3V1WA

Molecular basis for multiple ligand binding of calsequestrin and potential inhibition by caffeine and gallocatecin
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
349
structure length
349
Chain Sequence
EGLDFPEYDGVDRVINVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQVLEDKGVGFGLVDSEKDAAVAKKLGLTEEDSIYVFKEDEVIEYDGEFSADTLVEFLLDVLEDPVELIEGERELQAFENIEDEIKLIGYFKNKDSEHYKAFKEAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPVTIPDKPNSEEEIVNFVEEHRRSTLRKLKPESMYETWEDDMDGIHIVAFAEEADPDGYEFLEILKSVAQDNTDNPDLSIIWIDPDDFPLLVPYWEKTFDIDLSAPQIGVVNVTDADSVWMEMDDEEDLPSAEELEDWLEDVLEGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calsequestrin-1
publication title Molecular Basis for Multiple Ligand Binding of Calsequestrin and Potential Inhibition by Caffeine and Gallocatecin
rcsb
molecule tags Calcium binding protein
total genus 104
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2011-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3v1wA03
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3v1wA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3v1wA02
3ZREA 1AXDA 1M7TA 3GKNA 4ULXA 2B5EA 2X99A 4P3YB 1BEDA 2CZ3A 3M3MA 4NV2A 3M9KA 1FOVA 4LA1A 2C0GA 5DDLA 3UJ1A 3LWAA 2BMXA 3ZFBA 5DALB 1ZYQB 2V41A 3CSHA 4X1UA 6GSYA 5KEJA 4FYUA 1J0FA 3GSSA 1XBSA 1VRSD 1S3DA 1FHEA 1XFLA 3D22A 2YJ7A 1DE2A 3M8NA 2WRTA 3UOMA 3DEXA 2E7PA 5ECSA 4YQUA 3BOAA 2LRCA 3MSZA 3IPZA 1BG5A 4POBA 1A2MA 2H74A 5CO3A 4MJAA 4OCEA 5C00A 3MDKA 1IYHA 4ML6A 4V1Ag 4IELA 3ZTLA 2PN8A 3TRXA 3Q18A 4TKYA 3HKRA 3UARA 3BJ5A 4NWYA 1M0UA 3CSJA 1T7PB 1MDKA 4TN8A 5D73A 2F3MA 4IVFA 3QFBC 1YEPA 4WR4A 4YAPA 3UVTA 4X0XA 1KNGA 2CQ9A 2GTUA 1GL8A 4LLRA 1MD4A 3D0ZA 4F0CA 1B9XC 2EIRA 2FWHA 4WEYA 1SL0B 1PQNA 2EIOA 5HFGA 2JL4A 2CV4A 3D5JA 2K8VA 1ERUA 4HS1A 5ECPB 4EF0A 5IOXA 2IMEA 2HE3A 5G5EA 2YWIA 1SYXA 3TKQA 1G0TA 4NMUA 1X5CA 1MD3A 1X0RA 2LV3A 4JE1A 1MDJA 1TI3A 1ZOFA 1BQ7A 4IW9A 4XTSA 3E0UA 1Z9HA 1BJXA 1SL2B 2NVLA 3TJJA 1GSQA 5HQPA 5E4WA 1X9WB 1ZMAA 2FY6A 3QAVA 5AIXA 4HI7A 3C7MA 3F0IA 3SBCA 1I5GA 4HUAA 3P7XA 2JACA 1XZOA 4KNDA 4Q5FA 4OO4A 1SK0A 5D9VA 2LRTA 1XWKA 4RI6A 1GWCA 4Q5NA 1M2BA 2GT6A 4JU5A 3RPPA 5G30A 4L5LA 4LMVA 3P90A 5AISA 1V98A 1F9MA 4AGSA 3DMLA 4Z7XA 2L4QA 4XS4B 3D4TA 4AF2A 2VLUA 2VCQA 3GX8A 4PUAA 4PUFC 2AB6A 5C04A 3FZAA 3LQ7A 3D6IA 4TR4A 2B3SA 1VF3A 1XWGA 4HZ2A 2V6KA 2CT6A 2FLSA 1E2YA 2K8SA 4ECBA 3F4RA 4TW5A 19GSA 4WKWA 3HA9A 1SL1B 3O76A 4OO5A 1GSYA 3W8SA 3KTLA 4MF6A 3FZ4A 5HR2A 2I4AA 3G7IA 4PX1A 3JCML 4MF5A 2H1AA 1EV4A 1Z7PA 2H66A 2OBIA 4IN0A 1MDIA 2GDRA 4D73B 1CQGA 1GSEA 2FHEA 3G7YA 5ID2B 2C3TA 4WETA 1R4WA 1QFNA 2MMOA 4H86A 1SJIA 1YY7A 3F9UA 3LSZA 2C0FA 2TRCP 1X5EA 3APOA 4OWYA 4N0VA 4MA9A 1FB6A 1UVZA 2H72A 5A4VA 4MDCA 2CVDA 1ZZYA 1EEMA 2XPEA 2R37A 2OE0A 5CAXA 3WYWA 1XXUA 1KBNA 1ZCPA 3U6VA 1NHOA 2VL9A 4L8EA 2XPDA 4OMVA 5D9XA 4MPFA 1S3AA 2OE3A 3BD2A 4BWQA 1V40A 2H0GA 2HFDA 5JWQB 1YF0A 5CRDA 2IPAA 3KJYA 4HU7A 3GIXA 3GFKA 1TRUA 2A4VA 3TB2A 4ACSA 5CYYA 2HZEA 1T1VA 1TRVA 2MYGA 3QFAC 4ILFA 4YQVA 3CTGA 3ZVJA 4EDYA 2XBQA 3D4MA 2VUPA 20GSA 3HXSA 2F8AA 5IQYA 5LNKe 3H4KA 4I8BA 2GSSA 3SWLA 2CVBA 1XW5A 1GSSA 1U88A 5EVOA 1EOGA 3NIVA 2LTKA 2FWFA 3CBUA 2OACA 4XRDA 4JR4A 1R5AA 3R2QA 1MTCA 2IFQB 2AJQB 4PXOA 5B6NA 2LRNA 1PL2A 4MJBA 2VCWA 4OD7A 2PPTA 3GKXA 4IGJA 2V32A 3IE3A 4KDYA 1Z6MA 4QQ7A 2LSTA 4N10A 3IK7A 5KN0A 4ZILA 1K0BA 3PINA 4AJ6A 3VWWA 1A0FA 3GURA 5B7CA 4RI7A 1GNWA 4DSSA 3J7Yb 5D8IA 5G1KA 5D9WA 5JCWA 4QL9A 4E8EA 1KEBA 3HZ8A 3H79A 5G31A 3EC3A 3A2WA 3DD3A 2MMNA 1TKDB 3FK8A 1T4YA 4XHMA 4XRAA 1JZDA 4WR5A 2JZRA 3GV1A 2FA8A 1AUCA 4BPYA 3GA4A 4K2DA 5DBQA 5HR1A 2H01A 2C4JA 5A4UA 4ZL7A 4POKA 4TR1B 1PMTA 1PSQA 1G6WA 1GP1A 5GAND 3TJKA 1N2AA 2P5QA 3FY7A 1Q98A 2J23A 3Q74A 2P31A 3BCIA 3WT2A 4GSTA 1X5DA 5IMAA 5ECQB 4PNGA 2DJ1A 2O89A 2I3YA 2FWGA 4N11A 4JZQA 3N5OA 2H70A 4FIWA 3CRTA 1JZOA 2WCIA 2HSYA 2H75A 3P8WA 3IAS2 4JR6A 2KOKA 4QL7A 3TRQA 3KD0A 4YAVA 2H0HA 5DCGA 4ZL8A 5ECRB 2V1MA 3RBTA 3DKSA 3W8JA 1SU9A 1DUGA 3EMXA 1OE7A 2HXKA 4MF7A 1FVKA 1TK0B 1PGTA 3CXGA 4ZB9A 1EV9A 3MAKA 4O7HA 2WULA 2RUFA 6GSWA 1K0MA 5J41A 4ZB6A 1JLVA 5H5RA 5J3RA 3RPNA 4WBRD 4EC0A 5EPFA 1ST9A 4IP1A 2MBTA 1F37A 1DBYA 2ZNMA 1OYJA 6GSXA 3BBYA 4O92A 4NXIA 3TJBA 2GLRA 2DLXA 2YV9A 1BAYA 3DVXA 4I2UA 1ZYEA 4PURA 1EP8A 3I69A 2PUKC 4EVMA 7GSSA 1TP9A 3TGZA 1Y6EA 2FWEA 3HJPA 1YKCA 2ZUPA 3FR9A 1XW6A 4RUVA 2F8FA 3IOSA 5E59A 2DMLA 1K3OA 4HDEA 3G7JA 3N9JA 4MPGA 1B8XA 2FNOA 4MK3A 2C8UA 2IMIA 1PN9A 2ON5A 3FR6A 3V1WA 1TRSA 4KH7A 3FHKA 1O85A 3CRUA 1V2AA 1U3IA 2CVKA 2LJRA 5GAPD 2PGTA 3F4TA 3FZ5A 2KP1A 4L0WA 3EU4A 1E6BA 2VCVA 3VK9A 2AYTA 2X8GA 1JZWA 3EINA 1XW9A 1RK4A 4LL1B 5ECNB 3L9SA 1SKWB 1GLPA 1PL1A 2H1GA 3DWVA 2H6ZA 2OJLA 3APSA 4K0GA 2GVPA 2RLIA 3HZ4A 2FD3A 2KHPA 1GSFA 2BTOT 11GSA 12GSA 3ZVJD 2LNSA 9GSSA 5DAKA 1VF4A 2CAIA 2A2RA 3C1RA 3HVXA 3QMXA 2H73A 6GSTA 3WD6A 5IPHA 4ZXGA 4TVEA 2HRFA 3E9JB 5L71A 2O85A 1YDKA 1FW1A 4K7IA 5KN1A 3ZFLA 1B4PA 1PX7A 2DMMA 4E8HA 1EEJA 1THXA 4L5OA 2X8CA 3TUEA 4FYCA 3M1GA 1QQ2A 1TTZA 3O6TA 3QCPA 1EGRA 4F0BA 1TJDA 1GUMA 4I5QA 1ACVA 1M2DA 3VLNA 1MEKA 4MH3A 2AV4A 17GSA 4GTUA 3IAM2 4KGIA 3WGXA 4G10A 1O7UA 2I1UA 3QR6A 4K8MA 2EIQA 2M46A 2OE1A 2L4CA 3GTUA 4FH8A 2YANA 3UVHA 22GSA 2C0EA 8GSSA 3ZIJA 5GZZB 1WRYA 3UMAA 3MNGA 4GF0A 4HJMA 2YZUA 4KW6A 1HNAA 1TU8A 4WF5A 1GTBA 1XVWA 3TJGA 3A2XA 3VPQA 2CA8A 3GX0A 3VURA 4ZBBA 4ZIJA 1A24A 1LBKA 4KCAA 1X9MB 5F8BA 1THOA 3ZRDA 5H5SA 1XWAA 1AIUA 1LU4A 2GZPA 2GSTA 4V2MA 2CX3A 5HR0A 3A3TA 3VI5A 5J5NA 3J7Yk 1SKSB 2QGVA 1T3BA 6GSUA 1U3AA 1GNEA 2O7KA 3HY2A 1OKTA 2QC7A 1PD21 2DJ0A 5AGYA 2OA7A 4ID0A 4NPBA 3HDCA 1SENA 4HZ4A 4Q5QA 1PX6A 1SYRA 1CQHA 2DC5A 1YJ6A 5HR3A 4Q5RA 1SKRB 3IA1A 2YP6A 4J56E 4GQFA 1O8WA 5AIVA 3FZ9A 5DVBA 1BX9A 1SJ6A 4OFMA 2FGXA 2K9FA 2WFCA 5IO2A 2CAQA 2FUG2 3GNJA 1K0CA 1WE0A 3C8EA 3EE2A 3FW2A 3KP8A 4K9ZA 2GZYA 3CSIA 1NM3A 5DCHA 4XCSA 2IIYA 3BCKA 3GRXA 1GTIA 2ALBA 2K6VA 3CYNA 4OFTA 5DALA 2QSIA 2PBJA 5ELAA 4EE0A 3IV4A 4J57E 1AAZA 3QDNA 2GSRA 5LD0A 3GKKA 3VI7A 1ERVA 2VL2C 1Y25A 3IK9A 4EDZA 3PR8A 2B5YA 1M2AA 2PVQA 4YQMA 13GSA 1O73A 3H93A 5CRWA 1G7EA 1Z7RA 3GMFA 1OC3A 4V2LA 2YZHA 4KE3A 1PKWA 2R6KA 4IQAA 1T8EB 1A0RP 3RDWA 1YZXA 3TCOA 3UIWA 5B8BA 1R26A 1NSWA 2P5RA 3ERWA 3A2VA 1TU7A 2X8HA 5A4WA 1O6JA 2D2ZA 4IP6A 14GSA 3GH9A 2YPMA 3C73A 2C0DA 2E0QA 3ERFA 1K3YA 1WOUA 2LUSA 1IYIA 3TKRA 1FB0A 3ZIVA 3M0FA 1XOBA 1Q4JA 4CHSA 2NTOA 2JU5A 1TW9A 2DJ2A 2XBIA 2C3NA 1OKDA 1C72A 3TKSC 5HFKA 2PERA 3HD5A 2RIIA 4DEJA 5GSSA 2B6MA 1XIYA 4J2FA 4I97A 1AQXA 1SD8A 1GLQA 2LJAA 2F9SA 3PGTA 3KMOA 1QUWA 2J9HA 2JADA 3VWVA 2F51A 1N8JA 3FEUA 1AW9A 4EKZA 4EUYA 4MZBA 2L59A 3DRNA 16GSA 2YN1A 1WIKA 2P0GA 2H19A 1RW1A 2DJKA 5DJMA 2VIMA 2GZZA 4MH2A 1FO5A 2GGTA 4GRFA 2G0FA 1PRXA 2N5BA 1VF2A 4TR3A 1JLWA 2O87A 3ISOA 1XOAA 2YWNA 3L0HA 4GLTA 5ECOB 1O81A 2LQOA 3GH6A 5DAKB 4F82A 2CX4A 2GS3A 1M99A 3I9V2 3F3RA 4JEDA 3GKMA 3TKPA 2LJKA 4GCIA 3LJRA 4XS4A 5IPGA 4FO5A 1XWCA 2IWTA 1UC7A 3DIEA 1A8LA 5IOWA 5F06A 1A2JA 3KH9A 5ECKB 1ZGNA 2NBSA 4KX4A 5IO0A 3QD9A 1F3BA 3F63A 1URMA 4TXVA 3EURA 1F2EA 6GSVA 1EOHA 3IR4A 1W89A 4MABA 3LG6A 4ZB8A 1TRWA 4MZWA 3UEMA 4HOJA 2WS2A 3IHQA 3RHBA 4IKHA 3FRCA 1OC8A 2GQKA 4KSMA 2JSZA 3VWUA 4G2EA 2G2QA 4PQHA 1I9DA 1LJRA 1YF1A 4K6XA 5LCZA 2H6XA 3H8QA 4ISDA 5D96A 1AC1A 4ECCA 4KSOA 5CRGA 3HHVA 2DIZA 2GQLA 3LFLA 2PVOC 2LKUA 5ID2A 4G19A 2YWMA 2DJJA 3S9FA 3IDVA 2WDUA 2L5OA 4NAXA 1PKZA 3QAWA 3KZQA 2YWOA 2TRXA 4CDOA 3OR5A 3EMPA 2OADA 2C80A 5F05A 4NHWA 1SK2A 5ECIB 4TRXA 2IN3A 1H4OA 1QK8A 5B6MA 2H1BA 3O3TA 3QAGA 1GRXA 2K18A 5B8AA 3KM6A 5J9BA 3WGDA 1M9AA 5COHA 2XHFA 4TXOA 4OCFA 3LXTA 3F3QA 2EC4A 4O5RA 2V2GA 4RQRA 4BA7A 3ED3A 3C1SA 2B5XA 4I6XA 5ELGA 1OAZA 1OC9A 2QKEA 1HNBA 2IL3A 4PQ1A 3L9VA 1XPVA 1AQWA 2L6DA 3LXZA 2M80A 4V1Ap 4NV5A 3HVSA 3C71A 3KH7A 3DGQA 1R5PA 3KCMA 1TDIA 18GSA 4BVYA 1WJKA 3VWXA 1T00A 3HJOA 1Z6NA 4NHZA 1BYEA 4LL4B 2IFQA 5FT3A 1ERTA 1EP7A 2YV7A 1TXXA 3I43A 4GWRA 3KIJA 3IBHA 1AQVA 5JWRB 3QOUA 4POMA 2HYXA 3IRAA 3UBKA 5CP1A 2R3XA 3IXRA 1Z3EA 2VOCA 4KDUA 4KB3A 2VM2A 3ZL5A 2HSHA 1UN2A 2AAWA 1TK5B 2R2JA 3CTFA 4DSQA 5DQSA 2VAFA 3I6AA 1B4QA 3TOTA 2NPBA 2KP2A 5A5KA 4MLYA 1FG4A 4WBJA 1WP0A 3GL3A 1ABAA 2HZEB 1EWXA 3F6DA 3WGEA 2H0IA 4F9ZA 3F4SA 1OE8A 5G1LA 1HQOA 4MZCA 1DSBA 1U6TA 2M72A 4TR1A 2IMFA 4KA0A 1QXHA 1A8YA 1WMJA 2NDOA 5HFIA 3QPMA 4ZL9A 1S3CA 2CZ2A 1OVNA 4G9HA 4EL1A 1R7HA 1W4VA 5G2ZA 5ABRA 3A5WA 3KMNA 2B7JA 2L6CA 2VCTA 1NHYA 5D93A 3TRPA 1HNCA 2H6YA 2PWJA 3FYGA 2H30A 2ES7A 4X43A 4ECJA 1J08A 2H76A 4DSSB 5CNWA 3EU3A 3ERGA 1V9WA 3D21A 1USBA 2GSQA 1NW2A 5J9CA 1GUHA 1GSDA 5ECHB 1GSUA 1DE1A 1ZL9A 5KN2A 4GQCA 4MMMA 2PMTA 4KDXA 4DSRA 3VPTA 5AN1A 4PQIA 4PGTA 4WXTA 1UA5A 1V57A 1VF1A 2YJHA 4K7NA 5CRHA 3TDGA 1F6MC 2WJUA 1GTUA 5ECMB 4BVXA 2RUEA 2JSYA 4I2TA 2E2MA 1TOFA 1JZRA 2ON7A 1RQMA 2DJ3A 1Z5YE 3GUSA 2R5GA 2OBKA 4OFNA 5IMDA 3LYKA 4FYBA 2C1YA 2IMKA 5DJLA 3FKFA 4ZBDA 5F07A 2REMA 2V6OA 5CREA 1A2LA 2VCZA 3W6GA 5IIZA 5IMVA 3M9JA 4F2IA 4KAEA 1VGLA 4KCEA 3ZLPA 2VO4A 1TK8B 2Z9SA 4N30A 4TOPA 3AY8A 1WPIA 1FAAA 5H5QA 5JWOB 1PA3A 2VD1A 2BJXA 2MBSA 1JHBA 2B1LA 4IQ1A 2MZCA 1GUKA 1T4ZA 2C3QA 5IMCA 2L5LA 4O32A 1B48A 5JCGA 3TKSE 5EL8A 4AJ7A 3HYPA 1EGOA 1G7OA 2L57A 4TXOB 1V58A 4IBPA 2WZ9A 4MJCA 2FCHA 2HT9A 3EVIA 3RHCA 1JFUA 3FR3A 2IJYA 1OC9B 4BWSA 3K8NA 2MMZA 2TIRA 2AUVA 1TI1A 4K1FA 4K7OA 1XCCA 5FHIA 1O8XA 1B9YC 3U5RE 3NZNA 3DXBA 2OKAA 4GXZA 4K0NA 2GT5A 2VLVA 3F8UA 3MWHA 2WB9A 5GSTA 1SD9A 2O8VB 1GULA 1XWBA 2LNTA 1K3LA 3CMIA 3APQA 2HNLA 1XVQA 4YH2A 1X9SB 4IHUA 2B1KA 2LS5A 1H75A 2XC2A 2AHEA 2HRNA 2VL2A 4HEA2 3LEFA 4RQXA 1WWJA 2FA4A 2DBCA 3RAZA 1J9BA 1QGVA 3H1NA 1FVJA 6GSSA 2LEGA 3EWLA 2RM5A 1M9BA 2HZFA 2LQQA 1K0OA 2H8LA 5DQYA 4IS0A 3UBLA 4L0UA 3F6FA 3DVWA 4MJEA 1A23A 2VD0A 4TR0A 5ENUA 1HD2A 2HLSA 1ERWA 3KXOA 3LYPA 5FWGA 3ZYWA 3GSTA 4XIHA 2X64A 3L9UA 5IMZA 2YOIA 4JBBA 2A2SA 2VCXA 2YNXA 4IJ3A 5ECLB 1HYUA 3TJFA 1SK1A 2KLXA 2IMDA 3KGKA 2I81A 3G9BA 4CW9A 3TKSA 3NOFA 5KN3A 3GHAA 3L78A 2H1DA 4DVCA 4BL7A 2N5FA 3ZZXA 2DSAA 3ME7A 2VLTA 4V2NA 2I9HA 2MMAA 3ZMKA 1EZKA 1ML6A 5IM9A 3UL3A 1SJZA 3GTUB 2DIYA 3P2AA 1G6YA 1KTEA 5F0GA 2KUCA 4XS1A 3UAPA 4MCUA 10GSA 4WF4A 4IJIA 1YKAA 3ZITA 2B7KA 3GYKA 2RM6A 4D73A 3ME8A 5EY6A 3Q19A 5G5FA 2VL3A 1GH2A 4HQZA 3ZMLA 5INYA 3VFIA 3GL5A 3HVVA 3Q6OA 2R4VA 2WGRA 3DYRA 3LORA 1K0DA 1K0NA 2PU9C 1YQ1A 3HJMA 4HU9A 4ML1A 4KUNA 1YEXA 1U87A 4ECIA 4POLA 3IC4A 1F3AA 1ON4A 3TOUA 2E2GA 3LGCA 3PH9A 4N0ZA 3KP9A 4HJ2A 4JRRA 2GQMA 4MP4A 3WT1A 2YCDA 5J4UA 3E3EA 4GSSA 4LMWA 4XS6A 3KEBA 4GSNA 4ZBAA 2N5AA 2ZCTA 4HQSA 4F03A 1QMVA 3EYTA 4AJ8A 4EO3A 3L4NA 5D9TA 5JCUA 2JZSA 5IMFA 2JZTA 1K0AA 3US3A 2H71A 4EXJA 3HCZA 3KTBA 2HI7A 1GTAA 1ILOA 3GN3A 2VM1A 4PNFA
chains in the Genus database with same CATH superfamily
3ZREA 1AXDA 1M7TA 3GKNA 4ULXA 2B5EA 2X99A 4P3YB 1BEDA 2CZ3A 3M3MA 4NV2A 3M9KA 1FOVA 4LA1A 2C0GA 5DDLA 3UJ1A 3LWAA 2BMXA 3ZFBA 5DALB 1ZYQB 2V41A 3CSHA 4X1UA 6GSYA 5KEJA 4FYUA 1J0FA 3GSSA 1XBSA 1VRSD 1S3DA 1FHEA 1XFLA 3D22A 2YJ7A 1DE2A 3M8NA 2WRTA 3UOMA 3DEXA 2E7PA 5ECSA 4YQUA 3BOAA 2LRCA 3MSZA 3IPZA 1BG5A 4POBA 1PFOA 1A2MA 2H74A 5CO3A 4MJAA 4OCEA 5C00A 3MDKA 1IYHA 4ML6A 4V1Ag 4IELA 3ZTLA 2PN8A 3TRXA 3Q18A 4TKYA 3HKRA 3UARA 3BJ5A 4NWYA 1M0UA 3CSJA 1T7PB 1MDKA 4TN8A 5D73A 2F3MA 4IVFA 3QFBC 1YEPA 4WR4A 4YAPA 3UVTA 4X0XA 1KNGA 2CQ9A 2GTUA 1GL8A 4LLRA 1MD4A 3D0ZA 4F0CA 1B9XC 2EIRA 2FWHA 4WEYA 1SL0B 1PQNA 2EIOA 5HFGA 2JL4A 2CV4A 3D5JA 2K8VA 1ERUA 4HS1A 1M3JA 5ECPB 4EF0A 5IOXA 3A5IA 2IMEA 2HE3A 5G5EA 2YWIA 1SYXA 3TKQA 1G0TA 4NMUA 1X5CA 1MD3A 1X0RA 2LV3A 4JE1A 1MDJA 1TI3A 1ZOFA 1BQ7A 2X49A 4IW9A 4XTSA 3E0UA 1Z9HA 1BJXA 1SL2B 2NVLA 3TJJA 1GSQA 5HQPA 5E4WA 1X9WB 1ZMAA 2FY6A 3QAVA 5AIXA 4HI7A 3C7MA 3F0IA 3SBCA 1I5GA 4HUAA 3P7XA 2JACA 2HRAA 1XZOA 4KNDA 4Q5FA 4OO4A 1SK0A 5D9VA 2LRTA 1XWKA 4RI6A 1GWCA 4Q5NA 1M2BA 2GT6A 4JU5A 3RPPA 5G30A 3IHGA 4L5LA 4LMVA 3P90A 5AISA 1V98A 1F9MA 4AGSA 3DMLA 4Z7XA 2L4QA 4XS4B 3D4TA 4AF2A 2VLUA 2VCQA 3GX8A 4PUAA 4USSA 4PUFC 2AB6A 4MNNA 5C04A 3FZAA 3LQ7A 3D6IA 4TR4A 2B3SA 1VF3A 1XWGA 4HZ2A 2V6KA 2CT6A 2FLSA 1E2YA 2K8SA 4ECBA 3F4RA 4TW5A 19GSA 4WKWA 3HA9A 1SL1B 3O76A 4OO5A 1GSYA 3W8SA 3KTLA 4MF6A 3FZ4A 5HR2A 2I4AA 3G7IA 4PX1A 3JCML 4MF5A 2H1AA 1EV4A 1Z7PA 2H66A 2OBIA 4IN0A 1MDIA 2GDRA 4D73B 1CQGA 1GSEA 2FHEA 3G7YA 5ID2B 2C3TA 4WETA 1R4WA 1QFNA 2MMOA 4H86A 1SJIA 1YY7A 3F9UA 2QA1A 1XG8A 3LSZA 2C0FA 2TRCP 1X5EA 3APOA 4OWYA 4N0VA 4MA9A 1FB6A 1UVZA 2H72A 5A4VA 4MDCA 2CVDA 1ZZYA 1EEMA 2XPEA 2R37A 2OE0A 5CAXA 3WYWA 1XXUA 1KBNA 1ZCPA 3U6VA 1NHOA 2VL9A 4L8EA 2XPDA 4OMVA 5D9XA 4MPFA 1S3AA 2OE3A 3BD2A 4BWQA 1V40A 2H0GA 2HFDA 5JWQB 1YF0A 5CRDA 2IPAA 3KJYA 4HU7A 3GIXA 3GFKA 1TRUA 2A4VA 3TB2A 4ACSA 5CYYA 2HZEA 1T1VA 1TRVA 2MYGA 3QFAC 4ILFA 4YQVA 3CTGA 3ZVJA 4EDYA 2XBQA 3D4MA 2VUPA 20GSA 3HXSA 2F8AA 5IQYA 5LNKe 3H4KA 4I8BA 2GSSA 3SWLA 2CVBA 1XW5A 1GSSA 1U88A 4BVYB 5EVOA 1EOGA 3NIVA 2LTKA 2FWFA 3CBUA 2OACA 4XRDA 4JR4A 1R5AA 3R2QA 1MTCA 4ICYA 2IFQB 2AJQB 4PXOA 5B6NA 2LRNA 1PL2A 4MJBA 2VCWA 4OD7A 2PPTA 3GKXA 4IGJA 2V32A 3IE3A 4KDYA 1Z6MA 4QQ7A 2LSTA 4N10A 3IK7A 5KN0A 4ZILA 1K0BA 3PINA 4AJ6A 4CY6A 3VWWA 1A0FA 3GURA 5B7CA 4RI7A 1GNWA 4DSSA 3J7Yb 5D8IA 5G1KA 5D9WA 5JCWA 4QL9A 4E8EA 1KEBA 3HZ8A 3H79A 5G31A 3EC3A 3A2WA 3DD3A 2MMNA 1TKDB 3FK8A 1T4YA 4XHMA 4XRAA 1JZDA 4WR5A 2JZRA 3GV1A 2FA8A 1AUCA 4BPYA 3GA4A 4K2DA 5DBQA 5HR1A 2R0PA 2H01A 4EIPA 2C4JA 5A4UA 4ZL7A 4POKA 4TR1B 1PMTA 1PSQA 1G6WA 1GP1A 5GAND 3TJKA 1N2AA 2P5QA 3FY7A 1Q98A 2J23A 3Q74A 2P31A 3BCIA 3WT2A 4GSTA 1X5DA 5IMAA 5ECQB 4PNGA 2DJ1A 2O89A 2I3YA 2FWGA 4N11A 4JZQA 3N5OA 2H70A 4FIWA 3CRTA 3FMWA 1JZOA 2WCIA 2HSYA 2H75A 3P8WA 3IAS2 4JR6A 2KOKA 4QL7A 3TRQA 3KD0A 4YAVA 2H0HA 5DCGA 4ZL8A 5ECRB 2V1MA 3RBTA 3DKSA 3W8JA 1SU9A 1DUGA 3EMXA 1OE7A 2HXKA 4MF7A 1FVKA 1TK0B 1PGTA 3CXGA 4ZB9A 3MYDA 1EV9A 3MAKA 4O7HA 2WULA 2RUFA 6GSWA 1K0MA 5J41A 4ZB6A 1JLVA 5H5RA 5J3RA 3RPNA 4WBRD 4EC0A 5EPFA 1ST9A 4IP1A 2MBTA 1F37A 1DBYA 2ZNMA 1OYJA 6GSXA 3BBYA 4O92A 4NXIA 3TJBA 2GLRA 2DLXA 2YV9A 1BAYA 3DVXA 4I2UA 1ZYEA 4PURA 3R3EA 1EP8A 3I69A 4BVXB 2PUKC 4EVMA 7GSSA 1TP9A 3TGZA 1Y6EA 2R0CA 2FWEA 3HJPA 1YKCA 2ZUPA 3FR9A 1XW6A 4RUVA 2F8FA 3IOSA 5E59A 2DMLA 1K3OA 4HDEA 3G7JA 3N9JA 4MPGA 1B8XA 2FNOA 4MK3A 2C8UA 2IMIA 1PN9A 2ON5A 3FR6A 3V1WA 1TRSA 4KH7A 3FHKA 1O85A 3CRUA 1V2AA 1U3IA 2CVKA 2LJRA 5GAPD 2PGTA 3F4TA 3FZ5A 4K2XA 2KP1A 2DKIA 4L0WA 3EU4A 1E6BA 2VCVA 3VK9A 4KF9A 2AYTA 2X8GA 1JZWA 3EINA 3CQFA 1XW9A 1RK4A 4LL1B 5ECNB 3L9SA 1SKWB 3LW9A 1GLPA 1PL1A 2H1GA 3DWVA 2H6ZA 2OJLA 3APSA 4K0GA 2GVPA 2RLIA 3HZ4A 2FD3A 2KHPA 1GSFA 2BTOT 11GSA 12GSA 3ZVJD 2LNSA 9GSSA 2QA2A 5DAKA 1VF4A 2CAIA 2A2RA 3C1RA 3HVXA 3QMXA 2H73A 6GSTA 3WD6A 5IPHA 4ZXGA 4TVEA 2HRFA 3E9JB 5L71A 2O85A 1YDKA 1FW1A 4K7IA 5KN1A 3ZFLA 1B4PA 1PX7A 2DMMA 2HSMA 4E8HA 1EEJA 1THXA 4L5OA 2HRKA 2X8CA 3TUEA 4FYCA 3M1GA 1QQ2A 1TTZA 3O6TA 3QCPA 4O5UA 1EGRA 4F0BA 4K5SA 1TJDA 1GUMA 4I5QA 1ACVA 1M2DA 3VLNA 1MEKA 4MH3A 2AV4A 17GSA 4GTUA 3IAM2 4KGIA 3WGXA 4G10A 1O7UA 2I1UA 3QR6A 4K8MA 2EIQA 2M46A 2OE1A 2L4CA 3GTUA 4FH8A 2YANA 3UVHA 22GSA 2C0EA 8GSSA 3ZIJA 5GZZB 1WRYA 3UMAA 3MNGA 4GF0A 4HJMA 2YZUA 4KW6A 1HNAA 1TU8A 4WF5A 1GTBA 1XVWA 3TJGA 3A2XA 3VPQA 2CA8A 3GX0A 3VURA 4ZBBA 4ZIJA 1A24A 1LBKA 4KCAA 1X9MB 5F8BA 1THOA 3ZRDA 5H5SA 1XWAA 1AIUA 1LU4A 2GZPA 2GSTA 4V2MA 2CX3A 5HR0A 3A3TA 3VI5A 5J5NA 3J7Yk 1SKSB 2QGVA 1T3BA 6GSUA 1U3AA 1GNEA 2O7KA 3HY2A 1OKTA 2QC7A 1PD21 2DJ0A 5AGYA 2OA7A 4ID0A 4NPBA 3HDCA 1SENA 4HZ4A 4BL7B 4Q5QA 1PX6A 1SYRA 4K5RA 1CQHA 2DC5A 1YJ6A 5HR3A 4Q5RA 1SKRB 3IA1A 2YP6A 4J56E 4GQFA 1O8WA 5AIVA 3FZ9A 5DVBA 1BX9A 1SJ6A 4OFMA 2FGXA 2K9FA 2WFCA 5IO2A 2CAQA 2FUG2 3GNJA 1K0CA 1WE0A 3C8EA 3EE2A 3FW2A 3KP8A 4K9ZA 2GZYA 3CSIA 1NM3A 5DCHA 4XCSA 2IIYA 3BCKA 3GRXA 1GTIA 2ALBA 2K6VA 3CYNA 4OFTA 5DALA 2QSIA 2PBJA 5ELAA 4EE0A 3IV4A 4J57E 1AAZA 3QDNA 2GSRA 5LD0A 3GKKA 3VI7A 1ERVA 2VL2C 1Y25A 3IK9A 4EDZA 3PR8A 2B5YA 1M2AA 2PVQA 4YQMA 13GSA 1O73A 3H93A 5CRWA 1G7EA 1Z7RA 4G0KA 3GMFA 1OC3A 4V2LA 2YZHA 4KE3A 1PKWA 2R6KA 4IQAA 1T8EB 1A0RP 3RDWA 1YZXA 3TCOA 3UIWA 5B8BA 1R26A 1NSWA 2P5RA 3ERWA 3A2VA 1TU7A 2X8HA 5A4WA 1O6JA 2D2ZA 4IP6A 14GSA 3GH9A 4O5QA 2YPMA 3C73A 2C0DA 2E0QA 3ERFA 1K3YA 1WOUA 2LUSA 1IYIA 3TKRA 1FB0A 3ZIVA 3M0FA 1XOBA 1Q4JA 4CHSA 2NTOA 4YKFA 2JU5A 1TW9A 2DJ2A 2XBIA 2C3NA 1OKDA 1C72A 3TKSC 5HFKA 2PERA 3HD5A 2RIIA 4DEJA 5GSSA 2B6MA 1XIYA 4J2FA 4I97A 1AQXA 1SD8A 1GLQA 2LJAA 2F9SA 3PGTA 3KMOA 1QUWA 2J9HA 2JADA 3VWVA 2F51A 1N8JA 3FEUA 1AW9A 4EKZA 4EUYA 4MZBA 2L59A 3DRNA 16GSA 2YN1A 1WIKA 2P0GA 2H19A 4X4JA 1RW1A 2DJKA 5DJMA 2VIMA 2GZZA 4MH2A 1FO5A 2GGTA 4GRFA 2G0FA 1PRXA 2N5BA 1VF2A 4TR3A 1JLWA 2O87A 3ISOA 1XOAA 2YWNA 3L0HA 4GLTA 5ECOB 1O81A 2LQOA 3GH6A 5DAKB 4F82A 2CX4A 2GS3A 1M99A 4Z2TA 5BRTA 3I9V2 3F3RA 4JEDA 3GKMA 3TKPA 2LJKA 4GCIA 3LJRA 4XS4A 5IPGA 4FO5A 1XWCA 2IWTA 1UC7A 3DIEA 1A8LA 5IOWA 5F06A 1A2JA 3KH9A 5ECKB 1ZGNA 2NBSA 4KX4A 5IO0A 3QD9A 1F3BA 3F63A 1URMA 4TXVA 3EURA 1F2EA 6GSVA 1EOHA 3IR4A 1W89A 4MABA 3LG6A 4ZB8A 1TRWA 5KOWA 4MZWA 3UEMA 4HOJA 2WS2A 3IHQA 3RHBA 4IKHA 3FRCA 1OC8A 2GQKA 4KSMA 2JSZA 3VWUA 4G2EA 2G2QA 4PQHA 1I9DA 1LJRA 1YF1A 4K6XA 5LCZA 2H6XA 5KOXA 3H8QA 4ISDA 5D96A 1AC1A 4ECCA 4KSOA 2UZ8A 3HHVA 2DIZA 5CRGA 2GQLA 3LFLA 2PVOC 2LKUA 5ID2A 4G19A 2YWMA 2DJJA 3S9FA 3IDVA 2WDUA 2L5OA 4NAXA 3PPUA 1PKZA 3EPTA 3QAWA 3KZQA 2YWOA 2TRXA 4CDOA 3OR5A 3EMPA 2OADA 2C80A 4BIKA 5F05A 4NHWA 1SK2A 5ECIB 4TRXA 2IN3A 1H4OA 1QK8A 5B6MA 2H1BA 4YKGA 3O3TA 3QAGA 1GRXA 2K18A 5B8AA 3KM6A 5J9BA 3WGDA 1M9AA 5COHA 2XHFA 4TXOA 4OCFA 3LXTA 3F3QA 2EC4A 4O5RA 2V2GA 4RQRA 4BA7A 3ED3A 3C1SA 2B5XA 4I6XA 5ELGA 1OAZA 1OC9A 2QKEA 1HNBA 2IL3A 4PQ1A 3L9VA 1XPVA 1AQWA 2L6DA 3LXZA 2M80A 4V1Ap 4NV5A 3HVSA 3C71A 3KH7A 3DGQA 3HVNA 1R5PA 3KCMA 1TDIA 18GSA 4BVYA 1WJKA 3VWXA 1T00A 3HJOA 1Z6NA 4NHZA 1BYEA 4LL4B 2IFQA 5FT3A 1ERTA 1EP7A 2YV7A 1TXXA 3I43A 4GWRA 3KIJA 3IBHA 1AQVA 5JWRB 3QOUA 4POMA 2HYXA 3IRAA 3UBKA 5CP1A 2R3XA 3IXRA 1Z3EA 2VOCA 4KDUA 4KB3A 2VM2A 4PTSA 3ZL5A 2HSHA 1UN2A 2AAWA 1TK5B 1ZYNA 2R2JA 3CTFA 4G0LA 4DSQA 2VAFA 5DQSA 3I6AA 1B4QA 3TOTA 1PN0A 2NPBA 2KP2A 2X4AA 5A5KA 4MLYA 1FG4A 4WBJA 1WP0A 3GL3A 1ABAA 2HZEB 1EWXA 3F6DA 3WGEA 2H0IA 4F9ZA 3F4SA 1OE8A 5G1LA 1HQOA 4MZCA 1DSBA 1U6TA 2M72A 4TR1A 2IMFA 4KA0A 4G0IA 1QXHA 1A8YA 1WMJA 2NDOA 5HFIA 3QPMA 4ZL9A 1S3CA 2CZ2A 1OVNA 4G9HA 4EL1A 4EIQA 1R7HA 1W4VA 5G2ZA 5ABRA 3A5WA 3KMNA 2B7JA 2L6CA 2VCTA 1NHYA 5D93A 3TRPA 1HNCA 2H6YA 2PWJA 3FYGA 2H30A 2ES7A 4X43A 4ECJA 1J08A 2H76A 4DSSB 5CNWA 3EU3A 3ERGA 1V9WA 1FOHA 3D21A 1USBA 2GSQA 1NW2A 5J9CA 1GUHA 1GSDA 5ECHB 1GSUA 1DE1A 1ZL9A 5KN2A 4GQCA 4MMMA 2PMTA 4KDXA 4FQUA 4DSRA 3VPTA 5AN1A 4PQIA 4PGTA 4WXTA 1UA5A 4Z2RA 1V57A 5BMUA 1VF1A 2YJHA 2DKHA 4K7NA 5CRHA 3TDGA 1F6MC 2WJUA 1S3RA 1GTUA 5ECMB 4BVXA 2RUEA 2JSYA 4I2TA 2E2MA 1TOFA 1JZRA 2ON7A 1RQMA 2DJ3A 1Z5YE 3GUSA 2R5GA 4CY8A 2OBKA 4OFNA 5IMDA 3LYKA 4FYBA 2C1YA 2IMKA 5DJLA 3FKFA 4ZBDA 5F07A 2REMA 2V6OA 5CREA 1A2LA 2VCZA 3W6GA 5IIZA 5IMVA 3M9JA 4F2IA 4KAEA 1VGLA 4KCEA 3ZLPA 2VO4A 1TK8B 2Z9SA 4N30A 4TOPA 3AY8A 1WPIA 1FAAA 5H5QA 5JWOB 1PA3A 2VD1A 2BJXA 2MBSA 1JHBA 2B1LA 4IQ1A 2MZCA 1GUKA 1T4ZA 2C3QA 5IMCA 2L5LA 4O32A 1B48A 5JCGA 3TKSE 5EL8A 4AJ7A 3HYPA 1EGOA 1G7OA 2L57A 4TXOB 1V58A 4IBPA 2WZ9A 4MJCA 2FCHA 2HT9A 3EVIA 3RHCA 1JFUA 3FR3A 2IJYA 1OC9B 4BWSA 3K8NA 2MMZA 2TIRA 2AUVA 1TI1A 4K1FA 4K7OA 1XCCA 5FHIA 1O8XA 1B9YC 3U5RE 3NZNA 3DXBA 2OKAA 4GXZA 4K0NA 2GT5A 2VLVA 3F8UA 3MWHA 2WB9A 5GSTA 1SD9A 2O8VB 1GULA 1XWBA 2LNTA 1K3LA 2R0GA 3CMIA 3APQA 2HNLA 1XVQA 4YH2A 1X9SB 4IHUA 2B1KA 2LS5A 1H75A 2XC2A 2AHEA 2HRNA 2VL2A 1ZYPA 4HEA2 3LEFA 4RQXA 1WWJA 2FA4A 2DBCA 3RAZA 1J9BA 1QGVA 3H1NA 1FVJA 6GSSA 2LEGA 3EWLA 2RM5A 1M9BA 2HZFA 2LQQA 1K0OA 2H8LA 5DQYA 4IS0A 3UBLA 4L0UA 3F6FA 3DVWA 4MJEA 1A23A 2VD0A 4TR0A 5ENUA 1HD2A 2HLSA 1ERWA 3KXOA 3LYPA 5FWGA 3ZYWA 3GSTA 4XIHA 2X64A 3L9UA 5IMZA 2YOIA 4JBBA 2A2SA 2VCXA 2YNXA 4IJ3A 5ECLB 1HYUA 3TJFA 1SK1A 2KLXA 2IMDA 3IC8A 3KGKA 2I81A 3G9BA 4CW9A 3TKSA 3NOFA 5KN3A 3GHAA 3L78A 2H1DA 4DVCA 4BL7A 2N5FA 3ZZXA 1M3IA 2DSAA 3ME7A 2VLTA 4V2NA 2I9HA 2MMAA 2A4HA 3ZMKA 1EZKA 1ML6A 5IM9A 3UL3A 1SJZA 3GTUB 2DIYA 3P2AA 1G6YA 2A2PA 1KTEA 5F0GA 2KUCA 4XS1A 3UAPA 4MCUA 10GSA 4WF4A 4IJIA 1YKAA 3ZITA 4Z2UA 2B7KA 4HSCX 3GYKA 2RM6A 4D73A 3ME8A 5EY6A 3Q19A 5G5FA 2VL3A 1GH2A 4HQZA 3ZMLA 5INYA 3VFIA 3GL5A 3HVVA 3Q6OA 2R4VA 2WGRA 3DYRA 3LORA 1K0DA 1K0NA 2PU9C 1YQ1A 3HJMA 4HU9A 4ML1A 4KUNA 1U87A 1YEXA 4ECIA 4POLA 3IC4A 1F3AA 1ON4A 3TOUA 2E2GA 3LGCA 3PH9A 4N0ZA 3KP9A 4HJ2A 4JRRA 2GQMA 4MP4A 3WT1A 2YCDA 5J4UA 3E3EA 4GSSA 4LMWA 4XS6A 3KEBA 4GSNA 4ZBAA 2N5AA 3MIXA 2ZCTA 4HQSA 4F03A 1QMVA 3EYTA 4AJ8A 4EO3A 3L4NA 5D9TA 5JCUA 2JZSA 5IMFA 2JZTA 1K0AA 3US3A 2H71A 4EXJA 3HCZA 4A5PA 3KTBA 2HI7A 1GTAA 1ILOA 3GN3A 2VM1A 4PNFA
chains in the Genus database with same CATH topology
3ZREA 1AXDA 1M7TA 3GKNA 4ULXA 2B5EA 2X99A 4P3YB 1BEDA 2CZ3A 3M3MA 4NV2A 3M9KA 1FOVA 4LA1A 2C0GA 5DDLA 3UJ1A 3LWAA 2BMXA 3ZFBA 5DALB 1ZYQB 2V41A 3CSHA 4X1UA 6GSYA 5KEJA 4FYUA 1J0FA 3GSSA 1XBSA 1VRSD 1S3DA 1FHEA 1XFLA 3D22A 2YJ7A 1DE2A 3M8NA 2WRTA 3UOMA 3DEXA 2E7PA 5ECSA 4YQUA 3BOAA 2LRCA 3MSZA 3IPZA 1BG5A 4POBA 1A2MA 2H74A 5CO3A 4MJAA 4OCEA 5C00A 3MDKA 1IYHA 4ML6A 4V1Ag 4IELA 3ZTLA 2PN8A 3TRXA 3Q18A 4TKYA 3HKRA 3UARA 3BJ5A 4NWYA 1M0UA 3CSJA 1T7PB 1MDKA 4TN8A 5D73A 2F3MA 4IVFA 3QFBC 1YEPA 4WR4A 4YAPA 3UVTA 4X0XA 1KNGA 2CQ9A 2GTUA 1GL8A 4LLRA 1MD4A 3D0ZA 4F0CA 1B9XC 2EIRA 2FWHA 4WEYA 1SL0B 1PQNA 2EIOA 5HFGA 2JL4A 2CV4A 3D5JA 2K8VA 1ERUA 4HS1A 5ECPB 4EF0A 5IOXA 3A5IA 2IMEA 2HE3A 5G5EA 2YWIA 1SYXA 3TKQA 1G0TA 4NMUA 1X5CA 1MD3A 1X0RA 2LV3A 4JE1A 1MDJA 1TI3A 1ZOFA 1BQ7A 2X49A 4IW9A 4XTSA 3E0UA 1Z9HA 1BJXA 1SL2B 2NVLA 3TJJA 1GSQA 5HQPA 5E4WA 1X9WB 1ZMAA 2FY6A 3QAVA 5AIXA 4HI7A 3C7MA 3F0IA 3SBCA 1I5GA 4HUAA 3P7XA 2JACA 2HRAA 1XZOA 4KNDA 4Q5FA 4OO4A 1SK0A 5D9VA 2LRTA 1XWKA 4RI6A 1GWCA 4Q5NA 1M2BA 2GT6A 4JU5A 3RPPA 5G30A 3IHGA 4L5LA 4LMVA 3P90A 5AISA 1V98A 1F9MA 4AGSA 3DMLA 4Z7XA 2L4QA 4XS4B 3D4TA 4AF2A 2VLUA 2VCQA 3GX8A 4PUAA 4USSA 4PUFC 2AB6A 4MNNA 5C04A 3FZAA 3LQ7A 3D6IA 4TR4A 2B3SA 1VF3A 1XWGA 4HZ2A 2V6KA 2CT6A 2FLSA 1E2YA 2K8SA 4ECBA 3F4RA 4TW5A 19GSA 4WKWA 3HA9A 1SL1B 3O76A 4OO5A 1GSYA 3W8SA 3KTLA 4MF6A 3FZ4A 5HR2A 2I4AA 3G7IA 4PX1A 3JCML 4MF5A 2H1AA 1EV4A 1Z7PA 2H66A 2OBIA 4IN0A 1MDIA 2GDRA 4D73B 1CQGA 1GSEA 2FHEA 3G7YA 5ID2B 2C3TA 4WETA 1R4WA 1QFNA 2MMOA 4H86A 1SJIA 1YY7A 3F9UA 2QA1A 3LSZA 2C0FA 2TRCP 1X5EA 3APOA 4OWYA 4N0VA 4MA9A 1FB6A 1UVZA 2H72A 5A4VA 4MDCA 2CVDA 1ZZYA 1EEMA 2XPEA 2R37A 2OE0A 5CAXA 3WYWA 1XXUA 1KBNA 1ZCPA 3U6VA 1NHOA 2VL9A 4L8EA 2XPDA 4OMVA 5D9XA 4MPFA 1S3AA 2OE3A 3BD2A 4BWQA 1V40A 2H0GA 2HFDA 5JWQB 1YF0A 5CRDA 2IPAA 3KJYA 4HU7A 3GIXA 3GFKA 1TRUA 2A4VA 3TB2A 4ACSA 5CYYA 2HZEA 1T1VA 1TRVA 2MYGA 3QFAC 4ILFA 4YQVA 3CTGA 3ZVJA 4EDYA 2XBQA 3D4MA 2VUPA 20GSA 3HXSA 2F8AA 5IQYA 5LNKe 3H4KA 4I8BA 2GSSA 3SWLA 2CVBA 1XW5A 1GSSA 1U88A 4BVYB 5EVOA 1EOGA 3NIVA 2LTKA 2FWFA 3CBUA 2OACA 4XRDA 4JR4A 1R5AA 3R2QA 1MTCA 4ICYA 2IFQB 2AJQB 4PXOA 5B6NA 2LRNA 1PL2A 4MJBA 2VCWA 4OD7A 2PPTA 3GKXA 4IGJA 2V32A 3IE3A 4KDYA 1Z6MA 4QQ7A 2LSTA 4N10A 3IK7A 5KN0A 4ZILA 1K0BA 3PINA 4AJ6A 4CY6A 3VWWA 1A0FA 3GURA 5B7CA 4RI7A 1GNWA 4DSSA 3J7Yb 5D8IA 5G1KA 5D9WA 5JCWA 4QL9A 4E8EA 1KEBA 3HZ8A 3H79A 5G31A 3EC3A 3A2WA 3DD3A 2MMNA 1TKDB 3FK8A 1T4YA 4XHMA 4XRAA 1JZDA 4WR5A 2JZRA 3GV1A 2FA8A 1AUCA 4BPYA 3GA4A 4K2DA 5DBQA 5HR1A 2R0PA 2H01A 4EIPA 2C4JA 5A4UA 4ZL7A 4POKA 4TR1B 1PMTA 1PSQA 1G6WA 1GP1A 5GAND 3TJKA 1N2AA 2P5QA 3FY7A 1Q98A 2J23A 3Q74A 2P31A 3BCIA 3WT2A 4GSTA 1X5DA 5IMAA 5ECQB 4PNGA 2DJ1A 2O89A 2I3YA 2FWGA 4N11A 4JZQA 3N5OA 2H70A 4FIWA 3CRTA 3FMWA 1JZOA 2WCIA 2HSYA 2H75A 3P8WA 3IAS2 4JR6A 2KOKA 4QL7A 3TRQA 3KD0A 4YAVA 2H0HA 5DCGA 4ZL8A 5ECRB 2V1MA 3RBTA 3DKSA 3W8JA 1SU9A 1DUGA 3EMXA 1OE7A 2HXKA 4MF7A 1FVKA 1TK0B 1PGTA 3CXGA 4ZB9A 3MYDA 1EV9A 3MAKA 4O7HA 2WULA 2RUFA 6GSWA 1K0MA 5J41A 4ZB6A 1JLVA 5H5RA 5J3RA 3RPNA 4WBRD 4EC0A 5EPFA 1ST9A 4IP1A 2MBTA 1F37A 1DBYA 2ZNMA 1OYJA 6GSXA 3BBYA 4O92A 4NXIA 3TJBA 2GLRA 2DLXA 2YV9A 1BAYA 3DVXA 4I2UA 1ZYEA 4PURA 3R3EA 1EP8A 3I69A 4BVXB 2PUKC 4EVMA 7GSSA 1TP9A 3TGZA 1Y6EA 2R0CA 2FWEA 3HJPA 1YKCA 2ZUPA 3FR9A 1XW6A 4RUVA 2F8FA 3IOSA 5E59A 2DMLA 1K3OA 4HDEA 3G7JA 3N9JA 4MPGA 1B8XA 2FNOA 4MK3A 2C8UA 2IMIA 1PN9A 2ON5A 3FR6A 3V1WA 1TRSA 4KH7A 3FHKA 1O85A 3CRUA 1V2AA 1U3IA 2CVKA 2LJRA 5GAPD 2PGTA 3F4TA 3FZ5A 4K2XA 2KP1A 2DKIA 4L0WA 3EU4A 1E6BA 2VCVA 3VK9A 4KF9A 2AYTA 2X8GA 1JZWA 3EINA 1XW9A 1RK4A 4LL1B 5ECNB 3L9SA 1SKWB 3LW9A 1GLPA 1PL1A 2H1GA 3DWVA 2H6ZA 2OJLA 3APSA 4K0GA 2GVPA 2RLIA 3HZ4A 2FD3A 2KHPA 1GSFA 2BTOT 11GSA 12GSA 3ZVJD 2LNSA 9GSSA 2QA2A 5DAKA 1VF4A 2CAIA 2A2RA 3C1RA 3HVXA 3QMXA 2H73A 6GSTA 3WD6A 5IPHA 4ZXGA 4TVEA 2HRFA 3E9JB 5L71A 2O85A 1YDKA 1FW1A 4K7IA 5KN1A 3ZFLA 1B4PA 1PX7A 2DMMA 2HSMA 4E8HA 1EEJA 1THXA 4L5OA 2HRKA 2X8CA 3TUEA 4FYCA 3M1GA 1QQ2A 1TTZA 3O6TA 3QCPA 4O5UA 1EGRA 4F0BA 4K5SA 1TJDA 1GUMA 4I5QA 1ACVA 1M2DA 3VLNA 1MEKA 4MH3A 2AV4A 17GSA 4GTUA 3IAM2 4KGIA 3WGXA 4G10A 1O7UA 2I1UA 3QR6A 4K8MA 2EIQA 2M46A 2OE1A 2L4CA 3GTUA 4FH8A 2YANA 3UVHA 22GSA 2C0EA 8GSSA 3ZIJA 5GZZB 1WRYA 3UMAA 3MNGA 4GF0A 4HJMA 2YZUA 4KW6A 1HNAA 1TU8A 4WF5A 1GTBA 1XVWA 3TJGA 3A2XA 3VPQA 2CA8A 3GX0A 3VURA 4ZBBA 4ZIJA 1A24A 1LBKA 4KCAA 1X9MB 5F8BA 1THOA 3ZRDA 5H5SA 1XWAA 1AIUA 1LU4A 2GZPA 2GSTA 4V2MA 2CX3A 5HR0A 3A3TA 3VI5A 5J5NA 3J7Yk 1SKSB 2QGVA 1T3BA 6GSUA 1U3AA 1GNEA 2O7KA 3HY2A 1OKTA 2QC7A 1PD21 2DJ0A 5AGYA 2OA7A 4ID0A 4NPBA 3HDCA 1SENA 4HZ4A 4BL7B 4Q5QA 1PX6A 1SYRA 4K5RA 1CQHA 2DC5A 1YJ6A 5HR3A 4Q5RA 1SKRB 3IA1A 2YP6A 4J56E 4GQFA 1O8WA 5AIVA 3FZ9A 5DVBA 1BX9A 1SJ6A 4OFMA 2FGXA 2K9FA 2WFCA 5IO2A 2CAQA 2FUG2 3GNJA 1K0CA 1WE0A 3C8EA 3EE2A 3FW2A 3KP8A 4K9ZA 2GZYA 3CSIA 1NM3A 5DCHA 4XCSA 2IIYA 3BCKA 3GRXA 1GTIA 2ALBA 2K6VA 3CYNA 4OFTA 5DALA 2QSIA 2PBJA 5ELAA 4EE0A 3IV4A 4J57E 1AAZA 3QDNA 2GSRA 5LD0A 3GKKA 3VI7A 1ERVA 2VL2C 1Y25A 3IK9A 4EDZA 3PR8A 2B5YA 1M2AA 2PVQA 4YQMA 13GSA 1O73A 3H93A 5CRWA 1G7EA 1Z7RA 4G0KA 3GMFA 1OC3A 4V2LA 2YZHA 4KE3A 1PKWA 2R6KA 4IQAA 1T8EB 1A0RP 3RDWA 1YZXA 3TCOA 3UIWA 5B8BA 1R26A 1NSWA 2P5RA 3ERWA 3A2VA 1TU7A 2X8HA 5A4WA 1O6JA 2D2ZA 4IP6A 14GSA 3GH9A 4O5QA 2YPMA 3C73A 2C0DA 2E0QA 3ERFA 1K3YA 1WOUA 2LUSA 1IYIA 3TKRA 1FB0A 3ZIVA 3M0FA 1XOBA 1Q4JA 4CHSA 2NTOA 4YKFA 2JU5A 1TW9A 2DJ2A 2XBIA 2C3NA 1OKDA 1C72A 3TKSC 5HFKA 2PERA 3HD5A 2RIIA 4DEJA 5GSSA 2B6MA 1XIYA 4J2FA 4I97A 1AQXA 1SD8A 1GLQA 2LJAA 2F9SA 3PGTA 3KMOA 1QUWA 2J9HA 2JADA 3VWVA 2F51A 1N8JA 3FEUA 1AW9A 4EKZA 4EUYA 4MZBA 2L59A 3DRNA 16GSA 2YN1A 1WIKA 2P0GA 2H19A 4X4JA 1RW1A 2DJKA 5DJMA 2VIMA 2GZZA 4MH2A 1FO5A 2GGTA 4GRFA 2G0FA 1PRXA 2N5BA 1VF2A 4TR3A 1JLWA 2O87A 3ISOA 1XOAA 2YWNA 3L0HA 4GLTA 5ECOB 1O81A 2LQOA 3GH6A 5DAKB 4F82A 2CX4A 2GS3A 1M99A 4Z2TA 5BRTA 3I9V2 3F3RA 4JEDA 3GKMA 3TKPA 2LJKA 4GCIA 3LJRA 4XS4A 5IPGA 4FO5A 1XWCA 2IWTA 1UC7A 3DIEA 1A8LA 5IOWA 5F06A 1A2JA 3KH9A 5ECKB 1ZGNA 2NBSA 4KX4A 5IO0A 3QD9A 1F3BA 3F63A 1URMA 4TXVA 3EURA 1F2EA 6GSVA 1EOHA 3IR4A 1W89A 4MABA 3LG6A 4ZB8A 1TRWA 5KOWA 4MZWA 3UEMA 4HOJA 2WS2A 3IHQA 3RHBA 4IKHA 3FRCA 1OC8A 2GQKA 4KSMA 2JSZA 3VWUA 4G2EA 2G2QA 4PQHA 1I9DA 1LJRA 1YF1A 4K6XA 5LCZA 2H6XA 5KOXA 3H8QA 4ISDA 5D96A 1AC1A 4ECCA 4KSOA 2UZ8A 3HHVA 2DIZA 5CRGA 2GQLA 3LFLA 2PVOC 2LKUA 5ID2A 4G19A 2YWMA 2DJJA 3S9FA 3IDVA 2WDUA 2L5OA 4NAXA 3PPUA 1PKZA 3EPTA 3QAWA 3KZQA 2YWOA 2TRXA 4CDOA 3OR5A 3EMPA 2OADA 2C80A 5F05A 4NHWA 1SK2A 5ECIB 4TRXA 2IN3A 1H4OA 1QK8A 5B6MA 2H1BA 4YKGA 3O3TA 3QAGA 1GRXA 2K18A 5B8AA 3KM6A 5J9BA 3WGDA 1M9AA 5COHA 2XHFA 4TXOA 4OCFA 3LXTA 3F3QA 2EC4A 4O5RA 2V2GA 4RQRA 4BA7A 3ED3A 3C1SA 2B5XA 4I6XA 5ELGA 1OAZA 1OC9A 2QKEA 1HNBA 2IL3A 4PQ1A 3L9VA 1XPVA 1AQWA 2L6DA 3LXZA 2M80A 4V1Ap 4NV5A 3HVSA 3C71A 3KH7A 3DGQA 1R5PA 3KCMA 1TDIA 18GSA 4BVYA 1WJKA 3VWXA 1T00A 3HJOA 1Z6NA 4NHZA 1BYEA 4LL4B 2IFQA 5FT3A 1ERTA 1EP7A 2YV7A 1TXXA 3I43A 4GWRA 3KIJA 3IBHA 1AQVA 5JWRB 3QOUA 4POMA 2HYXA 3IRAA 3UBKA 5CP1A 2R3XA 3IXRA 1Z3EA 2VOCA 4KDUA 4KB3A 2VM2A 4PTSA 3ZL5A 2HSHA 1UN2A 2AAWA 1TK5B 1ZYNA 2R2JA 3CTFA 4G0LA 4DSQA 2VAFA 5DQSA 3I6AA 1B4QA 3TOTA 1PN0A 2NPBA 2KP2A 2X4AA 5A5KA 4MLYA 1FG4A 4WBJA 1WP0A 3GL3A 1ABAA 2HZEB 1EWXA 3F6DA 3WGEA 2H0IA 4F9ZA 3F4SA 1OE8A 5G1LA 1HQOA 4MZCA 1DSBA 1U6TA 2M72A 4TR1A 2IMFA 4KA0A 4G0IA 1QXHA 1A8YA 1WMJA 2NDOA 5HFIA 3QPMA 4ZL9A 1S3CA 2CZ2A 1OVNA 4G9HA 4EL1A 4EIQA 1R7HA 1W4VA 5G2ZA 5ABRA 3A5WA 3KMNA 2B7JA 2L6CA 2VCTA 1NHYA 5D93A 3TRPA 1HNCA 2H6YA 2PWJA 3FYGA 2H30A 2ES7A 4X43A 4ECJA 1J08A 2H76A 4DSSB 5CNWA 3EU3A 3ERGA 1V9WA 1FOHA 3D21A 1USBA 2GSQA 1NW2A 5J9CA 1GUHA 1GSDA 5ECHB 1GSUA 1DE1A 1ZL9A 5KN2A 4GQCA 4MMMA 2PMTA 4KDXA 4FQUA 4DSRA 3VPTA 5AN1A 4PQIA 4PGTA 4WXTA 1UA5A 4Z2RA 1V57A 5BMUA 1VF1A 2YJHA 2DKHA 4K7NA 5CRHA 3TDGA 1F6MC 2WJUA 1GTUA 5ECMB 4BVXA 2RUEA 2JSYA 4I2TA 2E2MA 1TOFA 1JZRA 2ON7A 1RQMA 2DJ3A 1Z5YE 3GUSA 2R5GA 4CY8A 2OBKA 4OFNA 5IMDA 3LYKA 4FYBA 2C1YA 2IMKA 5DJLA 3FKFA 4ZBDA 5F07A 2REMA 2V6OA 5CREA 1A2LA 2VCZA 3W6GA 5IIZA 5IMVA 3M9JA 4F2IA 4KAEA 1VGLA 4KCEA 3ZLPA 2VO4A 1TK8B 2Z9SA 4N30A 4TOPA 3AY8A 1WPIA 1FAAA 5H5QA 5JWOB 1PA3A 2VD1A 2BJXA 2MBSA 1JHBA 2B1LA 4IQ1A 2MZCA 1GUKA 1T4ZA 2C3QA 5IMCA 2L5LA 4O32A 1B48A 5JCGA 3TKSE 5EL8A 4AJ7A 3HYPA 1EGOA 1G7OA 2L57A 4TXOB 1V58A 4IBPA 2WZ9A 4MJCA 2FCHA 2HT9A 3EVIA 3RHCA 1JFUA 3FR3A 2IJYA 1OC9B 4BWSA 3K8NA 2MMZA 2TIRA 2AUVA 1TI1A 4K1FA 4K7OA 1XCCA 5FHIA 1O8XA 1B9YC 3U5RE 3NZNA 3DXBA 2OKAA 4GXZA 4K0NA 2GT5A 2VLVA 3F8UA 3MWHA 2WB9A 5GSTA 1SD9A 2O8VB 1GULA 1XWBA 2LNTA 1K3LA 2R0GA 3CMIA 3APQA 2HNLA 1XVQA 4YH2A 1X9SB 4IHUA 2B1KA 2LS5A 1H75A 2XC2A 2AHEA 2HRNA 2VL2A 1ZYPA 4HEA2 3LEFA 4RQXA 1WWJA 2FA4A 2DBCA 3RAZA 1J9BA 1QGVA 3H1NA 1FVJA 6GSSA 2LEGA 3EWLA 2RM5A 1M9BA 2HZFA 2LQQA 1K0OA 2H8LA 5DQYA 4IS0A 3UBLA 4L0UA 3F6FA 3DVWA 4MJEA 1A23A 2VD0A 4TR0A 5ENUA 1HD2A 2HLSA 1ERWA 3KXOA 3LYPA 5FWGA 3ZYWA 3GSTA 4XIHA 2X64A 3L9UA 5IMZA 2YOIA 4JBBA 2A2SA 2VCXA 2YNXA 4IJ3A 5ECLB 1HYUA 3TJFA 1SK1A 2KLXA 2IMDA 3IC8A 3KGKA 2I81A 3G9BA 4CW9A 3TKSA 3NOFA 5KN3A 3GHAA 3L78A 2H1DA 4DVCA 4BL7A 2N5FA 3ZZXA 2DSAA 3ME7A 2VLTA 4V2NA 2I9HA 2MMAA 2A4HA 3ZMKA 1EZKA 1ML6A 5IM9A 3UL3A 1SJZA 3GTUB 2DIYA 3P2AA 1G6YA 2A2PA 1KTEA 5F0GA 2KUCA 4XS1A 3UAPA 4MCUA 10GSA 4WF4A 4IJIA 1YKAA 3ZITA 4Z2UA 2B7KA 3GYKA 2RM6A 4D73A 3ME8A 5EY6A 3Q19A 5G5FA 2VL3A 1GH2A 4HQZA 3ZMLA 5INYA 3VFIA 3GL5A 3HVVA 3Q6OA 2R4VA 2WGRA 3DYRA 3LORA 1K0DA 1K0NA 2PU9C 1YQ1A 3HJMA 4HU9A 4ML1A 4KUNA 1YEXA 1U87A 4ECIA 4POLA 3IC4A 1F3AA 1ON4A 3TOUA 2E2GA 3LGCA 3PH9A 4N0ZA 3KP9A 4HJ2A 4JRRA 2GQMA 4MP4A 3WT1A 2YCDA 5J4UA 3E3EA 4GSSA 4LMWA 4XS6A 3KEBA 4GSNA 4ZBAA 2N5AA 3MIXA 2ZCTA 4HQSA 4F03A 1QMVA 3EYTA 4AJ8A 4EO3A 3L4NA 5D9TA 5JCUA 2JZSA 5IMFA 2JZTA 1K0AA 3US3A 2H71A 4EXJA 3HCZA 4A5PA 3KTBA 2HI7A 1GTAA 1ILOA 3GN3A 2VM1A 4PNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZRE A;  1AXD A;  1M7T A;  3GKN A;  4ULX A;  2B5E A;  2X99 A;  4P3Y B;  1BED A;  2CZ3 A;  3M3M A;  4NV2 A;  3M9K A;  1FOV A;  4LA1 A;  2C0G A;  5DDL A;  3UJ1 A;  3LWA A;  2BMX A;  3ZFB A;  5DAL B;  1ZYQ B;  2V41 A;  3CSH A;  4X1U A;  6GSY A;  5KEJ A;  4FYU A;  1J0F A;  3GSS A;  1XBS A;  1VRS D;  1S3D A;  1FHE A;  1XFL A;  3D22 A;  2YJ7 A;  1DE2 A;  3M8N A;  2WRT A;  3UOM A;  3DEX A;  2E7P A;  5ECS A;  4YQU A;  3BOA A;  2LRC A;  3MSZ A;  3IPZ A;  1BG5 A;  4POB A;  1A2M A;  2H74 A;  5CO3 A;  4MJA A;  4OCE A;  5C00 A;  3MDK A;  1IYH A;  4ML6 A;  4V1A g;  4IEL A;  3ZTL A;  2PN8 A;  3TRX A;  3Q18 A;  4TKY A;  3HKR A;  3UAR A;  3BJ5 A;  4NWY A;  1M0U A;  3CSJ A;  1T7P B;  1MDK A;  4TN8 A;  5D73 A;  2F3M A;  4IVF A;  3QFB C;  1YEP A;  4WR4 A;  4YAP A;  3UVT A;  4X0X A;  1KNG A;  2CQ9 A;  2GTU A;  1GL8 A;  4LLR A;  1MD4 A;  3D0Z A;  4F0C A;  1B9X C;  2EIR A;  2FWH A;  4WEY A;  1SL0 B;  1PQN A;  2EIO A;  5HFG A;  2JL4 A;  2CV4 A;  3D5J A;  2K8V A;  1ERU A;  4HS1 A;  5ECP B;  4EF0 A;  5IOX A;  2IME A;  2HE3 A;  5G5E A;  2YWI A;  1SYX A;  3TKQ A;  1G0T A;  4NMU A;  1X5C A;  1MD3 A;  1X0R A;  2LV3 A;  4JE1 A;  1MDJ A;  1TI3 A;  1ZOF A;  1BQ7 A;  4IW9 A;  4XTS A;  3E0U A;  1Z9H A;  1BJX A;  1SL2 B;  2NVL A;  3TJJ A;  1GSQ A;  5HQP A;  5E4W A;  1X9W B;  1ZMA A;  2FY6 A;  3QAV A;  5AIX A;  4HI7 A;  3C7M A;  3F0I A;  3SBC A;  1I5G A;  4HUA A;  3P7X A;  2JAC A;  1XZO A;  4KND A;  4Q5F A;  4OO4 A;  1SK0 A;  5D9V A;  2LRT A;  1XWK A;  4RI6 A;  1GWC A;  4Q5N A;  1M2B A;  2GT6 A;  4JU5 A;  3RPP A;  5G30 A;  4L5L A;  4LMV A;  3P90 A;  5AIS A;  1V98 A;  1F9M A;  4AGS A;  3DML A;  4Z7X A;  2L4Q A;  4XS4 B;  3D4T A;  4AF2 A;  2VLU A;  2VCQ A;  3GX8 A;  4PUA A;  4PUF C;  2AB6 A;  5C04 A;  3FZA A;  3LQ7 A;  3D6I A;  4TR4 A;  2B3S A;  1VF3 A;  1XWG A;  4HZ2 A;  2V6K A;  2CT6 A;  2FLS A;  1E2Y A;  2K8S A;  4ECB A;  3F4R A;  4TW5 A;  19GS A;  4WKW A;  3HA9 A;  1SL1 B;  3O76 A;  4OO5 A;  1GSY A;  3W8S A;  3KTL A;  4MF6 A;  3FZ4 A;  5HR2 A;  2I4A A;  3G7I A;  4PX1 A;  3JCM L;  4MF5 A;  2H1A A;  1EV4 A;  1Z7P A;  2H66 A;  2OBI A;  4IN0 A;  1MDI A;  2GDR A;  4D73 B;  1CQG A;  1GSE A;  2FHE A;  3G7Y A;  5ID2 B;  2C3T A;  4WET A;  1R4W A;  1QFN A;  2MMO A;  4H86 A;  1SJI A;  1YY7 A;  3F9U A;  3LSZ A;  2C0F A;  2TRC P;  1X5E A;  3APO A;  4OWY A;  4N0V A;  4MA9 A;  1FB6 A;  1UVZ A;  2H72 A;  5A4V A;  4MDC A;  2CVD A;  1ZZY A;  1EEM A;  2XPE A;  2R37 A;  2OE0 A;  5CAX A;  3WYW A;  1XXU A;  1KBN A;  1ZCP A;  3U6V A;  1NHO A;  2VL9 A;  4L8E A;  2XPD A;  4OMV A;  5D9X A;  4MPF A;  1S3A A;  2OE3 A;  3BD2 A;  4BWQ A;  1V40 A;  2H0G A;  2HFD A;  5JWQ B;  1YF0 A;  5CRD A;  2IPA A;  3KJY A;  4HU7 A;  3GIX A;  3GFK A;  1TRU A;  2A4V A;  3TB2 A;  4ACS A;  5CYY A;  2HZE A;  1T1V A;  1TRV A;  2MYG A;  3QFA C;  4ILF A;  4YQV A;  3CTG A;  3ZVJ A;  4EDY A;  2XBQ A;  3D4M A;  2VUP A;  20GS A;  3HXS A;  2F8A A;  5IQY A;  5LNK e;  3H4K A;  4I8B A;  2GSS A;  3SWL A;  2CVB A;  1XW5 A;  1GSS A;  1U88 A;  5EVO A;  1EOG A;  3NIV A;  2LTK A;  2FWF A;  3CBU A;  2OAC A;  4XRD A;  4JR4 A;  1R5A A;  3R2Q A;  1MTC A;  2IFQ B;  2AJQ B;  4PXO A;  5B6N A;  2LRN A;  1PL2 A;  4MJB A;  2VCW A;  4OD7 A;  2PPT A;  3GKX A;  4IGJ A;  2V32 A;  3IE3 A;  4KDY A;  1Z6M A;  4QQ7 A;  2LST A;  4N10 A;  3IK7 A;  5KN0 A;  4ZIL A;  1K0B A;  3PIN A;  4AJ6 A;  3VWW A;  1A0F A;  3GUR A;  5B7C A;  4RI7 A;  1GNW A;  4DSS A;  3J7Y b;  5D8I A;  5G1K A;  5D9W A;  5JCW A;  4QL9 A;  4E8E A;  1KEB A;  3HZ8 A;  3H79 A;  5G31 A;  3EC3 A;  3A2W A;  3DD3 A;  2MMN A;  1TKD B;  3FK8 A;  1T4Y A;  4XHM A;  4XRA A;  1JZD A;  4WR5 A;  2JZR A;  3GV1 A;  2FA8 A;  1AUC A;  4BPY A;  3GA4 A;  4K2D A;  5DBQ A;  5HR1 A;  2H01 A;  2C4J A;  5A4U A;  4ZL7 A;  4POK A;  4TR1 B;  1PMT A;  1PSQ A;  1G6W A;  1GP1 A;  5GAN D;  3TJK A;  1N2A A;  2P5Q A;  3FY7 A;  1Q98 A;  2J23 A;  3Q74 A;  2P31 A;  3BCI A;  3WT2 A;  4GST A;  1X5D A;  5IMA A;  5ECQ B;  4PNG A;  2DJ1 A;  2O89 A;  2I3Y A;  2FWG A;  4N11 A;  4JZQ A;  3N5O A;  2H70 A;  4FIW A;  3CRT A;  1JZO A;  2WCI A;  2HSY A;  2H75 A;  3P8W A;  3IAS 2;  4JR6 A;  2KOK A;  4QL7 A;  3TRQ A;  3KD0 A;  4YAV A;  2H0H A;  5DCG A;  4ZL8 A;  5ECR B;  2V1M A;  3RBT A;  3DKS A;  3W8J A;  1SU9 A;  1DUG A;  3EMX A;  1OE7 A;  2HXK A;  4MF7 A;  1FVK A;  1TK0 B;  1PGT A;  3CXG A;  4ZB9 A;  1EV9 A;  3MAK A;  4O7H A;  2WUL A;  2RUF A;  6GSW A;  1K0M A;  5J41 A;  4ZB6 A;  1JLV A;  5H5R A;  5J3R A;  3RPN A;  4WBR D;  4EC0 A;  5EPF A;  1ST9 A;  4IP1 A;  2MBT A;  1F37 A;  1DBY A;  2ZNM A;  1OYJ A;  6GSX A;  3BBY A;  4O92 A;  4NXI A;  3TJB A;  2GLR A;  2DLX A;  2YV9 A;  1BAY A;  3DVX A;  4I2U A;  1ZYE A;  4PUR A;  1EP8 A;  3I69 A;  2PUK C;  4EVM A;  7GSS A;  1TP9 A;  3TGZ A;  1Y6E A;  2FWE A;  3HJP A;  1YKC A;  2ZUP A;  3FR9 A;  1XW6 A;  4RUV A;  2F8F A;  3IOS A;  5E59 A;  2DML A;  1K3O A;  4HDE A;  3G7J A;  3N9J A;  4MPG A;  1B8X A;  2FNO A;  4MK3 A;  2C8U A;  2IMI A;  1PN9 A;  2ON5 A;  3FR6 A;  3V1W A;  1TRS A;  4KH7 A;  3FHK A;  1O85 A;  3CRU A;  1V2A A;  1U3I A;  2CVK A;  2LJR A;  5GAP D;  2PGT A;  3F4T A;  3FZ5 A;  2KP1 A;  4L0W A;  3EU4 A;  1E6B A;  2VCV A;  3VK9 A;  2AYT A;  2X8G A;  1JZW A;  3EIN A;  1XW9 A;  1RK4 A;  4LL1 B;  5ECN B;  3L9S A;  1SKW B;  1GLP A;  1PL1 A;  2H1G A;  3DWV A;  2H6Z A;  2OJL A;  3APS A;  4K0G A;  2GVP A;  2RLI A;  3HZ4 A;  2FD3 A;  2KHP A;  1GSF A;  2BTO T;  11GS A;  12GS A;  3ZVJ D;  2LNS A;  9GSS A;  5DAK A;  1VF4 A;  2CAI A;  2A2R A;  3C1R A;  3HVX A;  3QMX A;  2H73 A;  6GST A;  3WD6 A;  5IPH A;  4ZXG A;  4TVE A;  2HRF A;  3E9J B;  5L71 A;  2O85 A;  1YDK A;  1FW1 A;  4K7I A;  5KN1 A;  3ZFL A;  1B4P A;  1PX7 A;  2DMM A;  4E8H A;  1EEJ A;  1THX A;  4L5O A;  2X8C A;  3TUE A;  4FYC A;  3M1G A;  1QQ2 A;  1TTZ A;  3O6T A;  3QCP A;  1EGR A;  4F0B A;  1TJD A;  1GUM A;  4I5Q A;  1ACV A;  1M2D A;  3VLN A;  1MEK A;  4MH3 A;  2AV4 A;  17GS A;  4GTU A;  3IAM 2;  4KGI A;  3WGX A;  4G10 A;  1O7U A;  2I1U A;  3QR6 A;  4K8M A;  2EIQ A;  2M46 A;  2OE1 A;  2L4C A;  3GTU A;  4FH8 A;  2YAN A;  3UVH A;  22GS A;  2C0E A;  8GSS A;  3ZIJ A;  5GZZ B;  1WRY A;  3UMA A;  3MNG A;  4GF0 A;  4HJM A;  2YZU A;  4KW6 A;  1HNA A;  1TU8 A;  4WF5 A;  1GTB A;  1XVW A;  3TJG A;  3A2X A;  3VPQ A;  2CA8 A;  3GX0 A;  3VUR A;  4ZBB A;  4ZIJ A;  1A24 A;  1LBK A;  4KCA A;  1X9M B;  5F8B A;  1THO A;  3ZRD A;  5H5S A;  1XWA A;  1AIU A;  1LU4 A;  2GZP A;  2GST A;  4V2M A;  2CX3 A;  5HR0 A;  3A3T A;  3VI5 A;  5J5N A;  3J7Y k;  1SKS B;  2QGV A;  1T3B A;  6GSU A;  1U3A A;  1GNE A;  2O7K A;  3HY2 A;  1OKT A;  2QC7 A;  1PD2 1;  2DJ0 A;  5AGY A;  2OA7 A;  4ID0 A;  4NPB A;  3HDC A;  1SEN A;  4HZ4 A;  4Q5Q A;  1PX6 A;  1SYR A;  1CQH A;  2DC5 A;  1YJ6 A;  5HR3 A;  4Q5R A;  1SKR B;  3IA1 A;  2YP6 A;  4J56 E;  4GQF A;  1O8W A;  5AIV A;  3FZ9 A;  5DVB A;  1BX9 A;  1SJ6 A;  4OFM A;  2FGX A;  2K9F A;  2WFC A;  5IO2 A;  2CAQ A;  2FUG 2;  3GNJ A;  1K0C A;  1WE0 A;  3C8E A;  3EE2 A;  3FW2 A;  3KP8 A;  4K9Z A;  2GZY A;  3CSI A;  1NM3 A;  5DCH A;  4XCS A;  2IIY A;  3BCK A;  3GRX A;  1GTI A;  2ALB A;  2K6V A;  3CYN A;  4OFT A;  5DAL A;  2QSI A;  2PBJ A;  5ELA A;  4EE0 A;  3IV4 A;  4J57 E;  1AAZ A;  3QDN A;  2GSR A;  5LD0 A;  3GKK A;  3VI7 A;  1ERV A;  2VL2 C;  1Y25 A;  3IK9 A;  4EDZ A;  3PR8 A;  2B5Y A;  1M2A A;  2PVQ A;  4YQM A;  13GS A;  1O73 A;  3H93 A;  5CRW A;  1G7E A;  1Z7R A;  3GMF A;  1OC3 A;  4V2L A;  2YZH A;  4KE3 A;  1PKW A;  2R6K A;  4IQA A;  1T8E B;  1A0R P;  3RDW A;  1YZX A;  3TCO A;  3UIW A;  5B8B A;  1R26 A;  1NSW A;  2P5R A;  3ERW A;  3A2V A;  1TU7 A;  2X8H A;  5A4W A;  1O6J A;  2D2Z A;  4IP6 A;  14GS A;  3GH9 A;  2YPM A;  3C73 A;  2C0D A;  2E0Q A;  3ERF A;  1K3Y A;  1WOU A;  2LUS A;  1IYI A;  3TKR A;  1FB0 A;  3ZIV A;  3M0F A;  1XOB A;  1Q4J A;  4CHS A;  2NTO A;  2JU5 A;  1TW9 A;  2DJ2 A;  2XBI A;  2C3N A;  1OKD A;  1C72 A;  3TKS C;  5HFK A;  2PER A;  3HD5 A;  2RII A;  4DEJ A;  5GSS A;  2B6M A;  1XIY A;  4J2F A;  4I97 A;  1AQX A;  1SD8 A;  1GLQ A;  2LJA A;  2F9S A;  3PGT A;  3KMO A;  1QUW A;  2J9H A;  2JAD A;  3VWV A;  2F51 A;  1N8J A;  3FEU A;  1AW9 A;  4EKZ A;  4EUY A;  4MZB A;  2L59 A;  3DRN A;  16GS A;  2YN1 A;  1WIK A;  2P0G A;  2H19 A;  1RW1 A;  2DJK A;  5DJM A;  2VIM A;  2GZZ A;  4MH2 A;  1FO5 A;  2GGT A;  4GRF A;  2G0F A;  1PRX A;  2N5B A;  1VF2 A;  4TR3 A;  1JLW A;  2O87 A;  3ISO A;  1XOA A;  2YWN A;  3L0H A;  4GLT A;  5ECO B;  1O81 A;  2LQO A;  3GH6 A;  5DAK B;  4F82 A;  2CX4 A;  2GS3 A;  1M99 A;  3I9V 2;  3F3R A;  4JED A;  3GKM A;  3TKP A;  2LJK A;  4GCI A;  3LJR A;  4XS4 A;  5IPG A;  4FO5 A;  1XWC A;  2IWT A;  1UC7 A;  3DIE A;  1A8L A;  5IOW A;  5F06 A;  1A2J A;  3KH9 A;  5ECK B;  1ZGN A;  2NBS A;  4KX4 A;  5IO0 A;  3QD9 A;  1F3B A;  3F63 A;  1URM A;  4TXV A;  3EUR A;  1F2E A;  6GSV A;  1EOH A;  3IR4 A;  1W89 A;  4MAB A;  3LG6 A;  4ZB8 A;  1TRW A;  4MZW A;  3UEM A;  4HOJ A;  2WS2 A;  3IHQ A;  3RHB A;  4IKH A;  3FRC A;  1OC8 A;  2GQK A;  4KSM A;  2JSZ A;  3VWU A;  4G2E A;  2G2Q A;  4PQH A;  1I9D A;  1LJR A;  1YF1 A;  4K6X A;  5LCZ A;  2H6X A;  3H8Q A;  4ISD A;  5D96 A;  1AC1 A;  4ECC A;  4KSO A;  5CRG A;  3HHV A;  2DIZ A;  2GQL A;  3LFL A;  2PVO C;  2LKU A;  5ID2 A;  4G19 A;  2YWM A;  2DJJ A;  3S9F A;  3IDV A;  2WDU A;  2L5O A;  4NAX A;  1PKZ A;  3QAW A;  3KZQ A;  2YWO A;  2TRX A;  4CDO A;  3OR5 A;  3EMP A;  2OAD A;  2C80 A;  5F05 A;  4NHW A;  1SK2 A;  5ECI B;  4TRX A;  2IN3 A;  1H4O A;  1QK8 A;  5B6M A;  2H1B A;  3O3T A;  3QAG A;  1GRX A;  2K18 A;  5B8A A;  3KM6 A;  5J9B A;  3WGD A;  1M9A A;  5COH A;  2XHF A;  4TXO A;  4OCF A;  3LXT A;  3F3Q A;  2EC4 A;  4O5R A;  2V2G A;  4RQR A;  4BA7 A;  3ED3 A;  3C1S A;  2B5X A;  4I6X A;  5ELG A;  1OAZ A;  1OC9 A;  2QKE A;  1HNB A;  2IL3 A;  4PQ1 A;  3L9V A;  1XPV A;  1AQW A;  2L6D A;  3LXZ A;  2M80 A;  4V1A p;  4NV5 A;  3HVS A;  3C71 A;  3KH7 A;  3DGQ A;  1R5P A;  3KCM A;  1TDI A;  18GS A;  4BVY A;  1WJK A;  3VWX A;  1T00 A;  3HJO A;  1Z6N A;  4NHZ A;  1BYE A;  4LL4 B;  2IFQ A;  5FT3 A;  1ERT A;  1EP7 A;  2YV7 A;  1TXX A;  3I43 A;  4GWR A;  3KIJ A;  3IBH A;  1AQV A;  5JWR B;  3QOU A;  4POM A;  2HYX A;  3IRA A;  3UBK A;  5CP1 A;  2R3X A;  3IXR A;  1Z3E A;  2VOC A;  4KDU A;  4KB3 A;  2VM2 A;  3ZL5 A;  2HSH A;  1UN2 A;  2AAW A;  1TK5 B;  2R2J A;  3CTF A;  4DSQ A;  5DQS A;  2VAF A;  3I6A A;  1B4Q A;  3TOT A;  2NPB A;  2KP2 A;  5A5K A;  4MLY A;  1FG4 A;  4WBJ A;  1WP0 A;  3GL3 A;  1ABA A;  2HZE B;  1EWX A;  3F6D A;  3WGE A;  2H0I A;  4F9Z A;  3F4S A;  1OE8 A;  5G1L A;  1HQO A;  4MZC A;  1DSB A;  1U6T A;  2M72 A;  4TR1 A;  2IMF A;  4KA0 A;  1QXH A;  1A8Y A;  1WMJ A;  2NDO A;  5HFI A;  3QPM A;  4ZL9 A;  1S3C A;  2CZ2 A;  1OVN A;  4G9H A;  4EL1 A;  1R7H A;  1W4V A;  5G2Z A;  5ABR A;  3A5W A;  3KMN A;  2B7J A;  2L6C A;  2VCT A;  1NHY A;  5D93 A;  3TRP A;  1HNC A;  2H6Y A;  2PWJ A;  3FYG A;  2H30 A;  2ES7 A;  4X43 A;  4ECJ A;  1J08 A;  2H76 A;  4DSS B;  5CNW A;  3EU3 A;  3ERG A;  1V9W A;  3D21 A;  1USB A;  2GSQ A;  1NW2 A;  5J9C A;  1GUH A;  1GSD A;  5ECH B;  1GSU A;  1DE1 A;  1ZL9 A;  5KN2 A;  4GQC A;  4MMM A;  2PMT A;  4KDX A;  4DSR A;  3VPT A;  5AN1 A;  4PQI A;  4PGT A;  4WXT A;  1UA5 A;  1V57 A;  1VF1 A;  2YJH A;  4K7N A;  5CRH A;  3TDG A;  1F6M C;  2WJU A;  1GTU A;  5ECM B;  4BVX A;  2RUE A;  2JSY A;  4I2T A;  2E2M A;  1TOF A;  1JZR A;  2ON7 A;  1RQM A;  2DJ3 A;  1Z5Y E;  3GUS A;  2R5G A;  2OBK A;  4OFN A;  5IMD A;  3LYK A;  4FYB A;  2C1Y A;  2IMK A;  5DJL A;  3FKF A;  4ZBD A;  5F07 A;  2REM A;  2V6O A;  5CRE A;  1A2L A;  2VCZ A;  3W6G A;  5IIZ A;  5IMV A;  3M9J A;  4F2I A;  4KAE A;  1VGL A;  4KCE A;  3ZLP A;  2VO4 A;  1TK8 B;  2Z9S A;  4N30 A;  4TOP A;  3AY8 A;  1WPI A;  1FAA A;  5H5Q A;  5JWO B;  1PA3 A;  2VD1 A;  2BJX A;  2MBS A;  1JHB A;  2B1L A;  4IQ1 A;  2MZC A;  1GUK A;  1T4Z A;  2C3Q A;  5IMC A;  2L5L A;  4O32 A;  1B48 A;  5JCG A;  3TKS E;  5EL8 A;  4AJ7 A;  3HYP A;  1EGO A;  1G7O A;  2L57 A;  4TXO B;  1V58 A;  4IBP A;  2WZ9 A;  4MJC A;  2FCH A;  2HT9 A;  3EVI A;  3RHC A;  1JFU A;  3FR3 A;  2IJY A;  1OC9 B;  4BWS A;  3K8N A;  2MMZ A;  2TIR A;  2AUV A;  1TI1 A;  4K1F A;  4K7O A;  1XCC A;  5FHI A;  1O8X A;  1B9Y C;  3U5R E;  3NZN A;  3DXB A;  2OKA A;  4GXZ A;  4K0N A;  2GT5 A;  2VLV A;  3F8U A;  3MWH A;  2WB9 A;  5GST A;  1SD9 A;  2O8V B;  1GUL A;  1XWB A;  2LNT A;  1K3L A;  3CMI A;  3APQ A;  2HNL A;  1XVQ A;  4YH2 A;  1X9S B;  4IHU A;  2B1K A;  2LS5 A;  1H75 A;  2XC2 A;  2AHE A;  2HRN A;  2VL2 A;  4HEA 2;  3LEF A;  4RQX A;  1WWJ A;  2FA4 A;  2DBC A;  3RAZ A;  1J9B A;  1QGV A;  3H1N A;  1FVJ A;  6GSS A;  2LEG A;  3EWL A;  2RM5 A;  1M9B A;  2HZF A;  2LQQ A;  1K0O A;  2H8L A;  5DQY A;  4IS0 A;  3UBL A;  4L0U A;  3F6F A;  3DVW A;  4MJE A;  1A23 A;  2VD0 A;  4TR0 A;  5ENU A;  1HD2 A;  2HLS A;  1ERW A;  3KXO A;  3LYP A;  5FWG A;  3ZYW A;  3GST A;  4XIH A;  2X64 A;  3L9U A;  5IMZ A;  2YOI A;  4JBB A;  2A2S A;  2VCX A;  2YNX A;  4IJ3 A;  5ECL B;  1HYU A;  3TJF A;  1SK1 A;  2KLX A;  2IMD A;  3KGK A;  2I81 A;  3G9B A;  4CW9 A;  3TKS A;  3NOF A;  5KN3 A;  3GHA A;  3L78 A;  2H1D A;  4DVC A;  4BL7 A;  2N5F A;  3ZZX A;  2DSA A;  3ME7 A;  2VLT A;  4V2N A;  2I9H A;  2MMA A;  3ZMK A;  1EZK A;  1ML6 A;  5IM9 A;  3UL3 A;  1SJZ A;  3GTU B;  2DIY A;  3P2A A;  1G6Y A;  1KTE A;  5F0G A;  2KUC A;  4XS1 A;  3UAP A;  4MCU A;  10GS A;  4WF4 A;  4IJI A;  1YKA A;  3ZIT A;  2B7K A;  3GYK A;  2RM6 A;  4D73 A;  3ME8 A;  5EY6 A;  3Q19 A;  5G5F A;  2VL3 A;  1GH2 A;  4HQZ A;  3ZML A;  5INY A;  3VFI A;  3GL5 A;  3HVV A;  3Q6O A;  2R4V A;  2WGR A;  3DYR A;  3LOR A;  1K0D A;  1K0N A;  2PU9 C;  1YQ1 A;  3HJM A;  4HU9 A;  4ML1 A;  4KUN A;  1YEX A;  1U87 A;  4ECI A;  4POL A;  3IC4 A;  1F3A A;  1ON4 A;  3TOU A;  2E2G A;  3LGC A;  3PH9 A;  4N0Z A;  3KP9 A;  4HJ2 A;  4JRR A;  2GQM A;  4MP4 A;  3WT1 A;  2YCD A;  5J4U A;  3E3E A;  4GSS A;  4LMW A;  4XS6 A;  3KEB A;  4GSN A;  4ZBA A;  2N5A A;  2ZCT A;  4HQS A;  4F03 A;  1QMV A;  3EYT A;  4AJ8 A;  4EO3 A;  3L4N A;  5D9T A;  5JCU A;  2JZS A;  5IMF A;  2JZT A;  1K0A A;  3US3 A;  2H71 A;  4EXJ A;  3HCZ A;  3KTB A;  2HI7 A;  1GTA A;  1ILO A;  3GN3 A;  2VM1 A;  4PNF A; 
#chains in the Genus database with same CATH topology
 3ZRE A;  1AXD A;  1M7T A;  3GKN A;  4ULX A;  2B5E A;  2X99 A;  4P3Y B;  1BED A;  2CZ3 A;  3M3M A;  4NV2 A;  3M9K A;  1FOV A;  4LA1 A;  2C0G A;  5DDL A;  3UJ1 A;  3LWA A;  2BMX A;  3ZFB A;  5DAL B;  1ZYQ B;  2V41 A;  3CSH A;  4X1U A;  6GSY A;  5KEJ A;  4FYU A;  1J0F A;  3GSS A;  1XBS A;  1VRS D;  1S3D A;  1FHE A;  1XFL A;  3D22 A;  2YJ7 A;  1DE2 A;  3M8N A;  2WRT A;  3UOM A;  3DEX A;  2E7P A;  5ECS A;  4YQU A;  3BOA A;  2LRC A;  3MSZ A;  3IPZ A;  1BG5 A;  4POB A;  1PFO A;  1A2M A;  2H74 A;  5CO3 A;  4MJA A;  4OCE A;  5C00 A;  3MDK A;  1IYH A;  4ML6 A;  4V1A g;  4IEL A;  3ZTL A;  2PN8 A;  3TRX A;  3Q18 A;  4TKY A;  3HKR A;  3UAR A;  3BJ5 A;  4NWY A;  1M0U A;  3CSJ A;  1T7P B;  1MDK A;  4TN8 A;  5D73 A;  2F3M A;  4IVF A;  3QFB C;  1YEP A;  4WR4 A;  4YAP A;  3UVT A;  4X0X A;  1KNG A;  2CQ9 A;  2GTU A;  1GL8 A;  4LLR A;  1MD4 A;  3D0Z A;  4F0C A;  1B9X C;  2EIR A;  2FWH A;  4WEY A;  1SL0 B;  1PQN A;  2EIO A;  5HFG A;  2JL4 A;  2CV4 A;  3D5J A;  2K8V A;  1ERU A;  4HS1 A;  1M3J A;  5ECP B;  4EF0 A;  5IOX A;  3A5I A;  2IME A;  2HE3 A;  5G5E A;  2YWI A;  1SYX A;  3TKQ A;  1G0T A;  4NMU A;  1X5C A;  1MD3 A;  1X0R A;  2LV3 A;  4JE1 A;  1MDJ A;  1TI3 A;  1ZOF A;  1BQ7 A;  2X49 A;  4IW9 A;  4XTS A;  3E0U A;  1Z9H A;  1BJX A;  1SL2 B;  2NVL A;  3TJJ A;  1GSQ A;  5HQP A;  5E4W A;  1X9W B;  1ZMA A;  2FY6 A;  3QAV A;  5AIX A;  4HI7 A;  3C7M A;  3F0I A;  3SBC A;  1I5G A;  4HUA A;  3P7X A;  2JAC A;  2HRA A;  1XZO A;  4KND A;  4Q5F A;  4OO4 A;  1SK0 A;  5D9V A;  2LRT A;  1XWK A;  4RI6 A;  1GWC A;  4Q5N A;  1M2B A;  2GT6 A;  4JU5 A;  3RPP A;  5G30 A;  3IHG A;  4L5L A;  4LMV A;  3P90 A;  5AIS A;  1V98 A;  1F9M A;  4AGS A;  3DML A;  4Z7X A;  2L4Q A;  4XS4 B;  3D4T A;  4AF2 A;  2VLU A;  2VCQ A;  3GX8 A;  4PUA A;  4USS A;  4PUF C;  2AB6 A;  4MNN A;  5C04 A;  3FZA A;  3LQ7 A;  3D6I A;  4TR4 A;  2B3S A;  1VF3 A;  1XWG A;  4HZ2 A;  2V6K A;  2CT6 A;  2FLS A;  1E2Y A;  2K8S A;  4ECB A;  3F4R A;  4TW5 A;  19GS A;  4WKW A;  3HA9 A;  1SL1 B;  3O76 A;  4OO5 A;  1GSY A;  3W8S A;  3KTL A;  4MF6 A;  3FZ4 A;  5HR2 A;  2I4A A;  3G7I A;  4PX1 A;  3JCM L;  4MF5 A;  2H1A A;  1EV4 A;  1Z7P A;  2H66 A;  2OBI A;  4IN0 A;  1MDI A;  2GDR A;  4D73 B;  1CQG A;  1GSE A;  2FHE A;  3G7Y A;  5ID2 B;  2C3T A;  4WET A;  1R4W A;  1QFN A;  2MMO A;  4H86 A;  1SJI A;  1YY7 A;  3F9U A;  2QA1 A;  1XG8 A;  3LSZ A;  2C0F A;  2TRC P;  1X5E A;  3APO A;  4OWY A;  4N0V A;  4MA9 A;  1FB6 A;  1UVZ A;  2H72 A;  5A4V A;  4MDC A;  2CVD A;  1ZZY A;  1EEM A;  2XPE A;  2R37 A;  2OE0 A;  5CAX A;  3WYW A;  1XXU A;  1KBN A;  1ZCP A;  3U6V A;  1NHO A;  2VL9 A;  4L8E A;  2XPD A;  4OMV A;  5D9X A;  4MPF A;  1S3A A;  2OE3 A;  3BD2 A;  4BWQ A;  1V40 A;  2H0G A;  2HFD A;  5JWQ B;  1YF0 A;  5CRD A;  2IPA A;  3KJY A;  4HU7 A;  3GIX A;  3GFK A;  1TRU A;  2A4V A;  3TB2 A;  4ACS A;  5CYY A;  2HZE A;  1T1V A;  1TRV A;  2MYG A;  3QFA C;  4ILF A;  4YQV A;  3CTG A;  3ZVJ A;  4EDY A;  2XBQ A;  3D4M A;  2VUP A;  20GS A;  3HXS A;  2F8A A;  5IQY A;  5LNK e;  3H4K A;  4I8B A;  2GSS A;  3SWL A;  2CVB A;  1XW5 A;  1GSS A;  1U88 A;  4BVY B;  5EVO A;  1EOG A;  3NIV A;  2LTK A;  2FWF A;  3CBU A;  2OAC A;  4XRD A;  4JR4 A;  1R5A A;  3R2Q A;  1MTC A;  4ICY A;  2IFQ B;  2AJQ B;  4PXO A;  5B6N A;  2LRN A;  1PL2 A;  4MJB A;  2VCW A;  4OD7 A;  2PPT A;  3GKX A;  4IGJ A;  2V32 A;  3IE3 A;  4KDY A;  1Z6M A;  4QQ7 A;  2LST A;  4N10 A;  3IK7 A;  5KN0 A;  4ZIL A;  1K0B A;  3PIN A;  4AJ6 A;  4CY6 A;  3VWW A;  1A0F A;  3GUR A;  5B7C A;  4RI7 A;  1GNW A;  4DSS A;  3J7Y b;  5D8I A;  5G1K A;  5D9W A;  5JCW A;  4QL9 A;  4E8E A;  1KEB A;  3HZ8 A;  3H79 A;  5G31 A;  3EC3 A;  3A2W A;  3DD3 A;  2MMN A;  1TKD B;  3FK8 A;  1T4Y A;  4XHM A;  4XRA A;  1JZD A;  4WR5 A;  2JZR A;  3GV1 A;  2FA8 A;  1AUC A;  4BPY A;  3GA4 A;  4K2D A;  5DBQ A;  5HR1 A;  2R0P A;  2H01 A;  4EIP A;  2C4J A;  5A4U A;  4ZL7 A;  4POK A;  4TR1 B;  1PMT A;  1PSQ A;  1G6W A;  1GP1 A;  5GAN D;  3TJK A;  1N2A A;  2P5Q A;  3FY7 A;  1Q98 A;  2J23 A;  3Q74 A;  2P31 A;  3BCI A;  3WT2 A;  4GST A;  1X5D A;  5IMA A;  5ECQ B;  4PNG A;  2DJ1 A;  2O89 A;  2I3Y A;  2FWG A;  4N11 A;  4JZQ A;  3N5O A;  2H70 A;  4FIW A;  3CRT A;  3FMW A;  1JZO A;  2WCI A;  2HSY A;  2H75 A;  3P8W A;  3IAS 2;  4JR6 A;  2KOK A;  4QL7 A;  3TRQ A;  3KD0 A;  4YAV A;  2H0H A;  5DCG A;  4ZL8 A;  5ECR B;  2V1M A;  3RBT A;  3DKS A;  3W8J A;  1SU9 A;  1DUG A;  3EMX A;  1OE7 A;  2HXK A;  4MF7 A;  1FVK A;  1TK0 B;  1PGT A;  3CXG A;  4ZB9 A;  3MYD A;  1EV9 A;  3MAK A;  4O7H A;  2WUL A;  2RUF A;  6GSW A;  1K0M A;  5J41 A;  4ZB6 A;  1JLV A;  5H5R A;  5J3R A;  3RPN A;  4WBR D;  4EC0 A;  5EPF A;  1ST9 A;  4IP1 A;  2MBT A;  1F37 A;  1DBY A;  2ZNM A;  1OYJ A;  6GSX A;  3BBY A;  4O92 A;  4NXI A;  3TJB A;  2GLR A;  2DLX A;  2YV9 A;  1BAY A;  3DVX A;  4I2U A;  1ZYE A;  4PUR A;  3R3E A;  1EP8 A;  3I69 A;  4BVX B;  2PUK C;  4EVM A;  7GSS A;  1TP9 A;  3TGZ A;  1Y6E A;  2R0C A;  2FWE A;  3HJP A;  1YKC A;  2ZUP A;  3FR9 A;  1XW6 A;  4RUV A;  2F8F A;  3IOS A;  5E59 A;  2DML A;  1K3O A;  4HDE A;  3G7J A;  3N9J A;  4MPG A;  1B8X A;  2FNO A;  4MK3 A;  2C8U A;  2IMI A;  1PN9 A;  2ON5 A;  3FR6 A;  3V1W A;  1TRS A;  4KH7 A;  3FHK A;  1O85 A;  3CRU A;  1V2A A;  1U3I A;  2CVK A;  2LJR A;  5GAP D;  2PGT A;  3F4T A;  3FZ5 A;  4K2X A;  2KP1 A;  2DKI A;  4L0W A;  3EU4 A;  1E6B A;  2VCV A;  3VK9 A;  4KF9 A;  2AYT A;  2X8G A;  1JZW A;  3EIN A;  3CQF A;  1XW9 A;  1RK4 A;  4LL1 B;  5ECN B;  3L9S A;  1SKW B;  3LW9 A;  1GLP A;  1PL1 A;  2H1G A;  3DWV A;  2H6Z A;  2OJL A;  3APS A;  4K0G A;  2GVP A;  2RLI A;  3HZ4 A;  2FD3 A;  2KHP A;  1GSF A;  2BTO T;  11GS A;  12GS A;  3ZVJ D;  2LNS A;  9GSS A;  2QA2 A;  5DAK A;  1VF4 A;  2CAI A;  2A2R A;  3C1R A;  3HVX A;  3QMX A;  2H73 A;  6GST A;  3WD6 A;  5IPH A;  4ZXG A;  4TVE A;  2HRF A;  3E9J B;  5L71 A;  2O85 A;  1YDK A;  1FW1 A;  4K7I A;  5KN1 A;  3ZFL A;  1B4P A;  1PX7 A;  2DMM A;  2HSM A;  4E8H A;  1EEJ A;  1THX A;  4L5O A;  2HRK A;  2X8C A;  3TUE A;  4FYC A;  3M1G A;  1QQ2 A;  1TTZ A;  3O6T A;  3QCP A;  4O5U A;  1EGR A;  4F0B A;  4K5S A;  1TJD A;  1GUM A;  4I5Q A;  1ACV A;  1M2D A;  3VLN A;  1MEK A;  4MH3 A;  2AV4 A;  17GS A;  4GTU A;  3IAM 2;  4KGI A;  3WGX A;  4G10 A;  1O7U A;  2I1U A;  3QR6 A;  4K8M A;  2EIQ A;  2M46 A;  2OE1 A;  2L4C A;  3GTU A;  4FH8 A;  2YAN A;  3UVH A;  22GS A;  2C0E A;  8GSS A;  3ZIJ A;  5GZZ B;  1WRY A;  3UMA A;  3MNG A;  4GF0 A;  4HJM A;  2YZU A;  4KW6 A;  1HNA A;  1TU8 A;  4WF5 A;  1GTB A;  1XVW A;  3TJG A;  3A2X A;  3VPQ A;  2CA8 A;  3GX0 A;  3VUR A;  4ZBB A;  4ZIJ A;  1A24 A;  1LBK A;  4KCA A;  1X9M B;  5F8B A;  1THO A;  3ZRD A;  5H5S A;  1XWA A;  1AIU A;  1LU4 A;  2GZP A;  2GST A;  4V2M A;  2CX3 A;  5HR0 A;  3A3T A;  3VI5 A;  5J5N A;  3J7Y k;  1SKS B;  2QGV A;  1T3B A;  6GSU A;  1U3A A;  1GNE A;  2O7K A;  3HY2 A;  1OKT A;  2QC7 A;  1PD2 1;  2DJ0 A;  5AGY A;  2OA7 A;  4ID0 A;  4NPB A;  3HDC A;  1SEN A;  4HZ4 A;  4BL7 B;  4Q5Q A;  1PX6 A;  1SYR A;  4K5R A;  1CQH A;  2DC5 A;  1YJ6 A;  5HR3 A;  4Q5R A;  1SKR B;  3IA1 A;  2YP6 A;  4J56 E;  4GQF A;  1O8W A;  5AIV A;  3FZ9 A;  5DVB A;  1BX9 A;  1SJ6 A;  4OFM A;  2FGX A;  2K9F A;  2WFC A;  5IO2 A;  2CAQ A;  2FUG 2;  3GNJ A;  1K0C A;  1WE0 A;  3C8E A;  3EE2 A;  3FW2 A;  3KP8 A;  4K9Z A;  2GZY A;  3CSI A;  1NM3 A;  5DCH A;  4XCS A;  2IIY A;  3BCK A;  3GRX A;  1GTI A;  2ALB A;  2K6V A;  3CYN A;  4OFT A;  5DAL A;  2QSI A;  2PBJ A;  5ELA A;  4EE0 A;  3IV4 A;  4J57 E;  1AAZ A;  3QDN A;  2GSR A;  5LD0 A;  3GKK A;  3VI7 A;  1ERV A;  2VL2 C;  1Y25 A;  3IK9 A;  4EDZ A;  3PR8 A;  2B5Y A;  1M2A A;  2PVQ A;  4YQM A;  13GS A;  1O73 A;  3H93 A;  5CRW A;  1G7E A;  1Z7R A;  4G0K A;  3GMF A;  1OC3 A;  4V2L A;  2YZH A;  4KE3 A;  1PKW A;  2R6K A;  4IQA A;  1T8E B;  1A0R P;  3RDW A;  1YZX A;  3TCO A;  3UIW A;  5B8B A;  1R26 A;  1NSW A;  2P5R A;  3ERW A;  3A2V A;  1TU7 A;  2X8H A;  5A4W A;  1O6J A;  2D2Z A;  4IP6 A;  14GS A;  3GH9 A;  4O5Q A;  2YPM A;  3C73 A;  2C0D A;  2E0Q A;  3ERF A;  1K3Y A;  1WOU A;  2LUS A;  1IYI A;  3TKR A;  1FB0 A;  3ZIV A;  3M0F A;  1XOB A;  1Q4J A;  4CHS A;  2NTO A;  4YKF A;  2JU5 A;  1TW9 A;  2DJ2 A;  2XBI A;  2C3N A;  1OKD A;  1C72 A;  3TKS C;  5HFK A;  2PER A;  3HD5 A;  2RII A;  4DEJ A;  5GSS A;  2B6M A;  1XIY A;  4J2F A;  4I97 A;  1AQX A;  1SD8 A;  1GLQ A;  2LJA A;  2F9S A;  3PGT A;  3KMO A;  1QUW A;  2J9H A;  2JAD A;  3VWV A;  2F51 A;  1N8J A;  3FEU A;  1AW9 A;  4EKZ A;  4EUY A;  4MZB A;  2L59 A;  3DRN A;  16GS A;  2YN1 A;  1WIK A;  2P0G A;  2H19 A;  4X4J A;  1RW1 A;  2DJK A;  5DJM A;  2VIM A;  2GZZ A;  4MH2 A;  1FO5 A;  2GGT A;  4GRF A;  2G0F A;  1PRX A;  2N5B A;  1VF2 A;  4TR3 A;  1JLW A;  2O87 A;  3ISO A;  1XOA A;  2YWN A;  3L0H A;  4GLT A;  5ECO B;  1O81 A;  2LQO A;  3GH6 A;  5DAK B;  4F82 A;  2CX4 A;  2GS3 A;  1M99 A;  4Z2T A;  5BRT A;  3I9V 2;  3F3R A;  4JED A;  3GKM A;  3TKP A;  2LJK A;  4GCI A;  3LJR A;  4XS4 A;  5IPG A;  4FO5 A;  1XWC A;  2IWT A;  1UC7 A;  3DIE A;  1A8L A;  5IOW A;  5F06 A;  1A2J A;  3KH9 A;  5ECK B;  1ZGN A;  2NBS A;  4KX4 A;  5IO0 A;  3QD9 A;  1F3B A;  3F63 A;  1URM A;  4TXV A;  3EUR A;  1F2E A;  6GSV A;  1EOH A;  3IR4 A;  1W89 A;  4MAB A;  3LG6 A;  4ZB8 A;  1TRW A;  5KOW A;  4MZW A;  3UEM A;  4HOJ A;  2WS2 A;  3IHQ A;  3RHB A;  4IKH A;  3FRC A;  1OC8 A;  2GQK A;  4KSM A;  2JSZ A;  3VWU A;  4G2E A;  2G2Q A;  4PQH A;  1I9D A;  1LJR A;  1YF1 A;  4K6X A;  5LCZ A;  2H6X A;  5KOX A;  3H8Q A;  4ISD A;  5D96 A;  1AC1 A;  4ECC A;  4KSO A;  2UZ8 A;  3HHV A;  2DIZ A;  5CRG A;  2GQL A;  3LFL A;  2PVO C;  2LKU A;  5ID2 A;  4G19 A;  2YWM A;  2DJJ A;  3S9F A;  3IDV A;  2WDU A;  2L5O A;  4NAX A;  3PPU A;  1PKZ A;  3EPT A;  3QAW A;  3KZQ A;  2YWO A;  2TRX A;  4CDO A;  3OR5 A;  3EMP A;  2OAD A;  2C80 A;  4BIK A;  5F05 A;  4NHW A;  1SK2 A;  5ECI B;  4TRX A;  2IN3 A;  1H4O A;  1QK8 A;  5B6M A;  2H1B A;  4YKG A;  3O3T A;  3QAG A;  1GRX A;  2K18 A;  5B8A A;  3KM6 A;  5J9B A;  3WGD A;  1M9A A;  5COH A;  2XHF A;  4TXO A;  4OCF A;  3LXT A;  3F3Q A;  2EC4 A;  4O5R A;  2V2G A;  4RQR A;  4BA7 A;  3ED3 A;  3C1S A;  2B5X A;  4I6X A;  5ELG A;  1OAZ A;  1OC9 A;  2QKE A;  1HNB A;  2IL3 A;  4PQ1 A;  3L9V A;  1XPV A;  1AQW A;  2L6D A;  3LXZ A;  2M80 A;  4V1A p;  4NV5 A;  3HVS A;  3C71 A;  3KH7 A;  3DGQ A;  3HVN A;  1R5P A;  3KCM A;  1TDI A;  18GS A;  4BVY A;  1WJK A;  3VWX A;  1T00 A;  3HJO A;  1Z6N A;  4NHZ A;  1BYE A;  4LL4 B;  2IFQ A;  5FT3 A;  1ERT A;  1EP7 A;  2YV7 A;  1TXX A;  3I43 A;  4GWR A;  3KIJ A;  3IBH A;  1AQV A;  5JWR B;  3QOU A;  4POM A;  2HYX A;  3IRA A;  3UBK A;  5CP1 A;  2R3X A;  3IXR A;  1Z3E A;  2VOC A;  4KDU A;  4KB3 A;  2VM2 A;  4PTS A;  3ZL5 A;  2HSH A;  1UN2 A;  2AAW A;  1TK5 B;  1ZYN A;  2R2J A;  3CTF A;  4G0L A;  4DSQ A;  2VAF A;  5DQS A;  3I6A A;  1B4Q A;  3TOT A;  1PN0 A;  2NPB A;  2KP2 A;  2X4A A;  5A5K A;  4MLY A;  1FG4 A;  4WBJ A;  1WP0 A;  3GL3 A;  1ABA A;  2HZE B;  1EWX A;  3F6D A;  3WGE A;  2H0I A;  4F9Z A;  3F4S A;  1OE8 A;  5G1L A;  1HQO A;  4MZC A;  1DSB A;  1U6T A;  2M72 A;  4TR1 A;  2IMF A;  4KA0 A;  4G0I A;  1QXH A;  1A8Y A;  1WMJ A;  2NDO A;  5HFI A;  3QPM A;  4ZL9 A;  1S3C A;  2CZ2 A;  1OVN A;  4G9H A;  4EL1 A;  4EIQ A;  1R7H A;  1W4V A;  5G2Z A;  5ABR A;  3A5W A;  3KMN A;  2B7J A;  2L6C A;  2VCT A;  1NHY A;  5D93 A;  3TRP A;  1HNC A;  2H6Y A;  2PWJ A;  3FYG A;  2H30 A;  2ES7 A;  4X43 A;  4ECJ A;  1J08 A;  2H76 A;  4DSS B;  5CNW A;  3EU3 A;  3ERG A;  1V9W A;  1FOH A;  3D21 A;  1USB A;  2GSQ A;  1NW2 A;  5J9C A;  1GUH A;  1GSD A;  5ECH B;  1GSU A;  1DE1 A;  1ZL9 A;  5KN2 A;  4GQC A;  4MMM A;  2PMT A;  4KDX A;  4FQU A;  4DSR A;  3VPT A;  5AN1 A;  4PQI A;  4PGT A;  4WXT A;  1UA5 A;  4Z2R A;  1V57 A;  5BMU A;  1VF1 A;  2YJH A;  2DKH A;  4K7N A;  5CRH A;  3TDG A;  1F6M C;  2WJU A;  1S3R A;  1GTU A;  5ECM B;  4BVX A;  2RUE A;  2JSY A;  4I2T A;  2E2M A;  1TOF A;  1JZR A;  2ON7 A;  1RQM A;  2DJ3 A;  1Z5Y E;  3GUS A;  2R5G A;  4CY8 A;  2OBK A;  4OFN A;  5IMD A;  3LYK A;  4FYB A;  2C1Y A;  2IMK A;  5DJL A;  3FKF A;  4ZBD A;  5F07 A;  2REM A;  2V6O A;  5CRE A;  1A2L A;  2VCZ A;  3W6G A;  5IIZ A;  5IMV A;  3M9J A;  4F2I A;  4KAE A;  1VGL A;  4KCE A;  3ZLP A;  2VO4 A;  1TK8 B;  2Z9S A;  4N30 A;  4TOP A;  3AY8 A;  1WPI A;  1FAA A;  5H5Q A;  5JWO B;  1PA3 A;  2VD1 A;  2BJX A;  2MBS A;  1JHB A;  2B1L A;  4IQ1 A;  2MZC A;  1GUK A;  1T4Z A;  2C3Q A;  5IMC A;  2L5L A;  4O32 A;  1B48 A;  5JCG A;  3TKS E;  5EL8 A;  4AJ7 A;  3HYP A;  1EGO A;  1G7O A;  2L57 A;  4TXO B;  1V58 A;  4IBP A;  2WZ9 A;  4MJC A;  2FCH A;  2HT9 A;  3EVI A;  3RHC A;  1JFU A;  3FR3 A;  2IJY A;  1OC9 B;  4BWS A;  3K8N A;  2MMZ A;  2TIR A;  2AUV A;  1TI1 A;  4K1F A;  4K7O A;  1XCC A;  5FHI A;  1O8X A;  1B9Y C;  3U5R E;  3NZN A;  3DXB A;  2OKA A;  4GXZ A;  4K0N A;  2GT5 A;  2VLV A;  3F8U A;  3MWH A;  2WB9 A;  5GST A;  1SD9 A;  2O8V B;  1GUL A;  1XWB A;  2LNT A;  1K3L A;  2R0G A;  3CMI A;  3APQ A;  2HNL A;  1XVQ A;  4YH2 A;  1X9S B;  4IHU A;  2B1K A;  2LS5 A;  1H75 A;  2XC2 A;  2AHE A;  2HRN A;  2VL2 A;  1ZYP A;  4HEA 2;  3LEF A;  4RQX A;  1WWJ A;  2FA4 A;  2DBC A;  3RAZ A;  1J9B A;  1QGV A;  3H1N A;  1FVJ A;  6GSS A;  2LEG A;  3EWL A;  2RM5 A;  1M9B A;  2HZF A;  2LQQ A;  1K0O A;  2H8L A;  5DQY A;  4IS0 A;  3UBL A;  4L0U A;  3F6F A;  3DVW A;  4MJE A;  1A23 A;  2VD0 A;  4TR0 A;  5ENU A;  1HD2 A;  2HLS A;  1ERW A;  3KXO A;  3LYP A;  5FWG A;  3ZYW A;  3GST A;  4XIH A;  2X64 A;  3L9U A;  5IMZ A;  2YOI A;  4JBB A;  2A2S A;  2VCX A;  2YNX A;  4IJ3 A;  5ECL B;  1HYU A;  3TJF A;  1SK1 A;  2KLX A;  2IMD A;  3IC8 A;  3KGK A;  2I81 A;  3G9B A;  4CW9 A;  3TKS A;  3NOF A;  5KN3 A;  3GHA A;  3L78 A;  2H1D A;  4DVC A;  4BL7 A;  2N5F A;  3ZZX A;  1M3I A;  2DSA A;  3ME7 A;  2VLT A;  4V2N A;  2I9H A;  2MMA A;  2A4H A;  3ZMK A;  1EZK A;  1ML6 A;  5IM9 A;  3UL3 A;  1SJZ A;  3GTU B;  2DIY A;  3P2A A;  1G6Y A;  2A2P A;  1KTE A;  5F0G A;  2KUC A;  4XS1 A;  3UAP A;  4MCU A;  10GS A;  4WF4 A;  4IJI A;  1YKA A;  3ZIT A;  4Z2U A;  2B7K A;  4HSC X;  3GYK A;  2RM6 A;  4D73 A;  3ME8 A;  5EY6 A;  3Q19 A;  5G5F A;  2VL3 A;  1GH2 A;  4HQZ A;  3ZML A;  5INY A;  3VFI A;  3GL5 A;  3HVV A;  3Q6O A;  2R4V A;  2WGR A;  3DYR A;  3LOR A;  1K0D A;  1K0N A;  2PU9 C;  1YQ1 A;  3HJM A;  4HU9 A;  4ML1 A;  4KUN A;  1U87 A;  1YEX A;  4ECI A;  4POL A;  3IC4 A;  1F3A A;  1ON4 A;  3TOU A;  2E2G A;  3LGC A;  3PH9 A;  4N0Z A;  3KP9 A;  4HJ2 A;  4JRR A;  2GQM A;  4MP4 A;  3WT1 A;  2YCD A;  5J4U A;  3E3E A;  4GSS A;  4LMW A;  4XS6 A;  3KEB A;  4GSN A;  4ZBA A;  2N5A A;  3MIX A;  2ZCT A;  4HQS A;  4F03 A;  1QMV A;  3EYT A;  4AJ8 A;  4EO3 A;  3L4N A;  5D9T A;  5JCU A;  2JZS A;  5IMF A;  2JZT A;  1K0A A;  3US3 A;  2H71 A;  4EXJ A;  3HCZ A;  4A5P A;  3KTB A;  2HI7 A;  1GTA A;  1ILO A;  3GN3 A;  2VM1 A;  4PNF A; 
#chains in the Genus database with same CATH homology
 3ZRE A;  1AXD A;  1M7T A;  3GKN A;  4ULX A;  2B5E A;  2X99 A;  4P3Y B;  1BED A;  2CZ3 A;  3M3M A;  4NV2 A;  3M9K A;  1FOV A;  4LA1 A;  2C0G A;  5DDL A;  3UJ1 A;  3LWA A;  2BMX A;  3ZFB A;  5DAL B;  1ZYQ B;  2V41 A;  3CSH A;  4X1U A;  6GSY A;  5KEJ A;  4FYU A;  1J0F A;  3GSS A;  1XBS A;  1VRS D;  1S3D A;  1FHE A;  1XFL A;  3D22 A;  2YJ7 A;  1DE2 A;  3M8N A;  2WRT A;  3UOM A;  3DEX A;  2E7P A;  5ECS A;  4YQU A;  3BOA A;  2LRC A;  3MSZ A;  3IPZ A;  1BG5 A;  4POB A;  1A2M A;  2H74 A;  5CO3 A;  4MJA A;  4OCE A;  5C00 A;  3MDK A;  1IYH A;  4ML6 A;  4V1A g;  4IEL A;  3ZTL A;  2PN8 A;  3TRX A;  3Q18 A;  4TKY A;  3HKR A;  3UAR A;  3BJ5 A;  4NWY A;  1M0U A;  3CSJ A;  1T7P B;  1MDK A;  4TN8 A;  5D73 A;  2F3M A;  4IVF A;  3QFB C;  1YEP A;  4WR4 A;  4YAP A;  3UVT A;  4X0X A;  1KNG A;  2CQ9 A;  2GTU A;  1GL8 A;  4LLR A;  1MD4 A;  3D0Z A;  4F0C A;  1B9X C;  2EIR A;  2FWH A;  4WEY A;  1SL0 B;  1PQN A;  2EIO A;  5HFG A;  2JL4 A;  2CV4 A;  3D5J A;  2K8V A;  1ERU A;  4HS1 A;  5ECP B;  4EF0 A;  5IOX A;  3A5I A;  2IME A;  2HE3 A;  5G5E A;  2YWI A;  1SYX A;  3TKQ A;  1G0T A;  4NMU A;  1X5C A;  1MD3 A;  1X0R A;  2LV3 A;  4JE1 A;  1MDJ A;  1TI3 A;  1ZOF A;  1BQ7 A;  2X49 A;  4IW9 A;  4XTS A;  3E0U A;  1Z9H A;  1BJX A;  1SL2 B;  2NVL A;  3TJJ A;  1GSQ A;  5HQP A;  5E4W A;  1X9W B;  1ZMA A;  2FY6 A;  3QAV A;  5AIX A;  4HI7 A;  3C7M A;  3F0I A;  3SBC A;  1I5G A;  4HUA A;  3P7X A;  2JAC A;  2HRA A;  1XZO A;  4KND A;  4Q5F A;  4OO4 A;  1SK0 A;  5D9V A;  2LRT A;  1XWK A;  4RI6 A;  1GWC A;  4Q5N A;  1M2B A;  2GT6 A;  4JU5 A;  3RPP A;  5G30 A;  3IHG A;  4L5L A;  4LMV A;  3P90 A;  5AIS A;  1V98 A;  1F9M A;  4AGS A;  3DML A;  4Z7X A;  2L4Q A;  4XS4 B;  3D4T A;  4AF2 A;  2VLU A;  2VCQ A;  3GX8 A;  4PUA A;  4USS A;  4PUF C;  2AB6 A;  4MNN A;  5C04 A;  3FZA A;  3LQ7 A;  3D6I A;  4TR4 A;  2B3S A;  1VF3 A;  1XWG A;  4HZ2 A;  2V6K A;  2CT6 A;  2FLS A;  1E2Y A;  2K8S A;  4ECB A;  3F4R A;  4TW5 A;  19GS A;  4WKW A;  3HA9 A;  1SL1 B;  3O76 A;  4OO5 A;  1GSY A;  3W8S A;  3KTL A;  4MF6 A;  3FZ4 A;  5HR2 A;  2I4A A;  3G7I A;  4PX1 A;  3JCM L;  4MF5 A;  2H1A A;  1EV4 A;  1Z7P A;  2H66 A;  2OBI A;  4IN0 A;  1MDI A;  2GDR A;  4D73 B;  1CQG A;  1GSE A;  2FHE A;  3G7Y A;  5ID2 B;  2C3T A;  4WET A;  1R4W A;  1QFN A;  2MMO A;  4H86 A;  1SJI A;  1YY7 A;  3F9U A;  2QA1 A;  3LSZ A;  2C0F A;  2TRC P;  1X5E A;  3APO A;  4OWY A;  4N0V A;  4MA9 A;  1FB6 A;  1UVZ A;  2H72 A;  5A4V A;  4MDC A;  2CVD A;  1ZZY A;  1EEM A;  2XPE A;  2R37 A;  2OE0 A;  5CAX A;  3WYW A;  1XXU A;  1KBN A;  1ZCP A;  3U6V A;  1NHO A;  2VL9 A;  4L8E A;  2XPD A;  4OMV A;  5D9X A;  4MPF A;  1S3A A;  2OE3 A;  3BD2 A;  4BWQ A;  1V40 A;  2H0G A;  2HFD A;  5JWQ B;  1YF0 A;  5CRD A;  2IPA A;  3KJY A;  4HU7 A;  3GIX A;  3GFK A;  1TRU A;  2A4V A;  3TB2 A;  4ACS A;  5CYY A;  2HZE A;  1T1V A;  1TRV A;  2MYG A;  3QFA C;  4ILF A;  4YQV A;  3CTG A;  3ZVJ A;  4EDY A;  2XBQ A;  3D4M A;  2VUP A;  20GS A;  3HXS A;  2F8A A;  5IQY A;  5LNK e;  3H4K A;  4I8B A;  2GSS A;  3SWL A;  2CVB A;  1XW5 A;  1GSS A;  1U88 A;  4BVY B;  5EVO A;  1EOG A;  3NIV A;  2LTK A;  2FWF A;  3CBU A;  2OAC A;  4XRD A;  4JR4 A;  1R5A A;  3R2Q A;  1MTC A;  4ICY A;  2IFQ B;  2AJQ B;  4PXO A;  5B6N A;  2LRN A;  1PL2 A;  4MJB A;  2VCW A;  4OD7 A;  2PPT A;  3GKX A;  4IGJ A;  2V32 A;  3IE3 A;  4KDY A;  1Z6M A;  4QQ7 A;  2LST A;  4N10 A;  3IK7 A;  5KN0 A;  4ZIL A;  1K0B A;  3PIN A;  4AJ6 A;  4CY6 A;  3VWW A;  1A0F A;  3GUR A;  5B7C A;  4RI7 A;  1GNW A;  4DSS A;  3J7Y b;  5D8I A;  5G1K A;  5D9W A;  5JCW A;  4QL9 A;  4E8E A;  1KEB A;  3HZ8 A;  3H79 A;  5G31 A;  3EC3 A;  3A2W A;  3DD3 A;  2MMN A;  1TKD B;  3FK8 A;  1T4Y A;  4XHM A;  4XRA A;  1JZD A;  4WR5 A;  2JZR A;  3GV1 A;  2FA8 A;  1AUC A;  4BPY A;  3GA4 A;  4K2D A;  5DBQ A;  5HR1 A;  2R0P A;  2H01 A;  4EIP A;  2C4J A;  5A4U A;  4ZL7 A;  4POK A;  4TR1 B;  1PMT A;  1PSQ A;  1G6W A;  1GP1 A;  5GAN D;  3TJK A;  1N2A A;  2P5Q A;  3FY7 A;  1Q98 A;  2J23 A;  3Q74 A;  2P31 A;  3BCI A;  3WT2 A;  4GST A;  1X5D A;  5IMA A;  5ECQ B;  4PNG A;  2DJ1 A;  2O89 A;  2I3Y A;  2FWG A;  4N11 A;  4JZQ A;  3N5O A;  2H70 A;  4FIW A;  3CRT A;  3FMW A;  1JZO A;  2WCI A;  2HSY A;  2H75 A;  3P8W A;  3IAS 2;  4JR6 A;  2KOK A;  4QL7 A;  3TRQ A;  3KD0 A;  4YAV A;  2H0H A;  5DCG A;  4ZL8 A;  5ECR B;  2V1M A;  3RBT A;  3DKS A;  3W8J A;  1SU9 A;  1DUG A;  3EMX A;  1OE7 A;  2HXK A;  4MF7 A;  1FVK A;  1TK0 B;  1PGT A;  3CXG A;  4ZB9 A;  3MYD A;  1EV9 A;  3MAK A;  4O7H A;  2WUL A;  2RUF A;  6GSW A;  1K0M A;  5J41 A;  4ZB6 A;  1JLV A;  5H5R A;  5J3R A;  3RPN A;  4WBR D;  4EC0 A;  5EPF A;  1ST9 A;  4IP1 A;  2MBT A;  1F37 A;  1DBY A;  2ZNM A;  1OYJ A;  6GSX A;  3BBY A;  4O92 A;  4NXI A;  3TJB A;  2GLR A;  2DLX A;  2YV9 A;  1BAY A;  3DVX A;  4I2U A;  1ZYE A;  4PUR A;  3R3E A;  1EP8 A;  3I69 A;  4BVX B;  2PUK C;  4EVM A;  7GSS A;  1TP9 A;  3TGZ A;  1Y6E A;  2R0C A;  2FWE A;  3HJP A;  1YKC A;  2ZUP A;  3FR9 A;  1XW6 A;  4RUV A;  2F8F A;  3IOS A;  5E59 A;  2DML A;  1K3O A;  4HDE A;  3G7J A;  3N9J A;  4MPG A;  1B8X A;  2FNO A;  4MK3 A;  2C8U A;  2IMI A;  1PN9 A;  2ON5 A;  3FR6 A;  3V1W A;  1TRS A;  4KH7 A;  3FHK A;  1O85 A;  3CRU A;  1V2A A;  1U3I A;  2CVK A;  2LJR A;  5GAP D;  2PGT A;  3F4T A;  3FZ5 A;  4K2X A;  2KP1 A;  2DKI A;  4L0W A;  3EU4 A;  1E6B A;  2VCV A;  3VK9 A;  4KF9 A;  2AYT A;  2X8G A;  1JZW A;  3EIN A;  1XW9 A;  1RK4 A;  4LL1 B;  5ECN B;  3L9S A;  1SKW B;  3LW9 A;  1GLP A;  1PL1 A;  2H1G A;  3DWV A;  2H6Z A;  2OJL A;  3APS A;  4K0G A;  2GVP A;  2RLI A;  3HZ4 A;  2FD3 A;  2KHP A;  1GSF A;  2BTO T;  11GS A;  12GS A;  3ZVJ D;  2LNS A;  9GSS A;  2QA2 A;  5DAK A;  1VF4 A;  2CAI A;  2A2R A;  3C1R A;  3HVX A;  3QMX A;  2H73 A;  6GST A;  3WD6 A;  5IPH A;  4ZXG A;  4TVE A;  2HRF A;  3E9J B;  5L71 A;  2O85 A;  1YDK A;  1FW1 A;  4K7I A;  5KN1 A;  3ZFL A;  1B4P A;  1PX7 A;  2DMM A;  2HSM A;  4E8H A;  1EEJ A;  1THX A;  4L5O A;  2HRK A;  2X8C A;  3TUE A;  4FYC A;  3M1G A;  1QQ2 A;  1TTZ A;  3O6T A;  3QCP A;  4O5U A;  1EGR A;  4F0B A;  4K5S A;  1TJD A;  1GUM A;  4I5Q A;  1ACV A;  1M2D A;  3VLN A;  1MEK A;  4MH3 A;  2AV4 A;  17GS A;  4GTU A;  3IAM 2;  4KGI A;  3WGX A;  4G10 A;  1O7U A;  2I1U A;  3QR6 A;  4K8M A;  2EIQ A;  2M46 A;  2OE1 A;  2L4C A;  3GTU A;  4FH8 A;  2YAN A;  3UVH A;  22GS A;  2C0E A;  8GSS A;  3ZIJ A;  5GZZ B;  1WRY A;  3UMA A;  3MNG A;  4GF0 A;  4HJM A;  2YZU A;  4KW6 A;  1HNA A;  1TU8 A;  4WF5 A;  1GTB A;  1XVW A;  3TJG A;  3A2X A;  3VPQ A;  2CA8 A;  3GX0 A;  3VUR A;  4ZBB A;  4ZIJ A;  1A24 A;  1LBK A;  4KCA A;  1X9M B;  5F8B A;  1THO A;  3ZRD A;  5H5S A;  1XWA A;  1AIU A;  1LU4 A;  2GZP A;  2GST A;  4V2M A;  2CX3 A;  5HR0 A;  3A3T A;  3VI5 A;  5J5N A;  3J7Y k;  1SKS B;  2QGV A;  1T3B A;  6GSU A;  1U3A A;  1GNE A;  2O7K A;  3HY2 A;  1OKT A;  2QC7 A;  1PD2 1;  2DJ0 A;  5AGY A;  2OA7 A;  4ID0 A;  4NPB A;  3HDC A;  1SEN A;  4HZ4 A;  4BL7 B;  4Q5Q A;  1PX6 A;  1SYR A;  4K5R A;  1CQH A;  2DC5 A;  1YJ6 A;  5HR3 A;  4Q5R A;  1SKR B;  3IA1 A;  2YP6 A;  4J56 E;  4GQF A;  1O8W A;  5AIV A;  3FZ9 A;  5DVB A;  1BX9 A;  1SJ6 A;  4OFM A;  2FGX A;  2K9F A;  2WFC A;  5IO2 A;  2CAQ A;  2FUG 2;  3GNJ A;  1K0C A;  1WE0 A;  3C8E A;  3EE2 A;  3FW2 A;  3KP8 A;  4K9Z A;  2GZY A;  3CSI A;  1NM3 A;  5DCH A;  4XCS A;  2IIY A;  3BCK A;  3GRX A;  1GTI A;  2ALB A;  2K6V A;  3CYN A;  4OFT A;  5DAL A;  2QSI A;  2PBJ A;  5ELA A;  4EE0 A;  3IV4 A;  4J57 E;  1AAZ A;  3QDN A;  2GSR A;  5LD0 A;  3GKK A;  3VI7 A;  1ERV A;  2VL2 C;  1Y25 A;  3IK9 A;  4EDZ A;  3PR8 A;  2B5Y A;  1M2A A;  2PVQ A;  4YQM A;  13GS A;  1O73 A;  3H93 A;  5CRW A;  1G7E A;  1Z7R A;  4G0K A;  3GMF A;  1OC3 A;  4V2L A;  2YZH A;  4KE3 A;  1PKW A;  2R6K A;  4IQA A;  1T8E B;  1A0R P;  3RDW A;  1YZX A;  3TCO A;  3UIW A;  5B8B A;  1R26 A;  1NSW A;  2P5R A;  3ERW A;  3A2V A;  1TU7 A;  2X8H A;  5A4W A;  1O6J A;  2D2Z A;  4IP6 A;  14GS A;  3GH9 A;  4O5Q A;  2YPM A;  3C73 A;  2C0D A;  2E0Q A;  3ERF A;  1K3Y A;  1WOU A;  2LUS A;  1IYI A;  3TKR A;  1FB0 A;  3ZIV A;  3M0F A;  1XOB A;  1Q4J A;  4CHS A;  2NTO A;  4YKF A;  2JU5 A;  1TW9 A;  2DJ2 A;  2XBI A;  2C3N A;  1OKD A;  1C72 A;  3TKS C;  5HFK A;  2PER A;  3HD5 A;  2RII A;  4DEJ A;  5GSS A;  2B6M A;  1XIY A;  4J2F A;  4I97 A;  1AQX A;  1SD8 A;  1GLQ A;  2LJA A;  2F9S A;  3PGT A;  3KMO A;  1QUW A;  2J9H A;  2JAD A;  3VWV A;  2F51 A;  1N8J A;  3FEU A;  1AW9 A;  4EKZ A;  4EUY A;  4MZB A;  2L59 A;  3DRN A;  16GS A;  2YN1 A;  1WIK A;  2P0G A;  2H19 A;  4X4J A;  1RW1 A;  2DJK A;  5DJM A;  2VIM A;  2GZZ A;  4MH2 A;  1FO5 A;  2GGT A;  4GRF A;  2G0F A;  1PRX A;  2N5B A;  1VF2 A;  4TR3 A;  1JLW A;  2O87 A;  3ISO A;  1XOA A;  2YWN A;  3L0H A;  4GLT A;  5ECO B;  1O81 A;  2LQO A;  3GH6 A;  5DAK B;  4F82 A;  2CX4 A;  2GS3 A;  1M99 A;  4Z2T A;  5BRT A;  3I9V 2;  3F3R A;  4JED A;  3GKM A;  3TKP A;  2LJK A;  4GCI A;  3LJR A;  4XS4 A;  5IPG A;  4FO5 A;  1XWC A;  2IWT A;  1UC7 A;  3DIE A;  1A8L A;  5IOW A;  5F06 A;  1A2J A;  3KH9 A;  5ECK B;  1ZGN A;  2NBS A;  4KX4 A;  5IO0 A;  3QD9 A;  1F3B A;  3F63 A;  1URM A;  4TXV A;  3EUR A;  1F2E A;  6GSV A;  1EOH A;  3IR4 A;  1W89 A;  4MAB A;  3LG6 A;  4ZB8 A;  1TRW A;  5KOW A;  4MZW A;  3UEM A;  4HOJ A;  2WS2 A;  3IHQ A;  3RHB A;  4IKH A;  3FRC A;  1OC8 A;  2GQK A;  4KSM A;  2JSZ A;  3VWU A;  4G2E A;  2G2Q A;  4PQH A;  1I9D A;  1LJR A;  1YF1 A;  4K6X A;  5LCZ A;  2H6X A;  5KOX A;  3H8Q A;  4ISD A;  5D96 A;  1AC1 A;  4ECC A;  4KSO A;  2UZ8 A;  3HHV A;  2DIZ A;  5CRG A;  2GQL A;  3LFL A;  2PVO C;  2LKU A;  5ID2 A;  4G19 A;  2YWM A;  2DJJ A;  3S9F A;  3IDV A;  2WDU A;  2L5O A;  4NAX A;  3PPU A;  1PKZ A;  3EPT A;  3QAW A;  3KZQ A;  2YWO A;  2TRX A;  4CDO A;  3OR5 A;  3EMP A;  2OAD A;  2C80 A;  5F05 A;  4NHW A;  1SK2 A;  5ECI B;  4TRX A;  2IN3 A;  1H4O A;  1QK8 A;  5B6M A;  2H1B A;  4YKG A;  3O3T A;  3QAG A;  1GRX A;  2K18 A;  5B8A A;  3KM6 A;  5J9B A;  3WGD A;  1M9A A;  5COH A;  2XHF A;  4TXO A;  4OCF A;  3LXT A;  3F3Q A;  2EC4 A;  4O5R A;  2V2G A;  4RQR A;  4BA7 A;  3ED3 A;  3C1S A;  2B5X A;  4I6X A;  5ELG A;  1OAZ A;  1OC9 A;  2QKE A;  1HNB A;  2IL3 A;  4PQ1 A;  3L9V A;  1XPV A;  1AQW A;  2L6D A;  3LXZ A;  2M80 A;  4V1A p;  4NV5 A;  3HVS A;  3C71 A;  3KH7 A;  3DGQ A;  1R5P A;  3KCM A;  1TDI A;  18GS A;  4BVY A;  1WJK A;  3VWX A;  1T00 A;  3HJO A;  1Z6N A;  4NHZ A;  1BYE A;  4LL4 B;  2IFQ A;  5FT3 A;  1ERT A;  1EP7 A;  2YV7 A;  1TXX A;  3I43 A;  4GWR A;  3KIJ A;  3IBH A;  1AQV A;  5JWR B;  3QOU A;  4POM A;  2HYX A;  3IRA A;  3UBK A;  5CP1 A;  2R3X A;  3IXR A;  1Z3E A;  2VOC A;  4KDU A;  4KB3 A;  2VM2 A;  4PTS A;  3ZL5 A;  2HSH A;  1UN2 A;  2AAW A;  1TK5 B;  1ZYN A;  2R2J A;  3CTF A;  4G0L A;  4DSQ A;  2VAF A;  5DQS A;  3I6A A;  1B4Q A;  3TOT A;  1PN0 A;  2NPB A;  2KP2 A;  2X4A A;  5A5K A;  4MLY A;  1FG4 A;  4WBJ A;  1WP0 A;  3GL3 A;  1ABA A;  2HZE B;  1EWX A;  3F6D A;  3WGE A;  2H0I A;  4F9Z A;  3F4S A;  1OE8 A;  5G1L A;  1HQO A;  4MZC A;  1DSB A;  1U6T A;  2M72 A;  4TR1 A;  2IMF A;  4KA0 A;  4G0I A;  1QXH A;  1A8Y A;  1WMJ A;  2NDO A;  5HFI A;  3QPM A;  4ZL9 A;  1S3C A;  2CZ2 A;  1OVN A;  4G9H A;  4EL1 A;  4EIQ A;  1R7H A;  1W4V A;  5G2Z A;  5ABR A;  3A5W A;  3KMN A;  2B7J A;  2L6C A;  2VCT A;  1NHY A;  5D93 A;  3TRP A;  1HNC A;  2H6Y A;  2PWJ A;  3FYG A;  2H30 A;  2ES7 A;  4X43 A;  4ECJ A;  1J08 A;  2H76 A;  4DSS B;  5CNW A;  3EU3 A;  3ERG A;  1V9W A;  1FOH A;  3D21 A;  1USB A;  2GSQ A;  1NW2 A;  5J9C A;  1GUH A;  1GSD A;  5ECH B;  1GSU A;  1DE1 A;  1ZL9 A;  5KN2 A;  4GQC A;  4MMM A;  2PMT A;  4KDX A;  4FQU A;  4DSR A;  3VPT A;  5AN1 A;  4PQI A;  4PGT A;  4WXT A;  1UA5 A;  4Z2R A;  1V57 A;  5BMU A;  1VF1 A;  2YJH A;  2DKH A;  4K7N A;  5CRH A;  3TDG A;  1F6M C;  2WJU A;  1GTU A;  5ECM B;  4BVX A;  2RUE A;  2JSY A;  4I2T A;  2E2M A;  1TOF A;  1JZR A;  2ON7 A;  1RQM A;  2DJ3 A;  1Z5Y E;  3GUS A;  2R5G A;  4CY8 A;  2OBK A;  4OFN A;  5IMD A;  3LYK A;  4FYB A;  2C1Y A;  2IMK A;  5DJL A;  3FKF A;  4ZBD A;  5F07 A;  2REM A;  2V6O A;  5CRE A;  1A2L A;  2VCZ A;  3W6G A;  5IIZ A;  5IMV A;  3M9J A;  4F2I A;  4KAE A;  1VGL A;  4KCE A;  3ZLP A;  2VO4 A;  1TK8 B;  2Z9S A;  4N30 A;  4TOP A;  3AY8 A;  1WPI A;  1FAA A;  5H5Q A;  5JWO B;  1PA3 A;  2VD1 A;  2BJX A;  2MBS A;  1JHB A;  2B1L A;  4IQ1 A;  2MZC A;  1GUK A;  1T4Z A;  2C3Q A;  5IMC A;  2L5L A;  4O32 A;  1B48 A;  5JCG A;  3TKS E;  5EL8 A;  4AJ7 A;  3HYP A;  1EGO A;  1G7O A;  2L57 A;  4TXO B;  1V58 A;  4IBP A;  2WZ9 A;  4MJC A;  2FCH A;  2HT9 A;  3EVI A;  3RHC A;  1JFU A;  3FR3 A;  2IJY A;  1OC9 B;  4BWS A;  3K8N A;  2MMZ A;  2TIR A;  2AUV A;  1TI1 A;  4K1F A;  4K7O A;  1XCC A;  5FHI A;  1O8X A;  1B9Y C;  3U5R E;  3NZN A;  3DXB A;  2OKA A;  4GXZ A;  4K0N A;  2GT5 A;  2VLV A;  3F8U A;  3MWH A;  2WB9 A;  5GST A;  1SD9 A;  2O8V B;  1GUL A;  1XWB A;  2LNT A;  1K3L A;  2R0G A;  3CMI A;  3APQ A;  2HNL A;  1XVQ A;  4YH2 A;  1X9S B;  4IHU A;  2B1K A;  2LS5 A;  1H75 A;  2XC2 A;  2AHE A;  2HRN A;  2VL2 A;  1ZYP A;  4HEA 2;  3LEF A;  4RQX A;  1WWJ A;  2FA4 A;  2DBC A;  3RAZ A;  1J9B A;  1QGV A;  3H1N A;  1FVJ A;  6GSS A;  2LEG A;  3EWL A;  2RM5 A;  1M9B A;  2HZF A;  2LQQ A;  1K0O A;  2H8L A;  5DQY A;  4IS0 A;  3UBL A;  4L0U A;  3F6F A;  3DVW A;  4MJE A;  1A23 A;  2VD0 A;  4TR0 A;  5ENU A;  1HD2 A;  2HLS A;  1ERW A;  3KXO A;  3LYP A;  5FWG A;  3ZYW A;  3GST A;  4XIH A;  2X64 A;  3L9U A;  5IMZ A;  2YOI A;  4JBB A;  2A2S A;  2VCX A;  2YNX A;  4IJ3 A;  5ECL B;  1HYU A;  3TJF A;  1SK1 A;  2KLX A;  2IMD A;  3IC8 A;  3KGK A;  2I81 A;  3G9B A;  4CW9 A;  3TKS A;  3NOF A;  5KN3 A;  3GHA A;  3L78 A;  2H1D A;  4DVC A;  4BL7 A;  2N5F A;  3ZZX A;  2DSA A;  3ME7 A;  2VLT A;  4V2N A;  2I9H A;  2MMA A;  2A4H A;  3ZMK A;  1EZK A;  1ML6 A;  5IM9 A;  3UL3 A;  1SJZ A;  3GTU B;  2DIY A;  3P2A A;  1G6Y A;  2A2P A;  1KTE A;  5F0G A;  2KUC A;  4XS1 A;  3UAP A;  4MCU A;  10GS A;  4WF4 A;  4IJI A;  1YKA A;  3ZIT A;  4Z2U A;  2B7K A;  3GYK A;  2RM6 A;  4D73 A;  3ME8 A;  5EY6 A;  3Q19 A;  5G5F A;  2VL3 A;  1GH2 A;  4HQZ A;  3ZML A;  5INY A;  3VFI A;  3GL5 A;  3HVV A;  3Q6O A;  2R4V A;  2WGR A;  3DYR A;  3LOR A;  1K0D A;  1K0N A;  2PU9 C;  1YQ1 A;  3HJM A;  4HU9 A;  4ML1 A;  4KUN A;  1YEX A;  1U87 A;  4ECI A;  4POL A;  3IC4 A;  1F3A A;  1ON4 A;  3TOU A;  2E2G A;  3LGC A;  3PH9 A;  4N0Z A;  3KP9 A;  4HJ2 A;  4JRR A;  2GQM A;  4MP4 A;  3WT1 A;  2YCD A;  5J4U A;  3E3E A;  4GSS A;  4LMW A;  4XS6 A;  3KEB A;  4GSN A;  4ZBA A;  2N5A A;  3MIX A;  2ZCT A;  4HQS A;  4F03 A;  1QMV A;  3EYT A;  4AJ8 A;  4EO3 A;  3L4N A;  5D9T A;  5JCU A;  2JZS A;  5IMF A;  2JZT A;  1K0A A;  3US3 A;  2H71 A;  4EXJ A;  3HCZ A;  4A5P A;  3KTB A;  2HI7 A;  1GTA A;  1ILO A;  3GN3 A;  2VM1 A;  4PNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...