4GXZA

Crystal structure of a periplasmic thioredoxin-like protein from salmonella enterica serovar typhimurium
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
178
structure length
178
Chain Sequence
DQEKQIENLIHAALFNDPASPRIGAKHPKLTLVNFTDYNCPYCKQLDPMLEKIVQKYPDVAVIIKPLPFKGESSVLAARIALTTWREHPQQFLALHEKLMQKRVYHTDDSIKQAQQKAGATPVTLDEKSMETIRTNLQLARLVGVQGTPATIIGDELIPGAVPWDTLEAVVKEKLASA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Suppression of copper sensitivity protein
publication title Structural and functional characterization of ScsC, a periplasmic thioredoxin-like protein from Salmonella enterica serovar Typhimurium
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Isomerase
total genus 64
structure length 178
sequence length 178
chains with identical sequence B, C, D
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4gxzA00
1EP7A 3TB2A 3H79A 5B8AA 1OAZA 1LBKA 3LWAA 1U88A 3CYNA 1XOAA 3IK9A 2GGTA 3EU4A 3HVSA 4EC0A 3U5RE 2B5EA 3F8UA 3C1SA 5D96A 3H1NA 4HDEA 4P3YB 1ZL9A 4XIHA 3KMOA 2IIYA 4G19A 2QKEA 4ZBBA 1AQXA 3G7JA 4JE1A 4XRAA 3IOSA 2R2JA 1GLPA 5LCZA 2H6ZA 2LRTA 2N5AA 3TKSA 4I8BA 2L4QA 3NOFA 2GSQA 3IA1A 3IR4A 1Q4JA 1A24A 3PR8A 4WR5A 1MD3A 3W8JA 5CRDA 5ECOB 2BTOT 1SJZA 3QDNA 1THOA 1GSDA 1PQNA 2IMEA 1Z7RA 5E4WA 3EMXA 2VM1A 4GQFA 1PD21 2WDUA 3TJFA 4KGIA 2B6MA 4KB3A 3LQ7A 1EEJA 2JSZA 2AHEA 1TTZA 1IYHA 2VOCA 4MPGA 1M7TA 4MF6A 2B7JA 4K0NA 3LG6A 2H70A 2REMA 5DALA 4NHZA 2A2RA 2LJRA 5IMZA 5GAND 5AIVA 8GSSA 1GTUA 2GSTA 3US3A 2O85A 2GT5A 1GRXA 5G5EA 4WF5A 1VF1A 5CRHA 2DBCA 2PVOC 4HU9A 5IIZA 4RQXA 3EURA 4JBBA 2DIYA 3QPMA 1TP9A 3E3EA 4DSQA 1SKWB 3TUEA 2P5QA 4KSOA 5JCGA 4DSRA 1ZYQB 1OC8A 2WJUA 4MJAA 3VWWA 4XRDA 3FR9A 3M1GA 3RAZA 1JZWA 2ZUPA 4YH2A 4KCEA 5DJMA 4ILFA 3UARA 2IWTA 3HCZA 3CTFA 2IMFA 2VAFA 4J57E 5IO0A 2H72A 1GTBA 5EY6A 2KP2A 2H66A 1YEXA 5H5RA 1GULA 3C73A 3R2QA 4TR0A 2RM5A 1TDIA 1GUMA 3UJ1A 3GSSA 1X9WB 3SWLA 2YJHA 1K0BA 2FY6A 2YOIA 1K0CA 3IXRA 2VM2A 2ALBA 1B9YC 3M9KA 4TR1B 2KLXA 2FA4A 2R5GA 4O5RA 2RLIA 2AUVA 4POBA 4PNGA 1VGLA 2JZTA 1ERTA 4RI6A 2H0IA 1A0RP 3LORA 5C00A 4EF0A 1M9BA 5J9CA 4MZCA 5ID2B 4I97A 2OKAA 3F63A 3I43A 1K0DA 3EYTA 1E6BA 1WJKA 2WCIA 3A3TA 5LD0A 2A2SA 1K3LA 4HU7A 4ZXGA 2LQOA 2VL2A 4MZWA 1DE1A 3GFKA 4LL1B 2YWNA 4MJEA 5H5QA 1SJ6A 5DBQA 3GA4A 3TKPA 3UEMA 5G30A 2L57A 3GUSA 3KJYA 2H76A 1FB6A 3ZIJA 1FG4A 5CO3A 2RIIA 1SKRB 4ZL8A 1B8XA 3C1RA 3L4NA 2CVBA 2TRCP 1Y25A 1OVNA 3LYPA 5GAPD 1USBA 4KDXA 3APSA 1J9BA 3CXGA 3HZ8A 3HYPA 1B9XC 3IE3A 1N2AA 3BD2A 3FK8A 2C3NA 3TGZA 3TJJA 5EL8A 4IGJA 1PL2A 2FNOA 1FVJA 5IMFA 2CZ2A 1TU7A 4K8MA 1QMVA 5ECLB 4EVMA 2H1DA 2GLRA 1PRXA 3TOUA 4ACSA 5HFIA 1KBNA 5IQYA 2LJKA 1O8WA 5ECRB 4X1UA 3VWXA 4OFTA 5CRGA 4KSMA 2H30A 4OFMA 1AUCA 5ECHB 3GL3A 4GRFA 3RPPA 3TRXA 4K7OA 2YWMA 4FIWA 3PH9A 3ZTLA 4ZB8A 2EIQA 4WF4A 2H0HA 3QCPA 3GKXA 4EUYA 2H1GA 4O7HA 1T7PB 1UC7A 4GF0A 2O87A 1ST9A 3UOMA 2XC2A 1XZOA 2VL9A 3UL3A 2TIRA 1GL8A 5D9WA 3GKKA 4YQVA 2DSAA 1NHOA 1U87A 3GKNA 3ZMKA 2R3XA 4EDYA 1Y6EA 3UAPA 3BOAA 2LS5A 3QR6A 2WRTA 1BYEA 2CX4A 1TKDB 4OD7A 2I3YA 2PUKC 5F06A 3TKSE 1AAZA 2L6DA 1WOUA 2KOKA 2OACA 1O7UA 3DIEA 5J9BA 2LUSA 1YKAA 3HA9A 1XOBA 3TDGA 3GNJA 4FO5A 2LV3A 3DD3A 4OMVA 2KHPA 3F4TA 4H86A 4AF2A 4JEDA 1AXDA 3Q74A 2HZFA 2JACA 1BQ7A 4CDOA 2I1UA 1TI1A 2K9FA 1J08A 2FA8A 4G2EA 5EVOA 2NDOA 4HZ4A 2ZNMA 1M2BA 4XHMA 2N5BA 4GTUA 4BWSA 5A4WA 1XWGA 3ZIVA 3IAS2 2M72A 4X43A 4L5OA 3L78A 4HQSA 5D73A 3MDKA 4BL7A 3EU3A 1YF1A 3Q6OA 1YEPA 2GZZA 2F3MA 2VO4A 4LA1A 5DAKB 5GZZB 3C71A 4IHUA 3QAWA 5CRWA 2VCWA 2AB6A 3TKRA 3TRQA 3GX0A 2FGXA 5G2ZA 2XBIA 4YQMA 2CA8A 3F6FA 2PU9C 1U3AA 3DRNA 5ECPB 3ZREA 3LXTA 3O3TA 5J3RA 5ELAA 1WP0A 6GSTA 1T4ZA 3FR3A 4F9ZA 1K3YA 3CSJA 1QXHA 3J7Yk 3UIWA 2ES7A 2B1KA 3WGEA 5ENUA 2H01A 2BMXA 1EGOA 5ECKB 1G6WA 2IJYA 2R4VA 3TCOA 2YJ7A 3FR6A 3DXBA 1PGTA 1W4VA 1IYIA 4ZB6A 4HQZA 2C3QA 4POKA 1OC9A 4K7NA 3LJRA 4WR4A 3TKSC 4TXVA 1GSUA 3O76A 6GSWA 3IAM2 5CYYA 5EPFA 3FW2A 1Z6NA 2V32A 4QQ7A 4JR4A 4KNDA 3E9JB 1B4PA 1TRUA 2XBQA 1SD8A 1KNGA 1V98A 2MZCA 3N9JA 4NPBA 2JU5A 3MSZA 3FRCA 3VFIA 2M46A 4JZQA 3WGXA 2QGVA 1W89A 3KTLA 2P5RA 1AQVA 3FY7A 5AIXA 3KH7A 1QGVA 4PURA 1A2LA 4AJ6A 2YWOA 5KEJA 1MDJA 1PSQA 1X5DA 2J9HA 4IVFA 4QL7A 1R26A 4XTSA 1XXUA 5CREA 19GSA 2C1YA 2X8CA 1YDKA 1FHEA 3HHVA 2DMLA 2WFCA 3HXSA 3KIJA 2VL3A 4TVEA 1DBYA 2OADA 1SYXA 2FWGA 5D8IA 4KCAA 3ERGA 5DQYA 3KZQA 1ZOFA 2F8FA 4EL1A 2EC4A 1DE2A 1R7HA 2YN1A 3ZZXA 18GSA 1EWXA 1PKWA 3D5JA 3UBKA 4IQAA 1HD2A 1TK0B 1FOVA 2GQLA 2F9SA 3ZVJD 4KX4A 1E2YA 1JLWA 4MDCA 1BX9A 3LYKA 3UVHA 4BA7A 3EINA 3ZRDA 2WZ9A 1GSQA 2IMDA 1JHBA 4EDZA 4HI7A 5HFKA 5AISA 2HFDA 3L9SA 3P2AA 2HE3A 2CAIA 2D2ZA 2VIMA 3MWHA 2C0DA 3ED3A 2DJ1A 5G1KA 2O89A 3WT2A 3A2VA 4GSSA 1SKSB 3ZVJA 4MP4A 4XCSA 1FO5A 4KDUA 5GSSA 1T4YA 2GQKA 1B48A 5GSTA 1X9SB 2H75A 3QAGA 1I5GA 4N10A 4OFNA 1TU8A 1GUHA 2HZEB 3ZYWA 4L5LA 3GTUA 6GSSA 3QFBC 1HNBA 2VLVA 2GSSA 2YP6A 5IMVA 4I6XA 3WYWA 3CTGA 3DKSA 2FWFA 2MMZA 2VL2C 1HNAA 2WS2A 3MNGA 2AJQB 3VI5A 2C3TA 2HYXA 4PQHA 3P90A 3GN3A 1A23A 3WD6A 4IN0A 3LEFA 1O81A 1K0NA 5FT3A 9GSSA 3IBHA 1G6YA 4V1Ag 4YQUA 1M2AA 1S3AA 2HRFA 2YWIA 5KN0A 3WGDA 3ZFBA 3MAKA 1B4QA 2JL4A 1GUKA 4N30A 1ILOA 2HNLA 3G9BA 1XIYA 3D22A 1R4WA 1SJIA 1PN9A 2QSIA 4OO5A 1PL1A 3WT1A 2IPAA 5G5FA 2R6KA 2ON7A 2OE1A 3CRUA 3P7XA 3GSTA 1G0TA 3E0UA 1H4OA 1NHYA 2E0QA 4V2NA 4ECJA 4MJCA 2FD3A 2B5XA 4E8HA 2IFQB 1OC9B 4WXTA 4ZL7A 5IOWA 4HUAA 3LFLA 1GTIA 2OE0A 2VCVA 1N8JA 1LU4A 1GLQA 4O92A 2IMKA 5CP1A 3HJOA 1OC3A 3F0IA 2TRXA 4MPFA 2K8VA 3DMLA 1URMA 1K0AA 3APQA 1ZYEA 4HOJA 3VURA 3NIVA 1SL1B 4MH2A 4N0VA 4HJMA 2CVDA 2VLTA 5HR1A 4NMUA 3GH6A 1SU9A 3BBYA 1JZOA 1RW1A 1K0OA 2NVLA 1NM3A 1M0UA 3U6VA 4NWYA 12GSA 2NBSA 2H73A 2ON5A 3L9UA 1K0MA 4F82A 5D9VA 3F6DA 3VWUA 2CZ3A 1Z6MA 1U3IA 2YV9A 3ERFA 5E59A 1TRVA 3BJ5A 3SBCA 1M99A 1T3BA 1EOGA 2JZSA 1GWCA 1XW9A 3FYGA 2OJLA 1ERVA 1G7OA 1XW6A 3H8QA 2R37A 1VF2A 2P0GA 3IPZA 2YANA 2C80A 3UMAA 5ECMB 1AQWA 1WE0A 1VF4A 4GQCA 3HY2A 1TRWA 1FB0A 2FLSA 3ME7A 1JZRA 2LNTA 1ZCPA 3HVVA 3DVWA 3NZNA 3HVXA 3KP8A 2VUPA 3D0ZA 2DJ2A 2GDRA 5JCUA 2PGTA 3KD0A 1SK1A 1C72A 4D73A 2Z9SA 1ERWA 2XPDA 5IOXA 4F2IA 1JZDA 3FZ4A 2MMNA 3CSHA 1H75A 4L0UA 3F3RA 3IHQA 2H1BA 4OO4A 1FAAA 4MA9A 1CQHA 1PA3A 3DVXA 5DALB 2GS3A 1X5EA 5HR0A 2K6VA 2HRNA 4ECIA 1EV9A 5DCHA 2LEGA 5HFGA 2DJKA 1OKTA 5J41A 4K9ZA 2DMMA 1ON4A 1XBSA 1WPIA 1WIKA 1XPVA 4IKHA 4KUNA 1XW5A 1Z7PA 4MABA 2QC7A 1YY7A 1TI3A 4FYBA 3ME8A 4ML6A 2HSHA 4AJ8A 4OCEA 4Z7XA 4DSSA 3W8SA 3VPTA 1XCCA 2V41A 2AAWA 2I81A 3KMNA 1MDKA 1QQ2A 3VI7A 4ZB9A 2IL3A 3M0FA 2X8HA 11GSA 5KN2A 3IV4A 3ERWA 1TW9A 1V9WA 2OE3A 1FW1A 3M3MA 4TXOA 3TJBA 4K2DA 2LSTA 3G7YA 2VCQA 2L5OA 2RM6A 4HZ2A 2FWEA 3H4KA 4IBPA 4PGTA 3DEXA 3PGTA 2L59A 1BG5A 3I9V2 2LNSA 2FCHA 3LGCA 1SK0A 5F0GA 22GSA 4L0WA 1ML6A 4NV5A 2VLUA 1T00A 2VD1A 3O6TA 2KP1A 3FHKA 2OBIA 1WMJA 3H93A 2PERA 4YAPA 3FKFA 2JADA 2P31A 2OBKA 4POLA 2HI7A 2A4VA 2YNXA 3Q18A 5JWQB 1PX6A 3QAVA 2GQMA 1YF0A 4WEYA 3EVIA 1YQ1A 3UBLA 1PKZA 4IP6A 3TJGA 4LMWA 4IW9A 3A2XA 3LSZA 4LLRA 2V6KA 4TR1A 1EOHA 4K7IA 2KUCA 1MD4A 1TJDA 1OE8A 4BWQA 1WRYA 4EO3A 4MJBA 2YV7A 4K0GA 4IP1A 1UN2A 2WGRA 4OWYA 2X64A 4I2TA 4ML1A 3HDCA 1ERUA 2IN3A 2H19A 4PUAA 4GSNA 6GSVA 3FZAA 4RUVA 1EZKA 2PN8A 3IDVA 5DCGA 5KN1A 2NTOA 2V1MA 3IRAA 2MMOA 5IM9A 4NHWA 1Z9HA 1Z5YE 4TKYA 2LQQA 2LRNA 2C0GA 1HNCA 3GYKA 1RQMA 4MMMA 2VCTA 5D9TA 2C8UA 2PBJA 1S3DA 1BJXA 1XWBA 1UVZA 4D73B 1TOFA 1XWKA 4JRRA 4OCFA 1MEKA 1QFNA 4QL9A 5IPGA 17GSA 4RI7A 3GRXA 20GSA 4PXOA 3ZFLA 3M8NA 4F0CA 4TN8A 3A5WA 5ECIB 1YJ6A 1TK5B 1R5PA 4WBJA 1Z3EA 1EV4A 5IPHA 2GZPA 3QOUA 1GSYA 1F3BA 3KXOA 4XS1A 2XHFA 2GTUA 3S9FA 2XPEA 5ABRA 4K6XA 5B8BA 5IMAA 4AJ7A 2WB9A 4G10A 4HJ2A 2PWJA 2DLXA 2AYTA 3EWLA 1XWAA 1TXXA 5F07A 4DSSB 4ULXA 1XWCA 3G7IA 1Q98A 1NSWA 4ZBAA 3HJPA 1QK8A 2YZHA 5DDLA 4CHSA 5COHA 4ZL9A 4NAXA 1HYUA 2L4CA 1ZMAA 2CX3A 2O7KA 4Q5QA 3TRPA 5ECSA 14GSA 4MK3A 2ZCTA 3HZ4A 4XS4A 3C8EA 5JWOB 3RHCA 5AN1A 3QMXA 1GSFA 4TXOB 4KA0A 4F0BA 4NXIA 2RUEA 3KTBA 4PUFC 4EXJA 1ABAA 5DVBA 2C4JA 5D93A 5ELGA 1GNEA 2J23A 3V1WA 4JU5A 1X5CA 1UA5A 4ECBA 5HR2A 5ECQB 4DEJA 2E7PA 1SD9A 4G9HA 3CRTA 3DWVA 3C7MA 5JWRB 1BEDA 3GX8A 2F8AA 1YZXA 2X8GA 1V40A 2MBTA 1TK8B 2HSYA 1M9AA 1O6JA 5ECNB 4N11A 2DC5A 1F2EA 4V2LA 2BJXA 4K1FA 4KDYA 5G1LA 1F9MA 2WULA 3QD9A 2NPBA 2K8SA 4L8EA 2GSRA 3KGKA 4IJIA 1VRSD 3PINA 1VF3A 3FEUA 7GSSA 2CQ9A 2YZUA 2GT6A 3GV1A 1XVQA 2MYGA 3KCMA 5HQPA 4YAVA 1GSSA 3M9JA 3OR5A 2H0GA 5DAKA 4DVCA 1DUGA 3RHBA 4V2MA 4Q5FA 1DSBA 3D4TA 1CQGA 3I69A 4ZBDA 2K18A 3ZMLA 1M2DA 4EKZA 3HJMA 3EC3A 3QFAC 5A4VA 2EIRA 4KW6A 1R5AA 3P8WA 4BVXA 1O85A 1YKCA 1OKDA 1V58A 4N0ZA 3BCKA 1LJRA 1X0RA 2M80A 3KP9A 3EMPA 4NV2A 2L5LA 4WBRD 3ISOA 3TJKA 1PMTA 4PQ1A 2V2GA 1MTCA 2O8VB 4I5QA 2FUG2 2G0FA 5DQSA 3GH9A 1I9DA 3GIXA 1T1VA 1EEMA 3D6IA 1AIUA 2DJ3A 2FWHA 1A0FA 4KAEA 4TR3A 2I4AA 4TRXA 5HR3A 3F4RA 1ZZYA 1SK2A 2I9HA 2GVPA 3CBUA 4MH3A 4PNFA 2E2GA 3ZLPA 3TOTA 2H71A 1A8YA 4EE0A 5JCWA 3TKQA 4J56E 4IS0A 1AC1A 3EE2A 1EGRA 1G7EA 4AGSA 3HKRA 2B7KA 2JZRA 1OYJA 4BPYA 5H5SA 4IQ1A 2H6XA 5IO2A 5CAXA 2VCZA 1EP8A 1GH2A 2H74A 4O32A 1A2MA 5A4UA 3AY8A 3VPQA 1F6MC 4I2UA 3ZITA 4ZILA 4ID0A 2HXKA 4GCIA 2DJ0A 2MMAA 4WKWA 2C0FA 2JSYA 5J5NA 5FHIA 4BVYA 2RUFA 3ZL5A 1T8EB 3F9UA 1JLVA 6GSUA 4KH7A 3RDWA 5IMCA 1AW9A 4XS4B 1SENA 10GSA 4GWRA 1O8XA 3GTUB 5C04A 3GURA 4PX1A 2L6CA 3RBTA 1THXA 2N5FA 3I6AA 1X9MB 3JCML 1SL0B 5AGYA 1SYRA 2E2MA 3DYRA 4IELA 2EIOA 3GHAA 2YCDA 3BCIA 1SL2B 2CV4A 2FHEA 2F51A 4FH8A 5B6NA 2LKUA 5DJLA 4MF5A 4TOPA 2CT6A 2YPMA 4CW9A 2H6YA 2V6OA 1S3CA 3Q19A 3IK7A 3W6GA 2LJAA 5D9XA 3GMFA 4PQIA 3CMIA 2IMIA 2DIZA 3LXZA 4ZIJA 1GSEA 1TRSA 5J4UA 3J7Yb 4MZBA 4MCUA 1GNWA 2H8LA 4GSTA 3DGQA 4V1Ap 2PMTA 1A8LA 2VD0A 3F4SA 1MDIA 3HD5A 2LTKA 2HZEA 4ECCA 3KH9A 3KM6A 1ZGNA 1PX7A 1A2JA 3KEBA 4F03A 4HEA2 3L9VA 3VWVA 5INYA 1ACVA 2G2QA 2PPTA 3GKMA 5G31A 1RK4A 3A2WA 4LL4B 3VLNA 4TR4A 4WETA 4FYCA 1OE7A 2GZYA 3K8NA 4HS1A 1XVWA 3F3QA 3D21A 1O73A 3RPNA 4POMA 1BAYA 4Q5RA 4MF7A 1NW2A 5L71A 3FZ9A 2CVKA 5F8BA 1K3OA 4E8EA 4ISDA 2MBSA 3L0HA 3GL5A 2B1LA 1HQOA 4KE3A 4Q5NA 4X0XA 2AV4A 1JFUA 5LNKe 1GTAA 4RQRA 4JR6A 5A5KA 4TW5A 2VCXA 1F3AA 5B7CA 2OA7A 1GP1A 1WWJA 1V57A 2H1AA 3CSIA 5F05A 2PVQA 1XFLA 1V2AA 1KTEA 4MLYA 5ID2A 4J2FA 3APOA 16GSA 2IFQA 2LRCA 4GLTA 6GSYA 2HT9A 3VK9A 1QUWA 1KEBA 4IJ3A 2C0EA 5FWGA 2HLSA 4FYUA 1J0FA 5CNWA 5KN3A 2B3SA 1F37A 4XS6A 5B6MA 1U6TA 2CAQA 3D4MA 2X99A 2DJJA 6GSXA 3IC4A 2B5YA 4GXZA 3FZ5A 4LMVA 1FVKA 3N5OA 5IMDA 13GSA 3UVTA
chains in the Genus database with same CATH superfamily
1EP7A 3TB2A 3H79A 5B8AA 1OAZA 1LBKA 3LWAA 1U88A 3CYNA 1XOAA 3IK9A 2GGTA 3EU4A 3HVSA 4EC0A 3U5RE 2B5EA 3F8UA 3C1SA 4BVYB 5D96A 3H1NA 4HDEA 4P3YB 1ZL9A 4XIHA 3KMOA 2IIYA 4G19A 2QKEA 4ZBBA 1AQXA 3G7JA 4JE1A 4XRAA 3IOSA 2R2JA 1GLPA 5LCZA 2H6ZA 2LRTA 2N5AA 3TKSA 4I8BA 2L4QA 3NOFA 2GSQA 3IA1A 3IR4A 1Q4JA 1A24A 3PR8A 4WR5A 1MD3A 3W8JA 5CRDA 5ECOB 2BTOT 1SJZA 3QDNA 1THOA 1GSDA 1PQNA 2IMEA 1Z7RA 5E4WA 3EMXA 2VM1A 4GQFA 1PD21 2WDUA 3TJFA 4KGIA 2B6MA 4KB3A 3LQ7A 1EEJA 2JSZA 2AHEA 1TTZA 1IYHA 2VOCA 4MPGA 1M7TA 4MF6A 2B7JA 4K0NA 3LG6A 2H70A 2REMA 4NHZA 5DALA 2A2RA 2LJRA 5IMZA 5GAND 5AIVA 2X4AA 8GSSA 1GTUA 2GSTA 3US3A 2O85A 2GT5A 1GRXA 5G5EA 4WF5A 1VF1A 5CRHA 2DBCA 2PVOC 4HU9A 4K5SA 5IIZA 4RQXA 3EURA 4JBBA 2DIYA 3QPMA 1TP9A 3E3EA 4DSQA 1SKWB 3TUEA 2P5QA 4KSOA 5JCGA 4DSRA 1ZYQB 1OC8A 2WJUA 4MJAA 4K2XA 3VWWA 4XRDA 3FR9A 3M1GA 3RAZA 1JZWA 2ZUPA 4YH2A 4KCEA 5DJMA 4ILFA 3UARA 2IWTA 1M3JA 3HCZA 3CTFA 2IMFA 2VAFA 4J57E 5IO0A 2H72A 1GTBA 5EY6A 2KP2A 2H66A 1YEXA 5H5RA 1GULA 3C73A 3R2QA 4TR0A 2RM5A 1TDIA 1GUMA 3UJ1A 3GSSA 1X9WB 3SWLA 2YJHA 1K0BA 2FY6A 2YOIA 1K0CA 3IXRA 2VM2A 2ALBA 1B9YC 3M9KA 4TR1B 2KLXA 2FA4A 2R5GA 4O5RA 2RLIA 2AUVA 4POBA 4PNGA 1VGLA 2JZTA 1ERTA 4RI6A 2H0IA 1A0RP 3LORA 5C00A 4EF0A 1M9BA 5J9CA 4MZCA 5ID2B 4I97A 2DKHA 2OKAA 3F63A 3I43A 4HSCX 1K0DA 3EYTA 1E6BA 1WJKA 2WCIA 3A3TA 4CY6A 2UZ8A 5LD0A 2A2SA 1K3LA 4YKFA 4HU7A 2A2PA 4ZXGA 2LQOA 2VL2A 4MZWA 1DE1A 3GFKA 4LL1B 2YWNA 4MJEA 5H5QA 1SJ6A 5DBQA 3PPUA 3GA4A 3TKPA 3UEMA 5G30A 2L57A 3GUSA 3KJYA 2H76A 2R0CA 1FB6A 3ZIJA 1FG4A 5CO3A 2RIIA 1SKRB 4ZL8A 3IC8A 4G0KA 1B8XA 2R0GA 3C1RA 3L4NA 2CVBA 2TRCP 1Y25A 1OVNA 3LYPA 5GAPD 1USBA 4KDXA 3APSA 1J9BA 3CXGA 3HZ8A 3HYPA 1B9XC 3IE3A 1N2AA 3BD2A 3FK8A 2C3NA 3TGZA 3TJJA 5EL8A 4IGJA 1PL2A 2FNOA 1FVJA 5IMFA 2CZ2A 1TU7A 4K8MA 1QMVA 5ECLB 4EVMA 2H1DA 2GLRA 1PRXA 3TOUA 4ACSA 5HFIA 1KBNA 5IQYA 2LJKA 1O8WA 5ECRB 4X1UA 3VWXA 4OFTA 5CRGA 4KSMA 2H30A 3FMWA 4OFMA 1AUCA 5ECHB 3GL3A 4GRFA 3RPPA 3TRXA 4K7OA 2YWMA 4FIWA 3PH9A 3ZTLA 4ZB8A 2EIQA 4WF4A 2H0HA 3QCPA 3GKXA 4EUYA 2H1GA 4O7HA 1T7PB 1UC7A 4GF0A 2O87A 1ST9A 3UOMA 4A5PA 2XC2A 1XZOA 2VL9A 3UL3A 2TIRA 1GL8A 5D9WA 4MNNA 3GKKA 4YQVA 2DSAA 1NHOA 1U87A 3GKNA 3A5IA 3ZMKA 2R3XA 4EDYA 1Y6EA 3UAPA 3BOAA 2LS5A 3QR6A 2WRTA 1BYEA 2CX4A 1TKDB 4OD7A 2I3YA 2PUKC 5F06A 3TKSE 1AAZA 2L6DA 1WOUA 2KOKA 2OACA 1O7UA 3DIEA 3MYDA 5J9BA 2LUSA 1YKAA 3HA9A 1XOBA 3TDGA 3GNJA 4FO5A 2LV3A 3DD3A 4OMVA 2KHPA 3F4TA 4H86A 4AF2A 4X4JA 4JEDA 1AXDA 3Q74A 2HZFA 2JACA 1BQ7A 4CDOA 2I1UA 1TI1A 2K9FA 1J08A 2FA8A 4G2EA 5EVOA 2NDOA 4HZ4A 2ZNMA 1M2BA 4XHMA 2N5BA 4GTUA 4BWSA 5A4WA 1XWGA 3ZIVA 3IAS2 2M72A 4X43A 4L5OA 3L78A 4HQSA 5D73A 3MDKA 4BL7A 3EU3A 1YF1A 3Q6OA 1YEPA 2GZZA 2F3MA 2VO4A 4LA1A 5DAKB 5GZZB 3C71A 4IHUA 3QAWA 5CRWA 2VCWA 2AB6A 3TKRA 3TRQA 3GX0A 2FGXA 5G2ZA 4YKGA 2XBIA 4YQMA 2CA8A 3F6FA 4EIQA 2PU9C 1U3AA 3DRNA 5ECPB 3ZREA 3LXTA 3O3TA 5J3RA 5ELAA 1WP0A 6GSTA 1T4ZA 3FR3A 4F9ZA 1K3YA 3CSJA 1QXHA 3J7Yk 3UIWA 2ES7A 2B1KA 3WGEA 5ENUA 2H01A 2BMXA 1EGOA 5ECKB 1G6WA 2IJYA 2R4VA 3TCOA 2YJ7A 3FR6A 3DXBA 1PGTA 1W4VA 1IYIA 4ZB6A 4HQZA 2C3QA 4POKA 1OC9A 4K7NA 3LJRA 4WR4A 3TKSC 4TXVA 1GSUA 3O76A 6GSWA 3IAM2 5CYYA 5EPFA 3FW2A 1Z6NA 2V32A 4QQ7A 4JR4A 4KNDA 3E9JB 1B4PA 1TRUA 2XBQA 1SD8A 1KNGA 1V98A 2MZCA 3N9JA 4NPBA 2JU5A 3MSZA 3FRCA 3VFIA 2M46A 4JZQA 3WGXA 2QGVA 1W89A 3KTLA 2P5RA 1AQVA 3FY7A 1M3IA 5AIXA 3KH7A 1QGVA 4PURA 1A2LA 4AJ6A 2YWOA 5KEJA 1MDJA 1PSQA 1X5DA 2J9HA 4IVFA 4QL7A 1R26A 4XTSA 1XXUA 5CREA 4G0IA 19GSA 2C1YA 2X8CA 1YDKA 1FHEA 3HHVA 2DMLA 2WFCA 2A4HA 3HXSA 2HSMA 3KIJA 2VL3A 4TVEA 1DBYA 2OADA 1SYXA 2FWGA 5D8IA 4KCAA 3ERGA 5DQYA 3KZQA 1ZOFA 4USSA 2F8FA 4EL1A 2EC4A 1DE2A 1R7HA 2YN1A 3ZZXA 18GSA 1EWXA 1PKWA 3D5JA 3UBKA 4IQAA 1HD2A 1TK0B 3IHGA 1FOVA 2GQLA 2F9SA 3ZVJD 4O5QA 4KX4A 1E2YA 1JLWA 3LW9A 4MDCA 1BX9A 3LYKA 3UVHA 4BA7A 3EINA 3ZRDA 2WZ9A 1GSQA 2IMDA 1JHBA 4EDZA 4HI7A 5HFKA 4FQUA 5AISA 2HFDA 3L9SA 3P2AA 2HE3A 2CAIA 2D2ZA 2VIMA 3MWHA 2C0DA 3ED3A 2DJ1A 5G1KA 2O89A 3WT2A 3A2VA 4GSSA 1SKSB 3ZVJA 4MP4A 4XCSA 1FO5A 4KDUA 5GSSA 1T4YA 2GQKA 1B48A 5GSTA 1X9SB 2H75A 3QAGA 1I5GA 4N10A 4OFNA 1TU8A 1GUHA 2HZEB 3ZYWA 4L5LA 3GTUA 6GSSA 3QFBC 4BL7B 1HNBA 2VLVA 2GSSA 2YP6A 5IMVA 4I6XA 3WYWA 3CTGA 3DKSA 2FWFA 2MMZA 2VL2C 1HNAA 2WS2A 3MNGA 2AJQB 3VI5A 2C3TA 2HYXA 4PQHA 3P90A 3GN3A 1A23A 3WD6A 4IN0A 3LEFA 1O81A 1K0NA 5FT3A 9GSSA 3IBHA 1G6YA 4V1Ag 4YQUA 1M2AA 1S3AA 2HRFA 2YWIA 5KN0A 3WGDA 3ZFBA 3MAKA 1B4QA 2JL4A 1GUKA 4ICYA 4N30A 1ILOA 2HNLA 3G9BA 1XIYA 3D22A 4Z2RA 1R4WA 1SJIA 1PN9A 2QSIA 4OO5A 1PL1A 3WT1A 1ZYNA 2IPAA 5G5FA 2R6KA 2ON7A 2OE1A 3CRUA 3P7XA 3GSTA 1G0TA 3E0UA 1H4OA 1NHYA 2E0QA 4V2NA 4ECJA 4MJCA 2FD3A 2B5XA 4E8HA 2IFQB 1OC9B 4WXTA 4ZL7A 5IOWA 4HUAA 3LFLA 1GTIA 2OE0A 2VCVA 1N8JA 1LU4A 1GLQA 4O92A 2IMKA 5CP1A 3HJOA 1OC3A 3F0IA 2TRXA 4MPFA 2K8VA 3DMLA 1URMA 1K0AA 3APQA 1ZYEA 4HOJA 3VURA 3NIVA 1SL1B 4MH2A 4N0VA 4HJMA 2CVDA 2VLTA 2QA2A 5HR1A 4NMUA 3GH6A 1SU9A 3BBYA 1JZOA 1RW1A 1K0OA 2NVLA 1NM3A 1M0UA 3U6VA 4NWYA 12GSA 2NBSA 2H73A 2ON5A 3L9UA 1K0MA 4F82A 5D9VA 3F6DA 3VWUA 2CZ3A 1Z6MA 1U3IA 2YV9A 3ERFA 5E59A 1TRVA 3BJ5A 3SBCA 3CQFA 1M99A 1T3BA 1EOGA 2JZSA 1GWCA 1XW9A 3FYGA 2OJLA 1ERVA 1G7OA 1XW6A 3H8QA 2R37A 1VF2A 2P0GA 3IPZA 5BMUA 2YANA 2C80A 3UMAA 5ECMB 1AQWA 1WE0A 1VF4A 4GQCA 3HY2A 1TRWA 1FB0A 2FLSA 3ME7A 1JZRA 2LNTA 1ZCPA 3HVVA 3DVWA 3NZNA 3HVXA 3KP8A 2VUPA 3D0ZA 2DJ2A 2GDRA 5JCUA 2PGTA 3KD0A 1SK1A 1C72A 4D73A 2Z9SA 1ERWA 2XPDA 5IOXA 4F2IA 1JZDA 3FZ4A 2MMNA 3CSHA 1H75A 4L0UA 3F3RA 3IHQA 2H1BA 4OO4A 1FAAA 4MA9A 1CQHA 1PA3A 3DVXA 4PTSA 5DALB 2GS3A 1X5EA 5HR0A 2K6VA 2HRNA 4ECIA 1EV9A 5DCHA 2LEGA 5HFGA 2DJKA 1OKTA 5J41A 4K9ZA 2DMMA 1ON4A 1XBSA 1WPIA 1WIKA 1XPVA 4IKHA 4KUNA 1XW5A 1Z7PA 4MABA 2QC7A 1YY7A 1TI3A 4FYBA 3ME8A 4ML6A 2HSHA 4AJ8A 4OCEA 4Z7XA 4DSSA 3W8SA 3VPTA 1XCCA 2V41A 2AAWA 2I81A 3KMNA 1MDKA 1QQ2A 3VI7A 4ZB9A 2IL3A 3M0FA 2X8HA 11GSA 5KN2A 3IV4A 3ERWA 1TW9A 1V9WA 2OE3A 1FW1A 3M3MA 4TXOA 3TJBA 4K2DA 2LSTA 3G7YA 2VCQA 2L5OA 2RM6A 4HZ2A 2FWEA 3H4KA 4IBPA 4PGTA 3DEXA 3PGTA 2L59A 1BG5A 3I9V2 2LNSA 2FCHA 3LGCA 1SK0A 5F0GA 22GSA 4L0WA 1ML6A 4NV5A 2VLUA 1T00A 2VD1A 3O6TA 2KP1A 3FHKA 2OBIA 1WMJA 3H93A 2PERA 4YAPA 3FKFA 2JADA 2P31A 2OBKA 4POLA 2HI7A 2A4VA 2YNXA 3Q18A 5JWQB 1PX6A 3QAVA 2GQMA 1YF0A 4WEYA 1XG8A 3EVIA 1YQ1A 3UBLA 1PKZA 4IP6A 3TJGA 4LMWA 4IW9A 3A2XA 3LSZA 4LLRA 2V6KA 2DKIA 4TR1A 1EOHA 4K7IA 2KUCA 1MD4A 1TJDA 1OE8A 4BWQA 1WRYA 4EO3A 4MJBA 2YV7A 4K0GA 4IP1A 1UN2A 2WGRA 4OWYA 2X64A 4I2TA 4ML1A 3HDCA 1ERUA 2IN3A 2H19A 4PUAA 4GSNA 6GSVA 3FZAA 4RUVA 1EZKA 2PN8A 3IDVA 5DCGA 5KN1A 2NTOA 2V1MA 3IRAA 2MMOA 2R0PA 5IM9A 4NHWA 1Z9HA 2HRAA 1Z5YE 4TKYA 2LQQA 2LRNA 2C0GA 1HNCA 3GYKA 1RQMA 2HRKA 4MMMA 2VCTA 5D9TA 2C8UA 2PBJA 1S3DA 1BJXA 1XWBA 1UVZA 4D73B 1TOFA 1XWKA 4JRRA 4OCFA 5BRTA 4EIPA 1MEKA 1QFNA 4QL9A 5IPGA 17GSA 4K5RA 4RI7A 3GRXA 20GSA 4PXOA 3ZFLA 3M8NA 4F0CA 4TN8A 3A5WA 4CY8A 5ECIB 1YJ6A 1TK5B 1R5PA 4WBJA 1Z3EA 1EV4A 5IPHA 2GZPA 3QOUA 1GSYA 1F3BA 3KXOA 4XS1A 4BIKA 2XHFA 2GTUA 3S9FA 2XPEA 5ABRA 4K6XA 5B8BA 5IMAA 4AJ7A 2WB9A 4G10A 4HJ2A 2PWJA 2DLXA 2AYTA 3EWLA 1XWAA 1TXXA 5F07A 4DSSB 4ULXA 1XWCA 3G7IA 1Q98A 1NSWA 4ZBAA 3HJPA 1QK8A 2YZHA 5DDLA 4CHSA 5COHA 4ZL9A 4NAXA 1HYUA 2L4CA 1ZMAA 2CX3A 2O7KA 4Q5QA 3TRPA 1PN0A 5ECSA 14GSA 4MK3A 2ZCTA 3HZ4A 4XS4A 3C8EA 3MIXA 3RHCA 5JWOB 5AN1A 3QMXA 1GSFA 4TXOB 4KA0A 4F0BA 4NXIA 3HVNA 2RUEA 3KTBA 4PUFC 4EXJA 1ABAA 5DVBA 2C4JA 5D93A 5ELGA 1GNEA 2J23A 3V1WA 4JU5A 1X5CA 1UA5A 4ECBA 5HR2A 5ECQB 4DEJA 2E7PA 1SD9A 4G9HA 3CRTA 3DWVA 3C7MA 5JWRB 1BEDA 3GX8A 2F8AA 1YZXA 2X8GA 1V40A 2MBTA 1ZYPA 1TK8B 2HSYA 1M9AA 1O6JA 5ECNB 4N11A 5KOWA 2DC5A 1F2EA 4V2LA 2BJXA 4K1FA 4KDYA 5G1LA 1F9MA 2WULA 3QD9A 2NPBA 2K8SA 4L8EA 2GSRA 3KGKA 1PFOA 4IJIA 1VRSD 3PINA 1VF3A 3FEUA 7GSSA 2CQ9A 2YZUA 2GT6A 3GV1A 1XVQA 2MYGA 3KCMA 5HQPA 4YAVA 1GSSA 3M9JA 3OR5A 2H0GA 5DAKA 4DVCA 1DUGA 3RHBA 4V2MA 4Q5FA 1DSBA 3D4TA 1CQGA 3I69A 4ZBDA 2K18A 3ZMLA 1M2DA 4EKZA 3HJMA 3EC3A 3QFAC 5A4VA 2EIRA 4KW6A 1R5AA 3P8WA 4BVXA 1O85A 1YKCA 1OKDA 1V58A 4N0ZA 3BCKA 1LJRA 1X0RA 2M80A 3KP9A 3EMPA 4NV2A 4Z2UA 2L5LA 4WBRD 3ISOA 3TJKA 1PMTA 4PQ1A 2V2GA 1MTCA 2O8VB 4I5QA 2FUG2 2G0FA 5DQSA 3GH9A 1I9DA 3GIXA 1T1VA 1EEMA 3D6IA 1AIUA 2DJ3A 2FWHA 1A0FA 2QA1A 4KAEA 4TR3A 2I4AA 4TRXA 5HR3A 3F4RA 1ZZYA 1SK2A 2I9HA 2GVPA 3CBUA 4MH3A 4PNFA 2E2GA 3ZLPA 3TOTA 2H71A 1A8YA 4EE0A 5JCWA 3TKQA 4J56E 4IS0A 1AC1A 3EE2A 1EGRA 1G7EA 4AGSA 3HKRA 2B7KA 2JZRA 1OYJA 4BPYA 5H5SA 4IQ1A 2H6XA 5IO2A 5CAXA 2VCZA 1EP8A 1GH2A 2H74A 4O32A 1FOHA 1A2MA 5A4UA 3AY8A 3VPQA 1F6MC 4I2UA 3ZITA 4ZILA 4ID0A 2HXKA 4GCIA 2DJ0A 2MMAA 4WKWA 2C0FA 2JSYA 5J5NA 5FHIA 4BVYA 2RUFA 3ZL5A 1T8EB 3F9UA 1JLVA 6GSUA 4KH7A 3RDWA 5IMCA 1AW9A 4XS4B 1SENA 10GSA 4GWRA 1O8XA 3GTUB 5C04A 3GURA 4PX1A 2L6CA 3RBTA 1THXA 2N5FA 3I6AA 1X9MB 3EPTA 3JCML 1SL0B 2X49A 5AGYA 1SYRA 2E2MA 3DYRA 4IELA 2EIOA 3GHAA 2YCDA 3BCIA 1SL2B 2CV4A 2FHEA 5KOXA 2F51A 4FH8A 5B6NA 2LKUA 5DJLA 4MF5A 4TOPA 2CT6A 2YPMA 4CW9A 2H6YA 2V6OA 1S3CA 3Q19A 3IK7A 3W6GA 2LJAA 5D9XA 3GMFA 4PQIA 3CMIA 2IMIA 2DIZA 3LXZA 4ZIJA 1GSEA 1TRSA 5J4UA 3J7Yb 4MZBA 4MCUA 1GNWA 2H8LA 4GSTA 3DGQA 4V1Ap 2PMTA 1A8LA 2VD0A 4G0LA 3F4SA 1MDIA 3HD5A 2LTKA 2HZEA 4ECCA 3KH9A 3KM6A 1ZGNA 1PX7A 1A2JA 3KEBA 4F03A 4HEA2 3L9VA 3VWVA 5INYA 1ACVA 2G2QA 2PPTA 3GKMA 5G31A 1RK4A 3A2WA 4LL4B 3VLNA 1S3RA 4TR4A 4WETA 4FYCA 1OE7A 2GZYA 3K8NA 4HS1A 1XVWA 3F3QA 3D21A 1O73A 3RPNA 4POMA 1BAYA 4Q5RA 4MF7A 1NW2A 5L71A 3FZ9A 2CVKA 5F8BA 1K3OA 4E8EA 4ISDA 2MBSA 3L0HA 3GL5A 2B1LA 4BVXB 1HQOA 4KE3A 4Q5NA 4X0XA 2AV4A 1JFUA 5LNKe 1GTAA 4RQRA 4JR6A 5A5KA 4TW5A 2VCXA 1F3AA 5B7CA 2OA7A 1GP1A 1WWJA 1V57A 2H1AA 3CSIA 5F05A 4Z2TA 2PVQA 1XFLA 1V2AA 1KTEA 4MLYA 5ID2A 4J2FA 3APOA 16GSA 2IFQA 2LRCA 4GLTA 6GSYA 2HT9A 4O5UA 3VK9A 1QUWA 1KEBA 4IJ3A 2C0EA 5FWGA 2HLSA 4FYUA 1J0FA 5CNWA 5KN3A 2B3SA 1F37A 4XS6A 5B6MA 1U6TA 2CAQA 3D4MA 2X99A 2DJJA 6GSXA 3IC4A 2B5YA 4GXZA 3FZ5A 4LMVA 1FVKA 3N5OA 5IMDA 4KF9A 13GSA 3R3EA 3UVTA
chains in the Genus database with same CATH topology
1EP7A 3TB2A 3H79A 5B8AA 1OAZA 1LBKA 3LWAA 1U88A 3CYNA 1XOAA 3IK9A 2GGTA 3EU4A 3HVSA 4EC0A 3U5RE 2B5EA 3F8UA 3C1SA 4BVYB 5D96A 3H1NA 4HDEA 4P3YB 1ZL9A 4XIHA 3KMOA 2IIYA 4G19A 2QKEA 4ZBBA 1AQXA 3G7JA 4JE1A 4XRAA 3IOSA 2R2JA 1GLPA 5LCZA 2H6ZA 2LRTA 2N5AA 3TKSA 4I8BA 2L4QA 3NOFA 2GSQA 3IA1A 3IR4A 1Q4JA 1A24A 3PR8A 4WR5A 1MD3A 3W8JA 5CRDA 5ECOB 2BTOT 1SJZA 3QDNA 1THOA 1GSDA 1PQNA 2IMEA 1Z7RA 5E4WA 3EMXA 2VM1A 4GQFA 1PD21 2WDUA 3TJFA 4KGIA 2B6MA 4KB3A 3LQ7A 1EEJA 2JSZA 2AHEA 1TTZA 1IYHA 2VOCA 4MPGA 1M7TA 4MF6A 2B7JA 4K0NA 3LG6A 2H70A 2REMA 4NHZA 5DALA 2A2RA 2LJRA 5IMZA 5GAND 5AIVA 2X4AA 8GSSA 1GTUA 2GSTA 3US3A 2O85A 2GT5A 1GRXA 5G5EA 4WF5A 1VF1A 5CRHA 2DBCA 2PVOC 4HU9A 4K5SA 5IIZA 4RQXA 3EURA 4JBBA 2DIYA 3QPMA 1TP9A 3E3EA 4DSQA 1SKWB 3TUEA 2P5QA 4KSOA 5JCGA 4DSRA 1ZYQB 1OC8A 2WJUA 4MJAA 4K2XA 3VWWA 4XRDA 3FR9A 3M1GA 3RAZA 1JZWA 2ZUPA 4YH2A 4KCEA 5DJMA 4ILFA 3UARA 2IWTA 3HCZA 3CTFA 2IMFA 2VAFA 4J57E 5IO0A 2H72A 1GTBA 5EY6A 2KP2A 2H66A 1YEXA 5H5RA 1GULA 3C73A 3R2QA 4TR0A 2RM5A 1TDIA 1GUMA 3UJ1A 3GSSA 1X9WB 3SWLA 2YJHA 1K0BA 2FY6A 2YOIA 1K0CA 3IXRA 2VM2A 2ALBA 1B9YC 3M9KA 4TR1B 2KLXA 2FA4A 2R5GA 4O5RA 2RLIA 2AUVA 4POBA 4PNGA 1VGLA 2JZTA 1ERTA 4RI6A 2H0IA 1A0RP 3LORA 5C00A 4EF0A 1M9BA 5J9CA 4MZCA 5ID2B 4I97A 2DKHA 2OKAA 3F63A 3I43A 1K0DA 3EYTA 1E6BA 1WJKA 2WCIA 3A3TA 4CY6A 2UZ8A 5LD0A 2A2SA 1K3LA 4YKFA 4HU7A 2A2PA 4ZXGA 2LQOA 2VL2A 4MZWA 1DE1A 3GFKA 4LL1B 2YWNA 4MJEA 5H5QA 1SJ6A 5DBQA 3PPUA 3GA4A 3TKPA 3UEMA 5G30A 2L57A 3GUSA 3KJYA 2H76A 2R0CA 1FB6A 3ZIJA 1FG4A 5CO3A 2RIIA 1SKRB 4ZL8A 3IC8A 4G0KA 1B8XA 2R0GA 3C1RA 3L4NA 2CVBA 2TRCP 1Y25A 1OVNA 3LYPA 5GAPD 1USBA 4KDXA 3APSA 1J9BA 3CXGA 3HZ8A 3HYPA 1B9XC 3IE3A 1N2AA 3BD2A 3FK8A 2C3NA 3TGZA 3TJJA 5EL8A 4IGJA 1PL2A 2FNOA 1FVJA 5IMFA 2CZ2A 1TU7A 4K8MA 1QMVA 5ECLB 4EVMA 2H1DA 2GLRA 1PRXA 3TOUA 4ACSA 5HFIA 1KBNA 5IQYA 2LJKA 1O8WA 5ECRB 4X1UA 3VWXA 4OFTA 5CRGA 4KSMA 2H30A 3FMWA 4OFMA 1AUCA 5ECHB 3GL3A 4GRFA 3RPPA 3TRXA 4K7OA 2YWMA 4FIWA 3PH9A 3ZTLA 4ZB8A 2EIQA 4WF4A 2H0HA 3QCPA 3GKXA 4EUYA 2H1GA 4O7HA 1T7PB 1UC7A 4GF0A 2O87A 1ST9A 3UOMA 4A5PA 2XC2A 1XZOA 2VL9A 3UL3A 2TIRA 1GL8A 5D9WA 4MNNA 3GKKA 4YQVA 2DSAA 1NHOA 1U87A 3GKNA 3A5IA 3ZMKA 2R3XA 4EDYA 1Y6EA 3UAPA 3BOAA 2LS5A 3QR6A 2WRTA 1BYEA 2CX4A 1TKDB 4OD7A 2I3YA 2PUKC 5F06A 3TKSE 1AAZA 2L6DA 1WOUA 2KOKA 2OACA 1O7UA 3DIEA 3MYDA 5J9BA 2LUSA 1YKAA 3HA9A 1XOBA 3TDGA 3GNJA 4FO5A 2LV3A 3DD3A 4OMVA 2KHPA 3F4TA 4H86A 4AF2A 4X4JA 4JEDA 1AXDA 3Q74A 2HZFA 2JACA 1BQ7A 4CDOA 2I1UA 1TI1A 2K9FA 1J08A 2FA8A 4G2EA 5EVOA 2NDOA 4HZ4A 2ZNMA 1M2BA 4XHMA 2N5BA 4GTUA 4BWSA 5A4WA 1XWGA 3ZIVA 3IAS2 2M72A 4X43A 4L5OA 3L78A 4HQSA 5D73A 3MDKA 4BL7A 3EU3A 1YF1A 3Q6OA 1YEPA 2GZZA 2F3MA 2VO4A 4LA1A 5DAKB 5GZZB 3C71A 4IHUA 3QAWA 5CRWA 2VCWA 2AB6A 3TKRA 3TRQA 3GX0A 2FGXA 5G2ZA 4YKGA 2XBIA 4YQMA 2CA8A 3F6FA 4EIQA 2PU9C 1U3AA 3DRNA 5ECPB 3ZREA 3LXTA 3O3TA 5J3RA 5ELAA 1WP0A 6GSTA 1T4ZA 3FR3A 4F9ZA 1K3YA 3CSJA 1QXHA 3J7Yk 3UIWA 2ES7A 2B1KA 3WGEA 5ENUA 2H01A 2BMXA 1EGOA 5ECKB 1G6WA 2IJYA 2R4VA 3TCOA 2YJ7A 3FR6A 3DXBA 1PGTA 1W4VA 1IYIA 4ZB6A 4HQZA 2C3QA 4POKA 1OC9A 4K7NA 3LJRA 4WR4A 3TKSC 4TXVA 1GSUA 3O76A 6GSWA 3IAM2 5CYYA 5EPFA 3FW2A 1Z6NA 2V32A 4QQ7A 4JR4A 4KNDA 3E9JB 1B4PA 1TRUA 2XBQA 1SD8A 1KNGA 1V98A 2MZCA 3N9JA 4NPBA 2JU5A 3MSZA 3FRCA 3VFIA 2M46A 4JZQA 3WGXA 2QGVA 1W89A 3KTLA 2P5RA 1AQVA 3FY7A 5AIXA 3KH7A 1QGVA 4PURA 1A2LA 4AJ6A 2YWOA 5KEJA 1MDJA 1PSQA 1X5DA 2J9HA 4IVFA 4QL7A 1R26A 4XTSA 1XXUA 5CREA 4G0IA 19GSA 2C1YA 2X8CA 1YDKA 1FHEA 3HHVA 2DMLA 2WFCA 2A4HA 3HXSA 2HSMA 3KIJA 2VL3A 4TVEA 1DBYA 2OADA 1SYXA 2FWGA 5D8IA 4KCAA 3ERGA 5DQYA 3KZQA 1ZOFA 4USSA 2F8FA 4EL1A 2EC4A 1DE2A 1R7HA 2YN1A 3ZZXA 18GSA 1EWXA 1PKWA 3D5JA 3UBKA 4IQAA 1HD2A 1TK0B 3IHGA 1FOVA 2GQLA 2F9SA 3ZVJD 4O5QA 4KX4A 1E2YA 1JLWA 3LW9A 4MDCA 1BX9A 3LYKA 3UVHA 4BA7A 3EINA 3ZRDA 2WZ9A 1GSQA 2IMDA 1JHBA 4EDZA 4HI7A 5HFKA 4FQUA 5AISA 2HFDA 3L9SA 3P2AA 2HE3A 2CAIA 2D2ZA 2VIMA 3MWHA 2C0DA 3ED3A 2DJ1A 5G1KA 2O89A 3WT2A 3A2VA 4GSSA 1SKSB 3ZVJA 4MP4A 4XCSA 1FO5A 4KDUA 5GSSA 1T4YA 2GQKA 1B48A 5GSTA 1X9SB 2H75A 3QAGA 1I5GA 4N10A 4OFNA 1TU8A 1GUHA 2HZEB 3ZYWA 4L5LA 3GTUA 6GSSA 3QFBC 4BL7B 1HNBA 2VLVA 2GSSA 2YP6A 5IMVA 4I6XA 3WYWA 3CTGA 3DKSA 2FWFA 2MMZA 2VL2C 1HNAA 2WS2A 3MNGA 2AJQB 3VI5A 2C3TA 2HYXA 4PQHA 3P90A 3GN3A 1A23A 3WD6A 4IN0A 3LEFA 1O81A 1K0NA 5FT3A 9GSSA 3IBHA 1G6YA 4V1Ag 4YQUA 1M2AA 1S3AA 2HRFA 2YWIA 5KN0A 3WGDA 3ZFBA 3MAKA 1B4QA 2JL4A 1GUKA 4ICYA 4N30A 1ILOA 2HNLA 3G9BA 1XIYA 3D22A 4Z2RA 1R4WA 1SJIA 1PN9A 2QSIA 4OO5A 1PL1A 3WT1A 1ZYNA 2IPAA 5G5FA 2R6KA 2ON7A 2OE1A 3CRUA 3P7XA 3GSTA 1G0TA 3E0UA 1H4OA 1NHYA 2E0QA 4V2NA 4ECJA 4MJCA 2FD3A 2B5XA 4E8HA 2IFQB 1OC9B 4WXTA 4ZL7A 5IOWA 4HUAA 3LFLA 1GTIA 2OE0A 2VCVA 1N8JA 1LU4A 1GLQA 4O92A 2IMKA 5CP1A 3HJOA 1OC3A 3F0IA 2TRXA 4MPFA 2K8VA 3DMLA 1URMA 1K0AA 3APQA 1ZYEA 4HOJA 3VURA 3NIVA 1SL1B 4MH2A 4N0VA 4HJMA 2CVDA 2VLTA 2QA2A 5HR1A 4NMUA 3GH6A 1SU9A 3BBYA 1JZOA 1RW1A 1K0OA 2NVLA 1NM3A 1M0UA 3U6VA 4NWYA 12GSA 2NBSA 2H73A 2ON5A 3L9UA 1K0MA 4F82A 5D9VA 3F6DA 3VWUA 2CZ3A 1Z6MA 1U3IA 2YV9A 3ERFA 5E59A 1TRVA 3BJ5A 3SBCA 1M99A 1T3BA 1EOGA 2JZSA 1GWCA 1XW9A 3FYGA 2OJLA 1ERVA 1G7OA 1XW6A 3H8QA 2R37A 1VF2A 2P0GA 3IPZA 5BMUA 2YANA 2C80A 3UMAA 5ECMB 1AQWA 1WE0A 1VF4A 4GQCA 3HY2A 1TRWA 1FB0A 2FLSA 3ME7A 1JZRA 2LNTA 1ZCPA 3HVVA 3DVWA 3NZNA 3HVXA 3KP8A 2VUPA 3D0ZA 2DJ2A 2GDRA 5JCUA 2PGTA 3KD0A 1SK1A 1C72A 4D73A 2Z9SA 1ERWA 2XPDA 5IOXA 4F2IA 1JZDA 3FZ4A 2MMNA 3CSHA 1H75A 4L0UA 3F3RA 3IHQA 2H1BA 4OO4A 1FAAA 4MA9A 1CQHA 1PA3A 3DVXA 4PTSA 5DALB 2GS3A 1X5EA 5HR0A 2K6VA 2HRNA 4ECIA 1EV9A 5DCHA 2LEGA 5HFGA 2DJKA 1OKTA 5J41A 4K9ZA 2DMMA 1ON4A 1XBSA 1WPIA 1WIKA 1XPVA 4IKHA 4KUNA 1XW5A 1Z7PA 4MABA 2QC7A 1YY7A 1TI3A 4FYBA 3ME8A 4ML6A 2HSHA 4AJ8A 4OCEA 4Z7XA 4DSSA 3W8SA 3VPTA 1XCCA 2V41A 2AAWA 2I81A 3KMNA 1MDKA 1QQ2A 3VI7A 4ZB9A 2IL3A 3M0FA 2X8HA 11GSA 5KN2A 3IV4A 3ERWA 1TW9A 1V9WA 2OE3A 1FW1A 3M3MA 4TXOA 3TJBA 4K2DA 2LSTA 3G7YA 2VCQA 2L5OA 2RM6A 4HZ2A 2FWEA 3H4KA 4IBPA 4PGTA 3DEXA 3PGTA 2L59A 1BG5A 3I9V2 2LNSA 2FCHA 3LGCA 1SK0A 5F0GA 22GSA 4L0WA 1ML6A 4NV5A 2VLUA 1T00A 2VD1A 3O6TA 2KP1A 3FHKA 2OBIA 1WMJA 3H93A 2PERA 4YAPA 3FKFA 2JADA 2P31A 2OBKA 4POLA 2HI7A 2A4VA 2YNXA 3Q18A 5JWQB 1PX6A 3QAVA 2GQMA 1YF0A 4WEYA 3EVIA 1YQ1A 3UBLA 1PKZA 4IP6A 3TJGA 4LMWA 4IW9A 3A2XA 3LSZA 4LLRA 2V6KA 2DKIA 4TR1A 1EOHA 4K7IA 2KUCA 1MD4A 1TJDA 1OE8A 4BWQA 1WRYA 4EO3A 4MJBA 2YV7A 4K0GA 4IP1A 1UN2A 2WGRA 4OWYA 2X64A 4I2TA 4ML1A 3HDCA 1ERUA 2IN3A 2H19A 4PUAA 4GSNA 6GSVA 3FZAA 4RUVA 1EZKA 2PN8A 3IDVA 5DCGA 5KN1A 2NTOA 2V1MA 3IRAA 2MMOA 2R0PA 5IM9A 4NHWA 1Z9HA 2HRAA 1Z5YE 4TKYA 2LQQA 2LRNA 2C0GA 1HNCA 3GYKA 1RQMA 2HRKA 4MMMA 2VCTA 5D9TA 2C8UA 2PBJA 1S3DA 1BJXA 1XWBA 1UVZA 4D73B 1TOFA 1XWKA 4JRRA 4OCFA 5BRTA 4EIPA 1MEKA 1QFNA 4QL9A 5IPGA 17GSA 4K5RA 4RI7A 3GRXA 20GSA 4PXOA 3ZFLA 3M8NA 4F0CA 4TN8A 3A5WA 4CY8A 5ECIB 1YJ6A 1TK5B 1R5PA 4WBJA 1Z3EA 1EV4A 5IPHA 2GZPA 3QOUA 1GSYA 1F3BA 3KXOA 4XS1A 2XHFA 2GTUA 3S9FA 2XPEA 5ABRA 4K6XA 5B8BA 5IMAA 4AJ7A 2WB9A 4G10A 4HJ2A 2PWJA 2DLXA 2AYTA 3EWLA 1XWAA 1TXXA 5F07A 4DSSB 4ULXA 1XWCA 3G7IA 1Q98A 1NSWA 4ZBAA 3HJPA 1QK8A 2YZHA 5DDLA 4CHSA 5COHA 4ZL9A 4NAXA 1HYUA 2L4CA 1ZMAA 2CX3A 2O7KA 4Q5QA 3TRPA 1PN0A 5ECSA 14GSA 4MK3A 2ZCTA 3HZ4A 4XS4A 3C8EA 3MIXA 3RHCA 5JWOB 5AN1A 3QMXA 1GSFA 4TXOB 4KA0A 4F0BA 4NXIA 2RUEA 3KTBA 4PUFC 4EXJA 1ABAA 5DVBA 2C4JA 5D93A 5ELGA 1GNEA 2J23A 3V1WA 4JU5A 1X5CA 1UA5A 4ECBA 5HR2A 5ECQB 4DEJA 2E7PA 1SD9A 4G9HA 3CRTA 3DWVA 3C7MA 5JWRB 1BEDA 3GX8A 2F8AA 1YZXA 2X8GA 1V40A 2MBTA 1ZYPA 1TK8B 2HSYA 1M9AA 1O6JA 5ECNB 4N11A 5KOWA 2DC5A 1F2EA 4V2LA 2BJXA 4K1FA 4KDYA 5G1LA 1F9MA 2WULA 3QD9A 2NPBA 2K8SA 4L8EA 2GSRA 3KGKA 4IJIA 1VRSD 3PINA 1VF3A 3FEUA 7GSSA 2CQ9A 2YZUA 2GT6A 3GV1A 1XVQA 2MYGA 3KCMA 5HQPA 4YAVA 1GSSA 3M9JA 3OR5A 2H0GA 5DAKA 4DVCA 1DUGA 3RHBA 4V2MA 4Q5FA 1DSBA 3D4TA 1CQGA 3I69A 4ZBDA 2K18A 3ZMLA 1M2DA 4EKZA 3HJMA 3EC3A 3QFAC 5A4VA 2EIRA 4KW6A 1R5AA 3P8WA 4BVXA 1O85A 1YKCA 1OKDA 1V58A 4N0ZA 3BCKA 1LJRA 1X0RA 2M80A 3KP9A 3EMPA 4NV2A 4Z2UA 2L5LA 4WBRD 3ISOA 3TJKA 1PMTA 4PQ1A 2V2GA 1MTCA 2O8VB 4I5QA 2FUG2 2G0FA 5DQSA 3GH9A 1I9DA 3GIXA 1T1VA 1EEMA 3D6IA 1AIUA 2DJ3A 2FWHA 1A0FA 2QA1A 4KAEA 4TR3A 2I4AA 4TRXA 5HR3A 3F4RA 1ZZYA 1SK2A 2I9HA 2GVPA 3CBUA 4MH3A 4PNFA 2E2GA 3ZLPA 3TOTA 2H71A 1A8YA 4EE0A 5JCWA 3TKQA 4J56E 4IS0A 1AC1A 3EE2A 1EGRA 1G7EA 4AGSA 3HKRA 2B7KA 2JZRA 1OYJA 4BPYA 5H5SA 4IQ1A 2H6XA 5IO2A 5CAXA 2VCZA 1EP8A 1GH2A 2H74A 4O32A 1FOHA 1A2MA 5A4UA 3AY8A 3VPQA 1F6MC 4I2UA 3ZITA 4ZILA 4ID0A 2HXKA 4GCIA 2DJ0A 2MMAA 4WKWA 2C0FA 2JSYA 5J5NA 5FHIA 4BVYA 2RUFA 3ZL5A 1T8EB 3F9UA 1JLVA 6GSUA 4KH7A 3RDWA 5IMCA 1AW9A 4XS4B 1SENA 10GSA 4GWRA 1O8XA 3GTUB 5C04A 3GURA 4PX1A 2L6CA 3RBTA 1THXA 2N5FA 3I6AA 1X9MB 3EPTA 3JCML 1SL0B 2X49A 5AGYA 1SYRA 2E2MA 3DYRA 4IELA 2EIOA 3GHAA 2YCDA 3BCIA 1SL2B 2CV4A 2FHEA 5KOXA 2F51A 4FH8A 5B6NA 2LKUA 5DJLA 4MF5A 4TOPA 2CT6A 2YPMA 4CW9A 2H6YA 2V6OA 1S3CA 3Q19A 3IK7A 3W6GA 2LJAA 5D9XA 3GMFA 4PQIA 3CMIA 2IMIA 2DIZA 3LXZA 4ZIJA 1GSEA 1TRSA 5J4UA 3J7Yb 4MZBA 4MCUA 1GNWA 2H8LA 4GSTA 3DGQA 4V1Ap 2PMTA 1A8LA 2VD0A 4G0LA 3F4SA 1MDIA 3HD5A 2LTKA 2HZEA 4ECCA 3KH9A 3KM6A 1ZGNA 1PX7A 1A2JA 3KEBA 4F03A 4HEA2 3L9VA 3VWVA 5INYA 1ACVA 2G2QA 2PPTA 3GKMA 5G31A 1RK4A 3A2WA 4LL4B 3VLNA 4TR4A 4WETA 4FYCA 1OE7A 2GZYA 3K8NA 4HS1A 1XVWA 3F3QA 3D21A 1O73A 3RPNA 4POMA 1BAYA 4Q5RA 4MF7A 1NW2A 5L71A 3FZ9A 2CVKA 5F8BA 1K3OA 4E8EA 4ISDA 2MBSA 3L0HA 3GL5A 2B1LA 4BVXB 1HQOA 4KE3A 4Q5NA 4X0XA 2AV4A 1JFUA 5LNKe 1GTAA 4RQRA 4JR6A 5A5KA 4TW5A 2VCXA 1F3AA 5B7CA 2OA7A 1GP1A 1WWJA 1V57A 2H1AA 3CSIA 5F05A 4Z2TA 2PVQA 1XFLA 1V2AA 1KTEA 4MLYA 5ID2A 4J2FA 3APOA 16GSA 2IFQA 2LRCA 4GLTA 6GSYA 2HT9A 4O5UA 3VK9A 1QUWA 1KEBA 4IJ3A 2C0EA 5FWGA 2HLSA 4FYUA 1J0FA 5CNWA 5KN3A 2B3SA 1F37A 4XS6A 5B6MA 1U6TA 2CAQA 3D4MA 2X99A 2DJJA 6GSXA 3IC4A 2B5YA 4GXZA 3FZ5A 4LMVA 1FVKA 3N5OA 5IMDA 4KF9A 13GSA 3R3EA 3UVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EP7 A;  3TB2 A;  3H79 A;  5B8A A;  1OAZ A;  1LBK A;  3LWA A;  1U88 A;  3CYN A;  1XOA A;  3IK9 A;  2GGT A;  3EU4 A;  3HVS A;  4EC0 A;  3U5R E;  2B5E A;  3F8U A;  3C1S A;  5D96 A;  3H1N A;  4HDE A;  4P3Y B;  1ZL9 A;  4XIH A;  3KMO A;  2IIY A;  4G19 A;  2QKE A;  4ZBB A;  1AQX A;  3G7J A;  4JE1 A;  4XRA A;  3IOS A;  2R2J A;  1GLP A;  5LCZ A;  2H6Z A;  2LRT A;  2N5A A;  3TKS A;  4I8B A;  2L4Q A;  3NOF A;  2GSQ A;  3IA1 A;  3IR4 A;  1Q4J A;  1A24 A;  3PR8 A;  4WR5 A;  1MD3 A;  3W8J A;  5CRD A;  5ECO B;  2BTO T;  1SJZ A;  3QDN A;  1THO A;  1GSD A;  1PQN A;  2IME A;  1Z7R A;  5E4W A;  3EMX A;  2VM1 A;  4GQF A;  1PD2 1;  2WDU A;  3TJF A;  4KGI A;  2B6M A;  4KB3 A;  3LQ7 A;  1EEJ A;  2JSZ A;  2AHE A;  1TTZ A;  1IYH A;  2VOC A;  4MPG A;  1M7T A;  4MF6 A;  2B7J A;  4K0N A;  3LG6 A;  2H70 A;  2REM A;  5DAL A;  4NHZ A;  2A2R A;  2LJR A;  5IMZ A;  5GAN D;  5AIV A;  8GSS A;  1GTU A;  2GST A;  3US3 A;  2O85 A;  2GT5 A;  1GRX A;  5G5E A;  4WF5 A;  1VF1 A;  5CRH A;  2DBC A;  2PVO C;  4HU9 A;  5IIZ A;  4RQX A;  3EUR A;  4JBB A;  2DIY A;  3QPM A;  1TP9 A;  3E3E A;  4DSQ A;  1SKW B;  3TUE A;  2P5Q A;  4KSO A;  5JCG A;  4DSR A;  1ZYQ B;  1OC8 A;  2WJU A;  4MJA A;  3VWW A;  4XRD A;  3FR9 A;  3M1G A;  3RAZ A;  1JZW A;  2ZUP A;  4YH2 A;  4KCE A;  5DJM A;  4ILF A;  3UAR A;  2IWT A;  3HCZ A;  3CTF A;  2IMF A;  2VAF A;  4J57 E;  5IO0 A;  2H72 A;  1GTB A;  5EY6 A;  2KP2 A;  2H66 A;  1YEX A;  5H5R A;  1GUL A;  3C73 A;  3R2Q A;  4TR0 A;  2RM5 A;  1TDI A;  1GUM A;  3UJ1 A;  3GSS A;  1X9W B;  3SWL A;  2YJH A;  1K0B A;  2FY6 A;  2YOI A;  1K0C A;  3IXR A;  2VM2 A;  2ALB A;  1B9Y C;  3M9K A;  4TR1 B;  2KLX A;  2FA4 A;  2R5G A;  4O5R A;  2RLI A;  2AUV A;  4POB A;  4PNG A;  1VGL A;  2JZT A;  1ERT A;  4RI6 A;  2H0I A;  1A0R P;  3LOR A;  5C00 A;  4EF0 A;  1M9B A;  5J9C A;  4MZC A;  5ID2 B;  4I97 A;  2OKA A;  3F63 A;  3I43 A;  1K0D A;  3EYT A;  1E6B A;  1WJK A;  2WCI A;  3A3T A;  5LD0 A;  2A2S A;  1K3L A;  4HU7 A;  4ZXG A;  2LQO A;  2VL2 A;  4MZW A;  1DE1 A;  3GFK A;  4LL1 B;  2YWN A;  4MJE A;  5H5Q A;  1SJ6 A;  5DBQ A;  3GA4 A;  3TKP A;  3UEM A;  5G30 A;  2L57 A;  3GUS A;  3KJY A;  2H76 A;  1FB6 A;  3ZIJ A;  1FG4 A;  5CO3 A;  2RII A;  1SKR B;  4ZL8 A;  1B8X A;  3C1R A;  3L4N A;  2CVB A;  2TRC P;  1Y25 A;  1OVN A;  3LYP A;  5GAP D;  1USB A;  4KDX A;  3APS A;  1J9B A;  3CXG A;  3HZ8 A;  3HYP A;  1B9X C;  3IE3 A;  1N2A A;  3BD2 A;  3FK8 A;  2C3N A;  3TGZ A;  3TJJ A;  5EL8 A;  4IGJ A;  1PL2 A;  2FNO A;  1FVJ A;  5IMF A;  2CZ2 A;  1TU7 A;  4K8M A;  1QMV A;  5ECL B;  4EVM A;  2H1D A;  2GLR A;  1PRX A;  3TOU A;  4ACS A;  5HFI A;  1KBN A;  5IQY A;  2LJK A;  1O8W A;  5ECR B;  4X1U A;  3VWX A;  4OFT A;  5CRG A;  4KSM A;  2H30 A;  4OFM A;  1AUC A;  5ECH B;  3GL3 A;  4GRF A;  3RPP A;  3TRX A;  4K7O A;  2YWM A;  4FIW A;  3PH9 A;  3ZTL A;  4ZB8 A;  2EIQ A;  4WF4 A;  2H0H A;  3QCP A;  3GKX A;  4EUY A;  2H1G A;  4O7H A;  1T7P B;  1UC7 A;  4GF0 A;  2O87 A;  1ST9 A;  3UOM A;  2XC2 A;  1XZO A;  2VL9 A;  3UL3 A;  2TIR A;  1GL8 A;  5D9W A;  3GKK A;  4YQV A;  2DSA A;  1NHO A;  1U87 A;  3GKN A;  3ZMK A;  2R3X A;  4EDY A;  1Y6E A;  3UAP A;  3BOA A;  2LS5 A;  3QR6 A;  2WRT A;  1BYE A;  2CX4 A;  1TKD B;  4OD7 A;  2I3Y A;  2PUK C;  5F06 A;  3TKS E;  1AAZ A;  2L6D A;  1WOU A;  2KOK A;  2OAC A;  1O7U A;  3DIE A;  5J9B A;  2LUS A;  1YKA A;  3HA9 A;  1XOB A;  3TDG A;  3GNJ A;  4FO5 A;  2LV3 A;  3DD3 A;  4OMV A;  2KHP A;  3F4T A;  4H86 A;  4AF2 A;  4JED A;  1AXD A;  3Q74 A;  2HZF A;  2JAC A;  1BQ7 A;  4CDO A;  2I1U A;  1TI1 A;  2K9F A;  1J08 A;  2FA8 A;  4G2E A;  5EVO A;  2NDO A;  4HZ4 A;  2ZNM A;  1M2B A;  4XHM A;  2N5B A;  4GTU A;  4BWS A;  5A4W A;  1XWG A;  3ZIV A;  3IAS 2;  2M72 A;  4X43 A;  4L5O A;  3L78 A;  4HQS A;  5D73 A;  3MDK A;  4BL7 A;  3EU3 A;  1YF1 A;  3Q6O A;  1YEP A;  2GZZ A;  2F3M A;  2VO4 A;  4LA1 A;  5DAK B;  5GZZ B;  3C71 A;  4IHU A;  3QAW A;  5CRW A;  2VCW A;  2AB6 A;  3TKR A;  3TRQ A;  3GX0 A;  2FGX A;  5G2Z A;  2XBI A;  4YQM A;  2CA8 A;  3F6F A;  2PU9 C;  1U3A A;  3DRN A;  5ECP B;  3ZRE A;  3LXT A;  3O3T A;  5J3R A;  5ELA A;  1WP0 A;  6GST A;  1T4Z A;  3FR3 A;  4F9Z A;  1K3Y A;  3CSJ A;  1QXH A;  3J7Y k;  3UIW A;  2ES7 A;  2B1K A;  3WGE A;  5ENU A;  2H01 A;  2BMX A;  1EGO A;  5ECK B;  1G6W A;  2IJY A;  2R4V A;  3TCO A;  2YJ7 A;  3FR6 A;  3DXB A;  1PGT A;  1W4V A;  1IYI A;  4ZB6 A;  4HQZ A;  2C3Q A;  4POK A;  1OC9 A;  4K7N A;  3LJR A;  4WR4 A;  3TKS C;  4TXV A;  1GSU A;  3O76 A;  6GSW A;  3IAM 2;  5CYY A;  5EPF A;  3FW2 A;  1Z6N A;  2V32 A;  4QQ7 A;  4JR4 A;  4KND A;  3E9J B;  1B4P A;  1TRU A;  2XBQ A;  1SD8 A;  1KNG A;  1V98 A;  2MZC A;  3N9J A;  4NPB A;  2JU5 A;  3MSZ A;  3FRC A;  3VFI A;  2M46 A;  4JZQ A;  3WGX A;  2QGV A;  1W89 A;  3KTL A;  2P5R A;  1AQV A;  3FY7 A;  5AIX A;  3KH7 A;  1QGV A;  4PUR A;  1A2L A;  4AJ6 A;  2YWO A;  5KEJ A;  1MDJ A;  1PSQ A;  1X5D A;  2J9H A;  4IVF A;  4QL7 A;  1R26 A;  4XTS A;  1XXU A;  5CRE A;  19GS A;  2C1Y A;  2X8C A;  1YDK A;  1FHE A;  3HHV A;  2DML A;  2WFC A;  3HXS A;  3KIJ A;  2VL3 A;  4TVE A;  1DBY A;  2OAD A;  1SYX A;  2FWG A;  5D8I A;  4KCA A;  3ERG A;  5DQY A;  3KZQ A;  1ZOF A;  2F8F A;  4EL1 A;  2EC4 A;  1DE2 A;  1R7H A;  2YN1 A;  3ZZX A;  18GS A;  1EWX A;  1PKW A;  3D5J A;  3UBK A;  4IQA A;  1HD2 A;  1TK0 B;  1FOV A;  2GQL A;  2F9S A;  3ZVJ D;  4KX4 A;  1E2Y A;  1JLW A;  4MDC A;  1BX9 A;  3LYK A;  3UVH A;  4BA7 A;  3EIN A;  3ZRD A;  2WZ9 A;  1GSQ A;  2IMD A;  1JHB A;  4EDZ A;  4HI7 A;  5HFK A;  5AIS A;  2HFD A;  3L9S A;  3P2A A;  2HE3 A;  2CAI A;  2D2Z A;  2VIM A;  3MWH A;  2C0D A;  3ED3 A;  2DJ1 A;  5G1K A;  2O89 A;  3WT2 A;  3A2V A;  4GSS A;  1SKS B;  3ZVJ A;  4MP4 A;  4XCS A;  1FO5 A;  4KDU A;  5GSS A;  1T4Y A;  2GQK A;  1B48 A;  5GST A;  1X9S B;  2H75 A;  3QAG A;  1I5G A;  4N10 A;  4OFN A;  1TU8 A;  1GUH A;  2HZE B;  3ZYW A;  4L5L A;  3GTU A;  6GSS A;  3QFB C;  1HNB A;  2VLV A;  2GSS A;  2YP6 A;  5IMV A;  4I6X A;  3WYW A;  3CTG A;  3DKS A;  2FWF A;  2MMZ A;  2VL2 C;  1HNA A;  2WS2 A;  3MNG A;  2AJQ B;  3VI5 A;  2C3T A;  2HYX A;  4PQH A;  3P90 A;  3GN3 A;  1A23 A;  3WD6 A;  4IN0 A;  3LEF A;  1O81 A;  1K0N A;  5FT3 A;  9GSS A;  3IBH A;  1G6Y A;  4V1A g;  4YQU A;  1M2A A;  1S3A A;  2HRF A;  2YWI A;  5KN0 A;  3WGD A;  3ZFB A;  3MAK A;  1B4Q A;  2JL4 A;  1GUK A;  4N30 A;  1ILO A;  2HNL A;  3G9B A;  1XIY A;  3D22 A;  1R4W A;  1SJI A;  1PN9 A;  2QSI A;  4OO5 A;  1PL1 A;  3WT1 A;  2IPA A;  5G5F A;  2R6K A;  2ON7 A;  2OE1 A;  3CRU A;  3P7X A;  3GST A;  1G0T A;  3E0U A;  1H4O A;  1NHY A;  2E0Q A;  4V2N A;  4ECJ A;  4MJC A;  2FD3 A;  2B5X A;  4E8H A;  2IFQ B;  1OC9 B;  4WXT A;  4ZL7 A;  5IOW A;  4HUA A;  3LFL A;  1GTI A;  2OE0 A;  2VCV A;  1N8J A;  1LU4 A;  1GLQ A;  4O92 A;  2IMK A;  5CP1 A;  3HJO A;  1OC3 A;  3F0I A;  2TRX A;  4MPF A;  2K8V A;  3DML A;  1URM A;  1K0A A;  3APQ A;  1ZYE A;  4HOJ A;  3VUR A;  3NIV A;  1SL1 B;  4MH2 A;  4N0V A;  4HJM A;  2CVD A;  2VLT A;  5HR1 A;  4NMU A;  3GH6 A;  1SU9 A;  3BBY A;  1JZO A;  1RW1 A;  1K0O A;  2NVL A;  1NM3 A;  1M0U A;  3U6V A;  4NWY A;  12GS A;  2NBS A;  2H73 A;  2ON5 A;  3L9U A;  1K0M A;  4F82 A;  5D9V A;  3F6D A;  3VWU A;  2CZ3 A;  1Z6M A;  1U3I A;  2YV9 A;  3ERF A;  5E59 A;  1TRV A;  3BJ5 A;  3SBC A;  1M99 A;  1T3B A;  1EOG A;  2JZS A;  1GWC A;  1XW9 A;  3FYG A;  2OJL A;  1ERV A;  1G7O A;  1XW6 A;  3H8Q A;  2R37 A;  1VF2 A;  2P0G A;  3IPZ A;  2YAN A;  2C80 A;  3UMA A;  5ECM B;  1AQW A;  1WE0 A;  1VF4 A;  4GQC A;  3HY2 A;  1TRW A;  1FB0 A;  2FLS A;  3ME7 A;  1JZR A;  2LNT A;  1ZCP A;  3HVV A;  3DVW A;  3NZN A;  3HVX A;  3KP8 A;  2VUP A;  3D0Z A;  2DJ2 A;  2GDR A;  5JCU A;  2PGT A;  3KD0 A;  1SK1 A;  1C72 A;  4D73 A;  2Z9S A;  1ERW A;  2XPD A;  5IOX A;  4F2I A;  1JZD A;  3FZ4 A;  2MMN A;  3CSH A;  1H75 A;  4L0U A;  3F3R A;  3IHQ A;  2H1B A;  4OO4 A;  1FAA A;  4MA9 A;  1CQH A;  1PA3 A;  3DVX A;  5DAL B;  2GS3 A;  1X5E A;  5HR0 A;  2K6V A;  2HRN A;  4ECI A;  1EV9 A;  5DCH A;  2LEG A;  5HFG A;  2DJK A;  1OKT A;  5J41 A;  4K9Z A;  2DMM A;  1ON4 A;  1XBS A;  1WPI A;  1WIK A;  1XPV A;  4IKH A;  4KUN A;  1XW5 A;  1Z7P A;  4MAB A;  2QC7 A;  1YY7 A;  1TI3 A;  4FYB A;  3ME8 A;  4ML6 A;  2HSH A;  4AJ8 A;  4OCE A;  4Z7X A;  4DSS A;  3W8S A;  3VPT A;  1XCC A;  2V41 A;  2AAW A;  2I81 A;  3KMN A;  1MDK A;  1QQ2 A;  3VI7 A;  4ZB9 A;  2IL3 A;  3M0F A;  2X8H A;  11GS A;  5KN2 A;  3IV4 A;  3ERW A;  1TW9 A;  1V9W A;  2OE3 A;  1FW1 A;  3M3M A;  4TXO A;  3TJB A;  4K2D A;  2LST A;  3G7Y A;  2VCQ A;  2L5O A;  2RM6 A;  4HZ2 A;  2FWE A;  3H4K A;  4IBP A;  4PGT A;  3DEX A;  3PGT A;  2L59 A;  1BG5 A;  3I9V 2;  2LNS A;  2FCH A;  3LGC A;  1SK0 A;  5F0G A;  22GS A;  4L0W A;  1ML6 A;  4NV5 A;  2VLU A;  1T00 A;  2VD1 A;  3O6T A;  2KP1 A;  3FHK A;  2OBI A;  1WMJ A;  3H93 A;  2PER A;  4YAP A;  3FKF A;  2JAD A;  2P31 A;  2OBK A;  4POL A;  2HI7 A;  2A4V A;  2YNX A;  3Q18 A;  5JWQ B;  1PX6 A;  3QAV A;  2GQM A;  1YF0 A;  4WEY A;  3EVI A;  1YQ1 A;  3UBL A;  1PKZ A;  4IP6 A;  3TJG A;  4LMW A;  4IW9 A;  3A2X A;  3LSZ A;  4LLR A;  2V6K A;  4TR1 A;  1EOH A;  4K7I A;  2KUC A;  1MD4 A;  1TJD A;  1OE8 A;  4BWQ A;  1WRY A;  4EO3 A;  4MJB A;  2YV7 A;  4K0G A;  4IP1 A;  1UN2 A;  2WGR A;  4OWY A;  2X64 A;  4I2T A;  4ML1 A;  3HDC A;  1ERU A;  2IN3 A;  2H19 A;  4PUA A;  4GSN A;  6GSV A;  3FZA A;  4RUV A;  1EZK A;  2PN8 A;  3IDV A;  5DCG A;  5KN1 A;  2NTO A;  2V1M A;  3IRA A;  2MMO A;  5IM9 A;  4NHW A;  1Z9H A;  1Z5Y E;  4TKY A;  2LQQ A;  2LRN A;  2C0G A;  1HNC A;  3GYK A;  1RQM A;  4MMM A;  2VCT A;  5D9T A;  2C8U A;  2PBJ A;  1S3D A;  1BJX A;  1XWB A;  1UVZ A;  4D73 B;  1TOF A;  1XWK A;  4JRR A;  4OCF A;  1MEK A;  1QFN A;  4QL9 A;  5IPG A;  17GS A;  4RI7 A;  3GRX A;  20GS A;  4PXO A;  3ZFL A;  3M8N A;  4F0C A;  4TN8 A;  3A5W A;  5ECI B;  1YJ6 A;  1TK5 B;  1R5P A;  4WBJ A;  1Z3E A;  1EV4 A;  5IPH A;  2GZP A;  3QOU A;  1GSY A;  1F3B A;  3KXO A;  4XS1 A;  2XHF A;  2GTU A;  3S9F A;  2XPE A;  5ABR A;  4K6X A;  5B8B A;  5IMA A;  4AJ7 A;  2WB9 A;  4G10 A;  4HJ2 A;  2PWJ A;  2DLX A;  2AYT A;  3EWL A;  1XWA A;  1TXX A;  5F07 A;  4DSS B;  4ULX A;  1XWC A;  3G7I A;  1Q98 A;  1NSW A;  4ZBA A;  3HJP A;  1QK8 A;  2YZH A;  5DDL A;  4CHS A;  5COH A;  4ZL9 A;  4NAX A;  1HYU A;  2L4C A;  1ZMA A;  2CX3 A;  2O7K A;  4Q5Q A;  3TRP A;  5ECS A;  14GS A;  4MK3 A;  2ZCT A;  3HZ4 A;  4XS4 A;  3C8E A;  5JWO B;  3RHC A;  5AN1 A;  3QMX A;  1GSF A;  4TXO B;  4KA0 A;  4F0B A;  4NXI A;  2RUE A;  3KTB A;  4PUF C;  4EXJ A;  1ABA A;  5DVB A;  2C4J A;  5D93 A;  5ELG A;  1GNE A;  2J23 A;  3V1W A;  4JU5 A;  1X5C A;  1UA5 A;  4ECB A;  5HR2 A;  5ECQ B;  4DEJ A;  2E7P A;  1SD9 A;  4G9H A;  3CRT A;  3DWV A;  3C7M A;  5JWR B;  1BED A;  3GX8 A;  2F8A A;  1YZX A;  2X8G A;  1V40 A;  2MBT A;  1TK8 B;  2HSY A;  1M9A A;  1O6J A;  5ECN B;  4N11 A;  2DC5 A;  1F2E A;  4V2L A;  2BJX A;  4K1F A;  4KDY A;  5G1L A;  1F9M A;  2WUL A;  3QD9 A;  2NPB A;  2K8S A;  4L8E A;  2GSR A;  3KGK A;  4IJI A;  1VRS D;  3PIN A;  1VF3 A;  3FEU A;  7GSS A;  2CQ9 A;  2YZU A;  2GT6 A;  3GV1 A;  1XVQ A;  2MYG A;  3KCM A;  5HQP A;  4YAV A;  1GSS A;  3M9J A;  3OR5 A;  2H0G A;  5DAK A;  4DVC A;  1DUG A;  3RHB A;  4V2M A;  4Q5F A;  1DSB A;  3D4T A;  1CQG A;  3I69 A;  4ZBD A;  2K18 A;  3ZML A;  1M2D A;  4EKZ A;  3HJM A;  3EC3 A;  3QFA C;  5A4V A;  2EIR A;  4KW6 A;  1R5A A;  3P8W A;  4BVX A;  1O85 A;  1YKC A;  1OKD A;  1V58 A;  4N0Z A;  3BCK A;  1LJR A;  1X0R A;  2M80 A;  3KP9 A;  3EMP A;  4NV2 A;  2L5L A;  4WBR D;  3ISO A;  3TJK A;  1PMT A;  4PQ1 A;  2V2G A;  1MTC A;  2O8V B;  4I5Q A;  2FUG 2;  2G0F A;  5DQS A;  3GH9 A;  1I9D A;  3GIX A;  1T1V A;  1EEM A;  3D6I A;  1AIU A;  2DJ3 A;  2FWH A;  1A0F A;  4KAE A;  4TR3 A;  2I4A A;  4TRX A;  5HR3 A;  3F4R A;  1ZZY A;  1SK2 A;  2I9H A;  2GVP A;  3CBU A;  4MH3 A;  4PNF A;  2E2G A;  3ZLP A;  3TOT A;  2H71 A;  1A8Y A;  4EE0 A;  5JCW A;  3TKQ A;  4J56 E;  4IS0 A;  1AC1 A;  3EE2 A;  1EGR A;  1G7E A;  4AGS A;  3HKR A;  2B7K A;  2JZR A;  1OYJ A;  4BPY A;  5H5S A;  4IQ1 A;  2H6X A;  5IO2 A;  5CAX A;  2VCZ A;  1EP8 A;  1GH2 A;  2H74 A;  4O32 A;  1A2M A;  5A4U A;  3AY8 A;  3VPQ A;  1F6M C;  4I2U A;  3ZIT A;  4ZIL A;  4ID0 A;  2HXK A;  4GCI A;  2DJ0 A;  2MMA A;  4WKW A;  2C0F A;  2JSY A;  5J5N A;  5FHI A;  4BVY A;  2RUF A;  3ZL5 A;  1T8E B;  3F9U A;  1JLV A;  6GSU A;  4KH7 A;  3RDW A;  5IMC A;  1AW9 A;  4XS4 B;  1SEN A;  10GS A;  4GWR A;  1O8X A;  3GTU B;  5C04 A;  3GUR A;  4PX1 A;  2L6C A;  3RBT A;  1THX A;  2N5F A;  3I6A A;  1X9M B;  3JCM L;  1SL0 B;  5AGY A;  1SYR A;  2E2M A;  3DYR A;  4IEL A;  2EIO A;  3GHA A;  2YCD A;  3BCI A;  1SL2 B;  2CV4 A;  2FHE A;  2F51 A;  4FH8 A;  5B6N A;  2LKU A;  5DJL A;  4MF5 A;  4TOP A;  2CT6 A;  2YPM A;  4CW9 A;  2H6Y A;  2V6O A;  1S3C A;  3Q19 A;  3IK7 A;  3W6G A;  2LJA A;  5D9X A;  3GMF A;  4PQI A;  3CMI A;  2IMI A;  2DIZ A;  3LXZ A;  4ZIJ A;  1GSE A;  1TRS A;  5J4U A;  3J7Y b;  4MZB A;  4MCU A;  1GNW A;  2H8L A;  4GST A;  3DGQ A;  4V1A p;  2PMT A;  1A8L A;  2VD0 A;  3F4S A;  1MDI A;  3HD5 A;  2LTK A;  2HZE A;  4ECC A;  3KH9 A;  3KM6 A;  1ZGN A;  1PX7 A;  1A2J A;  3KEB A;  4F03 A;  4HEA 2;  3L9V A;  3VWV A;  5INY A;  1ACV A;  2G2Q A;  2PPT A;  3GKM A;  5G31 A;  1RK4 A;  3A2W A;  4LL4 B;  3VLN A;  4TR4 A;  4WET A;  4FYC A;  1OE7 A;  2GZY A;  3K8N A;  4HS1 A;  1XVW A;  3F3Q A;  3D21 A;  1O73 A;  3RPN A;  4POM A;  1BAY A;  4Q5R A;  4MF7 A;  1NW2 A;  5L71 A;  3FZ9 A;  2CVK A;  5F8B A;  1K3O A;  4E8E A;  4ISD A;  2MBS A;  3L0H A;  3GL5 A;  2B1L A;  1HQO A;  4KE3 A;  4Q5N A;  4X0X A;  2AV4 A;  1JFU A;  5LNK e;  1GTA A;  4RQR A;  4JR6 A;  5A5K A;  4TW5 A;  2VCX A;  1F3A A;  5B7C A;  2OA7 A;  1GP1 A;  1WWJ A;  1V57 A;  2H1A A;  3CSI A;  5F05 A;  2PVQ A;  1XFL A;  1V2A A;  1KTE A;  4MLY A;  5ID2 A;  4J2F A;  3APO A;  16GS A;  2IFQ A;  2LRC A;  4GLT A;  6GSY A;  2HT9 A;  3VK9 A;  1QUW A;  1KEB A;  4IJ3 A;  2C0E A;  5FWG A;  2HLS A;  4FYU A;  1J0F A;  5CNW A;  5KN3 A;  2B3S A;  1F37 A;  4XS6 A;  5B6M A;  1U6T A;  2CAQ A;  3D4M A;  2X99 A;  2DJJ A;  6GSX A;  3IC4 A;  2B5Y A;  4GXZ A;  3FZ5 A;  4LMV A;  1FVK A;  3N5O A;  5IMD A;  13GS A;  3UVT A; 
#chains in the Genus database with same CATH topology
 1EP7 A;  3TB2 A;  3H79 A;  5B8A A;  1OAZ A;  1LBK A;  3LWA A;  1U88 A;  3CYN A;  1XOA A;  3IK9 A;  2GGT A;  3EU4 A;  3HVS A;  4EC0 A;  3U5R E;  2B5E A;  3F8U A;  3C1S A;  4BVY B;  5D96 A;  3H1N A;  4HDE A;  4P3Y B;  1ZL9 A;  4XIH A;  3KMO A;  2IIY A;  4G19 A;  2QKE A;  4ZBB A;  1AQX A;  3G7J A;  4JE1 A;  4XRA A;  3IOS A;  2R2J A;  1GLP A;  5LCZ A;  2H6Z A;  2LRT A;  2N5A A;  3TKS A;  4I8B A;  2L4Q A;  3NOF A;  2GSQ A;  3IA1 A;  3IR4 A;  1Q4J A;  1A24 A;  3PR8 A;  4WR5 A;  1MD3 A;  3W8J A;  5CRD A;  5ECO B;  2BTO T;  1SJZ A;  3QDN A;  1THO A;  1GSD A;  1PQN A;  2IME A;  1Z7R A;  5E4W A;  3EMX A;  2VM1 A;  4GQF A;  1PD2 1;  2WDU A;  3TJF A;  4KGI A;  2B6M A;  4KB3 A;  3LQ7 A;  1EEJ A;  2JSZ A;  2AHE A;  1TTZ A;  1IYH A;  2VOC A;  4MPG A;  1M7T A;  4MF6 A;  2B7J A;  4K0N A;  3LG6 A;  2H70 A;  2REM A;  4NHZ A;  5DAL A;  2A2R A;  2LJR A;  5IMZ A;  5GAN D;  5AIV A;  2X4A A;  8GSS A;  1GTU A;  2GST A;  3US3 A;  2O85 A;  2GT5 A;  1GRX A;  5G5E A;  4WF5 A;  1VF1 A;  5CRH A;  2DBC A;  2PVO C;  4HU9 A;  4K5S A;  5IIZ A;  4RQX A;  3EUR A;  4JBB A;  2DIY A;  3QPM A;  1TP9 A;  3E3E A;  4DSQ A;  1SKW B;  3TUE A;  2P5Q A;  4KSO A;  5JCG A;  4DSR A;  1ZYQ B;  1OC8 A;  2WJU A;  4MJA A;  4K2X A;  3VWW A;  4XRD A;  3FR9 A;  3M1G A;  3RAZ A;  1JZW A;  2ZUP A;  4YH2 A;  4KCE A;  5DJM A;  4ILF A;  3UAR A;  2IWT A;  1M3J A;  3HCZ A;  3CTF A;  2IMF A;  2VAF A;  4J57 E;  5IO0 A;  2H72 A;  1GTB A;  5EY6 A;  2KP2 A;  2H66 A;  1YEX A;  5H5R A;  1GUL A;  3C73 A;  3R2Q A;  4TR0 A;  2RM5 A;  1TDI A;  1GUM A;  3UJ1 A;  3GSS A;  1X9W B;  3SWL A;  2YJH A;  1K0B A;  2FY6 A;  2YOI A;  1K0C A;  3IXR A;  2VM2 A;  2ALB A;  1B9Y C;  3M9K A;  4TR1 B;  2KLX A;  2FA4 A;  2R5G A;  4O5R A;  2RLI A;  2AUV A;  4POB A;  4PNG A;  1VGL A;  2JZT A;  1ERT A;  4RI6 A;  2H0I A;  1A0R P;  3LOR A;  5C00 A;  4EF0 A;  1M9B A;  5J9C A;  4MZC A;  5ID2 B;  4I97 A;  2DKH A;  2OKA A;  3F63 A;  3I43 A;  4HSC X;  1K0D A;  3EYT A;  1E6B A;  1WJK A;  2WCI A;  3A3T A;  4CY6 A;  2UZ8 A;  5LD0 A;  2A2S A;  1K3L A;  4YKF A;  4HU7 A;  2A2P A;  4ZXG A;  2LQO A;  2VL2 A;  4MZW A;  1DE1 A;  3GFK A;  4LL1 B;  2YWN A;  4MJE A;  5H5Q A;  1SJ6 A;  5DBQ A;  3PPU A;  3GA4 A;  3TKP A;  3UEM A;  5G30 A;  2L57 A;  3GUS A;  3KJY A;  2H76 A;  2R0C A;  1FB6 A;  3ZIJ A;  1FG4 A;  5CO3 A;  2RII A;  1SKR B;  4ZL8 A;  3IC8 A;  4G0K A;  1B8X A;  2R0G A;  3C1R A;  3L4N A;  2CVB A;  2TRC P;  1Y25 A;  1OVN A;  3LYP A;  5GAP D;  1USB A;  4KDX A;  3APS A;  1J9B A;  3CXG A;  3HZ8 A;  3HYP A;  1B9X C;  3IE3 A;  1N2A A;  3BD2 A;  3FK8 A;  2C3N A;  3TGZ A;  3TJJ A;  5EL8 A;  4IGJ A;  1PL2 A;  2FNO A;  1FVJ A;  5IMF A;  2CZ2 A;  1TU7 A;  4K8M A;  1QMV A;  5ECL B;  4EVM A;  2H1D A;  2GLR A;  1PRX A;  3TOU A;  4ACS A;  5HFI A;  1KBN A;  5IQY A;  2LJK A;  1O8W A;  5ECR B;  4X1U A;  3VWX A;  4OFT A;  5CRG A;  4KSM A;  2H30 A;  3FMW A;  4OFM A;  1AUC A;  5ECH B;  3GL3 A;  4GRF A;  3RPP A;  3TRX A;  4K7O A;  2YWM A;  4FIW A;  3PH9 A;  3ZTL A;  4ZB8 A;  2EIQ A;  4WF4 A;  2H0H A;  3QCP A;  3GKX A;  4EUY A;  2H1G A;  4O7H A;  1T7P B;  1UC7 A;  4GF0 A;  2O87 A;  1ST9 A;  3UOM A;  4A5P A;  2XC2 A;  1XZO A;  2VL9 A;  3UL3 A;  2TIR A;  1GL8 A;  5D9W A;  4MNN A;  3GKK A;  4YQV A;  2DSA A;  1NHO A;  1U87 A;  3GKN A;  3A5I A;  3ZMK A;  2R3X A;  4EDY A;  1Y6E A;  3UAP A;  3BOA A;  2LS5 A;  3QR6 A;  2WRT A;  1BYE A;  2CX4 A;  1TKD B;  4OD7 A;  2I3Y A;  2PUK C;  5F06 A;  3TKS E;  1AAZ A;  2L6D A;  1WOU A;  2KOK A;  2OAC A;  1O7U A;  3DIE A;  3MYD A;  5J9B A;  2LUS A;  1YKA A;  3HA9 A;  1XOB A;  3TDG A;  3GNJ A;  4FO5 A;  2LV3 A;  3DD3 A;  4OMV A;  2KHP A;  3F4T A;  4H86 A;  4AF2 A;  4X4J A;  4JED A;  1AXD A;  3Q74 A;  2HZF A;  2JAC A;  1BQ7 A;  4CDO A;  2I1U A;  1TI1 A;  2K9F A;  1J08 A;  2FA8 A;  4G2E A;  5EVO A;  2NDO A;  4HZ4 A;  2ZNM A;  1M2B A;  4XHM A;  2N5B A;  4GTU A;  4BWS A;  5A4W A;  1XWG A;  3ZIV A;  3IAS 2;  2M72 A;  4X43 A;  4L5O A;  3L78 A;  4HQS A;  5D73 A;  3MDK A;  4BL7 A;  3EU3 A;  1YF1 A;  3Q6O A;  1YEP A;  2GZZ A;  2F3M A;  2VO4 A;  4LA1 A;  5DAK B;  5GZZ B;  3C71 A;  4IHU A;  3QAW A;  5CRW A;  2VCW A;  2AB6 A;  3TKR A;  3TRQ A;  3GX0 A;  2FGX A;  5G2Z A;  4YKG A;  2XBI A;  4YQM A;  2CA8 A;  3F6F A;  4EIQ A;  2PU9 C;  1U3A A;  3DRN A;  5ECP B;  3ZRE A;  3LXT A;  3O3T A;  5J3R A;  5ELA A;  1WP0 A;  6GST A;  1T4Z A;  3FR3 A;  4F9Z A;  1K3Y A;  3CSJ A;  1QXH A;  3J7Y k;  3UIW A;  2ES7 A;  2B1K A;  3WGE A;  5ENU A;  2H01 A;  2BMX A;  1EGO A;  5ECK B;  1G6W A;  2IJY A;  2R4V A;  3TCO A;  2YJ7 A;  3FR6 A;  3DXB A;  1PGT A;  1W4V A;  1IYI A;  4ZB6 A;  4HQZ A;  2C3Q A;  4POK A;  1OC9 A;  4K7N A;  3LJR A;  4WR4 A;  3TKS C;  4TXV A;  1GSU A;  3O76 A;  6GSW A;  3IAM 2;  5CYY A;  5EPF A;  3FW2 A;  1Z6N A;  2V32 A;  4QQ7 A;  4JR4 A;  4KND A;  3E9J B;  1B4P A;  1TRU A;  2XBQ A;  1SD8 A;  1KNG A;  1V98 A;  2MZC A;  3N9J A;  4NPB A;  2JU5 A;  3MSZ A;  3FRC A;  3VFI A;  2M46 A;  4JZQ A;  3WGX A;  2QGV A;  1W89 A;  3KTL A;  2P5R A;  1AQV A;  3FY7 A;  1M3I A;  5AIX A;  3KH7 A;  1QGV A;  4PUR A;  1A2L A;  4AJ6 A;  2YWO A;  5KEJ A;  1MDJ A;  1PSQ A;  1X5D A;  2J9H A;  4IVF A;  4QL7 A;  1R26 A;  4XTS A;  1XXU A;  5CRE A;  4G0I A;  19GS A;  2C1Y A;  2X8C A;  1YDK A;  1FHE A;  3HHV A;  2DML A;  2WFC A;  2A4H A;  3HXS A;  2HSM A;  3KIJ A;  2VL3 A;  4TVE A;  1DBY A;  2OAD A;  1SYX A;  2FWG A;  5D8I A;  4KCA A;  3ERG A;  5DQY A;  3KZQ A;  1ZOF A;  4USS A;  2F8F A;  4EL1 A;  2EC4 A;  1DE2 A;  1R7H A;  2YN1 A;  3ZZX A;  18GS A;  1EWX A;  1PKW A;  3D5J A;  3UBK A;  4IQA A;  1HD2 A;  1TK0 B;  3IHG A;  1FOV A;  2GQL A;  2F9S A;  3ZVJ D;  4O5Q A;  4KX4 A;  1E2Y A;  1JLW A;  3LW9 A;  4MDC A;  1BX9 A;  3LYK A;  3UVH A;  4BA7 A;  3EIN A;  3ZRD A;  2WZ9 A;  1GSQ A;  2IMD A;  1JHB A;  4EDZ A;  4HI7 A;  5HFK A;  4FQU A;  5AIS A;  2HFD A;  3L9S A;  3P2A A;  2HE3 A;  2CAI A;  2D2Z A;  2VIM A;  3MWH A;  2C0D A;  3ED3 A;  2DJ1 A;  5G1K A;  2O89 A;  3WT2 A;  3A2V A;  4GSS A;  1SKS B;  3ZVJ A;  4MP4 A;  4XCS A;  1FO5 A;  4KDU A;  5GSS A;  1T4Y A;  2GQK A;  1B48 A;  5GST A;  1X9S B;  2H75 A;  3QAG A;  1I5G A;  4N10 A;  4OFN A;  1TU8 A;  1GUH A;  2HZE B;  3ZYW A;  4L5L A;  3GTU A;  6GSS A;  3QFB C;  4BL7 B;  1HNB A;  2VLV A;  2GSS A;  2YP6 A;  5IMV A;  4I6X A;  3WYW A;  3CTG A;  3DKS A;  2FWF A;  2MMZ A;  2VL2 C;  1HNA A;  2WS2 A;  3MNG A;  2AJQ B;  3VI5 A;  2C3T A;  2HYX A;  4PQH A;  3P90 A;  3GN3 A;  1A23 A;  3WD6 A;  4IN0 A;  3LEF A;  1O81 A;  1K0N A;  5FT3 A;  9GSS A;  3IBH A;  1G6Y A;  4V1A g;  4YQU A;  1M2A A;  1S3A A;  2HRF A;  2YWI A;  5KN0 A;  3WGD A;  3ZFB A;  3MAK A;  1B4Q A;  2JL4 A;  1GUK A;  4ICY A;  4N30 A;  1ILO A;  2HNL A;  3G9B A;  1XIY A;  3D22 A;  4Z2R A;  1R4W A;  1SJI A;  1PN9 A;  2QSI A;  4OO5 A;  1PL1 A;  3WT1 A;  1ZYN A;  2IPA A;  5G5F A;  2R6K A;  2ON7 A;  2OE1 A;  3CRU A;  3P7X A;  3GST A;  1G0T A;  3E0U A;  1H4O A;  1NHY A;  2E0Q A;  4V2N A;  4ECJ A;  4MJC A;  2FD3 A;  2B5X A;  4E8H A;  2IFQ B;  1OC9 B;  4WXT A;  4ZL7 A;  5IOW A;  4HUA A;  3LFL A;  1GTI A;  2OE0 A;  2VCV A;  1N8J A;  1LU4 A;  1GLQ A;  4O92 A;  2IMK A;  5CP1 A;  3HJO A;  1OC3 A;  3F0I A;  2TRX A;  4MPF A;  2K8V A;  3DML A;  1URM A;  1K0A A;  3APQ A;  1ZYE A;  4HOJ A;  3VUR A;  3NIV A;  1SL1 B;  4MH2 A;  4N0V A;  4HJM A;  2CVD A;  2VLT A;  2QA2 A;  5HR1 A;  4NMU A;  3GH6 A;  1SU9 A;  3BBY A;  1JZO A;  1RW1 A;  1K0O A;  2NVL A;  1NM3 A;  1M0U A;  3U6V A;  4NWY A;  12GS A;  2NBS A;  2H73 A;  2ON5 A;  3L9U A;  1K0M A;  4F82 A;  5D9V A;  3F6D A;  3VWU A;  2CZ3 A;  1Z6M A;  1U3I A;  2YV9 A;  3ERF A;  5E59 A;  1TRV A;  3BJ5 A;  3SBC A;  3CQF A;  1M99 A;  1T3B A;  1EOG A;  2JZS A;  1GWC A;  1XW9 A;  3FYG A;  2OJL A;  1ERV A;  1G7O A;  1XW6 A;  3H8Q A;  2R37 A;  1VF2 A;  2P0G A;  3IPZ A;  5BMU A;  2YAN A;  2C80 A;  3UMA A;  5ECM B;  1AQW A;  1WE0 A;  1VF4 A;  4GQC A;  3HY2 A;  1TRW A;  1FB0 A;  2FLS A;  3ME7 A;  1JZR A;  2LNT A;  1ZCP A;  3HVV A;  3DVW A;  3NZN A;  3HVX A;  3KP8 A;  2VUP A;  3D0Z A;  2DJ2 A;  2GDR A;  5JCU A;  2PGT A;  3KD0 A;  1SK1 A;  1C72 A;  4D73 A;  2Z9S A;  1ERW A;  2XPD A;  5IOX A;  4F2I A;  1JZD A;  3FZ4 A;  2MMN A;  3CSH A;  1H75 A;  4L0U A;  3F3R A;  3IHQ A;  2H1B A;  4OO4 A;  1FAA A;  4MA9 A;  1CQH A;  1PA3 A;  3DVX A;  4PTS A;  5DAL B;  2GS3 A;  1X5E A;  5HR0 A;  2K6V A;  2HRN A;  4ECI A;  1EV9 A;  5DCH A;  2LEG A;  5HFG A;  2DJK A;  1OKT A;  5J41 A;  4K9Z A;  2DMM A;  1ON4 A;  1XBS A;  1WPI A;  1WIK A;  1XPV A;  4IKH A;  4KUN A;  1XW5 A;  1Z7P A;  4MAB A;  2QC7 A;  1YY7 A;  1TI3 A;  4FYB A;  3ME8 A;  4ML6 A;  2HSH A;  4AJ8 A;  4OCE A;  4Z7X A;  4DSS A;  3W8S A;  3VPT A;  1XCC A;  2V41 A;  2AAW A;  2I81 A;  3KMN A;  1MDK A;  1QQ2 A;  3VI7 A;  4ZB9 A;  2IL3 A;  3M0F A;  2X8H A;  11GS A;  5KN2 A;  3IV4 A;  3ERW A;  1TW9 A;  1V9W A;  2OE3 A;  1FW1 A;  3M3M A;  4TXO A;  3TJB A;  4K2D A;  2LST A;  3G7Y A;  2VCQ A;  2L5O A;  2RM6 A;  4HZ2 A;  2FWE A;  3H4K A;  4IBP A;  4PGT A;  3DEX A;  3PGT A;  2L59 A;  1BG5 A;  3I9V 2;  2LNS A;  2FCH A;  3LGC A;  1SK0 A;  5F0G A;  22GS A;  4L0W A;  1ML6 A;  4NV5 A;  2VLU A;  1T00 A;  2VD1 A;  3O6T A;  2KP1 A;  3FHK A;  2OBI A;  1WMJ A;  3H93 A;  2PER A;  4YAP A;  3FKF A;  2JAD A;  2P31 A;  2OBK A;  4POL A;  2HI7 A;  2A4V A;  2YNX A;  3Q18 A;  5JWQ B;  1PX6 A;  3QAV A;  2GQM A;  1YF0 A;  4WEY A;  1XG8 A;  3EVI A;  1YQ1 A;  3UBL A;  1PKZ A;  4IP6 A;  3TJG A;  4LMW A;  4IW9 A;  3A2X A;  3LSZ A;  4LLR A;  2V6K A;  2DKI A;  4TR1 A;  1EOH A;  4K7I A;  2KUC A;  1MD4 A;  1TJD A;  1OE8 A;  4BWQ A;  1WRY A;  4EO3 A;  4MJB A;  2YV7 A;  4K0G A;  4IP1 A;  1UN2 A;  2WGR A;  4OWY A;  2X64 A;  4I2T A;  4ML1 A;  3HDC A;  1ERU A;  2IN3 A;  2H19 A;  4PUA A;  4GSN A;  6GSV A;  3FZA A;  4RUV A;  1EZK A;  2PN8 A;  3IDV A;  5DCG A;  5KN1 A;  2NTO A;  2V1M A;  3IRA A;  2MMO A;  2R0P A;  5IM9 A;  4NHW A;  1Z9H A;  2HRA A;  1Z5Y E;  4TKY A;  2LQQ A;  2LRN A;  2C0G A;  1HNC A;  3GYK A;  1RQM A;  2HRK A;  4MMM A;  2VCT A;  5D9T A;  2C8U A;  2PBJ A;  1S3D A;  1BJX A;  1XWB A;  1UVZ A;  4D73 B;  1TOF A;  1XWK A;  4JRR A;  4OCF A;  5BRT A;  4EIP A;  1MEK A;  1QFN A;  4QL9 A;  5IPG A;  17GS A;  4K5R A;  4RI7 A;  3GRX A;  20GS A;  4PXO A;  3ZFL A;  3M8N A;  4F0C A;  4TN8 A;  3A5W A;  4CY8 A;  5ECI B;  1YJ6 A;  1TK5 B;  1R5P A;  4WBJ A;  1Z3E A;  1EV4 A;  5IPH A;  2GZP A;  3QOU A;  1GSY A;  1F3B A;  3KXO A;  4XS1 A;  4BIK A;  2XHF A;  2GTU A;  3S9F A;  2XPE A;  5ABR A;  4K6X A;  5B8B A;  5IMA A;  4AJ7 A;  2WB9 A;  4G10 A;  4HJ2 A;  2PWJ A;  2DLX A;  2AYT A;  3EWL A;  1XWA A;  1TXX A;  5F07 A;  4DSS B;  4ULX A;  1XWC A;  3G7I A;  1Q98 A;  1NSW A;  4ZBA A;  3HJP A;  1QK8 A;  2YZH A;  5DDL A;  4CHS A;  5COH A;  4ZL9 A;  4NAX A;  1HYU A;  2L4C A;  1ZMA A;  2CX3 A;  2O7K A;  4Q5Q A;  3TRP A;  1PN0 A;  5ECS A;  14GS A;  4MK3 A;  2ZCT A;  3HZ4 A;  4XS4 A;  3C8E A;  3MIX A;  3RHC A;  5JWO B;  5AN1 A;  3QMX A;  1GSF A;  4TXO B;  4KA0 A;  4F0B A;  4NXI A;  3HVN A;  2RUE A;  3KTB A;  4PUF C;  4EXJ A;  1ABA A;  5DVB A;  2C4J A;  5D93 A;  5ELG A;  1GNE A;  2J23 A;  3V1W A;  4JU5 A;  1X5C A;  1UA5 A;  4ECB A;  5HR2 A;  5ECQ B;  4DEJ A;  2E7P A;  1SD9 A;  4G9H A;  3CRT A;  3DWV A;  3C7M A;  5JWR B;  1BED A;  3GX8 A;  2F8A A;  1YZX A;  2X8G A;  1V40 A;  2MBT A;  1ZYP A;  1TK8 B;  2HSY A;  1M9A A;  1O6J A;  5ECN B;  4N11 A;  5KOW A;  2DC5 A;  1F2E A;  4V2L A;  2BJX A;  4K1F A;  4KDY A;  5G1L A;  1F9M A;  2WUL A;  3QD9 A;  2NPB A;  2K8S A;  4L8E A;  2GSR A;  3KGK A;  1PFO A;  4IJI A;  1VRS D;  3PIN A;  1VF3 A;  3FEU A;  7GSS A;  2CQ9 A;  2YZU A;  2GT6 A;  3GV1 A;  1XVQ A;  2MYG A;  3KCM A;  5HQP A;  4YAV A;  1GSS A;  3M9J A;  3OR5 A;  2H0G A;  5DAK A;  4DVC A;  1DUG A;  3RHB A;  4V2M A;  4Q5F A;  1DSB A;  3D4T A;  1CQG A;  3I69 A;  4ZBD A;  2K18 A;  3ZML A;  1M2D A;  4EKZ A;  3HJM A;  3EC3 A;  3QFA C;  5A4V A;  2EIR A;  4KW6 A;  1R5A A;  3P8W A;  4BVX A;  1O85 A;  1YKC A;  1OKD A;  1V58 A;  4N0Z A;  3BCK A;  1LJR A;  1X0R A;  2M80 A;  3KP9 A;  3EMP A;  4NV2 A;  4Z2U A;  2L5L A;  4WBR D;  3ISO A;  3TJK A;  1PMT A;  4PQ1 A;  2V2G A;  1MTC A;  2O8V B;  4I5Q A;  2FUG 2;  2G0F A;  5DQS A;  3GH9 A;  1I9D A;  3GIX A;  1T1V A;  1EEM A;  3D6I A;  1AIU A;  2DJ3 A;  2FWH A;  1A0F A;  2QA1 A;  4KAE A;  4TR3 A;  2I4A A;  4TRX A;  5HR3 A;  3F4R A;  1ZZY A;  1SK2 A;  2I9H A;  2GVP A;  3CBU A;  4MH3 A;  4PNF A;  2E2G A;  3ZLP A;  3TOT A;  2H71 A;  1A8Y A;  4EE0 A;  5JCW A;  3TKQ A;  4J56 E;  4IS0 A;  1AC1 A;  3EE2 A;  1EGR A;  1G7E A;  4AGS A;  3HKR A;  2B7K A;  2JZR A;  1OYJ A;  4BPY A;  5H5S A;  4IQ1 A;  2H6X A;  5IO2 A;  5CAX A;  2VCZ A;  1EP8 A;  1GH2 A;  2H74 A;  4O32 A;  1FOH A;  1A2M A;  5A4U A;  3AY8 A;  3VPQ A;  1F6M C;  4I2U A;  3ZIT A;  4ZIL A;  4ID0 A;  2HXK A;  4GCI A;  2DJ0 A;  2MMA A;  4WKW A;  2C0F A;  2JSY A;  5J5N A;  5FHI A;  4BVY A;  2RUF A;  3ZL5 A;  1T8E B;  3F9U A;  1JLV A;  6GSU A;  4KH7 A;  3RDW A;  5IMC A;  1AW9 A;  4XS4 B;  1SEN A;  10GS A;  4GWR A;  1O8X A;  3GTU B;  5C04 A;  3GUR A;  4PX1 A;  2L6C A;  3RBT A;  1THX A;  2N5F A;  3I6A A;  1X9M B;  3EPT A;  3JCM L;  1SL0 B;  2X49 A;  5AGY A;  1SYR A;  2E2M A;  3DYR A;  4IEL A;  2EIO A;  3GHA A;  2YCD A;  3BCI A;  1SL2 B;  2CV4 A;  2FHE A;  5KOX A;  2F51 A;  4FH8 A;  5B6N A;  2LKU A;  5DJL A;  4MF5 A;  4TOP A;  2CT6 A;  2YPM A;  4CW9 A;  2H6Y A;  2V6O A;  1S3C A;  3Q19 A;  3IK7 A;  3W6G A;  2LJA A;  5D9X A;  3GMF A;  4PQI A;  3CMI A;  2IMI A;  2DIZ A;  3LXZ A;  4ZIJ A;  1GSE A;  1TRS A;  5J4U A;  3J7Y b;  4MZB A;  4MCU A;  1GNW A;  2H8L A;  4GST A;  3DGQ A;  4V1A p;  2PMT A;  1A8L A;  2VD0 A;  4G0L A;  3F4S A;  1MDI A;  3HD5 A;  2LTK A;  2HZE A;  4ECC A;  3KH9 A;  3KM6 A;  1ZGN A;  1PX7 A;  1A2J A;  3KEB A;  4F03 A;  4HEA 2;  3L9V A;  3VWV A;  5INY A;  1ACV A;  2G2Q A;  2PPT A;  3GKM A;  5G31 A;  1RK4 A;  3A2W A;  4LL4 B;  3VLN A;  1S3R A;  4TR4 A;  4WET A;  4FYC A;  1OE7 A;  2GZY A;  3K8N A;  4HS1 A;  1XVW A;  3F3Q A;  3D21 A;  1O73 A;  3RPN A;  4POM A;  1BAY A;  4Q5R A;  4MF7 A;  1NW2 A;  5L71 A;  3FZ9 A;  2CVK A;  5F8B A;  1K3O A;  4E8E A;  4ISD A;  2MBS A;  3L0H A;  3GL5 A;  2B1L A;  4BVX B;  1HQO A;  4KE3 A;  4Q5N A;  4X0X A;  2AV4 A;  1JFU A;  5LNK e;  1GTA A;  4RQR A;  4JR6 A;  5A5K A;  4TW5 A;  2VCX A;  1F3A A;  5B7C A;  2OA7 A;  1GP1 A;  1WWJ A;  1V57 A;  2H1A A;  3CSI A;  5F05 A;  4Z2T A;  2PVQ A;  1XFL A;  1V2A A;  1KTE A;  4MLY A;  5ID2 A;  4J2F A;  3APO A;  16GS A;  2IFQ A;  2LRC A;  4GLT A;  6GSY A;  2HT9 A;  4O5U A;  3VK9 A;  1QUW A;  1KEB A;  4IJ3 A;  2C0E A;  5FWG A;  2HLS A;  4FYU A;  1J0F A;  5CNW A;  5KN3 A;  2B3S A;  1F37 A;  4XS6 A;  5B6M A;  1U6T A;  2CAQ A;  3D4M A;  2X99 A;  2DJJ A;  6GSX A;  3IC4 A;  2B5Y A;  4GXZ A;  3FZ5 A;  4LMV A;  1FVK A;  3N5O A;  5IMD A;  4KF9 A;  13GS A;  3R3E A;  3UVT A; 
#chains in the Genus database with same CATH homology
 1EP7 A;  3TB2 A;  3H79 A;  5B8A A;  1OAZ A;  1LBK A;  3LWA A;  1U88 A;  3CYN A;  1XOA A;  3IK9 A;  2GGT A;  3EU4 A;  3HVS A;  4EC0 A;  3U5R E;  2B5E A;  3F8U A;  3C1S A;  4BVY B;  5D96 A;  3H1N A;  4HDE A;  4P3Y B;  1ZL9 A;  4XIH A;  3KMO A;  2IIY A;  4G19 A;  2QKE A;  4ZBB A;  1AQX A;  3G7J A;  4JE1 A;  4XRA A;  3IOS A;  2R2J A;  1GLP A;  5LCZ A;  2H6Z A;  2LRT A;  2N5A A;  3TKS A;  4I8B A;  2L4Q A;  3NOF A;  2GSQ A;  3IA1 A;  3IR4 A;  1Q4J A;  1A24 A;  3PR8 A;  4WR5 A;  1MD3 A;  3W8J A;  5CRD A;  5ECO B;  2BTO T;  1SJZ A;  3QDN A;  1THO A;  1GSD A;  1PQN A;  2IME A;  1Z7R A;  5E4W A;  3EMX A;  2VM1 A;  4GQF A;  1PD2 1;  2WDU A;  3TJF A;  4KGI A;  2B6M A;  4KB3 A;  3LQ7 A;  1EEJ A;  2JSZ A;  2AHE A;  1TTZ A;  1IYH A;  2VOC A;  4MPG A;  1M7T A;  4MF6 A;  2B7J A;  4K0N A;  3LG6 A;  2H70 A;  2REM A;  4NHZ A;  5DAL A;  2A2R A;  2LJR A;  5IMZ A;  5GAN D;  5AIV A;  2X4A A;  8GSS A;  1GTU A;  2GST A;  3US3 A;  2O85 A;  2GT5 A;  1GRX A;  5G5E A;  4WF5 A;  1VF1 A;  5CRH A;  2DBC A;  2PVO C;  4HU9 A;  4K5S A;  5IIZ A;  4RQX A;  3EUR A;  4JBB A;  2DIY A;  3QPM A;  1TP9 A;  3E3E A;  4DSQ A;  1SKW B;  3TUE A;  2P5Q A;  4KSO A;  5JCG A;  4DSR A;  1ZYQ B;  1OC8 A;  2WJU A;  4MJA A;  4K2X A;  3VWW A;  4XRD A;  3FR9 A;  3M1G A;  3RAZ A;  1JZW A;  2ZUP A;  4YH2 A;  4KCE A;  5DJM A;  4ILF A;  3UAR A;  2IWT A;  3HCZ A;  3CTF A;  2IMF A;  2VAF A;  4J57 E;  5IO0 A;  2H72 A;  1GTB A;  5EY6 A;  2KP2 A;  2H66 A;  1YEX A;  5H5R A;  1GUL A;  3C73 A;  3R2Q A;  4TR0 A;  2RM5 A;  1TDI A;  1GUM A;  3UJ1 A;  3GSS A;  1X9W B;  3SWL A;  2YJH A;  1K0B A;  2FY6 A;  2YOI A;  1K0C A;  3IXR A;  2VM2 A;  2ALB A;  1B9Y C;  3M9K A;  4TR1 B;  2KLX A;  2FA4 A;  2R5G A;  4O5R A;  2RLI A;  2AUV A;  4POB A;  4PNG A;  1VGL A;  2JZT A;  1ERT A;  4RI6 A;  2H0I A;  1A0R P;  3LOR A;  5C00 A;  4EF0 A;  1M9B A;  5J9C A;  4MZC A;  5ID2 B;  4I97 A;  2DKH A;  2OKA A;  3F63 A;  3I43 A;  1K0D A;  3EYT A;  1E6B A;  1WJK A;  2WCI A;  3A3T A;  4CY6 A;  2UZ8 A;  5LD0 A;  2A2S A;  1K3L A;  4YKF A;  4HU7 A;  2A2P A;  4ZXG A;  2LQO A;  2VL2 A;  4MZW A;  1DE1 A;  3GFK A;  4LL1 B;  2YWN A;  4MJE A;  5H5Q A;  1SJ6 A;  5DBQ A;  3PPU A;  3GA4 A;  3TKP A;  3UEM A;  5G30 A;  2L57 A;  3GUS A;  3KJY A;  2H76 A;  2R0C A;  1FB6 A;  3ZIJ A;  1FG4 A;  5CO3 A;  2RII A;  1SKR B;  4ZL8 A;  3IC8 A;  4G0K A;  1B8X A;  2R0G A;  3C1R A;  3L4N A;  2CVB A;  2TRC P;  1Y25 A;  1OVN A;  3LYP A;  5GAP D;  1USB A;  4KDX A;  3APS A;  1J9B A;  3CXG A;  3HZ8 A;  3HYP A;  1B9X C;  3IE3 A;  1N2A A;  3BD2 A;  3FK8 A;  2C3N A;  3TGZ A;  3TJJ A;  5EL8 A;  4IGJ A;  1PL2 A;  2FNO A;  1FVJ A;  5IMF A;  2CZ2 A;  1TU7 A;  4K8M A;  1QMV A;  5ECL B;  4EVM A;  2H1D A;  2GLR A;  1PRX A;  3TOU A;  4ACS A;  5HFI A;  1KBN A;  5IQY A;  2LJK A;  1O8W A;  5ECR B;  4X1U A;  3VWX A;  4OFT A;  5CRG A;  4KSM A;  2H30 A;  3FMW A;  4OFM A;  1AUC A;  5ECH B;  3GL3 A;  4GRF A;  3RPP A;  3TRX A;  4K7O A;  2YWM A;  4FIW A;  3PH9 A;  3ZTL A;  4ZB8 A;  2EIQ A;  4WF4 A;  2H0H A;  3QCP A;  3GKX A;  4EUY A;  2H1G A;  4O7H A;  1T7P B;  1UC7 A;  4GF0 A;  2O87 A;  1ST9 A;  3UOM A;  4A5P A;  2XC2 A;  1XZO A;  2VL9 A;  3UL3 A;  2TIR A;  1GL8 A;  5D9W A;  4MNN A;  3GKK A;  4YQV A;  2DSA A;  1NHO A;  1U87 A;  3GKN A;  3A5I A;  3ZMK A;  2R3X A;  4EDY A;  1Y6E A;  3UAP A;  3BOA A;  2LS5 A;  3QR6 A;  2WRT A;  1BYE A;  2CX4 A;  1TKD B;  4OD7 A;  2I3Y A;  2PUK C;  5F06 A;  3TKS E;  1AAZ A;  2L6D A;  1WOU A;  2KOK A;  2OAC A;  1O7U A;  3DIE A;  3MYD A;  5J9B A;  2LUS A;  1YKA A;  3HA9 A;  1XOB A;  3TDG A;  3GNJ A;  4FO5 A;  2LV3 A;  3DD3 A;  4OMV A;  2KHP A;  3F4T A;  4H86 A;  4AF2 A;  4X4J A;  4JED A;  1AXD A;  3Q74 A;  2HZF A;  2JAC A;  1BQ7 A;  4CDO A;  2I1U A;  1TI1 A;  2K9F A;  1J08 A;  2FA8 A;  4G2E A;  5EVO A;  2NDO A;  4HZ4 A;  2ZNM A;  1M2B A;  4XHM A;  2N5B A;  4GTU A;  4BWS A;  5A4W A;  1XWG A;  3ZIV A;  3IAS 2;  2M72 A;  4X43 A;  4L5O A;  3L78 A;  4HQS A;  5D73 A;  3MDK A;  4BL7 A;  3EU3 A;  1YF1 A;  3Q6O A;  1YEP A;  2GZZ A;  2F3M A;  2VO4 A;  4LA1 A;  5DAK B;  5GZZ B;  3C71 A;  4IHU A;  3QAW A;  5CRW A;  2VCW A;  2AB6 A;  3TKR A;  3TRQ A;  3GX0 A;  2FGX A;  5G2Z A;  4YKG A;  2XBI A;  4YQM A;  2CA8 A;  3F6F A;  4EIQ A;  2PU9 C;  1U3A A;  3DRN A;  5ECP B;  3ZRE A;  3LXT A;  3O3T A;  5J3R A;  5ELA A;  1WP0 A;  6GST A;  1T4Z A;  3FR3 A;  4F9Z A;  1K3Y A;  3CSJ A;  1QXH A;  3J7Y k;  3UIW A;  2ES7 A;  2B1K A;  3WGE A;  5ENU A;  2H01 A;  2BMX A;  1EGO A;  5ECK B;  1G6W A;  2IJY A;  2R4V A;  3TCO A;  2YJ7 A;  3FR6 A;  3DXB A;  1PGT A;  1W4V A;  1IYI A;  4ZB6 A;  4HQZ A;  2C3Q A;  4POK A;  1OC9 A;  4K7N A;  3LJR A;  4WR4 A;  3TKS C;  4TXV A;  1GSU A;  3O76 A;  6GSW A;  3IAM 2;  5CYY A;  5EPF A;  3FW2 A;  1Z6N A;  2V32 A;  4QQ7 A;  4JR4 A;  4KND A;  3E9J B;  1B4P A;  1TRU A;  2XBQ A;  1SD8 A;  1KNG A;  1V98 A;  2MZC A;  3N9J A;  4NPB A;  2JU5 A;  3MSZ A;  3FRC A;  3VFI A;  2M46 A;  4JZQ A;  3WGX A;  2QGV A;  1W89 A;  3KTL A;  2P5R A;  1AQV A;  3FY7 A;  5AIX A;  3KH7 A;  1QGV A;  4PUR A;  1A2L A;  4AJ6 A;  2YWO A;  5KEJ A;  1MDJ A;  1PSQ A;  1X5D A;  2J9H A;  4IVF A;  4QL7 A;  1R26 A;  4XTS A;  1XXU A;  5CRE A;  4G0I A;  19GS A;  2C1Y A;  2X8C A;  1YDK A;  1FHE A;  3HHV A;  2DML A;  2WFC A;  2A4H A;  3HXS A;  2HSM A;  3KIJ A;  2VL3 A;  4TVE A;  1DBY A;  2OAD A;  1SYX A;  2FWG A;  5D8I A;  4KCA A;  3ERG A;  5DQY A;  3KZQ A;  1ZOF A;  4USS A;  2F8F A;  4EL1 A;  2EC4 A;  1DE2 A;  1R7H A;  2YN1 A;  3ZZX A;  18GS A;  1EWX A;  1PKW A;  3D5J A;  3UBK A;  4IQA A;  1HD2 A;  1TK0 B;  3IHG A;  1FOV A;  2GQL A;  2F9S A;  3ZVJ D;  4O5Q A;  4KX4 A;  1E2Y A;  1JLW A;  3LW9 A;  4MDC A;  1BX9 A;  3LYK A;  3UVH A;  4BA7 A;  3EIN A;  3ZRD A;  2WZ9 A;  1GSQ A;  2IMD A;  1JHB A;  4EDZ A;  4HI7 A;  5HFK A;  4FQU A;  5AIS A;  2HFD A;  3L9S A;  3P2A A;  2HE3 A;  2CAI A;  2D2Z A;  2VIM A;  3MWH A;  2C0D A;  3ED3 A;  2DJ1 A;  5G1K A;  2O89 A;  3WT2 A;  3A2V A;  4GSS A;  1SKS B;  3ZVJ A;  4MP4 A;  4XCS A;  1FO5 A;  4KDU A;  5GSS A;  1T4Y A;  2GQK A;  1B48 A;  5GST A;  1X9S B;  2H75 A;  3QAG A;  1I5G A;  4N10 A;  4OFN A;  1TU8 A;  1GUH A;  2HZE B;  3ZYW A;  4L5L A;  3GTU A;  6GSS A;  3QFB C;  4BL7 B;  1HNB A;  2VLV A;  2GSS A;  2YP6 A;  5IMV A;  4I6X A;  3WYW A;  3CTG A;  3DKS A;  2FWF A;  2MMZ A;  2VL2 C;  1HNA A;  2WS2 A;  3MNG A;  2AJQ B;  3VI5 A;  2C3T A;  2HYX A;  4PQH A;  3P90 A;  3GN3 A;  1A23 A;  3WD6 A;  4IN0 A;  3LEF A;  1O81 A;  1K0N A;  5FT3 A;  9GSS A;  3IBH A;  1G6Y A;  4V1A g;  4YQU A;  1M2A A;  1S3A A;  2HRF A;  2YWI A;  5KN0 A;  3WGD A;  3ZFB A;  3MAK A;  1B4Q A;  2JL4 A;  1GUK A;  4ICY A;  4N30 A;  1ILO A;  2HNL A;  3G9B A;  1XIY A;  3D22 A;  4Z2R A;  1R4W A;  1SJI A;  1PN9 A;  2QSI A;  4OO5 A;  1PL1 A;  3WT1 A;  1ZYN A;  2IPA A;  5G5F A;  2R6K A;  2ON7 A;  2OE1 A;  3CRU A;  3P7X A;  3GST A;  1G0T A;  3E0U A;  1H4O A;  1NHY A;  2E0Q A;  4V2N A;  4ECJ A;  4MJC A;  2FD3 A;  2B5X A;  4E8H A;  2IFQ B;  1OC9 B;  4WXT A;  4ZL7 A;  5IOW A;  4HUA A;  3LFL A;  1GTI A;  2OE0 A;  2VCV A;  1N8J A;  1LU4 A;  1GLQ A;  4O92 A;  2IMK A;  5CP1 A;  3HJO A;  1OC3 A;  3F0I A;  2TRX A;  4MPF A;  2K8V A;  3DML A;  1URM A;  1K0A A;  3APQ A;  1ZYE A;  4HOJ A;  3VUR A;  3NIV A;  1SL1 B;  4MH2 A;  4N0V A;  4HJM A;  2CVD A;  2VLT A;  2QA2 A;  5HR1 A;  4NMU A;  3GH6 A;  1SU9 A;  3BBY A;  1JZO A;  1RW1 A;  1K0O A;  2NVL A;  1NM3 A;  1M0U A;  3U6V A;  4NWY A;  12GS A;  2NBS A;  2H73 A;  2ON5 A;  3L9U A;  1K0M A;  4F82 A;  5D9V A;  3F6D A;  3VWU A;  2CZ3 A;  1Z6M A;  1U3I A;  2YV9 A;  3ERF A;  5E59 A;  1TRV A;  3BJ5 A;  3SBC A;  1M99 A;  1T3B A;  1EOG A;  2JZS A;  1GWC A;  1XW9 A;  3FYG A;  2OJL A;  1ERV A;  1G7O A;  1XW6 A;  3H8Q A;  2R37 A;  1VF2 A;  2P0G A;  3IPZ A;  5BMU A;  2YAN A;  2C80 A;  3UMA A;  5ECM B;  1AQW A;  1WE0 A;  1VF4 A;  4GQC A;  3HY2 A;  1TRW A;  1FB0 A;  2FLS A;  3ME7 A;  1JZR A;  2LNT A;  1ZCP A;  3HVV A;  3DVW A;  3NZN A;  3HVX A;  3KP8 A;  2VUP A;  3D0Z A;  2DJ2 A;  2GDR A;  5JCU A;  2PGT A;  3KD0 A;  1SK1 A;  1C72 A;  4D73 A;  2Z9S A;  1ERW A;  2XPD A;  5IOX A;  4F2I A;  1JZD A;  3FZ4 A;  2MMN A;  3CSH A;  1H75 A;  4L0U A;  3F3R A;  3IHQ A;  2H1B A;  4OO4 A;  1FAA A;  4MA9 A;  1CQH A;  1PA3 A;  3DVX A;  4PTS A;  5DAL B;  2GS3 A;  1X5E A;  5HR0 A;  2K6V A;  2HRN A;  4ECI A;  1EV9 A;  5DCH A;  2LEG A;  5HFG A;  2DJK A;  1OKT A;  5J41 A;  4K9Z A;  2DMM A;  1ON4 A;  1XBS A;  1WPI A;  1WIK A;  1XPV A;  4IKH A;  4KUN A;  1XW5 A;  1Z7P A;  4MAB A;  2QC7 A;  1YY7 A;  1TI3 A;  4FYB A;  3ME8 A;  4ML6 A;  2HSH A;  4AJ8 A;  4OCE A;  4Z7X A;  4DSS A;  3W8S A;  3VPT A;  1XCC A;  2V41 A;  2AAW A;  2I81 A;  3KMN A;  1MDK A;  1QQ2 A;  3VI7 A;  4ZB9 A;  2IL3 A;  3M0F A;  2X8H A;  11GS A;  5KN2 A;  3IV4 A;  3ERW A;  1TW9 A;  1V9W A;  2OE3 A;  1FW1 A;  3M3M A;  4TXO A;  3TJB A;  4K2D A;  2LST A;  3G7Y A;  2VCQ A;  2L5O A;  2RM6 A;  4HZ2 A;  2FWE A;  3H4K A;  4IBP A;  4PGT A;  3DEX A;  3PGT A;  2L59 A;  1BG5 A;  3I9V 2;  2LNS A;  2FCH A;  3LGC A;  1SK0 A;  5F0G A;  22GS A;  4L0W A;  1ML6 A;  4NV5 A;  2VLU A;  1T00 A;  2VD1 A;  3O6T A;  2KP1 A;  3FHK A;  2OBI A;  1WMJ A;  3H93 A;  2PER A;  4YAP A;  3FKF A;  2JAD A;  2P31 A;  2OBK A;  4POL A;  2HI7 A;  2A4V A;  2YNX A;  3Q18 A;  5JWQ B;  1PX6 A;  3QAV A;  2GQM A;  1YF0 A;  4WEY A;  3EVI A;  1YQ1 A;  3UBL A;  1PKZ A;  4IP6 A;  3TJG A;  4LMW A;  4IW9 A;  3A2X A;  3LSZ A;  4LLR A;  2V6K A;  2DKI A;  4TR1 A;  1EOH A;  4K7I A;  2KUC A;  1MD4 A;  1TJD A;  1OE8 A;  4BWQ A;  1WRY A;  4EO3 A;  4MJB A;  2YV7 A;  4K0G A;  4IP1 A;  1UN2 A;  2WGR A;  4OWY A;  2X64 A;  4I2T A;  4ML1 A;  3HDC A;  1ERU A;  2IN3 A;  2H19 A;  4PUA A;  4GSN A;  6GSV A;  3FZA A;  4RUV A;  1EZK A;  2PN8 A;  3IDV A;  5DCG A;  5KN1 A;  2NTO A;  2V1M A;  3IRA A;  2MMO A;  2R0P A;  5IM9 A;  4NHW A;  1Z9H A;  2HRA A;  1Z5Y E;  4TKY A;  2LQQ A;  2LRN A;  2C0G A;  1HNC A;  3GYK A;  1RQM A;  2HRK A;  4MMM A;  2VCT A;  5D9T A;  2C8U A;  2PBJ A;  1S3D A;  1BJX A;  1XWB A;  1UVZ A;  4D73 B;  1TOF A;  1XWK A;  4JRR A;  4OCF A;  5BRT A;  4EIP A;  1MEK A;  1QFN A;  4QL9 A;  5IPG A;  17GS A;  4K5R A;  4RI7 A;  3GRX A;  20GS A;  4PXO A;  3ZFL A;  3M8N A;  4F0C A;  4TN8 A;  3A5W A;  4CY8 A;  5ECI B;  1YJ6 A;  1TK5 B;  1R5P A;  4WBJ A;  1Z3E A;  1EV4 A;  5IPH A;  2GZP A;  3QOU A;  1GSY A;  1F3B A;  3KXO A;  4XS1 A;  2XHF A;  2GTU A;  3S9F A;  2XPE A;  5ABR A;  4K6X A;  5B8B A;  5IMA A;  4AJ7 A;  2WB9 A;  4G10 A;  4HJ2 A;  2PWJ A;  2DLX A;  2AYT A;  3EWL A;  1XWA A;  1TXX A;  5F07 A;  4DSS B;  4ULX A;  1XWC A;  3G7I A;  1Q98 A;  1NSW A;  4ZBA A;  3HJP A;  1QK8 A;  2YZH A;  5DDL A;  4CHS A;  5COH A;  4ZL9 A;  4NAX A;  1HYU A;  2L4C A;  1ZMA A;  2CX3 A;  2O7K A;  4Q5Q A;  3TRP A;  1PN0 A;  5ECS A;  14GS A;  4MK3 A;  2ZCT A;  3HZ4 A;  4XS4 A;  3C8E A;  3MIX A;  3RHC A;  5JWO B;  5AN1 A;  3QMX A;  1GSF A;  4TXO B;  4KA0 A;  4F0B A;  4NXI A;  2RUE A;  3KTB A;  4PUF C;  4EXJ A;  1ABA A;  5DVB A;  2C4J A;  5D93 A;  5ELG A;  1GNE A;  2J23 A;  3V1W A;  4JU5 A;  1X5C A;  1UA5 A;  4ECB A;  5HR2 A;  5ECQ B;  4DEJ A;  2E7P A;  1SD9 A;  4G9H A;  3CRT A;  3DWV A;  3C7M A;  5JWR B;  1BED A;  3GX8 A;  2F8A A;  1YZX A;  2X8G A;  1V40 A;  2MBT A;  1ZYP A;  1TK8 B;  2HSY A;  1M9A A;  1O6J A;  5ECN B;  4N11 A;  5KOW A;  2DC5 A;  1F2E A;  4V2L A;  2BJX A;  4K1F A;  4KDY A;  5G1L A;  1F9M A;  2WUL A;  3QD9 A;  2NPB A;  2K8S A;  4L8E A;  2GSR A;  3KGK A;  4IJI A;  1VRS D;  3PIN A;  1VF3 A;  3FEU A;  7GSS A;  2CQ9 A;  2YZU A;  2GT6 A;  3GV1 A;  1XVQ A;  2MYG A;  3KCM A;  5HQP A;  4YAV A;  1GSS A;  3M9J A;  3OR5 A;  2H0G A;  5DAK A;  4DVC A;  1DUG A;  3RHB A;  4V2M A;  4Q5F A;  1DSB A;  3D4T A;  1CQG A;  3I69 A;  4ZBD A;  2K18 A;  3ZML A;  1M2D A;  4EKZ A;  3HJM A;  3EC3 A;  3QFA C;  5A4V A;  2EIR A;  4KW6 A;  1R5A A;  3P8W A;  4BVX A;  1O85 A;  1YKC A;  1OKD A;  1V58 A;  4N0Z A;  3BCK A;  1LJR A;  1X0R A;  2M80 A;  3KP9 A;  3EMP A;  4NV2 A;  4Z2U A;  2L5L A;  4WBR D;  3ISO A;  3TJK A;  1PMT A;  4PQ1 A;  2V2G A;  1MTC A;  2O8V B;  4I5Q A;  2FUG 2;  2G0F A;  5DQS A;  3GH9 A;  1I9D A;  3GIX A;  1T1V A;  1EEM A;  3D6I A;  1AIU A;  2DJ3 A;  2FWH A;  1A0F A;  2QA1 A;  4KAE A;  4TR3 A;  2I4A A;  4TRX A;  5HR3 A;  3F4R A;  1ZZY A;  1SK2 A;  2I9H A;  2GVP A;  3CBU A;  4MH3 A;  4PNF A;  2E2G A;  3ZLP A;  3TOT A;  2H71 A;  1A8Y A;  4EE0 A;  5JCW A;  3TKQ A;  4J56 E;  4IS0 A;  1AC1 A;  3EE2 A;  1EGR A;  1G7E A;  4AGS A;  3HKR A;  2B7K A;  2JZR A;  1OYJ A;  4BPY A;  5H5S A;  4IQ1 A;  2H6X A;  5IO2 A;  5CAX A;  2VCZ A;  1EP8 A;  1GH2 A;  2H74 A;  4O32 A;  1FOH A;  1A2M A;  5A4U A;  3AY8 A;  3VPQ A;  1F6M C;  4I2U A;  3ZIT A;  4ZIL A;  4ID0 A;  2HXK A;  4GCI A;  2DJ0 A;  2MMA A;  4WKW A;  2C0F A;  2JSY A;  5J5N A;  5FHI A;  4BVY A;  2RUF A;  3ZL5 A;  1T8E B;  3F9U A;  1JLV A;  6GSU A;  4KH7 A;  3RDW A;  5IMC A;  1AW9 A;  4XS4 B;  1SEN A;  10GS A;  4GWR A;  1O8X A;  3GTU B;  5C04 A;  3GUR A;  4PX1 A;  2L6C A;  3RBT A;  1THX A;  2N5F A;  3I6A A;  1X9M B;  3EPT A;  3JCM L;  1SL0 B;  2X49 A;  5AGY A;  1SYR A;  2E2M A;  3DYR A;  4IEL A;  2EIO A;  3GHA A;  2YCD A;  3BCI A;  1SL2 B;  2CV4 A;  2FHE A;  5KOX A;  2F51 A;  4FH8 A;  5B6N A;  2LKU A;  5DJL A;  4MF5 A;  4TOP A;  2CT6 A;  2YPM A;  4CW9 A;  2H6Y A;  2V6O A;  1S3C A;  3Q19 A;  3IK7 A;  3W6G A;  2LJA A;  5D9X A;  3GMF A;  4PQI A;  3CMI A;  2IMI A;  2DIZ A;  3LXZ A;  4ZIJ A;  1GSE A;  1TRS A;  5J4U A;  3J7Y b;  4MZB A;  4MCU A;  1GNW A;  2H8L A;  4GST A;  3DGQ A;  4V1A p;  2PMT A;  1A8L A;  2VD0 A;  4G0L A;  3F4S A;  1MDI A;  3HD5 A;  2LTK A;  2HZE A;  4ECC A;  3KH9 A;  3KM6 A;  1ZGN A;  1PX7 A;  1A2J A;  3KEB A;  4F03 A;  4HEA 2;  3L9V A;  3VWV A;  5INY A;  1ACV A;  2G2Q A;  2PPT A;  3GKM A;  5G31 A;  1RK4 A;  3A2W A;  4LL4 B;  3VLN A;  4TR4 A;  4WET A;  4FYC A;  1OE7 A;  2GZY A;  3K8N A;  4HS1 A;  1XVW A;  3F3Q A;  3D21 A;  1O73 A;  3RPN A;  4POM A;  1BAY A;  4Q5R A;  4MF7 A;  1NW2 A;  5L71 A;  3FZ9 A;  2CVK A;  5F8B A;  1K3O A;  4E8E A;  4ISD A;  2MBS A;  3L0H A;  3GL5 A;  2B1L A;  4BVX B;  1HQO A;  4KE3 A;  4Q5N A;  4X0X A;  2AV4 A;  1JFU A;  5LNK e;  1GTA A;  4RQR A;  4JR6 A;  5A5K A;  4TW5 A;  2VCX A;  1F3A A;  5B7C A;  2OA7 A;  1GP1 A;  1WWJ A;  1V57 A;  2H1A A;  3CSI A;  5F05 A;  4Z2T A;  2PVQ A;  1XFL A;  1V2A A;  1KTE A;  4MLY A;  5ID2 A;  4J2F A;  3APO A;  16GS A;  2IFQ A;  2LRC A;  4GLT A;  6GSY A;  2HT9 A;  4O5U A;  3VK9 A;  1QUW A;  1KEB A;  4IJ3 A;  2C0E A;  5FWG A;  2HLS A;  4FYU A;  1J0F A;  5CNW A;  5KN3 A;  2B3S A;  1F37 A;  4XS6 A;  5B6M A;  1U6T A;  2CAQ A;  3D4M A;  2X99 A;  2DJJ A;  6GSX A;  3IC4 A;  2B5Y A;  4GXZ A;  3FZ5 A;  4LMV A;  1FVK A;  3N5O A;  5IMD A;  4KF9 A;  13GS A;  3R3E A;  3UVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...