4GXZA

Crystal structure of a periplasmic thioredoxin-like protein from salmonella enterica serovar typhimurium
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
178
structure length
178
Chain Sequence
DQEKQIENLIHAALFNDPASPRIGAKHPKLTLVNFTDYNCPYCKQLDPMLEKIVQKYPDVAVIIKPLPFKGESSVLAARIALTTWREHPQQFLALHEKLMQKRVYHTDDSIKQAQQKAGATPVTLDEKSMETIRTNLQLARLVGVQGTPATIIGDELIPGAVPWDTLEAVVKEKLASA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Suppression of copper sensitivity protein
publication title Structural and functional characterization of ScsC, a periplasmic thioredoxin-like protein from Salmonella enterica serovar Typhimurium
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Isomerase
total genus 64
structure length 178
sequence length 178
chains with identical sequence B, C, D
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4gxzA00
3BCIA 2IPAA 2O85A 2HNLA 1TJDA 2PBJA 1GTBA 2AJQB 1E2YA 1O73A 3H93A 4O7HA 2V1MA 4TVEA 4XS6A 4TN8A 19GSA 1PD21 2O7KA 2PPTA 1GNWA 4MJAA 3FR6A 5LD0A 2FY6A 2OKAA 1F9MA 4JBBA 1PX6A 2ALBA 4NXIA 2LJAA 2VAFA 4WKWA 4LA1A 5ID2A 2FUG2 2JL4A 3GSTA 2A2RA 2MZCA 5IO2A 3KH9A 3LGCA 4FYUA 1SENA 2DBCA 4RI6A 2CQ9A 1WJKA 2XBIA 2JZSA 2H70A 2L59A 3ZLPA 1M2DA 2LNTA 1KTEA 1XVQA 3ZVJA 2I9HA 1G7EA 3C71A 1GH2A 3TRXA 1O6JA 4DSQA 1J08A 5EY6A 5HR2A 1MEKA 4TXOA 4RI7A 5KN1A 2H66A 3QDNA 4GCIA 1M2AA 5D9VA 2RM6A 4I97A 2TIRA 1DE1A 5DDLA 1ERTA 1OC9A 3TRQA 2D2ZA 1T1VA 4OWYA 1X9MB 1SL1B 3HJOA 3US3A 1R7HA 1T00A 3HVVA 1B8XA 2CT6A 3IK7A 4MLYA 2J23A 3ZREA 3KMNA 14GSA 4CHSA 2CA8A 3F4SA 3L9UA 1R4WA 1NM3A 1GSUA 5ECRB 3UL3A 4LMVA 4V1Ap 3UOMA 2HZEA 5CP1A 1MDJA 5G1LA 5ECSA 1U3AA 3L4NA 5G5FA 3KTLA 3WGXA 5JCUA 1YEXA 2DSAA 5D9WA 5DJLA 5CAXA 4EE0A 2OE3A 4KDUA 1C72A 3EURA 2I4AA 3HJMA 1GUHA 4HOJA 1JZRA 4FIWA 3GTUA 1VF1A 1YJ6A 1O8WA 1U6TA 2GVPA 3TCOA 2H6ZA 4K2DA 5GSSA 3RHCA 4ISDA 4ZIJA 5IIZA 1DE2A 4EVMA 2NPBA 1NW2A 1FG4A 4QQ7A 1RK4A 2KHPA 4GQFA 3F3RA 3R2QA 4GSSA 4ZB9A 9GSSA 1ZZYA 4JU5A 4MCUA 2B3SA 1BAYA 3DWVA 1WIKA 1SU9A 1Z7RA 4ZB8A 5IMDA 4MZCA 3IC4A 5HQPA 5ECNB 5C00A 3C7MA 1FB0A 5AGYA 4KE3A 5DALA 3VWUA 2FWGA 3U5RE 2HFDA 1ZYQB 3ERGA 2F8AA 4G9HA 2JACA 3L78A 2F8FA 4PQIA 2BMXA 3VLNA 3TJKA 5F07A 1A2LA 4JR6A 2V6OA 1YY7A 1RW1A 2H01A 1BX9A 4IS0A 1TU7A 4HZ2A 1A0FA 1Y6EA 4J2FA 5H5QA 4F0BA 4JE1A 3ERWA 3ZIJA 3GN3A 1XBSA 6GSSA 2GDRA 2DIYA 1AQWA 4HEA2 4WR5A 2IMKA 3EMPA 1PKZA 1WP0A 1QGVA 2JZRA 1XCCA 4GXZA 4N30A 3GRXA 2QC7A 4ZL9A 1VGLA 2OADA 1PQNA 2YV7A 3F6DA 3KXOA 2CVBA 3NZNA 5GSTA 3QFAC 5FT3A 4MZBA 1GSEA 2VM1A 2VOCA 5AIVA 3DRNA 4KSOA 3P8WA 1EP8A 2ZNMA 2C80A 4N0VA 3WD6A 1TI3A 2MMAA 1GSSA 1U3IA 2E7PA 2V32A 4TR4A 4OFMA 2RUEA 3RAZA 1V98A 1TKDB 1LJRA 3JCML 5HFKA 4WF4A 4K0NA 1UN2A 2GSQA 1XWKA 2WGRA 2ZUPA 3J7Yb 3IK9A 2QKEA 3M1GA 3DYRA 2DJKA 2LUSA 3W8JA 4EL1A 4MABA 5IMFA 1A23A 4K7OA 4V2NA 1SD9A 1X0RA 5FHIA 3MWHA 3ZMLA 2LQQA 3CRTA 1THXA 3PINA 3GKXA 2ZCTA 4ZXGA 4RUVA 3M3MA 2FHEA 1X5CA 5ENUA 4EKZA 3KEBA 3FZ9A 3WYWA 5J5NA 4MK3A 1OE7A 2X99A 5B7CA 2R5GA 4ZBDA 1YDKA 2C0EA 4G2EA 3IAM2 2PWJA 5G30A 3DIEA 3KCMA 5CRWA 3ZFLA 1Z7PA 4HUAA 1B4PA 2N5AA 3CRUA 2YNXA 4GSTA 5DVBA 1G6WA 3VWXA 5ECOB 2LS5A 2A4VA 2RLIA 4J56E 3TJJA 3FR3A 3N5OA 4HZ4A 5G1KA 3BBYA 3EVIA 1F2EA 2GT5A 2CAIA 3TKSC 1JZDA 4ZILA 1W89A 4LL4B 4K7IA 5IM9A 4DEJA 3HD5A 3ZL5A 4Q5RA 3WT1A 4WEYA 4G19A 1SK1A 1E6BA 2VL2C 4NPBA 3ZIVA 3E0UA 3APQA 4N0ZA 4F82A 5DBQA 2H1AA 4BWQA 1GP1A 4QL9A 5ECIB 2FWFA 2MMZA 1GUKA 5D96A 4IP1A 1GSYA 1ST9A 5ECMB 4JRRA 1GSFA 3HVXA 2HI7A 3D0ZA 1VF2A 3GHAA 1O7UA 1XW5A 4DSRA 1J0FA 2V6KA 4EXJA 1XWGA 2TRXA 3LWAA 3GFKA 2H72A 1ZYEA 2AB6A 1VRSD 1TU8A 4TR1A 5ECPB 2JU5A 4ZL8A 1XVWA 1SL0B 3SWLA 5DAKB 5DJMA 5DQYA 1JLVA 1XPVA 1M0UA 2VCXA 1M2BA 2O8VB 5ELAA 3TJFA 2HE3A 5CYYA 1ML6A 2C0DA 1R5PA 5INYA 4FYCA 2GZYA 3CMIA 3IHQA 4ECJA 1Q4JA 2H6XA 5F8BA 1Z5YE 1YF1A 4XS1A 2PU9C 2EC4A 5D9XA 2LSTA 1URMA 2IMIA 4MPGA 2FA8A 5JCWA 4NMUA 1AQVA 4WR4A 3HCZA 2PVOC 3HDCA 3DVXA 2PMTA 2M72A 5ELGA 3QOUA 3Q19A 2CVDA 1AC1A 1B48A 1JZOA 2K6VA 3ZRDA 5EPFA 3KM6A 1B4QA 3O6TA 1Z6MA 4K7NA 1PKWA 3ZYWA 1MDKA 2C1YA 3GX0A 2YANA 3KJYA 2X8GA 4OO4A 5DQSA 5ECQB 4F03A 1ZL9A 3KZQA 3HKRA 5KN0A 5EL8A 3G7IA 1TDIA 6GSXA 2DLXA 3UIWA 2H75A 4I2TA 1EEJA 3DMLA 5IPHA 4MJEA 4ECBA 3LXZA 1K0MA 2GQLA 3L9VA 2WDUA 1XW6A 4ECCA 3D6IA 3G7YA 2X8CA 4PX1A 4IELA 1TRVA 2P31A 1M99A 3GKNA 1TXXA 1MDIA 5D93A 3HYPA 3G9BA 1OC3A 3ZFBA 2PUKC 4H86A 4ML6A 4GLTA 3QAWA 4MF6A 1PA3A 1WPIA 5GAND 1T3BA 1N8JA 2OA7A 3QMXA 4K6XA 3D4MA 4MJBA 3GMFA 3ME7A 2M46A 2VUPA 3L0HA 1K3LA 1HNAA 2B1KA 2EIOA 1A24A 1EGOA 2CZ3A 4L8EA 2REMA 3DEXA 4JZQA 13GSA 2WB9A 4BWSA 3KP9A 3KTBA 5AIXA 4F9ZA 4PQ1A 3BJ5A 1TRWA 3TRPA 3EWLA 3ZVJD 2WZ9A 3QAGA 4MA9A 1J9BA 2VLUA 1O8XA 3FW2A 1X5EA 1KNGA 2GSTA 1HQOA 2RM5A 4WBJA 2L5OA 2YPMA 1CQGA 3KIJA 2R37A 4FH8A 3GA4A 2TRCP 1V40A 1BEDA 4POBA 3C8EA 3ED3A 4PURA 3LJRA 5D9TA 1Z6NA 2AV4A 1PRXA 2YOIA 4MJCA 2EIQA 5IMAA 3VPTA 3Q18A 4D73A 1ACVA 2L6DA 1SJ6A 5AISA 1YF0A 5IMCA 3SBCA 4IP6A 2EIRA 2IFQA 2GQMA 1M7TA 2VL3A 1UC7A 5G5EA 3LSZA 2L6CA 3EU4A 3GIXA 4MDCA 1T7PB 2KOKA 4L0UA 1XOBA 1BQ7A 3I9V2 1OKTA 1PGTA 5HR3A 2C4JA 4XRDA 5IMZA 2IL3A 2YJHA 2C3NA 2QGVA 3A5WA 2GTUA 4NHWA 4TR3A 4OCFA 3A3TA 2H73A 3HA9A 3LORA 1SJIA 1GTAA 1O85A 2KP1A 1TOFA 3D21A 1WWJA 3HVSA 4DSSB 1KBNA 4HS1A 4J57E 3KH7A 3GURA 3VFIA 4JR4A 4I6XA 4KSMA 4AJ6A 3QAVA 7GSSA 4PGTA 3TOUA 1XOAA 4XS4B 5J9CA 3E9JB 2GSRA 2NVLA 4P3YB 3RPNA 4CDOA 2CV4A 3TGZA 2YJ7A 2GQKA 3UVTA 3FKFA 3QR6A 3EMXA 4KW6A 2F9SA 2CX4A 2WFCA 4POMA 4KA0A 1OAZA 4FYBA 3TB2A 3OR5A 2H0HA 2LNSA 1F3BA 2YZHA 2K18A 1B9XC 1MD3A 1NSWA 1FVKA 5IOXA 3GSSA 4GQCA 1GUMA 4GRFA 3VWVA 1EOGA 2E2GA 3E3EA 2L57A 3CTGA 4IBPA 1W4VA 3TUEA 4OFNA 1XZOA 1LU4A 3FK8A 3FZ5A 1JZWA 2YCDA 4YQMA 3TKPA 2C3TA 4KX4A 1V57A 3EE2A 2LJKA 2BJXA 2H30A 4WETA 5ID2B 3FYGA 4ACSA 2CVKA 1QMVA 3ZZXA 4N11A 2HLSA 4ID0A 2N5FA 4K1FA 1JLWA 2XBQA 4ZL7A 1S3AA 3QCPA 1PSQA 4IQ1A 2LQOA 3GX8A 1OKDA 4TXOB 4HQZA 1K3YA 2C3QA 2XHFA 2B1LA 4TW5A 4TR0A 2AHEA 1GTUA 22GSA 1OC9B 4TKYA 2GGTA 5CRGA 5A4WA 3C73A 3U6VA 1PL2A 5B6NA 1OC8A 2LKUA 3ME8A 2HRNA 2H1BA 4IHUA 1T4ZA 1F6MC 3LFLA 2HZEB 2M80A 1JHBA 2E2MA 3GV1A 2HSYA 1PX7A 5A4VA 2K8SA 5H5SA 1U87A 2HYXA 6GSUA 2DJ2A 1AXDA 2AUVA 4KB3A 3KP8A 2P0GA 3H1NA 2J9HA 1THOA 5ECLB 3F8UA 4NV2A 5ECHB 4X1UA 3PH9A 3GTUB 4KDXA 3I6AA 2DC5A 2JSZA 1SKSB 4XCSA 2H1DA 3F4RA 1DUGA 3FHKA 1RQMA 2OE1A 4KH7A 1EWXA 2AYTA 2X64A 3FZ4A 4FO5A 4GWRA 5G31A 2IJYA 3M8NA 2LV3A 2OJLA 3CTFA 5J3RA 1K0AA 2FWHA 4PNGA 1XWCA 1FVJA 2PN8A 4MF7A 1IYHA 4O92A 3F3QA 2P5RA 3DVWA 2VD0A 5D73A 4PXOA 3NIVA 3ISOA 5DALB 3ZMKA 4OO5A 4XHMA 6GSWA 1ABAA 3CSIA 4F0CA 3NOFA 3Q74A 4Q5NA 5B8AA 2R3XA 3V1WA 4TXVA 2H71A 5JWQB 1N2AA 3FZAA 2H6YA 3N9JA 1O81A 4E8HA 2L4QA 1QFNA 1EOHA 2YN1A 1BG5A 4LL1B 4GSNA 5ECKB 3GH9A 4WF5A 2DMMA 1K0OA 5GAPD 4EC0A 1TK8B 3APOA 2N5BA 2GZPA 3UAPA 2XPDA 3UMAA 3G7JA 4RQRA 4XTSA 2VLTA 4EUYA 4BA7A 5HFIA 1AUCA 4AJ8A 3I69A 5B6MA 4KCEA 2GS3A 2HXKA 2F3MA 3HZ8A 4XRAA 4AGSA 2XPEA 3IR4A 3VWWA 3QD9A 4OFTA 4RQXA 1TP9A 16GSA 2VCQA 3TJGA 5B8BA 3L9SA 2F51A 1GULA 4G10A 4HU9A 1H4OA 3KMOA 3C1RA 2DJ1A 1XW9A 1TK0B 5J9BA 1XIYA 2C0FA 4TRXA 1SK2A 4Q5QA 2FA4A 1Z9HA 4XIHA 1XWAA 2O89A 4OMVA 3CBUA 2IIYA 3UBLA 1SKWB 4L5OA 3Q6OA 3P2AA 1UVZA 2OACA 1HYUA 2I81A 3VK9A 4YQUA 1GLPA 2HT9A 5F05A 4PQHA 2FCHA 5JWOB 2YWOA 3C1SA 3D22A 3IXRA 4MMMA 4MP4A 5LNKe 1SYRA 3HY2A 3FRCA 2PVQA 5A5KA 1AQXA 1XFLA 2CZ2A 2VD1A 4N10A 1YZXA 2MYGA 3H8QA 2DIZA 2VCTA 5CREA 4PUFC 1K0DA 1LBKA 4I8BA 3VI7A 1A8YA 4I5QA 2LRCA 3IRAA 5J41A 1FAAA 2I1UA 2MMOA 5EVOA 4HU7A 6GSTA 2IN3A 1GWCA 4HJMA 4IQAA 2JSYA 1FOVA 1BJXA 3LG6A 2GSSA 2CAQA 1VF3A 4E8EA 1S3CA 3LYKA 1AAZA 1QUWA 2H0IA 2PGTA 2H74A 3F6FA 1OVNA 11GSA 3J7Yk 3P7XA 4GF0A 2H0GA 2H1GA 3HXSA 2YWIA 1GSDA 4NAXA 3UARA 3FR9A 2ON5A 4DVCA 4IJ3A 5KEJA 1I5GA 5HR0A 2PERA 3W8SA 3TOTA 5ABRA 3CXGA 2CX3A 1FO5A 1BYEA 1G6YA 5F06A 1F37A 2OBIA 3PGTA 1UA5A 5FWGA 2GT6A 4TOPA 3TJBA 1A0RP 5CRDA 1ZMAA 2B5XA 2DJ0A 2QSIA 1Z3EA 1A8LA 4TR1B 1FB6A 3KGKA 2RUFA 4LLRA 2YV9A 1QK8A 3GUSA 4YAVA 1EP7A 5F0GA 1T8EB 1NHYA 1ZGNA 2C0GA 2LJRA 3DKSA 1HNCA 1GNEA 3CYNA 2XC2A 3GH6A 1K0NA 3FY7A 2C8UA 4EO3A 1JFUA 3GKMA 3UVHA 4IJIA 2VIMA 3KD0A 3LQ7A 5GZZB 2FGXA 4NWYA 2KLXA 4JEDA 3GL3A 2V41A 2GZZA 2R2JA 1GRXA 2IMDA 1SKRB 4L5LA 1ILOA 4ML1A 2LRNA 3IDVA 1SL2B 1H75A 4O32A 2NBSA 4MH2A 2VCWA 2HZFA 1K3OA 5CRHA 4OCEA 3GNJA 1A2JA 3F9UA 5HFGA 4KNDA 2K9FA 1QXHA 2WCIA 4MPFA 4PNFA 1SJZA 2X8HA 5C04A 5L71A 1ZOFA 2WULA 1X5DA 4O5RA 3WGEA 5J4UA 2MBSA 4BVXA 2FNOA 3BOAA 3WGDA 4V2MA 3TKSA 3EINA 4HI7A 2NTOA 3LYPA 1PN9A 2MBTA 1X9WB 1U88A 3HJPA 3A2WA 2R4VA 6GSYA 3WT2A 4MF5A 4X0XA 2VL2A 3TKRA 4YQVA 1V58A 4YH2A 5DAKA 5IO0A 1IYIA 3P90A 1GL8A 4KCAA 5LCZA 1PL1A 1B9YC 3QPMA 2HSHA 1R5AA 3MSZA 2GLRA 4KDYA 4KAEA 2H8LA 4WXTA 3IV4A 2L5LA 4LMWA 2WJUA 3F4TA 4IGJA 4IVFA 3UEMA 4ZB6A 1XXUA 5IOWA 1MTCA 1PMTA 1R26A 1EZKA 1TRSA 5E4WA 3CSJA 3HZ4A 8GSSA 2G0FA 3MAKA 3TDGA 1K0CA 1USBA 4IN0A 1T4YA 2BTOT 2P5QA 3IAS2 3A2VA 4POLA 1TI1A 2B7JA 2V2GA 4KGIA 3DGQA 3VPQA 1HD2A 4BPYA 3A2XA 1EGRA 3IPZA 5D8IA 2KP2A 4AJ7A 2VLVA 1XWBA 2WS2A 2FLSA 1G0TA 3VURA 1F3AA 3H79A 5HR1A 3IOSA 5G2ZA 3D5JA 1ZCPA 2JZTA 1I9DA 1ON4A 4V2LA 1G7OA 4GTUA 3RPPA 4X43A 3LXTA 3M9JA 4ULXA 1ERVA 1OYJA 2VO4A 3ZTLA 4WBRD 4POKA 2VL9A 4BVYA 3IA1A 1M9BA 3M0FA 17GSA 1WMJA 4D73B 3VI5A 4IW9A 2B5EA 1EV4A 3EU3A 4F2IA 3F0IA 1TW9A 3HHVA 5IQYA 4AF2A 2VCZA 1TRUA 2OBKA 1KEBA 2IFQB 4K0GA 1EV9A 1Y25A 3UJ1A 4K8MA 4MZWA 4HDEA 3GL5A 3RBTA 12GSA 1V2AA 1ERWA 4IKHA 1YKCA 3AY8A 2RIIA 2DJ3A 1TK5B 1SD8A 1YKAA 2OE0A 1WE0A 2G2QA 2B5YA 3GYKA 1YQ1A 5DCGA 2IWTA 5KN2A 5CNWA 3RHBA 3TKSE 1GLQA 1FW1A 1MD4A 1HNBA 3LEFA 4PUAA 2YWMA 1QQ2A 4V1Ag 3K8NA 1A2MA 4CW9A 2E0QA 10GSA 18GSA 4YAPA 1TTZA 5IPGA 4BL7A 3CSHA 3EYTA 2NDOA 2A2SA 5IMVA 5COHA 2IMEA 1AIUA 2DMLA 6GSVA 3D4TA 2HRFA 2K8VA 3BD2A 3O3TA 2FWEA 20GSA 3M9KA 4I2UA 1VF4A 4ZBBA 2O87A 4NHZA 4L0WA 2B6MA 4ECIA 5JCGA 2ES7A 3F63A 2JADA 2L4CA 2AAWA 1OE8A 3DD3A 3FEUA 1DSBA 3S9FA 2VCVA 3MNGA 3EC3A 3O76A 2R6KA 1SK0A 4OD7A 3IBHA 3H4KA 4K9ZA 2YZUA 4QL7A 4HJ2A 4MH3A 4EDYA 2Z9SA 2WRTA 1S3DA 1EEMA 4KUNA 1YEPA 3QFBC 1GSQA 3I43A 1DBYA 2KUCA 1WRYA 1WOUA 4EF0A 3ERFA 4Z7XA 4ILFA 3BCKA 2H19A 1X9SB 2DJJA 2ON7A 4HQSA 2LTKA 2FD3A 3PR8A 4DSSA 3APSA 1M9AA 1AW9A 2IMFA 5KN3A 4ZBAA 3RDWA 1K0BA 4XS4A 2B7KA 3DXBA 1ERUA 2I3YA 5JWRB 2YP6A 4EDZA 1Q98A 5E59A 2LEGA 1V9WA 5AN1A 3ZITA 4NV5A 1GTIA 2LRTA 2VM2A 3MDKA 3UBKA 1NHOA 3GKKA 2YWNA 3TKQA 2H76A 5A4UA 5DCHA 1CQHA 1FHEA 1SYXA 3W6GA 3IE3A 5H5RA 2MMNA 4Q5FA 5CO3A
chains in the Genus database with same CATH superfamily
3BCIA 2IPAA 2O85A 2HNLA 1TJDA 2PBJA 1GTBA 2AJQB 1E2YA 1O73A 3H93A 4O7HA 2V1MA 4TVEA 4XS6A 4TN8A 19GSA 1PD21 2O7KA 2PPTA 1GNWA 4MJAA 3FR6A 5LD0A 2FY6A 2OKAA 1F9MA 4JBBA 1PX6A 2ALBA 4NXIA 2LJAA 2VAFA 4WKWA 4LA1A 5ID2A 2FUG2 2JL4A 3GSTA 2A2RA 2MZCA 5IO2A 3KH9A 3LGCA 4FYUA 1SENA 2DBCA 4RI6A 2CQ9A 1WJKA 2XBIA 2JZSA 2H70A 2L59A 3ZLPA 1M2DA 2LNTA 1KTEA 1XVQA 3ZVJA 2I9HA 1G7EA 3C71A 1GH2A 3TRXA 1O6JA 4DSQA 1J08A 2QA2A 5EY6A 5HR2A 1MEKA 4TXOA 4RI7A 5KN1A 2H66A 3QDNA 4GCIA 1M2AA 5D9VA 2RM6A 4I97A 2TIRA 1DE1A 5DDLA 1ERTA 1OC9A 3TRQA 2D2ZA 1T1VA 4OWYA 1X9MB 1SL1B 3HJOA 3US3A 1R7HA 1T00A 3HVVA 1B8XA 2CT6A 3IK7A 4MLYA 2J23A 3ZREA 3KMNA 14GSA 4CHSA 2CA8A 3F4SA 3L9UA 1R4WA 1NM3A 1GSUA 5ECRB 3UL3A 4LMVA 1ZYNA 4V1Ap 3UOMA 2HZEA 5CP1A 1MDJA 5G1LA 5ECSA 1U3AA 3L4NA 5G5FA 3KTLA 3WGXA 5JCUA 1YEXA 2DSAA 5D9WA 5DJLA 5CAXA 4EE0A 2OE3A 4K2XA 2DKIA 4KDUA 1C72A 3EURA 2I4AA 3HJMA 1GUHA 4HOJA 1JZRA 4FIWA 3GTUA 1VF1A 1YJ6A 1O8WA 1U6TA 2GVPA 3TCOA 2H6ZA 4K2DA 5GSSA 3RHCA 4ISDA 4ZIJA 5IIZA 1DE2A 4EVMA 2NPBA 1NW2A 3IHGA 1FG4A 4QQ7A 1RK4A 2KHPA 4GQFA 3F3RA 3R2QA 4GSSA 4ZB9A 9GSSA 1ZZYA 4JU5A 4MCUA 2B3SA 1BAYA 3DWVA 1WIKA 1SU9A 1Z7RA 4ZB8A 5IMDA 4MZCA 3IC4A 5HQPA 5ECNB 5C00A 3C7MA 1FB0A 5AGYA 4KE3A 5DALA 3VWUA 2FWGA 3U5RE 2HFDA 1ZYQB 3ERGA 2F8AA 4G9HA 2JACA 3L78A 2F8FA 4PQIA 2BMXA 3VLNA 3TJKA 5F07A 1A2LA 4JR6A 2V6OA 1YY7A 2UZ8A 1RW1A 2H01A 1BX9A 4IS0A 1M3IA 1TU7A 4HZ2A 3R3EA 1A0FA 1Y6EA 4J2FA 5H5QA 4F0BA 4JE1A 4YKFA 3ERWA 3ZIJA 3GN3A 1XBSA 3CQFA 6GSSA 2GDRA 2DIYA 1AQWA 4HEA2 4G0KA 4WR5A 2IMKA 3EMPA 1PKZA 1WP0A 1QGVA 2JZRA 1XCCA 4GXZA 4N30A 3GRXA 2QC7A 4ZL9A 1VGLA 2OADA 1PQNA 2YV7A 3F6DA 3KXOA 2CVBA 3NZNA 5GSTA 3QFAC 5FT3A 4MZBA 3HVNA 1GSEA 2VM1A 2VOCA 5AIVA 3DRNA 4KSOA 3P8WA 1EP8A 2ZNMA 2C80A 4N0VA 3WD6A 1TI3A 2MMAA 1GSSA 1U3IA 2E7PA 2V32A 4TR4A 4OFMA 2RUEA 3RAZA 1V98A 1TKDB 1LJRA 3JCML 5HFKA 4WF4A 4K0NA 1UN2A 2GSQA 1XWKA 2WGRA 2ZUPA 3J7Yb 3IK9A 2QKEA 3M1GA 3DYRA 2DJKA 2LUSA 3W8JA 4EL1A 4MABA 5IMFA 1A23A 4K7OA 4V2NA 1SD9A 1X0RA 5FHIA 3MWHA 3ZMLA 2LQQA 3CRTA 1THXA 3PINA 3GKXA 2ZCTA 4ZXGA 4RUVA 3M3MA 2FHEA 1X5CA 5ENUA 4EKZA 3KEBA 4CY8A 3FZ9A 3WYWA 5J5NA 4MK3A 1OE7A 2X99A 5B7CA 2R5GA 4ZBDA 1YDKA 2C0EA 4G2EA 3IAM2 2PWJA 5G30A 3DIEA 3KCMA 5CRWA 3ZFLA 1Z7PA 4HUAA 1B4PA 2N5AA 3CRUA 2YNXA 4GSTA 5DVBA 1G6WA 3VWXA 2HRKA 5ECOB 2LS5A 2A4VA 2RLIA 4J56E 3TJJA 3FR3A 3N5OA 4HZ4A 5G1KA 3BBYA 3EVIA 1F2EA 2GT5A 2CAIA 3TKSC 1JZDA 4ZILA 1W89A 4LL4B 4K7IA 5IM9A 4DEJA 3HD5A 3ZL5A 4Q5RA 3WT1A 4WEYA 4MNNA 4G19A 1SK1A 1E6BA 2VL2C 4NPBA 3ZIVA 3E0UA 3APQA 4N0ZA 4F82A 5DBQA 2H1AA 4BWQA 1GP1A 4QL9A 5ECIB 2FWFA 2MMZA 1GUKA 5D96A 4IP1A 1GSYA 1ST9A 5ECMB 4JRRA 1GSFA 3HVXA 2HI7A 3D0ZA 4G0LA 4BVXB 1VF2A 3GHAA 1O7UA 1XW5A 4DSRA 1J0FA 2V6KA 4EXJA 1XWGA 2TRXA 3LWAA 3GFKA 2H72A 1ZYEA 2AB6A 1VRSD 1TU8A 4TR1A 5ECPB 2JU5A 4ZL8A 1XVWA 1SL0B 3SWLA 5DAKB 5DJMA 5DQYA 1JLVA 1XPVA 1M0UA 2VCXA 1M2BA 2O8VB 5ELAA 3TJFA 2HE3A 5CYYA 1ML6A 2C0DA 1R5PA 5INYA 4FYCA 2GZYA 3CMIA 3IHQA 4ECJA 1Q4JA 2H6XA 5F8BA 1Z5YE 1YF1A 4XS1A 2PU9C 2EC4A 2R0GA 4HSCX 5D9XA 2LSTA 1URMA 2IMIA 4MPGA 2FA8A 5JCWA 4NMUA 1AQVA 4WR4A 3HCZA 2PVOC 3HDCA 3DVXA 2PMTA 2M72A 5ELGA 3QOUA 3Q19A 1S3RA 2CVDA 1AC1A 1B48A 1JZOA 2K6VA 3ZRDA 5EPFA 3KM6A 3IC8A 1B4QA 3O6TA 1Z6MA 4K7NA 1PKWA 3ZYWA 1MDKA 2C1YA 3GX0A 2YANA 3KJYA 2X8GA 4OO4A 5DQSA 5ECQB 4CY6A 4F03A 1ZL9A 3KZQA 3HKRA 5KN0A 5EL8A 3G7IA 1TDIA 6GSXA 2DLXA 3UIWA 2H75A 4I2TA 1EEJA 3DMLA 5IPHA 5KOWA 4MJEA 4ECBA 4BVYB 3LXZA 1K0MA 2GQLA 3L9VA 2WDUA 1XW6A 4ECCA 3D6IA 3G7YA 2X8CA 4PX1A 4IELA 1TRVA 2P31A 1M99A 3GKNA 1TXXA 1MDIA 5D93A 3HYPA 3G9BA 1OC3A 3ZFBA 2PUKC 4H86A 4ML6A 4GLTA 3QAWA 4MF6A 1PA3A 1WPIA 5GAND 1T3BA 1N8JA 2OA7A 3QMXA 4K6XA 3D4MA 4MJBA 3GMFA 3ME7A 2M46A 2VUPA 3L0HA 1K3LA 1HNAA 2B1KA 2EIOA 1A24A 1EGOA 2CZ3A 4L8EA 2REMA 3DEXA 4JZQA 13GSA 2WB9A 4BWSA 3KP9A 3KTBA 5AIXA 4F9ZA 4PQ1A 3BJ5A 1TRWA 3TRPA 3EWLA 3ZVJD 2WZ9A 3QAGA 4MA9A 1J9BA 2VLUA 4BL7B 1O8XA 3FW2A 1X5EA 1KNGA 2GSTA 1HQOA 2RM5A 4WBJA 2L5OA 2YPMA 1CQGA 3KIJA 2R37A 4FH8A 3GA4A 2TRCP 1V40A 1PFOA 1BEDA 4POBA 3C8EA 3ED3A 4PURA 3LJRA 5D9TA 1Z6NA 2AV4A 1PRXA 2YOIA 4MJCA 2EIQA 3MYDA 5IMAA 3VPTA 3Q18A 4USSA 4D73A 1ACVA 2L6DA 1SJ6A 5AISA 1YF0A 5IMCA 3SBCA 4IP6A 2EIRA 2IFQA 2GQMA 1M7TA 2VL3A 1UC7A 5G5EA 1M3JA 4X4JA 3LSZA 2L6CA 3EU4A 3GIXA 4MDCA 1T7PB 1ZYPA 2KOKA 4L0UA 1XOBA 1BQ7A 3I9V2 1OKTA 1PGTA 5HR3A 2C4JA 4XRDA 5IMZA 2IL3A 2YJHA 2C3NA 2QGVA 1XG8A 3A5WA 2GTUA 4NHWA 4TR3A 4OCFA 3A3TA 2H73A 3HA9A 3LORA 1SJIA 1GTAA 1O85A 2KP1A 1TOFA 3D21A 1WWJA 3HVSA 4DSSB 1KBNA 4HS1A 4J57E 3KH7A 3GURA 3VFIA 4JR4A 4I6XA 4KSMA 4AJ6A 3QAVA 7GSSA 4PGTA 3EPTA 3TOUA 1XOAA 4XS4B 5J9CA 3E9JB 2GSRA 2NVLA 4P3YB 3RPNA 4CDOA 2CV4A 3TGZA 2YJ7A 2GQKA 3UVTA 3FKFA 3QR6A 3EMXA 4KW6A 2F9SA 2CX4A 2WFCA 4POMA 4KA0A 1OAZA 4FYBA 3TB2A 3OR5A 2H0HA 2LNSA 1F3BA 2YZHA 2K18A 1B9XC 1MD3A 4O5UA 1NSWA 1FVKA 5IOXA 3GSSA 4GQCA 4A5PA 1GUMA 4GRFA 3VWVA 1EOGA 2E2GA 3FMWA 3E3EA 2L57A 3CTGA 4IBPA 1W4VA 3TUEA 4OFNA 1XZOA 1LU4A 3FK8A 3FZ5A 1JZWA 2YCDA 4YQMA 3TKPA 2C3TA 4KX4A 1V57A 3EE2A 2LJKA 2BJXA 2H30A 4WETA 5ID2B 3FYGA 4ACSA 2CVKA 1QMVA 3ZZXA 4N11A 2HLSA 4ID0A 2N5FA 4K1FA 1JLWA 2XBQA 2HRAA 4ZL7A 1S3AA 3QCPA 1PSQA 4IQ1A 2LQOA 3GX8A 1OKDA 4TXOB 4HQZA 1K3YA 2A2PA 2C3QA 2XHFA 2B1LA 4TW5A 4TR0A 2AHEA 1GTUA 22GSA 1OC9B 4TKYA 2GGTA 1PN0A 5CRGA 5A4WA 3C73A 4O5QA 3U6VA 1PL2A 5B6NA 1OC8A 2LKUA 3ME8A 2HRNA 2H1BA 4IHUA 1T4ZA 1F6MC 3LFLA 2HZEB 2M80A 1JHBA 2E2MA 3GV1A 2HSYA 1PX7A 5A4VA 4KF9A 2K8SA 5H5SA 4Z2UA 1U87A 2HYXA 6GSUA 2DJ2A 1AXDA 2AUVA 4KB3A 3KP8A 2P0GA 3H1NA 2J9HA 1THOA 5ECLB 3F8UA 4NV2A 5ECHB 4X1UA 3PH9A 3GTUB 4KDXA 3I6AA 2DC5A 2JSZA 1SKSB 4XCSA 2X49A 2H1DA 3F4RA 1DUGA 3FHKA 1RQMA 2OE1A 4KH7A 1EWXA 2AYTA 2X64A 4Z2RA 3FZ4A 4FO5A 4GWRA 5G31A 2IJYA 3M8NA 2LV3A 2OJLA 3CTFA 5J3RA 1K0AA 2FWHA 4PNGA 1XWCA 1FVJA 2PN8A 4MF7A 1IYHA 4O92A 2DKHA 3F3QA 2P5RA 4K5RA 3DVWA 2VD0A 5D73A 4PXOA 3NIVA 3ISOA 5DALB 3ZMKA 4OO5A 4XHMA 6GSWA 1ABAA 3CSIA 4F0CA 3NOFA 3Q74A 4Q5NA 5B8AA 2R3XA 3V1WA 4TXVA 2H71A 5JWQB 1N2AA 3FZAA 2H6YA 3N9JA 1FOHA 1O81A 4E8HA 2L4QA 1QFNA 1EOHA 2YN1A 1BG5A 4LL1B 4GSNA 5ECKB 3GH9A 4WF5A 2DMMA 1K0OA 5GAPD 4EC0A 1TK8B 3APOA 2N5BA 2GZPA 3UAPA 2XPDA 3UMAA 3G7JA 4RQRA 4XTSA 2VLTA 4EUYA 4BA7A 5HFIA 1AUCA 4AJ8A 3I69A 3LW9A 5B6MA 4KCEA 2GS3A 2HXKA 4ICYA 2F3MA 3HZ8A 4XRAA 4AGSA 2XPEA 3IR4A 3VWWA 3QD9A 4OFTA 4RQXA 1TP9A 16GSA 2VCQA 3TJGA 5B8BA 3L9SA 2F51A 1GULA 4G10A 4HU9A 1H4OA 3KMOA 3C1RA 2DJ1A 2R0PA 1XW9A 1TK0B 5J9BA 1XIYA 2C0FA 4TRXA 1SK2A 4Q5QA 2FA4A 1Z9HA 4XIHA 1XWAA 2O89A 4OMVA 3CBUA 2IIYA 3UBLA 1SKWB 4L5OA 3Q6OA 3P2AA 1UVZA 2OACA 1HYUA 2I81A 3VK9A 2R0CA 4YQUA 1GLPA 2HT9A 5F05A 4PQHA 2FCHA 5JWOB 2YWOA 3C1SA 3D22A 3IXRA 4MMMA 4MP4A 5LNKe 1SYRA 3HY2A 3FRCA 2PVQA 5A5KA 1AQXA 1XFLA 2CZ2A 2VD1A 4N10A 1YZXA 2MYGA 3H8QA 2DIZA 2VCTA 5CREA 4PUFC 1K0DA 1LBKA 4I8BA 3VI7A 1A8YA 4I5QA 2LRCA 3IRAA 5J41A 1FAAA 2I1UA 2MMOA 5EVOA 4HU7A 6GSTA 2IN3A 1GWCA 4HJMA 4IQAA 2JSYA 1FOVA 1BJXA 3LG6A 2GSSA 2CAQA 1VF3A 4E8EA 1S3CA 3LYKA 1AAZA 1QUWA 4BIKA 2H0IA 2PGTA 2QA1A 2H74A 3F6FA 1OVNA 11GSA 3J7Yk 3P7XA 4GF0A 2H0GA 2H1GA 3HXSA 2YWIA 1GSDA 4NAXA 3UARA 3FR9A 2ON5A 4DVCA 4IJ3A 5KEJA 1I5GA 5HR0A 2PERA 3W8SA 3TOTA 5ABRA 3CXGA 2CX3A 1FO5A 1BYEA 1G6YA 5F06A 1F37A 2OBIA 3PGTA 1UA5A 5FWGA 2GT6A 4TOPA 3TJBA 1A0RP 5CRDA 1ZMAA 2B5XA 2DJ0A 2QSIA 1Z3EA 1A8LA 4TR1B 1FB6A 3KGKA 2RUFA 4LLRA 2YV9A 3MIXA 1QK8A 3GUSA 4YAVA 1EP7A 5F0GA 1T8EB 1NHYA 1ZGNA 2C0GA 2LJRA 3DKSA 1HNCA 1GNEA 3CYNA 2XC2A 3GH6A 1K0NA 3FY7A 2C8UA 4EO3A 1JFUA 3GKMA 3UVHA 4IJIA 2VIMA 3KD0A 3LQ7A 5GZZB 2FGXA 4NWYA 2KLXA 4JEDA 3GL3A 2V41A 2GZZA 2R2JA 1GRXA 4K5SA 2IMDA 1SKRB 4L5LA 1ILOA 4ML1A 2LRNA 3IDVA 1SL2B 1H75A 4O32A 2NBSA 4MH2A 2VCWA 2HZFA 1K3OA 5CRHA 4OCEA 3GNJA 1A2JA 3F9UA 5HFGA 4KNDA 2K9FA 1QXHA 2WCIA 4MPFA 4PNFA 1SJZA 2X8HA 5C04A 5L71A 1ZOFA 2WULA 1X5DA 4O5RA 3WGEA 5J4UA 2MBSA 4BVXA 2FNOA 3BOAA 3WGDA 4V2MA 3TKSA 3EINA 4HI7A 2NTOA 3LYPA 1PN9A 2MBTA 1X9WB 1U88A 3HJPA 3A2WA 2R4VA 6GSYA 3WT2A 4MF5A 4X0XA 2VL2A 3TKRA 4YQVA 1V58A 4YH2A 5DAKA 5IO0A 1IYIA 3P90A 1GL8A 4KCAA 5LCZA 1PL1A 1B9YC 3QPMA 2HSHA 1R5AA 3MSZA 2GLRA 4KDYA 4KAEA 2H8LA 4WXTA 5KOXA 3IV4A 2L5LA 4LMWA 2WJUA 3F4TA 4IGJA 4IVFA 3UEMA 4ZB6A 1XXUA 5IOWA 1MTCA 1PMTA 1R26A 1EZKA 1TRSA 5E4WA 3CSJA 3HZ4A 8GSSA 2G0FA 3MAKA 3PPUA 3TDGA 1K0CA 1USBA 4IN0A 4Z2TA 1T4YA 2BTOT 2P5QA 3IAS2 3A2VA 4POLA 1TI1A 2B7JA 2V2GA 4KGIA 3DGQA 2A4HA 3VPQA 1HD2A 4BPYA 3A2XA 1EGRA 3IPZA 4G0IA 5D8IA 2KP2A 4AJ7A 2VLVA 1XWBA 2WS2A 2FLSA 1G0TA 3VURA 1F3AA 3H79A 5HR1A 3IOSA 5G2ZA 3D5JA 1ZCPA 2JZTA 1I9DA 1ON4A 2X4AA 4V2LA 1G7OA 4GTUA 3RPPA 4X43A 3LXTA 3M9JA 4ULXA 1ERVA 1OYJA 2VO4A 3ZTLA 4WBRD 4POKA 2VL9A 4FQUA 4BVYA 3IA1A 4EIPA 1M9BA 3M0FA 17GSA 2HSMA 1WMJA 4D73B 3VI5A 4IW9A 2B5EA 1EV4A 3EU3A 4F2IA 3F0IA 1TW9A 3HHVA 5IQYA 4AF2A 2VCZA 1TRUA 2OBKA 1KEBA 2IFQB 4K0GA 1EV9A 1Y25A 3UJ1A 4K8MA 4MZWA 4HDEA 3GL5A 3RBTA 12GSA 1V2AA 1ERWA 4IKHA 1YKCA 3AY8A 2RIIA 2DJ3A 1TK5B 1SD8A 1YKAA 2OE0A 1WE0A 2G2QA 2B5YA 3GYKA 1YQ1A 5DCGA 2IWTA 5KN2A 5CNWA 3RHBA 3TKSE 1GLQA 1FW1A 1MD4A 1HNBA 3LEFA 4PUAA 2YWMA 1QQ2A 4V1Ag 3K8NA 1A2MA 4CW9A 2E0QA 10GSA 18GSA 5BRTA 4YAPA 1TTZA 5IPGA 4BL7A 3CSHA 3EYTA 2NDOA 2A2SA 5IMVA 5COHA 2IMEA 1AIUA 2DMLA 6GSVA 3D4TA 2HRFA 2K8VA 3BD2A 4PTSA 3O3TA 2FWEA 20GSA 3M9KA 4I2UA 1VF4A 4ZBBA 2O87A 4NHZA 4L0WA 2B6MA 4ECIA 5JCGA 2ES7A 3F63A 2JADA 2L4CA 2AAWA 4EIQA 1OE8A 3DD3A 3FEUA 1DSBA 3S9FA 2VCVA 4YKGA 3MNGA 3EC3A 3O76A 2R6KA 1SK0A 4OD7A 3IBHA 3H4KA 4K9ZA 2YZUA 4QL7A 4HJ2A 4MH3A 4EDYA 2Z9SA 2WRTA 1S3DA 1EEMA 4KUNA 5BMUA 1YEPA 3QFBC 1GSQA 3I43A 1DBYA 2KUCA 1WRYA 1WOUA 4EF0A 3ERFA 4Z7XA 4ILFA 3BCKA 2H19A 1X9SB 2DJJA 2ON7A 4HQSA 2LTKA 2FD3A 3PR8A 4DSSA 3APSA 1M9AA 1AW9A 2IMFA 5KN3A 4ZBAA 3RDWA 1K0BA 4XS4A 2B7KA 3DXBA 1ERUA 2I3YA 5JWRB 2YP6A 4EDZA 3A5IA 1Q98A 5E59A 2LEGA 1V9WA 5AN1A 3ZITA 4NV5A 1GTIA 2LRTA 2VM2A 3MDKA 3UBKA 1NHOA 3GKKA 2YWNA 3TKQA 2H76A 5A4UA 5DCHA 1CQHA 1FHEA 1SYXA 3W6GA 3IE3A 5H5RA 2MMNA 4Q5FA 5CO3A
chains in the Genus database with same CATH topology
3BCIA 2IPAA 2O85A 2HNLA 1TJDA 2PBJA 1GTBA 2AJQB 1E2YA 1O73A 3H93A 4O7HA 2V1MA 4TVEA 4XS6A 4TN8A 19GSA 1PD21 2O7KA 2PPTA 1GNWA 4MJAA 3FR6A 5LD0A 2FY6A 2OKAA 1F9MA 4JBBA 1PX6A 2ALBA 4NXIA 2LJAA 2VAFA 4WKWA 4LA1A 5ID2A 2FUG2 2JL4A 3GSTA 2A2RA 2MZCA 5IO2A 3KH9A 3LGCA 4FYUA 1SENA 2DBCA 4RI6A 2CQ9A 1WJKA 2XBIA 2JZSA 2H70A 2L59A 3ZLPA 1M2DA 2LNTA 1KTEA 1XVQA 3ZVJA 2I9HA 1G7EA 3C71A 1GH2A 3TRXA 1O6JA 4DSQA 1J08A 2QA2A 5EY6A 5HR2A 1MEKA 4TXOA 4RI7A 5KN1A 2H66A 3QDNA 4GCIA 1M2AA 5D9VA 2RM6A 4I97A 2TIRA 1DE1A 5DDLA 1ERTA 1OC9A 3TRQA 2D2ZA 1T1VA 4OWYA 1X9MB 1SL1B 3HJOA 3US3A 1R7HA 1T00A 3HVVA 1B8XA 2CT6A 3IK7A 4MLYA 2J23A 3ZREA 3KMNA 14GSA 4CHSA 2CA8A 3F4SA 3L9UA 1R4WA 1NM3A 1GSUA 5ECRB 3UL3A 4LMVA 1ZYNA 4V1Ap 3UOMA 2HZEA 5CP1A 1MDJA 5G1LA 5ECSA 1U3AA 3L4NA 5G5FA 3KTLA 3WGXA 5JCUA 1YEXA 2DSAA 5D9WA 5DJLA 5CAXA 4EE0A 2OE3A 4K2XA 2DKIA 4KDUA 1C72A 3EURA 2I4AA 3HJMA 1GUHA 4HOJA 1JZRA 4FIWA 3GTUA 1VF1A 1YJ6A 1O8WA 1U6TA 2GVPA 3TCOA 2H6ZA 4K2DA 5GSSA 3RHCA 4ISDA 4ZIJA 5IIZA 1DE2A 4EVMA 2NPBA 1NW2A 3IHGA 1FG4A 4QQ7A 1RK4A 2KHPA 4GQFA 3F3RA 3R2QA 4GSSA 4ZB9A 9GSSA 1ZZYA 4JU5A 4MCUA 2B3SA 1BAYA 3DWVA 1WIKA 1SU9A 1Z7RA 4ZB8A 5IMDA 4MZCA 3IC4A 5HQPA 5ECNB 5C00A 3C7MA 1FB0A 5AGYA 4KE3A 5DALA 3VWUA 2FWGA 3U5RE 2HFDA 1ZYQB 3ERGA 2F8AA 4G9HA 2JACA 3L78A 2F8FA 4PQIA 2BMXA 3VLNA 3TJKA 5F07A 1A2LA 4JR6A 2V6OA 1YY7A 2UZ8A 1RW1A 2H01A 1BX9A 4IS0A 1TU7A 4HZ2A 3R3EA 1A0FA 1Y6EA 4J2FA 5H5QA 4F0BA 4JE1A 4YKFA 3ERWA 3ZIJA 3GN3A 1XBSA 6GSSA 2GDRA 2DIYA 1AQWA 4HEA2 4G0KA 4WR5A 2IMKA 3EMPA 1PKZA 1WP0A 1QGVA 2JZRA 1XCCA 4GXZA 4N30A 3GRXA 2QC7A 4ZL9A 1VGLA 2OADA 1PQNA 2YV7A 3F6DA 3KXOA 2CVBA 3NZNA 5GSTA 3QFAC 5FT3A 4MZBA 1GSEA 2VM1A 2VOCA 5AIVA 3DRNA 4KSOA 3P8WA 1EP8A 2ZNMA 2C80A 4N0VA 3WD6A 1TI3A 2MMAA 1GSSA 1U3IA 2E7PA 2V32A 4TR4A 4OFMA 2RUEA 3RAZA 1V98A 1TKDB 1LJRA 3JCML 5HFKA 4WF4A 4K0NA 1UN2A 2GSQA 1XWKA 2WGRA 2ZUPA 3J7Yb 3IK9A 2QKEA 3M1GA 3DYRA 2DJKA 2LUSA 3W8JA 4EL1A 4MABA 5IMFA 1A23A 4K7OA 4V2NA 1SD9A 1X0RA 5FHIA 3MWHA 3ZMLA 2LQQA 3CRTA 1THXA 3PINA 3GKXA 2ZCTA 4ZXGA 4RUVA 3M3MA 2FHEA 1X5CA 5ENUA 4EKZA 3KEBA 4CY8A 3FZ9A 3WYWA 5J5NA 4MK3A 1OE7A 2X99A 5B7CA 2R5GA 4ZBDA 1YDKA 2C0EA 4G2EA 3IAM2 2PWJA 5G30A 3DIEA 3KCMA 5CRWA 3ZFLA 1Z7PA 4HUAA 1B4PA 2N5AA 3CRUA 2YNXA 4GSTA 5DVBA 1G6WA 3VWXA 2HRKA 5ECOB 2LS5A 2A4VA 2RLIA 4J56E 3TJJA 3FR3A 3N5OA 4HZ4A 5G1KA 3BBYA 3EVIA 1F2EA 2GT5A 2CAIA 3TKSC 1JZDA 4ZILA 1W89A 4LL4B 4K7IA 5IM9A 4DEJA 3HD5A 3ZL5A 4Q5RA 3WT1A 4WEYA 4MNNA 4G19A 1SK1A 1E6BA 2VL2C 4NPBA 3ZIVA 3E0UA 3APQA 4N0ZA 4F82A 5DBQA 2H1AA 4BWQA 1GP1A 4QL9A 5ECIB 2FWFA 2MMZA 1GUKA 5D96A 4IP1A 1GSYA 1ST9A 5ECMB 4JRRA 1GSFA 3HVXA 2HI7A 3D0ZA 4G0LA 4BVXB 1VF2A 3GHAA 1O7UA 1XW5A 4DSRA 1J0FA 2V6KA 4EXJA 1XWGA 2TRXA 3LWAA 3GFKA 2H72A 1ZYEA 2AB6A 1VRSD 1TU8A 4TR1A 5ECPB 2JU5A 4ZL8A 1XVWA 1SL0B 3SWLA 5DAKB 5DJMA 5DQYA 1JLVA 1XPVA 1M0UA 2VCXA 1M2BA 2O8VB 5ELAA 3TJFA 2HE3A 5CYYA 1ML6A 2C0DA 1R5PA 5INYA 4FYCA 2GZYA 3CMIA 3IHQA 4ECJA 1Q4JA 2H6XA 5F8BA 1Z5YE 1YF1A 4XS1A 2PU9C 2EC4A 2R0GA 5D9XA 2LSTA 1URMA 2IMIA 4MPGA 2FA8A 5JCWA 4NMUA 1AQVA 4WR4A 3HCZA 2PVOC 3HDCA 3DVXA 2PMTA 2M72A 5ELGA 3QOUA 3Q19A 2CVDA 1AC1A 1B48A 1JZOA 2K6VA 3ZRDA 5EPFA 3KM6A 3IC8A 1B4QA 3O6TA 1Z6MA 4K7NA 1PKWA 3ZYWA 1MDKA 2C1YA 3GX0A 2YANA 3KJYA 2X8GA 4OO4A 5DQSA 5ECQB 4CY6A 4F03A 1ZL9A 3KZQA 3HKRA 5KN0A 5EL8A 3G7IA 1TDIA 6GSXA 2DLXA 3UIWA 2H75A 4I2TA 1EEJA 3DMLA 5IPHA 5KOWA 4MJEA 4ECBA 4BVYB 3LXZA 1K0MA 2GQLA 3L9VA 2WDUA 1XW6A 4ECCA 3D6IA 3G7YA 2X8CA 4PX1A 4IELA 1TRVA 2P31A 1M99A 3GKNA 1TXXA 1MDIA 5D93A 3HYPA 3G9BA 1OC3A 3ZFBA 2PUKC 4H86A 4ML6A 4GLTA 3QAWA 4MF6A 1PA3A 1WPIA 5GAND 1T3BA 1N8JA 2OA7A 3QMXA 4K6XA 3D4MA 4MJBA 3GMFA 3ME7A 2M46A 2VUPA 3L0HA 1K3LA 1HNAA 2B1KA 2EIOA 1A24A 1EGOA 2CZ3A 4L8EA 2REMA 3DEXA 4JZQA 13GSA 2WB9A 4BWSA 3KP9A 3KTBA 5AIXA 4F9ZA 4PQ1A 3BJ5A 1TRWA 3TRPA 3EWLA 3ZVJD 2WZ9A 3QAGA 4MA9A 1J9BA 2VLUA 4BL7B 1O8XA 3FW2A 1X5EA 1KNGA 2GSTA 1HQOA 2RM5A 4WBJA 2L5OA 2YPMA 1CQGA 3KIJA 2R37A 4FH8A 3GA4A 2TRCP 1V40A 1BEDA 4POBA 3C8EA 3ED3A 4PURA 3LJRA 5D9TA 1Z6NA 2AV4A 1PRXA 2YOIA 4MJCA 2EIQA 3MYDA 5IMAA 3VPTA 3Q18A 4USSA 4D73A 1ACVA 2L6DA 1SJ6A 5AISA 1YF0A 5IMCA 3SBCA 4IP6A 2EIRA 2IFQA 2GQMA 1M7TA 2VL3A 1UC7A 5G5EA 4X4JA 3LSZA 2L6CA 3EU4A 3GIXA 4MDCA 1T7PB 1ZYPA 2KOKA 4L0UA 1XOBA 1BQ7A 3I9V2 1OKTA 1PGTA 5HR3A 2C4JA 4XRDA 5IMZA 2IL3A 2YJHA 2C3NA 2QGVA 3A5WA 2GTUA 4NHWA 4TR3A 4OCFA 3A3TA 2H73A 3HA9A 3LORA 1SJIA 1GTAA 1O85A 2KP1A 1TOFA 3D21A 1WWJA 3HVSA 4DSSB 1KBNA 4HS1A 4J57E 3KH7A 3GURA 3VFIA 4JR4A 4I6XA 4KSMA 4AJ6A 3QAVA 7GSSA 4PGTA 3EPTA 3TOUA 1XOAA 4XS4B 5J9CA 3E9JB 2GSRA 2NVLA 4P3YB 3RPNA 4CDOA 2CV4A 3TGZA 2YJ7A 2GQKA 3UVTA 3FKFA 3QR6A 3EMXA 4KW6A 2F9SA 2CX4A 2WFCA 4POMA 4KA0A 1OAZA 4FYBA 3TB2A 3OR5A 2H0HA 2LNSA 1F3BA 2YZHA 2K18A 1B9XC 1MD3A 4O5UA 1NSWA 1FVKA 5IOXA 3GSSA 4GQCA 4A5PA 1GUMA 4GRFA 3VWVA 1EOGA 2E2GA 3FMWA 3E3EA 2L57A 3CTGA 4IBPA 1W4VA 3TUEA 4OFNA 1XZOA 1LU4A 3FK8A 3FZ5A 1JZWA 2YCDA 4YQMA 3TKPA 2C3TA 4KX4A 1V57A 3EE2A 2LJKA 2BJXA 2H30A 4WETA 5ID2B 3FYGA 4ACSA 2CVKA 1QMVA 3ZZXA 4N11A 2HLSA 4ID0A 2N5FA 4K1FA 1JLWA 2XBQA 2HRAA 4ZL7A 1S3AA 3QCPA 1PSQA 4IQ1A 2LQOA 3GX8A 1OKDA 4TXOB 4HQZA 1K3YA 2A2PA 2C3QA 2XHFA 2B1LA 4TW5A 4TR0A 2AHEA 1GTUA 22GSA 1OC9B 4TKYA 2GGTA 1PN0A 5CRGA 5A4WA 3C73A 4O5QA 3U6VA 1PL2A 5B6NA 1OC8A 2LKUA 3ME8A 2HRNA 2H1BA 4IHUA 1T4ZA 1F6MC 3LFLA 2HZEB 2M80A 1JHBA 2E2MA 3GV1A 2HSYA 1PX7A 5A4VA 4KF9A 2K8SA 5H5SA 4Z2UA 1U87A 2HYXA 6GSUA 2DJ2A 1AXDA 2AUVA 4KB3A 3KP8A 2P0GA 3H1NA 2J9HA 1THOA 5ECLB 3F8UA 4NV2A 5ECHB 4X1UA 3PH9A 3GTUB 4KDXA 3I6AA 2DC5A 2JSZA 1SKSB 4XCSA 2X49A 2H1DA 3F4RA 1DUGA 3FHKA 1RQMA 2OE1A 4KH7A 1EWXA 2AYTA 2X64A 4Z2RA 3FZ4A 4FO5A 4GWRA 5G31A 2IJYA 3M8NA 2LV3A 2OJLA 3CTFA 5J3RA 1K0AA 2FWHA 4PNGA 1XWCA 1FVJA 2PN8A 4MF7A 1IYHA 4O92A 2DKHA 3F3QA 2P5RA 4K5RA 3DVWA 2VD0A 5D73A 4PXOA 3NIVA 3ISOA 5DALB 3ZMKA 4OO5A 4XHMA 6GSWA 1ABAA 3CSIA 4F0CA 3NOFA 3Q74A 4Q5NA 5B8AA 2R3XA 3V1WA 4TXVA 2H71A 5JWQB 1N2AA 3FZAA 2H6YA 3N9JA 1FOHA 1O81A 4E8HA 2L4QA 1QFNA 1EOHA 2YN1A 1BG5A 4LL1B 4GSNA 5ECKB 3GH9A 4WF5A 2DMMA 1K0OA 5GAPD 4EC0A 1TK8B 3APOA 2N5BA 2GZPA 3UAPA 2XPDA 3UMAA 3G7JA 4RQRA 4XTSA 2VLTA 4EUYA 4BA7A 5HFIA 1AUCA 4AJ8A 3I69A 3LW9A 5B6MA 4KCEA 2GS3A 2HXKA 4ICYA 2F3MA 3HZ8A 4XRAA 4AGSA 2XPEA 3IR4A 3VWWA 3QD9A 4OFTA 4RQXA 1TP9A 16GSA 2VCQA 3TJGA 5B8BA 3L9SA 2F51A 1GULA 4G10A 4HU9A 1H4OA 3KMOA 3C1RA 2DJ1A 2R0PA 1XW9A 1TK0B 5J9BA 1XIYA 2C0FA 4TRXA 1SK2A 4Q5QA 2FA4A 1Z9HA 4XIHA 1XWAA 2O89A 4OMVA 3CBUA 2IIYA 3UBLA 1SKWB 4L5OA 3Q6OA 3P2AA 1UVZA 2OACA 1HYUA 2I81A 3VK9A 2R0CA 4YQUA 1GLPA 2HT9A 5F05A 4PQHA 2FCHA 5JWOB 2YWOA 3C1SA 3D22A 3IXRA 4MMMA 4MP4A 5LNKe 1SYRA 3HY2A 3FRCA 2PVQA 5A5KA 1AQXA 1XFLA 2CZ2A 2VD1A 4N10A 1YZXA 2MYGA 3H8QA 2DIZA 2VCTA 5CREA 4PUFC 1K0DA 1LBKA 4I8BA 3VI7A 1A8YA 4I5QA 2LRCA 3IRAA 5J41A 1FAAA 2I1UA 2MMOA 5EVOA 4HU7A 6GSTA 2IN3A 1GWCA 4HJMA 4IQAA 2JSYA 1FOVA 1BJXA 3LG6A 2GSSA 2CAQA 1VF3A 4E8EA 1S3CA 3LYKA 1AAZA 1QUWA 2H0IA 2PGTA 2QA1A 2H74A 3F6FA 1OVNA 11GSA 3J7Yk 3P7XA 4GF0A 2H0GA 2H1GA 3HXSA 2YWIA 1GSDA 4NAXA 3UARA 3FR9A 2ON5A 4DVCA 4IJ3A 5KEJA 1I5GA 5HR0A 2PERA 3W8SA 3TOTA 5ABRA 3CXGA 2CX3A 1FO5A 1BYEA 1G6YA 5F06A 1F37A 2OBIA 3PGTA 1UA5A 5FWGA 2GT6A 4TOPA 3TJBA 1A0RP 5CRDA 1ZMAA 2B5XA 2DJ0A 2QSIA 1Z3EA 1A8LA 4TR1B 1FB6A 3KGKA 2RUFA 4LLRA 2YV9A 3MIXA 1QK8A 3GUSA 4YAVA 1EP7A 5F0GA 1T8EB 1NHYA 1ZGNA 2C0GA 2LJRA 3DKSA 1HNCA 1GNEA 3CYNA 2XC2A 3GH6A 1K0NA 3FY7A 2C8UA 4EO3A 1JFUA 3GKMA 3UVHA 4IJIA 2VIMA 3KD0A 3LQ7A 5GZZB 2FGXA 4NWYA 2KLXA 4JEDA 3GL3A 2V41A 2GZZA 2R2JA 1GRXA 4K5SA 2IMDA 1SKRB 4L5LA 1ILOA 4ML1A 2LRNA 3IDVA 1SL2B 1H75A 4O32A 2NBSA 4MH2A 2VCWA 2HZFA 1K3OA 5CRHA 4OCEA 3GNJA 1A2JA 3F9UA 5HFGA 4KNDA 2K9FA 1QXHA 2WCIA 4MPFA 4PNFA 1SJZA 2X8HA 5C04A 5L71A 1ZOFA 2WULA 1X5DA 4O5RA 3WGEA 5J4UA 2MBSA 4BVXA 2FNOA 3BOAA 3WGDA 4V2MA 3TKSA 3EINA 4HI7A 2NTOA 3LYPA 1PN9A 2MBTA 1X9WB 1U88A 3HJPA 3A2WA 2R4VA 6GSYA 3WT2A 4MF5A 4X0XA 2VL2A 3TKRA 4YQVA 1V58A 4YH2A 5DAKA 5IO0A 1IYIA 3P90A 1GL8A 4KCAA 5LCZA 1PL1A 1B9YC 3QPMA 2HSHA 1R5AA 3MSZA 2GLRA 4KDYA 4KAEA 2H8LA 4WXTA 5KOXA 3IV4A 2L5LA 4LMWA 2WJUA 3F4TA 4IGJA 4IVFA 3UEMA 4ZB6A 1XXUA 5IOWA 1MTCA 1PMTA 1R26A 1EZKA 1TRSA 5E4WA 3CSJA 3HZ4A 8GSSA 2G0FA 3MAKA 3PPUA 3TDGA 1K0CA 1USBA 4IN0A 4Z2TA 1T4YA 2BTOT 2P5QA 3IAS2 3A2VA 4POLA 1TI1A 2B7JA 2V2GA 4KGIA 3DGQA 2A4HA 3VPQA 1HD2A 4BPYA 3A2XA 1EGRA 3IPZA 4G0IA 5D8IA 2KP2A 4AJ7A 2VLVA 1XWBA 2WS2A 2FLSA 1G0TA 3VURA 1F3AA 3H79A 5HR1A 3IOSA 5G2ZA 3D5JA 1ZCPA 2JZTA 1I9DA 1ON4A 2X4AA 4V2LA 1G7OA 4GTUA 3RPPA 4X43A 3LXTA 3M9JA 4ULXA 1ERVA 1OYJA 2VO4A 3ZTLA 4WBRD 4POKA 2VL9A 4FQUA 4BVYA 3IA1A 4EIPA 1M9BA 3M0FA 17GSA 2HSMA 1WMJA 4D73B 3VI5A 4IW9A 2B5EA 1EV4A 3EU3A 4F2IA 3F0IA 1TW9A 3HHVA 5IQYA 4AF2A 2VCZA 1TRUA 2OBKA 1KEBA 2IFQB 4K0GA 1EV9A 1Y25A 3UJ1A 4K8MA 4MZWA 4HDEA 3GL5A 3RBTA 12GSA 1V2AA 1ERWA 4IKHA 1YKCA 3AY8A 2RIIA 2DJ3A 1TK5B 1SD8A 1YKAA 2OE0A 1WE0A 2G2QA 2B5YA 3GYKA 1YQ1A 5DCGA 2IWTA 5KN2A 5CNWA 3RHBA 3TKSE 1GLQA 1FW1A 1MD4A 1HNBA 3LEFA 4PUAA 2YWMA 1QQ2A 4V1Ag 3K8NA 1A2MA 4CW9A 2E0QA 10GSA 18GSA 5BRTA 4YAPA 1TTZA 5IPGA 4BL7A 3CSHA 3EYTA 2NDOA 2A2SA 5IMVA 5COHA 2IMEA 1AIUA 2DMLA 6GSVA 3D4TA 2HRFA 2K8VA 3BD2A 4PTSA 3O3TA 2FWEA 20GSA 3M9KA 4I2UA 1VF4A 4ZBBA 2O87A 4NHZA 4L0WA 2B6MA 4ECIA 5JCGA 2ES7A 3F63A 2JADA 2L4CA 2AAWA 4EIQA 1OE8A 3DD3A 3FEUA 1DSBA 3S9FA 2VCVA 4YKGA 3MNGA 3EC3A 3O76A 2R6KA 1SK0A 4OD7A 3IBHA 3H4KA 4K9ZA 2YZUA 4QL7A 4HJ2A 4MH3A 4EDYA 2Z9SA 2WRTA 1S3DA 1EEMA 4KUNA 5BMUA 1YEPA 3QFBC 1GSQA 3I43A 1DBYA 2KUCA 1WRYA 1WOUA 4EF0A 3ERFA 4Z7XA 4ILFA 3BCKA 2H19A 1X9SB 2DJJA 2ON7A 4HQSA 2LTKA 2FD3A 3PR8A 4DSSA 3APSA 1M9AA 1AW9A 2IMFA 5KN3A 4ZBAA 3RDWA 1K0BA 4XS4A 2B7KA 3DXBA 1ERUA 2I3YA 5JWRB 2YP6A 4EDZA 3A5IA 1Q98A 5E59A 2LEGA 1V9WA 5AN1A 3ZITA 4NV5A 1GTIA 2LRTA 2VM2A 3MDKA 3UBKA 1NHOA 3GKKA 2YWNA 3TKQA 2H76A 5A4UA 5DCHA 1CQHA 1FHEA 1SYXA 3W6GA 3IE3A 5H5RA 2MMNA 4Q5FA 5CO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BCI A;  2IPA A;  2O85 A;  2HNL A;  1TJD A;  2PBJ A;  1GTB A;  2AJQ B;  1E2Y A;  1O73 A;  3H93 A;  4O7H A;  2V1M A;  4TVE A;  4XS6 A;  4TN8 A;  19GS A;  1PD2 1;  2O7K A;  2PPT A;  1GNW A;  4MJA A;  3FR6 A;  5LD0 A;  2FY6 A;  2OKA A;  1F9M A;  4JBB A;  1PX6 A;  2ALB A;  4NXI A;  2LJA A;  2VAF A;  4WKW A;  4LA1 A;  5ID2 A;  2FUG 2;  2JL4 A;  3GST A;  2A2R A;  2MZC A;  5IO2 A;  3KH9 A;  3LGC A;  4FYU A;  1SEN A;  2DBC A;  4RI6 A;  2CQ9 A;  1WJK A;  2XBI A;  2JZS A;  2H70 A;  2L59 A;  3ZLP A;  1M2D A;  2LNT A;  1KTE A;  1XVQ A;  3ZVJ A;  2I9H A;  1G7E A;  3C71 A;  1GH2 A;  3TRX A;  1O6J A;  4DSQ A;  1J08 A;  5EY6 A;  5HR2 A;  1MEK A;  4TXO A;  4RI7 A;  5KN1 A;  2H66 A;  3QDN A;  4GCI A;  1M2A A;  5D9V A;  2RM6 A;  4I97 A;  2TIR A;  1DE1 A;  5DDL A;  1ERT A;  1OC9 A;  3TRQ A;  2D2Z A;  1T1V A;  4OWY A;  1X9M B;  1SL1 B;  3HJO A;  3US3 A;  1R7H A;  1T00 A;  3HVV A;  1B8X A;  2CT6 A;  3IK7 A;  4MLY A;  2J23 A;  3ZRE A;  3KMN A;  14GS A;  4CHS A;  2CA8 A;  3F4S A;  3L9U A;  1R4W A;  1NM3 A;  1GSU A;  5ECR B;  3UL3 A;  4LMV A;  4V1A p;  3UOM A;  2HZE A;  5CP1 A;  1MDJ A;  5G1L A;  5ECS A;  1U3A A;  3L4N A;  5G5F A;  3KTL A;  3WGX A;  5JCU A;  1YEX A;  2DSA A;  5D9W A;  5DJL A;  5CAX A;  4EE0 A;  2OE3 A;  4KDU A;  1C72 A;  3EUR A;  2I4A A;  3HJM A;  1GUH A;  4HOJ A;  1JZR A;  4FIW A;  3GTU A;  1VF1 A;  1YJ6 A;  1O8W A;  1U6T A;  2GVP A;  3TCO A;  2H6Z A;  4K2D A;  5GSS A;  3RHC A;  4ISD A;  4ZIJ A;  5IIZ A;  1DE2 A;  4EVM A;  2NPB A;  1NW2 A;  1FG4 A;  4QQ7 A;  1RK4 A;  2KHP A;  4GQF A;  3F3R A;  3R2Q A;  4GSS A;  4ZB9 A;  9GSS A;  1ZZY A;  4JU5 A;  4MCU A;  2B3S A;  1BAY A;  3DWV A;  1WIK A;  1SU9 A;  1Z7R A;  4ZB8 A;  5IMD A;  4MZC A;  3IC4 A;  5HQP A;  5ECN B;  5C00 A;  3C7M A;  1FB0 A;  5AGY A;  4KE3 A;  5DAL A;  3VWU A;  2FWG A;  3U5R E;  2HFD A;  1ZYQ B;  3ERG A;  2F8A A;  4G9H A;  2JAC A;  3L78 A;  2F8F A;  4PQI A;  2BMX A;  3VLN A;  3TJK A;  5F07 A;  1A2L A;  4JR6 A;  2V6O A;  1YY7 A;  1RW1 A;  2H01 A;  1BX9 A;  4IS0 A;  1TU7 A;  4HZ2 A;  1A0F A;  1Y6E A;  4J2F A;  5H5Q A;  4F0B A;  4JE1 A;  3ERW A;  3ZIJ A;  3GN3 A;  1XBS A;  6GSS A;  2GDR A;  2DIY A;  1AQW A;  4HEA 2;  4WR5 A;  2IMK A;  3EMP A;  1PKZ A;  1WP0 A;  1QGV A;  2JZR A;  1XCC A;  4GXZ A;  4N30 A;  3GRX A;  2QC7 A;  4ZL9 A;  1VGL A;  2OAD A;  1PQN A;  2YV7 A;  3F6D A;  3KXO A;  2CVB A;  3NZN A;  5GST A;  3QFA C;  5FT3 A;  4MZB A;  1GSE A;  2VM1 A;  2VOC A;  5AIV A;  3DRN A;  4KSO A;  3P8W A;  1EP8 A;  2ZNM A;  2C80 A;  4N0V A;  3WD6 A;  1TI3 A;  2MMA A;  1GSS A;  1U3I A;  2E7P A;  2V32 A;  4TR4 A;  4OFM A;  2RUE A;  3RAZ A;  1V98 A;  1TKD B;  1LJR A;  3JCM L;  5HFK A;  4WF4 A;  4K0N A;  1UN2 A;  2GSQ A;  1XWK A;  2WGR A;  2ZUP A;  3J7Y b;  3IK9 A;  2QKE A;  3M1G A;  3DYR A;  2DJK A;  2LUS A;  3W8J A;  4EL1 A;  4MAB A;  5IMF A;  1A23 A;  4K7O A;  4V2N A;  1SD9 A;  1X0R A;  5FHI A;  3MWH A;  3ZML A;  2LQQ A;  3CRT A;  1THX A;  3PIN A;  3GKX A;  2ZCT A;  4ZXG A;  4RUV A;  3M3M A;  2FHE A;  1X5C A;  5ENU A;  4EKZ A;  3KEB A;  3FZ9 A;  3WYW A;  5J5N A;  4MK3 A;  1OE7 A;  2X99 A;  5B7C A;  2R5G A;  4ZBD A;  1YDK A;  2C0E A;  4G2E A;  3IAM 2;  2PWJ A;  5G30 A;  3DIE A;  3KCM A;  5CRW A;  3ZFL A;  1Z7P A;  4HUA A;  1B4P A;  2N5A A;  3CRU A;  2YNX A;  4GST A;  5DVB A;  1G6W A;  3VWX A;  5ECO B;  2LS5 A;  2A4V A;  2RLI A;  4J56 E;  3TJJ A;  3FR3 A;  3N5O A;  4HZ4 A;  5G1K A;  3BBY A;  3EVI A;  1F2E A;  2GT5 A;  2CAI A;  3TKS C;  1JZD A;  4ZIL A;  1W89 A;  4LL4 B;  4K7I A;  5IM9 A;  4DEJ A;  3HD5 A;  3ZL5 A;  4Q5R A;  3WT1 A;  4WEY A;  4G19 A;  1SK1 A;  1E6B A;  2VL2 C;  4NPB A;  3ZIV A;  3E0U A;  3APQ A;  4N0Z A;  4F82 A;  5DBQ A;  2H1A A;  4BWQ A;  1GP1 A;  4QL9 A;  5ECI B;  2FWF A;  2MMZ A;  1GUK A;  5D96 A;  4IP1 A;  1GSY A;  1ST9 A;  5ECM B;  4JRR A;  1GSF A;  3HVX A;  2HI7 A;  3D0Z A;  1VF2 A;  3GHA A;  1O7U A;  1XW5 A;  4DSR A;  1J0F A;  2V6K A;  4EXJ A;  1XWG A;  2TRX A;  3LWA A;  3GFK A;  2H72 A;  1ZYE A;  2AB6 A;  1VRS D;  1TU8 A;  4TR1 A;  5ECP B;  2JU5 A;  4ZL8 A;  1XVW A;  1SL0 B;  3SWL A;  5DAK B;  5DJM A;  5DQY A;  1JLV A;  1XPV A;  1M0U A;  2VCX A;  1M2B A;  2O8V B;  5ELA A;  3TJF A;  2HE3 A;  5CYY A;  1ML6 A;  2C0D A;  1R5P A;  5INY A;  4FYC A;  2GZY A;  3CMI A;  3IHQ A;  4ECJ A;  1Q4J A;  2H6X A;  5F8B A;  1Z5Y E;  1YF1 A;  4XS1 A;  2PU9 C;  2EC4 A;  5D9X A;  2LST A;  1URM A;  2IMI A;  4MPG A;  2FA8 A;  5JCW A;  4NMU A;  1AQV A;  4WR4 A;  3HCZ A;  2PVO C;  3HDC A;  3DVX A;  2PMT A;  2M72 A;  5ELG A;  3QOU A;  3Q19 A;  2CVD A;  1AC1 A;  1B48 A;  1JZO A;  2K6V A;  3ZRD A;  5EPF A;  3KM6 A;  1B4Q A;  3O6T A;  1Z6M A;  4K7N A;  1PKW A;  3ZYW A;  1MDK A;  2C1Y A;  3GX0 A;  2YAN A;  3KJY A;  2X8G A;  4OO4 A;  5DQS A;  5ECQ B;  4F03 A;  1ZL9 A;  3KZQ A;  3HKR A;  5KN0 A;  5EL8 A;  3G7I A;  1TDI A;  6GSX A;  2DLX A;  3UIW A;  2H75 A;  4I2T A;  1EEJ A;  3DML A;  5IPH A;  4MJE A;  4ECB A;  3LXZ A;  1K0M A;  2GQL A;  3L9V A;  2WDU A;  1XW6 A;  4ECC A;  3D6I A;  3G7Y A;  2X8C A;  4PX1 A;  4IEL A;  1TRV A;  2P31 A;  1M99 A;  3GKN A;  1TXX A;  1MDI A;  5D93 A;  3HYP A;  3G9B A;  1OC3 A;  3ZFB A;  2PUK C;  4H86 A;  4ML6 A;  4GLT A;  3QAW A;  4MF6 A;  1PA3 A;  1WPI A;  5GAN D;  1T3B A;  1N8J A;  2OA7 A;  3QMX A;  4K6X A;  3D4M A;  4MJB A;  3GMF A;  3ME7 A;  2M46 A;  2VUP A;  3L0H A;  1K3L A;  1HNA A;  2B1K A;  2EIO A;  1A24 A;  1EGO A;  2CZ3 A;  4L8E A;  2REM A;  3DEX A;  4JZQ A;  13GS A;  2WB9 A;  4BWS A;  3KP9 A;  3KTB A;  5AIX A;  4F9Z A;  4PQ1 A;  3BJ5 A;  1TRW A;  3TRP A;  3EWL A;  3ZVJ D;  2WZ9 A;  3QAG A;  4MA9 A;  1J9B A;  2VLU A;  1O8X A;  3FW2 A;  1X5E A;  1KNG A;  2GST A;  1HQO A;  2RM5 A;  4WBJ A;  2L5O A;  2YPM A;  1CQG A;  3KIJ A;  2R37 A;  4FH8 A;  3GA4 A;  2TRC P;  1V40 A;  1BED A;  4POB A;  3C8E A;  3ED3 A;  4PUR A;  3LJR A;  5D9T A;  1Z6N A;  2AV4 A;  1PRX A;  2YOI A;  4MJC A;  2EIQ A;  5IMA A;  3VPT A;  3Q18 A;  4D73 A;  1ACV A;  2L6D A;  1SJ6 A;  5AIS A;  1YF0 A;  5IMC A;  3SBC A;  4IP6 A;  2EIR A;  2IFQ A;  2GQM A;  1M7T A;  2VL3 A;  1UC7 A;  5G5E A;  3LSZ A;  2L6C A;  3EU4 A;  3GIX A;  4MDC A;  1T7P B;  2KOK A;  4L0U A;  1XOB A;  1BQ7 A;  3I9V 2;  1OKT A;  1PGT A;  5HR3 A;  2C4J A;  4XRD A;  5IMZ A;  2IL3 A;  2YJH A;  2C3N A;  2QGV A;  3A5W A;  2GTU A;  4NHW A;  4TR3 A;  4OCF A;  3A3T A;  2H73 A;  3HA9 A;  3LOR A;  1SJI A;  1GTA A;  1O85 A;  2KP1 A;  1TOF A;  3D21 A;  1WWJ A;  3HVS A;  4DSS B;  1KBN A;  4HS1 A;  4J57 E;  3KH7 A;  3GUR A;  3VFI A;  4JR4 A;  4I6X A;  4KSM A;  4AJ6 A;  3QAV A;  7GSS A;  4PGT A;  3TOU A;  1XOA A;  4XS4 B;  5J9C A;  3E9J B;  2GSR A;  2NVL A;  4P3Y B;  3RPN A;  4CDO A;  2CV4 A;  3TGZ A;  2YJ7 A;  2GQK A;  3UVT A;  3FKF A;  3QR6 A;  3EMX A;  4KW6 A;  2F9S A;  2CX4 A;  2WFC A;  4POM A;  4KA0 A;  1OAZ A;  4FYB A;  3TB2 A;  3OR5 A;  2H0H A;  2LNS A;  1F3B A;  2YZH A;  2K18 A;  1B9X C;  1MD3 A;  1NSW A;  1FVK A;  5IOX A;  3GSS A;  4GQC A;  1GUM A;  4GRF A;  3VWV A;  1EOG A;  2E2G A;  3E3E A;  2L57 A;  3CTG A;  4IBP A;  1W4V A;  3TUE A;  4OFN A;  1XZO A;  1LU4 A;  3FK8 A;  3FZ5 A;  1JZW A;  2YCD A;  4YQM A;  3TKP A;  2C3T A;  4KX4 A;  1V57 A;  3EE2 A;  2LJK A;  2BJX A;  2H30 A;  4WET A;  5ID2 B;  3FYG A;  4ACS A;  2CVK A;  1QMV A;  3ZZX A;  4N11 A;  2HLS A;  4ID0 A;  2N5F A;  4K1F A;  1JLW A;  2XBQ A;  4ZL7 A;  1S3A A;  3QCP A;  1PSQ A;  4IQ1 A;  2LQO A;  3GX8 A;  1OKD A;  4TXO B;  4HQZ A;  1K3Y A;  2C3Q A;  2XHF A;  2B1L A;  4TW5 A;  4TR0 A;  2AHE A;  1GTU A;  22GS A;  1OC9 B;  4TKY A;  2GGT A;  5CRG A;  5A4W A;  3C73 A;  3U6V A;  1PL2 A;  5B6N A;  1OC8 A;  2LKU A;  3ME8 A;  2HRN A;  2H1B A;  4IHU A;  1T4Z A;  1F6M C;  3LFL A;  2HZE B;  2M80 A;  1JHB A;  2E2M A;  3GV1 A;  2HSY A;  1PX7 A;  5A4V A;  2K8S A;  5H5S A;  1U87 A;  2HYX A;  6GSU A;  2DJ2 A;  1AXD A;  2AUV A;  4KB3 A;  3KP8 A;  2P0G A;  3H1N A;  2J9H A;  1THO A;  5ECL B;  3F8U A;  4NV2 A;  5ECH B;  4X1U A;  3PH9 A;  3GTU B;  4KDX A;  3I6A A;  2DC5 A;  2JSZ A;  1SKS B;  4XCS A;  2H1D A;  3F4R A;  1DUG A;  3FHK A;  1RQM A;  2OE1 A;  4KH7 A;  1EWX A;  2AYT A;  2X64 A;  3FZ4 A;  4FO5 A;  4GWR A;  5G31 A;  2IJY A;  3M8N A;  2LV3 A;  2OJL A;  3CTF A;  5J3R A;  1K0A A;  2FWH A;  4PNG A;  1XWC A;  1FVJ A;  2PN8 A;  4MF7 A;  1IYH A;  4O92 A;  3F3Q A;  2P5R A;  3DVW A;  2VD0 A;  5D73 A;  4PXO A;  3NIV A;  3ISO A;  5DAL B;  3ZMK A;  4OO5 A;  4XHM A;  6GSW A;  1ABA A;  3CSI A;  4F0C A;  3NOF A;  3Q74 A;  4Q5N A;  5B8A A;  2R3X A;  3V1W A;  4TXV A;  2H71 A;  5JWQ B;  1N2A A;  3FZA A;  2H6Y A;  3N9J A;  1O81 A;  4E8H A;  2L4Q A;  1QFN A;  1EOH A;  2YN1 A;  1BG5 A;  4LL1 B;  4GSN A;  5ECK B;  3GH9 A;  4WF5 A;  2DMM A;  1K0O A;  5GAP D;  4EC0 A;  1TK8 B;  3APO A;  2N5B A;  2GZP A;  3UAP A;  2XPD A;  3UMA A;  3G7J A;  4RQR A;  4XTS A;  2VLT A;  4EUY A;  4BA7 A;  5HFI A;  1AUC A;  4AJ8 A;  3I69 A;  5B6M A;  4KCE A;  2GS3 A;  2HXK A;  2F3M A;  3HZ8 A;  4XRA A;  4AGS A;  2XPE A;  3IR4 A;  3VWW A;  3QD9 A;  4OFT A;  4RQX A;  1TP9 A;  16GS A;  2VCQ A;  3TJG A;  5B8B A;  3L9S A;  2F51 A;  1GUL A;  4G10 A;  4HU9 A;  1H4O A;  3KMO A;  3C1R A;  2DJ1 A;  1XW9 A;  1TK0 B;  5J9B A;  1XIY A;  2C0F A;  4TRX A;  1SK2 A;  4Q5Q A;  2FA4 A;  1Z9H A;  4XIH A;  1XWA A;  2O89 A;  4OMV A;  3CBU A;  2IIY A;  3UBL A;  1SKW B;  4L5O A;  3Q6O A;  3P2A A;  1UVZ A;  2OAC A;  1HYU A;  2I81 A;  3VK9 A;  4YQU A;  1GLP A;  2HT9 A;  5F05 A;  4PQH A;  2FCH A;  5JWO B;  2YWO A;  3C1S A;  3D22 A;  3IXR A;  4MMM A;  4MP4 A;  5LNK e;  1SYR A;  3HY2 A;  3FRC A;  2PVQ A;  5A5K A;  1AQX A;  1XFL A;  2CZ2 A;  2VD1 A;  4N10 A;  1YZX A;  2MYG A;  3H8Q A;  2DIZ A;  2VCT A;  5CRE A;  4PUF C;  1K0D A;  1LBK A;  4I8B A;  3VI7 A;  1A8Y A;  4I5Q A;  2LRC A;  3IRA A;  5J41 A;  1FAA A;  2I1U A;  2MMO A;  5EVO A;  4HU7 A;  6GST A;  2IN3 A;  1GWC A;  4HJM A;  4IQA A;  2JSY A;  1FOV A;  1BJX A;  3LG6 A;  2GSS A;  2CAQ A;  1VF3 A;  4E8E A;  1S3C A;  3LYK A;  1AAZ A;  1QUW A;  2H0I A;  2PGT A;  2H74 A;  3F6F A;  1OVN A;  11GS A;  3J7Y k;  3P7X A;  4GF0 A;  2H0G A;  2H1G A;  3HXS A;  2YWI A;  1GSD A;  4NAX A;  3UAR A;  3FR9 A;  2ON5 A;  4DVC A;  4IJ3 A;  5KEJ A;  1I5G A;  5HR0 A;  2PER A;  3W8S A;  3TOT A;  5ABR A;  3CXG A;  2CX3 A;  1FO5 A;  1BYE A;  1G6Y A;  5F06 A;  1F37 A;  2OBI A;  3PGT A;  1UA5 A;  5FWG A;  2GT6 A;  4TOP A;  3TJB A;  1A0R P;  5CRD A;  1ZMA A;  2B5X A;  2DJ0 A;  2QSI A;  1Z3E A;  1A8L A;  4TR1 B;  1FB6 A;  3KGK A;  2RUF A;  4LLR A;  2YV9 A;  1QK8 A;  3GUS A;  4YAV A;  1EP7 A;  5F0G A;  1T8E B;  1NHY A;  1ZGN A;  2C0G A;  2LJR A;  3DKS A;  1HNC A;  1GNE A;  3CYN A;  2XC2 A;  3GH6 A;  1K0N A;  3FY7 A;  2C8U A;  4EO3 A;  1JFU A;  3GKM A;  3UVH A;  4IJI A;  2VIM A;  3KD0 A;  3LQ7 A;  5GZZ B;  2FGX A;  4NWY A;  2KLX A;  4JED A;  3GL3 A;  2V41 A;  2GZZ A;  2R2J A;  1GRX A;  2IMD A;  1SKR B;  4L5L A;  1ILO A;  4ML1 A;  2LRN A;  3IDV A;  1SL2 B;  1H75 A;  4O32 A;  2NBS A;  4MH2 A;  2VCW A;  2HZF A;  1K3O A;  5CRH A;  4OCE A;  3GNJ A;  1A2J A;  3F9U A;  5HFG A;  4KND A;  2K9F A;  1QXH A;  2WCI A;  4MPF A;  4PNF A;  1SJZ A;  2X8H A;  5C04 A;  5L71 A;  1ZOF A;  2WUL A;  1X5D A;  4O5R A;  3WGE A;  5J4U A;  2MBS A;  4BVX A;  2FNO A;  3BOA A;  3WGD A;  4V2M A;  3TKS A;  3EIN A;  4HI7 A;  2NTO A;  3LYP A;  1PN9 A;  2MBT A;  1X9W B;  1U88 A;  3HJP A;  3A2W A;  2R4V A;  6GSY A;  3WT2 A;  4MF5 A;  4X0X A;  2VL2 A;  3TKR A;  4YQV A;  1V58 A;  4YH2 A;  5DAK A;  5IO0 A;  1IYI A;  3P90 A;  1GL8 A;  4KCA A;  5LCZ A;  1PL1 A;  1B9Y C;  3QPM A;  2HSH A;  1R5A A;  3MSZ A;  2GLR A;  4KDY A;  4KAE A;  2H8L A;  4WXT A;  3IV4 A;  2L5L A;  4LMW A;  2WJU A;  3F4T A;  4IGJ A;  4IVF A;  3UEM A;  4ZB6 A;  1XXU A;  5IOW A;  1MTC A;  1PMT A;  1R26 A;  1EZK A;  1TRS A;  5E4W A;  3CSJ A;  3HZ4 A;  8GSS A;  2G0F A;  3MAK A;  3TDG A;  1K0C A;  1USB A;  4IN0 A;  1T4Y A;  2BTO T;  2P5Q A;  3IAS 2;  3A2V A;  4POL A;  1TI1 A;  2B7J A;  2V2G A;  4KGI A;  3DGQ A;  3VPQ A;  1HD2 A;  4BPY A;  3A2X A;  1EGR A;  3IPZ A;  5D8I A;  2KP2 A;  4AJ7 A;  2VLV A;  1XWB A;  2WS2 A;  2FLS A;  1G0T A;  3VUR A;  1F3A A;  3H79 A;  5HR1 A;  3IOS A;  5G2Z A;  3D5J A;  1ZCP A;  2JZT A;  1I9D A;  1ON4 A;  4V2L A;  1G7O A;  4GTU A;  3RPP A;  4X43 A;  3LXT A;  3M9J A;  4ULX A;  1ERV A;  1OYJ A;  2VO4 A;  3ZTL A;  4WBR D;  4POK A;  2VL9 A;  4BVY A;  3IA1 A;  1M9B A;  3M0F A;  17GS A;  1WMJ A;  4D73 B;  3VI5 A;  4IW9 A;  2B5E A;  1EV4 A;  3EU3 A;  4F2I A;  3F0I A;  1TW9 A;  3HHV A;  5IQY A;  4AF2 A;  2VCZ A;  1TRU A;  2OBK A;  1KEB A;  2IFQ B;  4K0G A;  1EV9 A;  1Y25 A;  3UJ1 A;  4K8M A;  4MZW A;  4HDE A;  3GL5 A;  3RBT A;  12GS A;  1V2A A;  1ERW A;  4IKH A;  1YKC A;  3AY8 A;  2RII A;  2DJ3 A;  1TK5 B;  1SD8 A;  1YKA A;  2OE0 A;  1WE0 A;  2G2Q A;  2B5Y A;  3GYK A;  1YQ1 A;  5DCG A;  2IWT A;  5KN2 A;  5CNW A;  3RHB A;  3TKS E;  1GLQ A;  1FW1 A;  1MD4 A;  1HNB A;  3LEF A;  4PUA A;  2YWM A;  1QQ2 A;  4V1A g;  3K8N A;  1A2M A;  4CW9 A;  2E0Q A;  10GS A;  18GS A;  4YAP A;  1TTZ A;  5IPG A;  4BL7 A;  3CSH A;  3EYT A;  2NDO A;  2A2S A;  5IMV A;  5COH A;  2IME A;  1AIU A;  2DML A;  6GSV A;  3D4T A;  2HRF A;  2K8V A;  3BD2 A;  3O3T A;  2FWE A;  20GS A;  3M9K A;  4I2U A;  1VF4 A;  4ZBB A;  2O87 A;  4NHZ A;  4L0W A;  2B6M A;  4ECI A;  5JCG A;  2ES7 A;  3F63 A;  2JAD A;  2L4C A;  2AAW A;  1OE8 A;  3DD3 A;  3FEU A;  1DSB A;  3S9F A;  2VCV A;  3MNG A;  3EC3 A;  3O76 A;  2R6K A;  1SK0 A;  4OD7 A;  3IBH A;  3H4K A;  4K9Z A;  2YZU A;  4QL7 A;  4HJ2 A;  4MH3 A;  4EDY A;  2Z9S A;  2WRT A;  1S3D A;  1EEM A;  4KUN A;  1YEP A;  3QFB C;  1GSQ A;  3I43 A;  1DBY A;  2KUC A;  1WRY A;  1WOU A;  4EF0 A;  3ERF A;  4Z7X A;  4ILF A;  3BCK A;  2H19 A;  1X9S B;  2DJJ A;  2ON7 A;  4HQS A;  2LTK A;  2FD3 A;  3PR8 A;  4DSS A;  3APS A;  1M9A A;  1AW9 A;  2IMF A;  5KN3 A;  4ZBA A;  3RDW A;  1K0B A;  4XS4 A;  2B7K A;  3DXB A;  1ERU A;  2I3Y A;  5JWR B;  2YP6 A;  4EDZ A;  1Q98 A;  5E59 A;  2LEG A;  1V9W A;  5AN1 A;  3ZIT A;  4NV5 A;  1GTI A;  2LRT A;  2VM2 A;  3MDK A;  3UBK A;  1NHO A;  3GKK A;  2YWN A;  3TKQ A;  2H76 A;  5A4U A;  5DCH A;  1CQH A;  1FHE A;  1SYX A;  3W6G A;  3IE3 A;  5H5R A;  2MMN A;  4Q5F A;  5CO3 A; 
#chains in the Genus database with same CATH topology
 3BCI A;  2IPA A;  2O85 A;  2HNL A;  1TJD A;  2PBJ A;  1GTB A;  2AJQ B;  1E2Y A;  1O73 A;  3H93 A;  4O7H A;  2V1M A;  4TVE A;  4XS6 A;  4TN8 A;  19GS A;  1PD2 1;  2O7K A;  2PPT A;  1GNW A;  4MJA A;  3FR6 A;  5LD0 A;  2FY6 A;  2OKA A;  1F9M A;  4JBB A;  1PX6 A;  2ALB A;  4NXI A;  2LJA A;  2VAF A;  4WKW A;  4LA1 A;  5ID2 A;  2FUG 2;  2JL4 A;  3GST A;  2A2R A;  2MZC A;  5IO2 A;  3KH9 A;  3LGC A;  4FYU A;  1SEN A;  2DBC A;  4RI6 A;  2CQ9 A;  1WJK A;  2XBI A;  2JZS A;  2H70 A;  2L59 A;  3ZLP A;  1M2D A;  2LNT A;  1KTE A;  1XVQ A;  3ZVJ A;  2I9H A;  1G7E A;  3C71 A;  1GH2 A;  3TRX A;  1O6J A;  4DSQ A;  1J08 A;  2QA2 A;  5EY6 A;  5HR2 A;  1MEK A;  4TXO A;  4RI7 A;  5KN1 A;  2H66 A;  3QDN A;  4GCI A;  1M2A A;  5D9V A;  2RM6 A;  4I97 A;  2TIR A;  1DE1 A;  5DDL A;  1ERT A;  1OC9 A;  3TRQ A;  2D2Z A;  1T1V A;  4OWY A;  1X9M B;  1SL1 B;  3HJO A;  3US3 A;  1R7H A;  1T00 A;  3HVV A;  1B8X A;  2CT6 A;  3IK7 A;  4MLY A;  2J23 A;  3ZRE A;  3KMN A;  14GS A;  4CHS A;  2CA8 A;  3F4S A;  3L9U A;  1R4W A;  1NM3 A;  1GSU A;  5ECR B;  3UL3 A;  4LMV A;  1ZYN A;  4V1A p;  3UOM A;  2HZE A;  5CP1 A;  1MDJ A;  5G1L A;  5ECS A;  1U3A A;  3L4N A;  5G5F A;  3KTL A;  3WGX A;  5JCU A;  1YEX A;  2DSA A;  5D9W A;  5DJL A;  5CAX A;  4EE0 A;  2OE3 A;  4K2X A;  2DKI A;  4KDU A;  1C72 A;  3EUR A;  2I4A A;  3HJM A;  1GUH A;  4HOJ A;  1JZR A;  4FIW A;  3GTU A;  1VF1 A;  1YJ6 A;  1O8W A;  1U6T A;  2GVP A;  3TCO A;  2H6Z A;  4K2D A;  5GSS A;  3RHC A;  4ISD A;  4ZIJ A;  5IIZ A;  1DE2 A;  4EVM A;  2NPB A;  1NW2 A;  3IHG A;  1FG4 A;  4QQ7 A;  1RK4 A;  2KHP A;  4GQF A;  3F3R A;  3R2Q A;  4GSS A;  4ZB9 A;  9GSS A;  1ZZY A;  4JU5 A;  4MCU A;  2B3S A;  1BAY A;  3DWV A;  1WIK A;  1SU9 A;  1Z7R A;  4ZB8 A;  5IMD A;  4MZC A;  3IC4 A;  5HQP A;  5ECN B;  5C00 A;  3C7M A;  1FB0 A;  5AGY A;  4KE3 A;  5DAL A;  3VWU A;  2FWG A;  3U5R E;  2HFD A;  1ZYQ B;  3ERG A;  2F8A A;  4G9H A;  2JAC A;  3L78 A;  2F8F A;  4PQI A;  2BMX A;  3VLN A;  3TJK A;  5F07 A;  1A2L A;  4JR6 A;  2V6O A;  1YY7 A;  2UZ8 A;  1RW1 A;  2H01 A;  1BX9 A;  4IS0 A;  1M3I A;  1TU7 A;  4HZ2 A;  3R3E A;  1A0F A;  1Y6E A;  4J2F A;  5H5Q A;  4F0B A;  4JE1 A;  4YKF A;  3ERW A;  3ZIJ A;  3GN3 A;  1XBS A;  3CQF A;  6GSS A;  2GDR A;  2DIY A;  1AQW A;  4HEA 2;  4G0K A;  4WR5 A;  2IMK A;  3EMP A;  1PKZ A;  1WP0 A;  1QGV A;  2JZR A;  1XCC A;  4GXZ A;  4N30 A;  3GRX A;  2QC7 A;  4ZL9 A;  1VGL A;  2OAD A;  1PQN A;  2YV7 A;  3F6D A;  3KXO A;  2CVB A;  3NZN A;  5GST A;  3QFA C;  5FT3 A;  4MZB A;  3HVN A;  1GSE A;  2VM1 A;  2VOC A;  5AIV A;  3DRN A;  4KSO A;  3P8W A;  1EP8 A;  2ZNM A;  2C80 A;  4N0V A;  3WD6 A;  1TI3 A;  2MMA A;  1GSS A;  1U3I A;  2E7P A;  2V32 A;  4TR4 A;  4OFM A;  2RUE A;  3RAZ A;  1V98 A;  1TKD B;  1LJR A;  3JCM L;  5HFK A;  4WF4 A;  4K0N A;  1UN2 A;  2GSQ A;  1XWK A;  2WGR A;  2ZUP A;  3J7Y b;  3IK9 A;  2QKE A;  3M1G A;  3DYR A;  2DJK A;  2LUS A;  3W8J A;  4EL1 A;  4MAB A;  5IMF A;  1A23 A;  4K7O A;  4V2N A;  1SD9 A;  1X0R A;  5FHI A;  3MWH A;  3ZML A;  2LQQ A;  3CRT A;  1THX A;  3PIN A;  3GKX A;  2ZCT A;  4ZXG A;  4RUV A;  3M3M A;  2FHE A;  1X5C A;  5ENU A;  4EKZ A;  3KEB A;  4CY8 A;  3FZ9 A;  3WYW A;  5J5N A;  4MK3 A;  1OE7 A;  2X99 A;  5B7C A;  2R5G A;  4ZBD A;  1YDK A;  2C0E A;  4G2E A;  3IAM 2;  2PWJ A;  5G30 A;  3DIE A;  3KCM A;  5CRW A;  3ZFL A;  1Z7P A;  4HUA A;  1B4P A;  2N5A A;  3CRU A;  2YNX A;  4GST A;  5DVB A;  1G6W A;  3VWX A;  2HRK A;  5ECO B;  2LS5 A;  2A4V A;  2RLI A;  4J56 E;  3TJJ A;  3FR3 A;  3N5O A;  4HZ4 A;  5G1K A;  3BBY A;  3EVI A;  1F2E A;  2GT5 A;  2CAI A;  3TKS C;  1JZD A;  4ZIL A;  1W89 A;  4LL4 B;  4K7I A;  5IM9 A;  4DEJ A;  3HD5 A;  3ZL5 A;  4Q5R A;  3WT1 A;  4WEY A;  4MNN A;  4G19 A;  1SK1 A;  1E6B A;  2VL2 C;  4NPB A;  3ZIV A;  3E0U A;  3APQ A;  4N0Z A;  4F82 A;  5DBQ A;  2H1A A;  4BWQ A;  1GP1 A;  4QL9 A;  5ECI B;  2FWF A;  2MMZ A;  1GUK A;  5D96 A;  4IP1 A;  1GSY A;  1ST9 A;  5ECM B;  4JRR A;  1GSF A;  3HVX A;  2HI7 A;  3D0Z A;  4G0L A;  4BVX B;  1VF2 A;  3GHA A;  1O7U A;  1XW5 A;  4DSR A;  1J0F A;  2V6K A;  4EXJ A;  1XWG A;  2TRX A;  3LWA A;  3GFK A;  2H72 A;  1ZYE A;  2AB6 A;  1VRS D;  1TU8 A;  4TR1 A;  5ECP B;  2JU5 A;  4ZL8 A;  1XVW A;  1SL0 B;  3SWL A;  5DAK B;  5DJM A;  5DQY A;  1JLV A;  1XPV A;  1M0U A;  2VCX A;  1M2B A;  2O8V B;  5ELA A;  3TJF A;  2HE3 A;  5CYY A;  1ML6 A;  2C0D A;  1R5P A;  5INY A;  4FYC A;  2GZY A;  3CMI A;  3IHQ A;  4ECJ A;  1Q4J A;  2H6X A;  5F8B A;  1Z5Y E;  1YF1 A;  4XS1 A;  2PU9 C;  2EC4 A;  2R0G A;  4HSC X;  5D9X A;  2LST A;  1URM A;  2IMI A;  4MPG A;  2FA8 A;  5JCW A;  4NMU A;  1AQV A;  4WR4 A;  3HCZ A;  2PVO C;  3HDC A;  3DVX A;  2PMT A;  2M72 A;  5ELG A;  3QOU A;  3Q19 A;  1S3R A;  2CVD A;  1AC1 A;  1B48 A;  1JZO A;  2K6V A;  3ZRD A;  5EPF A;  3KM6 A;  3IC8 A;  1B4Q A;  3O6T A;  1Z6M A;  4K7N A;  1PKW A;  3ZYW A;  1MDK A;  2C1Y A;  3GX0 A;  2YAN A;  3KJY A;  2X8G A;  4OO4 A;  5DQS A;  5ECQ B;  4CY6 A;  4F03 A;  1ZL9 A;  3KZQ A;  3HKR A;  5KN0 A;  5EL8 A;  3G7I A;  1TDI A;  6GSX A;  2DLX A;  3UIW A;  2H75 A;  4I2T A;  1EEJ A;  3DML A;  5IPH A;  5KOW A;  4MJE A;  4ECB A;  4BVY B;  3LXZ A;  1K0M A;  2GQL A;  3L9V A;  2WDU A;  1XW6 A;  4ECC A;  3D6I A;  3G7Y A;  2X8C A;  4PX1 A;  4IEL A;  1TRV A;  2P31 A;  1M99 A;  3GKN A;  1TXX A;  1MDI A;  5D93 A;  3HYP A;  3G9B A;  1OC3 A;  3ZFB A;  2PUK C;  4H86 A;  4ML6 A;  4GLT A;  3QAW A;  4MF6 A;  1PA3 A;  1WPI A;  5GAN D;  1T3B A;  1N8J A;  2OA7 A;  3QMX A;  4K6X A;  3D4M A;  4MJB A;  3GMF A;  3ME7 A;  2M46 A;  2VUP A;  3L0H A;  1K3L A;  1HNA A;  2B1K A;  2EIO A;  1A24 A;  1EGO A;  2CZ3 A;  4L8E A;  2REM A;  3DEX A;  4JZQ A;  13GS A;  2WB9 A;  4BWS A;  3KP9 A;  3KTB A;  5AIX A;  4F9Z A;  4PQ1 A;  3BJ5 A;  1TRW A;  3TRP A;  3EWL A;  3ZVJ D;  2WZ9 A;  3QAG A;  4MA9 A;  1J9B A;  2VLU A;  4BL7 B;  1O8X A;  3FW2 A;  1X5E A;  1KNG A;  2GST A;  1HQO A;  2RM5 A;  4WBJ A;  2L5O A;  2YPM A;  1CQG A;  3KIJ A;  2R37 A;  4FH8 A;  3GA4 A;  2TRC P;  1V40 A;  1PFO A;  1BED A;  4POB A;  3C8E A;  3ED3 A;  4PUR A;  3LJR A;  5D9T A;  1Z6N A;  2AV4 A;  1PRX A;  2YOI A;  4MJC A;  2EIQ A;  3MYD A;  5IMA A;  3VPT A;  3Q18 A;  4USS A;  4D73 A;  1ACV A;  2L6D A;  1SJ6 A;  5AIS A;  1YF0 A;  5IMC A;  3SBC A;  4IP6 A;  2EIR A;  2IFQ A;  2GQM A;  1M7T A;  2VL3 A;  1UC7 A;  5G5E A;  1M3J A;  4X4J A;  3LSZ A;  2L6C A;  3EU4 A;  3GIX A;  4MDC A;  1T7P B;  1ZYP A;  2KOK A;  4L0U A;  1XOB A;  1BQ7 A;  3I9V 2;  1OKT A;  1PGT A;  5HR3 A;  2C4J A;  4XRD A;  5IMZ A;  2IL3 A;  2YJH A;  2C3N A;  2QGV A;  1XG8 A;  3A5W A;  2GTU A;  4NHW A;  4TR3 A;  4OCF A;  3A3T A;  2H73 A;  3HA9 A;  3LOR A;  1SJI A;  1GTA A;  1O85 A;  2KP1 A;  1TOF A;  3D21 A;  1WWJ A;  3HVS A;  4DSS B;  1KBN A;  4HS1 A;  4J57 E;  3KH7 A;  3GUR A;  3VFI A;  4JR4 A;  4I6X A;  4KSM A;  4AJ6 A;  3QAV A;  7GSS A;  4PGT A;  3EPT A;  3TOU A;  1XOA A;  4XS4 B;  5J9C A;  3E9J B;  2GSR A;  2NVL A;  4P3Y B;  3RPN A;  4CDO A;  2CV4 A;  3TGZ A;  2YJ7 A;  2GQK A;  3UVT A;  3FKF A;  3QR6 A;  3EMX A;  4KW6 A;  2F9S A;  2CX4 A;  2WFC A;  4POM A;  4KA0 A;  1OAZ A;  4FYB A;  3TB2 A;  3OR5 A;  2H0H A;  2LNS A;  1F3B A;  2YZH A;  2K18 A;  1B9X C;  1MD3 A;  4O5U A;  1NSW A;  1FVK A;  5IOX A;  3GSS A;  4GQC A;  4A5P A;  1GUM A;  4GRF A;  3VWV A;  1EOG A;  2E2G A;  3FMW A;  3E3E A;  2L57 A;  3CTG A;  4IBP A;  1W4V A;  3TUE A;  4OFN A;  1XZO A;  1LU4 A;  3FK8 A;  3FZ5 A;  1JZW A;  2YCD A;  4YQM A;  3TKP A;  2C3T A;  4KX4 A;  1V57 A;  3EE2 A;  2LJK A;  2BJX A;  2H30 A;  4WET A;  5ID2 B;  3FYG A;  4ACS A;  2CVK A;  1QMV A;  3ZZX A;  4N11 A;  2HLS A;  4ID0 A;  2N5F A;  4K1F A;  1JLW A;  2XBQ A;  2HRA A;  4ZL7 A;  1S3A A;  3QCP A;  1PSQ A;  4IQ1 A;  2LQO A;  3GX8 A;  1OKD A;  4TXO B;  4HQZ A;  1K3Y A;  2A2P A;  2C3Q A;  2XHF A;  2B1L A;  4TW5 A;  4TR0 A;  2AHE A;  1GTU A;  22GS A;  1OC9 B;  4TKY A;  2GGT A;  1PN0 A;  5CRG A;  5A4W A;  3C73 A;  4O5Q A;  3U6V A;  1PL2 A;  5B6N A;  1OC8 A;  2LKU A;  3ME8 A;  2HRN A;  2H1B A;  4IHU A;  1T4Z A;  1F6M C;  3LFL A;  2HZE B;  2M80 A;  1JHB A;  2E2M A;  3GV1 A;  2HSY A;  1PX7 A;  5A4V A;  4KF9 A;  2K8S A;  5H5S A;  4Z2U A;  1U87 A;  2HYX A;  6GSU A;  2DJ2 A;  1AXD A;  2AUV A;  4KB3 A;  3KP8 A;  2P0G A;  3H1N A;  2J9H A;  1THO A;  5ECL B;  3F8U A;  4NV2 A;  5ECH B;  4X1U A;  3PH9 A;  3GTU B;  4KDX A;  3I6A A;  2DC5 A;  2JSZ A;  1SKS B;  4XCS A;  2X49 A;  2H1D A;  3F4R A;  1DUG A;  3FHK A;  1RQM A;  2OE1 A;  4KH7 A;  1EWX A;  2AYT A;  2X64 A;  4Z2R A;  3FZ4 A;  4FO5 A;  4GWR A;  5G31 A;  2IJY A;  3M8N A;  2LV3 A;  2OJL A;  3CTF A;  5J3R A;  1K0A A;  2FWH A;  4PNG A;  1XWC A;  1FVJ A;  2PN8 A;  4MF7 A;  1IYH A;  4O92 A;  2DKH A;  3F3Q A;  2P5R A;  4K5R A;  3DVW A;  2VD0 A;  5D73 A;  4PXO A;  3NIV A;  3ISO A;  5DAL B;  3ZMK A;  4OO5 A;  4XHM A;  6GSW A;  1ABA A;  3CSI A;  4F0C A;  3NOF A;  3Q74 A;  4Q5N A;  5B8A A;  2R3X A;  3V1W A;  4TXV A;  2H71 A;  5JWQ B;  1N2A A;  3FZA A;  2H6Y A;  3N9J A;  1FOH A;  1O81 A;  4E8H A;  2L4Q A;  1QFN A;  1EOH A;  2YN1 A;  1BG5 A;  4LL1 B;  4GSN A;  5ECK B;  3GH9 A;  4WF5 A;  2DMM A;  1K0O A;  5GAP D;  4EC0 A;  1TK8 B;  3APO A;  2N5B A;  2GZP A;  3UAP A;  2XPD A;  3UMA A;  3G7J A;  4RQR A;  4XTS A;  2VLT A;  4EUY A;  4BA7 A;  5HFI A;  1AUC A;  4AJ8 A;  3I69 A;  3LW9 A;  5B6M A;  4KCE A;  2GS3 A;  2HXK A;  4ICY A;  2F3M A;  3HZ8 A;  4XRA A;  4AGS A;  2XPE A;  3IR4 A;  3VWW A;  3QD9 A;  4OFT A;  4RQX A;  1TP9 A;  16GS A;  2VCQ A;  3TJG A;  5B8B A;  3L9S A;  2F51 A;  1GUL A;  4G10 A;  4HU9 A;  1H4O A;  3KMO A;  3C1R A;  2DJ1 A;  2R0P A;  1XW9 A;  1TK0 B;  5J9B A;  1XIY A;  2C0F A;  4TRX A;  1SK2 A;  4Q5Q A;  2FA4 A;  1Z9H A;  4XIH A;  1XWA A;  2O89 A;  4OMV A;  3CBU A;  2IIY A;  3UBL A;  1SKW B;  4L5O A;  3Q6O A;  3P2A A;  1UVZ A;  2OAC A;  1HYU A;  2I81 A;  3VK9 A;  2R0C A;  4YQU A;  1GLP A;  2HT9 A;  5F05 A;  4PQH A;  2FCH A;  5JWO B;  2YWO A;  3C1S A;  3D22 A;  3IXR A;  4MMM A;  4MP4 A;  5LNK e;  1SYR A;  3HY2 A;  3FRC A;  2PVQ A;  5A5K A;  1AQX A;  1XFL A;  2CZ2 A;  2VD1 A;  4N10 A;  1YZX A;  2MYG A;  3H8Q A;  2DIZ A;  2VCT A;  5CRE A;  4PUF C;  1K0D A;  1LBK A;  4I8B A;  3VI7 A;  1A8Y A;  4I5Q A;  2LRC A;  3IRA A;  5J41 A;  1FAA A;  2I1U A;  2MMO A;  5EVO A;  4HU7 A;  6GST A;  2IN3 A;  1GWC A;  4HJM A;  4IQA A;  2JSY A;  1FOV A;  1BJX A;  3LG6 A;  2GSS A;  2CAQ A;  1VF3 A;  4E8E A;  1S3C A;  3LYK A;  1AAZ A;  1QUW A;  4BIK A;  2H0I A;  2PGT A;  2QA1 A;  2H74 A;  3F6F A;  1OVN A;  11GS A;  3J7Y k;  3P7X A;  4GF0 A;  2H0G A;  2H1G A;  3HXS A;  2YWI A;  1GSD A;  4NAX A;  3UAR A;  3FR9 A;  2ON5 A;  4DVC A;  4IJ3 A;  5KEJ A;  1I5G A;  5HR0 A;  2PER A;  3W8S A;  3TOT A;  5ABR A;  3CXG A;  2CX3 A;  1FO5 A;  1BYE A;  1G6Y A;  5F06 A;  1F37 A;  2OBI A;  3PGT A;  1UA5 A;  5FWG A;  2GT6 A;  4TOP A;  3TJB A;  1A0R P;  5CRD A;  1ZMA A;  2B5X A;  2DJ0 A;  2QSI A;  1Z3E A;  1A8L A;  4TR1 B;  1FB6 A;  3KGK A;  2RUF A;  4LLR A;  2YV9 A;  3MIX A;  1QK8 A;  3GUS A;  4YAV A;  1EP7 A;  5F0G A;  1T8E B;  1NHY A;  1ZGN A;  2C0G A;  2LJR A;  3DKS A;  1HNC A;  1GNE A;  3CYN A;  2XC2 A;  3GH6 A;  1K0N A;  3FY7 A;  2C8U A;  4EO3 A;  1JFU A;  3GKM A;  3UVH A;  4IJI A;  2VIM A;  3KD0 A;  3LQ7 A;  5GZZ B;  2FGX A;  4NWY A;  2KLX A;  4JED A;  3GL3 A;  2V41 A;  2GZZ A;  2R2J A;  1GRX A;  4K5S A;  2IMD A;  1SKR B;  4L5L A;  1ILO A;  4ML1 A;  2LRN A;  3IDV A;  1SL2 B;  1H75 A;  4O32 A;  2NBS A;  4MH2 A;  2VCW A;  2HZF A;  1K3O A;  5CRH A;  4OCE A;  3GNJ A;  1A2J A;  3F9U A;  5HFG A;  4KND A;  2K9F A;  1QXH A;  2WCI A;  4MPF A;  4PNF A;  1SJZ A;  2X8H A;  5C04 A;  5L71 A;  1ZOF A;  2WUL A;  1X5D A;  4O5R A;  3WGE A;  5J4U A;  2MBS A;  4BVX A;  2FNO A;  3BOA A;  3WGD A;  4V2M A;  3TKS A;  3EIN A;  4HI7 A;  2NTO A;  3LYP A;  1PN9 A;  2MBT A;  1X9W B;  1U88 A;  3HJP A;  3A2W A;  2R4V A;  6GSY A;  3WT2 A;  4MF5 A;  4X0X A;  2VL2 A;  3TKR A;  4YQV A;  1V58 A;  4YH2 A;  5DAK A;  5IO0 A;  1IYI A;  3P90 A;  1GL8 A;  4KCA A;  5LCZ A;  1PL1 A;  1B9Y C;  3QPM A;  2HSH A;  1R5A A;  3MSZ A;  2GLR A;  4KDY A;  4KAE A;  2H8L A;  4WXT A;  5KOX A;  3IV4 A;  2L5L A;  4LMW A;  2WJU A;  3F4T A;  4IGJ A;  4IVF A;  3UEM A;  4ZB6 A;  1XXU A;  5IOW A;  1MTC A;  1PMT A;  1R26 A;  1EZK A;  1TRS A;  5E4W A;  3CSJ A;  3HZ4 A;  8GSS A;  2G0F A;  3MAK A;  3PPU A;  3TDG A;  1K0C A;  1USB A;  4IN0 A;  4Z2T A;  1T4Y A;  2BTO T;  2P5Q A;  3IAS 2;  3A2V A;  4POL A;  1TI1 A;  2B7J A;  2V2G A;  4KGI A;  3DGQ A;  2A4H A;  3VPQ A;  1HD2 A;  4BPY A;  3A2X A;  1EGR A;  3IPZ A;  4G0I A;  5D8I A;  2KP2 A;  4AJ7 A;  2VLV A;  1XWB A;  2WS2 A;  2FLS A;  1G0T A;  3VUR A;  1F3A A;  3H79 A;  5HR1 A;  3IOS A;  5G2Z A;  3D5J A;  1ZCP A;  2JZT A;  1I9D A;  1ON4 A;  2X4A A;  4V2L A;  1G7O A;  4GTU A;  3RPP A;  4X43 A;  3LXT A;  3M9J A;  4ULX A;  1ERV A;  1OYJ A;  2VO4 A;  3ZTL A;  4WBR D;  4POK A;  2VL9 A;  4FQU A;  4BVY A;  3IA1 A;  4EIP A;  1M9B A;  3M0F A;  17GS A;  2HSM A;  1WMJ A;  4D73 B;  3VI5 A;  4IW9 A;  2B5E A;  1EV4 A;  3EU3 A;  4F2I A;  3F0I A;  1TW9 A;  3HHV A;  5IQY A;  4AF2 A;  2VCZ A;  1TRU A;  2OBK A;  1KEB A;  2IFQ B;  4K0G A;  1EV9 A;  1Y25 A;  3UJ1 A;  4K8M A;  4MZW A;  4HDE A;  3GL5 A;  3RBT A;  12GS A;  1V2A A;  1ERW A;  4IKH A;  1YKC A;  3AY8 A;  2RII A;  2DJ3 A;  1TK5 B;  1SD8 A;  1YKA A;  2OE0 A;  1WE0 A;  2G2Q A;  2B5Y A;  3GYK A;  1YQ1 A;  5DCG A;  2IWT A;  5KN2 A;  5CNW A;  3RHB A;  3TKS E;  1GLQ A;  1FW1 A;  1MD4 A;  1HNB A;  3LEF A;  4PUA A;  2YWM A;  1QQ2 A;  4V1A g;  3K8N A;  1A2M A;  4CW9 A;  2E0Q A;  10GS A;  18GS A;  5BRT A;  4YAP A;  1TTZ A;  5IPG A;  4BL7 A;  3CSH A;  3EYT A;  2NDO A;  2A2S A;  5IMV A;  5COH A;  2IME A;  1AIU A;  2DML A;  6GSV A;  3D4T A;  2HRF A;  2K8V A;  3BD2 A;  4PTS A;  3O3T A;  2FWE A;  20GS A;  3M9K A;  4I2U A;  1VF4 A;  4ZBB A;  2O87 A;  4NHZ A;  4L0W A;  2B6M A;  4ECI A;  5JCG A;  2ES7 A;  3F63 A;  2JAD A;  2L4C A;  2AAW A;  4EIQ A;  1OE8 A;  3DD3 A;  3FEU A;  1DSB A;  3S9F A;  2VCV A;  4YKG A;  3MNG A;  3EC3 A;  3O76 A;  2R6K A;  1SK0 A;  4OD7 A;  3IBH A;  3H4K A;  4K9Z A;  2YZU A;  4QL7 A;  4HJ2 A;  4MH3 A;  4EDY A;  2Z9S A;  2WRT A;  1S3D A;  1EEM A;  4KUN A;  5BMU A;  1YEP A;  3QFB C;  1GSQ A;  3I43 A;  1DBY A;  2KUC A;  1WRY A;  1WOU A;  4EF0 A;  3ERF A;  4Z7X A;  4ILF A;  3BCK A;  2H19 A;  1X9S B;  2DJJ A;  2ON7 A;  4HQS A;  2LTK A;  2FD3 A;  3PR8 A;  4DSS A;  3APS A;  1M9A A;  1AW9 A;  2IMF A;  5KN3 A;  4ZBA A;  3RDW A;  1K0B A;  4XS4 A;  2B7K A;  3DXB A;  1ERU A;  2I3Y A;  5JWR B;  2YP6 A;  4EDZ A;  3A5I A;  1Q98 A;  5E59 A;  2LEG A;  1V9W A;  5AN1 A;  3ZIT A;  4NV5 A;  1GTI A;  2LRT A;  2VM2 A;  3MDK A;  3UBK A;  1NHO A;  3GKK A;  2YWN A;  3TKQ A;  2H76 A;  5A4U A;  5DCH A;  1CQH A;  1FHE A;  1SYX A;  3W6G A;  3IE3 A;  5H5R A;  2MMN A;  4Q5F A;  5CO3 A; 
#chains in the Genus database with same CATH homology
 3BCI A;  2IPA A;  2O85 A;  2HNL A;  1TJD A;  2PBJ A;  1GTB A;  2AJQ B;  1E2Y A;  1O73 A;  3H93 A;  4O7H A;  2V1M A;  4TVE A;  4XS6 A;  4TN8 A;  19GS A;  1PD2 1;  2O7K A;  2PPT A;  1GNW A;  4MJA A;  3FR6 A;  5LD0 A;  2FY6 A;  2OKA A;  1F9M A;  4JBB A;  1PX6 A;  2ALB A;  4NXI A;  2LJA A;  2VAF A;  4WKW A;  4LA1 A;  5ID2 A;  2FUG 2;  2JL4 A;  3GST A;  2A2R A;  2MZC A;  5IO2 A;  3KH9 A;  3LGC A;  4FYU A;  1SEN A;  2DBC A;  4RI6 A;  2CQ9 A;  1WJK A;  2XBI A;  2JZS A;  2H70 A;  2L59 A;  3ZLP A;  1M2D A;  2LNT A;  1KTE A;  1XVQ A;  3ZVJ A;  2I9H A;  1G7E A;  3C71 A;  1GH2 A;  3TRX A;  1O6J A;  4DSQ A;  1J08 A;  2QA2 A;  5EY6 A;  5HR2 A;  1MEK A;  4TXO A;  4RI7 A;  5KN1 A;  2H66 A;  3QDN A;  4GCI A;  1M2A A;  5D9V A;  2RM6 A;  4I97 A;  2TIR A;  1DE1 A;  5DDL A;  1ERT A;  1OC9 A;  3TRQ A;  2D2Z A;  1T1V A;  4OWY A;  1X9M B;  1SL1 B;  3HJO A;  3US3 A;  1R7H A;  1T00 A;  3HVV A;  1B8X A;  2CT6 A;  3IK7 A;  4MLY A;  2J23 A;  3ZRE A;  3KMN A;  14GS A;  4CHS A;  2CA8 A;  3F4S A;  3L9U A;  1R4W A;  1NM3 A;  1GSU A;  5ECR B;  3UL3 A;  4LMV A;  1ZYN A;  4V1A p;  3UOM A;  2HZE A;  5CP1 A;  1MDJ A;  5G1L A;  5ECS A;  1U3A A;  3L4N A;  5G5F A;  3KTL A;  3WGX A;  5JCU A;  1YEX A;  2DSA A;  5D9W A;  5DJL A;  5CAX A;  4EE0 A;  2OE3 A;  4K2X A;  2DKI A;  4KDU A;  1C72 A;  3EUR A;  2I4A A;  3HJM A;  1GUH A;  4HOJ A;  1JZR A;  4FIW A;  3GTU A;  1VF1 A;  1YJ6 A;  1O8W A;  1U6T A;  2GVP A;  3TCO A;  2H6Z A;  4K2D A;  5GSS A;  3RHC A;  4ISD A;  4ZIJ A;  5IIZ A;  1DE2 A;  4EVM A;  2NPB A;  1NW2 A;  3IHG A;  1FG4 A;  4QQ7 A;  1RK4 A;  2KHP A;  4GQF A;  3F3R A;  3R2Q A;  4GSS A;  4ZB9 A;  9GSS A;  1ZZY A;  4JU5 A;  4MCU A;  2B3S A;  1BAY A;  3DWV A;  1WIK A;  1SU9 A;  1Z7R A;  4ZB8 A;  5IMD A;  4MZC A;  3IC4 A;  5HQP A;  5ECN B;  5C00 A;  3C7M A;  1FB0 A;  5AGY A;  4KE3 A;  5DAL A;  3VWU A;  2FWG A;  3U5R E;  2HFD A;  1ZYQ B;  3ERG A;  2F8A A;  4G9H A;  2JAC A;  3L78 A;  2F8F A;  4PQI A;  2BMX A;  3VLN A;  3TJK A;  5F07 A;  1A2L A;  4JR6 A;  2V6O A;  1YY7 A;  2UZ8 A;  1RW1 A;  2H01 A;  1BX9 A;  4IS0 A;  1TU7 A;  4HZ2 A;  3R3E A;  1A0F A;  1Y6E A;  4J2F A;  5H5Q A;  4F0B A;  4JE1 A;  4YKF A;  3ERW A;  3ZIJ A;  3GN3 A;  1XBS A;  6GSS A;  2GDR A;  2DIY A;  1AQW A;  4HEA 2;  4G0K A;  4WR5 A;  2IMK A;  3EMP A;  1PKZ A;  1WP0 A;  1QGV A;  2JZR A;  1XCC A;  4GXZ A;  4N30 A;  3GRX A;  2QC7 A;  4ZL9 A;  1VGL A;  2OAD A;  1PQN A;  2YV7 A;  3F6D A;  3KXO A;  2CVB A;  3NZN A;  5GST A;  3QFA C;  5FT3 A;  4MZB A;  1GSE A;  2VM1 A;  2VOC A;  5AIV A;  3DRN A;  4KSO A;  3P8W A;  1EP8 A;  2ZNM A;  2C80 A;  4N0V A;  3WD6 A;  1TI3 A;  2MMA A;  1GSS A;  1U3I A;  2E7P A;  2V32 A;  4TR4 A;  4OFM A;  2RUE A;  3RAZ A;  1V98 A;  1TKD B;  1LJR A;  3JCM L;  5HFK A;  4WF4 A;  4K0N A;  1UN2 A;  2GSQ A;  1XWK A;  2WGR A;  2ZUP A;  3J7Y b;  3IK9 A;  2QKE A;  3M1G A;  3DYR A;  2DJK A;  2LUS A;  3W8J A;  4EL1 A;  4MAB A;  5IMF A;  1A23 A;  4K7O A;  4V2N A;  1SD9 A;  1X0R A;  5FHI A;  3MWH A;  3ZML A;  2LQQ A;  3CRT A;  1THX A;  3PIN A;  3GKX A;  2ZCT A;  4ZXG A;  4RUV A;  3M3M A;  2FHE A;  1X5C A;  5ENU A;  4EKZ A;  3KEB A;  4CY8 A;  3FZ9 A;  3WYW A;  5J5N A;  4MK3 A;  1OE7 A;  2X99 A;  5B7C A;  2R5G A;  4ZBD A;  1YDK A;  2C0E A;  4G2E A;  3IAM 2;  2PWJ A;  5G30 A;  3DIE A;  3KCM A;  5CRW A;  3ZFL A;  1Z7P A;  4HUA A;  1B4P A;  2N5A A;  3CRU A;  2YNX A;  4GST A;  5DVB A;  1G6W A;  3VWX A;  2HRK A;  5ECO B;  2LS5 A;  2A4V A;  2RLI A;  4J56 E;  3TJJ A;  3FR3 A;  3N5O A;  4HZ4 A;  5G1K A;  3BBY A;  3EVI A;  1F2E A;  2GT5 A;  2CAI A;  3TKS C;  1JZD A;  4ZIL A;  1W89 A;  4LL4 B;  4K7I A;  5IM9 A;  4DEJ A;  3HD5 A;  3ZL5 A;  4Q5R A;  3WT1 A;  4WEY A;  4MNN A;  4G19 A;  1SK1 A;  1E6B A;  2VL2 C;  4NPB A;  3ZIV A;  3E0U A;  3APQ A;  4N0Z A;  4F82 A;  5DBQ A;  2H1A A;  4BWQ A;  1GP1 A;  4QL9 A;  5ECI B;  2FWF A;  2MMZ A;  1GUK A;  5D96 A;  4IP1 A;  1GSY A;  1ST9 A;  5ECM B;  4JRR A;  1GSF A;  3HVX A;  2HI7 A;  3D0Z A;  4G0L A;  4BVX B;  1VF2 A;  3GHA A;  1O7U A;  1XW5 A;  4DSR A;  1J0F A;  2V6K A;  4EXJ A;  1XWG A;  2TRX A;  3LWA A;  3GFK A;  2H72 A;  1ZYE A;  2AB6 A;  1VRS D;  1TU8 A;  4TR1 A;  5ECP B;  2JU5 A;  4ZL8 A;  1XVW A;  1SL0 B;  3SWL A;  5DAK B;  5DJM A;  5DQY A;  1JLV A;  1XPV A;  1M0U A;  2VCX A;  1M2B A;  2O8V B;  5ELA A;  3TJF A;  2HE3 A;  5CYY A;  1ML6 A;  2C0D A;  1R5P A;  5INY A;  4FYC A;  2GZY A;  3CMI A;  3IHQ A;  4ECJ A;  1Q4J A;  2H6X A;  5F8B A;  1Z5Y E;  1YF1 A;  4XS1 A;  2PU9 C;  2EC4 A;  2R0G A;  5D9X A;  2LST A;  1URM A;  2IMI A;  4MPG A;  2FA8 A;  5JCW A;  4NMU A;  1AQV A;  4WR4 A;  3HCZ A;  2PVO C;  3HDC A;  3DVX A;  2PMT A;  2M72 A;  5ELG A;  3QOU A;  3Q19 A;  2CVD A;  1AC1 A;  1B48 A;  1JZO A;  2K6V A;  3ZRD A;  5EPF A;  3KM6 A;  3IC8 A;  1B4Q A;  3O6T A;  1Z6M A;  4K7N A;  1PKW A;  3ZYW A;  1MDK A;  2C1Y A;  3GX0 A;  2YAN A;  3KJY A;  2X8G A;  4OO4 A;  5DQS A;  5ECQ B;  4CY6 A;  4F03 A;  1ZL9 A;  3KZQ A;  3HKR A;  5KN0 A;  5EL8 A;  3G7I A;  1TDI A;  6GSX A;  2DLX A;  3UIW A;  2H75 A;  4I2T A;  1EEJ A;  3DML A;  5IPH A;  5KOW A;  4MJE A;  4ECB A;  4BVY B;  3LXZ A;  1K0M A;  2GQL A;  3L9V A;  2WDU A;  1XW6 A;  4ECC A;  3D6I A;  3G7Y A;  2X8C A;  4PX1 A;  4IEL A;  1TRV A;  2P31 A;  1M99 A;  3GKN A;  1TXX A;  1MDI A;  5D93 A;  3HYP A;  3G9B A;  1OC3 A;  3ZFB A;  2PUK C;  4H86 A;  4ML6 A;  4GLT A;  3QAW A;  4MF6 A;  1PA3 A;  1WPI A;  5GAN D;  1T3B A;  1N8J A;  2OA7 A;  3QMX A;  4K6X A;  3D4M A;  4MJB A;  3GMF A;  3ME7 A;  2M46 A;  2VUP A;  3L0H A;  1K3L A;  1HNA A;  2B1K A;  2EIO A;  1A24 A;  1EGO A;  2CZ3 A;  4L8E A;  2REM A;  3DEX A;  4JZQ A;  13GS A;  2WB9 A;  4BWS A;  3KP9 A;  3KTB A;  5AIX A;  4F9Z A;  4PQ1 A;  3BJ5 A;  1TRW A;  3TRP A;  3EWL A;  3ZVJ D;  2WZ9 A;  3QAG A;  4MA9 A;  1J9B A;  2VLU A;  4BL7 B;  1O8X A;  3FW2 A;  1X5E A;  1KNG A;  2GST A;  1HQO A;  2RM5 A;  4WBJ A;  2L5O A;  2YPM A;  1CQG A;  3KIJ A;  2R37 A;  4FH8 A;  3GA4 A;  2TRC P;  1V40 A;  1BED A;  4POB A;  3C8E A;  3ED3 A;  4PUR A;  3LJR A;  5D9T A;  1Z6N A;  2AV4 A;  1PRX A;  2YOI A;  4MJC A;  2EIQ A;  3MYD A;  5IMA A;  3VPT A;  3Q18 A;  4USS A;  4D73 A;  1ACV A;  2L6D A;  1SJ6 A;  5AIS A;  1YF0 A;  5IMC A;  3SBC A;  4IP6 A;  2EIR A;  2IFQ A;  2GQM A;  1M7T A;  2VL3 A;  1UC7 A;  5G5E A;  4X4J A;  3LSZ A;  2L6C A;  3EU4 A;  3GIX A;  4MDC A;  1T7P B;  1ZYP A;  2KOK A;  4L0U A;  1XOB A;  1BQ7 A;  3I9V 2;  1OKT A;  1PGT A;  5HR3 A;  2C4J A;  4XRD A;  5IMZ A;  2IL3 A;  2YJH A;  2C3N A;  2QGV A;  3A5W A;  2GTU A;  4NHW A;  4TR3 A;  4OCF A;  3A3T A;  2H73 A;  3HA9 A;  3LOR A;  1SJI A;  1GTA A;  1O85 A;  2KP1 A;  1TOF A;  3D21 A;  1WWJ A;  3HVS A;  4DSS B;  1KBN A;  4HS1 A;  4J57 E;  3KH7 A;  3GUR A;  3VFI A;  4JR4 A;  4I6X A;  4KSM A;  4AJ6 A;  3QAV A;  7GSS A;  4PGT A;  3EPT A;  3TOU A;  1XOA A;  4XS4 B;  5J9C A;  3E9J B;  2GSR A;  2NVL A;  4P3Y B;  3RPN A;  4CDO A;  2CV4 A;  3TGZ A;  2YJ7 A;  2GQK A;  3UVT A;  3FKF A;  3QR6 A;  3EMX A;  4KW6 A;  2F9S A;  2CX4 A;  2WFC A;  4POM A;  4KA0 A;  1OAZ A;  4FYB A;  3TB2 A;  3OR5 A;  2H0H A;  2LNS A;  1F3B A;  2YZH A;  2K18 A;  1B9X C;  1MD3 A;  4O5U A;  1NSW A;  1FVK A;  5IOX A;  3GSS A;  4GQC A;  4A5P A;  1GUM A;  4GRF A;  3VWV A;  1EOG A;  2E2G A;  3FMW A;  3E3E A;  2L57 A;  3CTG A;  4IBP A;  1W4V A;  3TUE A;  4OFN A;  1XZO A;  1LU4 A;  3FK8 A;  3FZ5 A;  1JZW A;  2YCD A;  4YQM A;  3TKP A;  2C3T A;  4KX4 A;  1V57 A;  3EE2 A;  2LJK A;  2BJX A;  2H30 A;  4WET A;  5ID2 B;  3FYG A;  4ACS A;  2CVK A;  1QMV A;  3ZZX A;  4N11 A;  2HLS A;  4ID0 A;  2N5F A;  4K1F A;  1JLW A;  2XBQ A;  2HRA A;  4ZL7 A;  1S3A A;  3QCP A;  1PSQ A;  4IQ1 A;  2LQO A;  3GX8 A;  1OKD A;  4TXO B;  4HQZ A;  1K3Y A;  2A2P A;  2C3Q A;  2XHF A;  2B1L A;  4TW5 A;  4TR0 A;  2AHE A;  1GTU A;  22GS A;  1OC9 B;  4TKY A;  2GGT A;  1PN0 A;  5CRG A;  5A4W A;  3C73 A;  4O5Q A;  3U6V A;  1PL2 A;  5B6N A;  1OC8 A;  2LKU A;  3ME8 A;  2HRN A;  2H1B A;  4IHU A;  1T4Z A;  1F6M C;  3LFL A;  2HZE B;  2M80 A;  1JHB A;  2E2M A;  3GV1 A;  2HSY A;  1PX7 A;  5A4V A;  4KF9 A;  2K8S A;  5H5S A;  4Z2U A;  1U87 A;  2HYX A;  6GSU A;  2DJ2 A;  1AXD A;  2AUV A;  4KB3 A;  3KP8 A;  2P0G A;  3H1N A;  2J9H A;  1THO A;  5ECL B;  3F8U A;  4NV2 A;  5ECH B;  4X1U A;  3PH9 A;  3GTU B;  4KDX A;  3I6A A;  2DC5 A;  2JSZ A;  1SKS B;  4XCS A;  2X49 A;  2H1D A;  3F4R A;  1DUG A;  3FHK A;  1RQM A;  2OE1 A;  4KH7 A;  1EWX A;  2AYT A;  2X64 A;  4Z2R A;  3FZ4 A;  4FO5 A;  4GWR A;  5G31 A;  2IJY A;  3M8N A;  2LV3 A;  2OJL A;  3CTF A;  5J3R A;  1K0A A;  2FWH A;  4PNG A;  1XWC A;  1FVJ A;  2PN8 A;  4MF7 A;  1IYH A;  4O92 A;  2DKH A;  3F3Q A;  2P5R A;  4K5R A;  3DVW A;  2VD0 A;  5D73 A;  4PXO A;  3NIV A;  3ISO A;  5DAL B;  3ZMK A;  4OO5 A;  4XHM A;  6GSW A;  1ABA A;  3CSI A;  4F0C A;  3NOF A;  3Q74 A;  4Q5N A;  5B8A A;  2R3X A;  3V1W A;  4TXV A;  2H71 A;  5JWQ B;  1N2A A;  3FZA A;  2H6Y A;  3N9J A;  1FOH A;  1O81 A;  4E8H A;  2L4Q A;  1QFN A;  1EOH A;  2YN1 A;  1BG5 A;  4LL1 B;  4GSN A;  5ECK B;  3GH9 A;  4WF5 A;  2DMM A;  1K0O A;  5GAP D;  4EC0 A;  1TK8 B;  3APO A;  2N5B A;  2GZP A;  3UAP A;  2XPD A;  3UMA A;  3G7J A;  4RQR A;  4XTS A;  2VLT A;  4EUY A;  4BA7 A;  5HFI A;  1AUC A;  4AJ8 A;  3I69 A;  3LW9 A;  5B6M A;  4KCE A;  2GS3 A;  2HXK A;  4ICY A;  2F3M A;  3HZ8 A;  4XRA A;  4AGS A;  2XPE A;  3IR4 A;  3VWW A;  3QD9 A;  4OFT A;  4RQX A;  1TP9 A;  16GS A;  2VCQ A;  3TJG A;  5B8B A;  3L9S A;  2F51 A;  1GUL A;  4G10 A;  4HU9 A;  1H4O A;  3KMO A;  3C1R A;  2DJ1 A;  2R0P A;  1XW9 A;  1TK0 B;  5J9B A;  1XIY A;  2C0F A;  4TRX A;  1SK2 A;  4Q5Q A;  2FA4 A;  1Z9H A;  4XIH A;  1XWA A;  2O89 A;  4OMV A;  3CBU A;  2IIY A;  3UBL A;  1SKW B;  4L5O A;  3Q6O A;  3P2A A;  1UVZ A;  2OAC A;  1HYU A;  2I81 A;  3VK9 A;  2R0C A;  4YQU A;  1GLP A;  2HT9 A;  5F05 A;  4PQH A;  2FCH A;  5JWO B;  2YWO A;  3C1S A;  3D22 A;  3IXR A;  4MMM A;  4MP4 A;  5LNK e;  1SYR A;  3HY2 A;  3FRC A;  2PVQ A;  5A5K A;  1AQX A;  1XFL A;  2CZ2 A;  2VD1 A;  4N10 A;  1YZX A;  2MYG A;  3H8Q A;  2DIZ A;  2VCT A;  5CRE A;  4PUF C;  1K0D A;  1LBK A;  4I8B A;  3VI7 A;  1A8Y A;  4I5Q A;  2LRC A;  3IRA A;  5J41 A;  1FAA A;  2I1U A;  2MMO A;  5EVO A;  4HU7 A;  6GST A;  2IN3 A;  1GWC A;  4HJM A;  4IQA A;  2JSY A;  1FOV A;  1BJX A;  3LG6 A;  2GSS A;  2CAQ A;  1VF3 A;  4E8E A;  1S3C A;  3LYK A;  1AAZ A;  1QUW A;  2H0I A;  2PGT A;  2QA1 A;  2H74 A;  3F6F A;  1OVN A;  11GS A;  3J7Y k;  3P7X A;  4GF0 A;  2H0G A;  2H1G A;  3HXS A;  2YWI A;  1GSD A;  4NAX A;  3UAR A;  3FR9 A;  2ON5 A;  4DVC A;  4IJ3 A;  5KEJ A;  1I5G A;  5HR0 A;  2PER A;  3W8S A;  3TOT A;  5ABR A;  3CXG A;  2CX3 A;  1FO5 A;  1BYE A;  1G6Y A;  5F06 A;  1F37 A;  2OBI A;  3PGT A;  1UA5 A;  5FWG A;  2GT6 A;  4TOP A;  3TJB A;  1A0R P;  5CRD A;  1ZMA A;  2B5X A;  2DJ0 A;  2QSI A;  1Z3E A;  1A8L A;  4TR1 B;  1FB6 A;  3KGK A;  2RUF A;  4LLR A;  2YV9 A;  3MIX A;  1QK8 A;  3GUS A;  4YAV A;  1EP7 A;  5F0G A;  1T8E B;  1NHY A;  1ZGN A;  2C0G A;  2LJR A;  3DKS A;  1HNC A;  1GNE A;  3CYN A;  2XC2 A;  3GH6 A;  1K0N A;  3FY7 A;  2C8U A;  4EO3 A;  1JFU A;  3GKM A;  3UVH A;  4IJI A;  2VIM A;  3KD0 A;  3LQ7 A;  5GZZ B;  2FGX A;  4NWY A;  2KLX A;  4JED A;  3GL3 A;  2V41 A;  2GZZ A;  2R2J A;  1GRX A;  4K5S A;  2IMD A;  1SKR B;  4L5L A;  1ILO A;  4ML1 A;  2LRN A;  3IDV A;  1SL2 B;  1H75 A;  4O32 A;  2NBS A;  4MH2 A;  2VCW A;  2HZF A;  1K3O A;  5CRH A;  4OCE A;  3GNJ A;  1A2J A;  3F9U A;  5HFG A;  4KND A;  2K9F A;  1QXH A;  2WCI A;  4MPF A;  4PNF A;  1SJZ A;  2X8H A;  5C04 A;  5L71 A;  1ZOF A;  2WUL A;  1X5D A;  4O5R A;  3WGE A;  5J4U A;  2MBS A;  4BVX A;  2FNO A;  3BOA A;  3WGD A;  4V2M A;  3TKS A;  3EIN A;  4HI7 A;  2NTO A;  3LYP A;  1PN9 A;  2MBT A;  1X9W B;  1U88 A;  3HJP A;  3A2W A;  2R4V A;  6GSY A;  3WT2 A;  4MF5 A;  4X0X A;  2VL2 A;  3TKR A;  4YQV A;  1V58 A;  4YH2 A;  5DAK A;  5IO0 A;  1IYI A;  3P90 A;  1GL8 A;  4KCA A;  5LCZ A;  1PL1 A;  1B9Y C;  3QPM A;  2HSH A;  1R5A A;  3MSZ A;  2GLR A;  4KDY A;  4KAE A;  2H8L A;  4WXT A;  5KOX A;  3IV4 A;  2L5L A;  4LMW A;  2WJU A;  3F4T A;  4IGJ A;  4IVF A;  3UEM A;  4ZB6 A;  1XXU A;  5IOW A;  1MTC A;  1PMT A;  1R26 A;  1EZK A;  1TRS A;  5E4W A;  3CSJ A;  3HZ4 A;  8GSS A;  2G0F A;  3MAK A;  3PPU A;  3TDG A;  1K0C A;  1USB A;  4IN0 A;  4Z2T A;  1T4Y A;  2BTO T;  2P5Q A;  3IAS 2;  3A2V A;  4POL A;  1TI1 A;  2B7J A;  2V2G A;  4KGI A;  3DGQ A;  2A4H A;  3VPQ A;  1HD2 A;  4BPY A;  3A2X A;  1EGR A;  3IPZ A;  4G0I A;  5D8I A;  2KP2 A;  4AJ7 A;  2VLV A;  1XWB A;  2WS2 A;  2FLS A;  1G0T A;  3VUR A;  1F3A A;  3H79 A;  5HR1 A;  3IOS A;  5G2Z A;  3D5J A;  1ZCP A;  2JZT A;  1I9D A;  1ON4 A;  2X4A A;  4V2L A;  1G7O A;  4GTU A;  3RPP A;  4X43 A;  3LXT A;  3M9J A;  4ULX A;  1ERV A;  1OYJ A;  2VO4 A;  3ZTL A;  4WBR D;  4POK A;  2VL9 A;  4FQU A;  4BVY A;  3IA1 A;  4EIP A;  1M9B A;  3M0F A;  17GS A;  2HSM A;  1WMJ A;  4D73 B;  3VI5 A;  4IW9 A;  2B5E A;  1EV4 A;  3EU3 A;  4F2I A;  3F0I A;  1TW9 A;  3HHV A;  5IQY A;  4AF2 A;  2VCZ A;  1TRU A;  2OBK A;  1KEB A;  2IFQ B;  4K0G A;  1EV9 A;  1Y25 A;  3UJ1 A;  4K8M A;  4MZW A;  4HDE A;  3GL5 A;  3RBT A;  12GS A;  1V2A A;  1ERW A;  4IKH A;  1YKC A;  3AY8 A;  2RII A;  2DJ3 A;  1TK5 B;  1SD8 A;  1YKA A;  2OE0 A;  1WE0 A;  2G2Q A;  2B5Y A;  3GYK A;  1YQ1 A;  5DCG A;  2IWT A;  5KN2 A;  5CNW A;  3RHB A;  3TKS E;  1GLQ A;  1FW1 A;  1MD4 A;  1HNB A;  3LEF A;  4PUA A;  2YWM A;  1QQ2 A;  4V1A g;  3K8N A;  1A2M A;  4CW9 A;  2E0Q A;  10GS A;  18GS A;  5BRT A;  4YAP A;  1TTZ A;  5IPG A;  4BL7 A;  3CSH A;  3EYT A;  2NDO A;  2A2S A;  5IMV A;  5COH A;  2IME A;  1AIU A;  2DML A;  6GSV A;  3D4T A;  2HRF A;  2K8V A;  3BD2 A;  4PTS A;  3O3T A;  2FWE A;  20GS A;  3M9K A;  4I2U A;  1VF4 A;  4ZBB A;  2O87 A;  4NHZ A;  4L0W A;  2B6M A;  4ECI A;  5JCG A;  2ES7 A;  3F63 A;  2JAD A;  2L4C A;  2AAW A;  4EIQ A;  1OE8 A;  3DD3 A;  3FEU A;  1DSB A;  3S9F A;  2VCV A;  4YKG A;  3MNG A;  3EC3 A;  3O76 A;  2R6K A;  1SK0 A;  4OD7 A;  3IBH A;  3H4K A;  4K9Z A;  2YZU A;  4QL7 A;  4HJ2 A;  4MH3 A;  4EDY A;  2Z9S A;  2WRT A;  1S3D A;  1EEM A;  4KUN A;  5BMU A;  1YEP A;  3QFB C;  1GSQ A;  3I43 A;  1DBY A;  2KUC A;  1WRY A;  1WOU A;  4EF0 A;  3ERF A;  4Z7X A;  4ILF A;  3BCK A;  2H19 A;  1X9S B;  2DJJ A;  2ON7 A;  4HQS A;  2LTK A;  2FD3 A;  3PR8 A;  4DSS A;  3APS A;  1M9A A;  1AW9 A;  2IMF A;  5KN3 A;  4ZBA A;  3RDW A;  1K0B A;  4XS4 A;  2B7K A;  3DXB A;  1ERU A;  2I3Y A;  5JWR B;  2YP6 A;  4EDZ A;  3A5I A;  1Q98 A;  5E59 A;  2LEG A;  1V9W A;  5AN1 A;  3ZIT A;  4NV5 A;  1GTI A;  2LRT A;  2VM2 A;  3MDK A;  3UBK A;  1NHO A;  3GKK A;  2YWN A;  3TKQ A;  2H76 A;  5A4U A;  5DCH A;  1CQH A;  1FHE A;  1SYX A;  3W6G A;  3IE3 A;  5H5R A;  2MMN A;  4Q5F A;  5CO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...