4GXZA

Crystal structure of a periplasmic thioredoxin-like protein from salmonella enterica serovar typhimurium
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
178
structure length
178
Chain Sequence
DQEKQIENLIHAALFNDPASPRIGAKHPKLTLVNFTDYNCPYCKQLDPMLEKIVQKYPDVAVIIKPLPFKGESSVLAARIALTTWREHPQQFLALHEKLMQKRVYHTDDSIKQAQQKAGATPVTLDEKSMETIRTNLQLARLVGVQGTPATIIGDELIPGAVPWDTLEAVVKEKLASA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Suppression of copper sensitivity protein
publication title Structural and functional characterization of ScsC, a periplasmic thioredoxin-like protein from Salmonella enterica serovar Typhimurium
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 64
structure length 178
sequence length 178
chains with identical sequence B, C, D
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4gxzA00
1LU4A 1O8XA 4HZ2A 5H5RA 3CSHA 2R6KA 5JCWA 2GQKA 4MJBA 3ERWA 4RI7A 3VPTA 3O76A 3EMPA 2XBQA 4DSSB 1I5GA 4V1Ag 2YZHA 3M1GA 3ISOA 4OWYA 3LXZA 10GSA 3R2QA 2JSYA 2OA7A 3GKMA 3G9BA 1H75A 1WMJA 2YPMA 1XWCA 1OKDA 2V41A 2HSHA 2FHEA 1F6MC 4ZXGA 2CX3A 2PU9C 3VWVA 2KLXA 2YZUA 2FY6A 3ZRDA 2AYTA 3IOSA 4LL4B 1NHOA 3FYGA 2HT9A 3F4TA 2TIRA 3IHQA 4PQHA 1T7PB 1GUHA 2MBSA 3VK9A 1FOVA 1SJIA 2BTOT 3UOMA 2ES7A 2LV3A 3A5WA 2LQOA 2JADA 3QFBC 3EVIA 3MWHA 4AJ6A 2I81A 1YDKA 4OFNA 1G6YA 1SL0B 4XS4A 5D73A 5HR1A 1SYXA 1WWJA 5LCZA 1YF0A 1JZOA 1SENA 1M2DA 4NWYA 2HNLA 3EINA 2X8GA 11GSA 3VFIA 1YJ6A 2P31A 5F05A 2GVPA 4MJCA 1GLPA 5ECHB 4ZL8A 3IRAA 4JRRA 4O5RA 5B6NA 1Z7RA 3BBYA 5CRGA 4AJ8A 4TR0A 1E2YA 3QMXA 1FW1A 2P5RA 3IK9A 4LL1B 5KEJA 1MEKA 3S9FA 2L6CA 4Q5NA 1MTCA 3MAKA 3EU4A 1J0FA 1F2EA 3DKSA 2HRNA 4GWRA 1V2AA 1BAYA 4MF6A 1V9WA 3QAGA 4JR6A 1A0RP 2WRTA 5IMZA 4DSSA 2H66A 1EOHA 4YQMA 2NPBA 3DEXA 3TKPA 2YNXA 4O7HA 3C1RA 4HDEA 3LXTA 3KCMA 1MDIA 1SK1A 4LMVA 2H74A 5D9VA 2H73A 2F51A 2CT6A 1LBKA 5A4UA 1KTEA 2GDRA 2L4CA 3GMFA 4GLTA 4GTUA 3IE3A 5EPFA 4BPYA 2DBCA 4TR3A 3L9UA 4TW5A 1EP8A 5ECQB 4MA9A 5D9TA 1C72A 2MMOA 1XBSA 2I4AA 4G9HA 1EV4A 1WIKA 2GTUA 4KDXA 3MSZA 1HYUA 2E0QA 4ZBAA 2CZ3A 2ZCTA 1KNGA 4KAEA 3E0UA 5HR2A 4NV2A 4HJMA 4BA7A 1CQGA 2MMZA 2OJLA 4XS1A 1SKRB 1MD4A 5JCGA 1U3IA 1GSSA 1GSYA 3Q19A 1Q98A 4KCAA 2AJQB 3TDGA 3GL3A 2H0GA 1QK8A 5ECSA 1F9MA 3W8SA 2MYGA 3GX8A 3GHAA 2QC7A 3NZNA 2O89A 1OC9B 2FA8A 2MMAA 4FYCA 3ZIJA 3ZMLA 4ILFA 3EURA 1V40A 4DVCA 4YAPA 2VCWA 1GULA 4WR5A 5GSSA 3HA9A 2L6DA 2PPTA 1ERUA 1JLVA 2DMMA 1AQXA 1PX7A 1TJDA 2GZZA 5IMCA 3IDVA 2L5OA 3DGQA 4L0WA 5IOWA 1O8WA 1ZMAA 1XWBA 3TKQA 2V6OA 1A2LA 2VLUA 4QL9A 1M9BA 2RM6A 5E4WA 3IC4A 3BCIA 3F3QA 2NTOA 1YEPA 4ML1A 2X99A 2VAFA 3FR6A 2HYXA 4KA0A 4TR1B 2FWEA 4PNGA 3HJPA 1GLQA 4EL1A 4K0NA 1MDJA 5DAKB 3TJKA 4KW6A 4ZIJA 2H70A 5C00A 4L0UA 3O6TA 2VCZA 5A5KA 5FHIA 1Y6EA 3VI7A 4HU9A 5G5FA 1HQOA 4WETA 3P90A 1X9MB 1PA3A 2AB6A 4IP6A 4JZQA 2R3XA 2TRXA 3A2XA 4TXOB 5JWQB 4PURA 4BL7A 4TOPA 1K3OA 5ECKB 3ZITA 3EMXA 4OCFA 3ME7A 3E9JB 4IN0A 1X5EA 2V1MA 2DIZA 4HS1A 3OR5A 3FR3A 2FWFA 3DWVA 5IQYA 1V57A 2CAIA 3I69A 2C3NA 3QAWA 1T4YA 1J9BA 4D73A 4I2UA 3A2VA 4KSOA 4NMUA 5IO0A 1J08A 1TTZA 3BCKA 4K8MA 4QL7A 2PWJA 3ZYWA 4TVEA 3F63A 1QQ2A 2CVBA 4JE1A 2C8UA 2JSZA 2YCDA 3SWLA 2LTKA 3F9UA 1F37A 2GGTA 4G19A 9GSSA 4CW9A 1BEDA 4MMMA 2GT5A 2L57A 4EUYA 2HSYA 3FZAA 3DVWA 3LG6A 3D22A 3KIJA 1U6TA 4WF5A 4V2LA 1PKZA 3EC3A 3NIVA 1NSWA 4F9ZA 4LLRA 3L9VA 4NV5A 4HZ4A 3ED3A 2LJAA 2PN8A 5J3RA 3C1SA 4WF4A 2ALBA 5E59A 2C0DA 4MF5A 1EEJA 5F06A 5DAKA 2IL3A 1SL1B 3CRTA 4CHSA 1EEMA 2IMFA 5B8AA 1VF2A 4FYUA 1ZYQB 1Z6MA 3HVSA 3U6VA 2B1LA 4V2NA 4K2DA 4PQ1A 3HKRA 2IMDA 2A2RA 3P7XA 4F03A 3FZ4A 5J9CA 2VLTA 4TXOA 1EV9A 2HFDA 1ON4A 4PUFC 3N5OA 3ZZXA 3J7Yb 3UIWA 1JZWA 3F3RA 4YQUA 5AIXA 4XHMA 2H1DA 4K9ZA 4IELA 1OVNA 2VLVA 4YAVA 2E2MA 2H0IA 5CRWA 4FH8A 2VD1A 3ERGA 4AJ7A 3DXBA 2LRTA 2VIMA 3APQA 1B4PA 1EP7A 5IPHA 4FIWA 1AXDA 1VF4A 2CA8A 2CQ9A 4ISDA 2PMTA 3KP8A 3UL3A 4BWQA 5F0GA 2VCTA 3TOTA 5JCUA 4RI6A 1SD8A 1XOAA 4RQRA 3LJRA 2VD0A 6GSYA 4ZB8A 2GSQA 4Z7XA 1ERTA 3VI5A 2GQLA 1G6WA 4ECJA 1TRVA 3RPPA 1BQ7A 2EC4A 2H72A 2NVLA 4BWSA 1SD9A 2GLRA 2CVKA 5LNKe 1SYRA 4ZB6A 2K8VA 5DBQA 2WULA 1K0OA 2FUG2 1EGRA 2XPEA 2OBKA 2H71A 2LJKA 5HFGA 1T1VA 4QQ7A 3EWLA 2B7JA 3VWXA 4F0CA 3LFLA 3APOA 4ULXA 1A0FA 3FRCA 4POBA 2YJ7A 4WXTA 2F8AA 1OC3A 3D0ZA 3TRPA 3VPQA 2P0GA 2LSTA 2OACA 1TW9A 1ZL9A 5ELAA 3DD3A 1XVWA 2GSRA 1WP0A 4KE3A 4GSTA 2HI7A 5ID2A 1SKSB 2LJRA 2REMA 5HFKA 3UVHA 1FB6A 1T00A 4AF2A 1M2AA 3D21A 3UEMA 1PL1A 4JEDA 1PN9A 5G31A 1GL8A 4O92A 5J41A 4J57E 2I1UA 1XVQA 1WOUA 5AGYA 4J2FA 2ZUPA 3EYTA 6GSWA 1ILOA 1AQWA 4HU7A 4MH3A 4WEYA 3WT2A 2VM2A 2IMEA 4F0BA 4N10A 1XIYA 2XBIA 2G0FA 1DBYA 3FKFA 4IW9A 2AHEA 3QD9A 4ZBDA 1NW2A 3GV1A 1HNAA 5G2ZA 3TRXA 3RHCA 5IMDA 1N2AA 5IOXA 3LYPA 2H6YA 3UVTA 2OE0A 2KUCA 3D4MA 4POKA 5IMFA 1Y25A 1S3DA 1S3CA 3GTUA 5DALB 4WBJA 4XRDA 4MF7A 1B9YC 1AAZA 4JBBA 3ZIVA 1GSDA 2H1BA 3KTBA 1PQNA 4GQCA 3H8QA 2VCXA 4K7IA 2DJKA 2JACA 3QPMA 1Z5YE 5CRDA 1TRSA 1K0BA 3C7MA 2K18A 3I6AA 2G2QA 4PX1A 2GS3A 3LORA 1YKAA 1A8LA 2LEGA 1QFNA 3M8NA 3Q74A 5HFIA 5G1KA 1GSFA 4G10A 1XW9A 4ZBBA 3ZVJA 2WZ9A 2FGXA 5IO2A 2FWHA 3UAPA 3F6FA 1GNEA 2RLIA 5H5SA 5ECNB 2CAQA 4XCSA 3TB2A 3GH6A 3GFKA 5ABRA 1CQHA 1ST9A 3TKSA 4MZCA 4V1Ap 2HXKA 4GSNA 2JZRA 1UN2A 2DJ1A 2BJXA 3M9KA 4I5QA 5ECPB 1GSQA 2C1YA 2HLSA 4ZL7A 4HQSA 2LKUA 3D5JA 2C80A 4TRXA 1XXUA 4N30A 4TN8A 4IP1A 5AIVA 3KGKA 3TKSC 4PXOA 3IXRA 2WFCA 1EWXA 5IM9A 4GQFA 2HRFA 2QSIA 1TI1A 1GSUA 4L5LA 1DUGA 3PR8A 1UVZA 4XRAA 5LD0A 4ECIA 2RUEA 3VWWA 5DALA 1A2JA 2VCQA 5ECOB 3HHVA 5ECRB 4KDYA 2MZCA 5IMAA 4HQZA 5HR0A 1K0CA 1DSBA 1PX6A 4ECCA 1TXXA 3CSJA 2H75A 2YV7A 4IJ3A 3IAM2 3CRUA 4K1FA 3TKSE 4IQAA 2F9SA 2F8FA 3V1WA 1XPVA 4X43A 1GWCA 1R7HA 3AY8A 20GSA 2X8HA 3GURA 1X5CA 1Z6NA 3IAS2 1EGOA 3RAZA 2M80A 2JL4A 5JWOB 2PERA 1XW5A 1XWKA 1V98A 4DSQA 2O87A 1XZOA 3ZL5A 2GZYA 5A4WA 2AUVA 1A23A 1WJKA 1AC1A 3TCOA 1OKTA 4XIHA 3QAVA 5HQPA 1GTAA 1SK0A 4KCEA 3VLNA 5DJLA 1TU8A 2EIOA 2JU5A 3Q18A 2VL3A 3TRQA 1SJ6A 5CYYA 3UMAA 1R5AA 4PQIA 1B48A 4JR4A 2WJUA 1T4ZA 2PVOC 2B5EA 1GUKA 4YQVA 5KN3A 4JU5A 4TXVA 3FR9A 1QMVA 2I3YA 1ERVA 2HZEB 2A2SA 3F4SA 2D2ZA 1JZDA 3GUSA 3FW2A 1JZRA 1HNCA 2V2GA 2B3SA 2PGTA 1YZXA 1WRYA 5CO3A 1YQ1A 2F3MA 3JCML 2DJ2A 4ZB9A 2FWGA 3HCZA 3RBTA 2EIQA 3HYPA 3DMLA 3W8JA 3KZQA 5AISA 6GSSA 2QKEA 1MD3A 2IMKA 2RM5A 3A3TA 3HVVA 2I9HA 3KH9A 5G30A 1UC7A 1O6JA 6GSXA 1TK8B 1OC9A 2YP6A 2YN1A 1YF1A 1WPIA 2H0HA 1XOBA 4I2TA 2BMXA 3U5RE 4NHZA 3MDKA 2FNOA 4EDZA 4OFMA 1G7OA 5ECLB 1BJXA 2K8SA 2J9HA 1IYHA 4L5OA 5D9XA 3TJJA 1OE8A 4V2MA 1JLWA 1JFUA 3UBLA 1SL2B 1DE2A 3HXSA 4HJ2A 1I9DA 2FA4A 4TR1A 4EVMA 2DSAA 3KTLA 1VGLA 2LNTA 3QDNA 1KEBA 2LRCA 1EOGA 3ZFLA 4ML6A 4KGIA 3F4RA 5HR3A 1PSQA 4G2EA 1ZCPA 3D4TA 4Q5QA 1M2BA 3M9JA 2O7KA 3L78A 5G1LA 4DSRA 4OCEA 2HZEA 2VL9A 1AQVA 3HY2A 1U88A 5ELGA 3WYWA 1M9AA 2C4JA 3LEFA 4MZBA 3M0FA 1ACVA 2X8CA 2CX4A 2XHFA 4WBRD 4O32A 2L5LA 4EKZA 2NBSA 4NXIA 5DQYA 4RUVA 4L8EA 4P3YB 1NM3A 1PRXA 2PBJA 3H4KA 5C04A 1TRWA 2K6VA 4K7NA 3IA1A 1GTBA 1AW9A 1GP1A 5KN0A 2C0EA 2IJYA 2LS5A 1JHBA 3LQ7A 1RK4A 4N0ZA 4I8BA 1LJRA 3BD2A 1A2MA 2DLXA 5J9BA 2FLSA 3FZ5A 18GSA 4AGSA 4Q5FA 1PGTA 2YANA 4IHUA 3KXOA 2R2JA 2DJ0A 2H6XA 2MBTA 2C0GA 1ZZYA 3MNGA 1Q4JA 4F2IA 1FG4A 3I9V2 3TJBA 1BX9A 5KN2A 1X5DA 1T8EB 1THOA 2HZFA 1G7EA 1W89A 2YWOA 4K7OA 2EIRA 3EE2A 3GX0A 3W6GA 4EXJA 2IWTA 4X0XA 3UJ1A 3IK7A 1V58A 1XFLA 4Q5RA 1K0DA 2ON7A 4MLYA 2H6ZA 1BG5A 1TDIA 3HVXA 5GZZB 5COHA 3GSSA 3QCPA 2B6MA 1OAZA 2DIYA 4OO4A 3ME8A 4CDOA 3GH9A 4HI7A 2C0FA 2GZPA 4IS0A 3GA4A 2XC2A 1GTUA 4DEJA 3TGZA 5IPGA 5DJMA 1ABAA 1HD2A 4I97A 1SKWB 3IV4A 1GUMA 4ZILA 4I6XA 5A4VA 3FZ9A 3BOAA 2YJHA 4POMA 2IPAA 3CXGA 4MPFA 4E8HA 3G7YA 1ZOFA 4GF0A 2LUSA 5CREA 1Z3EA 3A2WA 3VURA 3UBKA 3TOUA 5JWRB 3RPNA 1FVJA 3KD0A 1K3LA 4MJAA 1T3BA 1K0NA 3GKNA 3M3MA 3DRNA 2V32A 2R37A 3G7JA 5B7CA 3KJYA 4WR4A 1U87A 1FAAA 5ENUA 2KP2A 4MABA 1RW1A 2V6KA 2WDUA 3C8EA 5D96A 1YEXA 2H30A 5H5QA 4EE0A 1GH2A 4X1UA 5D9WA 5CP1A 3BJ5A 1K0MA 1NHYA 1TKDB 5B6MA 1M99A 3LSZA 2R5GA 1ZGNA 2N5FA 3WGXA 3CBUA 1OYJA 4PNFA 3US3A 2GQMA 2OBIA 1YKCA 4ID0A 3UARA 3APSA 2HE3A 4IJIA 4NPBA 5L71A 2DJ3A 2Z9SA 5KN1A 2AAWA 4MP4A 1MDKA 2GT6A 4K0GA 1H4OA 3KEBA 3GSTA 2AV4A 3RDWA 5ECIB 2JZSA 2DC5A 3GKKA 2LNSA 4GSSA 2VM1A 2VL2A 1GSEA 2N5BA 1B8XA 1QGVA 4F82A 3QFAC 1X9WB 1SU9A 3CMIA 1TK5B 4HEA2 2KOKA 7GSSA 1VF1A 2YOIA 1TK0B 3TJGA 3HD5A 2VL2C 1FO5A 2CVDA 12GSA 3H93A 3PH9A 1USBA 2C3TA 2H1GA 4PUAA 3WGDA 1DE1A 3HZ8A 17GSA 1B9XC 2O85A 2RIIA 1OC8A 1UA5A 2OKAA 2OE3A 4RQXA 1A24A 1GTIA 3N9JA 4NHWA 1S3AA 4KH7A 2A4VA 6GSTA 2H19A 2B1KA 3H79A 13GSA 1RQMA 3J7Yk 1PD21 4MDCA 2DMLA 1FB0A 5EL8A 2K9FA 1FHEA 1WE0A 5J4UA 3CYNA 4MCUA 3K8NA 3WT1A 4N0VA 3C71A 3GNJA 8GSSA 2VO4A 3EU3A 1PKWA 3TUEA 4OFTA 2WGRA 3L9SA 5GAPD 3HDCA 4TR4A 3ZREA 1ZYEA 3ZVJD 1R26A 3I43A 1Z7PA 4NAXA 3H1NA 2X64A 5IIZA 6GSUA 5EVOA 1TP9A 4IVFA 4D73B 4GRFA 3KM6A 2C3QA 2VCVA 3CSIA 3O3TA 2PVQA 4HOJA 4FYBA 2GSSA 3DVXA 1FVKA 5CNWA 22GSA 2B5XA 4EF0A 2H1AA 1K3YA 3KMNA 3WD6A 2WCIA 1IYIA 1X0RA 2IFQB 3F8UA 1M0UA 3DIEA 2WS2A 2YWIA 1PL2A 5DVBA 4MH2A 1W4VA 5IMVA 2RUFA 4J56E 4GCIA 1X9SB 3PINA 2E2GA 1U3AA 3GKXA 3L0HA 1SK2A 3HJOA 4K6XA 3FY7A 2J23A 5GAND 2KHPA 4KNDA 5D8IA 1EZKA 1TI3A 4LA1A 1TOFA 1A8YA 4XTSA 2PUKC 1AUCA 1HNBA 3IBHA 2MMNA 2LQQA 4H86A 3IR4A 1VF3A 1O7UA 3P2AA 4BVYA 4KSMA 4WKWA 3KH7A 1O81A 2M72A 3D6IA 3SBCA 1E6BA 2YV9A 4ECBA 1TRUA 5AN1A 3CTFA 4OD7A 3F6DA 4BVXA 2JZTA 4MZWA 2E7PA 3KP9A 2P5QA 3GYKA 4MK3A 3VWUA 1PMTA 2FCHA 4ACSA 16GSA 4EC0A 2OADA 3KMOA 2YWNA 4TKYA 1N8JA 4OO5A 3HZ4A 5DCGA 2H01A 1G0TA 2L59A 2H76A 1VRSD 2M46A 1THXA 3CTGA 1O85A 1AIUA 1SJZA 1TU7A 2XPDA 2ZNMA 1F3BA 1XWAA 19GSA 1KBNA 4EO3A 3HJMA 4LMWA 1BYEA 5DDLA 2IFQA 1XW6A 3L4NA 4KX4A 2N5AA 5FT3A 14GSA 2GSTA 5DQSA 5F07A 5GSTA 3ZMKA 3LWAA 3GIXA 4KB3A 4IGJA 1B4QA 4PGTA 4HUAA 3G7IA 2TRCP 3ERFA 5EY6A 4POLA 4IKHA 3FHKA 5DCHA 4KDUA 3DYRA 3PGTA 1GRXA 3E3EA 5INYA 1YY7A 1Z9HA 4MPGA 3FK8A 3LYKA 3GN3A 3RHBA 6GSVA 5D93A 5CRHA 1F3AA 3LGCA 1GNWA 2OE1A 3IPZA 2VUPA 2KP1A 2NDOA 2O8VB 3ZLPA 5ID2B 3F0IA 4E8EA 2B7KA 4ZL9A 2L4QA 3NOFA 4GXZA 3QOUA 4YH2A 4IQ1A 3TKRA 1O73A 2QGVA 3C73A 2CV4A 1ML6A 4XS6A 3P8WA 1QXHA 2IMIA 5B8BA 2IIYA 2YWMA 2IN3A 2WB9A 2CZ2A 1ERWA 2DJJA 4MJEA 5CAXA 1K0AA 2VOCA 5F8BA 4EDYA 2ON5A 2B5YA 1OE7A 4XS4B 5ECMB 3ZFBA 3GRXA 3Q6OA 1QUWA 3FEUA 5J5NA 4FO5A 3TJFA 3WGEA 1URMA 5FWGA 1XCCA 2FD3A 2LRNA 4OMVA 3QR6A 1R4WA 1XWGA 3GTUB 4N11A 3ZTLA 2R4VA 1R5PA 5G5EA 3GL5A 2H8LA 4KUNA 4IBPA 1M7TA
chains in the Genus database with same CATH superfamily
1LU4A 1O8XA 4HZ2A 5H5RA 3CSHA 2R6KA 5JCWA 2GQKA 4MJBA 3ERWA 4RI7A 3VPTA 3O76A 3EMPA 2XBQA 4DSSB 1I5GA 4V1Ag 2YZHA 3M1GA 3ISOA 4OWYA 2R0CA 3LXZA 10GSA 4O5UA 3R2QA 2JSYA 2OA7A 3GKMA 3G9BA 1H75A 1WMJA 2YPMA 1XWCA 1OKDA 2V41A 2HSHA 2FHEA 1F6MC 4ZXGA 2CX3A 2PU9C 3VWVA 2KLXA 2YZUA 2FY6A 3ZRDA 2AYTA 3IOSA 4LL4B 1NHOA 3FYGA 2HT9A 3F4TA 2TIRA 3IHQA 4PQHA 1T7PB 1GUHA 2MBSA 3VK9A 1FOVA 1SJIA 2BTOT 3UOMA 2ES7A 2LV3A 3A5WA 2LQOA 2JADA 3QFBC 3EVIA 3MWHA 4AJ6A 2I81A 1YDKA 4OFNA 1G6YA 1SL0B 4XS4A 5D73A 5HR1A 1SYXA 1WWJA 5LCZA 1YF0A 1JZOA 1SENA 1M2DA 4NWYA 2HNLA 3EINA 2X8GA 11GSA 3VFIA 1YJ6A 2P31A 5F05A 2QA2A 2GVPA 4MJCA 1GLPA 5ECHB 4ZL8A 3IRAA 4JRRA 4O5RA 5B6NA 1Z7RA 3BBYA 5CRGA 4AJ8A 4TR0A 1E2YA 3QMXA 1FW1A 2P5RA 3IK9A 4LL1B 5KEJA 1MEKA 3S9FA 2L6CA 4Q5NA 1MTCA 3MAKA 3EU4A 1J0FA 1F2EA 3DKSA 2HRNA 4GWRA 1V2AA 1BAYA 4MF6A 1V9WA 3QAGA 4JR6A 1A0RP 2WRTA 5IMZA 4DSSA 2H66A 1EOHA 4YQMA 2NPBA 3DEXA 3TKPA 2YNXA 4O7HA 3C1RA 4HDEA 3LXTA 3KCMA 1MDIA 1SK1A 4LMVA 2H74A 5D9VA 2H73A 2F51A 2CT6A 1LBKA 2A4HA 5A4UA 1KTEA 2QA1A 2GDRA 2L4CA 3GMFA 4GLTA 4GTUA 3IE3A 5EPFA 4BPYA 2DBCA 4TR3A 3L9UA 4TW5A 1EP8A 5ECQB 4MA9A 5D9TA 1C72A 2MMOA 1XBSA 2I4AA 4G9HA 1EV4A 1WIKA 2GTUA 4KDXA 3MSZA 1HYUA 2E0QA 4ZBAA 2CZ3A 2ZCTA 1KNGA 4KAEA 3E0UA 5HR2A 4NV2A 4HJMA 4BA7A 4BL7B 1CQGA 2MMZA 2OJLA 4XS1A 1SKRB 1MD4A 5JCGA 1U3IA 1GSSA 1GSYA 3Q19A 1Q98A 4KCAA 2AJQB 3CQFA 3TDGA 3GL3A 2H0GA 1QK8A 5ECSA 1F9MA 3W8SA 2MYGA 3GX8A 3GHAA 2QC7A 3NZNA 2O89A 1OC9B 2FA8A 2MMAA 4FYCA 3ZIJA 3ZMLA 4ILFA 3EURA 1V40A 4DVCA 4YAPA 2VCWA 1GULA 4WR5A 5GSSA 3HA9A 2L6DA 2PPTA 1ERUA 1JLVA 2DMMA 1AQXA 1PX7A 1TJDA 2GZZA 5IMCA 3IDVA 2L5OA 3DGQA 4ICYA 4L0WA 5IOWA 1O8WA 1ZMAA 1XWBA 3TKQA 2V6OA 1A2LA 2VLUA 4QL9A 1M9BA 2RM6A 5BMUA 5E4WA 3IC4A 3BCIA 3F3QA 2NTOA 1YEPA 4ML1A 2X99A 2VAFA 3FR6A 2HYXA 4KA0A 4TR1B 2FWEA 4PNGA 3HJPA 1GLQA 4EL1A 4K0NA 1MDJA 5DAKB 3TJKA 4KW6A 4ZIJA 2H70A 5C00A 4L0UA 3O6TA 2VCZA 5A5KA 5FHIA 1Y6EA 3VI7A 4HU9A 5G5FA 1HQOA 4WETA 3P90A 1X9MB 1PA3A 2AB6A 4IP6A 4JZQA 2R3XA 2TRXA 1ZYNA 3A2XA 4TXOB 5JWQB 4PURA 4BL7A 4TOPA 1K3OA 5ECKB 3ZITA 3EMXA 4OCFA 3ME7A 3E9JB 4IN0A 1X5EA 2V1MA 2DIZA 4HS1A 3OR5A 3FR3A 2FWFA 3DWVA 4X4JA 1V57A 5IQYA 2CAIA 3I69A 2C3NA 3IHGA 3QAWA 1T4YA 1J9BA 4D73A 4I2UA 3A2VA 4KSOA 4NMUA 5IO0A 1J08A 1TTZA 3BCKA 4K8MA 4QL7A 2PWJA 3ZYWA 4TVEA 4YKFA 3F63A 1QQ2A 2CVBA 4JE1A 2C8UA 2JSZA 2YCDA 3SWLA 2LTKA 3F9UA 1F37A 2GGTA 4G19A 9GSSA 4CW9A 1BEDA 4MMMA 2GT5A 2L57A 4EUYA 4Z2RA 2HSYA 3FZAA 3DVWA 3LG6A 3D22A 3KIJA 1U6TA 4WF5A 4V2LA 1PKZA 3EC3A 3NIVA 1NSWA 4F9ZA 4LLRA 3L9VA 4NV5A 2A2PA 4HZ4A 3ED3A 2LJAA 2PN8A 5J3RA 4K2XA 3C1SA 4WF4A 2ALBA 5E59A 2C0DA 4MF5A 1EEJA 5F06A 5DAKA 2IL3A 1SL1B 3CRTA 4CHSA 1EEMA 2IMFA 5B8AA 1VF2A 4FYUA 1ZYQB 1Z6MA 3HVSA 3U6VA 2B1LA 4V2NA 4K2DA 4PQ1A 3HKRA 2IMDA 2A2RA 3P7XA 4F03A 3FZ4A 5J9CA 2VLTA 4TXOA 1EV9A 2HFDA 1ON4A 4PUFC 3N5OA 3ZZXA 3J7Yb 3UIWA 1JZWA 3F3RA 4YQUA 5AIXA 4XHMA 2H1DA 4K9ZA 4IELA 1OVNA 4MNNA 2VLVA 4YAVA 2E2MA 2H0IA 2R0PA 5CRWA 4FH8A 2VD1A 3ERGA 4AJ7A 3DXBA 2LRTA 2VIMA 3APQA 1B4PA 1EP7A 5IPHA 4FIWA 1AXDA 1VF4A 2CA8A 2CQ9A 4ISDA 2PMTA 3KP8A 3UL3A 4BWQA 5F0GA 2VCTA 3TOTA 5JCUA 4RI6A 1SD8A 1XOAA 4RQRA 3LJRA 2VD0A 6GSYA 3MYDA 4ZB8A 2GSQA 4Z7XA 1ERTA 3VI5A 2GQLA 1G6WA 4ECJA 1TRVA 3RPPA 3FMWA 1BQ7A 2EC4A 2H72A 2NVLA 4BWSA 1SD9A 2GLRA 2CVKA 5LNKe 1SYRA 4ZB6A 2K8VA 5DBQA 2WULA 1K0OA 2FUG2 1EGRA 2XPEA 2OBKA 2H71A 2LJKA 5HFGA 1T1VA 4QQ7A 3EWLA 2B7JA 3VWXA 4F0CA 3LFLA 3APOA 4ULXA 1A0FA 3FRCA 1FOHA 4POBA 2YJ7A 4WXTA 2F8AA 1OC3A 3D0ZA 3TRPA 3VPQA 2P0GA 4BIKA 2DKHA 2LSTA 2OACA 1TW9A 1ZL9A 5ELAA 3DD3A 1XVWA 2GSRA 1WP0A 4KE3A 4GSTA 2HI7A 5ID2A 1SKSB 2LJRA 2REMA 5HFKA 3UVHA 1FB6A 1T00A 4AF2A 1M2AA 2R0GA 3D21A 3UEMA 1PL1A 4JEDA 1PN9A 5G31A 1GL8A 4O92A 5J41A 4J57E 2I1UA 1XVQA 1WOUA 5AGYA 4J2FA 2ZUPA 3EYTA 6GSWA 1ILOA 1AQWA 4HU7A 4MH3A 4WEYA 3WT2A 2VM2A 2IMEA 4F0BA 4N10A 1XIYA 2XBIA 2G0FA 1DBYA 3FKFA 4IW9A 2AHEA 3QD9A 4ZBDA 1NW2A 3GV1A 1HNAA 5G2ZA 3TRXA 3RHCA 5IMDA 1N2AA 5IOXA 3LYPA 2H6YA 3UVTA 2OE0A 2KUCA 3D4MA 4POKA 5IMFA 1Y25A 1S3DA 1S3CA 1PN0A 3GTUA 5DALB 4WBJA 4XRDA 4MF7A 1B9YC 1AAZA 4JBBA 3ZIVA 1GSDA 2H1BA 3KTBA 1PQNA 4K5SA 4GQCA 3H8QA 2VCXA 4K7IA 2DJKA 2JACA 3QPMA 1Z5YE 5CRDA 1TRSA 1K0BA 3C7MA 2K18A 3I6AA 2G2QA 4PX1A 2GS3A 3LORA 1YKAA 1A8LA 2LEGA 1QFNA 3M8NA 3Q74A 5HFIA 5G1KA 1GSFA 4G10A 1XW9A 4ZBBA 3ZVJA 2WZ9A 2FGXA 5IO2A 2FWHA 3UAPA 3F6FA 1GNEA 2RLIA 5H5SA 5ECNB 2CAQA 4XCSA 3TB2A 3GH6A 3MIXA 2HRKA 3GFKA 5ABRA 1CQHA 1ST9A 3TKSA 4MZCA 4V1Ap 2HXKA 4GSNA 2JZRA 4EIPA 1UN2A 2DJ1A 2BJXA 3M9KA 4I5QA 1M3IA 5ECPB 5KOXA 1GSQA 2C1YA 2HLSA 4ZL7A 4HQSA 2LKUA 3D5JA 2C80A 4TRXA 1XXUA 4N30A 4TN8A 4IP1A 5AIVA 3KGKA 3TKSC 4PXOA 3IXRA 2WFCA 1EWXA 5IM9A 4GQFA 2HRFA 2QSIA 1TI1A 4USSA 1GSUA 4L5LA 4G0IA 4G0LA 1DUGA 3PR8A 1UVZA 3IC8A 4XRAA 5LD0A 4CY6A 4ECIA 2UZ8A 2RUEA 3VWWA 5DALA 4Z2TA 1A2JA 2VCQA 5ECOB 4BVYB 3HHVA 5ECRB 4KDYA 2MZCA 5IMAA 4HQZA 5HR0A 1K0CA 1DSBA 1PX6A 4ECCA 1TXXA 3CSJA 2H75A 2YV7A 4IJ3A 3IAM2 3CRUA 4K1FA 3TKSE 4IQAA 2F9SA 2F8FA 3V1WA 1XPVA 4X43A 1GWCA 1R7HA 3AY8A 20GSA 2X8HA 3GURA 1X5CA 1Z6NA 3IAS2 1EGOA 3RAZA 2M80A 4YKGA 2JL4A 5JWOB 2PERA 1XW5A 1XWKA 1V98A 4DSQA 2O87A 1XZOA 3ZL5A 2GZYA 5A4WA 2AUVA 3LW9A 1A23A 1WJKA 1AC1A 3TCOA 1OKTA 4XIHA 3QAVA 5HQPA 3EPTA 1GTAA 1SK0A 4KCEA 3VLNA 5DJLA 1TU8A 2EIOA 2JU5A 3Q18A 2VL3A 3TRQA 1SJ6A 5CYYA 3UMAA 1R5AA 5BRTA 4PQIA 1B48A 4JR4A 2WJUA 1T4ZA 2PVOC 2B5EA 1GUKA 4YQVA 5KN3A 4JU5A 4TXVA 3FR9A 1QMVA 2I3YA 1ERVA 2HZEB 2A2SA 3F4SA 2D2ZA 1JZDA 3GUSA 3FW2A 1JZRA 1HNCA 2V2GA 2B3SA 2PGTA 1YZXA 1WRYA 5CO3A 1YQ1A 2F3MA 3JCML 2DJ2A 4ZB9A 2FWGA 3HCZA 3RBTA 2EIQA 3HYPA 3DMLA 3W8JA 3KZQA 5AISA 6GSSA 2QKEA 1MD3A 2IMKA 2RM5A 3A3TA 3HVVA 2I9HA 3KH9A 5G30A 1UC7A 1O6JA 6GSXA 1TK8B 1OC9A 2YP6A 2YN1A 1YF1A 1WPIA 2H0HA 1XOBA 4I2TA 2BMXA 3U5RE 4NHZA 3MDKA 2FNOA 4EDZA 4OFMA 1G7OA 5ECLB 1BJXA 2K8SA 2J9HA 1IYHA 4L5OA 4O5QA 5D9XA 3TJJA 1OE8A 4V2MA 1JLWA 1JFUA 3UBLA 1SL2B 1DE2A 3HXSA 4HJ2A 1I9DA 2FA4A 4TR1A 4EVMA 2DSAA 3KTLA 1VGLA 2LNTA 3QDNA 1KEBA 2LRCA 1EOGA 3ZFLA 4ML6A 4KGIA 3F4RA 5HR3A 1PSQA 4G2EA 1ZCPA 3D4TA 4Q5QA 1M2BA 3M9JA 2O7KA 3L78A 5G1LA 4DSRA 4OCEA 2HZEA 2VL9A 1AQVA 3HY2A 1U88A 5ELGA 3WYWA 1M9AA 2C4JA 3LEFA 4MZBA 3M0FA 1ACVA 2X8CA 2CX4A 2XHFA 4WBRD 4O32A 2L5LA 4EKZA 2NBSA 4NXIA 5DQYA 4RUVA 4L8EA 4P3YB 1NM3A 1PRXA 2PBJA 3H4KA 5C04A 1TRWA 2K6VA 4K7NA 3IA1A 1GTBA 1AW9A 1GP1A 5KN0A 2C0EA 2IJYA 2LS5A 1JHBA 3LQ7A 1RK4A 4N0ZA 4I8BA 1LJRA 3BD2A 1A2MA 2DLXA 5J9BA 2FLSA 3FZ5A 18GSA 4AGSA 4Q5FA 1PGTA 2YANA 4IHUA 3KXOA 2R2JA 2DJ0A 2H6XA 2MBTA 2C0GA 1ZZYA 3MNGA 1Q4JA 4Z2UA 4F2IA 1FG4A 1M3JA 3I9V2 3TJBA 1BX9A 5KN2A 1X5DA 1T8EB 1THOA 2HZFA 1G7EA 1W89A 2YWOA 4K7OA 2EIRA 3EE2A 3GX0A 1S3RA 3W6GA 4EXJA 2IWTA 4X0XA 3UJ1A 3IK7A 1V58A 1XFLA 4Q5RA 1K0DA 2ON7A 4MLYA 2H6ZA 1BG5A 1TDIA 3HVXA 5GZZB 5COHA 3GSSA 3QCPA 2B6MA 1OAZA 2DIYA 4OO4A 3ME8A 4CDOA 3GH9A 4HI7A 2C0FA 2GZPA 4IS0A 3HVNA 3GA4A 2XC2A 1GTUA 4DEJA 3TGZA 5IPGA 5DJMA 1ABAA 4PTSA 1HD2A 4I97A 1SKWB 3IV4A 4CY8A 1GUMA 4ZILA 4I6XA 5A4VA 3FZ9A 3BOAA 2YJHA 4POMA 2IPAA 3CXGA 4MPFA 4E8HA 3G7YA 1ZOFA 4GF0A 2LUSA 5CREA 1Z3EA 3A2WA 3VURA 4HSCX 3UBKA 3TOUA 5JWRB 3RPNA 1FVJA 4EIQA 3KD0A 1K3LA 3R3EA 4MJAA 1T3BA 1K0NA 3GKNA 3M3MA 3DRNA 2V32A 2R37A 3G7JA 5B7CA 3KJYA 4WR4A 1U87A 1FAAA 5ENUA 2KP2A 4MABA 5KOWA 1RW1A 2V6KA 2WDUA 3C8EA 5D96A 1YEXA 2H30A 5H5QA 4EE0A 1GH2A 4X1UA 5D9WA 5CP1A 3BJ5A 1K0MA 1NHYA 1TKDB 5B6MA 1M99A 3LSZA 2R5GA 1ZGNA 2N5FA 3WGXA 3CBUA 1OYJA 4PNFA 3US3A 2GQMA 2OBIA 1YKCA 4ID0A 3UARA 3APSA 2HE3A 4IJIA 4NPBA 5L71A 2DJ3A 2Z9SA 5KN1A 2AAWA 4MP4A 1MDKA 2GT6A 4K0GA 1H4OA 3KEBA 3GSTA 2AV4A 3RDWA 5ECIB 2JZSA 2DC5A 3GKKA 2LNSA 4GSSA 2VM1A 2VL2A 1GSEA 2N5BA 1B8XA 1QGVA 4F82A 3QFAC 1X9WB 1SU9A 4K5RA 4KF9A 3CMIA 1TK5B 4HEA2 2KOKA 7GSSA 1VF1A 2YOIA 1TK0B 3TJGA 3HD5A 2VL2C 2HSMA 1FO5A 2CVDA 4G0KA 12GSA 3H93A 3PH9A 1USBA 2C3TA 2H1GA 4PUAA 3WGDA 1DE1A 3HZ8A 17GSA 1B9XC 2O85A 2RIIA 1OC8A 1UA5A 2OKAA 2OE3A 4RQXA 1A24A 1GTIA 3N9JA 4NHWA 1S3AA 4KH7A 2A4VA 6GSTA 2H19A 1ZYPA 2B1KA 3H79A 13GSA 1RQMA 3J7Yk 1PD21 4MDCA 2DMLA 1FB0A 5EL8A 2K9FA 1FHEA 1WE0A 5J4UA 3CYNA 4MCUA 3K8NA 3WT1A 4N0VA 3C71A 3GNJA 8GSSA 4BVXB 2VO4A 3EU3A 1PKWA 3TUEA 4OFTA 2WGRA 3L9SA 5GAPD 3HDCA 4TR4A 3ZREA 1ZYEA 3ZVJD 1R26A 3I43A 1Z7PA 4NAXA 3H1NA 2X64A 5IIZA 6GSUA 5EVOA 1TP9A 4IVFA 4D73B 4GRFA 3KM6A 2C3QA 2VCVA 3CSIA 3O3TA 2PVQA 4HOJA 4FYBA 2GSSA 3DVXA 1FVKA 5CNWA 22GSA 2B5XA 4EF0A 2H1AA 1K3YA 3KMNA 3WD6A 2WCIA 1IYIA 1X0RA 2IFQB 3F8UA 1M0UA 3DIEA 2WS2A 2YWIA 1PL2A 5DVBA 4MH2A 1PFOA 1W4VA 5IMVA 2RUFA 4J56E 4GCIA 1X9SB 3PINA 2E2GA 1U3AA 3GKXA 3L0HA 1SK2A 3HJOA 4K6XA 3FY7A 2J23A 5GAND 2KHPA 4KNDA 5D8IA 1EZKA 1TI3A 4LA1A 1TOFA 1A8YA 4XTSA 2PUKC 1AUCA 1HNBA 3IBHA 2MMNA 2LQQA 4H86A 3IR4A 1VF3A 1O7UA 3P2AA 4BVYA 4KSMA 4WKWA 3KH7A 1O81A 2M72A 3D6IA 3SBCA 1E6BA 2HRAA 2YV9A 4ECBA 1TRUA 5AN1A 2X4AA 3CTFA 4OD7A 3F6DA 4BVXA 2JZTA 3PPUA 4MZWA 2E7PA 3KP9A 2P5QA 3GYKA 4MK3A 3VWUA 1PMTA 2FCHA 4ACSA 16GSA 4EC0A 2OADA 3KMOA 2DKIA 2YWNA 4TKYA 1N8JA 4OO5A 3HZ4A 5DCGA 2H01A 1G0TA 2L59A 2H76A 1VRSD 2M46A 1THXA 3CTGA 3A5IA 1O85A 1AIUA 1SJZA 1TU7A 2XPDA 2ZNMA 1F3BA 1XWAA 19GSA 1KBNA 4EO3A 3HJMA 4LMWA 1BYEA 5DDLA 2IFQA 1XW6A 3L4NA 4KX4A 2N5AA 5FT3A 14GSA 2GSTA 5DQSA 5F07A 5GSTA 3ZMKA 3LWAA 3GIXA 4KB3A 4IGJA 1B4QA 4PGTA 4HUAA 3G7IA 2TRCP 3ERFA 5EY6A 4POLA 4IKHA 3FHKA 5DCHA 4KDUA 3DYRA 3PGTA 1GRXA 3E3EA 5INYA 1YY7A 1Z9HA 4MPGA 3FK8A 3LYKA 3GN3A 3RHBA 6GSVA 5D93A 5CRHA 1F3AA 3LGCA 1GNWA 2OE1A 3IPZA 2VUPA 2KP1A 2NDOA 2O8VB 3ZLPA 5ID2B 3F0IA 4E8EA 2B7KA 4ZL9A 2L4QA 3NOFA 4GXZA 3QOUA 4YH2A 4IQ1A 4FQUA 3TKRA 1O73A 2QGVA 3C73A 2CV4A 1ML6A 4XS6A 3P8WA 1QXHA 2IMIA 5B8BA 2IIYA 2YWMA 2IN3A 2WB9A 1XG8A 2CZ2A 1ERWA 2X49A 2DJJA 4MJEA 5CAXA 1K0AA 2VOCA 5F8BA 4EDYA 2ON5A 2B5YA 1OE7A 4XS4B 5ECMB 3ZFBA 3GRXA 3Q6OA 1QUWA 3FEUA 5J5NA 4FO5A 3TJFA 3WGEA 1URMA 5FWGA 1XCCA 2FD3A 2LRNA 4OMVA 3QR6A 1R4WA 1XWGA 3GTUB 4N11A 3ZTLA 2R4VA 1R5PA 5G5EA 3GL5A 2H8LA 4A5PA 4KUNA 4IBPA 1M7TA
chains in the Genus database with same CATH topology
1LU4A 1O8XA 4HZ2A 5H5RA 3CSHA 2R6KA 5JCWA 2GQKA 4MJBA 3ERWA 4RI7A 3VPTA 3O76A 3EMPA 2XBQA 4DSSB 1I5GA 4V1Ag 2YZHA 3M1GA 3ISOA 4OWYA 2R0CA 3LXZA 10GSA 4O5UA 3R2QA 2JSYA 2OA7A 3GKMA 3G9BA 1H75A 1WMJA 2YPMA 1XWCA 1OKDA 2V41A 2HSHA 2FHEA 1F6MC 4ZXGA 2CX3A 2PU9C 3VWVA 2KLXA 2YZUA 2FY6A 3ZRDA 2AYTA 3IOSA 4LL4B 1NHOA 3FYGA 2HT9A 3F4TA 2TIRA 3IHQA 4PQHA 1T7PB 1GUHA 2MBSA 3VK9A 1FOVA 1SJIA 2BTOT 3UOMA 2ES7A 2LV3A 3A5WA 2LQOA 2JADA 3QFBC 3EVIA 3MWHA 4AJ6A 2I81A 1YDKA 4OFNA 1G6YA 1SL0B 4XS4A 5D73A 5HR1A 1SYXA 1WWJA 5LCZA 1YF0A 1JZOA 1SENA 1M2DA 4NWYA 2HNLA 3EINA 2X8GA 11GSA 3VFIA 1YJ6A 2P31A 5F05A 2QA2A 2GVPA 4MJCA 1GLPA 5ECHB 4ZL8A 3IRAA 4JRRA 4O5RA 5B6NA 1Z7RA 3BBYA 5CRGA 4AJ8A 4TR0A 1E2YA 3QMXA 1FW1A 2P5RA 3IK9A 4LL1B 5KEJA 1MEKA 3S9FA 2L6CA 4Q5NA 1MTCA 3MAKA 3EU4A 1J0FA 1F2EA 3DKSA 2HRNA 4GWRA 1V2AA 1BAYA 4MF6A 1V9WA 3QAGA 4JR6A 1A0RP 2WRTA 5IMZA 4DSSA 2H66A 1EOHA 4YQMA 2NPBA 3DEXA 3TKPA 2YNXA 4O7HA 3C1RA 4HDEA 3LXTA 3KCMA 1MDIA 1SK1A 4LMVA 2H74A 5D9VA 2H73A 2F51A 2CT6A 1LBKA 2A4HA 5A4UA 1KTEA 2QA1A 2GDRA 2L4CA 3GMFA 4GLTA 4GTUA 3IE3A 5EPFA 4BPYA 2DBCA 4TR3A 3L9UA 4TW5A 1EP8A 5ECQB 4MA9A 5D9TA 1C72A 2MMOA 1XBSA 2I4AA 4G9HA 1EV4A 1WIKA 2GTUA 4KDXA 3MSZA 1HYUA 2E0QA 4ZBAA 2CZ3A 2ZCTA 1KNGA 4KAEA 3E0UA 5HR2A 4NV2A 4HJMA 4BA7A 4BL7B 1CQGA 2MMZA 2OJLA 4XS1A 1SKRB 1MD4A 5JCGA 1U3IA 1GSSA 1GSYA 3Q19A 1Q98A 4KCAA 2AJQB 3TDGA 3GL3A 2H0GA 1QK8A 5ECSA 1F9MA 3W8SA 2MYGA 3GX8A 3GHAA 2QC7A 3NZNA 2O89A 1OC9B 2FA8A 2MMAA 4FYCA 3ZIJA 3ZMLA 4ILFA 3EURA 1V40A 4DVCA 4YAPA 2VCWA 1GULA 4WR5A 5GSSA 3HA9A 2L6DA 2PPTA 1ERUA 1JLVA 2DMMA 1AQXA 1PX7A 1TJDA 2GZZA 5IMCA 3IDVA 2L5OA 3DGQA 4ICYA 4L0WA 5IOWA 1O8WA 1ZMAA 1XWBA 3TKQA 2V6OA 1A2LA 2VLUA 4QL9A 1M9BA 2RM6A 5BMUA 5E4WA 3IC4A 3BCIA 3F3QA 2NTOA 1YEPA 4ML1A 2X99A 2VAFA 3FR6A 2HYXA 4KA0A 4TR1B 2FWEA 4PNGA 3HJPA 1GLQA 4EL1A 4K0NA 1MDJA 5DAKB 3TJKA 4KW6A 4ZIJA 2H70A 5C00A 4L0UA 3O6TA 2VCZA 5A5KA 5FHIA 1Y6EA 3VI7A 4HU9A 5G5FA 1HQOA 4WETA 3P90A 1X9MB 1PA3A 2AB6A 4IP6A 4JZQA 2R3XA 2TRXA 1ZYNA 3A2XA 4TXOB 5JWQB 4PURA 4BL7A 4TOPA 1K3OA 5ECKB 3ZITA 3EMXA 4OCFA 3ME7A 3E9JB 4IN0A 1X5EA 2V1MA 2DIZA 4HS1A 3OR5A 3FR3A 2FWFA 3DWVA 4X4JA 1V57A 5IQYA 2CAIA 3I69A 2C3NA 3IHGA 3QAWA 1T4YA 1J9BA 4D73A 4I2UA 3A2VA 4KSOA 4NMUA 5IO0A 1J08A 1TTZA 3BCKA 4K8MA 4QL7A 2PWJA 3ZYWA 4TVEA 4YKFA 3F63A 1QQ2A 2CVBA 4JE1A 2C8UA 2JSZA 2YCDA 3SWLA 2LTKA 3F9UA 1F37A 2GGTA 4G19A 9GSSA 4CW9A 1BEDA 4MMMA 2GT5A 2L57A 4EUYA 4Z2RA 2HSYA 3FZAA 3DVWA 3LG6A 3D22A 3KIJA 1U6TA 4WF5A 4V2LA 1PKZA 3EC3A 3NIVA 1NSWA 4F9ZA 4LLRA 3L9VA 4NV5A 2A2PA 4HZ4A 3ED3A 2LJAA 2PN8A 5J3RA 4K2XA 3C1SA 4WF4A 2ALBA 5E59A 2C0DA 4MF5A 1EEJA 5F06A 5DAKA 2IL3A 1SL1B 3CRTA 4CHSA 1EEMA 2IMFA 5B8AA 1VF2A 4FYUA 1ZYQB 1Z6MA 3HVSA 3U6VA 2B1LA 4V2NA 4K2DA 4PQ1A 3HKRA 2IMDA 2A2RA 3P7XA 4F03A 3FZ4A 5J9CA 2VLTA 4TXOA 1EV9A 2HFDA 1ON4A 4PUFC 3N5OA 3ZZXA 3J7Yb 3UIWA 1JZWA 3F3RA 4YQUA 5AIXA 4XHMA 2H1DA 4K9ZA 4IELA 1OVNA 4MNNA 2VLVA 4YAVA 2E2MA 2H0IA 2R0PA 5CRWA 4FH8A 2VD1A 3ERGA 4AJ7A 3DXBA 2LRTA 2VIMA 3APQA 1B4PA 1EP7A 5IPHA 4FIWA 1AXDA 1VF4A 2CA8A 2CQ9A 4ISDA 2PMTA 3KP8A 3UL3A 4BWQA 5F0GA 2VCTA 3TOTA 5JCUA 4RI6A 1SD8A 1XOAA 4RQRA 3LJRA 2VD0A 6GSYA 3MYDA 4ZB8A 2GSQA 4Z7XA 1ERTA 3VI5A 2GQLA 1G6WA 4ECJA 1TRVA 3RPPA 3FMWA 1BQ7A 2EC4A 2H72A 2NVLA 4BWSA 1SD9A 2GLRA 2CVKA 5LNKe 1SYRA 4ZB6A 2K8VA 5DBQA 2WULA 1K0OA 2FUG2 1EGRA 2XPEA 2OBKA 2H71A 2LJKA 5HFGA 1T1VA 4QQ7A 3EWLA 2B7JA 3VWXA 4F0CA 3LFLA 3APOA 4ULXA 1A0FA 3FRCA 1FOHA 4POBA 2YJ7A 4WXTA 2F8AA 1OC3A 3D0ZA 3TRPA 3VPQA 2P0GA 2DKHA 2LSTA 2OACA 1TW9A 1ZL9A 5ELAA 3DD3A 1XVWA 2GSRA 1WP0A 4KE3A 4GSTA 2HI7A 5ID2A 1SKSB 2LJRA 2REMA 5HFKA 3UVHA 1FB6A 1T00A 4AF2A 1M2AA 2R0GA 3D21A 3UEMA 1PL1A 4JEDA 1PN9A 5G31A 1GL8A 4O92A 5J41A 4J57E 2I1UA 1XVQA 1WOUA 5AGYA 4J2FA 2ZUPA 3EYTA 6GSWA 1ILOA 1AQWA 4HU7A 4MH3A 4WEYA 3WT2A 2VM2A 2IMEA 4F0BA 4N10A 1XIYA 2XBIA 2G0FA 1DBYA 3FKFA 4IW9A 2AHEA 3QD9A 4ZBDA 1NW2A 3GV1A 1HNAA 5G2ZA 3TRXA 3RHCA 5IMDA 1N2AA 5IOXA 3LYPA 2H6YA 3UVTA 2OE0A 2KUCA 3D4MA 4POKA 5IMFA 1Y25A 1S3DA 1S3CA 1PN0A 3GTUA 5DALB 4WBJA 4XRDA 4MF7A 1B9YC 1AAZA 4JBBA 3ZIVA 1GSDA 2H1BA 3KTBA 1PQNA 4K5SA 4GQCA 3H8QA 2VCXA 4K7IA 2DJKA 2JACA 3QPMA 1Z5YE 5CRDA 1TRSA 1K0BA 3C7MA 2K18A 3I6AA 2G2QA 4PX1A 2GS3A 3LORA 1YKAA 1A8LA 2LEGA 1QFNA 3M8NA 3Q74A 5HFIA 5G1KA 1GSFA 4G10A 1XW9A 4ZBBA 3ZVJA 2WZ9A 2FGXA 5IO2A 2FWHA 3UAPA 3F6FA 1GNEA 2RLIA 5H5SA 5ECNB 2CAQA 4XCSA 3TB2A 3GH6A 3MIXA 2HRKA 3GFKA 5ABRA 1CQHA 1ST9A 3TKSA 4MZCA 4V1Ap 2HXKA 4GSNA 2JZRA 4EIPA 1UN2A 2DJ1A 2BJXA 3M9KA 4I5QA 5ECPB 5KOXA 1GSQA 2C1YA 2HLSA 4ZL7A 4HQSA 2LKUA 3D5JA 2C80A 4TRXA 1XXUA 4N30A 4TN8A 4IP1A 5AIVA 3KGKA 3TKSC 4PXOA 3IXRA 2WFCA 1EWXA 5IM9A 4GQFA 2HRFA 2QSIA 1TI1A 4USSA 1GSUA 4L5LA 4G0IA 4G0LA 1DUGA 3PR8A 1UVZA 3IC8A 4XRAA 5LD0A 4CY6A 4ECIA 2UZ8A 2RUEA 3VWWA 5DALA 4Z2TA 1A2JA 2VCQA 5ECOB 4BVYB 3HHVA 5ECRB 4KDYA 2MZCA 5IMAA 4HQZA 5HR0A 1K0CA 1DSBA 1PX6A 4ECCA 1TXXA 3CSJA 2H75A 2YV7A 4IJ3A 3IAM2 3CRUA 4K1FA 3TKSE 4IQAA 2F9SA 2F8FA 3V1WA 1XPVA 4X43A 1GWCA 1R7HA 3AY8A 20GSA 2X8HA 3GURA 1X5CA 1Z6NA 3IAS2 1EGOA 3RAZA 2M80A 4YKGA 2JL4A 5JWOB 2PERA 1XW5A 1XWKA 1V98A 4DSQA 2O87A 1XZOA 3ZL5A 2GZYA 5A4WA 2AUVA 3LW9A 1A23A 1WJKA 1AC1A 3TCOA 1OKTA 4XIHA 3QAVA 5HQPA 3EPTA 1GTAA 1SK0A 4KCEA 3VLNA 5DJLA 1TU8A 2EIOA 2JU5A 3Q18A 2VL3A 3TRQA 1SJ6A 5CYYA 3UMAA 1R5AA 5BRTA 4PQIA 1B48A 4JR4A 2WJUA 1T4ZA 2PVOC 2B5EA 1GUKA 4YQVA 5KN3A 4JU5A 4TXVA 3FR9A 1QMVA 2I3YA 1ERVA 2HZEB 2A2SA 3F4SA 2D2ZA 1JZDA 3GUSA 3FW2A 1JZRA 1HNCA 2V2GA 2B3SA 2PGTA 1YZXA 1WRYA 5CO3A 1YQ1A 2F3MA 3JCML 2DJ2A 4ZB9A 2FWGA 3HCZA 3RBTA 2EIQA 3HYPA 3DMLA 3W8JA 3KZQA 5AISA 6GSSA 2QKEA 1MD3A 2IMKA 2RM5A 3A3TA 3HVVA 2I9HA 3KH9A 5G30A 1UC7A 1O6JA 6GSXA 1TK8B 1OC9A 2YP6A 2YN1A 1YF1A 1WPIA 2H0HA 1XOBA 4I2TA 2BMXA 3U5RE 4NHZA 3MDKA 2FNOA 4EDZA 4OFMA 1G7OA 5ECLB 1BJXA 2K8SA 2J9HA 1IYHA 4L5OA 4O5QA 5D9XA 3TJJA 1OE8A 4V2MA 1JLWA 1JFUA 3UBLA 1SL2B 1DE2A 3HXSA 4HJ2A 1I9DA 2FA4A 4TR1A 4EVMA 2DSAA 3KTLA 1VGLA 2LNTA 3QDNA 1KEBA 2LRCA 1EOGA 3ZFLA 4ML6A 4KGIA 3F4RA 5HR3A 1PSQA 4G2EA 1ZCPA 3D4TA 4Q5QA 1M2BA 3M9JA 2O7KA 3L78A 5G1LA 4DSRA 4OCEA 2HZEA 2VL9A 1AQVA 3HY2A 1U88A 5ELGA 3WYWA 1M9AA 2C4JA 3LEFA 4MZBA 3M0FA 1ACVA 2X8CA 2CX4A 2XHFA 4WBRD 4O32A 2L5LA 4EKZA 2NBSA 4NXIA 5DQYA 4RUVA 4L8EA 4P3YB 1NM3A 1PRXA 2PBJA 3H4KA 5C04A 1TRWA 2K6VA 4K7NA 3IA1A 1GTBA 1AW9A 1GP1A 5KN0A 2C0EA 2IJYA 2LS5A 1JHBA 3LQ7A 1RK4A 4N0ZA 4I8BA 1LJRA 3BD2A 1A2MA 2DLXA 5J9BA 2FLSA 3FZ5A 18GSA 4AGSA 4Q5FA 1PGTA 2YANA 4IHUA 3KXOA 2R2JA 2DJ0A 2H6XA 2MBTA 2C0GA 1ZZYA 3MNGA 1Q4JA 4Z2UA 4F2IA 1FG4A 3I9V2 3TJBA 1BX9A 5KN2A 1X5DA 1T8EB 1THOA 2HZFA 1G7EA 1W89A 2YWOA 4K7OA 2EIRA 3EE2A 3GX0A 3W6GA 4EXJA 2IWTA 4X0XA 3UJ1A 3IK7A 1V58A 1XFLA 4Q5RA 1K0DA 2ON7A 4MLYA 2H6ZA 1BG5A 1TDIA 3HVXA 5GZZB 5COHA 3GSSA 3QCPA 2B6MA 1OAZA 2DIYA 4OO4A 3ME8A 4CDOA 3GH9A 4HI7A 2C0FA 2GZPA 4IS0A 3GA4A 2XC2A 1GTUA 4DEJA 3TGZA 5IPGA 5DJMA 1ABAA 4PTSA 1HD2A 4I97A 1SKWB 3IV4A 4CY8A 1GUMA 4ZILA 4I6XA 5A4VA 3FZ9A 3BOAA 2YJHA 4POMA 2IPAA 3CXGA 4MPFA 4E8HA 3G7YA 1ZOFA 4GF0A 2LUSA 5CREA 1Z3EA 3A2WA 3VURA 3UBKA 3TOUA 5JWRB 3RPNA 1FVJA 4EIQA 3KD0A 1K3LA 3R3EA 4MJAA 1T3BA 1K0NA 3GKNA 3M3MA 3DRNA 2V32A 2R37A 3G7JA 5B7CA 3KJYA 4WR4A 1U87A 1FAAA 5ENUA 2KP2A 4MABA 5KOWA 1RW1A 2V6KA 2WDUA 3C8EA 5D96A 1YEXA 2H30A 5H5QA 4EE0A 1GH2A 4X1UA 5D9WA 5CP1A 3BJ5A 1K0MA 1NHYA 1TKDB 5B6MA 1M99A 3LSZA 2R5GA 1ZGNA 2N5FA 3WGXA 3CBUA 1OYJA 4PNFA 3US3A 2GQMA 2OBIA 1YKCA 4ID0A 3UARA 3APSA 2HE3A 4IJIA 4NPBA 5L71A 2DJ3A 2Z9SA 5KN1A 2AAWA 4MP4A 1MDKA 2GT6A 4K0GA 1H4OA 3KEBA 3GSTA 2AV4A 3RDWA 5ECIB 2JZSA 2DC5A 3GKKA 2LNSA 4GSSA 2VM1A 2VL2A 1GSEA 2N5BA 1B8XA 1QGVA 4F82A 3QFAC 1X9WB 1SU9A 4K5RA 4KF9A 3CMIA 1TK5B 4HEA2 2KOKA 7GSSA 1VF1A 2YOIA 1TK0B 3TJGA 3HD5A 2VL2C 2HSMA 1FO5A 2CVDA 4G0KA 12GSA 3H93A 3PH9A 1USBA 2C3TA 2H1GA 4PUAA 3WGDA 1DE1A 3HZ8A 17GSA 1B9XC 2O85A 2RIIA 1OC8A 1UA5A 2OKAA 2OE3A 4RQXA 1A24A 1GTIA 3N9JA 4NHWA 1S3AA 4KH7A 2A4VA 6GSTA 2H19A 1ZYPA 2B1KA 3H79A 13GSA 1RQMA 3J7Yk 1PD21 4MDCA 2DMLA 1FB0A 5EL8A 2K9FA 1FHEA 1WE0A 5J4UA 3CYNA 4MCUA 3K8NA 3WT1A 4N0VA 3C71A 3GNJA 8GSSA 4BVXB 2VO4A 3EU3A 1PKWA 3TUEA 4OFTA 2WGRA 3L9SA 5GAPD 3HDCA 4TR4A 3ZREA 1ZYEA 3ZVJD 1R26A 3I43A 1Z7PA 4NAXA 3H1NA 2X64A 5IIZA 6GSUA 5EVOA 1TP9A 4IVFA 4D73B 4GRFA 3KM6A 2C3QA 2VCVA 3CSIA 3O3TA 2PVQA 4HOJA 4FYBA 2GSSA 3DVXA 1FVKA 5CNWA 22GSA 2B5XA 4EF0A 2H1AA 1K3YA 3KMNA 3WD6A 2WCIA 1IYIA 1X0RA 2IFQB 3F8UA 1M0UA 3DIEA 2WS2A 2YWIA 1PL2A 5DVBA 4MH2A 1W4VA 5IMVA 2RUFA 4J56E 4GCIA 1X9SB 3PINA 2E2GA 1U3AA 3GKXA 3L0HA 1SK2A 3HJOA 4K6XA 3FY7A 2J23A 5GAND 2KHPA 4KNDA 5D8IA 1EZKA 1TI3A 4LA1A 1TOFA 1A8YA 4XTSA 2PUKC 1AUCA 1HNBA 3IBHA 2MMNA 2LQQA 4H86A 3IR4A 1VF3A 1O7UA 3P2AA 4BVYA 4KSMA 4WKWA 3KH7A 1O81A 2M72A 3D6IA 3SBCA 1E6BA 2HRAA 2YV9A 4ECBA 1TRUA 5AN1A 2X4AA 3CTFA 4OD7A 3F6DA 4BVXA 2JZTA 3PPUA 4MZWA 2E7PA 3KP9A 2P5QA 3GYKA 4MK3A 3VWUA 1PMTA 2FCHA 4ACSA 16GSA 4EC0A 2OADA 3KMOA 2DKIA 2YWNA 4TKYA 1N8JA 4OO5A 3HZ4A 5DCGA 2H01A 1G0TA 2L59A 2H76A 1VRSD 2M46A 1THXA 3CTGA 3A5IA 1O85A 1AIUA 1SJZA 1TU7A 2XPDA 2ZNMA 1F3BA 1XWAA 19GSA 1KBNA 4EO3A 3HJMA 4LMWA 1BYEA 5DDLA 2IFQA 1XW6A 3L4NA 4KX4A 2N5AA 5FT3A 14GSA 2GSTA 5DQSA 5F07A 5GSTA 3ZMKA 3LWAA 3GIXA 4KB3A 4IGJA 1B4QA 4PGTA 4HUAA 3G7IA 2TRCP 3ERFA 5EY6A 4POLA 4IKHA 3FHKA 5DCHA 4KDUA 3DYRA 3PGTA 1GRXA 3E3EA 5INYA 1YY7A 1Z9HA 4MPGA 3FK8A 3LYKA 3GN3A 3RHBA 6GSVA 5D93A 5CRHA 1F3AA 3LGCA 1GNWA 2OE1A 3IPZA 2VUPA 2KP1A 2NDOA 2O8VB 3ZLPA 5ID2B 3F0IA 4E8EA 2B7KA 4ZL9A 2L4QA 3NOFA 4GXZA 3QOUA 4YH2A 4IQ1A 4FQUA 3TKRA 1O73A 2QGVA 3C73A 2CV4A 1ML6A 4XS6A 3P8WA 1QXHA 2IMIA 5B8BA 2IIYA 2YWMA 2IN3A 2WB9A 2CZ2A 1ERWA 2X49A 2DJJA 4MJEA 5CAXA 1K0AA 2VOCA 5F8BA 4EDYA 2ON5A 2B5YA 1OE7A 4XS4B 5ECMB 3ZFBA 3GRXA 3Q6OA 1QUWA 3FEUA 5J5NA 4FO5A 3TJFA 3WGEA 1URMA 5FWGA 1XCCA 2FD3A 2LRNA 4OMVA 3QR6A 1R4WA 1XWGA 3GTUB 4N11A 3ZTLA 2R4VA 1R5PA 5G5EA 3GL5A 2H8LA 4A5PA 4KUNA 4IBPA 1M7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LU4 A;  1O8X A;  4HZ2 A;  5H5R A;  3CSH A;  2R6K A;  5JCW A;  2GQK A;  4MJB A;  3ERW A;  4RI7 A;  3VPT A;  3O76 A;  3EMP A;  2XBQ A;  4DSS B;  1I5G A;  4V1A g;  2YZH A;  3M1G A;  3ISO A;  4OWY A;  3LXZ A;  10GS A;  3R2Q A;  2JSY A;  2OA7 A;  3GKM A;  3G9B A;  1H75 A;  1WMJ A;  2YPM A;  1XWC A;  1OKD A;  2V41 A;  2HSH A;  2FHE A;  1F6M C;  4ZXG A;  2CX3 A;  2PU9 C;  3VWV A;  2KLX A;  2YZU A;  2FY6 A;  3ZRD A;  2AYT A;  3IOS A;  4LL4 B;  1NHO A;  3FYG A;  2HT9 A;  3F4T A;  2TIR A;  3IHQ A;  4PQH A;  1T7P B;  1GUH A;  2MBS A;  3VK9 A;  1FOV A;  1SJI A;  2BTO T;  3UOM A;  2ES7 A;  2LV3 A;  3A5W A;  2LQO A;  2JAD A;  3QFB C;  3EVI A;  3MWH A;  4AJ6 A;  2I81 A;  1YDK A;  4OFN A;  1G6Y A;  1SL0 B;  4XS4 A;  5D73 A;  5HR1 A;  1SYX A;  1WWJ A;  5LCZ A;  1YF0 A;  1JZO A;  1SEN A;  1M2D A;  4NWY A;  2HNL A;  3EIN A;  2X8G A;  11GS A;  3VFI A;  1YJ6 A;  2P31 A;  5F05 A;  2GVP A;  4MJC A;  1GLP A;  5ECH B;  4ZL8 A;  3IRA A;  4JRR A;  4O5R A;  5B6N A;  1Z7R A;  3BBY A;  5CRG A;  4AJ8 A;  4TR0 A;  1E2Y A;  3QMX A;  1FW1 A;  2P5R A;  3IK9 A;  4LL1 B;  5KEJ A;  1MEK A;  3S9F A;  2L6C A;  4Q5N A;  1MTC A;  3MAK A;  3EU4 A;  1J0F A;  1F2E A;  3DKS A;  2HRN A;  4GWR A;  1V2A A;  1BAY A;  4MF6 A;  1V9W A;  3QAG A;  4JR6 A;  1A0R P;  2WRT A;  5IMZ A;  4DSS A;  2H66 A;  1EOH A;  4YQM A;  2NPB A;  3DEX A;  3TKP A;  2YNX A;  4O7H A;  3C1R A;  4HDE A;  3LXT A;  3KCM A;  1MDI A;  1SK1 A;  4LMV A;  2H74 A;  5D9V A;  2H73 A;  2F51 A;  2CT6 A;  1LBK A;  5A4U A;  1KTE A;  2GDR A;  2L4C A;  3GMF A;  4GLT A;  4GTU A;  3IE3 A;  5EPF A;  4BPY A;  2DBC A;  4TR3 A;  3L9U A;  4TW5 A;  1EP8 A;  5ECQ B;  4MA9 A;  5D9T A;  1C72 A;  2MMO A;  1XBS A;  2I4A A;  4G9H A;  1EV4 A;  1WIK A;  2GTU A;  4KDX A;  3MSZ A;  1HYU A;  2E0Q A;  4ZBA A;  2CZ3 A;  2ZCT A;  1KNG A;  4KAE A;  3E0U A;  5HR2 A;  4NV2 A;  4HJM A;  4BA7 A;  1CQG A;  2MMZ A;  2OJL A;  4XS1 A;  1SKR B;  1MD4 A;  5JCG A;  1U3I A;  1GSS A;  1GSY A;  3Q19 A;  1Q98 A;  4KCA A;  2AJQ B;  3TDG A;  3GL3 A;  2H0G A;  1QK8 A;  5ECS A;  1F9M A;  3W8S A;  2MYG A;  3GX8 A;  3GHA A;  2QC7 A;  3NZN A;  2O89 A;  1OC9 B;  2FA8 A;  2MMA A;  4FYC A;  3ZIJ A;  3ZML A;  4ILF A;  3EUR A;  1V40 A;  4DVC A;  4YAP A;  2VCW A;  1GUL A;  4WR5 A;  5GSS A;  3HA9 A;  2L6D A;  2PPT A;  1ERU A;  1JLV A;  2DMM A;  1AQX A;  1PX7 A;  1TJD A;  2GZZ A;  5IMC A;  3IDV A;  2L5O A;  3DGQ A;  4L0W A;  5IOW A;  1O8W A;  1ZMA A;  1XWB A;  3TKQ A;  2V6O A;  1A2L A;  2VLU A;  4QL9 A;  1M9B A;  2RM6 A;  5E4W A;  3IC4 A;  3BCI A;  3F3Q A;  2NTO A;  1YEP A;  4ML1 A;  2X99 A;  2VAF A;  3FR6 A;  2HYX A;  4KA0 A;  4TR1 B;  2FWE A;  4PNG A;  3HJP A;  1GLQ A;  4EL1 A;  4K0N A;  1MDJ A;  5DAK B;  3TJK A;  4KW6 A;  4ZIJ A;  2H70 A;  5C00 A;  4L0U A;  3O6T A;  2VCZ A;  5A5K A;  5FHI A;  1Y6E A;  3VI7 A;  4HU9 A;  5G5F A;  1HQO A;  4WET A;  3P90 A;  1X9M B;  1PA3 A;  2AB6 A;  4IP6 A;  4JZQ A;  2R3X A;  2TRX A;  3A2X A;  4TXO B;  5JWQ B;  4PUR A;  4BL7 A;  4TOP A;  1K3O A;  5ECK B;  3ZIT A;  3EMX A;  4OCF A;  3ME7 A;  3E9J B;  4IN0 A;  1X5E A;  2V1M A;  2DIZ A;  4HS1 A;  3OR5 A;  3FR3 A;  2FWF A;  3DWV A;  5IQY A;  1V57 A;  2CAI A;  3I69 A;  2C3N A;  3QAW A;  1T4Y A;  1J9B A;  4D73 A;  4I2U A;  3A2V A;  4KSO A;  4NMU A;  5IO0 A;  1J08 A;  1TTZ A;  3BCK A;  4K8M A;  4QL7 A;  2PWJ A;  3ZYW A;  4TVE A;  3F63 A;  1QQ2 A;  2CVB A;  4JE1 A;  2C8U A;  2JSZ A;  2YCD A;  3SWL A;  2LTK A;  3F9U A;  1F37 A;  2GGT A;  4G19 A;  9GSS A;  4CW9 A;  1BED A;  4MMM A;  2GT5 A;  2L57 A;  4EUY A;  2HSY A;  3FZA A;  3DVW A;  3LG6 A;  3D22 A;  3KIJ A;  1U6T A;  4WF5 A;  4V2L A;  1PKZ A;  3EC3 A;  3NIV A;  1NSW A;  4F9Z A;  4LLR A;  3L9V A;  4NV5 A;  4HZ4 A;  3ED3 A;  2LJA A;  2PN8 A;  5J3R A;  3C1S A;  4WF4 A;  2ALB A;  5E59 A;  2C0D A;  4MF5 A;  1EEJ A;  5F06 A;  5DAK A;  2IL3 A;  1SL1 B;  3CRT A;  4CHS A;  1EEM A;  2IMF A;  5B8A A;  1VF2 A;  4FYU A;  1ZYQ B;  1Z6M A;  3HVS A;  3U6V A;  2B1L A;  4V2N A;  4K2D A;  4PQ1 A;  3HKR A;  2IMD A;  2A2R A;  3P7X A;  4F03 A;  3FZ4 A;  5J9C A;  2VLT A;  4TXO A;  1EV9 A;  2HFD A;  1ON4 A;  4PUF C;  3N5O A;  3ZZX A;  3J7Y b;  3UIW A;  1JZW A;  3F3R A;  4YQU A;  5AIX A;  4XHM A;  2H1D A;  4K9Z A;  4IEL A;  1OVN A;  2VLV A;  4YAV A;  2E2M A;  2H0I A;  5CRW A;  4FH8 A;  2VD1 A;  3ERG A;  4AJ7 A;  3DXB A;  2LRT A;  2VIM A;  3APQ A;  1B4P A;  1EP7 A;  5IPH A;  4FIW A;  1AXD A;  1VF4 A;  2CA8 A;  2CQ9 A;  4ISD A;  2PMT A;  3KP8 A;  3UL3 A;  4BWQ A;  5F0G A;  2VCT A;  3TOT A;  5JCU A;  4RI6 A;  1SD8 A;  1XOA A;  4RQR A;  3LJR A;  2VD0 A;  6GSY A;  4ZB8 A;  2GSQ A;  4Z7X A;  1ERT A;  3VI5 A;  2GQL A;  1G6W A;  4ECJ A;  1TRV A;  3RPP A;  1BQ7 A;  2EC4 A;  2H72 A;  2NVL A;  4BWS A;  1SD9 A;  2GLR A;  2CVK A;  5LNK e;  1SYR A;  4ZB6 A;  2K8V A;  5DBQ A;  2WUL A;  1K0O A;  2FUG 2;  1EGR A;  2XPE A;  2OBK A;  2H71 A;  2LJK A;  5HFG A;  1T1V A;  4QQ7 A;  3EWL A;  2B7J A;  3VWX A;  4F0C A;  3LFL A;  3APO A;  4ULX A;  1A0F A;  3FRC A;  4POB A;  2YJ7 A;  4WXT A;  2F8A A;  1OC3 A;  3D0Z A;  3TRP A;  3VPQ A;  2P0G A;  2LST A;  2OAC A;  1TW9 A;  1ZL9 A;  5ELA A;  3DD3 A;  1XVW A;  2GSR A;  1WP0 A;  4KE3 A;  4GST A;  2HI7 A;  5ID2 A;  1SKS B;  2LJR A;  2REM A;  5HFK A;  3UVH A;  1FB6 A;  1T00 A;  4AF2 A;  1M2A A;  3D21 A;  3UEM A;  1PL1 A;  4JED A;  1PN9 A;  5G31 A;  1GL8 A;  4O92 A;  5J41 A;  4J57 E;  2I1U A;  1XVQ A;  1WOU A;  5AGY A;  4J2F A;  2ZUP A;  3EYT A;  6GSW A;  1ILO A;  1AQW A;  4HU7 A;  4MH3 A;  4WEY A;  3WT2 A;  2VM2 A;  2IME A;  4F0B A;  4N10 A;  1XIY A;  2XBI A;  2G0F A;  1DBY A;  3FKF A;  4IW9 A;  2AHE A;  3QD9 A;  4ZBD A;  1NW2 A;  3GV1 A;  1HNA A;  5G2Z A;  3TRX A;  3RHC A;  5IMD A;  1N2A A;  5IOX A;  3LYP A;  2H6Y A;  3UVT A;  2OE0 A;  2KUC A;  3D4M A;  4POK A;  5IMF A;  1Y25 A;  1S3D A;  1S3C A;  3GTU A;  5DAL B;  4WBJ A;  4XRD A;  4MF7 A;  1B9Y C;  1AAZ A;  4JBB A;  3ZIV A;  1GSD A;  2H1B A;  3KTB A;  1PQN A;  4GQC A;  3H8Q A;  2VCX A;  4K7I A;  2DJK A;  2JAC A;  3QPM A;  1Z5Y E;  5CRD A;  1TRS A;  1K0B A;  3C7M A;  2K18 A;  3I6A A;  2G2Q A;  4PX1 A;  2GS3 A;  3LOR A;  1YKA A;  1A8L A;  2LEG A;  1QFN A;  3M8N A;  3Q74 A;  5HFI A;  5G1K A;  1GSF A;  4G10 A;  1XW9 A;  4ZBB A;  3ZVJ A;  2WZ9 A;  2FGX A;  5IO2 A;  2FWH A;  3UAP A;  3F6F A;  1GNE A;  2RLI A;  5H5S A;  5ECN B;  2CAQ A;  4XCS A;  3TB2 A;  3GH6 A;  3GFK A;  5ABR A;  1CQH A;  1ST9 A;  3TKS A;  4MZC A;  4V1A p;  2HXK A;  4GSN A;  2JZR A;  1UN2 A;  2DJ1 A;  2BJX A;  3M9K A;  4I5Q A;  5ECP B;  1GSQ A;  2C1Y A;  2HLS A;  4ZL7 A;  4HQS A;  2LKU A;  3D5J A;  2C80 A;  4TRX A;  1XXU A;  4N30 A;  4TN8 A;  4IP1 A;  5AIV A;  3KGK A;  3TKS C;  4PXO A;  3IXR A;  2WFC A;  1EWX A;  5IM9 A;  4GQF A;  2HRF A;  2QSI A;  1TI1 A;  1GSU A;  4L5L A;  1DUG A;  3PR8 A;  1UVZ A;  4XRA A;  5LD0 A;  4ECI A;  2RUE A;  3VWW A;  5DAL A;  1A2J A;  2VCQ A;  5ECO B;  3HHV A;  5ECR B;  4KDY A;  2MZC A;  5IMA A;  4HQZ A;  5HR0 A;  1K0C A;  1DSB A;  1PX6 A;  4ECC A;  1TXX A;  3CSJ A;  2H75 A;  2YV7 A;  4IJ3 A;  3IAM 2;  3CRU A;  4K1F A;  3TKS E;  4IQA A;  2F9S A;  2F8F A;  3V1W A;  1XPV A;  4X43 A;  1GWC A;  1R7H A;  3AY8 A;  20GS A;  2X8H A;  3GUR A;  1X5C A;  1Z6N A;  3IAS 2;  1EGO A;  3RAZ A;  2M80 A;  2JL4 A;  5JWO B;  2PER A;  1XW5 A;  1XWK A;  1V98 A;  4DSQ A;  2O87 A;  1XZO A;  3ZL5 A;  2GZY A;  5A4W A;  2AUV A;  1A23 A;  1WJK A;  1AC1 A;  3TCO A;  1OKT A;  4XIH A;  3QAV A;  5HQP A;  1GTA A;  1SK0 A;  4KCE A;  3VLN A;  5DJL A;  1TU8 A;  2EIO A;  2JU5 A;  3Q18 A;  2VL3 A;  3TRQ A;  1SJ6 A;  5CYY A;  3UMA A;  1R5A A;  4PQI A;  1B48 A;  4JR4 A;  2WJU A;  1T4Z A;  2PVO C;  2B5E A;  1GUK A;  4YQV A;  5KN3 A;  4JU5 A;  4TXV A;  3FR9 A;  1QMV A;  2I3Y A;  1ERV A;  2HZE B;  2A2S A;  3F4S A;  2D2Z A;  1JZD A;  3GUS A;  3FW2 A;  1JZR A;  1HNC A;  2V2G A;  2B3S A;  2PGT A;  1YZX A;  1WRY A;  5CO3 A;  1YQ1 A;  2F3M A;  3JCM L;  2DJ2 A;  4ZB9 A;  2FWG A;  3HCZ A;  3RBT A;  2EIQ A;  3HYP A;  3DML A;  3W8J A;  3KZQ A;  5AIS A;  6GSS A;  2QKE A;  1MD3 A;  2IMK A;  2RM5 A;  3A3T A;  3HVV A;  2I9H A;  3KH9 A;  5G30 A;  1UC7 A;  1O6J A;  6GSX A;  1TK8 B;  1OC9 A;  2YP6 A;  2YN1 A;  1YF1 A;  1WPI A;  2H0H A;  1XOB A;  4I2T A;  2BMX A;  3U5R E;  4NHZ A;  3MDK A;  2FNO A;  4EDZ A;  4OFM A;  1G7O A;  5ECL B;  1BJX A;  2K8S A;  2J9H A;  1IYH A;  4L5O A;  5D9X A;  3TJJ A;  1OE8 A;  4V2M A;  1JLW A;  1JFU A;  3UBL A;  1SL2 B;  1DE2 A;  3HXS A;  4HJ2 A;  1I9D A;  2FA4 A;  4TR1 A;  4EVM A;  2DSA A;  3KTL A;  1VGL A;  2LNT A;  3QDN A;  1KEB A;  2LRC A;  1EOG A;  3ZFL A;  4ML6 A;  4KGI A;  3F4R A;  5HR3 A;  1PSQ A;  4G2E A;  1ZCP A;  3D4T A;  4Q5Q A;  1M2B A;  3M9J A;  2O7K A;  3L78 A;  5G1L A;  4DSR A;  4OCE A;  2HZE A;  2VL9 A;  1AQV A;  3HY2 A;  1U88 A;  5ELG A;  3WYW A;  1M9A A;  2C4J A;  3LEF A;  4MZB A;  3M0F A;  1ACV A;  2X8C A;  2CX4 A;  2XHF A;  4WBR D;  4O32 A;  2L5L A;  4EKZ A;  2NBS A;  4NXI A;  5DQY A;  4RUV A;  4L8E A;  4P3Y B;  1NM3 A;  1PRX A;  2PBJ A;  3H4K A;  5C04 A;  1TRW A;  2K6V A;  4K7N A;  3IA1 A;  1GTB A;  1AW9 A;  1GP1 A;  5KN0 A;  2C0E A;  2IJY A;  2LS5 A;  1JHB A;  3LQ7 A;  1RK4 A;  4N0Z A;  4I8B A;  1LJR A;  3BD2 A;  1A2M A;  2DLX A;  5J9B A;  2FLS A;  3FZ5 A;  18GS A;  4AGS A;  4Q5F A;  1PGT A;  2YAN A;  4IHU A;  3KXO A;  2R2J A;  2DJ0 A;  2H6X A;  2MBT A;  2C0G A;  1ZZY A;  3MNG A;  1Q4J A;  4F2I A;  1FG4 A;  3I9V 2;  3TJB A;  1BX9 A;  5KN2 A;  1X5D A;  1T8E B;  1THO A;  2HZF A;  1G7E A;  1W89 A;  2YWO A;  4K7O A;  2EIR A;  3EE2 A;  3GX0 A;  3W6G A;  4EXJ A;  2IWT A;  4X0X A;  3UJ1 A;  3IK7 A;  1V58 A;  1XFL A;  4Q5R A;  1K0D A;  2ON7 A;  4MLY A;  2H6Z A;  1BG5 A;  1TDI A;  3HVX A;  5GZZ B;  5COH A;  3GSS A;  3QCP A;  2B6M A;  1OAZ A;  2DIY A;  4OO4 A;  3ME8 A;  4CDO A;  3GH9 A;  4HI7 A;  2C0F A;  2GZP A;  4IS0 A;  3GA4 A;  2XC2 A;  1GTU A;  4DEJ A;  3TGZ A;  5IPG A;  5DJM A;  1ABA A;  1HD2 A;  4I97 A;  1SKW B;  3IV4 A;  1GUM A;  4ZIL A;  4I6X A;  5A4V A;  3FZ9 A;  3BOA A;  2YJH A;  4POM A;  2IPA A;  3CXG A;  4MPF A;  4E8H A;  3G7Y A;  1ZOF A;  4GF0 A;  2LUS A;  5CRE A;  1Z3E A;  3A2W A;  3VUR A;  3UBK A;  3TOU A;  5JWR B;  3RPN A;  1FVJ A;  3KD0 A;  1K3L A;  4MJA A;  1T3B A;  1K0N A;  3GKN A;  3M3M A;  3DRN A;  2V32 A;  2R37 A;  3G7J A;  5B7C A;  3KJY A;  4WR4 A;  1U87 A;  1FAA A;  5ENU A;  2KP2 A;  4MAB A;  1RW1 A;  2V6K A;  2WDU A;  3C8E A;  5D96 A;  1YEX A;  2H30 A;  5H5Q A;  4EE0 A;  1GH2 A;  4X1U A;  5D9W A;  5CP1 A;  3BJ5 A;  1K0M A;  1NHY A;  1TKD B;  5B6M A;  1M99 A;  3LSZ A;  2R5G A;  1ZGN A;  2N5F A;  3WGX A;  3CBU A;  1OYJ A;  4PNF A;  3US3 A;  2GQM A;  2OBI A;  1YKC A;  4ID0 A;  3UAR A;  3APS A;  2HE3 A;  4IJI A;  4NPB A;  5L71 A;  2DJ3 A;  2Z9S A;  5KN1 A;  2AAW A;  4MP4 A;  1MDK A;  2GT6 A;  4K0G A;  1H4O A;  3KEB A;  3GST A;  2AV4 A;  3RDW A;  5ECI B;  2JZS A;  2DC5 A;  3GKK A;  2LNS A;  4GSS A;  2VM1 A;  2VL2 A;  1GSE A;  2N5B A;  1B8X A;  1QGV A;  4F82 A;  3QFA C;  1X9W B;  1SU9 A;  3CMI A;  1TK5 B;  4HEA 2;  2KOK A;  7GSS A;  1VF1 A;  2YOI A;  1TK0 B;  3TJG A;  3HD5 A;  2VL2 C;  1FO5 A;  2CVD A;  12GS A;  3H93 A;  3PH9 A;  1USB A;  2C3T A;  2H1G A;  4PUA A;  3WGD A;  1DE1 A;  3HZ8 A;  17GS A;  1B9X C;  2O85 A;  2RII A;  1OC8 A;  1UA5 A;  2OKA A;  2OE3 A;  4RQX A;  1A24 A;  1GTI A;  3N9J A;  4NHW A;  1S3A A;  4KH7 A;  2A4V A;  6GST A;  2H19 A;  2B1K A;  3H79 A;  13GS A;  1RQM A;  3J7Y k;  1PD2 1;  4MDC A;  2DML A;  1FB0 A;  5EL8 A;  2K9F A;  1FHE A;  1WE0 A;  5J4U A;  3CYN A;  4MCU A;  3K8N A;  3WT1 A;  4N0V A;  3C71 A;  3GNJ A;  8GSS A;  2VO4 A;  3EU3 A;  1PKW A;  3TUE A;  4OFT A;  2WGR A;  3L9S A;  5GAP D;  3HDC A;  4TR4 A;  3ZRE A;  1ZYE A;  3ZVJ D;  1R26 A;  3I43 A;  1Z7P A;  4NAX A;  3H1N A;  2X64 A;  5IIZ A;  6GSU A;  5EVO A;  1TP9 A;  4IVF A;  4D73 B;  4GRF A;  3KM6 A;  2C3Q A;  2VCV A;  3CSI A;  3O3T A;  2PVQ A;  4HOJ A;  4FYB A;  2GSS A;  3DVX A;  1FVK A;  5CNW A;  22GS A;  2B5X A;  4EF0 A;  2H1A A;  1K3Y A;  3KMN A;  3WD6 A;  2WCI A;  1IYI A;  1X0R A;  2IFQ B;  3F8U A;  1M0U A;  3DIE A;  2WS2 A;  2YWI A;  1PL2 A;  5DVB A;  4MH2 A;  1W4V A;  5IMV A;  2RUF A;  4J56 E;  4GCI A;  1X9S B;  3PIN A;  2E2G A;  1U3A A;  3GKX A;  3L0H A;  1SK2 A;  3HJO A;  4K6X A;  3FY7 A;  2J23 A;  5GAN D;  2KHP A;  4KND A;  5D8I A;  1EZK A;  1TI3 A;  4LA1 A;  1TOF A;  1A8Y A;  4XTS A;  2PUK C;  1AUC A;  1HNB A;  3IBH A;  2MMN A;  2LQQ A;  4H86 A;  3IR4 A;  1VF3 A;  1O7U A;  3P2A A;  4BVY A;  4KSM A;  4WKW A;  3KH7 A;  1O81 A;  2M72 A;  3D6I A;  3SBC A;  1E6B A;  2YV9 A;  4ECB A;  1TRU A;  5AN1 A;  3CTF A;  4OD7 A;  3F6D A;  4BVX A;  2JZT A;  4MZW A;  2E7P A;  3KP9 A;  2P5Q A;  3GYK A;  4MK3 A;  3VWU A;  1PMT A;  2FCH A;  4ACS A;  16GS A;  4EC0 A;  2OAD A;  3KMO A;  2YWN A;  4TKY A;  1N8J A;  4OO5 A;  3HZ4 A;  5DCG A;  2H01 A;  1G0T A;  2L59 A;  2H76 A;  1VRS D;  2M46 A;  1THX A;  3CTG A;  1O85 A;  1AIU A;  1SJZ A;  1TU7 A;  2XPD A;  2ZNM A;  1F3B A;  1XWA A;  19GS A;  1KBN A;  4EO3 A;  3HJM A;  4LMW A;  1BYE A;  5DDL A;  2IFQ A;  1XW6 A;  3L4N A;  4KX4 A;  2N5A A;  5FT3 A;  14GS A;  2GST A;  5DQS A;  5F07 A;  5GST A;  3ZMK A;  3LWA A;  3GIX A;  4KB3 A;  4IGJ A;  1B4Q A;  4PGT A;  4HUA A;  3G7I A;  2TRC P;  3ERF A;  5EY6 A;  4POL A;  4IKH A;  3FHK A;  5DCH A;  4KDU A;  3DYR A;  3PGT A;  1GRX A;  3E3E A;  5INY A;  1YY7 A;  1Z9H A;  4MPG A;  3FK8 A;  3LYK A;  3GN3 A;  3RHB A;  6GSV A;  5D93 A;  5CRH A;  1F3A A;  3LGC A;  1GNW A;  2OE1 A;  3IPZ A;  2VUP A;  2KP1 A;  2NDO A;  2O8V B;  3ZLP A;  5ID2 B;  3F0I A;  4E8E A;  2B7K A;  4ZL9 A;  2L4Q A;  3NOF A;  4GXZ A;  3QOU A;  4YH2 A;  4IQ1 A;  3TKR A;  1O73 A;  2QGV A;  3C73 A;  2CV4 A;  1ML6 A;  4XS6 A;  3P8W A;  1QXH A;  2IMI A;  5B8B A;  2IIY A;  2YWM A;  2IN3 A;  2WB9 A;  2CZ2 A;  1ERW A;  2DJJ A;  4MJE A;  5CAX A;  1K0A A;  2VOC A;  5F8B A;  4EDY A;  2ON5 A;  2B5Y A;  1OE7 A;  4XS4 B;  5ECM B;  3ZFB A;  3GRX A;  3Q6O A;  1QUW A;  3FEU A;  5J5N A;  4FO5 A;  3TJF A;  3WGE A;  1URM A;  5FWG A;  1XCC A;  2FD3 A;  2LRN A;  4OMV A;  3QR6 A;  1R4W A;  1XWG A;  3GTU B;  4N11 A;  3ZTL A;  2R4V A;  1R5P A;  5G5E A;  3GL5 A;  2H8L A;  4KUN A;  4IBP A;  1M7T A; 
#chains in the Genus database with same CATH topology
 1LU4 A;  1O8X A;  4HZ2 A;  5H5R A;  3CSH A;  2R6K A;  5JCW A;  2GQK A;  4MJB A;  3ERW A;  4RI7 A;  3VPT A;  3O76 A;  3EMP A;  2XBQ A;  4DSS B;  1I5G A;  4V1A g;  2YZH A;  3M1G A;  3ISO A;  4OWY A;  2R0C A;  3LXZ A;  10GS A;  4O5U A;  3R2Q A;  2JSY A;  2OA7 A;  3GKM A;  3G9B A;  1H75 A;  1WMJ A;  2YPM A;  1XWC A;  1OKD A;  2V41 A;  2HSH A;  2FHE A;  1F6M C;  4ZXG A;  2CX3 A;  2PU9 C;  3VWV A;  2KLX A;  2YZU A;  2FY6 A;  3ZRD A;  2AYT A;  3IOS A;  4LL4 B;  1NHO A;  3FYG A;  2HT9 A;  3F4T A;  2TIR A;  3IHQ A;  4PQH A;  1T7P B;  1GUH A;  2MBS A;  3VK9 A;  1FOV A;  1SJI A;  2BTO T;  3UOM A;  2ES7 A;  2LV3 A;  3A5W A;  2LQO A;  2JAD A;  3QFB C;  3EVI A;  3MWH A;  4AJ6 A;  2I81 A;  1YDK A;  4OFN A;  1G6Y A;  1SL0 B;  4XS4 A;  5D73 A;  5HR1 A;  1SYX A;  1WWJ A;  5LCZ A;  1YF0 A;  1JZO A;  1SEN A;  1M2D A;  4NWY A;  2HNL A;  3EIN A;  2X8G A;  11GS A;  3VFI A;  1YJ6 A;  2P31 A;  5F05 A;  2QA2 A;  2GVP A;  4MJC A;  1GLP A;  5ECH B;  4ZL8 A;  3IRA A;  4JRR A;  4O5R A;  5B6N A;  1Z7R A;  3BBY A;  5CRG A;  4AJ8 A;  4TR0 A;  1E2Y A;  3QMX A;  1FW1 A;  2P5R A;  3IK9 A;  4LL1 B;  5KEJ A;  1MEK A;  3S9F A;  2L6C A;  4Q5N A;  1MTC A;  3MAK A;  3EU4 A;  1J0F A;  1F2E A;  3DKS A;  2HRN A;  4GWR A;  1V2A A;  1BAY A;  4MF6 A;  1V9W A;  3QAG A;  4JR6 A;  1A0R P;  2WRT A;  5IMZ A;  4DSS A;  2H66 A;  1EOH A;  4YQM A;  2NPB A;  3DEX A;  3TKP A;  2YNX A;  4O7H A;  3C1R A;  4HDE A;  3LXT A;  3KCM A;  1MDI A;  1SK1 A;  4LMV A;  2H74 A;  5D9V A;  2H73 A;  2F51 A;  2CT6 A;  1LBK A;  2A4H A;  5A4U A;  1KTE A;  2QA1 A;  2GDR A;  2L4C A;  3GMF A;  4GLT A;  4GTU A;  3IE3 A;  5EPF A;  4BPY A;  2DBC A;  4TR3 A;  3L9U A;  4TW5 A;  1EP8 A;  5ECQ B;  4MA9 A;  5D9T A;  1C72 A;  2MMO A;  1XBS A;  2I4A A;  4G9H A;  1EV4 A;  1WIK A;  2GTU A;  4KDX A;  3MSZ A;  1HYU A;  2E0Q A;  4ZBA A;  2CZ3 A;  2ZCT A;  1KNG A;  4KAE A;  3E0U A;  5HR2 A;  4NV2 A;  4HJM A;  4BA7 A;  4BL7 B;  1CQG A;  2MMZ A;  2OJL A;  4XS1 A;  1SKR B;  1MD4 A;  5JCG A;  1U3I A;  1GSS A;  1GSY A;  3Q19 A;  1Q98 A;  4KCA A;  2AJQ B;  3CQF A;  3TDG A;  3GL3 A;  2H0G A;  1QK8 A;  5ECS A;  1F9M A;  3W8S A;  2MYG A;  3GX8 A;  3GHA A;  2QC7 A;  3NZN A;  2O89 A;  1OC9 B;  2FA8 A;  2MMA A;  4FYC A;  3ZIJ A;  3ZML A;  4ILF A;  3EUR A;  1V40 A;  4DVC A;  4YAP A;  2VCW A;  1GUL A;  4WR5 A;  5GSS A;  3HA9 A;  2L6D A;  2PPT A;  1ERU A;  1JLV A;  2DMM A;  1AQX A;  1PX7 A;  1TJD A;  2GZZ A;  5IMC A;  3IDV A;  2L5O A;  3DGQ A;  4ICY A;  4L0W A;  5IOW A;  1O8W A;  1ZMA A;  1XWB A;  3TKQ A;  2V6O A;  1A2L A;  2VLU A;  4QL9 A;  1M9B A;  2RM6 A;  5BMU A;  5E4W A;  3IC4 A;  3BCI A;  3F3Q A;  2NTO A;  1YEP A;  4ML1 A;  2X99 A;  2VAF A;  3FR6 A;  2HYX A;  4KA0 A;  4TR1 B;  2FWE A;  4PNG A;  3HJP A;  1GLQ A;  4EL1 A;  4K0N A;  1MDJ A;  5DAK B;  3TJK A;  4KW6 A;  4ZIJ A;  2H70 A;  5C00 A;  4L0U A;  3O6T A;  2VCZ A;  5A5K A;  5FHI A;  1Y6E A;  3VI7 A;  4HU9 A;  5G5F A;  1HQO A;  4WET A;  3P90 A;  1X9M B;  1PA3 A;  2AB6 A;  4IP6 A;  4JZQ A;  2R3X A;  2TRX A;  1ZYN A;  3A2X A;  4TXO B;  5JWQ B;  4PUR A;  4BL7 A;  4TOP A;  1K3O A;  5ECK B;  3ZIT A;  3EMX A;  4OCF A;  3ME7 A;  3E9J B;  4IN0 A;  1X5E A;  2V1M A;  2DIZ A;  4HS1 A;  3OR5 A;  3FR3 A;  2FWF A;  3DWV A;  4X4J A;  1V57 A;  5IQY A;  2CAI A;  3I69 A;  2C3N A;  3IHG A;  3QAW A;  1T4Y A;  1J9B A;  4D73 A;  4I2U A;  3A2V A;  4KSO A;  4NMU A;  5IO0 A;  1J08 A;  1TTZ A;  3BCK A;  4K8M A;  4QL7 A;  2PWJ A;  3ZYW A;  4TVE A;  4YKF A;  3F63 A;  1QQ2 A;  2CVB A;  4JE1 A;  2C8U A;  2JSZ A;  2YCD A;  3SWL A;  2LTK A;  3F9U A;  1F37 A;  2GGT A;  4G19 A;  9GSS A;  4CW9 A;  1BED A;  4MMM A;  2GT5 A;  2L57 A;  4EUY A;  4Z2R A;  2HSY A;  3FZA A;  3DVW A;  3LG6 A;  3D22 A;  3KIJ A;  1U6T A;  4WF5 A;  4V2L A;  1PKZ A;  3EC3 A;  3NIV A;  1NSW A;  4F9Z A;  4LLR A;  3L9V A;  4NV5 A;  2A2P A;  4HZ4 A;  3ED3 A;  2LJA A;  2PN8 A;  5J3R A;  4K2X A;  3C1S A;  4WF4 A;  2ALB A;  5E59 A;  2C0D A;  4MF5 A;  1EEJ A;  5F06 A;  5DAK A;  2IL3 A;  1SL1 B;  3CRT A;  4CHS A;  1EEM A;  2IMF A;  5B8A A;  1VF2 A;  4FYU A;  1ZYQ B;  1Z6M A;  3HVS A;  3U6V A;  2B1L A;  4V2N A;  4K2D A;  4PQ1 A;  3HKR A;  2IMD A;  2A2R A;  3P7X A;  4F03 A;  3FZ4 A;  5J9C A;  2VLT A;  4TXO A;  1EV9 A;  2HFD A;  1ON4 A;  4PUF C;  3N5O A;  3ZZX A;  3J7Y b;  3UIW A;  1JZW A;  3F3R A;  4YQU A;  5AIX A;  4XHM A;  2H1D A;  4K9Z A;  4IEL A;  1OVN A;  4MNN A;  2VLV A;  4YAV A;  2E2M A;  2H0I A;  2R0P A;  5CRW A;  4FH8 A;  2VD1 A;  3ERG A;  4AJ7 A;  3DXB A;  2LRT A;  2VIM A;  3APQ A;  1B4P A;  1EP7 A;  5IPH A;  4FIW A;  1AXD A;  1VF4 A;  2CA8 A;  2CQ9 A;  4ISD A;  2PMT A;  3KP8 A;  3UL3 A;  4BWQ A;  5F0G A;  2VCT A;  3TOT A;  5JCU A;  4RI6 A;  1SD8 A;  1XOA A;  4RQR A;  3LJR A;  2VD0 A;  6GSY A;  3MYD A;  4ZB8 A;  2GSQ A;  4Z7X A;  1ERT A;  3VI5 A;  2GQL A;  1G6W A;  4ECJ A;  1TRV A;  3RPP A;  3FMW A;  1BQ7 A;  2EC4 A;  2H72 A;  2NVL A;  4BWS A;  1SD9 A;  2GLR A;  2CVK A;  5LNK e;  1SYR A;  4ZB6 A;  2K8V A;  5DBQ A;  2WUL A;  1K0O A;  2FUG 2;  1EGR A;  2XPE A;  2OBK A;  2H71 A;  2LJK A;  5HFG A;  1T1V A;  4QQ7 A;  3EWL A;  2B7J A;  3VWX A;  4F0C A;  3LFL A;  3APO A;  4ULX A;  1A0F A;  3FRC A;  1FOH A;  4POB A;  2YJ7 A;  4WXT A;  2F8A A;  1OC3 A;  3D0Z A;  3TRP A;  3VPQ A;  2P0G A;  4BIK A;  2DKH A;  2LST A;  2OAC A;  1TW9 A;  1ZL9 A;  5ELA A;  3DD3 A;  1XVW A;  2GSR A;  1WP0 A;  4KE3 A;  4GST A;  2HI7 A;  5ID2 A;  1SKS B;  2LJR A;  2REM A;  5HFK A;  3UVH A;  1FB6 A;  1T00 A;  4AF2 A;  1M2A A;  2R0G A;  3D21 A;  3UEM A;  1PL1 A;  4JED A;  1PN9 A;  5G31 A;  1GL8 A;  4O92 A;  5J41 A;  4J57 E;  2I1U A;  1XVQ A;  1WOU A;  5AGY A;  4J2F A;  2ZUP A;  3EYT A;  6GSW A;  1ILO A;  1AQW A;  4HU7 A;  4MH3 A;  4WEY A;  3WT2 A;  2VM2 A;  2IME A;  4F0B A;  4N10 A;  1XIY A;  2XBI A;  2G0F A;  1DBY A;  3FKF A;  4IW9 A;  2AHE A;  3QD9 A;  4ZBD A;  1NW2 A;  3GV1 A;  1HNA A;  5G2Z A;  3TRX A;  3RHC A;  5IMD A;  1N2A A;  5IOX A;  3LYP A;  2H6Y A;  3UVT A;  2OE0 A;  2KUC A;  3D4M A;  4POK A;  5IMF A;  1Y25 A;  1S3D A;  1S3C A;  1PN0 A;  3GTU A;  5DAL B;  4WBJ A;  4XRD A;  4MF7 A;  1B9Y C;  1AAZ A;  4JBB A;  3ZIV A;  1GSD A;  2H1B A;  3KTB A;  1PQN A;  4K5S A;  4GQC A;  3H8Q A;  2VCX A;  4K7I A;  2DJK A;  2JAC A;  3QPM A;  1Z5Y E;  5CRD A;  1TRS A;  1K0B A;  3C7M A;  2K18 A;  3I6A A;  2G2Q A;  4PX1 A;  2GS3 A;  3LOR A;  1YKA A;  1A8L A;  2LEG A;  1QFN A;  3M8N A;  3Q74 A;  5HFI A;  5G1K A;  1GSF A;  4G10 A;  1XW9 A;  4ZBB A;  3ZVJ A;  2WZ9 A;  2FGX A;  5IO2 A;  2FWH A;  3UAP A;  3F6F A;  1GNE A;  2RLI A;  5H5S A;  5ECN B;  2CAQ A;  4XCS A;  3TB2 A;  3GH6 A;  3MIX A;  2HRK A;  3GFK A;  5ABR A;  1CQH A;  1ST9 A;  3TKS A;  4MZC A;  4V1A p;  2HXK A;  4GSN A;  2JZR A;  4EIP A;  1UN2 A;  2DJ1 A;  2BJX A;  3M9K A;  4I5Q A;  1M3I A;  5ECP B;  5KOX A;  1GSQ A;  2C1Y A;  2HLS A;  4ZL7 A;  4HQS A;  2LKU A;  3D5J A;  2C80 A;  4TRX A;  1XXU A;  4N30 A;  4TN8 A;  4IP1 A;  5AIV A;  3KGK A;  3TKS C;  4PXO A;  3IXR A;  2WFC A;  1EWX A;  5IM9 A;  4GQF A;  2HRF A;  2QSI A;  1TI1 A;  4USS A;  1GSU A;  4L5L A;  4G0I A;  4G0L A;  1DUG A;  3PR8 A;  1UVZ A;  3IC8 A;  4XRA A;  5LD0 A;  4CY6 A;  4ECI A;  2UZ8 A;  2RUE A;  3VWW A;  5DAL A;  4Z2T A;  1A2J A;  2VCQ A;  5ECO B;  4BVY B;  3HHV A;  5ECR B;  4KDY A;  2MZC A;  5IMA A;  4HQZ A;  5HR0 A;  1K0C A;  1DSB A;  1PX6 A;  4ECC A;  1TXX A;  3CSJ A;  2H75 A;  2YV7 A;  4IJ3 A;  3IAM 2;  3CRU A;  4K1F A;  3TKS E;  4IQA A;  2F9S A;  2F8F A;  3V1W A;  1XPV A;  4X43 A;  1GWC A;  1R7H A;  3AY8 A;  20GS A;  2X8H A;  3GUR A;  1X5C A;  1Z6N A;  3IAS 2;  1EGO A;  3RAZ A;  2M80 A;  4YKG A;  2JL4 A;  5JWO B;  2PER A;  1XW5 A;  1XWK A;  1V98 A;  4DSQ A;  2O87 A;  1XZO A;  3ZL5 A;  2GZY A;  5A4W A;  2AUV A;  3LW9 A;  1A23 A;  1WJK A;  1AC1 A;  3TCO A;  1OKT A;  4XIH A;  3QAV A;  5HQP A;  3EPT A;  1GTA A;  1SK0 A;  4KCE A;  3VLN A;  5DJL A;  1TU8 A;  2EIO A;  2JU5 A;  3Q18 A;  2VL3 A;  3TRQ A;  1SJ6 A;  5CYY A;  3UMA A;  1R5A A;  5BRT A;  4PQI A;  1B48 A;  4JR4 A;  2WJU A;  1T4Z A;  2PVO C;  2B5E A;  1GUK A;  4YQV A;  5KN3 A;  4JU5 A;  4TXV A;  3FR9 A;  1QMV A;  2I3Y A;  1ERV A;  2HZE B;  2A2S A;  3F4S A;  2D2Z A;  1JZD A;  3GUS A;  3FW2 A;  1JZR A;  1HNC A;  2V2G A;  2B3S A;  2PGT A;  1YZX A;  1WRY A;  5CO3 A;  1YQ1 A;  2F3M A;  3JCM L;  2DJ2 A;  4ZB9 A;  2FWG A;  3HCZ A;  3RBT A;  2EIQ A;  3HYP A;  3DML A;  3W8J A;  3KZQ A;  5AIS A;  6GSS A;  2QKE A;  1MD3 A;  2IMK A;  2RM5 A;  3A3T A;  3HVV A;  2I9H A;  3KH9 A;  5G30 A;  1UC7 A;  1O6J A;  6GSX A;  1TK8 B;  1OC9 A;  2YP6 A;  2YN1 A;  1YF1 A;  1WPI A;  2H0H A;  1XOB A;  4I2T A;  2BMX A;  3U5R E;  4NHZ A;  3MDK A;  2FNO A;  4EDZ A;  4OFM A;  1G7O A;  5ECL B;  1BJX A;  2K8S A;  2J9H A;  1IYH A;  4L5O A;  4O5Q A;  5D9X A;  3TJJ A;  1OE8 A;  4V2M A;  1JLW A;  1JFU A;  3UBL A;  1SL2 B;  1DE2 A;  3HXS A;  4HJ2 A;  1I9D A;  2FA4 A;  4TR1 A;  4EVM A;  2DSA A;  3KTL A;  1VGL A;  2LNT A;  3QDN A;  1KEB A;  2LRC A;  1EOG A;  3ZFL A;  4ML6 A;  4KGI A;  3F4R A;  5HR3 A;  1PSQ A;  4G2E A;  1ZCP A;  3D4T A;  4Q5Q A;  1M2B A;  3M9J A;  2O7K A;  3L78 A;  5G1L A;  4DSR A;  4OCE A;  2HZE A;  2VL9 A;  1AQV A;  3HY2 A;  1U88 A;  5ELG A;  3WYW A;  1M9A A;  2C4J A;  3LEF A;  4MZB A;  3M0F A;  1ACV A;  2X8C A;  2CX4 A;  2XHF A;  4WBR D;  4O32 A;  2L5L A;  4EKZ A;  2NBS A;  4NXI A;  5DQY A;  4RUV A;  4L8E A;  4P3Y B;  1NM3 A;  1PRX A;  2PBJ A;  3H4K A;  5C04 A;  1TRW A;  2K6V A;  4K7N A;  3IA1 A;  1GTB A;  1AW9 A;  1GP1 A;  5KN0 A;  2C0E A;  2IJY A;  2LS5 A;  1JHB A;  3LQ7 A;  1RK4 A;  4N0Z A;  4I8B A;  1LJR A;  3BD2 A;  1A2M A;  2DLX A;  5J9B A;  2FLS A;  3FZ5 A;  18GS A;  4AGS A;  4Q5F A;  1PGT A;  2YAN A;  4IHU A;  3KXO A;  2R2J A;  2DJ0 A;  2H6X A;  2MBT A;  2C0G A;  1ZZY A;  3MNG A;  1Q4J A;  4Z2U A;  4F2I A;  1FG4 A;  1M3J A;  3I9V 2;  3TJB A;  1BX9 A;  5KN2 A;  1X5D A;  1T8E B;  1THO A;  2HZF A;  1G7E A;  1W89 A;  2YWO A;  4K7O A;  2EIR A;  3EE2 A;  3GX0 A;  1S3R A;  3W6G A;  4EXJ A;  2IWT A;  4X0X A;  3UJ1 A;  3IK7 A;  1V58 A;  1XFL A;  4Q5R A;  1K0D A;  2ON7 A;  4MLY A;  2H6Z A;  1BG5 A;  1TDI A;  3HVX A;  5GZZ B;  5COH A;  3GSS A;  3QCP A;  2B6M A;  1OAZ A;  2DIY A;  4OO4 A;  3ME8 A;  4CDO A;  3GH9 A;  4HI7 A;  2C0F A;  2GZP A;  4IS0 A;  3HVN A;  3GA4 A;  2XC2 A;  1GTU A;  4DEJ A;  3TGZ A;  5IPG A;  5DJM A;  1ABA A;  4PTS A;  1HD2 A;  4I97 A;  1SKW B;  3IV4 A;  4CY8 A;  1GUM A;  4ZIL A;  4I6X A;  5A4V A;  3FZ9 A;  3BOA A;  2YJH A;  4POM A;  2IPA A;  3CXG A;  4MPF A;  4E8H A;  3G7Y A;  1ZOF A;  4GF0 A;  2LUS A;  5CRE A;  1Z3E A;  3A2W A;  3VUR A;  4HSC X;  3UBK A;  3TOU A;  5JWR B;  3RPN A;  1FVJ A;  4EIQ A;  3KD0 A;  1K3L A;  3R3E A;  4MJA A;  1T3B A;  1K0N A;  3GKN A;  3M3M A;  3DRN A;  2V32 A;  2R37 A;  3G7J A;  5B7C A;  3KJY A;  4WR4 A;  1U87 A;  1FAA A;  5ENU A;  2KP2 A;  4MAB A;  5KOW A;  1RW1 A;  2V6K A;  2WDU A;  3C8E A;  5D96 A;  1YEX A;  2H30 A;  5H5Q A;  4EE0 A;  1GH2 A;  4X1U A;  5D9W A;  5CP1 A;  3BJ5 A;  1K0M A;  1NHY A;  1TKD B;  5B6M A;  1M99 A;  3LSZ A;  2R5G A;  1ZGN A;  2N5F A;  3WGX A;  3CBU A;  1OYJ A;  4PNF A;  3US3 A;  2GQM A;  2OBI A;  1YKC A;  4ID0 A;  3UAR A;  3APS A;  2HE3 A;  4IJI A;  4NPB A;  5L71 A;  2DJ3 A;  2Z9S A;  5KN1 A;  2AAW A;  4MP4 A;  1MDK A;  2GT6 A;  4K0G A;  1H4O A;  3KEB A;  3GST A;  2AV4 A;  3RDW A;  5ECI B;  2JZS A;  2DC5 A;  3GKK A;  2LNS A;  4GSS A;  2VM1 A;  2VL2 A;  1GSE A;  2N5B A;  1B8X A;  1QGV A;  4F82 A;  3QFA C;  1X9W B;  1SU9 A;  4K5R A;  4KF9 A;  3CMI A;  1TK5 B;  4HEA 2;  2KOK A;  7GSS A;  1VF1 A;  2YOI A;  1TK0 B;  3TJG A;  3HD5 A;  2VL2 C;  2HSM A;  1FO5 A;  2CVD A;  4G0K A;  12GS A;  3H93 A;  3PH9 A;  1USB A;  2C3T A;  2H1G A;  4PUA A;  3WGD A;  1DE1 A;  3HZ8 A;  17GS A;  1B9X C;  2O85 A;  2RII A;  1OC8 A;  1UA5 A;  2OKA A;  2OE3 A;  4RQX A;  1A24 A;  1GTI A;  3N9J A;  4NHW A;  1S3A A;  4KH7 A;  2A4V A;  6GST A;  2H19 A;  1ZYP A;  2B1K A;  3H79 A;  13GS A;  1RQM A;  3J7Y k;  1PD2 1;  4MDC A;  2DML A;  1FB0 A;  5EL8 A;  2K9F A;  1FHE A;  1WE0 A;  5J4U A;  3CYN A;  4MCU A;  3K8N A;  3WT1 A;  4N0V A;  3C71 A;  3GNJ A;  8GSS A;  4BVX B;  2VO4 A;  3EU3 A;  1PKW A;  3TUE A;  4OFT A;  2WGR A;  3L9S A;  5GAP D;  3HDC A;  4TR4 A;  3ZRE A;  1ZYE A;  3ZVJ D;  1R26 A;  3I43 A;  1Z7P A;  4NAX A;  3H1N A;  2X64 A;  5IIZ A;  6GSU A;  5EVO A;  1TP9 A;  4IVF A;  4D73 B;  4GRF A;  3KM6 A;  2C3Q A;  2VCV A;  3CSI A;  3O3T A;  2PVQ A;  4HOJ A;  4FYB A;  2GSS A;  3DVX A;  1FVK A;  5CNW A;  22GS A;  2B5X A;  4EF0 A;  2H1A A;  1K3Y A;  3KMN A;  3WD6 A;  2WCI A;  1IYI A;  1X0R A;  2IFQ B;  3F8U A;  1M0U A;  3DIE A;  2WS2 A;  2YWI A;  1PL2 A;  5DVB A;  4MH2 A;  1PFO A;  1W4V A;  5IMV A;  2RUF A;  4J56 E;  4GCI A;  1X9S B;  3PIN A;  2E2G A;  1U3A A;  3GKX A;  3L0H A;  1SK2 A;  3HJO A;  4K6X A;  3FY7 A;  2J23 A;  5GAN D;  2KHP A;  4KND A;  5D8I A;  1EZK A;  1TI3 A;  4LA1 A;  1TOF A;  1A8Y A;  4XTS A;  2PUK C;  1AUC A;  1HNB A;  3IBH A;  2MMN A;  2LQQ A;  4H86 A;  3IR4 A;  1VF3 A;  1O7U A;  3P2A A;  4BVY A;  4KSM A;  4WKW A;  3KH7 A;  1O81 A;  2M72 A;  3D6I A;  3SBC A;  1E6B A;  2HRA A;  2YV9 A;  4ECB A;  1TRU A;  5AN1 A;  2X4A A;  3CTF A;  4OD7 A;  3F6D A;  4BVX A;  2JZT A;  3PPU A;  4MZW A;  2E7P A;  3KP9 A;  2P5Q A;  3GYK A;  4MK3 A;  3VWU A;  1PMT A;  2FCH A;  4ACS A;  16GS A;  4EC0 A;  2OAD A;  3KMO A;  2DKI A;  2YWN A;  4TKY A;  1N8J A;  4OO5 A;  3HZ4 A;  5DCG A;  2H01 A;  1G0T A;  2L59 A;  2H76 A;  1VRS D;  2M46 A;  1THX A;  3CTG A;  3A5I A;  1O85 A;  1AIU A;  1SJZ A;  1TU7 A;  2XPD A;  2ZNM A;  1F3B A;  1XWA A;  19GS A;  1KBN A;  4EO3 A;  3HJM A;  4LMW A;  1BYE A;  5DDL A;  2IFQ A;  1XW6 A;  3L4N A;  4KX4 A;  2N5A A;  5FT3 A;  14GS A;  2GST A;  5DQS A;  5F07 A;  5GST A;  3ZMK A;  3LWA A;  3GIX A;  4KB3 A;  4IGJ A;  1B4Q A;  4PGT A;  4HUA A;  3G7I A;  2TRC P;  3ERF A;  5EY6 A;  4POL A;  4IKH A;  3FHK A;  5DCH A;  4KDU A;  3DYR A;  3PGT A;  1GRX A;  3E3E A;  5INY A;  1YY7 A;  1Z9H A;  4MPG A;  3FK8 A;  3LYK A;  3GN3 A;  3RHB A;  6GSV A;  5D93 A;  5CRH A;  1F3A A;  3LGC A;  1GNW A;  2OE1 A;  3IPZ A;  2VUP A;  2KP1 A;  2NDO A;  2O8V B;  3ZLP A;  5ID2 B;  3F0I A;  4E8E A;  2B7K A;  4ZL9 A;  2L4Q A;  3NOF A;  4GXZ A;  3QOU A;  4YH2 A;  4IQ1 A;  4FQU A;  3TKR A;  1O73 A;  2QGV A;  3C73 A;  2CV4 A;  1ML6 A;  4XS6 A;  3P8W A;  1QXH A;  2IMI A;  5B8B A;  2IIY A;  2YWM A;  2IN3 A;  2WB9 A;  1XG8 A;  2CZ2 A;  1ERW A;  2X49 A;  2DJJ A;  4MJE A;  5CAX A;  1K0A A;  2VOC A;  5F8B A;  4EDY A;  2ON5 A;  2B5Y A;  1OE7 A;  4XS4 B;  5ECM B;  3ZFB A;  3GRX A;  3Q6O A;  1QUW A;  3FEU A;  5J5N A;  4FO5 A;  3TJF A;  3WGE A;  1URM A;  5FWG A;  1XCC A;  2FD3 A;  2LRN A;  4OMV A;  3QR6 A;  1R4W A;  1XWG A;  3GTU B;  4N11 A;  3ZTL A;  2R4V A;  1R5P A;  5G5E A;  3GL5 A;  2H8L A;  4A5P A;  4KUN A;  4IBP A;  1M7T A; 
#chains in the Genus database with same CATH homology
 1LU4 A;  1O8X A;  4HZ2 A;  5H5R A;  3CSH A;  2R6K A;  5JCW A;  2GQK A;  4MJB A;  3ERW A;  4RI7 A;  3VPT A;  3O76 A;  3EMP A;  2XBQ A;  4DSS B;  1I5G A;  4V1A g;  2YZH A;  3M1G A;  3ISO A;  4OWY A;  2R0C A;  3LXZ A;  10GS A;  4O5U A;  3R2Q A;  2JSY A;  2OA7 A;  3GKM A;  3G9B A;  1H75 A;  1WMJ A;  2YPM A;  1XWC A;  1OKD A;  2V41 A;  2HSH A;  2FHE A;  1F6M C;  4ZXG A;  2CX3 A;  2PU9 C;  3VWV A;  2KLX A;  2YZU A;  2FY6 A;  3ZRD A;  2AYT A;  3IOS A;  4LL4 B;  1NHO A;  3FYG A;  2HT9 A;  3F4T A;  2TIR A;  3IHQ A;  4PQH A;  1T7P B;  1GUH A;  2MBS A;  3VK9 A;  1FOV A;  1SJI A;  2BTO T;  3UOM A;  2ES7 A;  2LV3 A;  3A5W A;  2LQO A;  2JAD A;  3QFB C;  3EVI A;  3MWH A;  4AJ6 A;  2I81 A;  1YDK A;  4OFN A;  1G6Y A;  1SL0 B;  4XS4 A;  5D73 A;  5HR1 A;  1SYX A;  1WWJ A;  5LCZ A;  1YF0 A;  1JZO A;  1SEN A;  1M2D A;  4NWY A;  2HNL A;  3EIN A;  2X8G A;  11GS A;  3VFI A;  1YJ6 A;  2P31 A;  5F05 A;  2QA2 A;  2GVP A;  4MJC A;  1GLP A;  5ECH B;  4ZL8 A;  3IRA A;  4JRR A;  4O5R A;  5B6N A;  1Z7R A;  3BBY A;  5CRG A;  4AJ8 A;  4TR0 A;  1E2Y A;  3QMX A;  1FW1 A;  2P5R A;  3IK9 A;  4LL1 B;  5KEJ A;  1MEK A;  3S9F A;  2L6C A;  4Q5N A;  1MTC A;  3MAK A;  3EU4 A;  1J0F A;  1F2E A;  3DKS A;  2HRN A;  4GWR A;  1V2A A;  1BAY A;  4MF6 A;  1V9W A;  3QAG A;  4JR6 A;  1A0R P;  2WRT A;  5IMZ A;  4DSS A;  2H66 A;  1EOH A;  4YQM A;  2NPB A;  3DEX A;  3TKP A;  2YNX A;  4O7H A;  3C1R A;  4HDE A;  3LXT A;  3KCM A;  1MDI A;  1SK1 A;  4LMV A;  2H74 A;  5D9V A;  2H73 A;  2F51 A;  2CT6 A;  1LBK A;  2A4H A;  5A4U A;  1KTE A;  2QA1 A;  2GDR A;  2L4C A;  3GMF A;  4GLT A;  4GTU A;  3IE3 A;  5EPF A;  4BPY A;  2DBC A;  4TR3 A;  3L9U A;  4TW5 A;  1EP8 A;  5ECQ B;  4MA9 A;  5D9T A;  1C72 A;  2MMO A;  1XBS A;  2I4A A;  4G9H A;  1EV4 A;  1WIK A;  2GTU A;  4KDX A;  3MSZ A;  1HYU A;  2E0Q A;  4ZBA A;  2CZ3 A;  2ZCT A;  1KNG A;  4KAE A;  3E0U A;  5HR2 A;  4NV2 A;  4HJM A;  4BA7 A;  4BL7 B;  1CQG A;  2MMZ A;  2OJL A;  4XS1 A;  1SKR B;  1MD4 A;  5JCG A;  1U3I A;  1GSS A;  1GSY A;  3Q19 A;  1Q98 A;  4KCA A;  2AJQ B;  3TDG A;  3GL3 A;  2H0G A;  1QK8 A;  5ECS A;  1F9M A;  3W8S A;  2MYG A;  3GX8 A;  3GHA A;  2QC7 A;  3NZN A;  2O89 A;  1OC9 B;  2FA8 A;  2MMA A;  4FYC A;  3ZIJ A;  3ZML A;  4ILF A;  3EUR A;  1V40 A;  4DVC A;  4YAP A;  2VCW A;  1GUL A;  4WR5 A;  5GSS A;  3HA9 A;  2L6D A;  2PPT A;  1ERU A;  1JLV A;  2DMM A;  1AQX A;  1PX7 A;  1TJD A;  2GZZ A;  5IMC A;  3IDV A;  2L5O A;  3DGQ A;  4ICY A;  4L0W A;  5IOW A;  1O8W A;  1ZMA A;  1XWB A;  3TKQ A;  2V6O A;  1A2L A;  2VLU A;  4QL9 A;  1M9B A;  2RM6 A;  5BMU A;  5E4W A;  3IC4 A;  3BCI A;  3F3Q A;  2NTO A;  1YEP A;  4ML1 A;  2X99 A;  2VAF A;  3FR6 A;  2HYX A;  4KA0 A;  4TR1 B;  2FWE A;  4PNG A;  3HJP A;  1GLQ A;  4EL1 A;  4K0N A;  1MDJ A;  5DAK B;  3TJK A;  4KW6 A;  4ZIJ A;  2H70 A;  5C00 A;  4L0U A;  3O6T A;  2VCZ A;  5A5K A;  5FHI A;  1Y6E A;  3VI7 A;  4HU9 A;  5G5F A;  1HQO A;  4WET A;  3P90 A;  1X9M B;  1PA3 A;  2AB6 A;  4IP6 A;  4JZQ A;  2R3X A;  2TRX A;  1ZYN A;  3A2X A;  4TXO B;  5JWQ B;  4PUR A;  4BL7 A;  4TOP A;  1K3O A;  5ECK B;  3ZIT A;  3EMX A;  4OCF A;  3ME7 A;  3E9J B;  4IN0 A;  1X5E A;  2V1M A;  2DIZ A;  4HS1 A;  3OR5 A;  3FR3 A;  2FWF A;  3DWV A;  4X4J A;  1V57 A;  5IQY A;  2CAI A;  3I69 A;  2C3N A;  3IHG A;  3QAW A;  1T4Y A;  1J9B A;  4D73 A;  4I2U A;  3A2V A;  4KSO A;  4NMU A;  5IO0 A;  1J08 A;  1TTZ A;  3BCK A;  4K8M A;  4QL7 A;  2PWJ A;  3ZYW A;  4TVE A;  4YKF A;  3F63 A;  1QQ2 A;  2CVB A;  4JE1 A;  2C8U A;  2JSZ A;  2YCD A;  3SWL A;  2LTK A;  3F9U A;  1F37 A;  2GGT A;  4G19 A;  9GSS A;  4CW9 A;  1BED A;  4MMM A;  2GT5 A;  2L57 A;  4EUY A;  4Z2R A;  2HSY A;  3FZA A;  3DVW A;  3LG6 A;  3D22 A;  3KIJ A;  1U6T A;  4WF5 A;  4V2L A;  1PKZ A;  3EC3 A;  3NIV A;  1NSW A;  4F9Z A;  4LLR A;  3L9V A;  4NV5 A;  2A2P A;  4HZ4 A;  3ED3 A;  2LJA A;  2PN8 A;  5J3R A;  4K2X A;  3C1S A;  4WF4 A;  2ALB A;  5E59 A;  2C0D A;  4MF5 A;  1EEJ A;  5F06 A;  5DAK A;  2IL3 A;  1SL1 B;  3CRT A;  4CHS A;  1EEM A;  2IMF A;  5B8A A;  1VF2 A;  4FYU A;  1ZYQ B;  1Z6M A;  3HVS A;  3U6V A;  2B1L A;  4V2N A;  4K2D A;  4PQ1 A;  3HKR A;  2IMD A;  2A2R A;  3P7X A;  4F03 A;  3FZ4 A;  5J9C A;  2VLT A;  4TXO A;  1EV9 A;  2HFD A;  1ON4 A;  4PUF C;  3N5O A;  3ZZX A;  3J7Y b;  3UIW A;  1JZW A;  3F3R A;  4YQU A;  5AIX A;  4XHM A;  2H1D A;  4K9Z A;  4IEL A;  1OVN A;  4MNN A;  2VLV A;  4YAV A;  2E2M A;  2H0I A;  2R0P A;  5CRW A;  4FH8 A;  2VD1 A;  3ERG A;  4AJ7 A;  3DXB A;  2LRT A;  2VIM A;  3APQ A;  1B4P A;  1EP7 A;  5IPH A;  4FIW A;  1AXD A;  1VF4 A;  2CA8 A;  2CQ9 A;  4ISD A;  2PMT A;  3KP8 A;  3UL3 A;  4BWQ A;  5F0G A;  2VCT A;  3TOT A;  5JCU A;  4RI6 A;  1SD8 A;  1XOA A;  4RQR A;  3LJR A;  2VD0 A;  6GSY A;  3MYD A;  4ZB8 A;  2GSQ A;  4Z7X A;  1ERT A;  3VI5 A;  2GQL A;  1G6W A;  4ECJ A;  1TRV A;  3RPP A;  3FMW A;  1BQ7 A;  2EC4 A;  2H72 A;  2NVL A;  4BWS A;  1SD9 A;  2GLR A;  2CVK A;  5LNK e;  1SYR A;  4ZB6 A;  2K8V A;  5DBQ A;  2WUL A;  1K0O A;  2FUG 2;  1EGR A;  2XPE A;  2OBK A;  2H71 A;  2LJK A;  5HFG A;  1T1V A;  4QQ7 A;  3EWL A;  2B7J A;  3VWX A;  4F0C A;  3LFL A;  3APO A;  4ULX A;  1A0F A;  3FRC A;  1FOH A;  4POB A;  2YJ7 A;  4WXT A;  2F8A A;  1OC3 A;  3D0Z A;  3TRP A;  3VPQ A;  2P0G A;  2DKH A;  2LST A;  2OAC A;  1TW9 A;  1ZL9 A;  5ELA A;  3DD3 A;  1XVW A;  2GSR A;  1WP0 A;  4KE3 A;  4GST A;  2HI7 A;  5ID2 A;  1SKS B;  2LJR A;  2REM A;  5HFK A;  3UVH A;  1FB6 A;  1T00 A;  4AF2 A;  1M2A A;  2R0G A;  3D21 A;  3UEM A;  1PL1 A;  4JED A;  1PN9 A;  5G31 A;  1GL8 A;  4O92 A;  5J41 A;  4J57 E;  2I1U A;  1XVQ A;  1WOU A;  5AGY A;  4J2F A;  2ZUP A;  3EYT A;  6GSW A;  1ILO A;  1AQW A;  4HU7 A;  4MH3 A;  4WEY A;  3WT2 A;  2VM2 A;  2IME A;  4F0B A;  4N10 A;  1XIY A;  2XBI A;  2G0F A;  1DBY A;  3FKF A;  4IW9 A;  2AHE A;  3QD9 A;  4ZBD A;  1NW2 A;  3GV1 A;  1HNA A;  5G2Z A;  3TRX A;  3RHC A;  5IMD A;  1N2A A;  5IOX A;  3LYP A;  2H6Y A;  3UVT A;  2OE0 A;  2KUC A;  3D4M A;  4POK A;  5IMF A;  1Y25 A;  1S3D A;  1S3C A;  1PN0 A;  3GTU A;  5DAL B;  4WBJ A;  4XRD A;  4MF7 A;  1B9Y C;  1AAZ A;  4JBB A;  3ZIV A;  1GSD A;  2H1B A;  3KTB A;  1PQN A;  4K5S A;  4GQC A;  3H8Q A;  2VCX A;  4K7I A;  2DJK A;  2JAC A;  3QPM A;  1Z5Y E;  5CRD A;  1TRS A;  1K0B A;  3C7M A;  2K18 A;  3I6A A;  2G2Q A;  4PX1 A;  2GS3 A;  3LOR A;  1YKA A;  1A8L A;  2LEG A;  1QFN A;  3M8N A;  3Q74 A;  5HFI A;  5G1K A;  1GSF A;  4G10 A;  1XW9 A;  4ZBB A;  3ZVJ A;  2WZ9 A;  2FGX A;  5IO2 A;  2FWH A;  3UAP A;  3F6F A;  1GNE A;  2RLI A;  5H5S A;  5ECN B;  2CAQ A;  4XCS A;  3TB2 A;  3GH6 A;  3MIX A;  2HRK A;  3GFK A;  5ABR A;  1CQH A;  1ST9 A;  3TKS A;  4MZC A;  4V1A p;  2HXK A;  4GSN A;  2JZR A;  4EIP A;  1UN2 A;  2DJ1 A;  2BJX A;  3M9K A;  4I5Q A;  5ECP B;  5KOX A;  1GSQ A;  2C1Y A;  2HLS A;  4ZL7 A;  4HQS A;  2LKU A;  3D5J A;  2C80 A;  4TRX A;  1XXU A;  4N30 A;  4TN8 A;  4IP1 A;  5AIV A;  3KGK A;  3TKS C;  4PXO A;  3IXR A;  2WFC A;  1EWX A;  5IM9 A;  4GQF A;  2HRF A;  2QSI A;  1TI1 A;  4USS A;  1GSU A;  4L5L A;  4G0I A;  4G0L A;  1DUG A;  3PR8 A;  1UVZ A;  3IC8 A;  4XRA A;  5LD0 A;  4CY6 A;  4ECI A;  2UZ8 A;  2RUE A;  3VWW A;  5DAL A;  4Z2T A;  1A2J A;  2VCQ A;  5ECO B;  4BVY B;  3HHV A;  5ECR B;  4KDY A;  2MZC A;  5IMA A;  4HQZ A;  5HR0 A;  1K0C A;  1DSB A;  1PX6 A;  4ECC A;  1TXX A;  3CSJ A;  2H75 A;  2YV7 A;  4IJ3 A;  3IAM 2;  3CRU A;  4K1F A;  3TKS E;  4IQA A;  2F9S A;  2F8F A;  3V1W A;  1XPV A;  4X43 A;  1GWC A;  1R7H A;  3AY8 A;  20GS A;  2X8H A;  3GUR A;  1X5C A;  1Z6N A;  3IAS 2;  1EGO A;  3RAZ A;  2M80 A;  4YKG A;  2JL4 A;  5JWO B;  2PER A;  1XW5 A;  1XWK A;  1V98 A;  4DSQ A;  2O87 A;  1XZO A;  3ZL5 A;  2GZY A;  5A4W A;  2AUV A;  3LW9 A;  1A23 A;  1WJK A;  1AC1 A;  3TCO A;  1OKT A;  4XIH A;  3QAV A;  5HQP A;  3EPT A;  1GTA A;  1SK0 A;  4KCE A;  3VLN A;  5DJL A;  1TU8 A;  2EIO A;  2JU5 A;  3Q18 A;  2VL3 A;  3TRQ A;  1SJ6 A;  5CYY A;  3UMA A;  1R5A A;  5BRT A;  4PQI A;  1B48 A;  4JR4 A;  2WJU A;  1T4Z A;  2PVO C;  2B5E A;  1GUK A;  4YQV A;  5KN3 A;  4JU5 A;  4TXV A;  3FR9 A;  1QMV A;  2I3Y A;  1ERV A;  2HZE B;  2A2S A;  3F4S A;  2D2Z A;  1JZD A;  3GUS A;  3FW2 A;  1JZR A;  1HNC A;  2V2G A;  2B3S A;  2PGT A;  1YZX A;  1WRY A;  5CO3 A;  1YQ1 A;  2F3M A;  3JCM L;  2DJ2 A;  4ZB9 A;  2FWG A;  3HCZ A;  3RBT A;  2EIQ A;  3HYP A;  3DML A;  3W8J A;  3KZQ A;  5AIS A;  6GSS A;  2QKE A;  1MD3 A;  2IMK A;  2RM5 A;  3A3T A;  3HVV A;  2I9H A;  3KH9 A;  5G30 A;  1UC7 A;  1O6J A;  6GSX A;  1TK8 B;  1OC9 A;  2YP6 A;  2YN1 A;  1YF1 A;  1WPI A;  2H0H A;  1XOB A;  4I2T A;  2BMX A;  3U5R E;  4NHZ A;  3MDK A;  2FNO A;  4EDZ A;  4OFM A;  1G7O A;  5ECL B;  1BJX A;  2K8S A;  2J9H A;  1IYH A;  4L5O A;  4O5Q A;  5D9X A;  3TJJ A;  1OE8 A;  4V2M A;  1JLW A;  1JFU A;  3UBL A;  1SL2 B;  1DE2 A;  3HXS A;  4HJ2 A;  1I9D A;  2FA4 A;  4TR1 A;  4EVM A;  2DSA A;  3KTL A;  1VGL A;  2LNT A;  3QDN A;  1KEB A;  2LRC A;  1EOG A;  3ZFL A;  4ML6 A;  4KGI A;  3F4R A;  5HR3 A;  1PSQ A;  4G2E A;  1ZCP A;  3D4T A;  4Q5Q A;  1M2B A;  3M9J A;  2O7K A;  3L78 A;  5G1L A;  4DSR A;  4OCE A;  2HZE A;  2VL9 A;  1AQV A;  3HY2 A;  1U88 A;  5ELG A;  3WYW A;  1M9A A;  2C4J A;  3LEF A;  4MZB A;  3M0F A;  1ACV A;  2X8C A;  2CX4 A;  2XHF A;  4WBR D;  4O32 A;  2L5L A;  4EKZ A;  2NBS A;  4NXI A;  5DQY A;  4RUV A;  4L8E A;  4P3Y B;  1NM3 A;  1PRX A;  2PBJ A;  3H4K A;  5C04 A;  1TRW A;  2K6V A;  4K7N A;  3IA1 A;  1GTB A;  1AW9 A;  1GP1 A;  5KN0 A;  2C0E A;  2IJY A;  2LS5 A;  1JHB A;  3LQ7 A;  1RK4 A;  4N0Z A;  4I8B A;  1LJR A;  3BD2 A;  1A2M A;  2DLX A;  5J9B A;  2FLS A;  3FZ5 A;  18GS A;  4AGS A;  4Q5F A;  1PGT A;  2YAN A;  4IHU A;  3KXO A;  2R2J A;  2DJ0 A;  2H6X A;  2MBT A;  2C0G A;  1ZZY A;  3MNG A;  1Q4J A;  4Z2U A;  4F2I A;  1FG4 A;  3I9V 2;  3TJB A;  1BX9 A;  5KN2 A;  1X5D A;  1T8E B;  1THO A;  2HZF A;  1G7E A;  1W89 A;  2YWO A;  4K7O A;  2EIR A;  3EE2 A;  3GX0 A;  3W6G A;  4EXJ A;  2IWT A;  4X0X A;  3UJ1 A;  3IK7 A;  1V58 A;  1XFL A;  4Q5R A;  1K0D A;  2ON7 A;  4MLY A;  2H6Z A;  1BG5 A;  1TDI A;  3HVX A;  5GZZ B;  5COH A;  3GSS A;  3QCP A;  2B6M A;  1OAZ A;  2DIY A;  4OO4 A;  3ME8 A;  4CDO A;  3GH9 A;  4HI7 A;  2C0F A;  2GZP A;  4IS0 A;  3GA4 A;  2XC2 A;  1GTU A;  4DEJ A;  3TGZ A;  5IPG A;  5DJM A;  1ABA A;  4PTS A;  1HD2 A;  4I97 A;  1SKW B;  3IV4 A;  4CY8 A;  1GUM A;  4ZIL A;  4I6X A;  5A4V A;  3FZ9 A;  3BOA A;  2YJH A;  4POM A;  2IPA A;  3CXG A;  4MPF A;  4E8H A;  3G7Y A;  1ZOF A;  4GF0 A;  2LUS A;  5CRE A;  1Z3E A;  3A2W A;  3VUR A;  3UBK A;  3TOU A;  5JWR B;  3RPN A;  1FVJ A;  4EIQ A;  3KD0 A;  1K3L A;  3R3E A;  4MJA A;  1T3B A;  1K0N A;  3GKN A;  3M3M A;  3DRN A;  2V32 A;  2R37 A;  3G7J A;  5B7C A;  3KJY A;  4WR4 A;  1U87 A;  1FAA A;  5ENU A;  2KP2 A;  4MAB A;  5KOW A;  1RW1 A;  2V6K A;  2WDU A;  3C8E A;  5D96 A;  1YEX A;  2H30 A;  5H5Q A;  4EE0 A;  1GH2 A;  4X1U A;  5D9W A;  5CP1 A;  3BJ5 A;  1K0M A;  1NHY A;  1TKD B;  5B6M A;  1M99 A;  3LSZ A;  2R5G A;  1ZGN A;  2N5F A;  3WGX A;  3CBU A;  1OYJ A;  4PNF A;  3US3 A;  2GQM A;  2OBI A;  1YKC A;  4ID0 A;  3UAR A;  3APS A;  2HE3 A;  4IJI A;  4NPB A;  5L71 A;  2DJ3 A;  2Z9S A;  5KN1 A;  2AAW A;  4MP4 A;  1MDK A;  2GT6 A;  4K0G A;  1H4O A;  3KEB A;  3GST A;  2AV4 A;  3RDW A;  5ECI B;  2JZS A;  2DC5 A;  3GKK A;  2LNS A;  4GSS A;  2VM1 A;  2VL2 A;  1GSE A;  2N5B A;  1B8X A;  1QGV A;  4F82 A;  3QFA C;  1X9W B;  1SU9 A;  4K5R A;  4KF9 A;  3CMI A;  1TK5 B;  4HEA 2;  2KOK A;  7GSS A;  1VF1 A;  2YOI A;  1TK0 B;  3TJG A;  3HD5 A;  2VL2 C;  2HSM A;  1FO5 A;  2CVD A;  4G0K A;  12GS A;  3H93 A;  3PH9 A;  1USB A;  2C3T A;  2H1G A;  4PUA A;  3WGD A;  1DE1 A;  3HZ8 A;  17GS A;  1B9X C;  2O85 A;  2RII A;  1OC8 A;  1UA5 A;  2OKA A;  2OE3 A;  4RQX A;  1A24 A;  1GTI A;  3N9J A;  4NHW A;  1S3A A;  4KH7 A;  2A4V A;  6GST A;  2H19 A;  1ZYP A;  2B1K A;  3H79 A;  13GS A;  1RQM A;  3J7Y k;  1PD2 1;  4MDC A;  2DML A;  1FB0 A;  5EL8 A;  2K9F A;  1FHE A;  1WE0 A;  5J4U A;  3CYN A;  4MCU A;  3K8N A;  3WT1 A;  4N0V A;  3C71 A;  3GNJ A;  8GSS A;  4BVX B;  2VO4 A;  3EU3 A;  1PKW A;  3TUE A;  4OFT A;  2WGR A;  3L9S A;  5GAP D;  3HDC A;  4TR4 A;  3ZRE A;  1ZYE A;  3ZVJ D;  1R26 A;  3I43 A;  1Z7P A;  4NAX A;  3H1N A;  2X64 A;  5IIZ A;  6GSU A;  5EVO A;  1TP9 A;  4IVF A;  4D73 B;  4GRF A;  3KM6 A;  2C3Q A;  2VCV A;  3CSI A;  3O3T A;  2PVQ A;  4HOJ A;  4FYB A;  2GSS A;  3DVX A;  1FVK A;  5CNW A;  22GS A;  2B5X A;  4EF0 A;  2H1A A;  1K3Y A;  3KMN A;  3WD6 A;  2WCI A;  1IYI A;  1X0R A;  2IFQ B;  3F8U A;  1M0U A;  3DIE A;  2WS2 A;  2YWI A;  1PL2 A;  5DVB A;  4MH2 A;  1W4V A;  5IMV A;  2RUF A;  4J56 E;  4GCI A;  1X9S B;  3PIN A;  2E2G A;  1U3A A;  3GKX A;  3L0H A;  1SK2 A;  3HJO A;  4K6X A;  3FY7 A;  2J23 A;  5GAN D;  2KHP A;  4KND A;  5D8I A;  1EZK A;  1TI3 A;  4LA1 A;  1TOF A;  1A8Y A;  4XTS A;  2PUK C;  1AUC A;  1HNB A;  3IBH A;  2MMN A;  2LQQ A;  4H86 A;  3IR4 A;  1VF3 A;  1O7U A;  3P2A A;  4BVY A;  4KSM A;  4WKW A;  3KH7 A;  1O81 A;  2M72 A;  3D6I A;  3SBC A;  1E6B A;  2HRA A;  2YV9 A;  4ECB A;  1TRU A;  5AN1 A;  2X4A A;  3CTF A;  4OD7 A;  3F6D A;  4BVX A;  2JZT A;  3PPU A;  4MZW A;  2E7P A;  3KP9 A;  2P5Q A;  3GYK A;  4MK3 A;  3VWU A;  1PMT A;  2FCH A;  4ACS A;  16GS A;  4EC0 A;  2OAD A;  3KMO A;  2DKI A;  2YWN A;  4TKY A;  1N8J A;  4OO5 A;  3HZ4 A;  5DCG A;  2H01 A;  1G0T A;  2L59 A;  2H76 A;  1VRS D;  2M46 A;  1THX A;  3CTG A;  3A5I A;  1O85 A;  1AIU A;  1SJZ A;  1TU7 A;  2XPD A;  2ZNM A;  1F3B A;  1XWA A;  19GS A;  1KBN A;  4EO3 A;  3HJM A;  4LMW A;  1BYE A;  5DDL A;  2IFQ A;  1XW6 A;  3L4N A;  4KX4 A;  2N5A A;  5FT3 A;  14GS A;  2GST A;  5DQS A;  5F07 A;  5GST A;  3ZMK A;  3LWA A;  3GIX A;  4KB3 A;  4IGJ A;  1B4Q A;  4PGT A;  4HUA A;  3G7I A;  2TRC P;  3ERF A;  5EY6 A;  4POL A;  4IKH A;  3FHK A;  5DCH A;  4KDU A;  3DYR A;  3PGT A;  1GRX A;  3E3E A;  5INY A;  1YY7 A;  1Z9H A;  4MPG A;  3FK8 A;  3LYK A;  3GN3 A;  3RHB A;  6GSV A;  5D93 A;  5CRH A;  1F3A A;  3LGC A;  1GNW A;  2OE1 A;  3IPZ A;  2VUP A;  2KP1 A;  2NDO A;  2O8V B;  3ZLP A;  5ID2 B;  3F0I A;  4E8E A;  2B7K A;  4ZL9 A;  2L4Q A;  3NOF A;  4GXZ A;  3QOU A;  4YH2 A;  4IQ1 A;  4FQU A;  3TKR A;  1O73 A;  2QGV A;  3C73 A;  2CV4 A;  1ML6 A;  4XS6 A;  3P8W A;  1QXH A;  2IMI A;  5B8B A;  2IIY A;  2YWM A;  2IN3 A;  2WB9 A;  2CZ2 A;  1ERW A;  2X49 A;  2DJJ A;  4MJE A;  5CAX A;  1K0A A;  2VOC A;  5F8B A;  4EDY A;  2ON5 A;  2B5Y A;  1OE7 A;  4XS4 B;  5ECM B;  3ZFB A;  3GRX A;  3Q6O A;  1QUW A;  3FEU A;  5J5N A;  4FO5 A;  3TJF A;  3WGE A;  1URM A;  5FWG A;  1XCC A;  2FD3 A;  2LRN A;  4OMV A;  3QR6 A;  1R4W A;  1XWG A;  3GTU B;  4N11 A;  3ZTL A;  2R4V A;  1R5P A;  5G5E A;  3GL5 A;  2H8L A;  4A5P A;  4KUN A;  4IBP A;  1M7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...