ3A 3TUEA 1Y6EA 2F51A 5F06A 5IMVA 1XPVA 3KXOA 2IPAA 2DBCA 4JRRA 5IMDA 3ZRDA 2H76A 2LQOA 4YAVA 4WXTA 3R2QA 5INYA 5ECSA 2R37A 2LTKA 2G0FA 3FR6A 1XVQA 2C3TA 3VPQA 1EOGA 3GX0A 3HD5A 4TXOA 5G30A 1OVNA 3GH6A 5ECKB 3KP8A 1TI3A 6GSUA 2BMXA 3MWHA 2IMEA 2H74A 3QAWA 5CRWA 4TR3A 1I9DA 5ENUA 3TKPA 2OJLA 2H70A 3G7IA 5HQPA 2QC7A 3EU3A 3O6TA 3D4MA 2H75A 4EDYA 5HR2A 2CX3A 4ZILA 5B7CA 3F6FA 2L5OA 4G9HA 4MF5A 4RI7A 3M0FA 4O7HA 4EO3A 1K0AA 3EYTA 4BVYA 3JCML 2O85A 4MF7A 1Z7RA 2WS2A 3VWUA 4Z7XA 1V57A 3F9UA 3NZNA 2DC5A 4OFMA 5H5SA 1SK0A 1J9BA 4K9ZA 3GIXA 1O73A 2H73A 3G7JA 2WZ9A 5IMCA 4F2IA 1G6YA 3L9SA 1TOFA 4J57E 4ISDA 1XCCA 4X1UA 2CQ9A 1OC9B 4L0WA 1ZMAA 2QSIA 3WT1A 1XWCA 4PNFA 3C8EA 1OKDA 2DSAA 1PN9A 5C00A 3DYRA 1THOA 2MMOA 1E2YA 2R2JA 1ZYQB 1U88A 5D8IA 1SJZA 1FHEA 3US3A 2C0DA 1GSYA 2KOKA 2K8SA 3A2VA 3ZVJD 3QCPA 2X99A 1IYIA 4XS6A 1X9SB 1MD3A 2CX4A 4F0BA 3KMOA 1M99A 3QFAC 5IQYA 1K0MA 1PKZA 1X0RA 4N0ZA 1EEMA 4GXZA 3M3MA 2NTOA 2YWMA 1K0OA 2RUFA 4GWRA 4MH3A 2JSZA 3AY8A 3HJPA 1WIKA 3WD6A 1MDKA 3D4TA 1X5DA 4G19A 3NIVA 4WEYA 4G10A 3V1WA 4AF2A 4PUFC 3HVVA 1U3IA 2C1YA 1XOAA 4QL9A 2DJKA 1UVZA 5JWOB 4Q5QA 1EEJA 2VO4A 3LXZA 1FOVA 2C8UA 2PN8A 1PL2A 3FZ4A 1SU9A 4AJ6A 3HDCA 4NPBA 4KSOA 2HSYA 4NWYA 3TJJA 2CVBA 5B6MA 5B8BA 5EPFA 1QQ2A 1Z7PA 3QFBC 1M2BA 3P90A 1CQHA 5IIZA 2D2ZA 6GSYA 2EIOA 3ZFBA 1BEDA 2H0HA 4I6XA 1PA3A 1NHYA 3GTUB 4IN0A 5F07A 1GRXA 2VD0A 1NSWA 1A2LA 1H75A 1K0DA 1I5GA 3HXSA 1TK8B 1S3AA 3DIEA 1BYEA 1FAAA 1YEXA 4WR4A 4K7OA 1XW9A 2OE1A 3P8WA 5IO2A 1EOHA 4WKWA 2YV7A 4K8MA 2FCHA 3TCOA 1ML6A 4KB3A 4XIHA 3GA4A 1U3AA 2R3XA 2I3YA 4XRDA 2HLSA 1R7HA 3C7MA 5CRHA 1KBNA 2C0GA 3CYNA 5FHIA 3GX8A 4ILFA 3GNJA 4KCEA 5DAKA 2FNOA 1DBYA 1V58A 3KEBA 4TXVA 4CHSA 2GDRA 2HXKA 4MJEA 1JHBA 4LLRA 1K0NA 2VL2C 3CBUA 2AJQB 3RPPA 3KH7A 4YQUA 5L71A 3L0HA 4JU5A 2F8FA 3ERWA 1UA5A 1EV4A 1XW5A 3KJYA 2MMZA 3ZMLA 3QR6A 2YOIA 2VCVA 4IHUA 4F82A 3GTUA 2OBKA 1T4ZA 3LEFA 4NAXA 1BJXA 3GFKA 2C3NA 3EINA 1K3YA 4XS4B 2IN3A 1O81A 4KX4A 10GSA 2YPMA 1O85A 2OACA 4ZIJA 1B48A 5EY6A 2O7KA 2TRXA 2K9FA 3FYGA 3UBLA 3ZIVA 3IPZA 5F0GA 1GSUA 2DMLA 5ECOB 1OE7A 3P2AA 2H0GA 2PUKC 3Q19A 3VI5A 2V1MA 1YKCA 2AUVA 5GSSA 5GZZB 3TOUA 2HFDA 1R26A 2H6YA 2M80A 2YZUA 1A23A 3UL3A 2H1AA 3ERFA 4YQVA 2FLSA 2PU9C 3LXTA 5LNKe 1SL1B 2E2MA 2H72A 4N10A 1TK0B 1F3AA 2IL3A 2ZUPA 2VM1A 3PGTA 4K1FA 4HQSA 2B5YA 2XC2A 5HR1A 3RHBA 5ECHB 2ALBA 4KAEA 3LSZA 3APQA 2KLXA 4WF5A 2HT9A 1BAYA 2GGTA 2V6OA 4NHZA 1PL1A 1YF0A 5D93A 5AN1A 5J9CA 1QMVA 1SL0B 1PX7A 2DJJA 3CRUA 2O89A 3KCMA 2MMAA 19GSA 5IOXA 3IDVA 4CDOA 5AIXA 5IPHA 2IFQA 3IV4A 3MDKA 13GSA 2OKAA 2VCTA 3N5OA 1SK2A 5D9VA 1ABAA 1C72A 4HZ2A 3FKFA 8GSSA 2PVQA 4HOJA 1WPIA 2YWNA 1F6MC 2E2GA 2B7KA 5E4WA 5DALB 5HFGA 5A5KA 1RW1A 1ERWA 3GKXA 2HI7A 3DXBA 3ZMKA 2C0EA 1VRSD 1T7PB 1GUKA 1NM3A 2X64A 1RQMA 2B1KA 4IQAA 5CNWA 4MH2A 4TXOB 4DSSA 4K7IA 2DMMA 3EWLA 4QL7A 4TW5A 1YF1A 2VOCA 3CTGA 4BVXA 1K3LA 2GQMA 3KTBA 4TR0A 1PQNA 1AQWA 3BCIA 3ISOA 4ID0A 4I5QA 1XWAA 3EVIA 2L6DA 16GSA 2FWHA 2F8AA 1SYRA 4TR4A 2X8HA 4L5LA 5DQYA 1HD2A 5J3RA 1JZWA 3LYPA 5D9XA 1XXUA 3ZZXA 2L57A 1Z6MA 4HU7A 3TRXA 2A2RA 1VGLA 1N2AA 5ABRA 4KW6A 3SWLA 2CAQA 1T1VA 11GSA 1EGRA 1YDKA 5ECLB 1MDJA 3HHVA 1A8YA 2K8VA 2YZHA 3GRXA 3HA9A 2B7JA 5HFKA 2GTUA 1M0UA 1U87A 1FB6A 2J23A 4IP1A 3GL3A 4ZBAA 2O8VB 1AIUA 2RLIA 2GT6A 4D73B 1QUWA 2XBIA 2VCQA 3L78A 2OA7A 5DALA 3DEXA 1DE2A 2KUCA 2VCXA 4MABA 4NV2A 1OC8A 6GSSA 1YZXA 3RHCA 1YEPA 2LRNA 4F0CA 1JLWA 3QMXA 3UEMA 4QQ7A 3TOTA 4ML1A 3VURA 3RPNA 5IM9A 4LMWA 5H5QA 3GUSA 3HZ4A 4MZBA 5DBQA 2PWJA 2JZRA 3ZL5A 4HZ4A 1TTZA 4FO5A 2L6CA 4P3YB 3CXGA 3H8QA 3UJ1A 1SKWB 3HY2A 3IHQA 2CAIA 4LMVA 2IWTA 3BOAA 3C73A 3IK7A 2HZEA 5HR0A 1X5EA 2FWFA 3VWVA 4IS0A 1YQ1A 1ERUA 3TKSC 4LA1A 4GCIA 3F3QA 4OFTA 3D22A 2LUSA 1V98A 4MPGA 5KN1A 5DJLA 1ZGNA 4DSRA 4D73A 2R4VA 4YH2A 3GV1A 4ZL7A 3HCZA 4EKZA 3PH9A 4TN8A 1Y25A 4PQHA 2YV9A 2YJHA 2P5QA 2L5LA 1MD4A 1TDIA 2GZPA 3IE3A 2OBIA 1GSSA 1GNWA 1JZRA 3F63A 3F4RA 4E8HA 4YQMA 2HNLA 3IA1A 2B1LA 3I43A 1G6WA 2AAWA 3G9BA 4CW9A 3FZAA 2LJRA 1USBA 2YJ7A 3TJBA 4DEJA 5KN0A 4OD7A 3D6IA 2LJKA 3ZREA 4ZL9A 3GMFA 1R4WA 1U6TA 5A4UA 5FWGA 3TKQA 2MMNA 3LGCA 1BX9A 1THXA 1OE8A 2FWEA 4IJIA 4KDXA 1HYUA 4KDUA 1KEBA 3IOSA 1GWCA 5J9BA 1O8XA 3QAGA 4N11A 1WWJA 1GULA 5DJMA 5F05A 1O8WA 1TJDA 4GLTA 2EIRA 4EVMA 3LYKA 2P0GA 2N5BA 4BWQA 7GSSA 3TJKA 2EC4A 2HRFA 3G7YA 5CP1A 4OFNA 2MBSA 2FWGA 5DAKB 4ULXA 1OYJA 1AW9A 1YKAA 4ACSA 2OE3A 4WBRD 2VCZA 1TRVA 1K0BA 2RUEA 4ECIA 3F4SA 1AQXA 2A2SA 1BQ7A 1F9MA 3A2XA 1R5PA 1MDIA 4L0UA 5JWRB 4IGJA 4TRXA 4XHMA 3S9FA 4TVEA 1GTUA 2C0FA 1XIYA 5ECRB 3CRTA 1FW1A 3FZ9A 5DCGA 2WGRA 1ST9A 3KZQA 1XWGA 1TRUA 1TP9A 3UBKA 3KM6A 5EL8A 2V32A 1B8XA 3W6GA 5ELAA 1NW2A 1FVJA 3KIJA 4PGTA 4V2LA 3ZLPA 2E0QA 4POBA 2XPEA 4H86A 2XBQA 3FY7A 4JBBA 1SJ6A 4MJBA 3LWAA 4MCUA 2K18A 2GLRA 3VWXA 4ECCA 3D5JA 3VI7A 1FG4A 3GKMA 3QD9A 2FD3A 1ACVA 3TKSE 6GSTA 3GYKA 2Z9SA 1AC1A 1O7UA 4K7NA 4EL1A 2L59A 3TRQA 2N5AA 4WR5A 1EV9A 2AB6A 5EVOA 4KNDA 1M2DA 4KE3A 5CYYA 3Q6OA 3A3TA 4HU9A 1R5AA 3FRCA 1AAZA 2CT6A 1GSFA 1PKWA 2M46A 3GURA 4V1Ag 1GSQA 5D9TA 2WFCA 3UARA 1XZOA 1DUGA 3UIWA 3TRPA 4K0NA 5F8BA 1DE1A 2IFQB 3FZ5A 4TOPA 4GQCA 4HJMA 1BG5A 1VF1A 2JACA 1SYXA 1XOBA 4MDCA 2ES7A 6GSWA 4Q5FA 3RDWA 3ZITA 3SBCA 2AV4A 2KP1A 2NVLA 3DGQA 2R5GA 3IXRA 3LORA 4MPFA 3DMLA 4EUYA 2WCIA 2MZCA 1X9MB 1A0FA 3A2WA 2B6MA 3IRAA 2GVPA 1JZDA 4DSSB 2YN1A 2C4JA 4MF6A 3KH9A 4XTSA 4LL4B 2GSRA 4OCEA 2VD1A 1F37A 3WT2A 4LL1B 2GSSA 4FYBA 3A5WA 1ILOA 3BD2A 1N8JA 5J41A 3H1NA 3FR9A 1ERTA 4BPYA 3HYPA 1K3OA 2IMIA 3GH9A 2PBJA 4MJCA 5D73A 2GQLA 2VL3A 2CA8A 2ON7A 2GZYA 1FVKA 4POKA 2P31A 5KN3A 1S3CA 1EGOA 1TRSA 4KSMA 12GSA 3NOFA 5AISA 3VPTA 1XWKA 5HFIA 1V40A 3IBHA 4RQRA 5CRDA 3EC3A 1GNEA 3J7Yk 1W89A 1EP8A 5ID2A 3M8NA 1XVWA 3TKSA 3TJGA 5KN2A 1F2EA 4IBPA 3F6DA 2LS5A 4N30A 2F9SA 4POMA 2FGXA 2J9HA 4OMVA 4DSQA 5AGYA 2LQQA 4BWSA 5ECMB 2JADA 2BTOT 4HI7A 3MSZA 4ZL8A 2H19A 5ECPB 3D21A 5CREA 5J4UA 5ELGA 2OADA 2KP2A 2QGVA 5JWQB 2H0IA 4GTUA 2VL9A 1G0TA 2X8CA 1TW9A 3Q18A 5G5EA 4XCSA 1Z3EA 1MEKA 4O32A 4IJ3A 3O3TA 1S3DA 1VF2A 4K6XA 3GSTA 4ZB6A 4MLYA 1GTIA 2IJYA 1T00A 3LFLA 1OAZA 3TKRA 3F0IA 1SL2B 2VLTA 4L5OA 5D9WA 3IK9A 2GQKA 3E9JB 1VF3A 2HZEB 2B5XA 1SKSB 4F03A 2JZSA 3FHKA 1ZYEA 2F3MA 4I2TA 2A4VA 3FK8A 2WULA 3L9UA 1OKTA 3EURA 2HYXA 5A4VA 1A2MA 3F3RA 3CSHA 4YAPA 4JR6A 4I2UA 5C04A 2NBSA 2I81A 3GKKA 3TDGA 4MA9A 4HJ2A 1WMJA 2LJAA 4KA0A 1SD9A 4DVCA 1K0CA 2L4QA 4HS1A
chains in the Genus database with same CATH superfamily
5B6NA 2FHEA 5G1KA 4XRAA 5ECQB 3TB2A 4Z2TA 4JZQA 3M1GA 3M9JA 4YKGA 3RAZA 1ERVA 5J5NA 1O6JA 1GL8A 2FA8A 3F4TA 2H01A 4GSTA 3LQ7A 4PQIA 1KNGA 5JCGA 1GUHA 1J08A 2ZNMA 1SD8A 2LNTA 1M9AA 2L4CA 2UZ8A 1Q4JA 4BL7A 5GAPD 4ECJA 2M72A 5GSTA 1CQGA 1WE0A 4EF0A 3IAM2 2WB9A 1B4QA 14GSA 3HVSA 4ZB8A 3VLNA 2HSHA 2HZFA 3ME8A 4PTSA 3PR8A 5H5RA 1GTAA 3L9VA 2YWIA 1A24A 3HJOA 2N5FA 3HVXA 4FYUA 4ECBA 2O87A 4X43A 4G2EA 2XPDA 17GSA 2H6ZA 3K8NA 4AGSA 4OCFA 2AHEA 1WP0A 1PRXA 5KEJA 3CMIA 4GF0A 1UN2A 3UVHA 4O5RA 3FR3A 3HKRA 2H8LA 3QOUA 1B9XC 2VL2A 4MK3A 2VLVA 3H4KA 1MTCA 2BJXA 1T8EB 3IC8A 1Z6NA 2JZTA 1Z5YE 2VCWA 4JE1A 3I69A 4OO5A 6GSXA 4L8EA 2NPBA 2NDOA 4IVFA 3ME7A 2PERA 1QXHA 3EMPA 5B8AA 1TK5B 1HNAA 3DKSA 4TR1B 4Q5NA 4WETA 1J0FA 3UVTA 4NV5A 1GSDA 3LG6A 4HDEA 2LRTA 2K6VA 5G1LA 5CRGA 3MAKA 1SENA 4K2DA 4PNGA 2TIRA 4PQ1A 2IIYA 4FH8A 4ZBBA 2ON5A 1URMA 4RQXA 1QFNA 3W8SA 5CO3A 4GQFA 2GSQA 1HNCA 3N9JA 3VWWA 3GN3A 5HR3A 5G2ZA 1HNBA 1QK8A 4N0VA 3ZVJA 3R3EA 1JFUA 3DVXA 2E7PA 4EXJA 3OR5A 2DJ2A 4XS1A 3I6AA 2FY6A 3EU4A 2FA4A 2LNSA 2VIMA 3MYDA 2QKEA 2YWOA 3BJ5A 1WOUA 1OC9A 3I9V2 1GUMA 1ZCPA 5AIVA 4MZWA 2WDUA 2JU5A 22GSA 1VF4A 4GSNA 3LW9A 2LSTA 1YY7A 1SK1A 5IO0A 3GSSA 1ZL9A 2C3QA 1M7TA 4V2MA 1B9YC 2CZ2A 2WJUA 1A0RP 4TR1A 4J2FA 1TRWA 5ECIB 1IYHA 4F9ZA 2XHFA 5FT3A 5LD0A 1X9WB 5GAND 4USSA 5A4WA 3GKNA 1SKRB 4TKYA 2H71A 2RM5A 2H6XA 4ZB9A 1ON4A 1OC3A 4KH7A 1QGVA 3IAS2 4PURA 18GSA 2I9HA 4WF4A 5IMFA 3RBTA 4ICYA 1DSBA 3D0ZA 9GSSA 3BBYA 3QDNA 3F8UA 1PGTA 2LKUA 3FEUA 2H1BA 3ZIJA 3TGZA 1T4YA 1EP7A 2HRNA 2R6KA 4CY6A 2H1DA 1GSEA 2VAFA 2IMDA 4OWYA 4EE0A 20GSA 3LJRA 5E59A 1A2JA 2AYTA 1RK4A 2GZZA 1V9WA 5ECNB 4KCAA 3FW2A 1F3BA 3L4NA 1T3BA 4KGIA 4RI6A 2JL4A 5IPGA 1PX6A 1FO5A 5JCWA 2V2GA 4X0XA 3U5RE 2LEGA 3IC4A 3TJFA 4MP4A 4MMMA 2WRTA 2ZCTA 2EIQA 4J56E 1G7EA 2YCDA 2MBTA 1TI1A 2JSYA 4EC0A 1GLQA 4O92A 1H4OA 3ZFLA 2I4AA 2DLXA 4ZBDA 1AQVA 1FB0A 2V6KA 4KDYA 5KOXA 4NMUA 5G31A 2CV4A 1JLVA 2LRCA 2DJ1A 2VUPA 5ID2B 4BIKA 3UAPA 2TRCP 1ZOFA 2H1GA 5DDLA 1LJRA 3U6VA 3VFIA 4BA7A 4E8EA 5G5FA 4GRFA 3MNGA 5IMAA 1HQOA 3ZTLA 2YNXA 3KMNA 1NHOA 3C1SA 3UOMA 3WGEA 1Z9HA 5DQSA 2PMTA 1X5CA 1GLPA 6GSVA 2OE0A 3Q74A 1M3IA 2REMA 1V2AA 4ML6A 5DVBA 3H79A 4IELA 2IMKA 2VM2A 1LBKA 5IMZA 3EMXA 4IKHA 4GSSA 3J7Yb 3C1RA 1ZZYA 3DRNA 3CSIA 4K0GA 1WRYA 3EE2A 2P5RA 3GL5A 4HUAA 2PPTA 5DCHA 2GT5A 4V1Ap 1EZKA 2C80A 1E6BA 3HZ8A 2PVOC 5D96A 1TU8A 4Q5RA 3DD3A 1B4PA 4PX1A 2H66A 3ERGA 2PGTA 1XFLA 1Q98A 2DIZA 3VK9A 3WGXA 4HQZA 3APOA 4JEDA 1M2AA 3QAVA 3KD0A 1PMTA 3IR4A 3O76A 4EDZA 3WYWA 4I8BA 3BCKA 2CVDA 4JR4A 4PUAA 2MYGA 4WBJA 4EIPA 3PINA 1PSQA 1YJ6A 4AJ8A 4XS4A 4NXIA 3DWVA 3APSA 4MZCA 1AUCA 5JCUA 1JZOA 4MJAA 1M9BA 1TXXA 3P7XA 4RUVA 2KHPA 2G2QA 2I1UA 2X8GA 3KGKA 1G7OA 5LCZA 1GP1A 2IMFA 4NHWA 2GSTA 3GHAA 1KTEA 2DJ0A 2X4AA 4FIWA 4PXOA 3ZYWA 3DVWA 4FYCA 1AXDA 4AJ7A 1WJKA 3QPMA 2LV3A 4OO4A 5COHA 2DJ3A 1TKDB 1A8LA 3E0UA 2HE3A 1SJIA 4V2NA 3UMAA 2RIIA 5CAXA 4IQ1A 1W4VA 4HEA2 1XBSA 3ED3A 1PD21 3CSJA 2YP6A 1GH2A 3M9KA 2GS3A 4BL7B 2H30A 1EWXA 1XWBA 3C71A 3W8JA 2FUG2 4POLA 3WGDA 5IOWA 3H93A 1UC7A 1XW6A 4KUNA 2CVKA 3KTLA 5KOWA 2VLUA 2DIYA 3KP9A 3E3EA 1LU4A 4I97A 4IP6A 4ZXGA 2B5EA 3HJMA 1TU7A 1ZYPA 4IW9A 2B3SA 2RM6A 2V41A 1GTBA 3CTFA 2YANA 2CZ3A 3TUEA 1Y6EA 2F51A 5F06A 5IMVA 1XPVA 3KXOA 2IPAA 2DBCA 4JRRA 5IMDA 3ZRDA 2H76A 2LQOA 4YAVA 4WXTA 3R2QA 5INYA 5ECSA 2R37A 2LTKA 2G0FA 3FR6A 1XVQA 2C3TA 3VPQA 1EOGA 3GX0A 3HD5A 4TXOA 5G30A 1OVNA 3GH6A 5ECKB 3KP8A 1TI3A 2R0PA 6GSUA 2BMXA 3MWHA 2IMEA 2H74A 3QAWA 5CRWA 4TR3A 1I9DA 5ENUA 3TKPA 2OJLA 2H70A 3G7IA 4A5PA 3IHGA 5HQPA 2QC7A 3EU3A 3O6TA 3HVNA 3D4MA 2H75A 4EDYA 5HR2A 2CX3A 4ZILA 5B7CA 3F6FA 2DKHA 2L5OA 4G9HA 4MF5A 4RI7A 3M0FA 4O7HA 4EO3A 1K0AA 3EYTA 4BVYA 3JCML 2O85A 4MF7A 1Z7RA 2WS2A 3VWUA 4Z7XA 2HSMA 1V57A 3F9UA 3NZNA 2DC5A 4OFMA 5H5SA 1SK0A 1J9BA 4K9ZA 3GIXA 1O73A 2H73A 3G7JA 2WZ9A 5IMCA 2X49A 4F2IA 1G6YA 3L9SA 1TOFA 4J57E 4ISDA 1XCCA 4YKFA 4X1UA 2CQ9A 1OC9B 4L0WA 1ZMAA 2QSIA 3WT1A 1XWCA 4PNFA 3C8EA 1OKDA 2DSAA 1PN9A 5C00A 3DYRA 1THOA 2MMOA 1E2YA 5BRTA 2R2JA 1ZYQB 1U88A 5D8IA 1SJZA 1FHEA 3US3A 2C0DA 1GSYA 2KOKA 2K8SA 3A2VA 3ZVJD 3QCPA 2X99A 1IYIA 4XS6A 1X9SB 1MD3A 2CX4A 4F0BA 3KMOA 1M99A 3QFAC 5IQYA 1K0MA 1PKZA 1X0RA 4N0ZA 4EIQA 1EEMA 4GXZA 3M3MA 2NTOA 2YWMA 1K0OA 2RUFA 4GWRA 4MH3A 2JSZA 3AY8A 3HJPA 1WIKA 3WD6A 1MDKA 3D4TA 1X5DA 4G19A 3NIVA 4WEYA 4G10A 1S3RA 3V1WA 4AF2A 4PUFC 3HVVA 1U3IA 2C1YA 1XOAA 4QL9A 2DJKA 1UVZA 5JWOB 4Q5QA 1EEJA 2VO4A 3LXZA 1FOVA 3MIXA 2C8UA 2PN8A 1PL2A 3FZ4A 1SU9A 4AJ6A 3HDCA 4NPBA 4KSOA 2HSYA 4NWYA 3TJJA 2CVBA 5B6MA 5B8BA 5EPFA 1QQ2A 1Z7PA 3QFBC 1M2BA 3P90A 1CQHA 5IIZA 2D2ZA 6GSYA 2EIOA 3ZFBA 1BEDA 2H0HA 4I6XA 1PA3A 1NHYA 3GTUB 4IN0A 5F07A 1GRXA 2VD0A 1NSWA 1A2LA 3FMWA 1H75A 1K0DA 1I5GA 3HXSA 4O5QA 1TK8B 1S3AA 3DIEA 1BYEA 1FAAA 1YEXA 4WR4A 4K7OA 1XW9A 2OE1A 3P8WA 5IO2A 1EOHA 4WKWA 2YV7A 4K8MA 2FCHA 3TCOA 1ML6A 4KB3A 4XIHA 3GA4A 1U3AA 4KF9A 2QA1A 2R3XA 2I3YA 4XRDA 2HLSA 1R7HA 3C7MA 5CRHA 1KBNA 2C0GA 3CYNA 5FHIA 3GX8A 4ILFA 3GNJA 4KCEA 5DAKA 2FNOA 1DBYA 1V58A 3KEBA 4TXVA 4CHSA 2GDRA 2HXKA 4MJEA 1JHBA 4LLRA 1K0NA 2VL2C 3CBUA 2AJQB 3RPPA 3KH7A 4YQUA 5L71A 3L0HA 4JU5A 2F8FA 4K5SA 3ERWA 1UA5A 1EV4A 1XW5A 3KJYA 2MMZA 3ZMLA 3QR6A 2QA2A 2YOIA 2VCVA 4IHUA 4F82A 3GTUA 2OBKA 1T4ZA 3LEFA 4NAXA 1BJXA 3GFKA 2C3NA 3EINA 1K3YA 4XS4B 2IN3A 1O81A 4KX4A 10GSA 2YPMA 1O85A 2OACA 4ZIJA 1B48A 5EY6A 2O7KA 2TRXA 2K9FA 3FYGA 3UBLA 3ZIVA 3IPZA 5F0GA 1GSUA 2DMLA 5ECOB 1OE7A 3P2AA 2H0GA 2PUKC 3Q19A 3VI5A 2V1MA 1YKCA 2AUVA 4Z2RA 5GSSA 5GZZB 3TOUA 2HFDA 1R26A 2H6YA 2M80A 2YZUA 1A23A 4X4JA 3UL3A 2H1AA 3ERFA 4YQVA 2FLSA 2PU9C 3LXTA 5LNKe 1SL1B 2E2MA 1FOHA 2H72A 4N10A 1TK0B 1F3AA 2IL3A 2ZUPA 4BVXB 2VM1A 3PGTA 4K1FA 4HQSA 2B5YA 2XC2A 5HR1A 3RHBA 2ALBA 5ECHB 4KAEA 4K2XA 3LSZA 3APQA 2KLXA 4WF5A 2HT9A 1BAYA 2GGTA 2V6OA 4NHZA 1PL1A 1YF0A 5D93A 5AN1A 5J9CA 1QMVA 1SL0B 1PX7A 2DJJA 3CRUA 2O89A 3KCMA 2MMAA 19GSA 5IOXA 3IDVA 4CDOA 5AIXA 5IPHA 2IFQA 3IV4A 3MDKA 13GSA 2OKAA 2VCTA 3N5OA 1SK2A 5D9VA 1ABAA 1C72A 4HZ2A 3FKFA 8GSSA 2PVQA 4HOJA 1WPIA 2YWNA 1F6MC 2E2GA 2B7KA 5E4WA 5DALB 5HFGA 5A5KA 3CQFA 1RW1A 1ERWA 3GKXA 2HI7A 3DXBA 3ZMKA 2C0EA 1VRSD 1T7PB 1GUKA 1NM3A 2X64A 1RQMA 2B1KA 4IQAA 5CNWA 4MH2A 4TXOB 4DSSA 4K7IA 2DMMA 3EWLA 4QL7A 4TW5A 1YF1A 2VOCA 3CTGA 4BVXA 1K3LA 2GQMA 3KTBA 4TR0A 1PQNA 1AQWA 3BCIA 3ISOA 4ID0A 4I5QA 1XWAA 3EVIA 2L6DA 16GSA 2FWHA 2F8AA 1SYRA 4TR4A 4Z2UA 2X8HA 4L5LA 5DQYA 1HD2A 5J3RA 1JZWA 3LYPA 1XXUA 5D9XA 3ZZXA 2L57A 1Z6MA 4HU7A 3TRXA 2A2RA 1VGLA 1N2AA 5ABRA 4BVYB 4KW6A 3SWLA 2CAQA 1T1VA 11GSA 1EGRA 1YDKA 5ECLB 1MDJA 3HHVA 1A8YA 2K8VA 2YZHA 3GRXA 3HA9A 2B7JA 5HFKA 2GTUA 1M0UA 1U87A 1FB6A 2J23A 4IP1A 3GL3A 4ZBAA 2O8VB 1AIUA 2RLIA 2GT6A 4D73B 1QUWA 2XBIA 2HRKA 2VCQA 3L78A 2OA7A 5DALA 3DEXA 1DE2A 2KUCA 2VCXA 4MABA 4NV2A 1OC8A 6GSSA 1YZXA 3RHCA 1YEPA 2LRNA 4F0CA 1JLWA 3QMXA 3UEMA 4QQ7A 3TOTA 4ML1A 3VURA 3RPNA 5IM9A 4LMWA 5H5QA 3GUSA 3HZ4A 4MZBA 5DBQA 2PWJA 2JZRA 3ZL5A 4HZ4A 1TTZA 4FO5A 2L6CA 4P3YB 3CXGA 3H8QA 3UJ1A 1SKWB 3HY2A 3IHQA 2CAIA 4LMVA 2IWTA 3BOAA 3C73A 3IK7A 2HZEA 5HR0A 1X5EA 2FWFA 3VWVA 1PFOA 4IS0A 1YQ1A 1M3JA 1ERUA 3TKSC 4LA1A 2R0CA 4GCIA 3F3QA 4OFTA 3D22A 2LUSA 1V98A 4MPGA 5KN1A 5DJLA 2HRAA 1ZGNA 4DSRA 4D73A 2R4VA 4YH2A 3GV1A 4ZL7A 3HCZA 4EKZA 3PH9A 4TN8A 4PQHA 1Y25A 2YV9A 2YJHA 4O5UA 2P5QA 2L5LA 1MD4A 1TDIA 2GZPA 3IE3A 2OBIA 1GSSA 1GNWA 1JZRA 3F63A 3F4RA 4E8HA 4YQMA 2HNLA 3IA1A 2B1LA 3I43A 1G6WA 2AAWA 3G9BA 4CW9A 3FZAA 2LJRA 1USBA 2YJ7A 3TJBA 4DEJA 5KN0A 4OD7A 3D6IA 2LJKA 3ZREA 4ZL9A 3GMFA 1R4WA 1U6TA 5A4UA 5FWGA 3TKQA 2MMNA 2R0GA 3LGCA 1BX9A 1THXA 1OE8A 2FWEA 4IJIA 4KDXA 1HYUA 4KDUA 1KEBA 3IOSA 1GWCA 5J9BA 1O8XA 3QAGA 4N11A 1WWJA 1GULA 5DJMA 5F05A 1O8WA 1TJDA 4GLTA 2EIRA 4G0LA 4EVMA 3LYKA 2P0GA 2N5BA 4FQUA 4BWQA 7GSSA 3TJKA 2EC4A 2HRFA 3PPUA 3G7YA 5CP1A 4OFNA 3A5IA 2MBSA 2FWGA 5DAKB 4ULXA 1OYJA 1AW9A 1YKAA 4ACSA 2OE3A 4WBRD 2VCZA 1TRVA 1K0BA 2RUEA 4MNNA 4ECIA 3F4SA 1AQXA 2A2SA 1BQ7A 1F9MA 3A2XA 1R5PA 1MDIA 4L0UA 5JWRB 4IGJA 4TRXA 4XHMA 3S9FA 4TVEA 1GTUA 2C0FA 1XIYA 5ECRB 3CRTA 1FW1A 3FZ9A 5DCGA 2WGRA 1ST9A 3KZQA 1XWGA 1TRUA 1TP9A 3UBKA 3KM6A 5EL8A 2V32A 1B8XA 3W6GA 5ELAA 1NW2A 1FVJA 3KIJA 4PGTA 4V2LA 3ZLPA 2E0QA 4G0KA 4POBA 2XPEA 4H86A 2XBQA 3FY7A 4JBBA 1SJ6A 4MJBA 3LWAA 4MCUA 2K18A 2GLRA 3VWXA 4ECCA 3D5JA 3VI7A 1FG4A 3GKMA 2A2PA 3QD9A 2FD3A 1ACVA 3TKSE 6GSTA 3GYKA 2Z9SA 1AC1A 1O7UA 4K7NA 4EL1A 2L59A 3TRQA 2N5AA 4WR5A 1EV9A 2AB6A 5EVOA 4KNDA 1M2DA 4KE3A 5CYYA 3Q6OA 3A3TA 4HU9A 1R5AA 3FRCA 1AAZA 2CT6A 1GSFA 1PKWA 2M46A 3GURA 4V1Ag 1GSQA 5D9TA 2WFCA 3UARA 1XZOA 1DUGA 3UIWA 3TRPA 4K0NA 5F8BA 1DE1A 2IFQB 3FZ5A 4TOPA 4GQCA 4HJMA 1BG5A 1VF1A 2JACA 1SYXA 1XOBA 4MDCA 2ES7A 2DKIA 6GSWA 4Q5FA 3RDWA 3ZITA 3SBCA 2AV4A 2KP1A 2NVLA 3DGQA 2R5GA 3IXRA 3LORA 4MPFA 3DMLA 4EUYA 2WCIA 2MZCA 1X9MB 1A0FA 3A2WA 2B6MA 3IRAA 2GVPA 1JZDA 1ZYNA 4DSSB 2YN1A 2C4JA 4MF6A 3KH9A 4XTSA 4LL4B 2GSRA 4OCEA 2VD1A 1F37A 3WT2A 4LL1B 2GSSA 4FYBA 3A5WA 1ILOA 3BD2A 1N8JA 5J41A 3H1NA 3FR9A 1ERTA 4BPYA 3HYPA 1K3OA 2IMIA 3GH9A 2PBJA 4MJCA 5D73A 2GQLA 2VL3A 2CA8A 2ON7A 2GZYA 1FVKA 4POKA 2P31A 5KN3A 1S3CA 1EGOA 1TRSA 4KSMA 12GSA 3NOFA 5AISA 3VPTA 1XWKA 5HFIA 1V40A 3IBHA 4RQRA 5CRDA 3EC3A 1GNEA 3J7Yk 1W89A 1EP8A 4K5RA 5ID2A 3M8NA 1PN0A 1XVWA 3TKSA 3TJGA 5KN2A 1F2EA 4IBPA 3F6DA 2LS5A 4N30A 2F9SA 4POMA 2FGXA 2J9HA 4OMVA 4DSQA 3EPTA 1XG8A 5AGYA 2LQQA 4BWSA 5ECMB 2JADA 2BTOT 4HI7A 3MSZA 4ZL8A 2H19A 5ECPB 3D21A 5CREA 5J4UA 5ELGA 2OADA 2KP2A 4HSCX 2QGVA 5JWQB 2H0IA 4GTUA 2VL9A 1G0TA 2X8CA 1TW9A 3Q18A 5G5EA 4XCSA 1Z3EA 1MEKA 4O32A 4IJ3A 3O3TA 1S3DA 1VF2A 4K6XA 3GSTA 4ZB6A 4MLYA 1GTIA 2IJYA 1T00A 3LFLA 1OAZA 3TKRA 3F0IA 1SL2B 2VLTA 4L5OA 5D9WA 3IK9A 2GQKA 3E9JB 1VF3A 2HZEB 2B5XA 1SKSB 4F03A 2JZSA 3FHKA 1ZYEA 2F3MA 4CY8A 4I2TA 2A4VA 3FK8A 2WULA 3L9UA 1OKTA 3EURA 2HYXA 4G0IA 5A4VA 1A2MA 3F3RA 5BMUA 3CSHA 4YAPA 4JR6A 4I2UA 5C04A 2NBSA 2I81A 3GKKA 3TDGA 4MA9A 4HJ2A 1WMJA 2A4HA 2LJAA 4KA0A 1SD9A 4DVCA 1K0CA 2L4QA 4HS1A
chains in the Genus database with same CATH topology
5B6NA 2FHEA 5G1KA 4XRAA 5ECQB 3TB2A 4Z2TA 4JZQA 3M1GA 3M9JA 4YKGA 3RAZA 1ERVA 5J5NA 1O6JA 1GL8A 2FA8A 3F4TA 2H01A 4GSTA 3LQ7A 4PQIA 1KNGA 5JCGA 1GUHA 1J08A 2ZNMA 1SD8A 2LNTA 1M9AA 2L4CA 2UZ8A 1Q4JA 4BL7A 5GAPD 4ECJA 2M72A 5GSTA 1CQGA 1WE0A 4EF0A 3IAM2 2WB9A 1B4QA 14GSA 3HVSA 4ZB8A 3VLNA 2HSHA 2HZFA 3ME8A 4PTSA 3PR8A 5H5RA 1GTAA 3L9VA 2YWIA 1A24A 3HJOA 2N5FA 3HVXA 4FYUA 4ECBA 2O87A 4X43A 4G2EA 2XPDA 17GSA 2H6ZA 3K8NA 4AGSA 4OCFA 2AHEA 1WP0A 1PRXA 5KEJA 3CMIA 4GF0A 1UN2A 3UVHA 4O5RA 3FR3A 3HKRA 2H8LA 3QOUA 1B9XC 2VL2A 4MK3A 2VLVA 3H4KA 1MTCA 2BJXA 1T8EB 3IC8A 1Z6NA 2JZTA 1Z5YE 2VCWA 4JE1A 3I69A 4OO5A 6GSXA 4L8EA 2NPBA 2NDOA 4IVFA 3ME7A 2PERA 1QXHA 3EMPA 5B8AA 1TK5B 1HNAA 3DKSA 4TR1B 4Q5NA 4WETA 1J0FA 3UVTA 4NV5A 1GSDA 3LG6A 4HDEA 2LRTA 2K6VA 5G1LA 5CRGA 3MAKA 1SENA 4K2DA 4PNGA 2TIRA 4PQ1A 2IIYA 4FH8A 4ZBBA 2ON5A 1URMA 4RQXA 1QFNA 3W8SA 5CO3A 4GQFA 2GSQA 1HNCA 3N9JA 3VWWA 3GN3A 5HR3A 5G2ZA 1HNBA 1QK8A 4N0VA 3ZVJA 3R3EA 1JFUA 3DVXA 2E7PA 4EXJA 3OR5A 2DJ2A 4XS1A 3I6AA 2FY6A 3EU4A 2FA4A 2LNSA 2VIMA 3MYDA 2QKEA 2YWOA 3BJ5A 1WOUA 1OC9A 3I9V2 1GUMA 1ZCPA 5AIVA 4MZWA 2WDUA 2JU5A 22GSA 1VF4A 4GSNA 3LW9A 2LSTA 1YY7A 1SK1A 5IO0A 3GSSA 1ZL9A 2C3QA 1M7TA 4V2MA 1B9YC 2CZ2A 2WJUA 1A0RP 4TR1A 4J2FA 1TRWA 5ECIB 1IYHA 4F9ZA 2XHFA 5FT3A 5LD0A 1X9WB 5GAND 4USSA 5A4WA 3GKNA 1SKRB 4TKYA 2H71A 2RM5A 2H6XA 4ZB9A 1ON4A 1OC3A 4KH7A 1QGVA 3IAS2 4PURA 18GSA 2I9HA 4WF4A 5IMFA 3RBTA 4ICYA 1DSBA 3D0ZA 9GSSA 3BBYA 3QDNA 3F8UA 1PGTA 2LKUA 3FEUA 2H1BA 3ZIJA 3TGZA 1T4YA 1EP7A 2HRNA 2R6KA 4CY6A 2H1DA 1GSEA 2VAFA 2IMDA 4OWYA 4EE0A 20GSA 3LJRA 5E59A 1A2JA 2AYTA 1RK4A 2GZZA 1V9WA 5ECNB 4KCAA 3FW2A 1F3BA 3L4NA 1T3BA 4KGIA 4RI6A 2JL4A 5IPGA 1PX6A 1FO5A 5JCWA 2V2GA 4X0XA 3U5RE 2LEGA 3IC4A 3TJFA 4MP4A 4MMMA 2WRTA 2ZCTA 2EIQA 4J56E 1G7EA 2YCDA 2MBTA 1TI1A 2JSYA 4EC0A 1GLQA 4O92A 1H4OA 3ZFLA 2I4AA 2DLXA 4ZBDA 1AQVA 1FB0A 2V6KA 4KDYA 5KOXA 4NMUA 5G31A 2CV4A 1JLVA 2LRCA 2DJ1A 2VUPA 5ID2B 3UAPA 2TRCP 1ZOFA 2H1GA 5DDLA 1LJRA 3U6VA 3VFIA 4BA7A 4E8EA 5G5FA 4GRFA 3MNGA 5IMAA 1HQOA 3ZTLA 2YNXA 3KMNA 1NHOA 3C1SA 3UOMA 3WGEA 1Z9HA 5DQSA 2PMTA 1X5CA 1GLPA 6GSVA 2OE0A 3Q74A 2REMA 1V2AA 4ML6A 5DVBA 3H79A 4IELA 2IMKA 2VM2A 1LBKA 5IMZA 3EMXA 4IKHA 4GSSA 3J7Yb 3C1RA 1ZZYA 3DRNA 3CSIA 4K0GA 1WRYA 3EE2A 2P5RA 3GL5A 4HUAA 2PPTA 5DCHA 2GT5A 4V1Ap 1EZKA 2C80A 1E6BA 3HZ8A 2PVOC 5D96A 1TU8A 4Q5RA 3DD3A 1B4PA 4PX1A 2H66A 3ERGA 2PGTA 1XFLA 1Q98A 2DIZA 3VK9A 3WGXA 4HQZA 3APOA 4JEDA 1M2AA 3QAVA 3KD0A 1PMTA 3IR4A 3O76A 4EDZA 3WYWA 4I8BA 3BCKA 2CVDA 4JR4A 4PUAA 2MYGA 4WBJA 4EIPA 3PINA 1PSQA 1YJ6A 4AJ8A 4XS4A 4NXIA 3DWVA 3APSA 4MZCA 1AUCA 5JCUA 1JZOA 4MJAA 1M9BA 1TXXA 3P7XA 4RUVA 2KHPA 2G2QA 2I1UA 2X8GA 3KGKA 1G7OA 5LCZA 1GP1A 2IMFA 4NHWA 2GSTA 3GHAA 1KTEA 2DJ0A 2X4AA 4FIWA 4PXOA 3ZYWA 3DVWA 4FYCA 1AXDA 4AJ7A 1WJKA 3QPMA 2LV3A 4OO4A 5COHA 2DJ3A 1TKDB 1A8LA 3E0UA 2HE3A 1SJIA 4V2NA 3UMAA 2RIIA 5CAXA 4IQ1A 1W4VA 4HEA2 1XBSA 3ED3A 1PD21 3CSJA 2YP6A 1GH2A 3M9KA 2GS3A 4BL7B 2H30A 1EWXA 1XWBA 3C71A 3W8JA 2FUG2 4POLA 3WGDA 5IOWA 3H93A 1UC7A 1XW6A 4KUNA 2CVKA 3KTLA 5KOWA 2VLUA 2DIYA 3KP9A 3E3EA 1LU4A 4I97A 4IP6A 4ZXGA 2B5EA 3HJMA 1TU7A 1ZYPA 4IW9A 2B3SA 2RM6A 2V41A 1GTBA 3CTFA 2YANA 2CZ3A 3TUEA 1Y6EA 2F51A 5F06A 5IMVA 1XPVA 3KXOA 2IPAA 2DBCA 4JRRA 5IMDA 3ZRDA 2H76A 2LQOA 4YAVA 4WXTA 3R2QA 5INYA 5ECSA 2R37A 2LTKA 2G0FA 3FR6A 1XVQA 2C3TA 3VPQA 1EOGA 3GX0A 3HD5A 4TXOA 5G30A 1OVNA 3GH6A 5ECKB 3KP8A 1TI3A 2R0PA 6GSUA 2BMXA 3MWHA 2IMEA 2H74A 3QAWA 5CRWA 4TR3A 1I9DA 5ENUA 3TKPA 2OJLA 2H70A 3G7IA 4A5PA 3IHGA 5HQPA 2QC7A 3EU3A 3O6TA 3D4MA 2H75A 4EDYA 5HR2A 2CX3A 4ZILA 5B7CA 3F6FA 2DKHA 2L5OA 4G9HA 4MF5A 4RI7A 3M0FA 4O7HA 4EO3A 1K0AA 3EYTA 4BVYA 3JCML 2O85A 4MF7A 1Z7RA 2WS2A 3VWUA 4Z7XA 2HSMA 1V57A 3F9UA 3NZNA 2DC5A 4OFMA 5H5SA 1SK0A 1J9BA 4K9ZA 3GIXA 1O73A 2H73A 3G7JA 2WZ9A 5IMCA 2X49A 4F2IA 1G6YA 3L9SA 1TOFA 4J57E 4ISDA 1XCCA 4YKFA 4X1UA 2CQ9A 1OC9B 4L0WA 1ZMAA 2QSIA 3WT1A 1XWCA 4PNFA 3C8EA 1OKDA 2DSAA 1PN9A 5C00A 3DYRA 1THOA 2MMOA 1E2YA 5BRTA 2R2JA 1ZYQB 1U88A 5D8IA 1SJZA 1FHEA 3US3A 2C0DA 1GSYA 2KOKA 2K8SA 3A2VA 3ZVJD 3QCPA 2X99A 1IYIA 4XS6A 1X9SB 1MD3A 2CX4A 4F0BA 3KMOA 1M99A 3QFAC 5IQYA 1K0MA 1PKZA 1X0RA 4N0ZA 4EIQA 1EEMA 4GXZA 3M3MA 2NTOA 2YWMA 1K0OA 2RUFA 4GWRA 4MH3A 2JSZA 3AY8A 3HJPA 1WIKA 3WD6A 1MDKA 3D4TA 1X5DA 4G19A 3NIVA 4WEYA 4G10A 3V1WA 4AF2A 4PUFC 3HVVA 1U3IA 2C1YA 1XOAA 4QL9A 2DJKA 1UVZA 5JWOB 4Q5QA 1EEJA 2VO4A 3LXZA 1FOVA 3MIXA 2C8UA 2PN8A 1PL2A 3FZ4A 1SU9A 4AJ6A 3HDCA 4NPBA 4KSOA 2HSYA 4NWYA 3TJJA 2CVBA 5B6MA 5B8BA 5EPFA 1QQ2A 1Z7PA 3QFBC 1M2BA 3P90A 1CQHA 5IIZA 2D2ZA 6GSYA 2EIOA 3ZFBA 1BEDA 2H0HA 4I6XA 1PA3A 1NHYA 3GTUB 4IN0A 5F07A 1GRXA 2VD0A 1NSWA 1A2LA 3FMWA 1H75A 1K0DA 1I5GA 3HXSA 4O5QA 1TK8B 1S3AA 3DIEA 1BYEA 1FAAA 1YEXA 4WR4A 4K7OA 1XW9A 2OE1A 3P8WA 5IO2A 1EOHA 4WKWA 2YV7A 4K8MA 2FCHA 3TCOA 1ML6A 4KB3A 4XIHA 3GA4A 1U3AA 4KF9A 2QA1A 2R3XA 2I3YA 4XRDA 2HLSA 1R7HA 3C7MA 5CRHA 1KBNA 2C0GA 3CYNA 5FHIA 3GX8A 4ILFA 3GNJA 4KCEA 5DAKA 2FNOA 1DBYA 1V58A 3KEBA 4TXVA 4CHSA 2GDRA 2HXKA 4MJEA 1JHBA 4LLRA 1K0NA 2VL2C 3CBUA 2AJQB 3RPPA 3KH7A 4YQUA 5L71A 3L0HA 4JU5A 2F8FA 4K5SA 3ERWA 1UA5A 1EV4A 1XW5A 3KJYA 2MMZA 3ZMLA 3QR6A 2QA2A 2YOIA 2VCVA 4IHUA 4F82A 3GTUA 2OBKA 1T4ZA 3LEFA 4NAXA 1BJXA 3GFKA 2C3NA 3EINA 1K3YA 4XS4B 2IN3A 1O81A 4KX4A 10GSA 2YPMA 1O85A 2OACA 4ZIJA 1B48A 5EY6A 2O7KA 2TRXA 2K9FA 3FYGA 3UBLA 3ZIVA 3IPZA 5F0GA 1GSUA 2DMLA 5ECOB 1OE7A 3P2AA 2H0GA 2PUKC 3Q19A 3VI5A 2V1MA 1YKCA 2AUVA 4Z2RA 5GSSA 5GZZB 3TOUA 2HFDA 1R26A 2H6YA 2M80A 2YZUA 1A23A 4X4JA 3UL3A 2H1AA 3ERFA 4YQVA 2FLSA 2PU9C 3LXTA 5LNKe 1SL1B 2E2MA 1FOHA 2H72A 4N10A 1TK0B 1F3AA 2IL3A 2ZUPA 4BVXB 2VM1A 3PGTA 4K1FA 4HQSA 2B5YA 2XC2A 5HR1A 3RHBA 2ALBA 5ECHB 4KAEA 4K2XA 3LSZA 3APQA 2KLXA 4WF5A 2HT9A 1BAYA 2GGTA 2V6OA 4NHZA 1PL1A 1YF0A 5D93A 5AN1A 5J9CA 1QMVA 1SL0B 1PX7A 2DJJA 3CRUA 2O89A 3KCMA 2MMAA 19GSA 5IOXA 3IDVA 4CDOA 5AIXA 5IPHA 2IFQA 3IV4A 3MDKA 13GSA 2OKAA 2VCTA 3N5OA 1SK2A 5D9VA 1ABAA 1C72A 4HZ2A 3FKFA 8GSSA 2PVQA 4HOJA 1WPIA 2YWNA 1F6MC 2E2GA 2B7KA 5E4WA 5DALB 5HFGA 5A5KA 1RW1A 1ERWA 3GKXA 2HI7A 3DXBA 3ZMKA 2C0EA 1VRSD 1T7PB 1GUKA 1NM3A 2X64A 1RQMA 2B1KA 4IQAA 5CNWA 4MH2A 4TXOB 4DSSA 4K7IA 2DMMA 3EWLA 4QL7A 4TW5A 1YF1A 2VOCA 3CTGA 4BVXA 1K3LA 2GQMA 3KTBA 4TR0A 1PQNA 1AQWA 3BCIA 3ISOA 4ID0A 4I5QA 1XWAA 3EVIA 2L6DA 16GSA 2FWHA 2F8AA 1SYRA 4TR4A 4Z2UA 2X8HA 4L5LA 5DQYA 1HD2A 5J3RA 1JZWA 3LYPA 1XXUA 5D9XA 3ZZXA 2L57A 1Z6MA 4HU7A 3TRXA 2A2RA 1VGLA 1N2AA 5ABRA 4BVYB 4KW6A 3SWLA 2CAQA 1T1VA 11GSA 1EGRA 1YDKA 5ECLB 1MDJA 3HHVA 1A8YA 2K8VA 2YZHA 3GRXA 3HA9A 2B7JA 5HFKA 2GTUA 1M0UA 1U87A 1FB6A 2J23A 4IP1A 3GL3A 4ZBAA 2O8VB 1AIUA 2RLIA 2GT6A 4D73B 1QUWA 2XBIA 2HRKA 2VCQA 3L78A 2OA7A 5DALA 3DEXA 1DE2A 2KUCA 2VCXA 4MABA 4NV2A 1OC8A 6GSSA 1YZXA 3RHCA 1YEPA 2LRNA 4F0CA 1JLWA 3QMXA 3UEMA 4QQ7A 3TOTA 4ML1A 3VURA 3RPNA 5IM9A 4LMWA 5H5QA 3GUSA 3HZ4A 4MZBA 5DBQA 2PWJA 2JZRA 3ZL5A 4HZ4A 1TTZA 4FO5A 2L6CA 4P3YB 3CXGA 3H8QA 3UJ1A 1SKWB 3HY2A 3IHQA 2CAIA 4LMVA 2IWTA 3BOAA 3C73A 3IK7A 2HZEA 5HR0A 1X5EA 2FWFA 3VWVA 4IS0A 1YQ1A 1ERUA 3TKSC 4LA1A 2R0CA 4GCIA 3F3QA 4OFTA 3D22A 2LUSA 1V98A 4MPGA 5KN1A 5DJLA 2HRAA 1ZGNA 4DSRA 4D73A 2R4VA 4YH2A 3GV1A 4ZL7A 3HCZA 4EKZA 3PH9A 4TN8A 1Y25A 4PQHA 2YV9A 2YJHA 4O5UA 2P5QA 2L5LA 1MD4A 1TDIA 2GZPA 3IE3A 2OBIA 1GSSA 1GNWA 1JZRA 3F63A 3F4RA 4E8HA 4YQMA 2HNLA 3IA1A 2B1LA 3I43A 1G6WA 2AAWA 3G9BA 4CW9A 3FZAA 2LJRA 1USBA 2YJ7A 3TJBA 4DEJA 5KN0A 4OD7A 3D6IA 2LJKA 3ZREA 4ZL9A 3GMFA 1R4WA 1U6TA 5A4UA 5FWGA 3TKQA 2MMNA 2R0GA 3LGCA 1BX9A 1THXA 1OE8A 2FWEA 4IJIA 4KDXA 1HYUA 4KDUA 1KEBA 3IOSA 1GWCA 5J9BA 1O8XA 3QAGA 4N11A 1WWJA 1GULA 5DJMA 5F05A 1O8WA 1TJDA 4GLTA 2EIRA 4G0LA 4EVMA 3LYKA 2P0GA 2N5BA 4FQUA 4BWQA 7GSSA 3TJKA 2EC4A 2HRFA 3PPUA 3G7YA 5CP1A 4OFNA 3A5IA 2MBSA 2FWGA 5DAKB 4ULXA 1OYJA 1AW9A 1YKAA 4ACSA 2OE3A 4WBRD 2VCZA 1TRVA 1K0BA 2RUEA 4MNNA 4ECIA 3F4SA 1AQXA 2A2SA 1BQ7A 1F9MA 3A2XA 1R5PA 1MDIA 4L0UA 5JWRB 4IGJA 4TRXA 4XHMA 3S9FA 4TVEA 1GTUA 2C0FA 1XIYA 5ECRB 3CRTA 1FW1A 3FZ9A 5DCGA 2WGRA 1ST9A 3KZQA 1XWGA 1TRUA 1TP9A 3UBKA 3KM6A 5EL8A 2V32A 1B8XA 3W6GA 5ELAA 1NW2A 1FVJA 3KIJA 4PGTA 4V2LA 3ZLPA 2E0QA 4G0KA 4POBA 2XPEA 4H86A 2XBQA 3FY7A 4JBBA 1SJ6A 4MJBA 3LWAA 4MCUA 2K18A 2GLRA 3VWXA 4ECCA 3D5JA 3VI7A 1FG4A 3GKMA 2A2PA 3QD9A 2FD3A 1ACVA 3TKSE 6GSTA 3GYKA 2Z9SA 1AC1A 1O7UA 4K7NA 4EL1A 2L59A 3TRQA 2N5AA 4WR5A 1EV9A 2AB6A 5EVOA 4KNDA 1M2DA 4KE3A 5CYYA 3Q6OA 3A3TA 4HU9A 1R5AA 3FRCA 1AAZA 2CT6A 1GSFA 1PKWA 2M46A 3GURA 4V1Ag 1GSQA 5D9TA 2WFCA 3UARA 1XZOA 1DUGA 3UIWA 3TRPA 4K0NA 5F8BA 1DE1A 2IFQB 3FZ5A 4TOPA 4GQCA 4HJMA 1BG5A 1VF1A 2JACA 1SYXA 1XOBA 4MDCA 2ES7A 2DKIA 6GSWA 4Q5FA 3RDWA 3ZITA 3SBCA 2AV4A 2KP1A 2NVLA 3DGQA 2R5GA 3IXRA 3LORA 4MPFA 3DMLA 4EUYA 2WCIA 2MZCA 1X9MB 1A0FA 3A2WA 2B6MA 3IRAA 2GVPA 1JZDA 1ZYNA 4DSSB 2YN1A 2C4JA 4MF6A 3KH9A 4XTSA 4LL4B 2GSRA 4OCEA 2VD1A 1F37A 3WT2A 4LL1B 2GSSA 4FYBA 3A5WA 1ILOA 3BD2A 1N8JA 5J41A 3H1NA 3FR9A 1ERTA 4BPYA 3HYPA 1K3OA 2IMIA 3GH9A 2PBJA 4MJCA 5D73A 2GQLA 2VL3A 2CA8A 2ON7A 2GZYA 1FVKA 4POKA 2P31A 5KN3A 1S3CA 1EGOA 1TRSA 4KSMA 12GSA 3NOFA 5AISA 3VPTA 1XWKA 5HFIA 1V40A 3IBHA 4RQRA 5CRDA 3EC3A 1GNEA 3J7Yk 1W89A 1EP8A 4K5RA 5ID2A 3M8NA 1PN0A 1XVWA 3TKSA 3TJGA 5KN2A 1F2EA 4IBPA 3F6DA 2LS5A 4N30A 2F9SA 4POMA 2FGXA 2J9HA 4OMVA 4DSQA 3EPTA 5AGYA 2LQQA 4BWSA 5ECMB 2JADA 2BTOT 4HI7A 3MSZA 4ZL8A 2H19A 5ECPB 3D21A 5CREA 5J4UA 5ELGA 2OADA 2KP2A 2QGVA 5JWQB 2H0IA 4GTUA 2VL9A 1G0TA 2X8CA 1TW9A 3Q18A 5G5EA 4XCSA 1Z3EA 1MEKA 4O32A 4IJ3A 3O3TA 1S3DA 1VF2A 4K6XA 3GSTA 4ZB6A 4MLYA 1GTIA 2IJYA 1T00A 3LFLA 1OAZA 3TKRA 3F0IA 1SL2B 2VLTA 4L5OA 5D9WA 3IK9A 2GQKA 3E9JB 1VF3A 2HZEB 2B5XA 1SKSB 4F03A 2JZSA 3FHKA 1ZYEA 2F3MA 4CY8A 4I2TA 2A4VA 3FK8A 2WULA 3L9UA 1OKTA 3EURA 2HYXA 4G0IA 5A4VA 1A2MA 3F3RA 5BMUA 3CSHA 4YAPA 4JR6A 4I2UA 5C04A 2NBSA 2I81A 3GKKA 3TDGA 4MA9A 4HJ2A 1WMJA 2A4HA 2LJAA 4KA0A 1SD9A 4DVCA 1K0CA 2L4QA 4HS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B6N A;  2FHE A;  5G1K A;  4XRA A;  5ECQ B;  3TB2 A;  4JZQ A;  3M1G A;  3M9J A;  3RAZ A;  1ERV A;  5J5N A;  1O6J A;  1GL8 A;  2FA8 A;  3F4T A;  2H01 A;  4GST A;  3LQ7 A;  4PQI A;  1KNG A;  5JCG A;  1GUH A;  1J08 A;  2ZNM A;  1SD8 A;  2LNT A;  1M9A A;  2L4C A;  1Q4J A;  4BL7 A;  5GAP D;  4ECJ A;  2M72 A;  5GST A;  1CQG A;  1WE0 A;  4EF0 A;  3IAM 2;  2WB9 A;  1B4Q A;  14GS A;  3HVS A;  4ZB8 A;  3VLN A;  2HSH A;  2HZF A;  3ME8 A;  3PR8 A;  5H5R A;  1GTA A;  3L9V A;  2YWI A;  1A24 A;  3HJO A;  2N5F A;  3HVX A;  4FYU A;  4ECB A;  2O87 A;  4X43 A;  4G2E A;  2XPD A;  17GS A;  2H6Z A;  3K8N A;  4AGS A;  4OCF A;  2AHE A;  1WP0 A;  1PRX A;  5KEJ A;  3CMI A;  4GF0 A;  1UN2 A;  3UVH A;  4O5R A;  3FR3 A;  3HKR A;  2H8L A;  3QOU A;  1B9X C;  2VL2 A;  4MK3 A;  2VLV A;  3H4K A;  1MTC A;  2BJX A;  1T8E B;  1Z6N A;  2JZT A;  1Z5Y E;  2VCW A;  4JE1 A;  3I69 A;  4OO5 A;  6GSX A;  4L8E A;  2NPB A;  2NDO A;  4IVF A;  3ME7 A;  2PER A;  1QXH A;  3EMP A;  5B8A A;  1TK5 B;  1HNA A;  3DKS A;  4TR1 B;  4Q5N A;  4WET A;  1J0F A;  3UVT A;  4NV5 A;  1GSD A;  3LG6 A;  4HDE A;  2LRT A;  2K6V A;  5G1L A;  5CRG A;  3MAK A;  1SEN A;  4K2D A;  4PNG A;  2TIR A;  4PQ1 A;  2IIY A;  4FH8 A;  4ZBB A;  2ON5 A;  1URM A;  4RQX A;  1QFN A;  3W8S A;  5CO3 A;  4GQF A;  2GSQ A;  1HNC A;  3N9J A;  3VWW A;  3GN3 A;  5HR3 A;  5G2Z A;  1HNB A;  1QK8 A;  4N0V A;  3ZVJ A;  1JFU A;  3DVX A;  2E7P A;  4EXJ A;  3OR5 A;  2DJ2 A;  4XS1 A;  3I6A A;  2FY6 A;  3EU4 A;  2FA4 A;  2LNS A;  2VIM A;  2QKE A;  2YWO A;  3BJ5 A;  1WOU A;  1OC9 A;  3I9V 2;  1GUM A;  1ZCP A;  5AIV A;  4MZW A;  2WDU A;  2JU5 A;  22GS A;  1VF4 A;  4GSN A;  2LST A;  1YY7 A;  1SK1 A;  5IO0 A;  3GSS A;  1ZL9 A;  2C3Q A;  1M7T A;  4V2M A;  1B9Y C;  2CZ2 A;  2WJU A;  1A0R P;  4TR1 A;  4J2F A;  1TRW A;  5ECI B;  1IYH A;  4F9Z A;  2XHF A;  5FT3 A;  5LD0 A;  1X9W B;  5GAN D;  5A4W A;  3GKN A;  1SKR B;  4TKY A;  2H71 A;  2RM5 A;  2H6X A;  4ZB9 A;  1ON4 A;  1OC3 A;  4KH7 A;  1QGV A;  3IAS 2;  4PUR A;  18GS A;  2I9H A;  4WF4 A;  5IMF A;  3RBT A;  1DSB A;  3D0Z A;  9GSS A;  3BBY A;  3QDN A;  3F8U A;  1PGT A;  2LKU A;  3FEU A;  2H1B A;  3ZIJ A;  3TGZ A;  1T4Y A;  1EP7 A;  2HRN A;  2R6K A;  2H1D A;  1GSE A;  2VAF A;  2IMD A;  4OWY A;  4EE0 A;  20GS A;  3LJR A;  5E59 A;  1A2J A;  2AYT A;  1RK4 A;  2GZZ A;  1V9W A;  5ECN B;  4KCA A;  3FW2 A;  1F3B A;  3L4N A;  1T3B A;  4KGI A;  4RI6 A;  2JL4 A;  5IPG A;  1PX6 A;  1FO5 A;  5JCW A;  2V2G A;  4X0X A;  3U5R E;  2LEG A;  3IC4 A;  3TJF A;  4MP4 A;  4MMM A;  2WRT A;  2ZCT A;  2EIQ A;  4J56 E;  1G7E A;  2YCD A;  2MBT A;  1TI1 A;  2JSY A;  4EC0 A;  1GLQ A;  4O92 A;  1H4O A;  3ZFL A;  2I4A A;  2DLX A;  4ZBD A;  1AQV A;  1FB0 A;  2V6K A;  4KDY A;  4NMU A;  5G31 A;  2CV4 A;  1JLV A;  2LRC A;  2DJ1 A;  2VUP A;  5ID2 B;  3UAP A;  2TRC P;  1ZOF A;  2H1G A;  5DDL A;  1LJR A;  3U6V A;  3VFI A;  4BA7 A;  4E8E A;  5G5F A;  4GRF A;  3MNG A;  5IMA A;  1HQO A;  3ZTL A;  2YNX A;  3KMN A;  1NHO A;  3C1S A;  3UOM A;  3WGE A;  1Z9H A;  5DQS A;  2PMT A;  1X5C A;  1GLP A;  6GSV A;  2OE0 A;  3Q74 A;  2REM A;  1V2A A;  4ML6 A;  5DVB A;  3H79 A;  4IEL A;  2IMK A;  2VM2 A;  1LBK A;  5IMZ A;  3EMX A;  4IKH A;  4GSS A;  3J7Y b;  3C1R A;  1ZZY A;  3DRN A;  3CSI A;  4K0G A;  1WRY A;  3EE2 A;  2P5R A;  3GL5 A;  4HUA A;  2PPT A;  5DCH A;  2GT5 A;  4V1A p;  1EZK A;  2C80 A;  1E6B A;  3HZ8 A;  2PVO C;  5D96 A;  1TU8 A;  4Q5R A;  3DD3 A;  1B4P A;  4PX1 A;  2H66 A;  3ERG A;  2PGT A;  1XFL A;  1Q98 A;  2DIZ A;  3VK9 A;  3WGX A;  4HQZ A;  3APO A;  4JED A;  1M2A A;  3QAV A;  3KD0 A;  1PMT A;  3IR4 A;  3O76 A;  4EDZ A;  3WYW A;  4I8B A;  3BCK A;  2CVD A;  4JR4 A;  4PUA A;  2MYG A;  4WBJ A;  3PIN A;  1PSQ A;  1YJ6 A;  4AJ8 A;  4XS4 A;  4NXI A;  3DWV A;  3APS A;  4MZC A;  1AUC A;  5JCU A;  1JZO A;  4MJA A;  1M9B A;  1TXX A;  3P7X A;  4RUV A;  2KHP A;  2G2Q A;  2I1U A;  2X8G A;  3KGK A;  1G7O A;  5LCZ A;  1GP1 A;  2IMF A;  4NHW A;  2GST A;  3GHA A;  1KTE A;  2DJ0 A;  4FIW A;  4PXO A;  3ZYW A;  3DVW A;  4FYC A;  1AXD A;  4AJ7 A;  1WJK A;  3QPM A;  2LV3 A;  4OO4 A;  5COH A;  2DJ3 A;  1TKD B;  1A8L A;  3E0U A;  2HE3 A;  1SJI A;  4V2N A;  3UMA A;  2RII A;  5CAX A;  4IQ1 A;  1W4V A;  4HEA 2;  1XBS A;  3ED3 A;  1PD2 1;  3CSJ A;  2YP6 A;  1GH2 A;  3M9K A;  2GS3 A;  2H30 A;  1EWX A;  1XWB A;  3C71 A;  3W8J A;  2FUG 2;  4POL A;  3WGD A;  5IOW A;  3H93 A;  1UC7 A;  1XW6 A;  4KUN A;  2CVK A;  3KTL A;  2VLU A;  2DIY A;  3KP9 A;  3E3E A;  1LU4 A;  4I97 A;  4IP6 A;  4ZXG A;  2B5E A;  3HJM A;  1TU7 A;  4IW9 A;  2B3S A;  2RM6 A;  2V41 A;  1GTB A;  3CTF A;  2YAN A;  2CZ3 A;  3TUE A;  1Y6E A;  2F51 A;  5F06 A;  5IMV A;  1XPV A;  3KXO A;  2IPA A;  2DBC A;  4JRR A;  5IMD A;  3ZRD A;  2H76 A;  2LQO A;  4YAV A;  4WXT A;  3R2Q A;  5INY A;  5ECS A;  2R37 A;  2LTK A;  2G0F A;  3FR6 A;  1XVQ A;  2C3T A;  3VPQ A;  1EOG A;  3GX0 A;  3HD5 A;  4TXO A;  5G30 A;  1OVN A;  3GH6 A;  5ECK B;  3KP8 A;  1TI3 A;  6GSU A;  2BMX A;  3MWH A;  2IME A;  2H74 A;  3QAW A;  5CRW A;  4TR3 A;  1I9D A;  5ENU A;  3TKP A;  2OJL A;  2H70 A;  3G7I A;  5HQP A;  2QC7 A;  3EU3 A;  3O6T A;  3D4M A;  2H75 A;  4EDY A;  5HR2 A;  2CX3 A;  4ZIL A;  5B7C A;  3F6F A;  2L5O A;  4G9H A;  4MF5 A;  4RI7 A;  3M0F A;  4O7H A;  4EO3 A;  1K0A A;  3EYT A;  4BVY A;  3JCM L;  2O85 A;  4MF7 A;  1Z7R A;  2WS2 A;  3VWU A;  4Z7X A;  1V57 A;  3F9U A;  3NZN A;  2DC5 A;  4OFM A;  5H5S A;  1SK0 A;  1J9B A;  4K9Z A;  3GIX A;  1O73 A;  2H73 A;  3G7J A;  2WZ9 A;  5IMC A;  4F2I A;  1G6Y A;  3L9S A;  1TOF A;  4J57 E;  4ISD A;  1XCC A;  4X1U A;  2CQ9 A;  1OC9 B;  4L0W A;  1ZMA A;  2QSI A;  3WT1 A;  1XWC A;  4PNF A;  3C8E A;  1OKD A;  2DSA A;  1PN9 A;  5C00 A;  3DYR A;  1THO A;  2MMO A;  1E2Y A;  2R2J A;  1ZYQ B;  1U88 A;  5D8I A;  1SJZ A;  1FHE A;  3US3 A;  2C0D A;  1GSY A;  2KOK A;  2K8S A;  3A2V A;  3ZVJ D;  3QCP A;  2X99 A;  1IYI A;  4XS6 A;  1X9S B;  1MD3 A;  2CX4 A;  4F0B A;  3KMO A;  1M99 A;  3QFA C;  5IQY A;  1K0M A;  1PKZ A;  1X0R A;  4N0Z A;  1EEM A;  4GXZ A;  3M3M A;  2NTO A;  2YWM A;  1K0O A;  2RUF A;  4GWR A;  4MH3 A;  2JSZ A;  3AY8 A;  3HJP A;  1WIK A;  3WD6 A;  1MDK A;  3D4T A;  1X5D A;  4G19 A;  3NIV A;  4WEY A;  4G10 A;  3V1W A;  4AF2 A;  4PUF C;  3HVV A;  1U3I A;  2C1Y A;  1XOA A;  4QL9 A;  2DJK A;  1UVZ A;  5JWO B;  4Q5Q A;  1EEJ A;  2VO4 A;  3LXZ A;  1FOV A;  2C8U A;  2PN8 A;  1PL2 A;  3FZ4 A;  1SU9 A;  4AJ6 A;  3HDC A;  4NPB A;  4KSO A;  2HSY A;  4NWY A;  3TJJ A;  2CVB A;  5B6M A;  5B8B A;  5EPF A;  1QQ2 A;  1Z7P A;  3QFB C;  1M2B A;  3P90 A;  1CQH A;  5IIZ A;  2D2Z A;  6GSY A;  2EIO A;  3ZFB A;  1BED A;  2H0H A;  4I6X A;  1PA3 A;  1NHY A;  3GTU B;  4IN0 A;  5F07 A;  1GRX A;  2VD0 A;  1NSW A;  1A2L A;  1H75 A;  1K0D A;  1I5G A;  3HXS A;  1TK8 B;  1S3A A;  3DIE A;  1BYE A;  1FAA A;  1YEX A;  4WR4 A;  4K7O A;  1XW9 A;  2OE1 A;  3P8W A;  5IO2 A;  1EOH A;  4WKW A;  2YV7 A;  4K8M A;  2FCH A;  3TCO A;  1ML6 A;  4KB3 A;  4XIH A;  3GA4 A;  1U3A A;  2R3X A;  2I3Y A;  4XRD A;  2HLS A;  1R7H A;  3C7M A;  5CRH A;  1KBN A;  2C0G A;  3CYN A;  5FHI A;  3GX8 A;  4ILF A;  3GNJ A;  4KCE A;  5DAK A;  2FNO A;  1DBY A;  1V58 A;  3KEB A;  4TXV A;  4CHS A;  2GDR A;  2HXK A;  4MJE A;  1JHB A;  4LLR A;  1K0N A;  2VL2 C;  3CBU A;  2AJQ B;  3RPP A;  3KH7 A;  4YQU A;  5L71 A;  3L0H A;  4JU5 A;  2F8F A;  3ERW A;  1UA5 A;  1EV4 A;  1XW5 A;  3KJY A;  2MMZ A;  3ZML A;  3QR6 A;  2YOI A;  2VCV A;  4IHU A;  4F82 A;  3GTU A;  2OBK A;  1T4Z A;  3LEF A;  4NAX A;  1BJX A;  3GFK A;  2C3N A;  3EIN A;  1K3Y A;  4XS4 B;  2IN3 A;  1O81 A;  4KX4 A;  10GS A;  2YPM A;  1O85 A;  2OAC A;  4ZIJ A;  1B48 A;  5EY6 A;  2O7K A;  2TRX A;  2K9F A;  3FYG A;  3UBL A;  3ZIV A;  3IPZ A;  5F0G A;  1GSU A;  2DML A;  5ECO B;  1OE7 A;  3P2A A;  2H0G A;  2PUK C;  3Q19 A;  3VI5 A;  2V1M A;  1YKC A;  2AUV A;  5GSS A;  5GZZ B;  3TOU A;  2HFD A;  1R26 A;  2H6Y A;  2M80 A;  2YZU A;  1A23 A;  3UL3 A;  2H1A A;  3ERF A;  4YQV A;  2FLS A;  2PU9 C;  3LXT A;  5LNK e;  1SL1 B;  2E2M A;  2H72 A;  4N10 A;  1TK0 B;  1F3A A;  2IL3 A;  2ZUP A;  2VM1 A;  3PGT A;  4K1F A;  4HQS A;  2B5Y A;  2XC2 A;  5HR1 A;  3RHB A;  5ECH B;  2ALB A;  4KAE A;  3LSZ A;  3APQ A;  2KLX A;  4WF5 A;  2HT9 A;  1BAY A;  2GGT A;  2V6O A;  4NHZ A;  1PL1 A;  1YF0 A;  5D93 A;  5AN1 A;  5J9C A;  1QMV A;  1SL0 B;  1PX7 A;  2DJJ A;  3CRU A;  2O89 A;  3KCM A;  2MMA A;  19GS A;  5IOX A;  3IDV A;  4CDO A;  5AIX A;  5IPH A;  2IFQ A;  3IV4 A;  3MDK A;  13GS A;  2OKA A;  2VCT A;  3N5O A;  1SK2 A;  5D9V A;  1ABA A;  1C72 A;  4HZ2 A;  3FKF A;  8GSS A;  2PVQ A;  4HOJ A;  1WPI A;  2YWN A;  1F6M C;  2E2G A;  2B7K A;  5E4W A;  5DAL B;  5HFG A;  5A5K A;  1RW1 A;  1ERW A;  3GKX A;  2HI7 A;  3DXB A;  3ZMK A;  2C0E A;  1VRS D;  1T7P B;  1GUK A;  1NM3 A;  2X64 A;  1RQM A;  2B1K A;  4IQA A;  5CNW A;  4MH2 A;  4TXO B;  4DSS A;  4K7I A;  2DMM A;  3EWL A;  4QL7 A;  4TW5 A;  1YF1 A;  2VOC A;  3CTG A;  4BVX A;  1K3L A;  2GQM A;  3KTB A;  4TR0 A;  1PQN A;  1AQW A;  3BCI A;  3ISO A;  4ID0 A;  4I5Q A;  1XWA A;  3EVI A;  2L6D A;  16GS A;  2FWH A;  2F8A A;  1SYR A;  4TR4 A;  2X8H A;  4L5L A;  5DQY A;  1HD2 A;  5J3R A;  1JZW A;  3LYP A;  5D9X A;  1XXU A;  3ZZX A;  2L57 A;  1Z6M A;  4HU7 A;  3TRX A;  2A2R A;  1VGL A;  1N2A A;  5ABR A;  4KW6 A;  3SWL A;  2CAQ A;  1T1V A;  11GS A;  1EGR A;  1YDK A;  5ECL B;  1MDJ A;  3HHV A;  1A8Y A;  2K8V A;  2YZH A;  3GRX A;  3HA9 A;  2B7J A;  5HFK A;  2GTU A;  1M0U A;  1U87 A;  1FB6 A;  2J23 A;  4IP1 A;  3GL3 A;  4ZBA A;  2O8V B;  1AIU A;  2RLI A;  2GT6 A;  4D73 B;  1QUW A;  2XBI A;  2VCQ A;  3L78 A;  2OA7 A;  5DAL A;  3DEX A;  1DE2 A;  2KUC A;  2VCX A;  4MAB A;  4NV2 A;  1OC8 A;  6GSS A;  1YZX A;  3RHC A;  1YEP A;  2LRN A;  4F0C A;  1JLW A;  3QMX A;  3UEM A;  4QQ7 A;  3TOT A;  4ML1 A;  3VUR A;  3RPN A;  5IM9 A;  4LMW A;  5H5Q A;  3GUS A;  3HZ4 A;  4MZB A;  5DBQ A;  2PWJ A;  2JZR A;  3ZL5 A;  4HZ4 A;  1TTZ A;  4FO5 A;  2L6C A;  4P3Y B;  3CXG A;  3H8Q A;  3UJ1 A;  1SKW B;  3HY2 A;  3IHQ A;  2CAI A;  4LMV A;  2IWT A;  3BOA A;  3C73 A;  3IK7 A;  2HZE A;  5HR0 A;  1X5E A;  2FWF A;  3VWV A;  4IS0 A;  1YQ1 A;  1ERU A;  3TKS C;  4LA1 A;  4GCI A;  3F3Q A;  4OFT A;  3D22 A;  2LUS A;  1V98 A;  4MPG A;  5KN1 A;  5DJL A;  1ZGN A;  4DSR A;  4D73 A;  2R4V A;  4YH2 A;  3GV1 A;  4ZL7 A;  3HCZ A;  4EKZ A;  3PH9 A;  4TN8 A;  1Y25 A;  4PQH A;  2YV9 A;  2YJH A;  2P5Q A;  2L5L A;  1MD4 A;  1TDI A;  2GZP A;  3IE3 A;  2OBI A;  1GSS A;  1GNW A;  1JZR A;  3F63 A;  3F4R A;  4E8H A;  4YQM A;  2HNL A;  3IA1 A;  2B1L A;  3I43 A;  1G6W A;  2AAW A;  3G9B A;  4CW9 A;  3FZA A;  2LJR A;  1USB A;  2YJ7 A;  3TJB A;  4DEJ A;  5KN0 A;  4OD7 A;  3D6I A;  2LJK A;  3ZRE A;  4ZL9 A;  3GMF A;  1R4W A;  1U6T A;  5A4U A;  5FWG A;  3TKQ A;  2MMN A;  3LGC A;  1BX9 A;  1THX A;  1OE8 A;  2FWE A;  4IJI A;  4KDX A;  1HYU A;  4KDU A;  1KEB A;  3IOS A;  1GWC A;  5J9B A;  1O8X A;  3QAG A;  4N11 A;  1WWJ A;  1GUL A;  5DJM A;  5F05 A;  1O8W A;  1TJD A;  4GLT A;  2EIR A;  4EVM A;  3LYK A;  2P0G A;  2N5B A;  4BWQ A;  7GSS A;  3TJK A;  2EC4 A;  2HRF A;  3G7Y A;  5CP1 A;  4OFN A;  2MBS A;  2FWG A;  5DAK B;  4ULX A;  1OYJ A;  1AW9 A;  1YKA A;  4ACS A;  2OE3 A;  4WBR D;  2VCZ A;  1TRV A;  1K0B A;  2RUE A;  4ECI A;  3F4S A;  1AQX A;  2A2S A;  1BQ7 A;  1F9M A;  3A2X A;  1R5P A;  1MDI A;  4L0U A;  5JWR B;  4IGJ A;  4TRX A;  4XHM A;  3S9F A;  4TVE A;  1GTU A;  2C0F A;  1XIY A;  5ECR B;  3CRT A;  1FW1 A;  3FZ9 A;  5DCG A;  2WGR A;  1ST9 A;  3KZQ A;  1XWG A;  1TRU A;  1TP9 A;  3UBK A;  3KM6 A;  5EL8 A;  2V32 A;  1B8X A;  3W6G A;  5ELA A;  1NW2 A;  1FVJ A;  3KIJ A;  4PGT A;  4V2L A;  3ZLP A;  2E0Q A;  4POB A;  2XPE A;  4H86 A;  2XBQ A;  3FY7 A;  4JBB A;  1SJ6 A;  4MJB A;  3LWA A;  4MCU A;  2K18 A;  2GLR A;  3VWX A;  4ECC A;  3D5J A;  3VI7 A;  1FG4 A;  3GKM A;  3QD9 A;  2FD3 A;  1ACV A;  3TKS E;  6GST A;  3GYK A;  2Z9S A;  1AC1 A;  1O7U A;  4K7N A;  4EL1 A;  2L59 A;  3TRQ A;  2N5A A;  4WR5 A;  1EV9 A;  2AB6 A;  5EVO A;  4KND A;  1M2D A;  4KE3 A;  5CYY A;  3Q6O A;  3A3T A;  4HU9 A;  1R5A A;  3FRC A;  1AAZ A;  2CT6 A;  1GSF A;  1PKW A;  2M46 A;  3GUR A;  4V1A g;  1GSQ A;  5D9T A;  2WFC A;  3UAR A;  1XZO A;  1DUG A;  3UIW A;  3TRP A;  4K0N A;  5F8B A;  1DE1 A;  2IFQ B;  3FZ5 A;  4TOP A;  4GQC A;  4HJM A;  1BG5 A;  1VF1 A;  2JAC A;  1SYX A;  1XOB A;  4MDC A;  2ES7 A;  6GSW A;  4Q5F A;  3RDW A;  3ZIT A;  3SBC A;  2AV4 A;  2KP1 A;  2NVL A;  3DGQ A;  2R5G A;  3IXR A;  3LOR A;  4MPF A;  3DML A;  4EUY A;  2WCI A;  2MZC A;  1X9M B;  1A0F A;  3A2W A;  2B6M A;  3IRA A;  2GVP A;  1JZD A;  4DSS B;  2YN1 A;  2C4J A;  4MF6 A;  3KH9 A;  4XTS A;  4LL4 B;  2GSR A;  4OCE A;  2VD1 A;  1F37 A;  3WT2 A;  4LL1 B;  2GSS A;  4FYB A;  3A5W A;  1ILO A;  3BD2 A;  1N8J A;  5J41 A;  3H1N A;  3FR9 A;  1ERT A;  4BPY A;  3HYP A;  1K3O A;  2IMI A;  3GH9 A;  2PBJ A;  4MJC A;  5D73 A;  2GQL A;  2VL3 A;  2CA8 A;  2ON7 A;  2GZY A;  1FVK A;  4POK A;  2P31 A;  5KN3 A;  1S3C A;  1EGO A;  1TRS A;  4KSM A;  12GS A;  3NOF A;  5AIS A;  3VPT A;  1XWK A;  5HFI A;  1V40 A;  3IBH A;  4RQR A;  5CRD A;  3EC3 A;  1GNE A;  3J7Y k;  1W89 A;  1EP8 A;  5ID2 A;  3M8N A;  1XVW A;  3TKS A;  3TJG A;  5KN2 A;  1F2E A;  4IBP A;  3F6D A;  2LS5 A;  4N30 A;  2F9S A;  4POM A;  2FGX A;  2J9H A;  4OMV A;  4DSQ A;  5AGY A;  2LQQ A;  4BWS A;  5ECM B;  2JAD A;  2BTO T;  4HI7 A;  3MSZ A;  4ZL8 A;  2H19 A;  5ECP B;  3D21 A;  5CRE A;  5J4U A;  5ELG A;  2OAD A;  2KP2 A;  2QGV A;  5JWQ B;  2H0I A;  4GTU A;  2VL9 A;  1G0T A;  2X8C A;  1TW9 A;  3Q18 A;  5G5E A;  4XCS A;  1Z3E A;  1MEK A;  4O32 A;  4IJ3 A;  3O3T A;  1S3D A;  1VF2 A;  4K6X A;  3GST A;  4ZB6 A;  4MLY A;  1GTI A;  2IJY A;  1T00 A;  3LFL A;  1OAZ A;  3TKR A;  3F0I A;  1SL2 B;  2VLT A;  4L5O A;  5D9W A;  3IK9 A;  2GQK A;  3E9J B;  1VF3 A;  2HZE B;  2B5X A;  1SKS B;  4F03 A;  2JZS A;  3FHK A;  1ZYE A;  2F3M A;  4I2T A;  2A4V A;  3FK8 A;  2WUL A;  3L9U A;  1OKT A;  3EUR A;  2HYX A;  5A4V A;  1A2M A;  3F3R A;  3CSH A;  4YAP A;  4JR6 A;  4I2U A;  5C04 A;  2NBS A;  2I81 A;  3GKK A;  3TDG A;  4MA9 A;  4HJ2 A;  1WMJ A;  2LJA A;  4KA0 A;  1SD9 A;  4DVC A;  1K0C A;  2L4Q A;  4HS1 A; 
#chains in the Genus database with same CATH topology
 5B6N A;  2FHE A;  5G1K A;  4XRA A;  5ECQ B;  3TB2 A;  4Z2T A;  4JZQ A;  3M1G A;  3M9J A;  4YKG A;  3RAZ A;  1ERV A;  5J5N A;  1O6J A;  1GL8 A;  2FA8 A;  3F4T A;  2H01 A;  4GST A;  3LQ7 A;  4PQI A;  1KNG A;  5JCG A;  1GUH A;  1J08 A;  2ZNM A;  1SD8 A;  2LNT A;  1M9A A;  2L4C A;  2UZ8 A;  1Q4J A;  4BL7 A;  5GAP D;  4ECJ A;  2M72 A;  5GST A;  1CQG A;  1WE0 A;  4EF0 A;  3IAM 2;  2WB9 A;  1B4Q A;  14GS A;  3HVS A;  4ZB8 A;  3VLN A;  2HSH A;  2HZF A;  3ME8 A;  4PTS A;  3PR8 A;  5H5R A;  1GTA A;  3L9V A;  2YWI A;  1A24 A;  3HJO A;  2N5F A;  3HVX A;  4FYU A;  4ECB A;  2O87 A;  4X43 A;  4G2E A;  2XPD A;  17GS A;  2H6Z A;  3K8N A;  4AGS A;  4OCF A;  2AHE A;  1WP0 A;  1PRX A;  5KEJ A;  3CMI A;  4GF0 A;  1UN2 A;  3UVH A;  4O5R A;  3FR3 A;  3HKR A;  2H8L A;  3QOU A;  1B9X C;  2VL2 A;  4MK3 A;  2VLV A;  3H4K A;  1MTC A;  2BJX A;  1T8E B;  3IC8 A;  1Z6N A;  2JZT A;  1Z5Y E;  2VCW A;  4JE1 A;  3I69 A;  4OO5 A;  6GSX A;  4L8E A;  2NPB A;  2NDO A;  4IVF A;  3ME7 A;  2PER A;  1QXH A;  3EMP A;  5B8A A;  1TK5 B;  1HNA A;  3DKS A;  4TR1 B;  4Q5N A;  4WET A;  1J0F A;  3UVT A;  4NV5 A;  1GSD A;  3LG6 A;  4HDE A;  2LRT A;  2K6V A;  5G1L A;  5CRG A;  3MAK A;  1SEN A;  4K2D A;  4PNG A;  2TIR A;  4PQ1 A;  2IIY A;  4FH8 A;  4ZBB A;  2ON5 A;  1URM A;  4RQX A;  1QFN A;  3W8S A;  5CO3 A;  4GQF A;  2GSQ A;  1HNC A;  3N9J A;  3VWW A;  3GN3 A;  5HR3 A;  5G2Z A;  1HNB A;  1QK8 A;  4N0V A;  3ZVJ A;  3R3E A;  1JFU A;  3DVX A;  2E7P A;  4EXJ A;  3OR5 A;  2DJ2 A;  4XS1 A;  3I6A A;  2FY6 A;  3EU4 A;  2FA4 A;  2LNS A;  2VIM A;  3MYD A;  2QKE A;  2YWO A;  3BJ5 A;  1WOU A;  1OC9 A;  3I9V 2;  1GUM A;  1ZCP A;  5AIV A;  4MZW A;  2WDU A;  2JU5 A;  22GS A;  1VF4 A;  4GSN A;  3LW9 A;  2LST A;  1YY7 A;  1SK1 A;  5IO0 A;  3GSS A;  1ZL9 A;  2C3Q A;  1M7T A;  4V2M A;  1B9Y C;  2CZ2 A;  2WJU A;  1A0R P;  4TR1 A;  4J2F A;  1TRW A;  5ECI B;  1IYH A;  4F9Z A;  2XHF A;  5FT3 A;  5LD0 A;  1X9W B;  5GAN D;  4USS A;  5A4W A;  3GKN A;  1SKR B;  4TKY A;  2H71 A;  2RM5 A;  2H6X A;  4ZB9 A;  1ON4 A;  1OC3 A;  4KH7 A;  1QGV A;  3IAS 2;  4PUR A;  18GS A;  2I9H A;  4WF4 A;  5IMF A;  3RBT A;  4ICY A;  1DSB A;  3D0Z A;  9GSS A;  3BBY A;  3QDN A;  3F8U A;  1PGT A;  2LKU A;  3FEU A;  2H1B A;  3ZIJ A;  3TGZ A;  1T4Y A;  1EP7 A;  2HRN A;  2R6K A;  4CY6 A;  2H1D A;  1GSE A;  2VAF A;  2IMD A;  4OWY A;  4EE0 A;  20GS A;  3LJR A;  5E59 A;  1A2J A;  2AYT A;  1RK4 A;  2GZZ A;  1V9W A;  5ECN B;  4KCA A;  3FW2 A;  1F3B A;  3L4N A;  1T3B A;  4KGI A;  4RI6 A;  2JL4 A;  5IPG A;  1PX6 A;  1FO5 A;  5JCW A;  2V2G A;  4X0X A;  3U5R E;  2LEG A;  3IC4 A;  3TJF A;  4MP4 A;  4MMM A;  2WRT A;  2ZCT A;  2EIQ A;  4J56 E;  1G7E A;  2YCD A;  2MBT A;  1TI1 A;  2JSY A;  4EC0 A;  1GLQ A;  4O92 A;  1H4O A;  3ZFL A;  2I4A A;  2DLX A;  4ZBD A;  1AQV A;  1FB0 A;  2V6K A;  4KDY A;  5KOX A;  4NMU A;  5G31 A;  2CV4 A;  1JLV A;  2LRC A;  2DJ1 A;  2VUP A;  5ID2 B;  4BIK A;  3UAP A;  2TRC P;  1ZOF A;  2H1G A;  5DDL A;  1LJR A;  3U6V A;  3VFI A;  4BA7 A;  4E8E A;  5G5F A;  4GRF A;  3MNG A;  5IMA A;  1HQO A;  3ZTL A;  2YNX A;  3KMN A;  1NHO A;  3C1S A;  3UOM A;  3WGE A;  1Z9H A;  5DQS A;  2PMT A;  1X5C A;  1GLP A;  6GSV A;  2OE0 A;  3Q74 A;  1M3I A;  2REM A;  1V2A A;  4ML6 A;  5DVB A;  3H79 A;  4IEL A;  2IMK A;  2VM2 A;  1LBK A;  5IMZ A;  3EMX A;  4IKH A;  4GSS A;  3J7Y b;  3C1R A;  1ZZY A;  3DRN A;  3CSI A;  4K0G A;  1WRY A;  3EE2 A;  2P5R A;  3GL5 A;  4HUA A;  2PPT A;  5DCH A;  2GT5 A;  4V1A p;  1EZK A;  2C80 A;  1E6B A;  3HZ8 A;  2PVO C;  5D96 A;  1TU8 A;  4Q5R A;  3DD3 A;  1B4P A;  4PX1 A;  2H66 A;  3ERG A;  2PGT A;  1XFL A;  1Q98 A;  2DIZ A;  3VK9 A;  3WGX A;  4HQZ A;  3APO A;  4JED A;  1M2A A;  3QAV A;  3KD0 A;  1PMT A;  3IR4 A;  3O76 A;  4EDZ A;  3WYW A;  4I8B A;  3BCK A;  2CVD A;  4JR4 A;  4PUA A;  2MYG A;  4WBJ A;  4EIP A;  3PIN A;  1PSQ A;  1YJ6 A;  4AJ8 A;  4XS4 A;  4NXI A;  3DWV A;  3APS A;  4MZC A;  1AUC A;  5JCU A;  1JZO A;  4MJA A;  1M9B A;  1TXX A;  3P7X A;  4RUV A;  2KHP A;  2G2Q A;  2I1U A;  2X8G A;  3KGK A;  1G7O A;  5LCZ A;  1GP1 A;  2IMF A;  4NHW A;  2GST A;  3GHA A;  1KTE A;  2DJ0 A;  2X4A A;  4FIW A;  4PXO A;  3ZYW A;  3DVW A;  4FYC A;  1AXD A;  4AJ7 A;  1WJK A;  3QPM A;  2LV3 A;  4OO4 A;  5COH A;  2DJ3 A;  1TKD B;  1A8L A;  3E0U A;  2HE3 A;  1SJI A;  4V2N A;  3UMA A;  2RII A;  5CAX A;  4IQ1 A;  1W4V A;  4HEA 2;  1XBS A;  3ED3 A;  1PD2 1;  3CSJ A;  2YP6 A;  1GH2 A;  3M9K A;  2GS3 A;  4BL7 B;  2H30 A;  1EWX A;  1XWB A;  3C71 A;  3W8J A;  2FUG 2;  4POL A;  3WGD A;  5IOW A;  3H93 A;  1UC7 A;  1XW6 A;  4KUN A;  2CVK A;  3KTL A;  5KOW A;  2VLU A;  2DIY A;  3KP9 A;  3E3E A;  1LU4 A;  4I97 A;  4IP6 A;  4ZXG A;  2B5E A;  3HJM A;  1TU7 A;  1ZYP A;  4IW9 A;  2B3S A;  2RM6 A;  2V41 A;  1GTB A;  3CTF A;  2YAN A;  2CZ3 A;  3TUE A;  1Y6E A;  2F51 A;  5F06 A;  5IMV A;  1XPV A;  3KXO A;  2IPA A;  2DBC A;  4JRR A;  5IMD A;  3ZRD A;  2H76 A;  2LQO A;  4YAV A;  4WXT A;  3R2Q A;  5INY A;  5ECS A;  2R37 A;  2LTK A;  2G0F A;  3FR6 A;  1XVQ A;  2C3T A;  3VPQ A;  1EOG A;  3GX0 A;  3HD5 A;  4TXO A;  5G30 A;  1OVN A;  3GH6 A;  5ECK B;  3KP8 A;  1TI3 A;  2R0P A;  6GSU A;  2BMX A;  3MWH A;  2IME A;  2H74 A;  3QAW A;  5CRW A;  4TR3 A;  1I9D A;  5ENU A;  3TKP A;  2OJL A;  2H70 A;  3G7I A;  4A5P A;  3IHG A;  5HQP A;  2QC7 A;  3EU3 A;  3O6T A;  3HVN A;  3D4M A;  2H75 A;  4EDY A;  5HR2 A;  2CX3 A;  4ZIL A;  5B7C A;  3F6F A;  2DKH A;  2L5O A;  4G9H A;  4MF5 A;  4RI7 A;  3M0F A;  4O7H A;  4EO3 A;  1K0A A;  3EYT A;  4BVY A;  3JCM L;  2O85 A;  4MF7 A;  1Z7R A;  2WS2 A;  3VWU A;  4Z7X A;  2HSM A;  1V57 A;  3F9U A;  3NZN A;  2DC5 A;  4OFM A;  5H5S A;  1SK0 A;  1J9B A;  4K9Z A;  3GIX A;  1O73 A;  2H73 A;  3G7J A;  2WZ9 A;  5IMC A;  2X49 A;  4F2I A;  1G6Y A;  3L9S A;  1TOF A;  4J57 E;  4ISD A;  1XCC A;  4YKF A;  4X1U A;  2CQ9 A;  1OC9 B;  4L0W A;  1ZMA A;  2QSI A;  3WT1 A;  1XWC A;  4PNF A;  3C8E A;  1OKD A;  2DSA A;  1PN9 A;  5C00 A;  3DYR A;  1THO A;  2MMO A;  1E2Y A;  5BRT A;  2R2J A;  1ZYQ B;  1U88 A;  5D8I A;  1SJZ A;  1FHE A;  3US3 A;  2C0D A;  1GSY A;  2KOK A;  2K8S A;  3A2V A;  3ZVJ D;  3QCP A;  2X99 A;  1IYI A;  4XS6 A;  1X9S B;  1MD3 A;  2CX4 A;  4F0B A;  3KMO A;  1M99 A;  3QFA C;  5IQY A;  1K0M A;  1PKZ A;  1X0R A;  4N0Z A;  4EIQ A;  1EEM A;  4GXZ A;  3M3M A;  2NTO A;  2YWM A;  1K0O A;  2RUF A;  4GWR A;  4MH3 A;  2JSZ A;  3AY8 A;  3HJP A;  1WIK A;  3WD6 A;  1MDK A;  3D4T A;  1X5D A;  4G19 A;  3NIV A;  4WEY A;  4G10 A;  1S3R A;  3V1W A;  4AF2 A;  4PUF C;  3HVV A;  1U3I A;  2C1Y A;  1XOA A;  4QL9 A;  2DJK A;  1UVZ A;  5JWO B;  4Q5Q A;  1EEJ A;  2VO4 A;  3LXZ A;  1FOV A;  3MIX A;  2C8U A;  2PN8 A;  1PL2 A;  3FZ4 A;  1SU9 A;  4AJ6 A;  3HDC A;  4NPB A;  4KSO A;  2HSY A;  4NWY A;  3TJJ A;  2CVB A;  5B6M A;  5B8B A;  5EPF A;  1QQ2 A;  1Z7P A;  3QFB C;  1M2B A;  3P90 A;  1CQH A;  5IIZ A;  2D2Z A;  6GSY A;  2EIO A;  3ZFB A;  1BED A;  2H0H A;  4I6X A;  1PA3 A;  1NHY A;  3GTU B;  4IN0 A;  5F07 A;  1GRX A;  2VD0 A;  1NSW A;  1A2L A;  3FMW A;  1H75 A;  1K0D A;  1I5G A;  3HXS A;  4O5Q A;  1TK8 B;  1S3A A;  3DIE A;  1BYE A;  1FAA A;  1YEX A;  4WR4 A;  4K7O A;  1XW9 A;  2OE1 A;  3P8W A;  5IO2 A;  1EOH A;  4WKW A;  2YV7 A;  4K8M A;  2FCH A;  3TCO A;  1ML6 A;  4KB3 A;  4XIH A;  3GA4 A;  1U3A A;  4KF9 A;  2QA1 A;  2R3X A;  2I3Y A;  4XRD A;  2HLS A;  1R7H A;  3C7M A;  5CRH A;  1KBN A;  2C0G A;  3CYN A;  5FHI A;  3GX8 A;  4ILF A;  3GNJ A;  4KCE A;  5DAK A;  2FNO A;  1DBY A;  1V58 A;  3KEB A;  4TXV A;  4CHS A;  2GDR A;  2HXK A;  4MJE A;  1JHB A;  4LLR A;  1K0N A;  2VL2 C;  3CBU A;  2AJQ B;  3RPP A;  3KH7 A;  4YQU A;  5L71 A;  3L0H A;  4JU5 A;  2F8F A;  4K5S A;  3ERW A;  1UA5 A;  1EV4 A;  1XW5 A;  3KJY A;  2MMZ A;  3ZML A;  3QR6 A;  2QA2 A;  2YOI A;  2VCV A;  4IHU A;  4F82 A;  3GTU A;  2OBK A;  1T4Z A;  3LEF A;  4NAX A;  1BJX A;  3GFK A;  2C3N A;  3EIN A;  1K3Y A;  4XS4 B;  2IN3 A;  1O81 A;  4KX4 A;  10GS A;  2YPM A;  1O85 A;  2OAC A;  4ZIJ A;  1B48 A;  5EY6 A;  2O7K A;  2TRX A;  2K9F A;  3FYG A;  3UBL A;  3ZIV A;  3IPZ A;  5F0G A;  1GSU A;  2DML A;  5ECO B;  1OE7 A;  3P2A A;  2H0G A;  2PUK C;  3Q19 A;  3VI5 A;  2V1M A;  1YKC A;  2AUV A;  4Z2R A;  5GSS A;  5GZZ B;  3TOU A;  2HFD A;  1R26 A;  2H6Y A;  2M80 A;  2YZU A;  1A23 A;  4X4J A;  3UL3 A;  2H1A A;  3ERF A;  4YQV A;  2FLS A;  2PU9 C;  3LXT A;  5LNK e;  1SL1 B;  2E2M A;  1FOH A;  2H72 A;  4N10 A;  1TK0 B;  1F3A A;  2IL3 A;  2ZUP A;  4BVX B;  2VM1 A;  3PGT A;  4K1F A;  4HQS A;  2B5Y A;  2XC2 A;  5HR1 A;  3RHB A;  2ALB A;  5ECH B;  4KAE A;  4K2X A;  3LSZ A;  3APQ A;  2KLX A;  4WF5 A;  2HT9 A;  1BAY A;  2GGT A;  2V6O A;  4NHZ A;  1PL1 A;  1YF0 A;  5D93 A;  5AN1 A;  5J9C A;  1QMV A;  1SL0 B;  1PX7 A;  2DJJ A;  3CRU A;  2O89 A;  3KCM A;  2MMA A;  19GS A;  5IOX A;  3IDV A;  4CDO A;  5AIX A;  5IPH A;  2IFQ A;  3IV4 A;  3MDK A;  13GS A;  2OKA A;  2VCT A;  3N5O A;  1SK2 A;  5D9V A;  1ABA A;  1C72 A;  4HZ2 A;  3FKF A;  8GSS A;  2PVQ A;  4HOJ A;  1WPI A;  2YWN A;  1F6M C;  2E2G A;  2B7K A;  5E4W A;  5DAL B;  5HFG A;  5A5K A;  3CQF A;  1RW1 A;  1ERW A;  3GKX A;  2HI7 A;  3DXB A;  3ZMK A;  2C0E A;  1VRS D;  1T7P B;  1GUK A;  1NM3 A;  2X64 A;  1RQM A;  2B1K A;  4IQA A;  5CNW A;  4MH2 A;  4TXO B;  4DSS A;  4K7I A;  2DMM A;  3EWL A;  4QL7 A;  4TW5 A;  1YF1 A;  2VOC A;  3CTG A;  4BVX A;  1K3L A;  2GQM A;  3KTB A;  4TR0 A;  1PQN A;  1AQW A;  3BCI A;  3ISO A;  4ID0 A;  4I5Q A;  1XWA A;  3EVI A;  2L6D A;  16GS A;  2FWH A;  2F8A A;  1SYR A;  4TR4 A;  4Z2U A;  2X8H A;  4L5L A;  5DQY A;  1HD2 A;  5J3R A;  1JZW A;  3LYP A;  1XXU A;  5D9X A;  3ZZX A;  2L57 A;  1Z6M A;  4HU7 A;  3TRX A;  2A2R A;  1VGL A;  1N2A A;  5ABR A;  4BVY B;  4KW6 A;  3SWL A;  2CAQ A;  1T1V A;  11GS A;  1EGR A;  1YDK A;  5ECL B;  1MDJ A;  3HHV A;  1A8Y A;  2K8V A;  2YZH A;  3GRX A;  3HA9 A;  2B7J A;  5HFK A;  2GTU A;  1M0U A;  1U87 A;  1FB6 A;  2J23 A;  4IP1 A;  3GL3 A;  4ZBA A;  2O8V B;  1AIU A;  2RLI A;  2GT6 A;  4D73 B;  1QUW A;  2XBI A;  2HRK A;  2VCQ A;  3L78 A;  2OA7 A;  5DAL A;  3DEX A;  1DE2 A;  2KUC A;  2VCX A;  4MAB A;  4NV2 A;  1OC8 A;  6GSS A;  1YZX A;  3RHC A;  1YEP A;  2LRN A;  4F0C A;  1JLW A;  3QMX A;  3UEM A;  4QQ7 A;  3TOT A;  4ML1 A;  3VUR A;  3RPN A;  5IM9 A;  4LMW A;  5H5Q A;  3GUS A;  3HZ4 A;  4MZB A;  5DBQ A;  2PWJ A;  2JZR A;  3ZL5 A;  4HZ4 A;  1TTZ A;  4FO5 A;  2L6C A;  4P3Y B;  3CXG A;  3H8Q A;  3UJ1 A;  1SKW B;  3HY2 A;  3IHQ A;  2CAI A;  4LMV A;  2IWT A;  3BOA A;  3C73 A;  3IK7 A;  2HZE A;  5HR0 A;  1X5E A;  2FWF A;  3VWV A;  1PFO A;  4IS0 A;  1YQ1 A;  1M3J A;  1ERU A;  3TKS C;  4LA1 A;  2R0C A;  4GCI A;  3F3Q A;  4OFT A;  3D22 A;  2LUS A;  1V98 A;  4MPG A;  5KN1 A;  5DJL A;  2HRA A;  1ZGN A;  4DSR A;  4D73 A;  2R4V A;  4YH2 A;  3GV1 A;  4ZL7 A;  3HCZ A;  4EKZ A;  3PH9 A;  4TN8 A;  4PQH A;  1Y25 A;  2YV9 A;  2YJH A;  4O5U A;  2P5Q A;  2L5L A;  1MD4 A;  1TDI A;  2GZP A;  3IE3 A;  2OBI A;  1GSS A;  1GNW A;  1JZR A;  3F63 A;  3F4R A;  4E8H A;  4YQM A;  2HNL A;  3IA1 A;  2B1L A;  3I43 A;  1G6W A;  2AAW A;  3G9B A;  4CW9 A;  3FZA A;  2LJR A;  1USB A;  2YJ7 A;  3TJB A;  4DEJ A;  5KN0 A;  4OD7 A;  3D6I A;  2LJK A;  3ZRE A;  4ZL9 A;  3GMF A;  1R4W A;  1U6T A;  5A4U A;  5FWG A;  3TKQ A;  2MMN A;  2R0G A;  3LGC A;  1BX9 A;  1THX A;  1OE8 A;  2FWE A;  4IJI A;  4KDX A;  1HYU A;  4KDU A;  1KEB A;  3IOS A;  1GWC A;  5J9B A;  1O8X A;  3QAG A;  4N11 A;  1WWJ A;  1GUL A;  5DJM A;  5F05 A;  1O8W A;  1TJD A;  4GLT A;  2EIR A;  4G0L A;  4EVM A;  3LYK A;  2P0G A;  2N5B A;  4FQU A;  4BWQ A;  7GSS A;  3TJK A;  2EC4 A;  2HRF A;  3PPU A;  3G7Y A;  5CP1 A;  4OFN A;  3A5I A;  2MBS A;  2FWG A;  5DAK B;  4ULX A;  1OYJ A;  1AW9 A;  1YKA A;  4ACS A;  2OE3 A;  4WBR D;  2VCZ A;  1TRV A;  1K0B A;  2RUE A;  4MNN A;  4ECI A;  3F4S A;  1AQX A;  2A2S A;  1BQ7 A;  1F9M A;  3A2X A;  1R5P A;  1MDI A;  4L0U A;  5JWR B;  4IGJ A;  4TRX A;  4XHM A;  3S9F A;  4TVE A;  1GTU A;  2C0F A;  1XIY A;  5ECR B;  3CRT A;  1FW1 A;  3FZ9 A;  5DCG A;  2WGR A;  1ST9 A;  3KZQ A;  1XWG A;  1TRU A;  1TP9 A;  3UBK A;  3KM6 A;  5EL8 A;  2V32 A;  1B8X A;  3W6G A;  5ELA A;  1NW2 A;  1FVJ A;  3KIJ A;  4PGT A;  4V2L A;  3ZLP A;  2E0Q A;  4G0K A;  4POB A;  2XPE A;  4H86 A;  2XBQ A;  3FY7 A;  4JBB A;  1SJ6 A;  4MJB A;  3LWA A;  4MCU A;  2K18 A;  2GLR A;  3VWX A;  4ECC A;  3D5J A;  3VI7 A;  1FG4 A;  3GKM A;  2A2P A;  3QD9 A;  2FD3 A;  1ACV A;  3TKS E;  6GST A;  3GYK A;  2Z9S A;  1AC1 A;  1O7U A;  4K7N A;  4EL1 A;  2L59 A;  3TRQ A;  2N5A A;  4WR5 A;  1EV9 A;  2AB6 A;  5EVO A;  4KND A;  1M2D A;  4KE3 A;  5CYY A;  3Q6O A;  3A3T A;  4HU9 A;  1R5A A;  3FRC A;  1AAZ A;  2CT6 A;  1GSF A;  1PKW A;  2M46 A;  3GUR A;  4V1A g;  1GSQ A;  5D9T A;  2WFC A;  3UAR A;  1XZO A;  1DUG A;  3UIW A;  3TRP A;  4K0N A;  5F8B A;  1DE1 A;  2IFQ B;  3FZ5 A;  4TOP A;  4GQC A;  4HJM A;  1BG5 A;  1VF1 A;  2JAC A;  1SYX A;  1XOB A;  4MDC A;  2ES7 A;  2DKI A;  6GSW A;  4Q5F A;  3RDW A;  3ZIT A;  3SBC A;  2AV4 A;  2KP1 A;  2NVL A;  3DGQ A;  2R5G A;  3IXR A;  3LOR A;  4MPF A;  3DML A;  4EUY A;  2WCI A;  2MZC A;  1X9M B;  1A0F A;  3A2W A;  2B6M A;  3IRA A;  2GVP A;  1JZD A;  1ZYN A;  4DSS B;  2YN1 A;  2C4J A;  4MF6 A;  3KH9 A;  4XTS A;  4LL4 B;  2GSR A;  4OCE A;  2VD1 A;  1F37 A;  3WT2 A;  4LL1 B;  2GSS A;  4FYB A;  3A5W A;  1ILO A;  3BD2 A;  1N8J A;  5J41 A;  3H1N A;  3FR9 A;  1ERT A;  4BPY A;  3HYP A;  1K3O A;  2IMI A;  3GH9 A;  2PBJ A;  4MJC A;  5D73 A;  2GQL A;  2VL3 A;  2CA8 A;  2ON7 A;  2GZY A;  1FVK A;  4POK A;  2P31 A;  5KN3 A;  1S3C A;  1EGO A;  1TRS A;  4KSM A;  12GS A;  3NOF A;  5AIS A;  3VPT A;  1XWK A;  5HFI A;  1V40 A;  3IBH A;  4RQR A;  5CRD A;  3EC3 A;  1GNE A;  3J7Y k;  1W89 A;  1EP8 A;  4K5R A;  5ID2 A;  3M8N A;  1PN0 A;  1XVW A;  3TKS A;  3TJG A;  5KN2 A;  1F2E A;  4IBP A;  3F6D A;  2LS5 A;  4N30 A;  2F9S A;  4POM A;  2FGX A;  2J9H A;  4OMV A;  4DSQ A;  3EPT A;  1XG8 A;  5AGY A;  2LQQ A;  4BWS A;  5ECM B;  2JAD A;  2BTO T;  4HI7 A;  3MSZ A;  4ZL8 A;  2H19 A;  5ECP B;  3D21 A;  5CRE A;  5J4U A;  5ELG A;  2OAD A;  2KP2 A;  4HSC X;  2QGV A;  5JWQ B;  2H0I A;  4GTU A;  2VL9 A;  1G0T A;  2X8C A;  1TW9 A;  3Q18 A;  5G5E A;  4XCS A;  1Z3E A;  1MEK A;  4O32 A;  4IJ3 A;  3O3T A;  1S3D A;  1VF2 A;  4K6X A;  3GST A;  4ZB6 A;  4MLY A;  1GTI A;  2IJY A;  1T00 A;  3LFL A;  1OAZ A;  3TKR A;  3F0I A;  1SL2 B;  2VLT A;  4L5O A;  5D9W A;  3IK9 A;  2GQK A;  3E9J B;  1VF3 A;  2HZE B;  2B5X A;  1SKS B;  4F03 A;  2JZS A;  3FHK A;  1ZYE A;  2F3M A;  4CY8 A;  4I2T A;  2A4V A;  3FK8 A;  2WUL A;  3L9U A;  1OKT A;  3EUR A;  2HYX A;  4G0I A;  5A4V A;  1A2M A;  3F3R A;  5BMU A;  3CSH A;  4YAP A;  4JR6 A;  4I2U A;  5C04 A;  2NBS A;  2I81 A;  3GKK A;  3TDG A;  4MA9 A;  4HJ2 A;  1WMJ A;  2A4H A;  2LJA A;  4KA0 A;  1SD9 A;  4DVC A;  1K0C A;  2L4Q A;  4HS1 A; 
#chains in the Genus database with same CATH homology
 5B6N A;  2FHE A;  5G1K A;  4XRA A;  5ECQ B;  3TB2 A;  4Z2T A;  4JZQ A;  3M1G A;  3M9J A;  4YKG A;  3RAZ A;  1ERV A;  5J5N A;  1O6J A;  1GL8 A;  2FA8 A;  3F4T A;  2H01 A;  4GST A;  3LQ7 A;  4PQI A;  1KNG A;  5JCG A;  1GUH A;  1J08 A;  2ZNM A;  1SD8 A;  2LNT A;  1M9A A;  2L4C A;  2UZ8 A;  1Q4J A;  4BL7 A;  5GAP D;  4ECJ A;  2M72 A;  5GST A;  1CQG A;  1WE0 A;  4EF0 A;  3IAM 2;  2WB9 A;  1B4Q A;  14GS A;  3HVS A;  4ZB8 A;  3VLN A;  2HSH A;  2HZF A;  3ME8 A;  4PTS A;  3PR8 A;  5H5R A;  1GTA A;  3L9V A;  2YWI A;  1A24 A;  3HJO A;  2N5F A;  3HVX A;  4FYU A;  4ECB A;  2O87 A;  4X43 A;  4G2E A;  2XPD A;  17GS A;  2H6Z A;  3K8N A;  4AGS A;  4OCF A;  2AHE A;  1WP0 A;  1PRX A;  5KEJ A;  3CMI A;  4GF0 A;  1UN2 A;  3UVH A;  4O5R A;  3FR3 A;  3HKR A;  2H8L A;  3QOU A;  1B9X C;  2VL2 A;  4MK3 A;  2VLV A;  3H4K A;  1MTC A;  2BJX A;  1T8E B;  3IC8 A;  1Z6N A;  2JZT A;  1Z5Y E;  2VCW A;  4JE1 A;  3I69 A;  4OO5 A;  6GSX A;  4L8E A;  2NPB A;  2NDO A;  4IVF A;  3ME7 A;  2PER A;  1QXH A;  3EMP A;  5B8A A;  1TK5 B;  1HNA A;  3DKS A;  4TR1 B;  4Q5N A;  4WET A;  1J0F A;  3UVT A;  4NV5 A;  1GSD A;  3LG6 A;  4HDE A;  2LRT A;  2K6V A;  5G1L A;  5CRG A;  3MAK A;  1SEN A;  4K2D A;  4PNG A;  2TIR A;  4PQ1 A;  2IIY A;  4FH8 A;  4ZBB A;  2ON5 A;  1URM A;  4RQX A;  1QFN A;  3W8S A;  5CO3 A;  4GQF A;  2GSQ A;  1HNC A;  3N9J A;  3VWW A;  3GN3 A;  5HR3 A;  5G2Z A;  1HNB A;  1QK8 A;  4N0V A;  3ZVJ A;  3R3E A;  1JFU A;  3DVX A;  2E7P A;  4EXJ A;  3OR5 A;  2DJ2 A;  4XS1 A;  3I6A A;  2FY6 A;  3EU4 A;  2FA4 A;  2LNS A;  2VIM A;  3MYD A;  2QKE A;  2YWO A;  3BJ5 A;  1WOU A;  1OC9 A;  3I9V 2;  1GUM A;  1ZCP A;  5AIV A;  4MZW A;  2WDU A;  2JU5 A;  22GS A;  1VF4 A;  4GSN A;  3LW9 A;  2LST A;  1YY7 A;  1SK1 A;  5IO0 A;  3GSS A;  1ZL9 A;  2C3Q A;  1M7T A;  4V2M A;  1B9Y C;  2CZ2 A;  2WJU A;  1A0R P;  4TR1 A;  4J2F A;  1TRW A;  5ECI B;  1IYH A;  4F9Z A;  2XHF A;  5FT3 A;  5LD0 A;  1X9W B;  5GAN D;  4USS A;  5A4W A;  3GKN A;  1SKR B;  4TKY A;  2H71 A;  2RM5 A;  2H6X A;  4ZB9 A;  1ON4 A;  1OC3 A;  4KH7 A;  1QGV A;  3IAS 2;  4PUR A;  18GS A;  2I9H A;  4WF4 A;  5IMF A;  3RBT A;  4ICY A;  1DSB A;  3D0Z A;  9GSS A;  3BBY A;  3QDN A;  3F8U A;  1PGT A;  2LKU A;  3FEU A;  2H1B A;  3ZIJ A;  3TGZ A;  1T4Y A;  1EP7 A;  2HRN A;  2R6K A;  4CY6 A;  2H1D A;  1GSE A;  2VAF A;  2IMD A;  4OWY A;  4EE0 A;  20GS A;  3LJR A;  5E59 A;  1A2J A;  2AYT A;  1RK4 A;  2GZZ A;  1V9W A;  5ECN B;  4KCA A;  3FW2 A;  1F3B A;  3L4N A;  1T3B A;  4KGI A;  4RI6 A;  2JL4 A;  5IPG A;  1PX6 A;  1FO5 A;  5JCW A;  2V2G A;  4X0X A;  3U5R E;  2LEG A;  3IC4 A;  3TJF A;  4MP4 A;  4MMM A;  2WRT A;  2ZCT A;  2EIQ A;  4J56 E;  1G7E A;  2YCD A;  2MBT A;  1TI1 A;  2JSY A;  4EC0 A;  1GLQ A;  4O92 A;  1H4O A;  3ZFL A;  2I4A A;  2DLX A;  4ZBD A;  1AQV A;  1FB0 A;  2V6K A;  4KDY A;  5KOX A;  4NMU A;  5G31 A;  2CV4 A;  1JLV A;  2LRC A;  2DJ1 A;  2VUP A;  5ID2 B;  3UAP A;  2TRC P;  1ZOF A;  2H1G A;  5DDL A;  1LJR A;  3U6V A;  3VFI A;  4BA7 A;  4E8E A;  5G5F A;  4GRF A;  3MNG A;  5IMA A;  1HQO A;  3ZTL A;  2YNX A;  3KMN A;  1NHO A;  3C1S A;  3UOM A;  3WGE A;  1Z9H A;  5DQS A;  2PMT A;  1X5C A;  1GLP A;  6GSV A;  2OE0 A;  3Q74 A;  2REM A;  1V2A A;  4ML6 A;  5DVB A;  3H79 A;  4IEL A;  2IMK A;  2VM2 A;  1LBK A;  5IMZ A;  3EMX A;  4IKH A;  4GSS A;  3J7Y b;  3C1R A;  1ZZY A;  3DRN A;  3CSI A;  4K0G A;  1WRY A;  3EE2 A;  2P5R A;  3GL5 A;  4HUA A;  2PPT A;  5DCH A;  2GT5 A;  4V1A p;  1EZK A;  2C80 A;  1E6B A;  3HZ8 A;  2PVO C;  5D96 A;  1TU8 A;  4Q5R A;  3DD3 A;  1B4P A;  4PX1 A;  2H66 A;  3ERG A;  2PGT A;  1XFL A;  1Q98 A;  2DIZ A;  3VK9 A;  3WGX A;  4HQZ A;  3APO A;  4JED A;  1M2A A;  3QAV A;  3KD0 A;  1PMT A;  3IR4 A;  3O76 A;  4EDZ A;  3WYW A;  4I8B A;  3BCK A;  2CVD A;  4JR4 A;  4PUA A;  2MYG A;  4WBJ A;  4EIP A;  3PIN A;  1PSQ A;  1YJ6 A;  4AJ8 A;  4XS4 A;  4NXI A;  3DWV A;  3APS A;  4MZC A;  1AUC A;  5JCU A;  1JZO A;  4MJA A;  1M9B A;  1TXX A;  3P7X A;  4RUV A;  2KHP A;  2G2Q A;  2I1U A;  2X8G A;  3KGK A;  1G7O A;  5LCZ A;  1GP1 A;  2IMF A;  4NHW A;  2GST A;  3GHA A;  1KTE A;  2DJ0 A;  2X4A A;  4FIW A;  4PXO A;  3ZYW A;  3DVW A;  4FYC A;  1AXD A;  4AJ7 A;  1WJK A;  3QPM A;  2LV3 A;  4OO4 A;  5COH A;  2DJ3 A;  1TKD B;  1A8L A;  3E0U A;  2HE3 A;  1SJI A;  4V2N A;  3UMA A;  2RII A;  5CAX A;  4IQ1 A;  1W4V A;  4HEA 2;  1XBS A;  3ED3 A;  1PD2 1;  3CSJ A;  2YP6 A;  1GH2 A;  3M9K A;  2GS3 A;  4BL7 B;  2H30 A;  1EWX A;  1XWB A;  3C71 A;  3W8J A;  2FUG 2;  4POL A;  3WGD A;  5IOW A;  3H93 A;  1UC7 A;  1XW6 A;  4KUN A;  2CVK A;  3KTL A;  5KOW A;  2VLU A;  2DIY A;  3KP9 A;  3E3E A;  1LU4 A;  4I97 A;  4IP6 A;  4ZXG A;  2B5E A;  3HJM A;  1TU7 A;  1ZYP A;  4IW9 A;  2B3S A;  2RM6 A;  2V41 A;  1GTB A;  3CTF A;  2YAN A;  2CZ3 A;  3TUE A;  1Y6E A;  2F51 A;  5F06 A;  5IMV A;  1XPV A;  3KXO A;  2IPA A;  2DBC A;  4JRR A;  5IMD A;  3ZRD A;  2H76 A;  2LQO A;  4YAV A;  4WXT A;  3R2Q A;  5INY A;  5ECS A;  2R37 A;  2LTK A;  2G0F A;  3FR6 A;  1XVQ A;  2C3T A;  3VPQ A;  1EOG A;  3GX0 A;  3HD5 A;  4TXO A;  5G30 A;  1OVN A;  3GH6 A;  5ECK B;  3KP8 A;  1TI3 A;  2R0P A;  6GSU A;  2BMX A;  3MWH A;  2IME A;  2H74 A;  3QAW A;  5CRW A;  4TR3 A;  1I9D A;  5ENU A;  3TKP A;  2OJL A;  2H70 A;  3G7I A;  4A5P A;  3IHG A;  5HQP A;  2QC7 A;  3EU3 A;  3O6T A;  3D4M A;  2H75 A;  4EDY A;  5HR2 A;  2CX3 A;  4ZIL A;  5B7C A;  3F6F A;  2DKH A;  2L5O A;  4G9H A;  4MF5 A;  4RI7 A;  3M0F A;  4O7H A;  4EO3 A;  1K0A A;  3EYT A;  4BVY A;  3JCM L;  2O85 A;  4MF7 A;  1Z7R A;  2WS2 A;  3VWU A;  4Z7X A;  2HSM A;  1V57 A;  3F9U A;  3NZN A;  2DC5 A;  4OFM A;  5H5S A;  1SK0 A;  1J9B A;  4K9Z A;  3GIX A;  1O73 A;  2H73 A;  3G7J A;  2WZ9 A;  5IMC A;  2X49 A;  4F2I A;  1G6Y A;  3L9S A;  1TOF A;  4J57 E;  4ISD A;  1XCC A;  4YKF A;  4X1U A;  2CQ9 A;  1OC9 B;  4L0W A;  1ZMA A;  2QSI A;  3WT1 A;  1XWC A;  4PNF A;  3C8E A;  1OKD A;  2DSA A;  1PN9 A;  5C00 A;  3DYR A;  1THO A;  2MMO A;  1E2Y A;  5BRT A;  2R2J A;  1ZYQ B;  1U88 A;  5D8I A;  1SJZ A;  1FHE A;  3US3 A;  2C0D A;  1GSY A;  2KOK A;  2K8S A;  3A2V A;  3ZVJ D;  3QCP A;  2X99 A;  1IYI A;  4XS6 A;  1X9S B;  1MD3 A;  2CX4 A;  4F0B A;  3KMO A;  1M99 A;  3QFA C;  5IQY A;  1K0M A;  1PKZ A;  1X0R A;  4N0Z A;  4EIQ A;  1EEM A;  4GXZ A;  3M3M A;  2NTO A;  2YWM A;  1K0O A;  2RUF A;  4GWR A;  4MH3 A;  2JSZ A;  3AY8 A;  3HJP A;  1WIK A;  3WD6 A;  1MDK A;  3D4T A;  1X5D A;  4G19 A;  3NIV A;  4WEY A;  4G10 A;  3V1W A;  4AF2 A;  4PUF C;  3HVV A;  1U3I A;  2C1Y A;  1XOA A;  4QL9 A;  2DJK A;  1UVZ A;  5JWO B;  4Q5Q A;  1EEJ A;  2VO4 A;  3LXZ A;  1FOV A;  3MIX A;  2C8U A;  2PN8 A;  1PL2 A;  3FZ4 A;  1SU9 A;  4AJ6 A;  3HDC A;  4NPB A;  4KSO A;  2HSY A;  4NWY A;  3TJJ A;  2CVB A;  5B6M A;  5B8B A;  5EPF A;  1QQ2 A;  1Z7P A;  3QFB C;  1M2B A;  3P90 A;  1CQH A;  5IIZ A;  2D2Z A;  6GSY A;  2EIO A;  3ZFB A;  1BED A;  2H0H A;  4I6X A;  1PA3 A;  1NHY A;  3GTU B;  4IN0 A;  5F07 A;  1GRX A;  2VD0 A;  1NSW A;  1A2L A;  3FMW A;  1H75 A;  1K0D A;  1I5G A;  3HXS A;  4O5Q A;  1TK8 B;  1S3A A;  3DIE A;  1BYE A;  1FAA A;  1YEX A;  4WR4 A;  4K7O A;  1XW9 A;  2OE1 A;  3P8W A;  5IO2 A;  1EOH A;  4WKW A;  2YV7 A;  4K8M A;  2FCH A;  3TCO A;  1ML6 A;  4KB3 A;  4XIH A;  3GA4 A;  1U3A A;  4KF9 A;  2QA1 A;  2R3X A;  2I3Y A;  4XRD A;  2HLS A;  1R7H A;  3C7M A;  5CRH A;  1KBN A;  2C0G A;  3CYN A;  5FHI A;  3GX8 A;  4ILF A;  3GNJ A;  4KCE A;  5DAK A;  2FNO A;  1DBY A;  1V58 A;  3KEB A;  4TXV A;  4CHS A;  2GDR A;  2HXK A;  4MJE A;  1JHB A;  4LLR A;  1K0N A;  2VL2 C;  3CBU A;  2AJQ B;  3RPP A;  3KH7 A;  4YQU A;  5L71 A;  3L0H A;  4JU5 A;  2F8F A;  4K5S A;  3ERW A;  1UA5 A;  1EV4 A;  1XW5 A;  3KJY A;  2MMZ A;  3ZML A;  3QR6 A;  2QA2 A;  2YOI A;  2VCV A;  4IHU A;  4F82 A;  3GTU A;  2OBK A;  1T4Z A;  3LEF A;  4NAX A;  1BJX A;  3GFK A;  2C3N A;  3EIN A;  1K3Y A;  4XS4 B;  2IN3 A;  1O81 A;  4KX4 A;  10GS A;  2YPM A;  1O85 A;  2OAC A;  4ZIJ A;  1B48 A;  5EY6 A;  2O7K A;  2TRX A;  2K9F A;  3FYG A;  3UBL A;  3ZIV A;  3IPZ A;  5F0G A;  1GSU A;  2DML A;  5ECO B;  1OE7 A;  3P2A A;  2H0G A;  2PUK C;  3Q19 A;  3VI5 A;  2V1M A;  1YKC A;  2AUV A;  4Z2R A;  5GSS A;  5GZZ B;  3TOU A;  2HFD A;  1R26 A;  2H6Y A;  2M80 A;  2YZU A;  1A23 A;  4X4J A;  3UL3 A;  2H1A A;  3ERF A;  4YQV A;  2FLS A;  2PU9 C;  3LXT A;  5LNK e;  1SL1 B;  2E2M A;  1FOH A;  2H72 A;  4N10 A;  1TK0 B;  1F3A A;  2IL3 A;  2ZUP A;  4BVX B;  2VM1 A;  3PGT A;  4K1F A;  4HQS A;  2B5Y A;  2XC2 A;  5HR1 A;  3RHB A;  2ALB A;  5ECH B;  4KAE A;  4K2X A;  3LSZ A;  3APQ A;  2KLX A;  4WF5 A;  2HT9 A;  1BAY A;  2GGT A;  2V6O A;  4NHZ A;  1PL1 A;  1YF0 A;  5D93 A;  5AN1 A;  5J9C A;  1QMV A;  1SL0 B;  1PX7 A;  2DJJ A;  3CRU A;  2O89 A;  3KCM A;  2MMA A;  19GS A;  5IOX A;  3IDV A;  4CDO A;  5AIX A;  5IPH A;  2IFQ A;  3IV4 A;  3MDK A;  13GS A;  2OKA A;  2VCT A;  3N5O A;  1SK2 A;  5D9V A;  1ABA A;  1C72 A;  4HZ2 A;  3FKF A;  8GSS A;  2PVQ A;  4HOJ A;  1WPI A;  2YWN A;  1F6M C;  2E2G A;  2B7K A;  5E4W A;  5DAL B;  5HFG A;  5A5K A;  1RW1 A;  1ERW A;  3GKX A;  2HI7 A;  3DXB A;  3ZMK A;  2C0E A;  1VRS D;  1T7P B;  1GUK A;  1NM3 A;  2X64 A;  1RQM A;  2B1K A;  4IQA A;  5CNW A;  4MH2 A;  4TXO B;  4DSS A;  4K7I A;  2DMM A;  3EWL A;  4QL7 A;  4TW5 A;  1YF1 A;  2VOC A;  3CTG A;  4BVX A;  1K3L A;  2GQM A;  3KTB A;  4TR0 A;  1PQN A;  1AQW A;  3BCI A;  3ISO A;  4ID0 A;  4I5Q A;  1XWA A;  3EVI A;  2L6D A;  16GS A;  2FWH A;  2F8A A;  1SYR A;  4TR4 A;  4Z2U A;  2X8H A;  4L5L A;  5DQY A;  1HD2 A;  5J3R A;  1JZW A;  3LYP A;  1XXU A;  5D9X A;  3ZZX A;  2L57 A;  1Z6M A;  4HU7 A;  3TRX A;  2A2R A;  1VGL A;  1N2A A;  5ABR A;  4BVY B;  4KW6 A;  3SWL A;  2CAQ A;  1T1V A;  11GS A;  1EGR A;  1YDK A;  5ECL B;  1MDJ A;  3HHV A;  1A8Y A;  2K8V A;  2YZH A;  3GRX A;  3HA9 A;  2B7J A;  5HFK A;  2GTU A;  1M0U A;  1U87 A;  1FB6 A;  2J23 A;  4IP1 A;  3GL3 A;  4ZBA A;  2O8V B;  1AIU A;  2RLI A;  2GT6 A;  4D73 B;  1QUW A;  2XBI A;  2HRK A;  2VCQ A;  3L78 A;  2OA7 A;  5DAL A;  3DEX A;  1DE2 A;  2KUC A;  2VCX A;  4MAB A;  4NV2 A;  1OC8 A;  6GSS A;  1YZX A;  3RHC A;  1YEP A;  2LRN A;  4F0C A;  1JLW A;  3QMX A;  3UEM A;  4QQ7 A;  3TOT A;  4ML1 A;  3VUR A;  3RPN A;  5IM9 A;  4LMW A;  5H5Q A;  3GUS A;  3HZ4 A;  4MZB A;  5DBQ A;  2PWJ A;  2JZR A;  3ZL5 A;  4HZ4 A;  1TTZ A;  4FO5 A;  2L6C A;  4P3Y B;  3CXG A;  3H8Q A;  3UJ1 A;  1SKW B;  3HY2 A;  3IHQ A;  2CAI A;  4LMV A;  2IWT A;  3BOA A;  3C73 A;  3IK7 A;  2HZE A;  5HR0 A;  1X5E A;  2FWF A;  3VWV A;  4IS0 A;  1YQ1 A;  1ERU A;  3TKS C;  4LA1 A;  2R0C A;  4GCI A;  3F3Q A;  4OFT A;  3D22 A;  2LUS A;  1V98 A;  4MPG A;  5KN1 A;  5DJL A;  2HRA A;  1ZGN A;  4DSR A;  4D73 A;  2R4V A;  4YH2 A;  3GV1 A;  4ZL7 A;  3HCZ A;  4EKZ A;  3PH9 A;  4TN8 A;  1Y25 A;  4PQH A;  2YV9 A;  2YJH A;  4O5U A;  2P5Q A;  2L5L A;  1MD4 A;  1TDI A;  2GZP A;  3IE3 A;  2OBI A;  1GSS A;  1GNW A;  1JZR A;  3F63 A;  3F4R A;  4E8H A;  4YQM A;  2HNL A;  3IA1 A;  2B1L A;  3I43 A;  1G6W A;  2AAW A;  3G9B A;  4CW9 A;  3FZA A;  2LJR A;  1USB A;  2YJ7 A;  3TJB A;  4DEJ A;  5KN0 A;  4OD7 A;  3D6I A;  2LJK A;  3ZRE A;  4ZL9 A;  3GMF A;  1R4W A;  1U6T A;  5A4U A;  5FWG A;  3TKQ A;  2MMN A;  2R0G A;  3LGC A;  1BX9 A;  1THX A;  1OE8 A;  2FWE A;  4IJI A;  4KDX A;  1HYU A;  4KDU A;  1KEB A;  3IOS A;  1GWC A;  5J9B A;  1O8X A;  3QAG A;  4N11 A;  1WWJ A;  1GUL A;  5DJM A;  5F05 A;  1O8W A;  1TJD A;  4GLT A;  2EIR A;  4G0L A;  4EVM A;  3LYK A;  2P0G A;  2N5B A;  4FQU A;  4BWQ A;  7GSS A;  3TJK A;  2EC4 A;  2HRF A;  3PPU A;  3G7Y A;  5CP1 A;  4OFN A;  3A5I A;  2MBS A;  2FWG A;  5DAK B;  4ULX A;  1OYJ A;  1AW9 A;  1YKA A;  4ACS A;  2OE3 A;  4WBR D;  2VCZ A;  1TRV A;  1K0B A;  2RUE A;  4MNN A;  4ECI A;  3F4S A;  1AQX A;  2A2S A;  1BQ7 A;  1F9M A;  3A2X A;  1R5P A;  1MDI A;  4L0U A;  5JWR B;  4IGJ A;  4TRX A;  4XHM A;  3S9F A;  4TVE A;  1GTU A;  2C0F A;  1XIY A;  5ECR B;  3CRT A;  1FW1 A;  3FZ9 A;  5DCG A;  2WGR A;  1ST9 A;  3KZQ A;  1XWG A;  1TRU A;  1TP9 A;  3UBK A;  3KM6 A;  5EL8 A;  2V32 A;  1B8X A;  3W6G A;  5ELA A;  1NW2 A;  1FVJ A;  3KIJ A;  4PGT A;  4V2L A;  3ZLP A;  2E0Q A;  4G0K A;  4POB A;  2XPE A;  4H86 A;  2XBQ A;  3FY7 A;  4JBB A;  1SJ6 A;  4MJB A;  3LWA A;  4MCU A;  2K18 A;  2GLR A;  3VWX A;  4ECC A;  3D5J A;  3VI7 A;  1FG4 A;  3GKM A;  2A2P A;  3QD9 A;  2FD3 A;  1ACV A;  3TKS E;  6GST A;  3GYK A;  2Z9S A;  1AC1 A;  1O7U A;  4K7N A;  4EL1 A;  2L59 A;  3TRQ A;  2N5A A;  4WR5 A;  1EV9 A;  2AB6 A;  5EVO A;  4KND A;  1M2D A;  4KE3 A;  5CYY A;  3Q6O A;  3A3T A;  4HU9 A;  1R5A A;  3FRC A;  1AAZ A;  2CT6 A;  1GSF A;  1PKW A;  2M46 A;  3GUR A;  4V1A g;  1GSQ A;  5D9T A;  2WFC A;  3UAR A;  1XZO A;  1DUG A;  3UIW A;  3TRP A;  4K0N A;  5F8B A;  1DE1 A;  2IFQ B;  3FZ5 A;  4TOP A;  4GQC A;  4HJM A;  1BG5 A;  1VF1 A;  2JAC A;  1SYX A;  1XOB A;  4MDC A;  2ES7 A;  2DKI A;  6GSW A;  4Q5F A;  3RDW A;  3ZIT A;  3SBC A;  2AV4 A;  2KP1 A;  2NVL A;  3DGQ A;  2R5G A;  3IXR A;  3LOR A;  4MPF A;  3DML A;  4EUY A;  2WCI A;  2MZC A;  1X9M B;  1A0F A;  3A2W A;  2B6M A;  3IRA A;  2GVP A;  1JZD A;  1ZYN A;  4DSS B;  2YN1 A;  2C4J A;  4MF6 A;  3KH9 A;  4XTS A;  4LL4 B;  2GSR A;  4OCE A;  2VD1 A;  1F37 A;  3WT2 A;  4LL1 B;  2GSS A;  4FYB A;  3A5W A;  1ILO A;  3BD2 A;  1N8J A;  5J41 A;  3H1N A;  3FR9 A;  1ERT A;  4BPY A;  3HYP A;  1K3O A;  2IMI A;  3GH9 A;  2PBJ A;  4MJC A;  5D73 A;  2GQL A;  2VL3 A;  2CA8 A;  2ON7 A;  2GZY A;  1FVK A;  4POK A;  2P31 A;  5KN3 A;  1S3C A;  1EGO A;  1TRS A;  4KSM A;  12GS A;  3NOF A;  5AIS A;  3VPT A;  1XWK A;  5HFI A;  1V40 A;  3IBH A;  4RQR A;  5CRD A;  3EC3 A;  1GNE A;  3J7Y k;  1W89 A;  1EP8 A;  4K5R A;  5ID2 A;  3M8N A;  1PN0 A;  1XVW A;  3TKS A;  3TJG A;  5KN2 A;  1F2E A;  4IBP A;  3F6D A;  2LS5 A;  4N30 A;  2F9S A;  4POM A;  2FGX A;  2J9H A;  4OMV A;  4DSQ A;  3EPT A;  5AGY A;  2LQQ A;  4BWS A;  5ECM B;  2JAD A;  2BTO T;  4HI7 A;  3MSZ A;  4ZL8 A;  2H19 A;  5ECP B;  3D21 A;  5CRE A;  5J4U A;  5ELG A;  2OAD A;  2KP2 A;  2QGV A;  5JWQ B;  2H0I A;  4GTU A;  2VL9 A;  1G0T A;  2X8C A;  1TW9 A;  3Q18 A;  5G5E A;  4XCS A;  1Z3E A;  1MEK A;  4O32 A;  4IJ3 A;  3O3T A;  1S3D A;  1VF2 A;  4K6X A;  3GST A;  4ZB6 A;  4MLY A;  1GTI A;  2IJY A;  1T00 A;  3LFL A;  1OAZ A;  3TKR A;  3F0I A;  1SL2 B;  2VLT A;  4L5O A;  5D9W A;  3IK9 A;  2GQK A;  3E9J B;  1VF3 A;  2HZE B;  2B5X A;  1SKS B;  4F03 A;  2JZS A;  3FHK A;  1ZYE A;  2F3M A;  4CY8 A;  4I2T A;  2A4V A;  3FK8 A;  2WUL A;  3L9U A;  1OKT A;  3EUR A;  2HYX A;  4G0I A;  5A4V A;  1A2M A;  3F3R A;  5BMU A;  3CSH A;  4YAP A;  4JR6 A;  4I2U A;  5C04 A;  2NBS A;  2I81 A;  3GKK A;  3TDG A;  4MA9 A;  4HJ2 A;  1WMJ A;  2A4H A;  2LJA A;  4KA0 A;  1SD9 A;  4DVC A;  1K0C A;  2L4Q A;  4HS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...