3V1WA

Molecular basis for multiple ligand binding of calsequestrin and potential inhibition by caffeine and gallocatecin
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
349
structure length
349
Chain Sequence
EGLDFPEYDGVDRVINVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQVLEDKGVGFGLVDSEKDAAVAKKLGLTEEDSIYVFKEDEVIEYDGEFSADTLVEFLLDVLEDPVELIEGERELQAFENIEDEIKLIGYFKNKDSEHYKAFKEAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPVTIPDKPNSEEEIVNFVEEHRRSTLRKLKPESMYETWEDDMDGIHIVAFAEEADPDGYEFLEILKSVAQDNTDNPDLSIIWIDPDDFPLLVPYWEKTFDIDLSAPQIGVVNVTDADSVWMEMDDEEDLPSAEELEDWLEDVLEGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding protein
molecule keywords Calsequestrin-1
publication title Molecular Basis for Multiple Ligand Binding of Calsequestrin and Potential Inhibition by Caffeine and Gallocatecin
rcsb
total genus 104
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2011-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3v1wA03
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3v1wA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3v1wA02
1NHYA 1CQHA 1A23A 3FY7A 1JZWA 8GSSA 1R5PA 2C0FA 3HD5A 3L9VA 3LYKA 4POKA 2V1MA 4G9HA 4L8EA 1PN9A 3FRCA 1MTCA 1AIUA 5L71A 4ZB8A 4IS0A 4N11A 4GQCA 3QR6A 2V32A 3H1NA 4OMVA 5HR0A 4DSSB 3KMOA 3O76A 3QAGA 5IMFA 3VLNA 4NHWA 4DSQA 4TR1A 2K9FA 5IPGA 3DIEA 3L9SA 2HXKA 1WJKA 3M0FA 3BJ5A 1JLVA 4AF2A 2F9SA 3ZFBA 5EL8A 2J9HA 1VGLA 4TVEA 5GSSA 2AAWA 2JADA 1Q4JA 3FYGA 1U3AA 1UC7A 3IXRA 2JL4A 3GYKA 1FB6A 1GSEA 3DRNA 2O87A 5B8BA 1F6MC 3F6FA 1Z6MA 1OAZA 2VUPA 1V98A 2KP1A 2LSTA 4KB3A 4JZQA 3GL5A 4EDZA 4MPGA 4JEDA 5CRGA 5D96A 1WRYA 5CRWA 3GA4A 1OVNA 4GRFA 1GTBA 1BEDA 3GN3A 3IR4A 3UBKA 2LS5A 3ZYWA 2YV9A 2RUEA 4K1FA 2K18A 1PL1A 2FY6A 3IHQA 4WKWA 5DCHA 4NMUA 5H5QA 1R4WA 4YH2A 3F3RA 3KH9A 1W89A 2CA8A 4GWRA 5J4UA 4POBA 1XW5A 3EMXA 3D21A 3EC3A 5ECHB 5FHIA 5DVBA 3G7YA 4N30A 4LL4B 3TJBA 1M99A 1AQWA 2CZ2A 3KGKA 3UVTA 3A5WA 1SL2B 1TJDA 4GF0A 4RUVA 3VURA 3LSZA 5DDLA 3TRQA 4IN0A 2CV4A 2ZNMA 5B6NA 4LLRA 2RIIA 3JCML 4EF0A 1WPIA 1AAZA 4WF4A 4YQUA 4OFNA 5CRDA 2H6YA 6GSSA 2CQ9A 5GAPD 1YEXA 4GLTA 4L5LA 3VI7A 5H5RA 5FT3A 1H4OA 5D9TA 5J9BA 3HY2A 3TB2A 2KP2A 1UA5A 4MMMA 3E9JB 3DVWA 2CX4A 1GUKA 2C1YA 2B1LA 4RQRA 3CRUA 1GULA 2KOKA 4WR4A 1E6BA 4JRRA 1EV9A 5ELAA 2O89A 4IW9A 2GSRA 4J2FA 1V2AA 1J9BA 1SL0B 1BX9A 4DEJA 1MEKA 5IMCA 1GRXA 4KCAA 1A8YA 3HJMA 3DXBA 1Q98A 1TDIA 3A3TA 7GSSA 1XWGA 3GRXA 5CNWA 2I4AA 4OFTA 4PQIA 12GSA 2VL2C 1FOVA 5JCWA 1PMTA 2X8CA 18GSA 3EU4A 2IMIA 1FHEA 2AHEA 1OC9A 3CRTA 3QMXA 2HSHA 2GDRA 1OC9B 4HEA2 2KLXA 1BQ7A 4O7HA 4TXOB 4QL7A 1TRUA 2HT9A 3M9KA 5J3RA 1EGOA 1FAAA 2OA7A 4NWYA 1X5EA 1AXDA 1HNCA 5ABRA 4I2TA 4K7NA 1XZOA 1PGTA 2WRTA 3K8NA 2R4VA 3CSJA 1G6YA 1FVKA 3C1SA 3LXTA 5DALB 5HR2A 2H01A 2RM6A 2HYXA 3KZQA 2GZPA 4MJCA 2B5XA 1PX6A 2QC7A 1ERWA 1FO5A 3ZMLA 2D2ZA 2X8GA 3HXSA 3FR9A 2M80A 3FW2A 3P90A 3UARA 1X5DA 5ID2B 5IMDA 5A4VA 4K7OA 3I69A 3LJRA 1A2LA 4FH8A 1ERTA 2ES7A 3WGXA 1MDIA 2FWGA 3PINA 4GTUA 1GTAA 3DD3A 1V9WA 3MWHA 3WT2A 3KTBA 2OBIA 3NIVA 4KX4A 3GSSA 2EIOA 1JZRA 3ERGA 3IAS2 2AUVA 4ZL9A 5ECMB 3OR5A 2HZEA 3RPPA 1TW9A 3APSA 2YWNA 1U88A 4DVCA 2VCQA 2PVOC 5IOWA 4PX1A 1BYEA 3IE3A 5AIXA 1YF0A 2XPDA 2GSQA 5IPHA 2H76A 2LUSA 2IMDA 4N0VA 3FHKA 2O8VB 3N9JA 2GZZA 2VCZA 1ERVA 3VK9A 4CW9A 2I1UA 5F8BA 1MDJA 1YJ6A 4ZB9A 4HU9A 3DMLA 1GP1A 4I8BA 1A2JA 4IELA 4KA0A 1AQXA 1T7PB 2PWJA 1G7OA 2H74A 4GSSA 1IYIA 5F07A 3QAWA 2C3TA 3WYWA 3DEXA 2GZYA 5DJMA 1XVQA 2CAQA 2V2GA 2B6MA 2YWMA 4BL7A 4OCEA 4MF5A 3O3TA 3IBHA 2LNTA 4BVYA 2HNLA 1GNWA 2QSIA 3DKSA 4MA9A 3ERWA 4FO5A 2C3NA 3VWUA 3VFIA 3ZREA 2L6CA 4WBJA 3P8WA 2PERA 5D9WA 3F8UA 2VD1A 4Q5NA 1J0FA 1GLQA 2FWEA 2H1BA 1F3BA 4GQFA 3EYTA 3IDVA 2FGXA 3BCIA 1ZCPA 4K6XA 2AV4A 1LU4A 3I43A 1PD21 3N5OA 2DBCA 2GGTA 1DSBA 3QD9A 2M72A 4I6XA 1MDKA 2FHEA 2HFDA 2C0DA 1OC8A 1NW2A 4JE1A 3KD0A 3KEBA 1WE0A 4GSNA 4KNDA 1ZZYA 2CX3A 4PGTA 1XXUA 1VF3A 4XHMA 2P31A 3HZ8A 1FB0A 3L9UA 5CYYA 2YJ7A 4KCEA 1OC3A 4MP4A 3D4MA 1ZMAA 2ALBA 4YQMA 2IFQB 2YNXA 3BBYA 3EURA 1UN2A 4H86A 3APOA 1GTUA 3C73A 4WETA 4YAVA 4BWQA 17GSA 2X99A 5G1KA 3ZFLA 4ECJA 2VOCA 2M46A 6GSUA 1QXHA 1VF4A 2FWFA 1PKZA 3ISOA 2DMLA 3UAPA 4BVXA 1HD2A 4F82A 2DJKA 5F06A 3VPTA 5C04A 2H0GA 5G1LA 3FR3A 3ZTLA 4RI7A 3ZRDA 3ZIJA 4DSSA 2CAIA 3EINA 6GSVA 1WIKA 1GNEA 1AC1A 3IOSA 3M1GA 4MF6A 2X64A 2VM1A 3LGCA 4JU5A 2HLSA 4IBPA 4YAPA 1B9YC 3TKQA 2DJ2A 1LJRA 1N8JA 2RLIA 1QMVA 2YP6A 4N0ZA 4K2DA 2EIQA 2JSZA 3GKXA 4XRAA 1QUWA 1SK1A 3W6GA 1K3YA 3CTGA 4NV5A 4NXIA 1EOGA 3GH6A 1K0DA 4ID0A 1B8XA 4ECBA 3DVXA 4WBRD 5IO0A 5ECPB 2WS2A 4IQAA 5CP1A 3CTFA 5HFGA 1PSQA 1NSWA 1Y25A 2K6VA 3ME8A 5EPFA 3KP9A 2H72A 1U87A 3D4TA 1PRXA 3PR8A 4IP6A 2HSYA 3PGTA 1FG4A 3RHBA 4XTSA 1R5AA 2YOIA 2XC2A 4V2MA 3DYRA 4F0BA 2OKAA 2DJJA 1SK2A 1V40A 4K0NA 3CYNA 4HDEA 4XCSA 1X9SB 2VO4A 2AB6A 5ECQB 3GUSA 3I9V2 4IJIA 1THOA 3KM6A 2WZ9A 6GSXA 1X9MB 1SKRB 2B5YA 2NPBA 4HQZA 2VAFA 4RI6A 1BJXA 3H93A 5IQYA 3LXZA 11GSA 4ECCA 4ZBBA 2HE3A 4BA7A 1B48A 2VCXA 5C00A 5JCGA 1I5GA 1GSQA 4MJEA 3EVIA 1XWKA 2YV7A 4WR5A 1OKTA 3L0HA 1RQMA 5DAKB 2B7JA 3ZVJA 3F6DA 2WJUA 3US3A 2VCWA 3ME7A 1TU8A 2HI7A 2IJYA 3F9UA 3TCOA 16GSA 1ACVA 2DJ3A 2HRFA 2P5QA 2QKEA 5LCZA 4WEYA 1VRSD 2MBSA 4K0GA 1GTIA 1G0TA 3GTUB 3TJKA 2V6OA 2DJ1A 3LORA 1NM3A 1TTZA 3CMIA 3WGEA 1RK4A 5KN0A 1JLWA 5E4WA 1YY7A 5DJLA 3TKSE 1AQVA 1U6TA 5HFKA 3FZ5A 4EE0A 3HVSA 1K0NA 2FD3A 4EDYA 2DC5A 1YZXA 4HI7A 3A2WA 3QPMA 2JZRA 4P3YB 2WB9A 2B3SA 2DJ0A 5GSTA 1O8WA 2HZFA 4MK3A 4K8MA 2H1DA 6GSYA 1GUMA 2K8VA 5G5EA 1SK0A 4TXOA 2V6KA 4ZBDA 5DCGA 4Q5QA 4IVFA 3GKMA 1NHOA 1QK8A 3C1RA 1TXXA 2R37A 1CQGA 2L5OA 5IMAA 2JACA 5JWRB 1T00A 2IIYA 4OO4A 1YF1A 1THXA 4NV2A 5D93A 4IKHA 2NBSA 1Z7RA 4ZXGA 4ML6A 5DALA 3KTLA 3DGQA 1YKCA 1T4ZA 4EXJA 4AJ8A 4ILFA 4X0XA 4ZBAA 1O7UA 3IK7A 5KN1A 3GX0A 2RM5A 3VWVA 5D73A 3UOMA 4L0UA 2REMA 3RBTA 5D9VA 5B6MA 2H30A 3ZZXA 1GSUA 5ID2A 2P0GA 2JU5A 1EWXA 4MF7A 1XOAA 4EO3A 3VWXA 1AW9A 3E3EA 3Q74A 5LNKe 1TK8B 5ECSA 2R5GA 2B7KA 1M2BA 3F4SA 3UMAA 2H8LA 3RPNA 4KAEA 1EZKA 2GS3A 2XHFA 2C3QA 2YCDA 1VF2A 2L59A 3NOFA 3A2XA 3IRAA 3U6VA 3RDWA 2LJRA 3F3QA 4KDUA 1A2MA 1XPVA 1ZYQB 2WDUA 3VI5A 2TRCP 1M0UA 1S3CA 5COHA 3EU3A 1KNGA 3I6AA 1TP9A 4OWYA 4FYCA 2CT6A 3TRPA 3D5JA 2G0FA 3KJYA 4PUAA 1GLPA 2TIRA 1S3AA 5A4WA 3QFAC 1TRVA 3H4KA 3W8JA 3WD6A 10GSA 2H70A 1FVJA 1M9AA 1SU9A 1Z3EA 4HZ4A 1ZL9A 4IP1A 5JWQB 3HYPA 2H66A 4EUYA 19GSA 3F4TA 1QGVA 2C0GA 2L57A 2MMAA 3UL3A 5AISA 1YQ1A 3U5RE 1PA3A 1M9BA 1XWCA 2I3YA 2XBIA 3MNGA 2IPAA 3D22A 3UJ1A 3UIWA 3HA9A 5HQPA 3V1WA 2VD0A 3J7Yk 2DIYA 4Q5RA 1DUGA 3F63A 5ELGA 3ZMKA 1M2AA 1YEPA 4V2LA 4ISDA 4XS1A 2L4QA 1T4YA 1V57A 3A2VA 2YWIA 3RAZA 3GURA 2R2JA 1TOFA 3Q19A 1GSSA 2TRXA 2ON7A 3TOUA 2FWHA 3GKNA 5CO3A 4FYBA 3H79A 2H1AA 2WGRA 1C72A 5CRHA 4LA1A 22GSA 4MJBA 3WT1A 3ERFA 3IK9A 2KHPA 2NTOA 4KSMA 1SJIA 1OYJA 5ECRB 3BCKA 2WFCA 2IWTA 1DBYA 4HOJA 4RQXA 1RW1A 1T3BA 2H1GA 2IMEA 4ZL7A 5G30A 1EEJA 2NVLA 2N5AA 2DSAA 3ZL5A 4EL1A 1XW9A 2DIZA 1GUHA 1ILOA 4G10A 2A2RA 3J7Yb 1X0RA 1GH2A 1SJ6A 4TR0A 5FWGA 2F8FA 4XS6A 1SYRA 5DBQA 5DQSA 3GSTA 2ON5A 2QGVA 1JHBA 2E2GA 2IFQA 3HJOA 2FA4A 3D0ZA 1F9MA 1ZGNA 2OE3A 4G2EA 4PNGA 2MBTA 4DSRA 3W8SA 1A0FA 2IMKA 1DE1A 2OACA 1H75A 1T1VA 2PUKC 5J5NA 2GT5A 3G7JA 1N2AA 4NPBA 3LEFA 2C0EA 4K7IA 3EMPA 4XIHA 3HKRA 4K9ZA 1ZOFA 1JZOA 1WMJA 5J9CA 4MPFA 1K3LA 3E0UA 4Z7XA 4V1Ap 4J57E 2EC4A 2VM2A 3TOTA 2MYGA 4KUNA 4JR4A 2VL9A 4TRXA 4KH7A 2LJKA 2LRTA 2FA8A 1ZYEA 1M7TA 2L4CA 2H19A 2PU9C 4IJ3A 1SENA 2MMOA 2GQMA 3ZLPA 2F3MA 2H75A 2GSTA 2PMTA 4IHUA 2CVKA 3S9FA 5ECOB 3KH7A 4PURA 5ECKB 2H73A 5F05A 4BPYA 3LG6A 1F3AA 3CSIA 3O6TA 4KDYA 3QOUA 5DQYA 2RUFA 2I81A 2F51A 2GQLA 1XBSA 3GL3A 3VPQA 2YN1A 4V2NA 1E2YA 5E59A 1O6JA 4TR3A 1UVZA 4OCFA 4TR1B 1MD4A 1XIYA 3HHVA 5HR3A 1BAYA 2X8HA 5IMVA 3G9BA 4KGIA 2EIRA 3FR6A 4HJMA 2OADA 5IM9A 4L5OA 4F9ZA 2VLUA 4PNFA 1SYXA 1JZDA 4I5QA 5EY6A 3M8NA 2GQKA 6GSWA 2CVBA 2N5BA 4QQ7A 1FW1A 1GWCA 3MDKA 1TRWA 1TU7A 3LFLA 5A5KA 1OE8A 1EEMA 2JZSA 3TJGA 4MCUA 1Z7PA 3GV1A 4WF5A 2O7KA 3IPZA 4HQSA 1HYUA 3FZAA 3UEMA 4ACSA 4L0WA 2JSYA 5GZZB 4HJ2A 3SWLA 1YDKA 1EV4A 3HCZA 2AYTA 2YANA 2R6KA 1W4VA 1F37A 4G19A 1G6WA 3C8EA 5G2ZA 1OE7A 3ZITA 2E7PA 2E0QA 4TKYA 3C71A 2LNSA 2WULA 2YJHA 2GSSA 5H5SA 1WWJA 4GXZA 4PUFC 1J08A 1K0CA 4JBBA 3FK8A 4GCIA 2DLXA 6GSTA 1QFNA 2H6ZA 4E8HA 4KE3A 2H0HA 3TUEA 5A4UA 2VLTA 3HDCA 3LWAA 3IC4A 1U3IA 3L78A 4ZIJA 5DAKA 2C80A 3L4NA 4V1Ag 3SBCA 2LRCA 3CXGA 1AUCA 3GIXA 1TRSA 1PL2A 3LQ7A 1ML6A 3ZVJD 1EOHA 2YPMA 3QAVA 2Z9SA 4Q5FA 1WOUA 5AIVA 4EC0A 2PGTA 2FLSA 1XW6A 3GTUA 3BD2A 5B8AA 2KUCA 2H0IA 3AY8A 3KMNA 1F2EA 2B1KA 1VF1A 1G7EA 1O8XA 5F0GA 1IYHA 5JWOB 2GLRA 2BMXA 3M9JA 4WXTA 4TW5A 1XWBA 2PVQA 1TI3A 2E2MA 5ECIB 4OD7A 1K0OA 3GFKA 2XPEA 2F8AA 5D8IA 4HUAA 3LYPA 1HQOA 4TOPA 3H8QA 2C8UA 2H6XA 2LQOA 2FCHA 3Q18A 3QCPA 1HNAA 4MZBA 1T8EB 1TK5B 3EWLA 4NHZA 1WP0A 3FZ4A 3C7MA 2VL2A 2LQQA 2NDOA 5INYA 4OO5A 3BOAA 1K0AA 3UVHA 2OBKA 2LJAA 3EE2A 2WCIA 1PKWA 4HU7A 3KIJA 4OFMA 2N5FA 4D73A 3GKKA 1URMA 3R2QA 1O81A 4D73B 3Q6OA 3G7IA 1SD8A 2GT6A 2LEGA 3GHAA 2BTOT 2A4VA 5ECLB 1XCCA 3TKRA 1JFUA 1SL1B 1OKDA 4J56E 5EVOA 4MJAA 1YKAA 1KBNA 2PN8A 1Y6EA 1LBKA 1TKDB 2MMNA 1PX7A 2LRNA 3DWVA 1A8LA 1B4PA 4LMVA 3QDNA 3WGDA 1A24A 4ECIA 4KSOA 2YWOA 5KEJA 2VLVA 1TK0B 2JZTA 1O85A 1GSDA 1K3OA 4IGJA 4I2UA 4EVMA 2V41A 1I9DA 5AGYA 1EP7A 1R26A 2R3XA 2A2SA 5HR1A 4X43A 2CVDA 1SD9A 20GSA 2YZUA 3IA1A 3QFBC 3APQA 3ED3A 2GVPA 3HVVA 3FZ9A 4N10A 5CAXA 4BWSA 4MABA 4ZILA 2L6DA 9GSSA 4YQVA 2GTUA 2BJXA 2OJLA 2HZEB 1K0BA 3GNJA 3VWWA 2H71A 1X9WB 5G5FA 4MH2A 1TI1A 2VCVA 4TXVA 1SJZA 2LTKA 1Z6NA 3TKSA 4MZWA 3TDGA 2B5EA 2K8SA 4X1UA 1SKWB 3KP8A 4I97A 5JCUA 4AJ6A 4CDOA 1EGRA 4O32A 2P5RA 2ZUPA 3TKSC 1XOBA 4O5RA 4XRDA 5GAND 3F0IA 5B7CA 3CBUA 5ECNB 1O73A 1A0RP 3P2AA 2L5LA 2O85A 3HZ4A 4POLA 1K0MA 1EP8A 4F0CA 1KTEA 5KN2A 1ST9A 3NZNA 1ERUA 4F2IA 1R7HA 1M2DA 3HJPA 2MMZA 2LKUA 4MZCA 4QL9A 2PBJA 2IMFA 3MAKA 2CZ3A 4AJ7A 5G31A 4NAXA 4MDCA 4IQ1A 5AN1A 4JR6A 5IIZA 3FKFA 5J41A 3P7XA 4AGSA 5HFIA 3TJFA 5IO2A 2AJQB 4POMA 1HNBA 1XWAA 2XBQA 4KW6A 2C4JA 2LV3A 1MD3A 5CREA 3D6IA 2VIMA 3UBLA 3ZIVA 3GH9A 3F4RA 4ULXA 2ZCTA 3M3MA 5IOXA 5KN3A 1KEBA 5LD0A 1B4QA 4KDXA 4FIWA 3FEUA 3PH9A 3RHCA 3TJJA 4E8EA 4XS4A 4MH3A 4HZ2A 4ZB6A 3TRXA 3IAM2 1GSFA 1PQNA 3HVXA 4XS4B 1GSYA 5ENUA 2DMMA 4PQHA 4ML1A 14GSA 4TR4A 1DE2A 1B9XC 4EKZA 3KXOA 2YZHA 4ZL8A 1XFLA 3CSHA 4PXOA 4MLYA 13GSA 2VCTA 2OE1A 1XVWA 3IV4A 5IMZA 1V58A 1Z9HA 2HRNA 2VL3A 3TKPA 4F03A 4FYUA 4HS1A 4LMWA 4CHSA 2J23A 4PQ1A 1X5CA 1GL8A 2MZCA 1BG5A 5D9XA 1ABAA 1USBA 4O92A 2PPTA 1ON4A 1QQ2A 3GX8A 1SKSB 3TGZA 2I9HA 2IL3A 1S3DA 3GMFA 4GSTA 1Z5YE 4LL1B 4TN8A 2FNOA 3MSZA 2G2QA 3KCMA 2OE0A 2IN3A 2FUG2
chains in the Genus database with same CATH superfamily
1NHYA 1CQHA 1A23A 3FY7A 1JZWA 8GSSA 1R5PA 2C0FA 3HD5A 3L9VA 3LYKA 4POKA 2V1MA 4BVXB 4G9HA 4L8EA 1PN9A 3FRCA 1MTCA 1AIUA 5L71A 4ZB8A 4IS0A 4N11A 4GQCA 3QR6A 2V32A 3H1NA 4OMVA 5HR0A 4DSSB 3KMOA 3O76A 3QAGA 2QA1A 5IMFA 3VLNA 4NHWA 4DSQA 4TR1A 2K9FA 5IPGA 3DIEA 3L9SA 2HXKA 1WJKA 3M0FA 3BJ5A 1JLVA 4AF2A 2F9SA 3ZFBA 5EL8A 2J9HA 1VGLA 4TVEA 5GSSA 2AAWA 2JADA 1Q4JA 3FYGA 1U3AA 1UC7A 3IXRA 2JL4A 3GYKA 4G0IA 1FB6A 1GSEA 3DRNA 2O87A 5B8BA 1F6MC 3F6FA 1Z6MA 1OAZA 2VUPA 1V98A 4MNNA 2KP1A 2LSTA 4KB3A 4JZQA 3GL5A 4EDZA 4MPGA 4JEDA 5CRGA 5D96A 1WRYA 5CRWA 3GA4A 1OVNA 4GRFA 1GTBA 1BEDA 3GN3A 3IR4A 3UBKA 2LS5A 4EIQA 3ZYWA 2YV9A 2RUEA 4K1FA 2K18A 1PL1A 2FY6A 3IHQA 4WKWA 5DCHA 4NMUA 5H5QA 1R4WA 4YH2A 3F3RA 3KH9A 1W89A 2CA8A 4GWRA 5J4UA 4POBA 1XW5A 3EMXA 3D21A 3EC3A 5ECHB 5FHIA 5DVBA 3G7YA 4N30A 4LL4B 3TJBA 1M99A 1AQWA 5KOXA 2CZ2A 3KGKA 3UVTA 3A5WA 1SL2B 1TJDA 4GF0A 4RUVA 3VURA 3LSZA 5DDLA 3TRQA 4IN0A 2CV4A 2ZNMA 5B6NA 4LLRA 2RIIA 3JCML 4EF0A 1WPIA 1AAZA 4WF4A 4YQUA 4OFNA 5CRDA 2H6YA 6GSSA 2CQ9A 5GAPD 1YEXA 4GLTA 4L5LA 3VI7A 5H5RA 5FT3A 1H4OA 5D9TA 5J9BA 3HY2A 3TB2A 4CY6A 2KP2A 1UA5A 4MMMA 3E9JB 3DVWA 2CX4A 1GUKA 2C1YA 2B1LA 4RQRA 3CRUA 1GULA 2KOKA 4WR4A 1E6BA 4JRRA 1EV9A 5ELAA 2O89A 4IW9A 2GSRA 4J2FA 1V2AA 1J9BA 1SL0B 1BX9A 4DEJA 1MEKA 5IMCA 1GRXA 4KCAA 1A8YA 3HJMA 3DXBA 1Q98A 1TDIA 3A3TA 7GSSA 5CNWA 1XWGA 3GRXA 2I4AA 4OFTA 4PQIA 12GSA 2VL2C 1FOVA 5JCWA 1PMTA 2X8CA 1FOHA 18GSA 3EU4A 2IMIA 1FHEA 3LW9A 2AHEA 1OC9A 3CRTA 3QMXA 2HSHA 2GDRA 1OC9B 4HEA2 2KLXA 1BQ7A 4O7HA 4TXOB 4QL7A 1TRUA 2HT9A 3M9KA 5J3RA 1EGOA 1FAAA 2OA7A 4NWYA 1X5EA 1AXDA 4X4JA 1HNCA 5ABRA 1M3IA 4I2TA 4K7NA 1XZOA 1PGTA 2WRTA 3K8NA 2R4VA 3CQFA 3CSJA 1G6YA 1FVKA 3C1SA 3LXTA 5DALB 5HR2A 2H01A 2RM6A 2HYXA 3KZQA 2GZPA 4MJCA 2B5XA 1PX6A 2QC7A 1ERWA 1FO5A 3ZMLA 2D2ZA 2X8GA 3HXSA 3FR9A 2M80A 3FW2A 3P90A 3UARA 1X5DA 5ID2B 5IMDA 5A4VA 4K7OA 4PTSA 3I69A 3LJRA 1A2LA 4FH8A 1ERTA 2ES7A 3WGXA 1MDIA 2FWGA 3PINA 4GTUA 1GTAA 3DD3A 1V9WA 3MWHA 3WT2A 3KTBA 2OBIA 3NIVA 4KX4A 3GSSA 2EIOA 4USSA 1JZRA 3ERGA 3IAS2 2AUVA 4ZL9A 5ECMB 3OR5A 2HZEA 3RPPA 1TW9A 3APSA 2YWNA 1M3JA 1U88A 4DVCA 2VCQA 2PVOC 5IOWA 4PX1A 1BYEA 3IE3A 5AIXA 1YF0A 2XPDA 2GSQA 5IPHA 2H76A 2LUSA 2IMDA 4N0VA 3FHKA 2O8VB 3N9JA 2GZZA 2VCZA 4Z2TA 1ERVA 3VK9A 4CW9A 2I1UA 5F8BA 1MDJA 1YJ6A 4ZB9A 4HU9A 3DMLA 1GP1A 4I8BA 1A2JA 4IELA 4KA0A 1AQXA 1T7PB 2PWJA 1G7OA 2H74A 4GSSA 1IYIA 5F07A 3QAWA 2C3TA 3WYWA 3DEXA 2GZYA 5DJMA 1XVQA 2CAQA 2V2GA 2B6MA 2YWMA 4BL7A 4OCEA 4BL7B 4MF5A 3O3TA 3IBHA 2LNTA 4BVYA 2HNLA 1GNWA 2QSIA 3DKSA 4MA9A 3ERWA 4FO5A 2C3NA 3VWUA 3VFIA 3ZREA 2L6CA 4WBJA 3P8WA 2PERA 5D9WA 3F8UA 2VD1A 4Q5NA 1J0FA 1GLQA 2FWEA 2H1BA 1F3BA 4GQFA 3EYTA 3IDVA 2FGXA 3BCIA 1ZCPA 4K6XA 2AV4A 1LU4A 3I43A 1PD21 3N5OA 2DBCA 2GGTA 1DSBA 3QD9A 2M72A 4I6XA 1MDKA 2FHEA 2HFDA 2C0DA 1OC8A 1NW2A 4JE1A 5BMUA 3KD0A 3KEBA 1WE0A 4GSNA 4KNDA 1ZZYA 2CX3A 4PGTA 1XXUA 1VF3A 4XHMA 2P31A 3HZ8A 1FB0A 3L9UA 5CYYA 2YJ7A 4KCEA 1OC3A 4MP4A 3D4MA 1ZMAA 4G0KA 2ALBA 4YQMA 2IFQB 2YNXA 3BBYA 2X49A 3EURA 1UN2A 4H86A 3APOA 1GTUA 3C73A 4WETA 4YAVA 4BWQA 17GSA 2X99A 5G1KA 3MIXA 3ZFLA 4ECJA 2VOCA 2M46A 6GSUA 1QXHA 1VF4A 2FWFA 1PFOA 1PKZA 3ISOA 2DMLA 3UAPA 4BVXA 1HD2A 4F82A 2DJKA 2A2PA 5F06A 3VPTA 5C04A 2H0GA 5G1LA 3FR3A 3ZTLA 4RI7A 3ZRDA 3ZIJA 4DSSA 2CAIA 3EINA 6GSVA 1WIKA 1GNEA 1AC1A 3IOSA 3M1GA 4MF6A 2X64A 2VM1A 3LGCA 4JU5A 2HLSA 4IBPA 4YAPA 1B9YC 3TKQA 4HSCX 2DJ2A 1LJRA 1N8JA 2RLIA 1QMVA 2YP6A 4N0ZA 4K2DA 2EIQA 2JSZA 3GKXA 4XRAA 1QUWA 1SK1A 3W6GA 1K3YA 3CTGA 4NV5A 4NXIA 1EOGA 3GH6A 1K0DA 4ID0A 4EIPA 1B8XA 4ECBA 3DVXA 4WBRD 5IO0A 5ECPB 2WS2A 4IQAA 5CP1A 3CTFA 5HFGA 2DKIA 1PSQA 1NSWA 1PN0A 1Y25A 2K6VA 3ME8A 5EPFA 3KP9A 2H72A 1U87A 3D4TA 1PRXA 3PR8A 4IP6A 2HSYA 3PGTA 1FG4A 3RHBA 4XTSA 1R5AA 2YOIA 2XC2A 2A4HA 4V2MA 3DYRA 4F0BA 2OKAA 2DJJA 1SK2A 3EPTA 1V40A 4K0NA 3CYNA 4HDEA 4XCSA 1X9SB 2VO4A 2AB6A 4ICYA 5ECQB 3GUSA 3I9V2 4IJIA 1THOA 3KM6A 2WZ9A 6GSXA 1X9MB 1SKRB 2B5YA 2NPBA 4HQZA 2VAFA 4RI6A 1BJXA 3H93A 5IQYA 3LXZA 11GSA 4ECCA 4ZBBA 2HE3A 4BA7A 1B48A 2VCXA 5C00A 5JCGA 1I5GA 1GSQA 4MJEA 3EVIA 1XWKA 2YV7A 4WR5A 1OKTA 3L0HA 1RQMA 5DAKB 2B7JA 3ZVJA 3F6DA 2WJUA 3US3A 2VCWA 3ME7A 1TU8A 2HI7A 2IJYA 3F9UA 3TCOA 16GSA 1ACVA 1ZYPA 2DJ3A 2HRFA 2P5QA 2QKEA 5LCZA 4WEYA 1VRSD 2MBSA 4K0GA 1GTIA 1G0TA 3GTUB 3TJKA 2V6OA 2DJ1A 3LORA 1NM3A 1TTZA 3CMIA 3WGEA 1RK4A 5KN0A 1JLWA 3IHGA 5E4WA 1YY7A 5DJLA 3TKSE 1AQVA 1U6TA 3HVNA 5HFKA 3FZ5A 4EE0A 3HVSA 1K0NA 2FD3A 4EDYA 2DC5A 1YZXA 4HI7A 3R3EA 3A2WA 3QPMA 2JZRA 4P3YB 2WB9A 2B3SA 2DJ0A 5GSTA 1O8WA 2HZFA 4MK3A 4K8MA 2H1DA 6GSYA 1GUMA 2K8VA 5G5EA 1SK0A 4TXOA 2V6KA 4ZBDA 5DCGA 4Q5QA 4IVFA 3GKMA 1NHOA 1QK8A 3C1RA 1TXXA 2R37A 1CQGA 2L5OA 5IMAA 2JACA 5JWRB 1T00A 2IIYA 4OO4A 1YF1A 1THXA 4NV2A 5D93A 4IKHA 2NBSA 1Z7RA 4ZXGA 4ML6A 5DALA 3KTLA 3DGQA 1YKCA 1T4ZA 4EXJA 4AJ8A 4ILFA 4CY8A 4X0XA 4ZBAA 1O7UA 3IK7A 5KN1A 3GX0A 2RM5A 3VWVA 5D73A 3UOMA 4L0UA 2REMA 3RBTA 5D9VA 5B6MA 2H30A 3ZZXA 1GSUA 5ID2A 2P0GA 2JU5A 1EWXA 4MF7A 1XOAA 4EO3A 3VWXA 1AW9A 3E3EA 3Q74A 5LNKe 1TK8B 5ECSA 2R5GA 3IC8A 2B7KA 1M2BA 3F4SA 3UMAA 2H8LA 3RPNA 4KAEA 1EZKA 2GS3A 3PPUA 2XHFA 2C3QA 2YCDA 1VF2A 2L59A 3NOFA 3A2XA 3IRAA 3U6VA 3RDWA 2LJRA 3F3QA 4KDUA 1A2MA 1XPVA 1ZYQB 2WDUA 3VI5A 2TRCP 4O5UA 1M0UA 1S3CA 5COHA 3EU3A 1KNGA 3I6AA 1TP9A 4OWYA 4FYCA 2CT6A 3TRPA 3D5JA 4FQUA 2G0FA 3KJYA 4PUAA 1GLPA 2TIRA 1S3AA 5A4WA 3QFAC 1TRVA 3H4KA 3W8JA 3WD6A 10GSA 2H70A 1FVJA 1M9AA 1SU9A 1Z3EA 4HZ4A 1ZL9A 4IP1A 5JWQB 3HYPA 2H66A 4EUYA 19GSA 3F4TA 1QGVA 2C0GA 2L57A 2MMAA 3UL3A 5AISA 1YQ1A 3U5RE 4G0LA 1PA3A 1M9BA 1XWCA 2I3YA 2XBIA 3MNGA 2IPAA 3D22A 3UJ1A 3UIWA 3HA9A 5HQPA 3V1WA 2VD0A 3J7Yk 2DIYA 4Q5RA 1DUGA 3F63A 5ELGA 2R0CA 3ZMKA 1M2AA 1YEPA 4V2LA 4ISDA 4XS1A 2L4QA 1T4YA 1V57A 3A2VA 2YWIA 3RAZA 3GURA 2R2JA 1TOFA 3Q19A 1GSSA 2TRXA 4YKGA 2ON7A 3TOUA 2FWHA 3GKNA 5CO3A 4FYBA 3H79A 2H1AA 2WGRA 1C72A 5CRHA 4LA1A 22GSA 4MJBA 3WT1A 3ERFA 3IK9A 2KHPA 2NTOA 4KSMA 1SJIA 1OYJA 5ECRB 3BCKA 2WFCA 2IWTA 1DBYA 4HOJA 4RQXA 1RW1A 1T3BA 2H1GA 2IMEA 4ZL7A 5G30A 1EEJA 2NVLA 2N5AA 2DSAA 3ZL5A 4EL1A 1XW9A 2DIZA 1GUHA 1ILOA 4G10A 2A2RA 3J7Yb 1X0RA 1GH2A 1SJ6A 4TR0A 5FWGA 2F8FA 4XS6A 1SYRA 5DBQA 5DQSA 3GSTA 2ON5A 2QGVA 1JHBA 2E2GA 2IFQA 3HJOA 2FA4A 3D0ZA 1F9MA 1ZGNA 2X4AA 3A5IA 2OE3A 4G2EA 4PNGA 2MBTA 4DSRA 3W8SA 1A0FA 2IMKA 1DE1A 2OACA 1H75A 1T1VA 2PUKC 5J5NA 2GT5A 3G7JA 1N2AA 2QA2A 4NPBA 3LEFA 2C0EA 4K7IA 3EMPA 4XIHA 3HKRA 4K9ZA 1ZOFA 1JZOA 1WMJA 5J9CA 4MPFA 1K3LA 3E0UA 4Z7XA 4V1Ap 4J57E 2EC4A 2VM2A 3TOTA 2MYGA 4KUNA 4JR4A 2VL9A 4TRXA 4KH7A 2LJKA 2LRTA 2FA8A 1ZYEA 1M7TA 2L4CA 2H19A 2PU9C 4IJ3A 1SENA 2MMOA 4YKFA 2GQMA 3ZLPA 2F3MA 2H75A 4Z2RA 2GSTA 2PMTA 4IHUA 2CVKA 3S9FA 5ECOB 3KH7A 4PURA 5ECKB 2H73A 5F05A 4BPYA 3LG6A 1F3AA 3CSIA 3O6TA 4KDYA 3QOUA 5DQYA 2RUFA 2I81A 2F51A 2GQLA 1XBSA 3GL3A 3VPQA 2YN1A 4V2NA 1E2YA 5E59A 1O6JA 4TR3A 1UVZA 4OCFA 4TR1B 1MD4A 1XIYA 3HHVA 5HR3A 1BAYA 2X8HA 5IMVA 3G9BA 4KGIA 2EIRA 3FR6A 4K5RA 4HJMA 2OADA 5IM9A 4L5OA 4F9ZA 2VLUA 4PNFA 1SYXA 1JZDA 4I5QA 5EY6A 3M8NA 1XG8A 2GQKA 6GSWA 2CVBA 2N5BA 4QQ7A 1FW1A 1GWCA 3MDKA 1TRWA 1TU7A 3LFLA 5A5KA 1OE8A 1EEMA 2JZSA 3TJGA 4MCUA 1Z7PA 3GV1A 4WF5A 4K5SA 4O5QA 2O7KA 3IPZA 4HQSA 1HYUA 3FZAA 3UEMA 4ACSA 4L0WA 2JSYA 5GZZB 4HJ2A 3SWLA 1YDKA 1EV4A 3HCZA 2AYTA 2YANA 2R6KA 1W4VA 1F37A 4G19A 1G6WA 3C8EA 5G2ZA 1OE7A 3ZITA 2E7PA 2E0QA 4TKYA 3C71A 2LNSA 2WULA 2YJHA 2GSSA 5H5SA 1WWJA 4GXZA 4PUFC 1J08A 1K0CA 4JBBA 3FK8A 4GCIA 2DLXA 6GSTA 1QFNA 2H6ZA 4E8HA 1ZYNA 4KE3A 2H0HA 3TUEA 5A4UA 2VLTA 3HDCA 3LWAA 3FMWA 3IC4A 1U3IA 3L78A 4ZIJA 5DAKA 2C80A 3L4NA 4V1Ag 3SBCA 2HRKA 2LRCA 3CXGA 1AUCA 2DKHA 3GIXA 1TRSA 1PL2A 3LQ7A 1ML6A 3ZVJD 1EOHA 2YPMA 3QAVA 2Z9SA 4Q5FA 1WOUA 5AIVA 4EC0A 2PGTA 2FLSA 1XW6A 3GTUA 3BD2A 5B8AA 2KUCA 2H0IA 3AY8A 3KMNA 1F2EA 2B1KA 1VF1A 1G7EA 1O8XA 5F0GA 1IYHA 5JWOB 2GLRA 2BMXA 3M9JA 4WXTA 4TW5A 1XWBA 2PVQA 1TI3A 4A5PA 2E2MA 5ECIB 4OD7A 1K0OA 3GFKA 2XPEA 2F8AA 5D8IA 4HUAA 3LYPA 1HQOA 4TOPA 3H8QA 2C8UA 2H6XA 2LQOA 2FCHA 3Q18A 3QCPA 1HNAA 3MYDA 4MZBA 1T8EB 1TK5B 3EWLA 4NHZA 1WP0A 3FZ4A 3C7MA 2VL2A 2LQQA 2NDOA 5INYA 4OO5A 3BOAA 1K0AA 3UVHA 2OBKA 2HRAA 2LJAA 3EE2A 2WCIA 1PKWA 4HU7A 3KIJA 4OFMA 2N5FA 4D73A 3GKKA 1URMA 3R2QA 1O81A 4D73B 3Q6OA 3G7IA 1SD8A 2GT6A 2LEGA 3GHAA 2BTOT 2A4VA 5ECLB 1XCCA 3TKRA 1JFUA 1SL1B 1OKDA 5BRTA 4J56E 5EVOA 4MJAA 1YKAA 1KBNA 2PN8A 1Y6EA 2R0GA 1LBKA 1TKDB 2MMNA 1PX7A 2LRNA 3DWVA 1A8LA 1B4PA 4LMVA 3QDNA 3WGDA 1A24A 4ECIA 4KSOA 2YWOA 5KEJA 2VLVA 1TK0B 2JZTA 1O85A 1GSDA 1K3OA 4IGJA 4I2UA 4EVMA 2V41A 1I9DA 5AGYA 1EP7A 1R26A 2R3XA 1S3RA 2A2SA 5HR1A 4X43A 2CVDA 1SD9A 20GSA 2YZUA 3IA1A 3QFBC 3APQA 4BIKA 3ED3A 2GVPA 3HVVA 2UZ8A 3FZ9A 4N10A 5CAXA 4BWSA 4MABA 4ZILA 2L6DA 9GSSA 4YQVA 2GTUA 2BJXA 2OJLA 2HZEB 1K0BA 3GNJA 3VWWA 2H71A 1X9WB 5G5FA 4MH2A 1TI1A 4K2XA 2VCVA 4TXVA 1SJZA 2LTKA 1Z6NA 3TKSA 4MZWA 3TDGA 2B5EA 2K8SA 4X1UA 1SKWB 3KP8A 4I97A 5JCUA 4AJ6A 4CDOA 1EGRA 4O32A 2P5RA 2ZUPA 3TKSC 1XOBA 4O5RA 4XRDA 5GAND 3F0IA 5B7CA 3CBUA 5ECNB 1O73A 1A0RP 3P2AA 2L5LA 2O85A 3HZ4A 4POLA 1K0MA 1EP8A 4F0CA 1KTEA 5KN2A 1ST9A 3NZNA 2R0PA 1ERUA 4F2IA 1R7HA 1M2DA 3HJPA 2MMZA 2LKUA 4MZCA 4QL9A 2PBJA 2IMFA 3MAKA 2CZ3A 4AJ7A 5G31A 4NAXA 4MDCA 4IQ1A 5AN1A 4JR6A 5IIZA 3FKFA 5J41A 3P7XA 4AGSA 5HFIA 3TJFA 5IO2A 2AJQB 4POMA 1HNBA 1XWAA 2XBQA 4KW6A 4BVYB 2C4JA 2LV3A 1MD3A 5CREA 3D6IA 2VIMA 3UBLA 2HSMA 3ZIVA 3GH9A 3F4RA 4ULXA 2ZCTA 3M3MA 5IOXA 5KN3A 1KEBA 5LD0A 1B4QA 4KDXA 4FIWA 4Z2UA 3FEUA 3PH9A 3RHCA 4KF9A 3TJJA 4E8EA 4XS4A 4MH3A 4HZ2A 4ZB6A 3TRXA 3IAM2 1GSFA 1PQNA 3HVXA 4XS4B 1GSYA 5ENUA 2DMMA 4PQHA 4ML1A 5KOWA 14GSA 4TR4A 1DE2A 1B9XC 4EKZA 3KXOA 2YZHA 4ZL8A 1XFLA 3CSHA 4PXOA 4MLYA 13GSA 2VCTA 2OE1A 1XVWA 3IV4A 5IMZA 1V58A 1Z9HA 2HRNA 2VL3A 3TKPA 4F03A 4FYUA 4HS1A 4LMWA 4CHSA 2J23A 4PQ1A 1X5CA 1GL8A 2MZCA 1BG5A 5D9XA 1ABAA 1USBA 4O92A 2PPTA 1ON4A 1QQ2A 3GX8A 1SKSB 3TGZA 2I9HA 2IL3A 1S3DA 3GMFA 4GSTA 1Z5YE 4LL1B 4TN8A 2FNOA 3MSZA 2G2QA 3KCMA 2OE0A 2IN3A 2FUG2
chains in the Genus database with same CATH topology
1NHYA 1CQHA 1A23A 3FY7A 1JZWA 8GSSA 1R5PA 2C0FA 3HD5A 3L9VA 3LYKA 4POKA 2V1MA 4BVXB 4G9HA 4L8EA 1PN9A 3FRCA 1MTCA 1AIUA 5L71A 4ZB8A 4IS0A 4N11A 4GQCA 3QR6A 2V32A 3H1NA 4OMVA 5HR0A 4DSSB 3KMOA 3O76A 3QAGA 2QA1A 5IMFA 3VLNA 4NHWA 4DSQA 4TR1A 2K9FA 5IPGA 3DIEA 3L9SA 2HXKA 1WJKA 3M0FA 3BJ5A 1JLVA 4AF2A 2F9SA 3ZFBA 5EL8A 2J9HA 1VGLA 4TVEA 5GSSA 2AAWA 2JADA 1Q4JA 3FYGA 1U3AA 1UC7A 3IXRA 2JL4A 3GYKA 4G0IA 1FB6A 1GSEA 3DRNA 2O87A 5B8BA 1F6MC 3F6FA 1Z6MA 1OAZA 2VUPA 1V98A 4MNNA 2KP1A 2LSTA 4KB3A 4JZQA 3GL5A 4EDZA 4MPGA 4JEDA 5CRGA 5D96A 1WRYA 5CRWA 3GA4A 1OVNA 4GRFA 1GTBA 1BEDA 3GN3A 3IR4A 3UBKA 2LS5A 4EIQA 3ZYWA 2YV9A 2RUEA 4K1FA 2K18A 1PL1A 2FY6A 3IHQA 4WKWA 5DCHA 4NMUA 5H5QA 1R4WA 4YH2A 3F3RA 3KH9A 1W89A 2CA8A 4GWRA 5J4UA 4POBA 1XW5A 3EMXA 3D21A 3EC3A 5ECHB 5FHIA 5DVBA 3G7YA 4N30A 4LL4B 3TJBA 1M99A 1AQWA 5KOXA 2CZ2A 3KGKA 3UVTA 3A5WA 1SL2B 1TJDA 4GF0A 4RUVA 3VURA 3LSZA 5DDLA 3TRQA 4IN0A 2CV4A 2ZNMA 5B6NA 4LLRA 2RIIA 3JCML 4EF0A 1WPIA 1AAZA 4WF4A 4YQUA 4OFNA 5CRDA 2H6YA 6GSSA 2CQ9A 5GAPD 1YEXA 4GLTA 4L5LA 3VI7A 5H5RA 5FT3A 1H4OA 5D9TA 5J9BA 3HY2A 3TB2A 4CY6A 2KP2A 1UA5A 4MMMA 3E9JB 3DVWA 2CX4A 1GUKA 2C1YA 2B1LA 4RQRA 3CRUA 1GULA 2KOKA 4WR4A 1E6BA 4JRRA 1EV9A 5ELAA 2O89A 4IW9A 2GSRA 4J2FA 1V2AA 1J9BA 1SL0B 1BX9A 4DEJA 1MEKA 5IMCA 1GRXA 4KCAA 1A8YA 3HJMA 3DXBA 1Q98A 1TDIA 3A3TA 7GSSA 5CNWA 1XWGA 3GRXA 2I4AA 4OFTA 4PQIA 12GSA 2VL2C 1FOVA 5JCWA 1PMTA 2X8CA 1FOHA 18GSA 3EU4A 2IMIA 1FHEA 3LW9A 2AHEA 1OC9A 3CRTA 3QMXA 2HSHA 2GDRA 1OC9B 4HEA2 2KLXA 1BQ7A 4O7HA 4TXOB 4QL7A 1TRUA 2HT9A 3M9KA 5J3RA 1EGOA 1FAAA 2OA7A 4NWYA 1X5EA 1AXDA 4X4JA 1HNCA 5ABRA 4I2TA 4K7NA 1XZOA 1PGTA 2WRTA 3K8NA 2R4VA 3CSJA 1G6YA 1FVKA 3C1SA 3LXTA 5DALB 5HR2A 2H01A 2RM6A 2HYXA 3KZQA 2GZPA 4MJCA 2B5XA 1PX6A 2QC7A 1ERWA 1FO5A 3ZMLA 2D2ZA 2X8GA 3HXSA 3FR9A 2M80A 3FW2A 3P90A 3UARA 1X5DA 5ID2B 5IMDA 5A4VA 4K7OA 4PTSA 3I69A 3LJRA 1A2LA 4FH8A 1ERTA 2ES7A 3WGXA 1MDIA 2FWGA 3PINA 4GTUA 1GTAA 3DD3A 1V9WA 3MWHA 3WT2A 3KTBA 2OBIA 3NIVA 4KX4A 3GSSA 2EIOA 4USSA 1JZRA 3ERGA 3IAS2 2AUVA 4ZL9A 5ECMB 3OR5A 2HZEA 3RPPA 1TW9A 3APSA 2YWNA 1U88A 4DVCA 2VCQA 2PVOC 5IOWA 4PX1A 1BYEA 3IE3A 5AIXA 1YF0A 2XPDA 2GSQA 5IPHA 2H76A 2LUSA 2IMDA 4N0VA 3FHKA 2O8VB 3N9JA 2GZZA 2VCZA 4Z2TA 1ERVA 3VK9A 4CW9A 2I1UA 5F8BA 1MDJA 1YJ6A 4ZB9A 4HU9A 3DMLA 1GP1A 4I8BA 1A2JA 4IELA 4KA0A 1AQXA 1T7PB 2PWJA 1G7OA 2H74A 4GSSA 1IYIA 5F07A 3QAWA 2C3TA 3WYWA 3DEXA 2GZYA 5DJMA 1XVQA 2CAQA 2V2GA 2B6MA 2YWMA 4BL7A 4OCEA 4BL7B 4MF5A 3O3TA 3IBHA 2LNTA 4BVYA 2HNLA 1GNWA 2QSIA 3DKSA 4MA9A 3ERWA 4FO5A 2C3NA 3VWUA 3VFIA 3ZREA 2L6CA 4WBJA 3P8WA 2PERA 5D9WA 3F8UA 2VD1A 4Q5NA 1J0FA 1GLQA 2FWEA 2H1BA 1F3BA 4GQFA 3EYTA 3IDVA 2FGXA 3BCIA 1ZCPA 4K6XA 2AV4A 1LU4A 3I43A 1PD21 3N5OA 2DBCA 2GGTA 1DSBA 3QD9A 2M72A 4I6XA 1MDKA 2FHEA 2HFDA 2C0DA 1OC8A 1NW2A 4JE1A 5BMUA 3KD0A 3KEBA 1WE0A 4GSNA 4KNDA 1ZZYA 2CX3A 4PGTA 1XXUA 1VF3A 4XHMA 2P31A 3HZ8A 1FB0A 3L9UA 5CYYA 2YJ7A 4KCEA 1OC3A 4MP4A 3D4MA 1ZMAA 4G0KA 2ALBA 4YQMA 2IFQB 2YNXA 3BBYA 2X49A 3EURA 1UN2A 4H86A 3APOA 1GTUA 3C73A 4WETA 4YAVA 4BWQA 17GSA 2X99A 5G1KA 3MIXA 3ZFLA 4ECJA 2VOCA 2M46A 6GSUA 1QXHA 1VF4A 2FWFA 1PKZA 3ISOA 2DMLA 3UAPA 4BVXA 1HD2A 4F82A 2DJKA 2A2PA 5F06A 3VPTA 5C04A 2H0GA 5G1LA 3FR3A 3ZTLA 4RI7A 3ZRDA 3ZIJA 4DSSA 2CAIA 3EINA 6GSVA 1WIKA 1GNEA 1AC1A 3IOSA 3M1GA 4MF6A 2X64A 2VM1A 3LGCA 4JU5A 2HLSA 4IBPA 4YAPA 1B9YC 3TKQA 2DJ2A 1LJRA 1N8JA 2RLIA 1QMVA 2YP6A 4N0ZA 4K2DA 2EIQA 2JSZA 3GKXA 4XRAA 1QUWA 1SK1A 3W6GA 1K3YA 3CTGA 4NV5A 4NXIA 1EOGA 3GH6A 1K0DA 4ID0A 4EIPA 1B8XA 4ECBA 3DVXA 4WBRD 5IO0A 5ECPB 2WS2A 4IQAA 5CP1A 3CTFA 5HFGA 2DKIA 1PSQA 1NSWA 1PN0A 1Y25A 2K6VA 3ME8A 5EPFA 3KP9A 2H72A 1U87A 3D4TA 1PRXA 3PR8A 4IP6A 2HSYA 3PGTA 1FG4A 3RHBA 4XTSA 1R5AA 2YOIA 2XC2A 2A4HA 4V2MA 3DYRA 4F0BA 2OKAA 2DJJA 1SK2A 3EPTA 1V40A 4K0NA 3CYNA 4HDEA 4XCSA 1X9SB 2VO4A 2AB6A 4ICYA 5ECQB 3GUSA 3I9V2 4IJIA 1THOA 3KM6A 2WZ9A 6GSXA 1X9MB 1SKRB 2B5YA 2NPBA 4HQZA 2VAFA 4RI6A 1BJXA 3H93A 5IQYA 3LXZA 11GSA 4ECCA 4ZBBA 2HE3A 4BA7A 1B48A 2VCXA 5C00A 5JCGA 1I5GA 1GSQA 4MJEA 3EVIA 1XWKA 2YV7A 4WR5A 1OKTA 3L0HA 1RQMA 5DAKB 2B7JA 3ZVJA 3F6DA 2WJUA 3US3A 2VCWA 3ME7A 1TU8A 2HI7A 2IJYA 3F9UA 3TCOA 16GSA 1ACVA 1ZYPA 2DJ3A 2HRFA 2P5QA 2QKEA 5LCZA 4WEYA 1VRSD 2MBSA 4K0GA 1GTIA 1G0TA 3GTUB 3TJKA 2V6OA 2DJ1A 3LORA 1NM3A 1TTZA 3CMIA 3WGEA 1RK4A 5KN0A 1JLWA 3IHGA 5E4WA 1YY7A 5DJLA 3TKSE 1AQVA 1U6TA 5HFKA 3FZ5A 4EE0A 3HVSA 1K0NA 2FD3A 4EDYA 2DC5A 1YZXA 4HI7A 3R3EA 3A2WA 3QPMA 2JZRA 4P3YB 2WB9A 2B3SA 2DJ0A 5GSTA 1O8WA 2HZFA 4MK3A 4K8MA 2H1DA 6GSYA 1GUMA 2K8VA 5G5EA 1SK0A 4TXOA 2V6KA 4ZBDA 5DCGA 4Q5QA 4IVFA 3GKMA 1NHOA 1QK8A 3C1RA 1TXXA 2R37A 1CQGA 2L5OA 5IMAA 2JACA 5JWRB 1T00A 2IIYA 4OO4A 1YF1A 1THXA 4NV2A 5D93A 4IKHA 2NBSA 1Z7RA 4ZXGA 4ML6A 5DALA 3KTLA 3DGQA 1YKCA 1T4ZA 4EXJA 4AJ8A 4ILFA 4CY8A 4X0XA 4ZBAA 1O7UA 3IK7A 5KN1A 3GX0A 2RM5A 3VWVA 5D73A 3UOMA 4L0UA 2REMA 3RBTA 5D9VA 5B6MA 2H30A 3ZZXA 1GSUA 5ID2A 2P0GA 2JU5A 1EWXA 4MF7A 1XOAA 4EO3A 3VWXA 1AW9A 3E3EA 3Q74A 5LNKe 1TK8B 5ECSA 2R5GA 3IC8A 2B7KA 1M2BA 3F4SA 3UMAA 2H8LA 3RPNA 4KAEA 1EZKA 2GS3A 3PPUA 2XHFA 2C3QA 2YCDA 1VF2A 2L59A 3NOFA 3A2XA 3IRAA 3U6VA 3RDWA 2LJRA 3F3QA 4KDUA 1A2MA 1XPVA 1ZYQB 2WDUA 3VI5A 2TRCP 4O5UA 1M0UA 1S3CA 5COHA 3EU3A 1KNGA 3I6AA 1TP9A 4OWYA 4FYCA 2CT6A 3TRPA 3D5JA 4FQUA 2G0FA 3KJYA 4PUAA 1GLPA 2TIRA 1S3AA 5A4WA 3QFAC 1TRVA 3H4KA 3W8JA 3WD6A 10GSA 2H70A 1FVJA 1M9AA 1SU9A 1Z3EA 4HZ4A 1ZL9A 4IP1A 5JWQB 3HYPA 2H66A 4EUYA 19GSA 3F4TA 1QGVA 2C0GA 2L57A 2MMAA 3UL3A 5AISA 1YQ1A 3U5RE 4G0LA 1PA3A 1M9BA 1XWCA 2I3YA 2XBIA 3MNGA 2IPAA 3D22A 3UJ1A 3UIWA 3HA9A 5HQPA 3V1WA 2VD0A 3J7Yk 2DIYA 4Q5RA 1DUGA 3F63A 5ELGA 2R0CA 3ZMKA 1M2AA 1YEPA 4V2LA 4ISDA 4XS1A 2L4QA 1T4YA 1V57A 3A2VA 2YWIA 3RAZA 3GURA 2R2JA 1TOFA 3Q19A 1GSSA 2TRXA 4YKGA 2ON7A 3TOUA 2FWHA 3GKNA 5CO3A 4FYBA 3H79A 2H1AA 2WGRA 1C72A 5CRHA 4LA1A 22GSA 4MJBA 3WT1A 3ERFA 3IK9A 2KHPA 2NTOA 4KSMA 1SJIA 1OYJA 5ECRB 3BCKA 2WFCA 2IWTA 1DBYA 4HOJA 4RQXA 1RW1A 1T3BA 2H1GA 2IMEA 4ZL7A 5G30A 1EEJA 2NVLA 2N5AA 2DSAA 3ZL5A 4EL1A 1XW9A 2DIZA 1GUHA 1ILOA 4G10A 2A2RA 3J7Yb 1X0RA 1GH2A 1SJ6A 4TR0A 5FWGA 2F8FA 4XS6A 1SYRA 5DBQA 5DQSA 3GSTA 2ON5A 2QGVA 1JHBA 2E2GA 2IFQA 3HJOA 2FA4A 3D0ZA 1F9MA 1ZGNA 2X4AA 3A5IA 2OE3A 4G2EA 4PNGA 2MBTA 4DSRA 3W8SA 1A0FA 2IMKA 1DE1A 2OACA 1H75A 1T1VA 2PUKC 5J5NA 2GT5A 3G7JA 1N2AA 2QA2A 4NPBA 3LEFA 2C0EA 4K7IA 3EMPA 4XIHA 3HKRA 4K9ZA 1ZOFA 1JZOA 1WMJA 5J9CA 4MPFA 1K3LA 3E0UA 4Z7XA 4V1Ap 4J57E 2EC4A 2VM2A 3TOTA 2MYGA 4KUNA 4JR4A 2VL9A 4TRXA 4KH7A 2LJKA 2LRTA 2FA8A 1ZYEA 1M7TA 2L4CA 2H19A 2PU9C 4IJ3A 1SENA 2MMOA 4YKFA 2GQMA 3ZLPA 2F3MA 2H75A 4Z2RA 2GSTA 2PMTA 4IHUA 2CVKA 3S9FA 5ECOB 3KH7A 4PURA 5ECKB 2H73A 5F05A 4BPYA 3LG6A 1F3AA 3CSIA 3O6TA 4KDYA 3QOUA 5DQYA 2RUFA 2I81A 2F51A 2GQLA 1XBSA 3GL3A 3VPQA 2YN1A 4V2NA 1E2YA 5E59A 1O6JA 4TR3A 1UVZA 4OCFA 4TR1B 1MD4A 1XIYA 3HHVA 5HR3A 1BAYA 2X8HA 5IMVA 3G9BA 4KGIA 2EIRA 3FR6A 4K5RA 4HJMA 2OADA 5IM9A 4L5OA 4F9ZA 2VLUA 4PNFA 1SYXA 1JZDA 4I5QA 5EY6A 3M8NA 2GQKA 6GSWA 2CVBA 2N5BA 4QQ7A 1FW1A 1GWCA 3MDKA 1TRWA 1TU7A 3LFLA 5A5KA 1OE8A 1EEMA 2JZSA 3TJGA 4MCUA 1Z7PA 3GV1A 4WF5A 4K5SA 4O5QA 2O7KA 3IPZA 4HQSA 1HYUA 3FZAA 3UEMA 4ACSA 4L0WA 2JSYA 5GZZB 4HJ2A 3SWLA 1YDKA 1EV4A 3HCZA 2AYTA 2YANA 2R6KA 1W4VA 1F37A 4G19A 1G6WA 3C8EA 5G2ZA 1OE7A 3ZITA 2E7PA 2E0QA 4TKYA 3C71A 2LNSA 2WULA 2YJHA 2GSSA 5H5SA 1WWJA 4GXZA 4PUFC 1J08A 1K0CA 4JBBA 3FK8A 4GCIA 2DLXA 6GSTA 1QFNA 2H6ZA 4E8HA 1ZYNA 4KE3A 2H0HA 3TUEA 5A4UA 2VLTA 3HDCA 3LWAA 3FMWA 3IC4A 1U3IA 3L78A 4ZIJA 5DAKA 2C80A 3L4NA 4V1Ag 3SBCA 2HRKA 2LRCA 3CXGA 1AUCA 2DKHA 3GIXA 1TRSA 1PL2A 3LQ7A 1ML6A 3ZVJD 1EOHA 2YPMA 3QAVA 2Z9SA 4Q5FA 1WOUA 5AIVA 4EC0A 2PGTA 2FLSA 1XW6A 3GTUA 3BD2A 5B8AA 2KUCA 2H0IA 3AY8A 3KMNA 1F2EA 2B1KA 1VF1A 1G7EA 1O8XA 5F0GA 1IYHA 5JWOB 2GLRA 2BMXA 3M9JA 4WXTA 4TW5A 1XWBA 2PVQA 1TI3A 4A5PA 2E2MA 5ECIB 4OD7A 1K0OA 3GFKA 2XPEA 2F8AA 5D8IA 4HUAA 3LYPA 1HQOA 4TOPA 3H8QA 2C8UA 2H6XA 2LQOA 2FCHA 3Q18A 3QCPA 1HNAA 3MYDA 4MZBA 1T8EB 1TK5B 3EWLA 4NHZA 1WP0A 3FZ4A 3C7MA 2VL2A 2LQQA 2NDOA 5INYA 4OO5A 3BOAA 1K0AA 3UVHA 2OBKA 2HRAA 2LJAA 3EE2A 2WCIA 1PKWA 4HU7A 3KIJA 4OFMA 2N5FA 4D73A 3GKKA 1URMA 3R2QA 1O81A 4D73B 3Q6OA 3G7IA 1SD8A 2GT6A 2LEGA 3GHAA 2BTOT 2A4VA 5ECLB 1XCCA 3TKRA 1JFUA 1SL1B 1OKDA 5BRTA 4J56E 5EVOA 4MJAA 1YKAA 1KBNA 2PN8A 1Y6EA 2R0GA 1LBKA 1TKDB 2MMNA 1PX7A 2LRNA 3DWVA 1A8LA 1B4PA 4LMVA 3QDNA 3WGDA 1A24A 4ECIA 4KSOA 2YWOA 5KEJA 2VLVA 1TK0B 2JZTA 1O85A 1GSDA 1K3OA 4IGJA 4I2UA 4EVMA 2V41A 1I9DA 5AGYA 1EP7A 1R26A 2R3XA 2A2SA 5HR1A 4X43A 2CVDA 1SD9A 20GSA 2YZUA 3IA1A 3QFBC 3APQA 3ED3A 2GVPA 3HVVA 2UZ8A 3FZ9A 4N10A 5CAXA 4BWSA 4MABA 4ZILA 2L6DA 9GSSA 4YQVA 2GTUA 2BJXA 2OJLA 2HZEB 1K0BA 3GNJA 3VWWA 2H71A 1X9WB 5G5FA 4MH2A 1TI1A 4K2XA 2VCVA 4TXVA 1SJZA 2LTKA 1Z6NA 3TKSA 4MZWA 3TDGA 2B5EA 2K8SA 4X1UA 1SKWB 3KP8A 4I97A 5JCUA 4AJ6A 4CDOA 1EGRA 4O32A 2P5RA 2ZUPA 3TKSC 1XOBA 4O5RA 4XRDA 5GAND 3F0IA 5B7CA 3CBUA 5ECNB 1O73A 1A0RP 3P2AA 2L5LA 2O85A 3HZ4A 4POLA 1K0MA 1EP8A 4F0CA 1KTEA 5KN2A 1ST9A 3NZNA 2R0PA 1ERUA 4F2IA 1R7HA 1M2DA 3HJPA 2MMZA 2LKUA 4MZCA 4QL9A 2PBJA 2IMFA 3MAKA 2CZ3A 4AJ7A 5G31A 4NAXA 4MDCA 4IQ1A 5AN1A 4JR6A 5IIZA 3FKFA 5J41A 3P7XA 4AGSA 5HFIA 3TJFA 5IO2A 2AJQB 4POMA 1HNBA 1XWAA 2XBQA 4KW6A 4BVYB 2C4JA 2LV3A 1MD3A 5CREA 3D6IA 2VIMA 3UBLA 2HSMA 3ZIVA 3GH9A 3F4RA 4ULXA 2ZCTA 3M3MA 5IOXA 5KN3A 1KEBA 5LD0A 1B4QA 4KDXA 4FIWA 4Z2UA 3FEUA 3PH9A 3RHCA 4KF9A 3TJJA 4E8EA 4XS4A 4MH3A 4HZ2A 4ZB6A 3TRXA 3IAM2 1GSFA 1PQNA 3HVXA 4XS4B 1GSYA 5ENUA 2DMMA 4PQHA 4ML1A 5KOWA 14GSA 4TR4A 1DE2A 1B9XC 4EKZA 3KXOA 2YZHA 4ZL8A 1XFLA 3CSHA 4PXOA 4MLYA 13GSA 2VCTA 2OE1A 1XVWA 3IV4A 5IMZA 1V58A 1Z9HA 2HRNA 2VL3A 3TKPA 4F03A 4FYUA 4HS1A 4LMWA 4CHSA 2J23A 4PQ1A 1X5CA 1GL8A 2MZCA 1BG5A 5D9XA 1ABAA 1USBA 4O92A 2PPTA 1ON4A 1QQ2A 3GX8A 1SKSB 3TGZA 2I9HA 2IL3A 1S3DA 3GMFA 4GSTA 1Z5YE 4LL1B 4TN8A 2FNOA 3MSZA 2G2QA 3KCMA 2OE0A 2IN3A 2FUG2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHY A;  1CQH A;  1A23 A;  3FY7 A;  1JZW A;  8GSS A;  1R5P A;  2C0F A;  3HD5 A;  3L9V A;  3LYK A;  4POK A;  2V1M A;  4G9H A;  4L8E A;  1PN9 A;  3FRC A;  1MTC A;  1AIU A;  5L71 A;  4ZB8 A;  4IS0 A;  4N11 A;  4GQC A;  3QR6 A;  2V32 A;  3H1N A;  4OMV A;  5HR0 A;  4DSS B;  3KMO A;  3O76 A;  3QAG A;  5IMF A;  3VLN A;  4NHW A;  4DSQ A;  4TR1 A;  2K9F A;  5IPG A;  3DIE A;  3L9S A;  2HXK A;  1WJK A;  3M0F A;  3BJ5 A;  1JLV A;  4AF2 A;  2F9S A;  3ZFB A;  5EL8 A;  2J9H A;  1VGL A;  4TVE A;  5GSS A;  2AAW A;  2JAD A;  1Q4J A;  3FYG A;  1U3A A;  1UC7 A;  3IXR A;  2JL4 A;  3GYK A;  1FB6 A;  1GSE A;  3DRN A;  2O87 A;  5B8B A;  1F6M C;  3F6F A;  1Z6M A;  1OAZ A;  2VUP A;  1V98 A;  2KP1 A;  2LST A;  4KB3 A;  4JZQ A;  3GL5 A;  4EDZ A;  4MPG A;  4JED A;  5CRG A;  5D96 A;  1WRY A;  5CRW A;  3GA4 A;  1OVN A;  4GRF A;  1GTB A;  1BED A;  3GN3 A;  3IR4 A;  3UBK A;  2LS5 A;  3ZYW A;  2YV9 A;  2RUE A;  4K1F A;  2K18 A;  1PL1 A;  2FY6 A;  3IHQ A;  4WKW A;  5DCH A;  4NMU A;  5H5Q A;  1R4W A;  4YH2 A;  3F3R A;  3KH9 A;  1W89 A;  2CA8 A;  4GWR A;  5J4U A;  4POB A;  1XW5 A;  3EMX A;  3D21 A;  3EC3 A;  5ECH B;  5FHI A;  5DVB A;  3G7Y A;  4N30 A;  4LL4 B;  3TJB A;  1M99 A;  1AQW A;  2CZ2 A;  3KGK A;  3UVT A;  3A5W A;  1SL2 B;  1TJD A;  4GF0 A;  4RUV A;  3VUR A;  3LSZ A;  5DDL A;  3TRQ A;  4IN0 A;  2CV4 A;  2ZNM A;  5B6N A;  4LLR A;  2RII A;  3JCM L;  4EF0 A;  1WPI A;  1AAZ A;  4WF4 A;  4YQU A;  4OFN A;  5CRD A;  2H6Y A;  6GSS A;  2CQ9 A;  5GAP D;  1YEX A;  4GLT A;  4L5L A;  3VI7 A;  5H5R A;  5FT3 A;  1H4O A;  5D9T A;  5J9B A;  3HY2 A;  3TB2 A;  2KP2 A;  1UA5 A;  4MMM A;  3E9J B;  3DVW A;  2CX4 A;  1GUK A;  2C1Y A;  2B1L A;  4RQR A;  3CRU A;  1GUL A;  2KOK A;  4WR4 A;  1E6B A;  4JRR A;  1EV9 A;  5ELA A;  2O89 A;  4IW9 A;  2GSR A;  4J2F A;  1V2A A;  1J9B A;  1SL0 B;  1BX9 A;  4DEJ A;  1MEK A;  5IMC A;  1GRX A;  4KCA A;  1A8Y A;  3HJM A;  3DXB A;  1Q98 A;  1TDI A;  3A3T A;  7GSS A;  1XWG A;  3GRX A;  5CNW A;  2I4A A;  4OFT A;  4PQI A;  12GS A;  2VL2 C;  1FOV A;  5JCW A;  1PMT A;  2X8C A;  18GS A;  3EU4 A;  2IMI A;  1FHE A;  2AHE A;  1OC9 A;  3CRT A;  3QMX A;  2HSH A;  2GDR A;  1OC9 B;  4HEA 2;  2KLX A;  1BQ7 A;  4O7H A;  4TXO B;  4QL7 A;  1TRU A;  2HT9 A;  3M9K A;  5J3R A;  1EGO A;  1FAA A;  2OA7 A;  4NWY A;  1X5E A;  1AXD A;  1HNC A;  5ABR A;  4I2T A;  4K7N A;  1XZO A;  1PGT A;  2WRT A;  3K8N A;  2R4V A;  3CSJ A;  1G6Y A;  1FVK A;  3C1S A;  3LXT A;  5DAL B;  5HR2 A;  2H01 A;  2RM6 A;  2HYX A;  3KZQ A;  2GZP A;  4MJC A;  2B5X A;  1PX6 A;  2QC7 A;  1ERW A;  1FO5 A;  3ZML A;  2D2Z A;  2X8G A;  3HXS A;  3FR9 A;  2M80 A;  3FW2 A;  3P90 A;  3UAR A;  1X5D A;  5ID2 B;  5IMD A;  5A4V A;  4K7O A;  3I69 A;  3LJR A;  1A2L A;  4FH8 A;  1ERT A;  2ES7 A;  3WGX A;  1MDI A;  2FWG A;  3PIN A;  4GTU A;  1GTA A;  3DD3 A;  1V9W A;  3MWH A;  3WT2 A;  3KTB A;  2OBI A;  3NIV A;  4KX4 A;  3GSS A;  2EIO A;  1JZR A;  3ERG A;  3IAS 2;  2AUV A;  4ZL9 A;  5ECM B;  3OR5 A;  2HZE A;  3RPP A;  1TW9 A;  3APS A;  2YWN A;  1U88 A;  4DVC A;  2VCQ A;  2PVO C;  5IOW A;  4PX1 A;  1BYE A;  3IE3 A;  5AIX A;  1YF0 A;  2XPD A;  2GSQ A;  5IPH A;  2H76 A;  2LUS A;  2IMD A;  4N0V A;  3FHK A;  2O8V B;  3N9J A;  2GZZ A;  2VCZ A;  1ERV A;  3VK9 A;  4CW9 A;  2I1U A;  5F8B A;  1MDJ A;  1YJ6 A;  4ZB9 A;  4HU9 A;  3DML A;  1GP1 A;  4I8B A;  1A2J A;  4IEL A;  4KA0 A;  1AQX A;  1T7P B;  2PWJ A;  1G7O A;  2H74 A;  4GSS A;  1IYI A;  5F07 A;  3QAW A;  2C3T A;  3WYW A;  3DEX A;  2GZY A;  5DJM A;  1XVQ A;  2CAQ A;  2V2G A;  2B6M A;  2YWM A;  4BL7 A;  4OCE A;  4MF5 A;  3O3T A;  3IBH A;  2LNT A;  4BVY A;  2HNL A;  1GNW A;  2QSI A;  3DKS A;  4MA9 A;  3ERW A;  4FO5 A;  2C3N A;  3VWU A;  3VFI A;  3ZRE A;  2L6C A;  4WBJ A;  3P8W A;  2PER A;  5D9W A;  3F8U A;  2VD1 A;  4Q5N A;  1J0F A;  1GLQ A;  2FWE A;  2H1B A;  1F3B A;  4GQF A;  3EYT A;  3IDV A;  2FGX A;  3BCI A;  1ZCP A;  4K6X A;  2AV4 A;  1LU4 A;  3I43 A;  1PD2 1;  3N5O A;  2DBC A;  2GGT A;  1DSB A;  3QD9 A;  2M72 A;  4I6X A;  1MDK A;  2FHE A;  2HFD A;  2C0D A;  1OC8 A;  1NW2 A;  4JE1 A;  3KD0 A;  3KEB A;  1WE0 A;  4GSN A;  4KND A;  1ZZY A;  2CX3 A;  4PGT A;  1XXU A;  1VF3 A;  4XHM A;  2P31 A;  3HZ8 A;  1FB0 A;  3L9U A;  5CYY A;  2YJ7 A;  4KCE A;  1OC3 A;  4MP4 A;  3D4M A;  1ZMA A;  2ALB A;  4YQM A;  2IFQ B;  2YNX A;  3BBY A;  3EUR A;  1UN2 A;  4H86 A;  3APO A;  1GTU A;  3C73 A;  4WET A;  4YAV A;  4BWQ A;  17GS A;  2X99 A;  5G1K A;  3ZFL A;  4ECJ A;  2VOC A;  2M46 A;  6GSU A;  1QXH A;  1VF4 A;  2FWF A;  1PKZ A;  3ISO A;  2DML A;  3UAP A;  4BVX A;  1HD2 A;  4F82 A;  2DJK A;  5F06 A;  3VPT A;  5C04 A;  2H0G A;  5G1L A;  3FR3 A;  3ZTL A;  4RI7 A;  3ZRD A;  3ZIJ A;  4DSS A;  2CAI A;  3EIN A;  6GSV A;  1WIK A;  1GNE A;  1AC1 A;  3IOS A;  3M1G A;  4MF6 A;  2X64 A;  2VM1 A;  3LGC A;  4JU5 A;  2HLS A;  4IBP A;  4YAP A;  1B9Y C;  3TKQ A;  2DJ2 A;  1LJR A;  1N8J A;  2RLI A;  1QMV A;  2YP6 A;  4N0Z A;  4K2D A;  2EIQ A;  2JSZ A;  3GKX A;  4XRA A;  1QUW A;  1SK1 A;  3W6G A;  1K3Y A;  3CTG A;  4NV5 A;  4NXI A;  1EOG A;  3GH6 A;  1K0D A;  4ID0 A;  1B8X A;  4ECB A;  3DVX A;  4WBR D;  5IO0 A;  5ECP B;  2WS2 A;  4IQA A;  5CP1 A;  3CTF A;  5HFG A;  1PSQ A;  1NSW A;  1Y25 A;  2K6V A;  3ME8 A;  5EPF A;  3KP9 A;  2H72 A;  1U87 A;  3D4T A;  1PRX A;  3PR8 A;  4IP6 A;  2HSY A;  3PGT A;  1FG4 A;  3RHB A;  4XTS A;  1R5A A;  2YOI A;  2XC2 A;  4V2M A;  3DYR A;  4F0B A;  2OKA A;  2DJJ A;  1SK2 A;  1V40 A;  4K0N A;  3CYN A;  4HDE A;  4XCS A;  1X9S B;  2VO4 A;  2AB6 A;  5ECQ B;  3GUS A;  3I9V 2;  4IJI A;  1THO A;  3KM6 A;  2WZ9 A;  6GSX A;  1X9M B;  1SKR B;  2B5Y A;  2NPB A;  4HQZ A;  2VAF A;  4RI6 A;  1BJX A;  3H93 A;  5IQY A;  3LXZ A;  11GS A;  4ECC A;  4ZBB A;  2HE3 A;  4BA7 A;  1B48 A;  2VCX A;  5C00 A;  5JCG A;  1I5G A;  1GSQ A;  4MJE A;  3EVI A;  1XWK A;  2YV7 A;  4WR5 A;  1OKT A;  3L0H A;  1RQM A;  5DAK B;  2B7J A;  3ZVJ A;  3F6D A;  2WJU A;  3US3 A;  2VCW A;  3ME7 A;  1TU8 A;  2HI7 A;  2IJY A;  3F9U A;  3TCO A;  16GS A;  1ACV A;  2DJ3 A;  2HRF A;  2P5Q A;  2QKE A;  5LCZ A;  4WEY A;  1VRS D;  2MBS A;  4K0G A;  1GTI A;  1G0T A;  3GTU B;  3TJK A;  2V6O A;  2DJ1 A;  3LOR A;  1NM3 A;  1TTZ A;  3CMI A;  3WGE A;  1RK4 A;  5KN0 A;  1JLW A;  5E4W A;  1YY7 A;  5DJL A;  3TKS E;  1AQV A;  1U6T A;  5HFK A;  3FZ5 A;  4EE0 A;  3HVS A;  1K0N A;  2FD3 A;  4EDY A;  2DC5 A;  1YZX A;  4HI7 A;  3A2W A;  3QPM A;  2JZR A;  4P3Y B;  2WB9 A;  2B3S A;  2DJ0 A;  5GST A;  1O8W A;  2HZF A;  4MK3 A;  4K8M A;  2H1D A;  6GSY A;  1GUM A;  2K8V A;  5G5E A;  1SK0 A;  4TXO A;  2V6K A;  4ZBD A;  5DCG A;  4Q5Q A;  4IVF A;  3GKM A;  1NHO A;  1QK8 A;  3C1R A;  1TXX A;  2R37 A;  1CQG A;  2L5O A;  5IMA A;  2JAC A;  5JWR B;  1T00 A;  2IIY A;  4OO4 A;  1YF1 A;  1THX A;  4NV2 A;  5D93 A;  4IKH A;  2NBS A;  1Z7R A;  4ZXG A;  4ML6 A;  5DAL A;  3KTL A;  3DGQ A;  1YKC A;  1T4Z A;  4EXJ A;  4AJ8 A;  4ILF A;  4X0X A;  4ZBA A;  1O7U A;  3IK7 A;  5KN1 A;  3GX0 A;  2RM5 A;  3VWV A;  5D73 A;  3UOM A;  4L0U A;  2REM A;  3RBT A;  5D9V A;  5B6M A;  2H30 A;  3ZZX A;  1GSU A;  5ID2 A;  2P0G A;  2JU5 A;  1EWX A;  4MF7 A;  1XOA A;  4EO3 A;  3VWX A;  1AW9 A;  3E3E A;  3Q74 A;  5LNK e;  1TK8 B;  5ECS A;  2R5G A;  2B7K A;  1M2B A;  3F4S A;  3UMA A;  2H8L A;  3RPN A;  4KAE A;  1EZK A;  2GS3 A;  2XHF A;  2C3Q A;  2YCD A;  1VF2 A;  2L59 A;  3NOF A;  3A2X A;  3IRA A;  3U6V A;  3RDW A;  2LJR A;  3F3Q A;  4KDU A;  1A2M A;  1XPV A;  1ZYQ B;  2WDU A;  3VI5 A;  2TRC P;  1M0U A;  1S3C A;  5COH A;  3EU3 A;  1KNG A;  3I6A A;  1TP9 A;  4OWY A;  4FYC A;  2CT6 A;  3TRP A;  3D5J A;  2G0F A;  3KJY A;  4PUA A;  1GLP A;  2TIR A;  1S3A A;  5A4W A;  3QFA C;  1TRV A;  3H4K A;  3W8J A;  3WD6 A;  10GS A;  2H70 A;  1FVJ A;  1M9A A;  1SU9 A;  1Z3E A;  4HZ4 A;  1ZL9 A;  4IP1 A;  5JWQ B;  3HYP A;  2H66 A;  4EUY A;  19GS A;  3F4T A;  1QGV A;  2C0G A;  2L57 A;  2MMA A;  3UL3 A;  5AIS A;  1YQ1 A;  3U5R E;  1PA3 A;  1M9B A;  1XWC A;  2I3Y A;  2XBI A;  3MNG A;  2IPA A;  3D22 A;  3UJ1 A;  3UIW A;  3HA9 A;  5HQP A;  3V1W A;  2VD0 A;  3J7Y k;  2DIY A;  4Q5R A;  1DUG A;  3F63 A;  5ELG A;  3ZMK A;  1M2A A;  1YEP A;  4V2L A;  4ISD A;  4XS1 A;  2L4Q A;  1T4Y A;  1V57 A;  3A2V A;  2YWI A;  3RAZ A;  3GUR A;  2R2J A;  1TOF A;  3Q19 A;  1GSS A;  2TRX A;  2ON7 A;  3TOU A;  2FWH A;  3GKN A;  5CO3 A;  4FYB A;  3H79 A;  2H1A A;  2WGR A;  1C72 A;  5CRH A;  4LA1 A;  22GS A;  4MJB A;  3WT1 A;  3ERF A;  3IK9 A;  2KHP A;  2NTO A;  4KSM A;  1SJI A;  1OYJ A;  5ECR B;  3BCK A;  2WFC A;  2IWT A;  1DBY A;  4HOJ A;  4RQX A;  1RW1 A;  1T3B A;  2H1G A;  2IME A;  4ZL7 A;  5G30 A;  1EEJ A;  2NVL A;  2N5A A;  2DSA A;  3ZL5 A;  4EL1 A;  1XW9 A;  2DIZ A;  1GUH A;  1ILO A;  4G10 A;  2A2R A;  3J7Y b;  1X0R A;  1GH2 A;  1SJ6 A;  4TR0 A;  5FWG A;  2F8F A;  4XS6 A;  1SYR A;  5DBQ A;  5DQS A;  3GST A;  2ON5 A;  2QGV A;  1JHB A;  2E2G A;  2IFQ A;  3HJO A;  2FA4 A;  3D0Z A;  1F9M A;  1ZGN A;  2OE3 A;  4G2E A;  4PNG A;  2MBT A;  4DSR A;  3W8S A;  1A0F A;  2IMK A;  1DE1 A;  2OAC A;  1H75 A;  1T1V A;  2PUK C;  5J5N A;  2GT5 A;  3G7J A;  1N2A A;  4NPB A;  3LEF A;  2C0E A;  4K7I A;  3EMP A;  4XIH A;  3HKR A;  4K9Z A;  1ZOF A;  1JZO A;  1WMJ A;  5J9C A;  4MPF A;  1K3L A;  3E0U A;  4Z7X A;  4V1A p;  4J57 E;  2EC4 A;  2VM2 A;  3TOT A;  2MYG A;  4KUN A;  4JR4 A;  2VL9 A;  4TRX A;  4KH7 A;  2LJK A;  2LRT A;  2FA8 A;  1ZYE A;  1M7T A;  2L4C A;  2H19 A;  2PU9 C;  4IJ3 A;  1SEN A;  2MMO A;  2GQM A;  3ZLP A;  2F3M A;  2H75 A;  2GST A;  2PMT A;  4IHU A;  2CVK A;  3S9F A;  5ECO B;  3KH7 A;  4PUR A;  5ECK B;  2H73 A;  5F05 A;  4BPY A;  3LG6 A;  1F3A A;  3CSI A;  3O6T A;  4KDY A;  3QOU A;  5DQY A;  2RUF A;  2I81 A;  2F51 A;  2GQL A;  1XBS A;  3GL3 A;  3VPQ A;  2YN1 A;  4V2N A;  1E2Y A;  5E59 A;  1O6J A;  4TR3 A;  1UVZ A;  4OCF A;  4TR1 B;  1MD4 A;  1XIY A;  3HHV A;  5HR3 A;  1BAY A;  2X8H A;  5IMV A;  3G9B A;  4KGI A;  2EIR A;  3FR6 A;  4HJM A;  2OAD A;  5IM9 A;  4L5O A;  4F9Z A;  2VLU A;  4PNF A;  1SYX A;  1JZD A;  4I5Q A;  5EY6 A;  3M8N A;  2GQK A;  6GSW A;  2CVB A;  2N5B A;  4QQ7 A;  1FW1 A;  1GWC A;  3MDK A;  1TRW A;  1TU7 A;  3LFL A;  5A5K A;  1OE8 A;  1EEM A;  2JZS A;  3TJG A;  4MCU A;  1Z7P A;  3GV1 A;  4WF5 A;  2O7K A;  3IPZ A;  4HQS A;  1HYU A;  3FZA A;  3UEM A;  4ACS A;  4L0W A;  2JSY A;  5GZZ B;  4HJ2 A;  3SWL A;  1YDK A;  1EV4 A;  3HCZ A;  2AYT A;  2YAN A;  2R6K A;  1W4V A;  1F37 A;  4G19 A;  1G6W A;  3C8E A;  5G2Z A;  1OE7 A;  3ZIT A;  2E7P A;  2E0Q A;  4TKY A;  3C71 A;  2LNS A;  2WUL A;  2YJH A;  2GSS A;  5H5S A;  1WWJ A;  4GXZ A;  4PUF C;  1J08 A;  1K0C A;  4JBB A;  3FK8 A;  4GCI A;  2DLX A;  6GST A;  1QFN A;  2H6Z A;  4E8H A;  4KE3 A;  2H0H A;  3TUE A;  5A4U A;  2VLT A;  3HDC A;  3LWA A;  3IC4 A;  1U3I A;  3L78 A;  4ZIJ A;  5DAK A;  2C80 A;  3L4N A;  4V1A g;  3SBC A;  2LRC A;  3CXG A;  1AUC A;  3GIX A;  1TRS A;  1PL2 A;  3LQ7 A;  1ML6 A;  3ZVJ D;  1EOH A;  2YPM A;  3QAV A;  2Z9S A;  4Q5F A;  1WOU A;  5AIV A;  4EC0 A;  2PGT A;  2FLS A;  1XW6 A;  3GTU A;  3BD2 A;  5B8A A;  2KUC A;  2H0I A;  3AY8 A;  3KMN A;  1F2E A;  2B1K A;  1VF1 A;  1G7E A;  1O8X A;  5F0G A;  1IYH A;  5JWO B;  2GLR A;  2BMX A;  3M9J A;  4WXT A;  4TW5 A;  1XWB A;  2PVQ A;  1TI3 A;  2E2M A;  5ECI B;  4OD7 A;  1K0O A;  3GFK A;  2XPE A;  2F8A A;  5D8I A;  4HUA A;  3LYP A;  1HQO A;  4TOP A;  3H8Q A;  2C8U A;  2H6X A;  2LQO A;  2FCH A;  3Q18 A;  3QCP A;  1HNA A;  4MZB A;  1T8E B;  1TK5 B;  3EWL A;  4NHZ A;  1WP0 A;  3FZ4 A;  3C7M A;  2VL2 A;  2LQQ A;  2NDO A;  5INY A;  4OO5 A;  3BOA A;  1K0A A;  3UVH A;  2OBK A;  2LJA A;  3EE2 A;  2WCI A;  1PKW A;  4HU7 A;  3KIJ A;  4OFM A;  2N5F A;  4D73 A;  3GKK A;  1URM A;  3R2Q A;  1O81 A;  4D73 B;  3Q6O A;  3G7I A;  1SD8 A;  2GT6 A;  2LEG A;  3GHA A;  2BTO T;  2A4V A;  5ECL B;  1XCC A;  3TKR A;  1JFU A;  1SL1 B;  1OKD A;  4J56 E;  5EVO A;  4MJA A;  1YKA A;  1KBN A;  2PN8 A;  1Y6E A;  1LBK A;  1TKD B;  2MMN A;  1PX7 A;  2LRN A;  3DWV A;  1A8L A;  1B4P A;  4LMV A;  3QDN A;  3WGD A;  1A24 A;  4ECI A;  4KSO A;  2YWO A;  5KEJ A;  2VLV A;  1TK0 B;  2JZT A;  1O85 A;  1GSD A;  1K3O A;  4IGJ A;  4I2U A;  4EVM A;  2V41 A;  1I9D A;  5AGY A;  1EP7 A;  1R26 A;  2R3X A;  2A2S A;  5HR1 A;  4X43 A;  2CVD A;  1SD9 A;  20GS A;  2YZU A;  3IA1 A;  3QFB C;  3APQ A;  3ED3 A;  2GVP A;  3HVV A;  3FZ9 A;  4N10 A;  5CAX A;  4BWS A;  4MAB A;  4ZIL A;  2L6D A;  9GSS A;  4YQV A;  2GTU A;  2BJX A;  2OJL A;  2HZE B;  1K0B A;  3GNJ A;  3VWW A;  2H71 A;  1X9W B;  5G5F A;  4MH2 A;  1TI1 A;  2VCV A;  4TXV A;  1SJZ A;  2LTK A;  1Z6N A;  3TKS A;  4MZW A;  3TDG A;  2B5E A;  2K8S A;  4X1U A;  1SKW B;  3KP8 A;  4I97 A;  5JCU A;  4AJ6 A;  4CDO A;  1EGR A;  4O32 A;  2P5R A;  2ZUP A;  3TKS C;  1XOB A;  4O5R A;  4XRD A;  5GAN D;  3F0I A;  5B7C A;  3CBU A;  5ECN B;  1O73 A;  1A0R P;  3P2A A;  2L5L A;  2O85 A;  3HZ4 A;  4POL A;  1K0M A;  1EP8 A;  4F0C A;  1KTE A;  5KN2 A;  1ST9 A;  3NZN A;  1ERU A;  4F2I A;  1R7H A;  1M2D A;  3HJP A;  2MMZ A;  2LKU A;  4MZC A;  4QL9 A;  2PBJ A;  2IMF A;  3MAK A;  2CZ3 A;  4AJ7 A;  5G31 A;  4NAX A;  4MDC A;  4IQ1 A;  5AN1 A;  4JR6 A;  5IIZ A;  3FKF A;  5J41 A;  3P7X A;  4AGS A;  5HFI A;  3TJF A;  5IO2 A;  2AJQ B;  4POM A;  1HNB A;  1XWA A;  2XBQ A;  4KW6 A;  2C4J A;  2LV3 A;  1MD3 A;  5CRE A;  3D6I A;  2VIM A;  3UBL A;  3ZIV A;  3GH9 A;  3F4R A;  4ULX A;  2ZCT A;  3M3M A;  5IOX A;  5KN3 A;  1KEB A;  5LD0 A;  1B4Q A;  4KDX A;  4FIW A;  3FEU A;  3PH9 A;  3RHC A;  3TJJ A;  4E8E A;  4XS4 A;  4MH3 A;  4HZ2 A;  4ZB6 A;  3TRX A;  3IAM 2;  1GSF A;  1PQN A;  3HVX A;  4XS4 B;  1GSY A;  5ENU A;  2DMM A;  4PQH A;  4ML1 A;  14GS A;  4TR4 A;  1DE2 A;  1B9X C;  4EKZ A;  3KXO A;  2YZH A;  4ZL8 A;  1XFL A;  3CSH A;  4PXO A;  4MLY A;  13GS A;  2VCT A;  2OE1 A;  1XVW A;  3IV4 A;  5IMZ A;  1V58 A;  1Z9H A;  2HRN A;  2VL3 A;  3TKP A;  4F03 A;  4FYU A;  4HS1 A;  4LMW A;  4CHS A;  2J23 A;  4PQ1 A;  1X5C A;  1GL8 A;  2MZC A;  1BG5 A;  5D9X A;  1ABA A;  1USB A;  4O92 A;  2PPT A;  1ON4 A;  1QQ2 A;  3GX8 A;  1SKS B;  3TGZ A;  2I9H A;  2IL3 A;  1S3D A;  3GMF A;  4GST A;  1Z5Y E;  4LL1 B;  4TN8 A;  2FNO A;  3MSZ A;  2G2Q A;  3KCM A;  2OE0 A;  2IN3 A;  2FUG 2; 
#chains in the Genus database with same CATH topology
 1NHY A;  1CQH A;  1A23 A;  3FY7 A;  1JZW A;  8GSS A;  1R5P A;  2C0F A;  3HD5 A;  3L9V A;  3LYK A;  4POK A;  2V1M A;  4BVX B;  4G9H A;  4L8E A;  1PN9 A;  3FRC A;  1MTC A;  1AIU A;  5L71 A;  4ZB8 A;  4IS0 A;  4N11 A;  4GQC A;  3QR6 A;  2V32 A;  3H1N A;  4OMV A;  5HR0 A;  4DSS B;  3KMO A;  3O76 A;  3QAG A;  2QA1 A;  5IMF A;  3VLN A;  4NHW A;  4DSQ A;  4TR1 A;  2K9F A;  5IPG A;  3DIE A;  3L9S A;  2HXK A;  1WJK A;  3M0F A;  3BJ5 A;  1JLV A;  4AF2 A;  2F9S A;  3ZFB A;  5EL8 A;  2J9H A;  1VGL A;  4TVE A;  5GSS A;  2AAW A;  2JAD A;  1Q4J A;  3FYG A;  1U3A A;  1UC7 A;  3IXR A;  2JL4 A;  3GYK A;  4G0I A;  1FB6 A;  1GSE A;  3DRN A;  2O87 A;  5B8B A;  1F6M C;  3F6F A;  1Z6M A;  1OAZ A;  2VUP A;  1V98 A;  4MNN A;  2KP1 A;  2LST A;  4KB3 A;  4JZQ A;  3GL5 A;  4EDZ A;  4MPG A;  4JED A;  5CRG A;  5D96 A;  1WRY A;  5CRW A;  3GA4 A;  1OVN A;  4GRF A;  1GTB A;  1BED A;  3GN3 A;  3IR4 A;  3UBK A;  2LS5 A;  4EIQ A;  3ZYW A;  2YV9 A;  2RUE A;  4K1F A;  2K18 A;  1PL1 A;  2FY6 A;  3IHQ A;  4WKW A;  5DCH A;  4NMU A;  5H5Q A;  1R4W A;  4YH2 A;  3F3R A;  3KH9 A;  1W89 A;  2CA8 A;  4GWR A;  5J4U A;  4POB A;  1XW5 A;  3EMX A;  3D21 A;  3EC3 A;  5ECH B;  5FHI A;  5DVB A;  3G7Y A;  4N30 A;  4LL4 B;  3TJB A;  1M99 A;  1AQW A;  5KOX A;  2CZ2 A;  3KGK A;  3UVT A;  3A5W A;  1SL2 B;  1TJD A;  4GF0 A;  4RUV A;  3VUR A;  3LSZ A;  5DDL A;  3TRQ A;  4IN0 A;  2CV4 A;  2ZNM A;  5B6N A;  4LLR A;  2RII A;  3JCM L;  4EF0 A;  1WPI A;  1AAZ A;  4WF4 A;  4YQU A;  4OFN A;  5CRD A;  2H6Y A;  6GSS A;  2CQ9 A;  5GAP D;  1YEX A;  4GLT A;  4L5L A;  3VI7 A;  5H5R A;  5FT3 A;  1H4O A;  5D9T A;  5J9B A;  3HY2 A;  3TB2 A;  4CY6 A;  2KP2 A;  1UA5 A;  4MMM A;  3E9J B;  3DVW A;  2CX4 A;  1GUK A;  2C1Y A;  2B1L A;  4RQR A;  3CRU A;  1GUL A;  2KOK A;  4WR4 A;  1E6B A;  4JRR A;  1EV9 A;  5ELA A;  2O89 A;  4IW9 A;  2GSR A;  4J2F A;  1V2A A;  1J9B A;  1SL0 B;  1BX9 A;  4DEJ A;  1MEK A;  5IMC A;  1GRX A;  4KCA A;  1A8Y A;  3HJM A;  3DXB A;  1Q98 A;  1TDI A;  3A3T A;  7GSS A;  5CNW A;  1XWG A;  3GRX A;  2I4A A;  4OFT A;  4PQI A;  12GS A;  2VL2 C;  1FOV A;  5JCW A;  1PMT A;  2X8C A;  1FOH A;  18GS A;  3EU4 A;  2IMI A;  1FHE A;  3LW9 A;  2AHE A;  1OC9 A;  3CRT A;  3QMX A;  2HSH A;  2GDR A;  1OC9 B;  4HEA 2;  2KLX A;  1BQ7 A;  4O7H A;  4TXO B;  4QL7 A;  1TRU A;  2HT9 A;  3M9K A;  5J3R A;  1EGO A;  1FAA A;  2OA7 A;  4NWY A;  1X5E A;  1AXD A;  4X4J A;  1HNC A;  5ABR A;  1M3I A;  4I2T A;  4K7N A;  1XZO A;  1PGT A;  2WRT A;  3K8N A;  2R4V A;  3CQF A;  3CSJ A;  1G6Y A;  1FVK A;  3C1S A;  3LXT A;  5DAL B;  5HR2 A;  2H01 A;  2RM6 A;  2HYX A;  3KZQ A;  2GZP A;  4MJC A;  2B5X A;  1PX6 A;  2QC7 A;  1ERW A;  1FO5 A;  3ZML A;  2D2Z A;  2X8G A;  3HXS A;  3FR9 A;  2M80 A;  3FW2 A;  3P90 A;  3UAR A;  1X5D A;  5ID2 B;  5IMD A;  5A4V A;  4K7O A;  4PTS A;  3I69 A;  3LJR A;  1A2L A;  4FH8 A;  1ERT A;  2ES7 A;  3WGX A;  1MDI A;  2FWG A;  3PIN A;  4GTU A;  1GTA A;  3DD3 A;  1V9W A;  3MWH A;  3WT2 A;  3KTB A;  2OBI A;  3NIV A;  4KX4 A;  3GSS A;  2EIO A;  4USS A;  1JZR A;  3ERG A;  3IAS 2;  2AUV A;  4ZL9 A;  5ECM B;  3OR5 A;  2HZE A;  3RPP A;  1TW9 A;  3APS A;  2YWN A;  1M3J A;  1U88 A;  4DVC A;  2VCQ A;  2PVO C;  5IOW A;  4PX1 A;  1BYE A;  3IE3 A;  5AIX A;  1YF0 A;  2XPD A;  2GSQ A;  5IPH A;  2H76 A;  2LUS A;  2IMD A;  4N0V A;  3FHK A;  2O8V B;  3N9J A;  2GZZ A;  2VCZ A;  4Z2T A;  1ERV A;  3VK9 A;  4CW9 A;  2I1U A;  5F8B A;  1MDJ A;  1YJ6 A;  4ZB9 A;  4HU9 A;  3DML A;  1GP1 A;  4I8B A;  1A2J A;  4IEL A;  4KA0 A;  1AQX A;  1T7P B;  2PWJ A;  1G7O A;  2H74 A;  4GSS A;  1IYI A;  5F07 A;  3QAW A;  2C3T A;  3WYW A;  3DEX A;  2GZY A;  5DJM A;  1XVQ A;  2CAQ A;  2V2G A;  2B6M A;  2YWM A;  4BL7 A;  4OCE A;  4BL7 B;  4MF5 A;  3O3T A;  3IBH A;  2LNT A;  4BVY A;  2HNL A;  1GNW A;  2QSI A;  3DKS A;  4MA9 A;  3ERW A;  4FO5 A;  2C3N A;  3VWU A;  3VFI A;  3ZRE A;  2L6C A;  4WBJ A;  3P8W A;  2PER A;  5D9W A;  3F8U A;  2VD1 A;  4Q5N A;  1J0F A;  1GLQ A;  2FWE A;  2H1B A;  1F3B A;  4GQF A;  3EYT A;  3IDV A;  2FGX A;  3BCI A;  1ZCP A;  4K6X A;  2AV4 A;  1LU4 A;  3I43 A;  1PD2 1;  3N5O A;  2DBC A;  2GGT A;  1DSB A;  3QD9 A;  2M72 A;  4I6X A;  1MDK A;  2FHE A;  2HFD A;  2C0D A;  1OC8 A;  1NW2 A;  4JE1 A;  5BMU A;  3KD0 A;  3KEB A;  1WE0 A;  4GSN A;  4KND A;  1ZZY A;  2CX3 A;  4PGT A;  1XXU A;  1VF3 A;  4XHM A;  2P31 A;  3HZ8 A;  1FB0 A;  3L9U A;  5CYY A;  2YJ7 A;  4KCE A;  1OC3 A;  4MP4 A;  3D4M A;  1ZMA A;  4G0K A;  2ALB A;  4YQM A;  2IFQ B;  2YNX A;  3BBY A;  2X49 A;  3EUR A;  1UN2 A;  4H86 A;  3APO A;  1GTU A;  3C73 A;  4WET A;  4YAV A;  4BWQ A;  17GS A;  2X99 A;  5G1K A;  3MIX A;  3ZFL A;  4ECJ A;  2VOC A;  2M46 A;  6GSU A;  1QXH A;  1VF4 A;  2FWF A;  1PFO A;  1PKZ A;  3ISO A;  2DML A;  3UAP A;  4BVX A;  1HD2 A;  4F82 A;  2DJK A;  2A2P A;  5F06 A;  3VPT A;  5C04 A;  2H0G A;  5G1L A;  3FR3 A;  3ZTL A;  4RI7 A;  3ZRD A;  3ZIJ A;  4DSS A;  2CAI A;  3EIN A;  6GSV A;  1WIK A;  1GNE A;  1AC1 A;  3IOS A;  3M1G A;  4MF6 A;  2X64 A;  2VM1 A;  3LGC A;  4JU5 A;  2HLS A;  4IBP A;  4YAP A;  1B9Y C;  3TKQ A;  4HSC X;  2DJ2 A;  1LJR A;  1N8J A;  2RLI A;  1QMV A;  2YP6 A;  4N0Z A;  4K2D A;  2EIQ A;  2JSZ A;  3GKX A;  4XRA A;  1QUW A;  1SK1 A;  3W6G A;  1K3Y A;  3CTG A;  4NV5 A;  4NXI A;  1EOG A;  3GH6 A;  1K0D A;  4ID0 A;  4EIP A;  1B8X A;  4ECB A;  3DVX A;  4WBR D;  5IO0 A;  5ECP B;  2WS2 A;  4IQA A;  5CP1 A;  3CTF A;  5HFG A;  2DKI A;  1PSQ A;  1NSW A;  1PN0 A;  1Y25 A;  2K6V A;  3ME8 A;  5EPF A;  3KP9 A;  2H72 A;  1U87 A;  3D4T A;  1PRX A;  3PR8 A;  4IP6 A;  2HSY A;  3PGT A;  1FG4 A;  3RHB A;  4XTS A;  1R5A A;  2YOI A;  2XC2 A;  2A4H A;  4V2M A;  3DYR A;  4F0B A;  2OKA A;  2DJJ A;  1SK2 A;  3EPT A;  1V40 A;  4K0N A;  3CYN A;  4HDE A;  4XCS A;  1X9S B;  2VO4 A;  2AB6 A;  4ICY A;  5ECQ B;  3GUS A;  3I9V 2;  4IJI A;  1THO A;  3KM6 A;  2WZ9 A;  6GSX A;  1X9M B;  1SKR B;  2B5Y A;  2NPB A;  4HQZ A;  2VAF A;  4RI6 A;  1BJX A;  3H93 A;  5IQY A;  3LXZ A;  11GS A;  4ECC A;  4ZBB A;  2HE3 A;  4BA7 A;  1B48 A;  2VCX A;  5C00 A;  5JCG A;  1I5G A;  1GSQ A;  4MJE A;  3EVI A;  1XWK A;  2YV7 A;  4WR5 A;  1OKT A;  3L0H A;  1RQM A;  5DAK B;  2B7J A;  3ZVJ A;  3F6D A;  2WJU A;  3US3 A;  2VCW A;  3ME7 A;  1TU8 A;  2HI7 A;  2IJY A;  3F9U A;  3TCO A;  16GS A;  1ACV A;  1ZYP A;  2DJ3 A;  2HRF A;  2P5Q A;  2QKE A;  5LCZ A;  4WEY A;  1VRS D;  2MBS A;  4K0G A;  1GTI A;  1G0T A;  3GTU B;  3TJK A;  2V6O A;  2DJ1 A;  3LOR A;  1NM3 A;  1TTZ A;  3CMI A;  3WGE A;  1RK4 A;  5KN0 A;  1JLW A;  3IHG A;  5E4W A;  1YY7 A;  5DJL A;  3TKS E;  1AQV A;  1U6T A;  3HVN A;  5HFK A;  3FZ5 A;  4EE0 A;  3HVS A;  1K0N A;  2FD3 A;  4EDY A;  2DC5 A;  1YZX A;  4HI7 A;  3R3E A;  3A2W A;  3QPM A;  2JZR A;  4P3Y B;  2WB9 A;  2B3S A;  2DJ0 A;  5GST A;  1O8W A;  2HZF A;  4MK3 A;  4K8M A;  2H1D A;  6GSY A;  1GUM A;  2K8V A;  5G5E A;  1SK0 A;  4TXO A;  2V6K A;  4ZBD A;  5DCG A;  4Q5Q A;  4IVF A;  3GKM A;  1NHO A;  1QK8 A;  3C1R A;  1TXX A;  2R37 A;  1CQG A;  2L5O A;  5IMA A;  2JAC A;  5JWR B;  1T00 A;  2IIY A;  4OO4 A;  1YF1 A;  1THX A;  4NV2 A;  5D93 A;  4IKH A;  2NBS A;  1Z7R A;  4ZXG A;  4ML6 A;  5DAL A;  3KTL A;  3DGQ A;  1YKC A;  1T4Z A;  4EXJ A;  4AJ8 A;  4ILF A;  4CY8 A;  4X0X A;  4ZBA A;  1O7U A;  3IK7 A;  5KN1 A;  3GX0 A;  2RM5 A;  3VWV A;  5D73 A;  3UOM A;  4L0U A;  2REM A;  3RBT A;  5D9V A;  5B6M A;  2H30 A;  3ZZX A;  1GSU A;  5ID2 A;  2P0G A;  2JU5 A;  1EWX A;  4MF7 A;  1XOA A;  4EO3 A;  3VWX A;  1AW9 A;  3E3E A;  3Q74 A;  5LNK e;  1TK8 B;  5ECS A;  2R5G A;  3IC8 A;  2B7K A;  1M2B A;  3F4S A;  3UMA A;  2H8L A;  3RPN A;  4KAE A;  1EZK A;  2GS3 A;  3PPU A;  2XHF A;  2C3Q A;  2YCD A;  1VF2 A;  2L59 A;  3NOF A;  3A2X A;  3IRA A;  3U6V A;  3RDW A;  2LJR A;  3F3Q A;  4KDU A;  1A2M A;  1XPV A;  1ZYQ B;  2WDU A;  3VI5 A;  2TRC P;  4O5U A;  1M0U A;  1S3C A;  5COH A;  3EU3 A;  1KNG A;  3I6A A;  1TP9 A;  4OWY A;  4FYC A;  2CT6 A;  3TRP A;  3D5J A;  4FQU A;  2G0F A;  3KJY A;  4PUA A;  1GLP A;  2TIR A;  1S3A A;  5A4W A;  3QFA C;  1TRV A;  3H4K A;  3W8J A;  3WD6 A;  10GS A;  2H70 A;  1FVJ A;  1M9A A;  1SU9 A;  1Z3E A;  4HZ4 A;  1ZL9 A;  4IP1 A;  5JWQ B;  3HYP A;  2H66 A;  4EUY A;  19GS A;  3F4T A;  1QGV A;  2C0G A;  2L57 A;  2MMA A;  3UL3 A;  5AIS A;  1YQ1 A;  3U5R E;  4G0L A;  1PA3 A;  1M9B A;  1XWC A;  2I3Y A;  2XBI A;  3MNG A;  2IPA A;  3D22 A;  3UJ1 A;  3UIW A;  3HA9 A;  5HQP A;  3V1W A;  2VD0 A;  3J7Y k;  2DIY A;  4Q5R A;  1DUG A;  3F63 A;  5ELG A;  2R0C A;  3ZMK A;  1M2A A;  1YEP A;  4V2L A;  4ISD A;  4XS1 A;  2L4Q A;  1T4Y A;  1V57 A;  3A2V A;  2YWI A;  3RAZ A;  3GUR A;  2R2J A;  1TOF A;  3Q19 A;  1GSS A;  2TRX A;  4YKG A;  2ON7 A;  3TOU A;  2FWH A;  3GKN A;  5CO3 A;  4FYB A;  3H79 A;  2H1A A;  2WGR A;  1C72 A;  5CRH A;  4LA1 A;  22GS A;  4MJB A;  3WT1 A;  3ERF A;  3IK9 A;  2KHP A;  2NTO A;  4KSM A;  1SJI A;  1OYJ A;  5ECR B;  3BCK A;  2WFC A;  2IWT A;  1DBY A;  4HOJ A;  4RQX A;  1RW1 A;  1T3B A;  2H1G A;  2IME A;  4ZL7 A;  5G30 A;  1EEJ A;  2NVL A;  2N5A A;  2DSA A;  3ZL5 A;  4EL1 A;  1XW9 A;  2DIZ A;  1GUH A;  1ILO A;  4G10 A;  2A2R A;  3J7Y b;  1X0R A;  1GH2 A;  1SJ6 A;  4TR0 A;  5FWG A;  2F8F A;  4XS6 A;  1SYR A;  5DBQ A;  5DQS A;  3GST A;  2ON5 A;  2QGV A;  1JHB A;  2E2G A;  2IFQ A;  3HJO A;  2FA4 A;  3D0Z A;  1F9M A;  1ZGN A;  2X4A A;  3A5I A;  2OE3 A;  4G2E A;  4PNG A;  2MBT A;  4DSR A;  3W8S A;  1A0F A;  2IMK A;  1DE1 A;  2OAC A;  1H75 A;  1T1V A;  2PUK C;  5J5N A;  2GT5 A;  3G7J A;  1N2A A;  2QA2 A;  4NPB A;  3LEF A;  2C0E A;  4K7I A;  3EMP A;  4XIH A;  3HKR A;  4K9Z A;  1ZOF A;  1JZO A;  1WMJ A;  5J9C A;  4MPF A;  1K3L A;  3E0U A;  4Z7X A;  4V1A p;  4J57 E;  2EC4 A;  2VM2 A;  3TOT A;  2MYG A;  4KUN A;  4JR4 A;  2VL9 A;  4TRX A;  4KH7 A;  2LJK A;  2LRT A;  2FA8 A;  1ZYE A;  1M7T A;  2L4C A;  2H19 A;  2PU9 C;  4IJ3 A;  1SEN A;  2MMO A;  4YKF A;  2GQM A;  3ZLP A;  2F3M A;  2H75 A;  4Z2R A;  2GST A;  2PMT A;  4IHU A;  2CVK A;  3S9F A;  5ECO B;  3KH7 A;  4PUR A;  5ECK B;  2H73 A;  5F05 A;  4BPY A;  3LG6 A;  1F3A A;  3CSI A;  3O6T A;  4KDY A;  3QOU A;  5DQY A;  2RUF A;  2I81 A;  2F51 A;  2GQL A;  1XBS A;  3GL3 A;  3VPQ A;  2YN1 A;  4V2N A;  1E2Y A;  5E59 A;  1O6J A;  4TR3 A;  1UVZ A;  4OCF A;  4TR1 B;  1MD4 A;  1XIY A;  3HHV A;  5HR3 A;  1BAY A;  2X8H A;  5IMV A;  3G9B A;  4KGI A;  2EIR A;  3FR6 A;  4K5R A;  4HJM A;  2OAD A;  5IM9 A;  4L5O A;  4F9Z A;  2VLU A;  4PNF A;  1SYX A;  1JZD A;  4I5Q A;  5EY6 A;  3M8N A;  1XG8 A;  2GQK A;  6GSW A;  2CVB A;  2N5B A;  4QQ7 A;  1FW1 A;  1GWC A;  3MDK A;  1TRW A;  1TU7 A;  3LFL A;  5A5K A;  1OE8 A;  1EEM A;  2JZS A;  3TJG A;  4MCU A;  1Z7P A;  3GV1 A;  4WF5 A;  4K5S A;  4O5Q A;  2O7K A;  3IPZ A;  4HQS A;  1HYU A;  3FZA A;  3UEM A;  4ACS A;  4L0W A;  2JSY A;  5GZZ B;  4HJ2 A;  3SWL A;  1YDK A;  1EV4 A;  3HCZ A;  2AYT A;  2YAN A;  2R6K A;  1W4V A;  1F37 A;  4G19 A;  1G6W A;  3C8E A;  5G2Z A;  1OE7 A;  3ZIT A;  2E7P A;  2E0Q A;  4TKY A;  3C71 A;  2LNS A;  2WUL A;  2YJH A;  2GSS A;  5H5S A;  1WWJ A;  4GXZ A;  4PUF C;  1J08 A;  1K0C A;  4JBB A;  3FK8 A;  4GCI A;  2DLX A;  6GST A;  1QFN A;  2H6Z A;  4E8H A;  1ZYN A;  4KE3 A;  2H0H A;  3TUE A;  5A4U A;  2VLT A;  3HDC A;  3LWA A;  3FMW A;  3IC4 A;  1U3I A;  3L78 A;  4ZIJ A;  5DAK A;  2C80 A;  3L4N A;  4V1A g;  3SBC A;  2HRK A;  2LRC A;  3CXG A;  1AUC A;  2DKH A;  3GIX A;  1TRS A;  1PL2 A;  3LQ7 A;  1ML6 A;  3ZVJ D;  1EOH A;  2YPM A;  3QAV A;  2Z9S A;  4Q5F A;  1WOU A;  5AIV A;  4EC0 A;  2PGT A;  2FLS A;  1XW6 A;  3GTU A;  3BD2 A;  5B8A A;  2KUC A;  2H0I A;  3AY8 A;  3KMN A;  1F2E A;  2B1K A;  1VF1 A;  1G7E A;  1O8X A;  5F0G A;  1IYH A;  5JWO B;  2GLR A;  2BMX A;  3M9J A;  4WXT A;  4TW5 A;  1XWB A;  2PVQ A;  1TI3 A;  4A5P A;  2E2M A;  5ECI B;  4OD7 A;  1K0O A;  3GFK A;  2XPE A;  2F8A A;  5D8I A;  4HUA A;  3LYP A;  1HQO A;  4TOP A;  3H8Q A;  2C8U A;  2H6X A;  2LQO A;  2FCH A;  3Q18 A;  3QCP A;  1HNA A;  3MYD A;  4MZB A;  1T8E B;  1TK5 B;  3EWL A;  4NHZ A;  1WP0 A;  3FZ4 A;  3C7M A;  2VL2 A;  2LQQ A;  2NDO A;  5INY A;  4OO5 A;  3BOA A;  1K0A A;  3UVH A;  2OBK A;  2HRA A;  2LJA A;  3EE2 A;  2WCI A;  1PKW A;  4HU7 A;  3KIJ A;  4OFM A;  2N5F A;  4D73 A;  3GKK A;  1URM A;  3R2Q A;  1O81 A;  4D73 B;  3Q6O A;  3G7I A;  1SD8 A;  2GT6 A;  2LEG A;  3GHA A;  2BTO T;  2A4V A;  5ECL B;  1XCC A;  3TKR A;  1JFU A;  1SL1 B;  1OKD A;  5BRT A;  4J56 E;  5EVO A;  4MJA A;  1YKA A;  1KBN A;  2PN8 A;  1Y6E A;  2R0G A;  1LBK A;  1TKD B;  2MMN A;  1PX7 A;  2LRN A;  3DWV A;  1A8L A;  1B4P A;  4LMV A;  3QDN A;  3WGD A;  1A24 A;  4ECI A;  4KSO A;  2YWO A;  5KEJ A;  2VLV A;  1TK0 B;  2JZT A;  1O85 A;  1GSD A;  1K3O A;  4IGJ A;  4I2U A;  4EVM A;  2V41 A;  1I9D A;  5AGY A;  1EP7 A;  1R26 A;  2R3X A;  1S3R A;  2A2S A;  5HR1 A;  4X43 A;  2CVD A;  1SD9 A;  20GS A;  2YZU A;  3IA1 A;  3QFB C;  3APQ A;  4BIK A;  3ED3 A;  2GVP A;  3HVV A;  2UZ8 A;  3FZ9 A;  4N10 A;  5CAX A;  4BWS A;  4MAB A;  4ZIL A;  2L6D A;  9GSS A;  4YQV A;  2GTU A;  2BJX A;  2OJL A;  2HZE B;  1K0B A;  3GNJ A;  3VWW A;  2H71 A;  1X9W B;  5G5F A;  4MH2 A;  1TI1 A;  4K2X A;  2VCV A;  4TXV A;  1SJZ A;  2LTK A;  1Z6N A;  3TKS A;  4MZW A;  3TDG A;  2B5E A;  2K8S A;  4X1U A;  1SKW B;  3KP8 A;  4I97 A;  5JCU A;  4AJ6 A;  4CDO A;  1EGR A;  4O32 A;  2P5R A;  2ZUP A;  3TKS C;  1XOB A;  4O5R A;  4XRD A;  5GAN D;  3F0I A;  5B7C A;  3CBU A;  5ECN B;  1O73 A;  1A0R P;  3P2A A;  2L5L A;  2O85 A;  3HZ4 A;  4POL A;  1K0M A;  1EP8 A;  4F0C A;  1KTE A;  5KN2 A;  1ST9 A;  3NZN A;  2R0P A;  1ERU A;  4F2I A;  1R7H A;  1M2D A;  3HJP A;  2MMZ A;  2LKU A;  4MZC A;  4QL9 A;  2PBJ A;  2IMF A;  3MAK A;  2CZ3 A;  4AJ7 A;  5G31 A;  4NAX A;  4MDC A;  4IQ1 A;  5AN1 A;  4JR6 A;  5IIZ A;  3FKF A;  5J41 A;  3P7X A;  4AGS A;  5HFI A;  3TJF A;  5IO2 A;  2AJQ B;  4POM A;  1HNB A;  1XWA A;  2XBQ A;  4KW6 A;  4BVY B;  2C4J A;  2LV3 A;  1MD3 A;  5CRE A;  3D6I A;  2VIM A;  3UBL A;  2HSM A;  3ZIV A;  3GH9 A;  3F4R A;  4ULX A;  2ZCT A;  3M3M A;  5IOX A;  5KN3 A;  1KEB A;  5LD0 A;  1B4Q A;  4KDX A;  4FIW A;  4Z2U A;  3FEU A;  3PH9 A;  3RHC A;  4KF9 A;  3TJJ A;  4E8E A;  4XS4 A;  4MH3 A;  4HZ2 A;  4ZB6 A;  3TRX A;  3IAM 2;  1GSF A;  1PQN A;  3HVX A;  4XS4 B;  1GSY A;  5ENU A;  2DMM A;  4PQH A;  4ML1 A;  5KOW A;  14GS A;  4TR4 A;  1DE2 A;  1B9X C;  4EKZ A;  3KXO A;  2YZH A;  4ZL8 A;  1XFL A;  3CSH A;  4PXO A;  4MLY A;  13GS A;  2VCT A;  2OE1 A;  1XVW A;  3IV4 A;  5IMZ A;  1V58 A;  1Z9H A;  2HRN A;  2VL3 A;  3TKP A;  4F03 A;  4FYU A;  4HS1 A;  4LMW A;  4CHS A;  2J23 A;  4PQ1 A;  1X5C A;  1GL8 A;  2MZC A;  1BG5 A;  5D9X A;  1ABA A;  1USB A;  4O92 A;  2PPT A;  1ON4 A;  1QQ2 A;  3GX8 A;  1SKS B;  3TGZ A;  2I9H A;  2IL3 A;  1S3D A;  3GMF A;  4GST A;  1Z5Y E;  4LL1 B;  4TN8 A;  2FNO A;  3MSZ A;  2G2Q A;  3KCM A;  2OE0 A;  2IN3 A;  2FUG 2; 
#chains in the Genus database with same CATH homology
 1NHY A;  1CQH A;  1A23 A;  3FY7 A;  1JZW A;  8GSS A;  1R5P A;  2C0F A;  3HD5 A;  3L9V A;  3LYK A;  4POK A;  2V1M A;  4BVX B;  4G9H A;  4L8E A;  1PN9 A;  3FRC A;  1MTC A;  1AIU A;  5L71 A;  4ZB8 A;  4IS0 A;  4N11 A;  4GQC A;  3QR6 A;  2V32 A;  3H1N A;  4OMV A;  5HR0 A;  4DSS B;  3KMO A;  3O76 A;  3QAG A;  2QA1 A;  5IMF A;  3VLN A;  4NHW A;  4DSQ A;  4TR1 A;  2K9F A;  5IPG A;  3DIE A;  3L9S A;  2HXK A;  1WJK A;  3M0F A;  3BJ5 A;  1JLV A;  4AF2 A;  2F9S A;  3ZFB A;  5EL8 A;  2J9H A;  1VGL A;  4TVE A;  5GSS A;  2AAW A;  2JAD A;  1Q4J A;  3FYG A;  1U3A A;  1UC7 A;  3IXR A;  2JL4 A;  3GYK A;  4G0I A;  1FB6 A;  1GSE A;  3DRN A;  2O87 A;  5B8B A;  1F6M C;  3F6F A;  1Z6M A;  1OAZ A;  2VUP A;  1V98 A;  4MNN A;  2KP1 A;  2LST A;  4KB3 A;  4JZQ A;  3GL5 A;  4EDZ A;  4MPG A;  4JED A;  5CRG A;  5D96 A;  1WRY A;  5CRW A;  3GA4 A;  1OVN A;  4GRF A;  1GTB A;  1BED A;  3GN3 A;  3IR4 A;  3UBK A;  2LS5 A;  4EIQ A;  3ZYW A;  2YV9 A;  2RUE A;  4K1F A;  2K18 A;  1PL1 A;  2FY6 A;  3IHQ A;  4WKW A;  5DCH A;  4NMU A;  5H5Q A;  1R4W A;  4YH2 A;  3F3R A;  3KH9 A;  1W89 A;  2CA8 A;  4GWR A;  5J4U A;  4POB A;  1XW5 A;  3EMX A;  3D21 A;  3EC3 A;  5ECH B;  5FHI A;  5DVB A;  3G7Y A;  4N30 A;  4LL4 B;  3TJB A;  1M99 A;  1AQW A;  5KOX A;  2CZ2 A;  3KGK A;  3UVT A;  3A5W A;  1SL2 B;  1TJD A;  4GF0 A;  4RUV A;  3VUR A;  3LSZ A;  5DDL A;  3TRQ A;  4IN0 A;  2CV4 A;  2ZNM A;  5B6N A;  4LLR A;  2RII A;  3JCM L;  4EF0 A;  1WPI A;  1AAZ A;  4WF4 A;  4YQU A;  4OFN A;  5CRD A;  2H6Y A;  6GSS A;  2CQ9 A;  5GAP D;  1YEX A;  4GLT A;  4L5L A;  3VI7 A;  5H5R A;  5FT3 A;  1H4O A;  5D9T A;  5J9B A;  3HY2 A;  3TB2 A;  4CY6 A;  2KP2 A;  1UA5 A;  4MMM A;  3E9J B;  3DVW A;  2CX4 A;  1GUK A;  2C1Y A;  2B1L A;  4RQR A;  3CRU A;  1GUL A;  2KOK A;  4WR4 A;  1E6B A;  4JRR A;  1EV9 A;  5ELA A;  2O89 A;  4IW9 A;  2GSR A;  4J2F A;  1V2A A;  1J9B A;  1SL0 B;  1BX9 A;  4DEJ A;  1MEK A;  5IMC A;  1GRX A;  4KCA A;  1A8Y A;  3HJM A;  3DXB A;  1Q98 A;  1TDI A;  3A3T A;  7GSS A;  5CNW A;  1XWG A;  3GRX A;  2I4A A;  4OFT A;  4PQI A;  12GS A;  2VL2 C;  1FOV A;  5JCW A;  1PMT A;  2X8C A;  1FOH A;  18GS A;  3EU4 A;  2IMI A;  1FHE A;  3LW9 A;  2AHE A;  1OC9 A;  3CRT A;  3QMX A;  2HSH A;  2GDR A;  1OC9 B;  4HEA 2;  2KLX A;  1BQ7 A;  4O7H A;  4TXO B;  4QL7 A;  1TRU A;  2HT9 A;  3M9K A;  5J3R A;  1EGO A;  1FAA A;  2OA7 A;  4NWY A;  1X5E A;  1AXD A;  4X4J A;  1HNC A;  5ABR A;  4I2T A;  4K7N A;  1XZO A;  1PGT A;  2WRT A;  3K8N A;  2R4V A;  3CSJ A;  1G6Y A;  1FVK A;  3C1S A;  3LXT A;  5DAL B;  5HR2 A;  2H01 A;  2RM6 A;  2HYX A;  3KZQ A;  2GZP A;  4MJC A;  2B5X A;  1PX6 A;  2QC7 A;  1ERW A;  1FO5 A;  3ZML A;  2D2Z A;  2X8G A;  3HXS A;  3FR9 A;  2M80 A;  3FW2 A;  3P90 A;  3UAR A;  1X5D A;  5ID2 B;  5IMD A;  5A4V A;  4K7O A;  4PTS A;  3I69 A;  3LJR A;  1A2L A;  4FH8 A;  1ERT A;  2ES7 A;  3WGX A;  1MDI A;  2FWG A;  3PIN A;  4GTU A;  1GTA A;  3DD3 A;  1V9W A;  3MWH A;  3WT2 A;  3KTB A;  2OBI A;  3NIV A;  4KX4 A;  3GSS A;  2EIO A;  4USS A;  1JZR A;  3ERG A;  3IAS 2;  2AUV A;  4ZL9 A;  5ECM B;  3OR5 A;  2HZE A;  3RPP A;  1TW9 A;  3APS A;  2YWN A;  1U88 A;  4DVC A;  2VCQ A;  2PVO C;  5IOW A;  4PX1 A;  1BYE A;  3IE3 A;  5AIX A;  1YF0 A;  2XPD A;  2GSQ A;  5IPH A;  2H76 A;  2LUS A;  2IMD A;  4N0V A;  3FHK A;  2O8V B;  3N9J A;  2GZZ A;  2VCZ A;  4Z2T A;  1ERV A;  3VK9 A;  4CW9 A;  2I1U A;  5F8B A;  1MDJ A;  1YJ6 A;  4ZB9 A;  4HU9 A;  3DML A;  1GP1 A;  4I8B A;  1A2J A;  4IEL A;  4KA0 A;  1AQX A;  1T7P B;  2PWJ A;  1G7O A;  2H74 A;  4GSS A;  1IYI A;  5F07 A;  3QAW A;  2C3T A;  3WYW A;  3DEX A;  2GZY A;  5DJM A;  1XVQ A;  2CAQ A;  2V2G A;  2B6M A;  2YWM A;  4BL7 A;  4OCE A;  4BL7 B;  4MF5 A;  3O3T A;  3IBH A;  2LNT A;  4BVY A;  2HNL A;  1GNW A;  2QSI A;  3DKS A;  4MA9 A;  3ERW A;  4FO5 A;  2C3N A;  3VWU A;  3VFI A;  3ZRE A;  2L6C A;  4WBJ A;  3P8W A;  2PER A;  5D9W A;  3F8U A;  2VD1 A;  4Q5N A;  1J0F A;  1GLQ A;  2FWE A;  2H1B A;  1F3B A;  4GQF A;  3EYT A;  3IDV A;  2FGX A;  3BCI A;  1ZCP A;  4K6X A;  2AV4 A;  1LU4 A;  3I43 A;  1PD2 1;  3N5O A;  2DBC A;  2GGT A;  1DSB A;  3QD9 A;  2M72 A;  4I6X A;  1MDK A;  2FHE A;  2HFD A;  2C0D A;  1OC8 A;  1NW2 A;  4JE1 A;  5BMU A;  3KD0 A;  3KEB A;  1WE0 A;  4GSN A;  4KND A;  1ZZY A;  2CX3 A;  4PGT A;  1XXU A;  1VF3 A;  4XHM A;  2P31 A;  3HZ8 A;  1FB0 A;  3L9U A;  5CYY A;  2YJ7 A;  4KCE A;  1OC3 A;  4MP4 A;  3D4M A;  1ZMA A;  4G0K A;  2ALB A;  4YQM A;  2IFQ B;  2YNX A;  3BBY A;  2X49 A;  3EUR A;  1UN2 A;  4H86 A;  3APO A;  1GTU A;  3C73 A;  4WET A;  4YAV A;  4BWQ A;  17GS A;  2X99 A;  5G1K A;  3MIX A;  3ZFL A;  4ECJ A;  2VOC A;  2M46 A;  6GSU A;  1QXH A;  1VF4 A;  2FWF A;  1PKZ A;  3ISO A;  2DML A;  3UAP A;  4BVX A;  1HD2 A;  4F82 A;  2DJK A;  2A2P A;  5F06 A;  3VPT A;  5C04 A;  2H0G A;  5G1L A;  3FR3 A;  3ZTL A;  4RI7 A;  3ZRD A;  3ZIJ A;  4DSS A;  2CAI A;  3EIN A;  6GSV A;  1WIK A;  1GNE A;  1AC1 A;  3IOS A;  3M1G A;  4MF6 A;  2X64 A;  2VM1 A;  3LGC A;  4JU5 A;  2HLS A;  4IBP A;  4YAP A;  1B9Y C;  3TKQ A;  2DJ2 A;  1LJR A;  1N8J A;  2RLI A;  1QMV A;  2YP6 A;  4N0Z A;  4K2D A;  2EIQ A;  2JSZ A;  3GKX A;  4XRA A;  1QUW A;  1SK1 A;  3W6G A;  1K3Y A;  3CTG A;  4NV5 A;  4NXI A;  1EOG A;  3GH6 A;  1K0D A;  4ID0 A;  4EIP A;  1B8X A;  4ECB A;  3DVX A;  4WBR D;  5IO0 A;  5ECP B;  2WS2 A;  4IQA A;  5CP1 A;  3CTF A;  5HFG A;  2DKI A;  1PSQ A;  1NSW A;  1PN0 A;  1Y25 A;  2K6V A;  3ME8 A;  5EPF A;  3KP9 A;  2H72 A;  1U87 A;  3D4T A;  1PRX A;  3PR8 A;  4IP6 A;  2HSY A;  3PGT A;  1FG4 A;  3RHB A;  4XTS A;  1R5A A;  2YOI A;  2XC2 A;  2A4H A;  4V2M A;  3DYR A;  4F0B A;  2OKA A;  2DJJ A;  1SK2 A;  3EPT A;  1V40 A;  4K0N A;  3CYN A;  4HDE A;  4XCS A;  1X9S B;  2VO4 A;  2AB6 A;  4ICY A;  5ECQ B;  3GUS A;  3I9V 2;  4IJI A;  1THO A;  3KM6 A;  2WZ9 A;  6GSX A;  1X9M B;  1SKR B;  2B5Y A;  2NPB A;  4HQZ A;  2VAF A;  4RI6 A;  1BJX A;  3H93 A;  5IQY A;  3LXZ A;  11GS A;  4ECC A;  4ZBB A;  2HE3 A;  4BA7 A;  1B48 A;  2VCX A;  5C00 A;  5JCG A;  1I5G A;  1GSQ A;  4MJE A;  3EVI A;  1XWK A;  2YV7 A;  4WR5 A;  1OKT A;  3L0H A;  1RQM A;  5DAK B;  2B7J A;  3ZVJ A;  3F6D A;  2WJU A;  3US3 A;  2VCW A;  3ME7 A;  1TU8 A;  2HI7 A;  2IJY A;  3F9U A;  3TCO A;  16GS A;  1ACV A;  1ZYP A;  2DJ3 A;  2HRF A;  2P5Q A;  2QKE A;  5LCZ A;  4WEY A;  1VRS D;  2MBS A;  4K0G A;  1GTI A;  1G0T A;  3GTU B;  3TJK A;  2V6O A;  2DJ1 A;  3LOR A;  1NM3 A;  1TTZ A;  3CMI A;  3WGE A;  1RK4 A;  5KN0 A;  1JLW A;  3IHG A;  5E4W A;  1YY7 A;  5DJL A;  3TKS E;  1AQV A;  1U6T A;  5HFK A;  3FZ5 A;  4EE0 A;  3HVS A;  1K0N A;  2FD3 A;  4EDY A;  2DC5 A;  1YZX A;  4HI7 A;  3R3E A;  3A2W A;  3QPM A;  2JZR A;  4P3Y B;  2WB9 A;  2B3S A;  2DJ0 A;  5GST A;  1O8W A;  2HZF A;  4MK3 A;  4K8M A;  2H1D A;  6GSY A;  1GUM A;  2K8V A;  5G5E A;  1SK0 A;  4TXO A;  2V6K A;  4ZBD A;  5DCG A;  4Q5Q A;  4IVF A;  3GKM A;  1NHO A;  1QK8 A;  3C1R A;  1TXX A;  2R37 A;  1CQG A;  2L5O A;  5IMA A;  2JAC A;  5JWR B;  1T00 A;  2IIY A;  4OO4 A;  1YF1 A;  1THX A;  4NV2 A;  5D93 A;  4IKH A;  2NBS A;  1Z7R A;  4ZXG A;  4ML6 A;  5DAL A;  3KTL A;  3DGQ A;  1YKC A;  1T4Z A;  4EXJ A;  4AJ8 A;  4ILF A;  4CY8 A;  4X0X A;  4ZBA A;  1O7U A;  3IK7 A;  5KN1 A;  3GX0 A;  2RM5 A;  3VWV A;  5D73 A;  3UOM A;  4L0U A;  2REM A;  3RBT A;  5D9V A;  5B6M A;  2H30 A;  3ZZX A;  1GSU A;  5ID2 A;  2P0G A;  2JU5 A;  1EWX A;  4MF7 A;  1XOA A;  4EO3 A;  3VWX A;  1AW9 A;  3E3E A;  3Q74 A;  5LNK e;  1TK8 B;  5ECS A;  2R5G A;  3IC8 A;  2B7K A;  1M2B A;  3F4S A;  3UMA A;  2H8L A;  3RPN A;  4KAE A;  1EZK A;  2GS3 A;  3PPU A;  2XHF A;  2C3Q A;  2YCD A;  1VF2 A;  2L59 A;  3NOF A;  3A2X A;  3IRA A;  3U6V A;  3RDW A;  2LJR A;  3F3Q A;  4KDU A;  1A2M A;  1XPV A;  1ZYQ B;  2WDU A;  3VI5 A;  2TRC P;  4O5U A;  1M0U A;  1S3C A;  5COH A;  3EU3 A;  1KNG A;  3I6A A;  1TP9 A;  4OWY A;  4FYC A;  2CT6 A;  3TRP A;  3D5J A;  4FQU A;  2G0F A;  3KJY A;  4PUA A;  1GLP A;  2TIR A;  1S3A A;  5A4W A;  3QFA C;  1TRV A;  3H4K A;  3W8J A;  3WD6 A;  10GS A;  2H70 A;  1FVJ A;  1M9A A;  1SU9 A;  1Z3E A;  4HZ4 A;  1ZL9 A;  4IP1 A;  5JWQ B;  3HYP A;  2H66 A;  4EUY A;  19GS A;  3F4T A;  1QGV A;  2C0G A;  2L57 A;  2MMA A;  3UL3 A;  5AIS A;  1YQ1 A;  3U5R E;  4G0L A;  1PA3 A;  1M9B A;  1XWC A;  2I3Y A;  2XBI A;  3MNG A;  2IPA A;  3D22 A;  3UJ1 A;  3UIW A;  3HA9 A;  5HQP A;  3V1W A;  2VD0 A;  3J7Y k;  2DIY A;  4Q5R A;  1DUG A;  3F63 A;  5ELG A;  2R0C A;  3ZMK A;  1M2A A;  1YEP A;  4V2L A;  4ISD A;  4XS1 A;  2L4Q A;  1T4Y A;  1V57 A;  3A2V A;  2YWI A;  3RAZ A;  3GUR A;  2R2J A;  1TOF A;  3Q19 A;  1GSS A;  2TRX A;  4YKG A;  2ON7 A;  3TOU A;  2FWH A;  3GKN A;  5CO3 A;  4FYB A;  3H79 A;  2H1A A;  2WGR A;  1C72 A;  5CRH A;  4LA1 A;  22GS A;  4MJB A;  3WT1 A;  3ERF A;  3IK9 A;  2KHP A;  2NTO A;  4KSM A;  1SJI A;  1OYJ A;  5ECR B;  3BCK A;  2WFC A;  2IWT A;  1DBY A;  4HOJ A;  4RQX A;  1RW1 A;  1T3B A;  2H1G A;  2IME A;  4ZL7 A;  5G30 A;  1EEJ A;  2NVL A;  2N5A A;  2DSA A;  3ZL5 A;  4EL1 A;  1XW9 A;  2DIZ A;  1GUH A;  1ILO A;  4G10 A;  2A2R A;  3J7Y b;  1X0R A;  1GH2 A;  1SJ6 A;  4TR0 A;  5FWG A;  2F8F A;  4XS6 A;  1SYR A;  5DBQ A;  5DQS A;  3GST A;  2ON5 A;  2QGV A;  1JHB A;  2E2G A;  2IFQ A;  3HJO A;  2FA4 A;  3D0Z A;  1F9M A;  1ZGN A;  2X4A A;  3A5I A;  2OE3 A;  4G2E A;  4PNG A;  2MBT A;  4DSR A;  3W8S A;  1A0F A;  2IMK A;  1DE1 A;  2OAC A;  1H75 A;  1T1V A;  2PUK C;  5J5N A;  2GT5 A;  3G7J A;  1N2A A;  2QA2 A;  4NPB A;  3LEF A;  2C0E A;  4K7I A;  3EMP A;  4XIH A;  3HKR A;  4K9Z A;  1ZOF A;  1JZO A;  1WMJ A;  5J9C A;  4MPF A;  1K3L A;  3E0U A;  4Z7X A;  4V1A p;  4J57 E;  2EC4 A;  2VM2 A;  3TOT A;  2MYG A;  4KUN A;  4JR4 A;  2VL9 A;  4TRX A;  4KH7 A;  2LJK A;  2LRT A;  2FA8 A;  1ZYE A;  1M7T A;  2L4C A;  2H19 A;  2PU9 C;  4IJ3 A;  1SEN A;  2MMO A;  4YKF A;  2GQM A;  3ZLP A;  2F3M A;  2H75 A;  4Z2R A;  2GST A;  2PMT A;  4IHU A;  2CVK A;  3S9F A;  5ECO B;  3KH7 A;  4PUR A;  5ECK B;  2H73 A;  5F05 A;  4BPY A;  3LG6 A;  1F3A A;  3CSI A;  3O6T A;  4KDY A;  3QOU A;  5DQY A;  2RUF A;  2I81 A;  2F51 A;  2GQL A;  1XBS A;  3GL3 A;  3VPQ A;  2YN1 A;  4V2N A;  1E2Y A;  5E59 A;  1O6J A;  4TR3 A;  1UVZ A;  4OCF A;  4TR1 B;  1MD4 A;  1XIY A;  3HHV A;  5HR3 A;  1BAY A;  2X8H A;  5IMV A;  3G9B A;  4KGI A;  2EIR A;  3FR6 A;  4K5R A;  4HJM A;  2OAD A;  5IM9 A;  4L5O A;  4F9Z A;  2VLU A;  4PNF A;  1SYX A;  1JZD A;  4I5Q A;  5EY6 A;  3M8N A;  2GQK A;  6GSW A;  2CVB A;  2N5B A;  4QQ7 A;  1FW1 A;  1GWC A;  3MDK A;  1TRW A;  1TU7 A;  3LFL A;  5A5K A;  1OE8 A;  1EEM A;  2JZS A;  3TJG A;  4MCU A;  1Z7P A;  3GV1 A;  4WF5 A;  4K5S A;  4O5Q A;  2O7K A;  3IPZ A;  4HQS A;  1HYU A;  3FZA A;  3UEM A;  4ACS A;  4L0W A;  2JSY A;  5GZZ B;  4HJ2 A;  3SWL A;  1YDK A;  1EV4 A;  3HCZ A;  2AYT A;  2YAN A;  2R6K A;  1W4V A;  1F37 A;  4G19 A;  1G6W A;  3C8E A;  5G2Z A;  1OE7 A;  3ZIT A;  2E7P A;  2E0Q A;  4TKY A;  3C71 A;  2LNS A;  2WUL A;  2YJH A;  2GSS A;  5H5S A;  1WWJ A;  4GXZ A;  4PUF C;  1J08 A;  1K0C A;  4JBB A;  3FK8 A;  4GCI A;  2DLX A;  6GST A;  1QFN A;  2H6Z A;  4E8H A;  1ZYN A;  4KE3 A;  2H0H A;  3TUE A;  5A4U A;  2VLT A;  3HDC A;  3LWA A;  3FMW A;  3IC4 A;  1U3I A;  3L78 A;  4ZIJ A;  5DAK A;  2C80 A;  3L4N A;  4V1A g;  3SBC A;  2HRK A;  2LRC A;  3CXG A;  1AUC A;  2DKH A;  3GIX A;  1TRS A;  1PL2 A;  3LQ7 A;  1ML6 A;  3ZVJ D;  1EOH A;  2YPM A;  3QAV A;  2Z9S A;  4Q5F A;  1WOU A;  5AIV A;  4EC0 A;  2PGT A;  2FLS A;  1XW6 A;  3GTU A;  3BD2 A;  5B8A A;  2KUC A;  2H0I A;  3AY8 A;  3KMN A;  1F2E A;  2B1K A;  1VF1 A;  1G7E A;  1O8X A;  5F0G A;  1IYH A;  5JWO B;  2GLR A;  2BMX A;  3M9J A;  4WXT A;  4TW5 A;  1XWB A;  2PVQ A;  1TI3 A;  4A5P A;  2E2M A;  5ECI B;  4OD7 A;  1K0O A;  3GFK A;  2XPE A;  2F8A A;  5D8I A;  4HUA A;  3LYP A;  1HQO A;  4TOP A;  3H8Q A;  2C8U A;  2H6X A;  2LQO A;  2FCH A;  3Q18 A;  3QCP A;  1HNA A;  3MYD A;  4MZB A;  1T8E B;  1TK5 B;  3EWL A;  4NHZ A;  1WP0 A;  3FZ4 A;  3C7M A;  2VL2 A;  2LQQ A;  2NDO A;  5INY A;  4OO5 A;  3BOA A;  1K0A A;  3UVH A;  2OBK A;  2HRA A;  2LJA A;  3EE2 A;  2WCI A;  1PKW A;  4HU7 A;  3KIJ A;  4OFM A;  2N5F A;  4D73 A;  3GKK A;  1URM A;  3R2Q A;  1O81 A;  4D73 B;  3Q6O A;  3G7I A;  1SD8 A;  2GT6 A;  2LEG A;  3GHA A;  2BTO T;  2A4V A;  5ECL B;  1XCC A;  3TKR A;  1JFU A;  1SL1 B;  1OKD A;  5BRT A;  4J56 E;  5EVO A;  4MJA A;  1YKA A;  1KBN A;  2PN8 A;  1Y6E A;  2R0G A;  1LBK A;  1TKD B;  2MMN A;  1PX7 A;  2LRN A;  3DWV A;  1A8L A;  1B4P A;  4LMV A;  3QDN A;  3WGD A;  1A24 A;  4ECI A;  4KSO A;  2YWO A;  5KEJ A;  2VLV A;  1TK0 B;  2JZT A;  1O85 A;  1GSD A;  1K3O A;  4IGJ A;  4I2U A;  4EVM A;  2V41 A;  1I9D A;  5AGY A;  1EP7 A;  1R26 A;  2R3X A;  2A2S A;  5HR1 A;  4X43 A;  2CVD A;  1SD9 A;  20GS A;  2YZU A;  3IA1 A;  3QFB C;  3APQ A;  3ED3 A;  2GVP A;  3HVV A;  2UZ8 A;  3FZ9 A;  4N10 A;  5CAX A;  4BWS A;  4MAB A;  4ZIL A;  2L6D A;  9GSS A;  4YQV A;  2GTU A;  2BJX A;  2OJL A;  2HZE B;  1K0B A;  3GNJ A;  3VWW A;  2H71 A;  1X9W B;  5G5F A;  4MH2 A;  1TI1 A;  4K2X A;  2VCV A;  4TXV A;  1SJZ A;  2LTK A;  1Z6N A;  3TKS A;  4MZW A;  3TDG A;  2B5E A;  2K8S A;  4X1U A;  1SKW B;  3KP8 A;  4I97 A;  5JCU A;  4AJ6 A;  4CDO A;  1EGR A;  4O32 A;  2P5R A;  2ZUP A;  3TKS C;  1XOB A;  4O5R A;  4XRD A;  5GAN D;  3F0I A;  5B7C A;  3CBU A;  5ECN B;  1O73 A;  1A0R P;  3P2A A;  2L5L A;  2O85 A;  3HZ4 A;  4POL A;  1K0M A;  1EP8 A;  4F0C A;  1KTE A;  5KN2 A;  1ST9 A;  3NZN A;  2R0P A;  1ERU A;  4F2I A;  1R7H A;  1M2D A;  3HJP A;  2MMZ A;  2LKU A;  4MZC A;  4QL9 A;  2PBJ A;  2IMF A;  3MAK A;  2CZ3 A;  4AJ7 A;  5G31 A;  4NAX A;  4MDC A;  4IQ1 A;  5AN1 A;  4JR6 A;  5IIZ A;  3FKF A;  5J41 A;  3P7X A;  4AGS A;  5HFI A;  3TJF A;  5IO2 A;  2AJQ B;  4POM A;  1HNB A;  1XWA A;  2XBQ A;  4KW6 A;  4BVY B;  2C4J A;  2LV3 A;  1MD3 A;  5CRE A;  3D6I A;  2VIM A;  3UBL A;  2HSM A;  3ZIV A;  3GH9 A;  3F4R A;  4ULX A;  2ZCT A;  3M3M A;  5IOX A;  5KN3 A;  1KEB A;  5LD0 A;  1B4Q A;  4KDX A;  4FIW A;  4Z2U A;  3FEU A;  3PH9 A;  3RHC A;  4KF9 A;  3TJJ A;  4E8E A;  4XS4 A;  4MH3 A;  4HZ2 A;  4ZB6 A;  3TRX A;  3IAM 2;  1GSF A;  1PQN A;  3HVX A;  4XS4 B;  1GSY A;  5ENU A;  2DMM A;  4PQH A;  4ML1 A;  5KOW A;  14GS A;  4TR4 A;  1DE2 A;  1B9X C;  4EKZ A;  3KXO A;  2YZH A;  4ZL8 A;  1XFL A;  3CSH A;  4PXO A;  4MLY A;  13GS A;  2VCT A;  2OE1 A;  1XVW A;  3IV4 A;  5IMZ A;  1V58 A;  1Z9H A;  2HRN A;  2VL3 A;  3TKP A;  4F03 A;  4FYU A;  4HS1 A;  4LMW A;  4CHS A;  2J23 A;  4PQ1 A;  1X5C A;  1GL8 A;  2MZC A;  1BG5 A;  5D9X A;  1ABA A;  1USB A;  4O92 A;  2PPT A;  1ON4 A;  1QQ2 A;  3GX8 A;  1SKS B;  3TGZ A;  2I9H A;  2IL3 A;  1S3D A;  3GMF A;  4GST A;  1Z5Y E;  4LL1 B;  4TN8 A;  2FNO A;  3MSZ A;  2G2Q A;  3KCM A;  2OE0 A;  2IN3 A;  2FUG 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...