3GH9A

Crystal structure of edta-treated bdbd (oxidised)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
186
structure length
186
Chain Sequence
b'NDAVSGQPSIKGQPVLGKDDAPVTVVEFGDYKCPSCKVFNSDIFPKIQKDFIDKGDVKFSFVNVMFHGKGSRLAALASEEVWKEDPDSFWDFHEKLFEKQPDTEQEWVTPGLLGDLAKSTTKIKPETLKENLDKETFASQVEKDSDLNQKMNIQATPTIYVNDKVIKNFADYDEIKETIEKELKGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Disulfide bond formation protein D
publication title Crystal Structure and Biophysical Properties of Bacillus subtilis BdbD: AN OXIDIZING THIOL:DISULFIDE OXIDOREDUCTASE CONTAINING A NOVEL METAL SITE
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 76
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3gh9A00
1XVWA 1EOGA 4X1UA 3WT1A 5HR3A 2GLRA 1XWCA 3QAVA 3NZNA 1B8XA 2I3YA 2EC4A 1XW5A 4DSSA 1T3BA 1OE7A 1QK8A 4I5QA 1VF2A 1G7OA 5ECLB 2OADA 2KOKA 1ZCPA 1EEJA 2ON5A 4EO3A 3IK9A 2R5GA 5DAKB 1N8JA 5IO2A 4WBJA 2GS3A 2X8GA 4ECBA 3D21A 3MNGA 1TW9A 3N9JA 2YOIA 2PVOC 5CRWA 2KP1A 1UA5A 4NV2A 2NDOA 4X43A 4YAPA 4FYUA 4LA1A 3WGXA 18GSA 3KP8A 2BJXA 1T8EB 1SU9A 3CYNA 2LSTA 5GSSA 5ECIB 22GSA 4ZL8A 4EXJA 4PGTA 4K0NA 1GSYA 3P90A 4HI7A 1KNGA 3LWAA 2HYXA 1VF4A 1IYIA 3MWHA 4Q5NA 4G2EA 5HFGA 4TOPA 3GL3A 2PMTA 5ECKB 3FZ5A 4TKYA 1GSFA 2FCHA 2IFQB 2FUG2 1ERVA 3FHKA 1T7PB 4I2TA 1BX9A 1TRUA 3DVWA 1AXDA 3APOA 2B1LA 3HZ4A 2B7JA 3KMNA 2VCQA 3UAPA 2IWTA 4X0XA 3ED3A 1H4OA 3HY2A 1V40A 1QGVA 1WJKA 2X8CA 1OKTA 2YV9A 4HUAA 1E2YA 4BVYA 2C0GA 4JRRA 3CSIA 3KP9A 3L0HA 2GQLA 4DVCA 5E59A 3APQA 4EDZA 4MLYA 2AUVA 2FA4A 4Z7XA 1ON4A 3H8QA 1AC1A 5J4UA 1FB6A 2V2GA 1OE8A 2TRXA 1ERTA 3TUEA 4O7HA 1BJXA 5G1LA 2L6DA 2YWMA 2FA8A 1GTBA 3QDNA 2YCDA 5IQYA 1ZMAA 3H4KA 3CTFA 3EWLA 1YJ6A 3FRCA 2XBQA 4AF2A 2JACA 2EIOA 2H1GA 5AISA 3NOFA 2OBIA 1X9MB 5KN2A 1AAZA 2HZEB 2C4JA 3K8NA 4O92A 1ZOFA 1ZL9A 3ME8A 2V41A 4TXOB 1LBKA 1YF1A 2VL2A 1BQ7A 4PX1A 4ZILA 2L57A 2IN3A 1R4WA 5A5KA 2VIMA 2B6MA 1Q4JA 4KDXA 5ABRA 1K0BA 2C1YA 1SL2B 1U87A 2H30A 3SWLA 5ECQB 3UEMA 2PBJA 5HR1A 1M2DA 3J7Yk 4FH8A 3CRTA 2JADA 3ZL5A 4BVXA 4FIWA 2H0IA 2CX4A 3TJJA 4POLA 6GSWA 4MCUA 2LKUA 1G6YA 3QPMA 2ON7A 1V58A 3UARA 4IKHA 4JU5A 4F0BA 5IMAA 1TU8A 2DMLA 2H1AA 4IBPA 5A4UA 4DEJA 3HVXA 2RUEA 1OKDA 3ZITA 2HXKA 3BD2A 3I69A 3VK9A 5KN0A 3DVXA 1PMTA 5KN3A 3GA4A 4L5LA 2R3XA 1RW1A 2QGVA 2R6KA 1SD8A 2NTOA 3GMFA 4HEA2 2H6YA 1MD3A 2LQQA 1EV9A 1LJRA 4ZB6A 4ACSA 2YNXA 4J56E 1ILOA 1WRYA 1J9BA 1GTUA 1YF0A 1SK0A 1OYJA 2DJKA 2V1MA 3Q6OA 3TKSE 4HQSA 5D96A 5IOWA 2VAFA 1GSEA 1PSQA 5FHIA 5ECMB 3RHCA 2PERA 1QXHA 4GTUA 4L8EA 1GWCA 1GRXA 3KJYA 4XHMA 4WBRD 2H1DA 2GZPA 5D73A 3IOSA 2H71A 4Q5QA 5GAND 2HFDA 3PR8A 4WXTA 3FYGA 2REMA 2H72A 1U3IA 4AJ7A 1FAAA 1AIUA 3GX0A 2CVDA 2Z9SA 3GL5A 1HNCA 4TR4A 1SKWB 1MTCA 4WEYA 1U88A 1PL1A 2MBSA 3VURA 2F3MA 4MP4A 4P3YB 3GH9A 5G2ZA 4EVMA 3E9JB 4HOJA 1TRVA 2GVPA 3KIJA 2HE3A 3C1RA 2AYTA 1AQXA 4MJCA 2VUPA 1S3DA 2FD3A 3IC4A 3ZIVA 4MK3A 1MDJA 1PRXA 5LD0A 5D9XA 4N0ZA 2FWHA 4OMVA 3D22A 3LQ7A 5CP1A 4JE1A 3VFIA 2G0FA 5GAPD 2A2SA 1PD21 1J0FA 5IMVA 5F0GA 1TOFA 4CHSA 1OC9B 2AAWA 5IPGA 1XW9A 3HZ8A 1GSSA 5JWOB 1SJZA 3TJFA 1J08A 2WRTA 4PQ1A 4GSNA 1V9WA 5DALA 2A4VA 4POBA 1WPIA 2WDUA 3GKXA 4FYCA 2IJYA 2DJ1A 2CT6A 1ERWA 2H0GA 4GRFA 4XCSA 3W6GA 1UN2A 1AQVA 4ZBDA 2DC5A 3RHBA 3P2AA 4GLTA 1XWAA 3Q74A 3ZLPA 5CRDA 4WETA 1YDKA 3L9UA 4HZ2A 5JWQB 2E7PA 3ERWA 2B5XA 2LS5A 1H75A 3DWVA 4I97A 4MZWA 1HNAA 4MZBA 4HQZA 4NV5A 5DQSA 3C71A 3VPTA 3GSSA 2HZFA 1XPVA 1B9YC 1C72A 2MZCA 4D73B 3C73A 2GSTA 3G7JA 5D93A 4V2LA 1K3OA 2P31A 1PX6A 2M72A 3ZTLA 1NM3A 1A8LA 3U5RE 4EKZA 3FZAA 3O3TA 2JL4A 3GNJA 2H8LA 3BOAA 2X99A 4NHZA 3DMLA 2VCWA 4TN8A 5H5RA 2B1KA 1OC8A 2M46A 4BL7A 5H5SA 4TR1B 3GKMA 10GSA 2P5RA 2C0EA 4LL4B 2V6KA 4WKWA 1Z6MA 2MBTA 2C80A 4NWYA 2YPMA 6GSTA 1GNWA 2IIYA 1KTEA 5IM9A 3F6FA 2DJ0A 3G7YA 1GH2A 4LL1B 4TVEA 1O85A 3FKFA 5JCUA 2MMZA 2H01A 2JSZA 5CRHA 4MF5A 3EVIA 2VL3A 2GTUA 1G0TA 3CRUA 2LJKA 2O87A 1CQHA 3ZFBA 4I2UA 1JZOA 1R26A 1I5GA 1THXA 2C0DA 2EIQA 1RQMA 1WP0A 1TDIA 2GSQA 2AJQB 3IPZA 4XS6A 2H75A 1Z3EA 5J5NA 2KP2A 4POMA 1YEPA 1UVZA 4GSTA 2F9SA 2H6ZA 2ZNMA 1BEDA 3E3EA 4MF6A 1TI1A 3W8JA 3MDKA 1K0OA 4K1FA 2O7KA 4K2DA 5HFIA 4HDEA 5ECNB 14GSA 3GN3A 3FR9A 5J9CA 5ECRB 1PA3A 1FB0A 3IR4A 3UBKA 3EMXA 4N0VA 2F51A 3D5JA 1NHOA 3I9V2 2KHPA 5LCZA 3I43A 1WWJA 3KCMA 4KCEA 2JSYA 4LLRA 5ID2A 1K0MA 2JZTA 3GKNA 4KUNA 5AGYA 1HNBA 4I6XA 1K0NA 1QUWA 3IRAA 4XIHA 4KNDA 1SL0B 3JCML 2K8SA 1SD9A 2H0HA 2BTOT 3M9KA 5GZZB 2K6VA 2TRCP 3UIWA 4ISDA 3LFLA 4IELA 3KGKA 4HU7A 1LU4A 1NHYA 3DD3A 3IXRA 3H93A 3QOUA 3QFAC 2IMIA 2MMNA 5EY6A 5CYYA 1W4VA 2GZZA 3G9BA 2PGTA 3ZREA 4V2NA 3FR3A 1GSQA 1F37A 3IHQA 3UMAA 4AJ6A 1WE0A 2G2QA 3LGCA 4DSRA 2IMEA 1ZGNA 2AV4A 4RQRA 2VL9A 3TGZA 4E8EA 1OC9A 4MH3A 3I6AA 3F8UA 1M2BA 3TRPA 3US3A 1UC7A 5DALB 2YJ7A 1B48A 4PQIA 3L9SA 1ABAA 2LNSA 4K8MA 2LRTA 3HD5A 4L0UA 1DBYA 3H79A 4O5RA 2ZUPA 4GF0A 2OE3A 2L59A 4WF5A 4IGJA 3QAGA 2OKAA 3SBCA 4ML6A 2P0GA 4ID0A 2DSAA 3CMIA 2GQKA 1EV4A 1M9BA 4G10A 4PXOA 4TW5A 1JLWA 4HJMA 4GCIA 1HQOA 3MSZA 5B8BA 2CA8A 2K9FA 1BAYA 2XHFA 4ML1A 1EP8A 1WMJA 5ECSA 8GSSA 2IPAA 1EZKA 4ZB8A 4D73A 2X64A 2C0FA 3VI7A 2FGXA 2H76A 5IMCA 3TKSA 4BWQA 1T4YA 2ALBA 3RPNA 2YJHA 2TIRA 3F4RA 4KH7A 3DEXA 4N11A 2PVQA 4FO5A 5EVOA 1FW1A 1I9DA 5DJMA 5B6MA 4KGIA 4TR1A 2HRFA 3QFBC 4IP1A 2VL2C 2RM6A 2E2GA 4YH2A 1EOHA 3WD6A 3EU4A 3Q19A 5G31A 4JR4A 3QAWA 3HDCA 5L71A 2DLXA 1GULA 1B9XC 4NHWA 1JFUA 4G19A 1T1VA 1JZDA 5LNKe 4OCFA 2V6OA 3QMXA 2QSIA 11GSA 4JBBA 4PNFA 2MMOA 2D2ZA 3M3MA 9GSSA 1TK8B 4EL1A 5HQPA 1WIKA 2EIRA 3L9VA 4OCEA 4XS4B 2IL3A 3MAKA 3CTGA 1O8XA 3TDGA 1A2JA 1ZYEA 3UVTA 2VM1A 1TI3A 2LRNA 4K6XA 2CVBA 2BMXA 3IV4A 3IBHA 1B4QA 3ERGA 3TKQA 1S3CA 1XOBA 3C7MA 2L5LA 4XRDA 5ID2B 3ERFA 3F3QA 5CNWA 5E4WA 2CV4A 3DRNA 1X5DA 3A2WA 1FG4A 4EC0A 1XWKA 3LXTA 5KN1A 1XVQA 4K0GA 4PNGA 5DCHA 4ZBAA 1G7EA 3L78A 2R2JA 4MA9A 2H74A 4YAVA 4ZL7A 20GSA 4OO4A 5ENUA 1R5AA 3DGQA 1YKAA 4OO5A 3M1GA 6GSSA 4TR3A 5AIVA 4JZQA 3W8SA 2VD0A 3C1SA 1PKWA 2YWOA 3LYKA 2B5EA 2QKEA 1X9WB 4XS1A 4KAEA 2NBSA 3FK8A 3PH9A 3LJRA 2WZ9A 5DVBA 2VLVA 4QQ7A 2GGTA 5IMZA 4EE0A 3DYRA 4Q5FA 3TJKA 3GURA 3G7IA 1EP7A 4GSSA 4IQ1A 5D9VA 2OE0A 4HZ4A 4K7OA 3QR6A 5JWRB 1FO5A 3HJMA 2O8VB 3LSZA 5AIXA 1FVKA 1VF1A 3UOMA 4F0CA 2PPTA 4OFTA 1USBA 3WGEA 2PUKC 3HHVA 4MPGA 1V57A 3HYPA 1X5EA 1FHEA 2DJ2A 1GLPA 5GSTA 2DBCA 3EINA 5ECHB 4MZCA 2AB6A 1SK1A 3GHAA 1N2AA 1K3LA 3CXGA 2VLTA 3UBLA 5DDLA 3HCZA 4IP6A 2LNTA 4L0WA 3VWUA 2LTKA 1G6WA 1R7HA 3QD9A 1U6TA 3D6IA 3KH7A 2RM5A 1SYRA 2VD1A 5IOXA 5IIZA 1XCCA 1GTIA 5F05A 3N5OA 1ZYQB 1JHBA 2L6CA 2FY6A 4IJIA 3F4SA 1TTZA 3UVHA 3IK7A 6GSVA 5DCGA 2A2RA 1O73A 2F8AA 4KX4A 1VF3A 3BJ5A 2GZYA 3VWVA 1PN9A 2O85A 2YN1A 1PX7A 1X0RA 4RUVA 3IA1A 2WGRA 4TXVA 2RUFA 4O32A 3VWWA 16GSA 5IMDA 4ECJA 3ZRDA 1TRWA 4F82A 3IAM2 1NSWA 2YZHA 4KE3A 1TP9A 1M7TA 3R2QA 4LMVA 5CRGA 1O6JA 4WF4A 1Z6NA 2GSRA 2YWNA 1PQNA 1TKDB 1O8WA 2I4AA 3BBYA 2CAQA 3F3RA 1K0DA 1ZZYA 1F3BA 2VCXA 2NPBA 1BG5A 2WJUA 4OD7A 1V2AA 1XXUA 5DQYA 2VCZA 3FZ4A 1AQWA 3V1WA 1T00A 2GDRA 1K0AA 2B5YA 2WFCA 4ECCA 1DSBA 2FWGA 3KTLA 4KW6A 1RK4A 3KD0A 4V1Ap 3FEUA 1IYHA 3PGTA 4XS4A 4OFNA 2M80A 3ZVJA 2IMKA 1GSDA 2WS2A 2YZUA 3GTUB 2LV3A 3KTBA 2HSYA 3J7Yb 1FVJA 1JLVA 4ILFA 2YV7A 3A3TA 4ZBBA 2L4CA 5KEJA 2HSHA 2CAIA 4QL9A 4KSOA 4EDYA 3M0FA 2PU9C 2DMMA 2HNLA 1SJIA 2I9HA 4ZIJA 3NIVA 1SKRB 2HLSA 2OBKA 3LG6A 3F4TA 2C3TA 2WB9A 1F9MA 2XBIA 3TKRA 1PGTA 3ISOA 2YANA 4WR4A 2RLIA 1SK2A 3CBUA 2N5FA 4CDOA 3ZYWA 4EF0A 3EURA 1T4ZA 1XWBA 1XW6A 3KEBA 1U3AA 1F3AA 3EE2A 3ZZXA 2KLXA 2FNOA 4E8HA 1SYXA 3L4NA 2LJRA 1B4PA 1SL1B 5CAXA 4G9HA 1BYEA 1JZWA 1M0UA 5A4VA 2LEGA 1ERUA 4WR5A 17GSA 1EGRA 1PL2A 2H19A 1XBSA 1SKSB 2RIIA 4YQVA 2DJ3A 2F8FA 2OE1A 1CQGA 1W89A 2P5QA 5CREA 4F03A 3S9FA 1TRSA 3TOUA 3GSTA 1TXXA 4BPYA 4MJBA 3LORA 4I8BA 3FW2A 4AGSA 2DJJA 5G1KA 3D0ZA 1HD2A 3GX8A 2K8VA 2DIZA 4DSQA 3FR6A 4ZXGA 1QQ2A 3FY7A 3UJ1A 1Y6EA 2GT5A 4KB3A 4GQCA 3WYWA 1TU7A 4L5OA 4PUFC 4BWSA 4J2FA 4ZL9A 3M8NA 1GUMA 1NW2A 4K7IA 3A2XA 2VO4A 4GQFA 1QMVA 4QL7A 2N5AA 5IO0A 4K7NA 3DIEA 4XRAA 2K18A 2R4VA 4H86A 3TKPA 1XWGA 2L4QA 1GSUA 3FZ9A 4HS1A 2V32A 4EUYA 4MF7A 4OWYA 3C8EA 2L5OA 4RI6A 2XPEA 6GSYA 3F63A 2IMDA 2XPDA 5HR0A 3TRXA 4J57E 4KDYA 4NMUA 2PWJA 2VOCA 5HR2A 4KA0A 5INYA 4MH2A 4TRXA 2N5BA 1OAZA 1V98A 5COHA 1TJDA 2C3NA 1THOA 4N30A 2X8HA 4ECIA 3TKSC 2VCVA 4IVFA 1F2EA 1Z9HA 4RI7A 4IHUA 1A8YA 2JU5A 1VGLA 3KM6A 2MYGA 3EYTA 2HI7A 3EU3A 1F6MC 5ECOB 3RDWA 2E2MA 1GLQA 5G5EA 1GL8A 3A5WA 1O7UA 4XTSA 4POKA 3TCOA 3KZQA 3CSHA 2MMAA 5C04A 4ZB9A 3RPPA 1YY7A 2FHEA 4YQUA 3U6VA 3KH9A 2O89A 2CX3A 5G5FA 2B3SA 4JR6A 1MEKA 2WULA 3VWXA 1AUCA 2VM2A 4NPBA 5EPFA 3TRQA 1MDKA 3AY8A 3F6DA 3HJPA 4MJEA 3ZVJD 1YEXA 2JZSA 13GSA 7GSSA 1YZXA 4NAXA 2DIYA 2HRNA 1MDIA 2FWEA 4LMWA 4IJ3A 4F2IA 2OA7A 2OJLA 3O6TA 1X9SB 1GUHA 4PURA 3VI5A 3GTUA 3UL3A 1GP1A 4DSSB 3TOTA 3P7XA 1O81A 3PINA 4PUAA 1JZRA 2CZ2A 3F0IA 4PQHA 3P8WA 1M99A 3TB2A 1ST9A 1Z7RA 2H1BA 5A4WA 5DAKA 3DXBA 4KSMA 1X5CA 3ZFLA 5ELGA 3ZIJA 2KUCA 4F9ZA 4IW9A 2PN8A 2WCIA 2GT6A 3E0UA 5D9WA 5H5QA 5DBQA 4GWRA 1DE2A 5DJLA 3LEFA 3ME7A 3D4TA 5F07A 1A24A 2H70A 1DUGA 5C00A 2CVKA 1SENA 2VLUA 2R37A 5ECPB 4MMMA 4YQMA 2ES7A 2IFQA 4K9ZA 1KBNA 4IS0A 4KCAA 5B8AA 2I81A 4RQXA 3QCPA 2VCTA 5G30A 5F06A 5CO3A 2FLSA 1ML6A 1M2AA 1WOUA 2I1UA 1OVNA 1GTAA 1K0CA 2YP6A 3GKKA 4BA7A 1OC3A 1EEMA 3M9JA 5J41A 4IQAA 3HXSA 3Q18A 3H1NA 1URMA 3IE3A 3HVVA 3IAS2 5EL8A 1R5PA 3APSA 3DKSA 3GH6A 5AN1A 2E0QA 1E6BA 4JEDA 2ZCTA 3KXOA 3D4MA 2FWFA 2CQ9A 3LXZA 5J9BA 3GYKA 3GIXA 1XZOA 1AW9A 2IMFA 1A23A 2LQOA 4V2MA 1EGOA 3EC3A 3EMPA 5D9TA 3F9UA 2CZ3A 2C8UA 1EWXA 4MABA 3HVSA 2JZRA 1M9AA 1A0FA 3HKRA 4HJ2A 2C3QA 2AHEA 2NVLA 6GSUA 3LYPA 4ULXA 1TK5B 2HZEA 2J9HA 3TJGA 2LJAA 1A2MA 1KEBA 1GNEA 4TXOA 1S3AA 4MDCA 1Q98A 1A0RP 2J23A 3CSJA 3ZMLA 2QC7A 4GXZA 2H6XA 5IMFA 5F8BA 5B7CA 1K3YA 3BCIA 4KDUA 4TR0A 3BCKA 4AJ8A 1HYUA 2GQMA 1Y25A 1XIYA 2GSSA 5J3RA 4MPFA 2HT9A 3VLNA 1A2LA 2LUSA 3GFKA 1Z5YE 1SJ6A 1Z7PA 3VPQA 2YWIA 5IPHA 1MD4A 1VRSD 3HJOA 4FYBA 4IN0A 3WGDA 3OR5A 1GUKA 3HA9A 4HU9A 4Q5RA 3RAZA 2H73A 3GUSA 5ELAA 1QFNA 5B6NA 2B7KA 5FWGA 5D8IA 4N10A 4V1Ag 3A2VA 2LRCA 19GSA 3IDVA 3GV1A 1YQ1A 2OACA 5JCWA 1PKZA 3RBTA 1XFLA 3ZMKA 1YKCA 4OFMA 5FT3A 3GRXA 2XC2A 1DE1A 3WT2A 1TK0B 4NXIA 3TJBA 3KMOA 6GSXA 1XOAA 12GSA 3O76A 4MJAA 1ACVA 4CW9A 2H66A 5JCGA 5HFKA 1FOVA
chains in the Genus database with same CATH superfamily
1XVWA 1EOGA 4X1UA 3WT1A 5HR3A 2GLRA 1XWCA 3QAVA 3NZNA 1B8XA 2I3YA 2EC4A 1XW5A 4DSSA 1T3BA 1OE7A 1QK8A 4I5QA 1VF2A 1G7OA 5ECLB 5BRTA 2OADA 2KOKA 1ZCPA 1EEJA 2ON5A 4EO3A 3IK9A 2R5GA 4EIPA 5DAKB 1N8JA 5IO2A 4WBJA 2GS3A 2X8GA 4ECBA 3D21A 3MNGA 1TW9A 3N9JA 2YOIA 2PVOC 5CRWA 2KP1A 1UA5A 4NV2A 2NDOA 4X43A 4YAPA 4FYUA 4LA1A 3WGXA 18GSA 3KP8A 2BJXA 1T8EB 1SU9A 3CYNA 2LSTA 5GSSA 5ECIB 22GSA 4ZL8A 4EXJA 4PGTA 4K0NA 1GSYA 3P90A 4HI7A 1KNGA 3LWAA 2HYXA 1VF4A 1IYIA 3MWHA 4Q5NA 4G2EA 5HFGA 4TOPA 3GL3A 2PMTA 5ECKB 3FZ5A 4TKYA 1GSFA 2FCHA 2IFQB 2FUG2 1ERVA 3FHKA 1T7PB 4I2TA 1BX9A 1TRUA 3DVWA 1AXDA 3APOA 2B1LA 3HZ4A 2B7JA 3KMNA 2VCQA 3UAPA 2IWTA 4X0XA 3ED3A 1H4OA 3HY2A 1V40A 1QGVA 1WJKA 2X8CA 1OKTA 2YV9A 4Z2TA 4HUAA 1E2YA 4BVYA 2C0GA 4JRRA 3R3EA 3CSIA 3KP9A 3L0HA 2GQLA 4DVCA 5E59A 3APQA 4EDZA 4MLYA 2AUVA 4MNNA 2FA4A 4Z7XA 1ON4A 3H8QA 1AC1A 5J4UA 1FB6A 2V2GA 1OE8A 2TRXA 1ERTA 3TUEA 4O7HA 1BJXA 4X4JA 5G1LA 2L6DA 2YWMA 2FA8A 1GTBA 3QDNA 2YCDA 4ICYA 5IQYA 1ZMAA 3H4KA 1PN0A 3CTFA 3EWLA 1YJ6A 3FRCA 2XBQA 4AF2A 2JACA 2EIOA 2H1GA 5AISA 4O5UA 3NOFA 2OBIA 1X9MB 5KN2A 1AAZA 2HZEB 2C4JA 3K8NA 4O92A 1ZOFA 1ZL9A 3ME8A 2V41A 4TXOB 1LBKA 1YF1A 2VL2A 1BQ7A 4PX1A 4ZILA 2L57A 2IN3A 1R4WA 5A5KA 2VIMA 2B6MA 1Q4JA 4KDXA 5ABRA 1K0BA 2C1YA 1SL2B 1U87A 2H30A 3SWLA 4BL7B 5ECQB 3UEMA 2PBJA 5HR1A 1M2DA 3J7Yk 4FH8A 3CRTA 2JADA 3ZL5A 4BVXA 4FIWA 2H0IA 2CX4A 3TJJA 4POLA 6GSWA 4MCUA 2LKUA 1G6YA 3QPMA 2ON7A 1V58A 3UARA 4IKHA 4JU5A 4F0BA 5IMAA 1TU8A 2DMLA 2H1AA 4IBPA 5A4UA 4DEJA 3HVXA 2RUEA 1OKDA 3ZITA 2HXKA 3BD2A 3I69A 3VK9A 5KN0A 3DVXA 1PMTA 5KN3A 3GA4A 4L5LA 2R3XA 1RW1A 2QGVA 2R6KA 1SD8A 2NTOA 4HEA2 3GMFA 4EIQA 2H6YA 1MD3A 2LQQA 1EV9A 1LJRA 4ZB6A 4ACSA 3FMWA 2YNXA 4J56E 1ILOA 1WRYA 1J9BA 1GTUA 1YF0A 1SK0A 1OYJA 2DJKA 2V1MA 3Q6OA 3TKSE 4HQSA 5D96A 5IOWA 2VAFA 1GSEA 1PSQA 3IC8A 5FHIA 5ECMB 3RHCA 2PERA 1QXHA 4GTUA 4L8EA 1GWCA 1GRXA 3KJYA 4XHMA 4WBRD 2H1DA 2GZPA 5D73A 3IOSA 2H71A 4Q5QA 5GAND 2HFDA 3PR8A 4WXTA 3FYGA 2REMA 2H72A 5KOWA 1U3IA 4AJ7A 1FAAA 1AIUA 4USSA 3GX0A 2CVDA 2Z9SA 3GL5A 1HNCA 3IHGA 4TR4A 1SKWB 1MTCA 4WEYA 1U88A 1PL1A 2A2PA 2MBSA 3VURA 2F3MA 4MP4A 4P3YB 3GH9A 5G2ZA 4EVMA 3E9JB 4HOJA 1TRVA 2GVPA 3KIJA 2HE3A 3C1RA 2AYTA 1AQXA 4MJCA 2VUPA 1S3DA 2FD3A 3IC4A 3ZIVA 1FOHA 4MK3A 1MDJA 1PRXA 5LD0A 5D9XA 4N0ZA 2FWHA 4OMVA 3D22A 3LQ7A 5CP1A 4JE1A 3VFIA 2G0FA 5GAPD 2A2SA 1PD21 1J0FA 5IMVA 5F0GA 1TOFA 4CHSA 1OC9B 2AAWA 5IPGA 1XW9A 2HSMA 3HZ8A 1GSSA 5JWOB 1SJZA 3TJFA 1J08A 2WRTA 4PQ1A 4HSCX 4GSNA 1V9WA 5DALA 2A4VA 4POBA 1WPIA 2WDUA 3GKXA 4FYCA 2IJYA 2DJ1A 2CT6A 1ERWA 2H0GA 1M3JA 4GRFA 4XCSA 3W6GA 1UN2A 1AQVA 4ZBDA 4FQUA 2DC5A 3RHBA 3P2AA 4GLTA 1XWAA 3Q74A 3ZLPA 5CRDA 4WETA 1YDKA 3L9UA 4HZ2A 5JWQB 2E7PA 3ERWA 3MYDA 2B5XA 2LS5A 1H75A 3DWVA 4I97A 4MZWA 1HNAA 4MZBA 4HQZA 4NV5A 5DQSA 3C71A 3VPTA 3GSSA 2HZFA 1XPVA 1B9YC 1C72A 2MZCA 4D73B 3C73A 2GSTA 3G7JA 5D93A 4V2LA 1K3OA 2P31A 1PX6A 2M72A 3ZTLA 1NM3A 1A8LA 3U5RE 4EKZA 3FZAA 3O3TA 2JL4A 3GNJA 2H8LA 3BOAA 2X99A 4NHZA 3DMLA 2VCWA 4TN8A 5H5RA 2B1KA 1OC8A 2M46A 4BL7A 5H5SA 4TR1B 3GKMA 10GSA 1XG8A 2P5RA 4BVXB 2C0EA 4LL4B 2V6KA 4WKWA 1Z6MA 2MBTA 2C80A 4NWYA 2YPMA 6GSTA 1GNWA 2IIYA 1KTEA 4K5SA 5IM9A 3F6FA 2DJ0A 3G7YA 1GH2A 4LL1B 4TVEA 1O85A 3FKFA 5JCUA 2MMZA 2H01A 2JSZA 5CRHA 4MF5A 3EVIA 2VL3A 2GTUA 1G0TA 3CRUA 2LJKA 2O87A 1CQHA 3ZFBA 4I2UA 1JZOA 1R26A 1I5GA 1THXA 2C0DA 2EIQA 1RQMA 1WP0A 1TDIA 2GSQA 2AJQB 3IPZA 4XS6A 3PPUA 2H75A 1Z3EA 5J5NA 2KP2A 4POMA 1YEPA 1UVZA 4GSTA 2F9SA 2H6ZA 2ZNMA 1BEDA 3E3EA 4MF6A 1TI1A 3W8JA 3MDKA 1K0OA 4K1FA 2O7KA 4K2DA 5HFIA 4HDEA 5ECNB 14GSA 3GN3A 4YKGA 3FR9A 5J9CA 5ECRB 1PA3A 1FB0A 3IR4A 3UBKA 3EMXA 4N0VA 2F51A 3D5JA 1NHOA 3I9V2 2KHPA 5LCZA 3I43A 1WWJA 3KCMA 4KCEA 2JSYA 4LLRA 5ID2A 1K0MA 2JZTA 3GKNA 4KUNA 5AGYA 1HNBA 4I6XA 1K0NA 1QUWA 3IRAA 4XIHA 4KNDA 1SL0B 3JCML 2K8SA 1SD9A 2H0HA 2BTOT 3M9KA 5GZZB 2K6VA 2TRCP 3UIWA 4ISDA 3LFLA 4IELA 3KGKA 4HU7A 1LU4A 1NHYA 3DD3A 3IXRA 3H93A 3QOUA 3QFAC 2IMIA 2MMNA 5EY6A 5CYYA 1W4VA 2GZZA 3G9BA 2PGTA 3ZREA 4V2NA 3FR3A 1GSQA 3CQFA 1F37A 3IHQA 3UMAA 4AJ6A 1WE0A 2G2QA 3LGCA 4DSRA 2IMEA 1ZGNA 2AV4A 4RQRA 2VL9A 2R0CA 3TGZA 4E8EA 1OC9A 4MH3A 3I6AA 3F8UA 1M2BA 3TRPA 3US3A 1UC7A 5DALB 2YJ7A 1B48A 4PQIA 3L9SA 1ABAA 2LNSA 4K8MA 2LRTA 3HD5A 4KF9A 4L0UA 1DBYA 3H79A 4O5RA 2ZUPA 4GF0A 2OE3A 2L59A 4WF5A 4IGJA 3QAGA 2OKAA 3SBCA 4ML6A 2P0GA 4ID0A 2DSAA 3CMIA 2GQKA 1EV4A 1M9BA 4G10A 4PXOA 4TW5A 4CY6A 1JLWA 4HJMA 4GCIA 1HQOA 3MSZA 5B8BA 2CA8A 2K9FA 1BAYA 2R0GA 2XHFA 4ML1A 1EP8A 1WMJA 5ECSA 8GSSA 2IPAA 1EZKA 4ZB8A 4D73A 2X64A 2C0FA 3VI7A 2FGXA 2H76A 5IMCA 3TKSA 4BWQA 1T4YA 2ALBA 3RPNA 2YJHA 3EPTA 2TIRA 3F4RA 4KH7A 3DEXA 4N11A 2PVQA 4FO5A 5EVOA 1FW1A 1I9DA 5DJMA 5B6MA 4KGIA 4TR1A 2HRFA 3QFBC 4IP1A 2VL2C 2RM6A 2E2GA 4YH2A 1EOHA 3WD6A 3EU4A 2HRKA 3Q19A 5G31A 4JR4A 3QAWA 3HDCA 5L71A 2DLXA 1GULA 1B9XC 4NHWA 1JFUA 4G19A 1T1VA 1JZDA 5LNKe 4OCFA 2V6OA 3QMXA 2QSIA 11GSA 4JBBA 4PNFA 2MMOA 2D2ZA 3M3MA 9GSSA 1TK8B 4EL1A 5HQPA 1WIKA 4G0LA 2EIRA 3L9VA 4OCEA 4XS4B 2IL3A 3MAKA 3CTGA 1O8XA 3TDGA 1A2JA 1ZYEA 3UVTA 2VM1A 1TI3A 2LRNA 4K6XA 2CVBA 2BMXA 3IV4A 3IBHA 1B4QA 3ERGA 3TKQA 1S3CA 1XOBA 3C7MA 2L5LA 4XRDA 5ID2B 3ERFA 3F3QA 5CNWA 5E4WA 2CV4A 3DRNA 1X5DA 3A2WA 1FG4A 4EC0A 1XWKA 3LXTA 5KN1A 1XVQA 4K0GA 4PNGA 2A4HA 5DCHA 4ZBAA 1G7EA 3L78A 2R2JA 4MA9A 2H74A 4YAVA 4ZL7A 20GSA 4OO4A 5ENUA 1R5AA 3DGQA 1YKAA 4OO5A 3M1GA 6GSSA 4TR3A 5AIVA 4JZQA 3W8SA 2VD0A 3C1SA 1PKWA 2YWOA 3LYKA 2B5EA 2QKEA 1X9WB 4XS1A 4KAEA 2NBSA 3FK8A 3PH9A 3LJRA 3A5IA 2WZ9A 5DVBA 4K2XA 2VLVA 4QQ7A 2GGTA 5IMZA 4EE0A 3DYRA 4Q5FA 3TJKA 3GURA 3G7IA 1EP7A 4GSSA 4IQ1A 3HVNA 5D9VA 2OE0A 4HZ4A 4K7OA 3QR6A 5JWRB 1FO5A 3HJMA 2O8VB 3LSZA 5AIXA 1FVKA 1VF1A 3UOMA 4F0CA 2PPTA 4OFTA 1USBA 3WGEA 2PUKC 3HHVA 4MPGA 1V57A 3HYPA 1X5EA 1FHEA 2DJ2A 1GLPA 5GSTA 1M3IA 2DBCA 3EINA 5ECHB 4MZCA 2AB6A 1SK1A 3GHAA 1N2AA 1K3LA 3CXGA 2VLTA 3UBLA 5DDLA 3HCZA 4IP6A 2LNTA 4L0WA 3VWUA 2LTKA 1G6WA 1R7HA 3QD9A 1U6TA 3D6IA 3KH7A 2RM5A 1SYRA 2VD1A 5IOXA 5IIZA 1XCCA 1GTIA 5F05A 3N5OA 1ZYQB 4YKFA 1JHBA 2L6CA 2DKIA 2FY6A 4IJIA 3F4SA 1TTZA 3UVHA 3IK7A 6GSVA 5DCGA 2A2RA 1O73A 2F8AA 4KX4A 1VF3A 3BJ5A 2GZYA 3VWVA 1PN9A 2O85A 2YN1A 1PX7A 1X0RA 4RUVA 3IA1A 2WGRA 4TXVA 2RUFA 4O32A 3VWWA 16GSA 5IMDA 4ECJA 3ZRDA 1TRWA 4F82A 3IAM2 1NSWA 2X4AA 2YZHA 4KE3A 1TP9A 1M7TA 3R2QA 4LMVA 5CRGA 1O6JA 4WF4A 1Z6NA 2GSRA 2YWNA 1PQNA 1TKDB 1O8WA 2I4AA 3BBYA 2CAQA 3F3RA 1K0DA 1ZZYA 1F3BA 2VCXA 2NPBA 1BG5A 2WJUA 4OD7A 1V2AA 1XXUA 5DQYA 2VCZA 3FZ4A 1AQWA 3V1WA 1T00A 2GDRA 1K0AA 2B5YA 2WFCA 4ECCA 1DSBA 2FWGA 3KTLA 4KW6A 1RK4A 2R0PA 3KD0A 4V1Ap 3FEUA 2QA2A 1IYHA 3PGTA 4XS4A 4OFNA 2M80A 3ZVJA 2IMKA 1S3RA 1GSDA 2WS2A 2YZUA 3GTUB 2LV3A 3KTBA 2HSYA 3J7Yb 1FVJA 1JLVA 4ILFA 2YV7A 3A3TA 4ZBBA 2L4CA 5KEJA 2HSHA 2CAIA 4QL9A 4KSOA 4EDYA 3M0FA 2PU9C 2DMMA 2HNLA 1SJIA 2I9HA 4ZIJA 3NIVA 1SKRB 2HLSA 2OBKA 3LG6A 3F4TA 2C3TA 2WB9A 1F9MA 2XBIA 3TKRA 1PGTA 3ISOA 3MIXA 2YANA 4WR4A 2RLIA 1SK2A 3CBUA 2N5FA 4CDOA 3ZYWA 4EF0A 4G0IA 3EURA 1T4ZA 1XWBA 1XW6A 3KEBA 1U3AA 1F3AA 3EE2A 3ZZXA 2KLXA 2FNOA 4E8HA 1SYXA 3L4NA 2LJRA 1B4PA 1SL1B 5CAXA 4G9HA 1BYEA 1JZWA 1M0UA 5A4VA 2LEGA 1ERUA 4WR5A 5KOXA 17GSA 1EGRA 1PL2A 2H19A 1XBSA 1SKSB 2RIIA 4YQVA 2DJ3A 2F8FA 2OE1A 1CQGA 1W89A 2P5QA 5CREA 4F03A 3S9FA 4Z2UA 1TRSA 3TOUA 3GSTA 1TXXA 4BPYA 4MJBA 3LORA 4I8BA 3FW2A 4AGSA 2DJJA 5G1KA 3D0ZA 1HD2A 3GX8A 2K8VA 2DIZA 4DSQA 3FR6A 4ZXGA 1QQ2A 3FY7A 3UJ1A 1Y6EA 2GT5A 4KB3A 4GQCA 3WYWA 1TU7A 4L5OA 4PUFC 4BWSA 4J2FA 4ZL9A 3M8NA 1GUMA 1NW2A 4K7IA 3A2XA 2VO4A 4GQFA 1QMVA 4QL7A 2N5AA 5IO0A 4K7NA 3DIEA 4XRAA 2K18A 2R4VA 4H86A 3TKPA 1XWGA 2L4QA 1GSUA 3FZ9A 4O5QA 4HS1A 2V32A 4EUYA 4MF7A 4OWYA 3C8EA 2L5OA 4RI6A 2XPEA 6GSYA 1ZYNA 3F63A 2IMDA 2XPDA 5HR0A 3TRXA 4J57E 4KDYA 4NMUA 2PWJA 2VOCA 5HR2A 4KA0A 5INYA 4MH2A 4TRXA 2N5BA 1OAZA 1V98A 5COHA 1TJDA 2C3NA 1THOA 4N30A 2X8HA 4ECIA 3TKSC 2VCVA 4IVFA 1F2EA 1Z9HA 4RI7A 4PTSA 4IHUA 1A8YA 2JU5A 1VGLA 3KM6A 2MYGA 3EYTA 2HI7A 3EU3A 1F6MC 5ECOB 3RDWA 2E2MA 1GLQA 5G5EA 4K5RA 1GL8A 3A5WA 1O7UA 4XTSA 5BMUA 4POKA 3TCOA 3KZQA 3CSHA 2MMAA 5C04A 4ZB9A 3RPPA 1YY7A 2FHEA 4YQUA 3U6VA 3KH9A 2O89A 2CX3A 5G5FA 2B3SA 4JR6A 1MEKA 2WULA 3VWXA 1AUCA 2VM2A 4NPBA 5EPFA 3TRQA 1MDKA 3AY8A 3F6DA 3HJPA 4MJEA 3ZVJD 1YEXA 2JZSA 13GSA 7GSSA 1YZXA 4NAXA 2DIYA 2HRNA 1MDIA 2FWEA 4LMWA 4IJ3A 4F2IA 2OA7A 2OJLA 3O6TA 1X9SB 1GUHA 4PURA 3VI5A 3GTUA 3UL3A 1GP1A 4DSSB 3TOTA 3P7XA 1O81A 3PINA 4PUAA 1JZRA 2CZ2A 3F0IA 4PQHA 3P8WA 1M99A 3TB2A 1ST9A 1Z7RA 2H1BA 5A4WA 5DAKA 3DXBA 4KSMA 1X5CA 3ZFLA 5ELGA 3ZIJA 1PFOA 2KUCA 2DKHA 4F9ZA 4IW9A 2PN8A 2WCIA 2GT6A 3E0UA 5D9WA 5H5QA 5DBQA 4GWRA 1DE2A 5DJLA 3LEFA 4Z2RA 3ME7A 3D4TA 5F07A 1A24A 2H70A 1DUGA 5C00A 2CVKA 1SENA 2VLUA 2R37A 5ECPB 4MMMA 4YQMA 2ES7A 2IFQA 4K9ZA 1KBNA 4IS0A 4KCAA 5B8AA 2I81A 4RQXA 3QCPA 2VCTA 5G30A 5F06A 5CO3A 2FLSA 1ML6A 1M2AA 1WOUA 2I1UA 1OVNA 4A5PA 1GTAA 1K0CA 4BVYB 2YP6A 3GKKA 4BA7A 1OC3A 1EEMA 3M9JA 5J41A 4IQAA 3HXSA 3Q18A 3H1NA 1URMA 3IE3A 3HVVA 3IAS2 5EL8A 1R5PA 3APSA 3DKSA 3GH6A 5AN1A 2E0QA 1E6BA 4JEDA 2ZCTA 3KXOA 3D4MA 2FWFA 2QA1A 2CQ9A 3LXZA 5J9BA 3GYKA 3GIXA 1XZOA 1AW9A 2IMFA 1A23A 2HRAA 2LQOA 4V2MA 1EGOA 3EC3A 3EMPA 5D9TA 3F9UA 2CZ3A 1ZYPA 2C8UA 1EWXA 4MABA 3HVSA 2JZRA 1M9AA 1A0FA 3HKRA 4HJ2A 2C3QA 2AHEA 2NVLA 6GSUA 3LYPA 4ULXA 1TK5B 2HZEA 2J9HA 3TJGA 2LJAA 1A2MA 1KEBA 1GNEA 4TXOA 1S3AA 4MDCA 1Q98A 1A0RP 2J23A 3CSJA 3ZMLA 4BIKA 2QC7A 4GXZA 2H6XA 5IMFA 3LW9A 5F8BA 5B7CA 1K3YA 3BCIA 4KDUA 4TR0A 3BCKA 4AJ8A 1HYUA 2GQMA 1Y25A 1XIYA 2UZ8A 2GSSA 5J3RA 4MPFA 2HT9A 3VLNA 1A2LA 2LUSA 3GFKA 1Z5YE 1SJ6A 1Z7PA 3VPQA 2YWIA 5IPHA 1MD4A 1VRSD 3HJOA 4FYBA 4IN0A 3WGDA 3OR5A 1GUKA 3HA9A 4HU9A 4Q5RA 3RAZA 2H73A 3GUSA 5ELAA 1QFNA 5B6NA 2B7KA 5FWGA 5D8IA 4N10A 4V1Ag 3A2VA 2LRCA 19GSA 3IDVA 3GV1A 1YQ1A 2OACA 4G0KA 5JCWA 2X49A 1PKZA 4CY8A 3RBTA 1XFLA 3ZMKA 1YKCA 4OFMA 5FT3A 3GRXA 2XC2A 1DE1A 3WT2A 1TK0B 4NXIA 3TJBA 3KMOA 6GSXA 1XOAA 12GSA 3O76A 4MJAA 1ACVA 4CW9A 2H66A 5JCGA 5HFKA 1FOVA
chains in the Genus database with same CATH topology
1XVWA 1EOGA 4X1UA 3WT1A 5HR3A 2GLRA 1XWCA 3QAVA 3NZNA 1B8XA 2I3YA 2EC4A 1XW5A 4DSSA 1T3BA 1OE7A 1QK8A 4I5QA 1VF2A 1G7OA 5ECLB 5BRTA 2OADA 2KOKA 1ZCPA 1EEJA 2ON5A 4EO3A 3IK9A 2R5GA 4EIPA 5DAKB 1N8JA 5IO2A 4WBJA 2GS3A 2X8GA 4ECBA 3D21A 3MNGA 1TW9A 3N9JA 2YOIA 2PVOC 5CRWA 2KP1A 1UA5A 4NV2A 2NDOA 4X43A 4YAPA 4FYUA 4LA1A 3WGXA 18GSA 3KP8A 2BJXA 1T8EB 1SU9A 3CYNA 2LSTA 5GSSA 5ECIB 22GSA 4ZL8A 4EXJA 4PGTA 4K0NA 1GSYA 3P90A 4HI7A 1KNGA 3LWAA 2HYXA 1VF4A 1IYIA 3MWHA 4Q5NA 4G2EA 5HFGA 4TOPA 3GL3A 2PMTA 5ECKB 3FZ5A 4TKYA 1GSFA 2FCHA 2IFQB 2FUG2 1ERVA 3FHKA 1T7PB 4I2TA 1BX9A 1TRUA 3DVWA 1AXDA 3APOA 2B1LA 3HZ4A 2B7JA 3KMNA 2VCQA 3UAPA 2IWTA 4X0XA 3ED3A 1H4OA 3HY2A 1V40A 1QGVA 1WJKA 2X8CA 1OKTA 2YV9A 4Z2TA 4HUAA 1E2YA 4BVYA 2C0GA 4JRRA 3R3EA 3CSIA 3KP9A 3L0HA 2GQLA 4DVCA 5E59A 3APQA 4EDZA 4MLYA 2AUVA 4MNNA 2FA4A 4Z7XA 1ON4A 3H8QA 1AC1A 5J4UA 1FB6A 2V2GA 1OE8A 2TRXA 1ERTA 3TUEA 4O7HA 1BJXA 4X4JA 5G1LA 2L6DA 2YWMA 2FA8A 1GTBA 3QDNA 2YCDA 4ICYA 5IQYA 1ZMAA 3H4KA 1PN0A 3CTFA 3EWLA 1YJ6A 3FRCA 2XBQA 4AF2A 2JACA 2EIOA 2H1GA 5AISA 4O5UA 3NOFA 2OBIA 1X9MB 5KN2A 1AAZA 2HZEB 2C4JA 3K8NA 4O92A 1ZOFA 1ZL9A 3ME8A 2V41A 4TXOB 1LBKA 1YF1A 2VL2A 1BQ7A 4PX1A 4ZILA 2L57A 2IN3A 1R4WA 5A5KA 2VIMA 2B6MA 1Q4JA 4KDXA 5ABRA 1K0BA 2C1YA 1SL2B 1U87A 2H30A 3SWLA 4BL7B 5ECQB 3UEMA 2PBJA 5HR1A 1M2DA 3J7Yk 4FH8A 3CRTA 2JADA 3ZL5A 4BVXA 4FIWA 2H0IA 2CX4A 3TJJA 4POLA 6GSWA 4MCUA 2LKUA 1G6YA 3QPMA 2ON7A 1V58A 3UARA 4IKHA 4JU5A 4F0BA 5IMAA 1TU8A 2DMLA 2H1AA 4IBPA 5A4UA 4DEJA 3HVXA 2RUEA 1OKDA 3ZITA 2HXKA 3BD2A 3I69A 3VK9A 5KN0A 3DVXA 1PMTA 5KN3A 3GA4A 4L5LA 2R3XA 1RW1A 2QGVA 2R6KA 1SD8A 2NTOA 4HEA2 3GMFA 4EIQA 2H6YA 1MD3A 2LQQA 1EV9A 1LJRA 4ZB6A 4ACSA 3FMWA 2YNXA 4J56E 1ILOA 1WRYA 1J9BA 1GTUA 1YF0A 1SK0A 1OYJA 2DJKA 2V1MA 3Q6OA 3TKSE 4HQSA 5D96A 5IOWA 2VAFA 1GSEA 1PSQA 3IC8A 5FHIA 5ECMB 3RHCA 2PERA 1QXHA 4GTUA 4L8EA 1GWCA 1GRXA 3KJYA 4XHMA 4WBRD 2H1DA 2GZPA 5D73A 3IOSA 2H71A 4Q5QA 5GAND 2HFDA 3PR8A 4WXTA 3FYGA 2REMA 2H72A 5KOWA 1U3IA 4AJ7A 1FAAA 1AIUA 4USSA 3GX0A 2CVDA 2Z9SA 3GL5A 1HNCA 3IHGA 4TR4A 1SKWB 1MTCA 4WEYA 1U88A 1PL1A 2A2PA 2MBSA 3VURA 2F3MA 4MP4A 4P3YB 3GH9A 5G2ZA 4EVMA 3E9JB 4HOJA 1TRVA 2GVPA 3KIJA 2HE3A 3C1RA 2AYTA 1AQXA 4MJCA 2VUPA 1S3DA 2FD3A 3IC4A 3ZIVA 1FOHA 4MK3A 1MDJA 1PRXA 5LD0A 5D9XA 4N0ZA 2FWHA 4OMVA 3D22A 3LQ7A 5CP1A 4JE1A 3VFIA 2G0FA 5GAPD 2A2SA 1PD21 1J0FA 5IMVA 5F0GA 1TOFA 4CHSA 1OC9B 2AAWA 5IPGA 1XW9A 2HSMA 3HZ8A 1GSSA 5JWOB 1SJZA 3TJFA 1J08A 2WRTA 4PQ1A 4GSNA 1V9WA 5DALA 2A4VA 4POBA 1WPIA 2WDUA 3GKXA 4FYCA 2IJYA 2DJ1A 2CT6A 1ERWA 2H0GA 4GRFA 4XCSA 3W6GA 1UN2A 1AQVA 4ZBDA 4FQUA 2DC5A 3RHBA 3P2AA 4GLTA 1XWAA 3Q74A 3ZLPA 5CRDA 4WETA 1YDKA 3L9UA 4HZ2A 5JWQB 2E7PA 3ERWA 3MYDA 2B5XA 2LS5A 1H75A 3DWVA 4I97A 4MZWA 1HNAA 4MZBA 4HQZA 4NV5A 5DQSA 3C71A 3VPTA 3GSSA 2HZFA 1XPVA 1B9YC 1C72A 2MZCA 4D73B 3C73A 2GSTA 3G7JA 5D93A 4V2LA 1K3OA 2P31A 1PX6A 2M72A 3ZTLA 1NM3A 1A8LA 3U5RE 4EKZA 3FZAA 3O3TA 2JL4A 3GNJA 2H8LA 3BOAA 2X99A 4NHZA 3DMLA 2VCWA 4TN8A 5H5RA 2B1KA 1OC8A 2M46A 4BL7A 5H5SA 4TR1B 3GKMA 10GSA 2P5RA 4BVXB 2C0EA 4LL4B 2V6KA 4WKWA 1Z6MA 2MBTA 2C80A 4NWYA 2YPMA 6GSTA 1GNWA 2IIYA 1KTEA 4K5SA 5IM9A 3F6FA 2DJ0A 3G7YA 1GH2A 4LL1B 4TVEA 1O85A 3FKFA 5JCUA 2MMZA 2H01A 2JSZA 5CRHA 4MF5A 3EVIA 2VL3A 2GTUA 1G0TA 3CRUA 2LJKA 2O87A 1CQHA 3ZFBA 4I2UA 1JZOA 1R26A 1I5GA 1THXA 2C0DA 2EIQA 1RQMA 1WP0A 1TDIA 2GSQA 2AJQB 3IPZA 4XS6A 3PPUA 2H75A 1Z3EA 5J5NA 2KP2A 4POMA 1YEPA 1UVZA 4GSTA 2F9SA 2H6ZA 2ZNMA 1BEDA 3E3EA 4MF6A 1TI1A 3W8JA 3MDKA 1K0OA 4K1FA 2O7KA 4K2DA 5HFIA 4HDEA 5ECNB 14GSA 3GN3A 4YKGA 3FR9A 5J9CA 5ECRB 1PA3A 1FB0A 3IR4A 3UBKA 3EMXA 4N0VA 2F51A 3D5JA 1NHOA 3I9V2 2KHPA 5LCZA 3I43A 1WWJA 3KCMA 4KCEA 2JSYA 4LLRA 5ID2A 1K0MA 2JZTA 3GKNA 4KUNA 5AGYA 1HNBA 4I6XA 1K0NA 1QUWA 3IRAA 4XIHA 4KNDA 1SL0B 3JCML 2K8SA 1SD9A 2H0HA 2BTOT 3M9KA 5GZZB 2K6VA 2TRCP 3UIWA 4ISDA 3LFLA 4IELA 3KGKA 4HU7A 1LU4A 1NHYA 3DD3A 3IXRA 3H93A 3QOUA 3QFAC 2IMIA 2MMNA 5EY6A 5CYYA 1W4VA 2GZZA 3G9BA 2PGTA 3ZREA 4V2NA 3FR3A 1GSQA 1F37A 3IHQA 3UMAA 4AJ6A 1WE0A 2G2QA 3LGCA 4DSRA 2IMEA 1ZGNA 2AV4A 4RQRA 2VL9A 2R0CA 3TGZA 4E8EA 1OC9A 4MH3A 3I6AA 3F8UA 1M2BA 3TRPA 3US3A 1UC7A 5DALB 2YJ7A 1B48A 4PQIA 3L9SA 1ABAA 2LNSA 4K8MA 2LRTA 3HD5A 4KF9A 4L0UA 1DBYA 3H79A 4O5RA 2ZUPA 4GF0A 2OE3A 2L59A 4WF5A 4IGJA 3QAGA 2OKAA 3SBCA 4ML6A 2P0GA 4ID0A 2DSAA 3CMIA 2GQKA 1EV4A 1M9BA 4G10A 4PXOA 4TW5A 4CY6A 1JLWA 4HJMA 4GCIA 1HQOA 3MSZA 5B8BA 2CA8A 2K9FA 1BAYA 2R0GA 2XHFA 4ML1A 1EP8A 1WMJA 5ECSA 8GSSA 2IPAA 1EZKA 4ZB8A 4D73A 2X64A 2C0FA 3VI7A 2FGXA 2H76A 5IMCA 3TKSA 4BWQA 1T4YA 2ALBA 3RPNA 2YJHA 3EPTA 2TIRA 3F4RA 4KH7A 3DEXA 4N11A 2PVQA 4FO5A 5EVOA 1FW1A 1I9DA 5DJMA 5B6MA 4KGIA 4TR1A 2HRFA 3QFBC 4IP1A 2VL2C 2RM6A 2E2GA 4YH2A 1EOHA 3WD6A 3EU4A 2HRKA 3Q19A 5G31A 4JR4A 3QAWA 3HDCA 5L71A 2DLXA 1GULA 1B9XC 4NHWA 1JFUA 4G19A 1T1VA 1JZDA 5LNKe 4OCFA 2V6OA 3QMXA 2QSIA 11GSA 4JBBA 4PNFA 2MMOA 2D2ZA 3M3MA 9GSSA 1TK8B 4EL1A 5HQPA 1WIKA 4G0LA 2EIRA 3L9VA 4OCEA 4XS4B 2IL3A 3MAKA 3CTGA 1O8XA 3TDGA 1A2JA 1ZYEA 3UVTA 2VM1A 1TI3A 2LRNA 4K6XA 2CVBA 2BMXA 3IV4A 3IBHA 1B4QA 3ERGA 3TKQA 1S3CA 1XOBA 3C7MA 2L5LA 4XRDA 5ID2B 3ERFA 3F3QA 5CNWA 5E4WA 2CV4A 3DRNA 1X5DA 3A2WA 1FG4A 4EC0A 1XWKA 3LXTA 5KN1A 1XVQA 4K0GA 4PNGA 2A4HA 5DCHA 4ZBAA 1G7EA 3L78A 2R2JA 4MA9A 2H74A 4YAVA 4ZL7A 20GSA 4OO4A 5ENUA 1R5AA 3DGQA 1YKAA 4OO5A 3M1GA 6GSSA 4TR3A 5AIVA 4JZQA 3W8SA 2VD0A 3C1SA 1PKWA 2YWOA 3LYKA 2B5EA 2QKEA 1X9WB 4XS1A 4KAEA 2NBSA 3FK8A 3PH9A 3LJRA 3A5IA 2WZ9A 5DVBA 4K2XA 2VLVA 4QQ7A 2GGTA 5IMZA 4EE0A 3DYRA 4Q5FA 3TJKA 3GURA 3G7IA 1EP7A 4GSSA 4IQ1A 5D9VA 2OE0A 4HZ4A 4K7OA 3QR6A 5JWRB 1FO5A 3HJMA 2O8VB 3LSZA 5AIXA 1FVKA 1VF1A 3UOMA 4F0CA 2PPTA 4OFTA 1USBA 3WGEA 2PUKC 3HHVA 4MPGA 1V57A 3HYPA 1X5EA 1FHEA 2DJ2A 1GLPA 5GSTA 2DBCA 3EINA 5ECHB 4MZCA 2AB6A 1SK1A 3GHAA 1N2AA 1K3LA 3CXGA 2VLTA 3UBLA 5DDLA 3HCZA 4IP6A 2LNTA 4L0WA 3VWUA 2LTKA 1G6WA 1R7HA 3QD9A 1U6TA 3D6IA 3KH7A 2RM5A 1SYRA 2VD1A 5IOXA 5IIZA 1XCCA 1GTIA 5F05A 3N5OA 1ZYQB 4YKFA 1JHBA 2L6CA 2DKIA 2FY6A 4IJIA 3F4SA 1TTZA 3UVHA 3IK7A 6GSVA 5DCGA 2A2RA 1O73A 2F8AA 4KX4A 1VF3A 3BJ5A 2GZYA 3VWVA 1PN9A 2O85A 2YN1A 1PX7A 1X0RA 4RUVA 3IA1A 2WGRA 4TXVA 2RUFA 4O32A 3VWWA 16GSA 5IMDA 4ECJA 3ZRDA 1TRWA 4F82A 3IAM2 1NSWA 2X4AA 2YZHA 4KE3A 1TP9A 1M7TA 3R2QA 4LMVA 5CRGA 1O6JA 4WF4A 1Z6NA 2GSRA 2YWNA 1PQNA 1TKDB 1O8WA 2I4AA 3BBYA 2CAQA 3F3RA 1K0DA 1ZZYA 1F3BA 2VCXA 2NPBA 1BG5A 2WJUA 4OD7A 1V2AA 1XXUA 5DQYA 2VCZA 3FZ4A 1AQWA 3V1WA 1T00A 2GDRA 1K0AA 2B5YA 2WFCA 4ECCA 1DSBA 2FWGA 3KTLA 4KW6A 1RK4A 2R0PA 3KD0A 4V1Ap 3FEUA 2QA2A 1IYHA 3PGTA 4XS4A 4OFNA 2M80A 3ZVJA 2IMKA 1GSDA 2WS2A 2YZUA 3GTUB 2LV3A 3KTBA 2HSYA 3J7Yb 1FVJA 1JLVA 4ILFA 2YV7A 3A3TA 4ZBBA 2L4CA 5KEJA 2HSHA 2CAIA 4QL9A 4KSOA 4EDYA 3M0FA 2PU9C 2DMMA 2HNLA 1SJIA 2I9HA 4ZIJA 3NIVA 1SKRB 2HLSA 2OBKA 3LG6A 3F4TA 2C3TA 2WB9A 1F9MA 2XBIA 3TKRA 1PGTA 3ISOA 3MIXA 2YANA 4WR4A 2RLIA 1SK2A 3CBUA 2N5FA 4CDOA 3ZYWA 4EF0A 4G0IA 3EURA 1T4ZA 1XWBA 1XW6A 3KEBA 1U3AA 1F3AA 3EE2A 3ZZXA 2KLXA 2FNOA 4E8HA 1SYXA 3L4NA 2LJRA 1B4PA 1SL1B 5CAXA 4G9HA 1BYEA 1JZWA 1M0UA 5A4VA 2LEGA 1ERUA 4WR5A 5KOXA 17GSA 1EGRA 1PL2A 2H19A 1XBSA 1SKSB 2RIIA 4YQVA 2DJ3A 2F8FA 2OE1A 1CQGA 1W89A 2P5QA 5CREA 4F03A 3S9FA 4Z2UA 1TRSA 3TOUA 3GSTA 1TXXA 4BPYA 4MJBA 3LORA 4I8BA 3FW2A 4AGSA 2DJJA 5G1KA 3D0ZA 1HD2A 3GX8A 2K8VA 2DIZA 4DSQA 3FR6A 4ZXGA 1QQ2A 3FY7A 3UJ1A 1Y6EA 2GT5A 4KB3A 4GQCA 3WYWA 1TU7A 4L5OA 4PUFC 4BWSA 4J2FA 4ZL9A 3M8NA 1GUMA 1NW2A 4K7IA 3A2XA 2VO4A 4GQFA 1QMVA 4QL7A 2N5AA 5IO0A 4K7NA 3DIEA 4XRAA 2K18A 2R4VA 4H86A 3TKPA 1XWGA 2L4QA 1GSUA 3FZ9A 4O5QA 4HS1A 2V32A 4EUYA 4MF7A 4OWYA 3C8EA 2L5OA 4RI6A 2XPEA 6GSYA 1ZYNA 3F63A 2IMDA 2XPDA 5HR0A 3TRXA 4J57E 4KDYA 4NMUA 2PWJA 2VOCA 5HR2A 4KA0A 5INYA 4MH2A 4TRXA 2N5BA 1OAZA 1V98A 5COHA 1TJDA 2C3NA 1THOA 4N30A 2X8HA 4ECIA 3TKSC 2VCVA 4IVFA 1F2EA 1Z9HA 4RI7A 4PTSA 4IHUA 1A8YA 2JU5A 1VGLA 3KM6A 2MYGA 3EYTA 2HI7A 3EU3A 1F6MC 5ECOB 3RDWA 2E2MA 1GLQA 5G5EA 4K5RA 1GL8A 3A5WA 1O7UA 4XTSA 5BMUA 4POKA 3TCOA 3KZQA 3CSHA 2MMAA 5C04A 4ZB9A 3RPPA 1YY7A 2FHEA 4YQUA 3U6VA 3KH9A 2O89A 2CX3A 5G5FA 2B3SA 4JR6A 1MEKA 2WULA 3VWXA 1AUCA 2VM2A 4NPBA 5EPFA 3TRQA 1MDKA 3AY8A 3F6DA 3HJPA 4MJEA 3ZVJD 1YEXA 2JZSA 13GSA 7GSSA 1YZXA 4NAXA 2DIYA 2HRNA 1MDIA 2FWEA 4LMWA 4IJ3A 4F2IA 2OA7A 2OJLA 3O6TA 1X9SB 1GUHA 4PURA 3VI5A 3GTUA 3UL3A 1GP1A 4DSSB 3TOTA 3P7XA 1O81A 3PINA 4PUAA 1JZRA 2CZ2A 3F0IA 4PQHA 3P8WA 1M99A 3TB2A 1ST9A 1Z7RA 2H1BA 5A4WA 5DAKA 3DXBA 4KSMA 1X5CA 3ZFLA 5ELGA 3ZIJA 2KUCA 2DKHA 4F9ZA 4IW9A 2PN8A 2WCIA 2GT6A 3E0UA 5D9WA 5H5QA 5DBQA 4GWRA 1DE2A 5DJLA 3LEFA 4Z2RA 3ME7A 3D4TA 5F07A 1A24A 2H70A 1DUGA 5C00A 2CVKA 1SENA 2VLUA 2R37A 5ECPB 4MMMA 4YQMA 2ES7A 2IFQA 4K9ZA 1KBNA 4IS0A 4KCAA 5B8AA 2I81A 4RQXA 3QCPA 2VCTA 5G30A 5F06A 5CO3A 2FLSA 1ML6A 1M2AA 1WOUA 2I1UA 1OVNA 4A5PA 1GTAA 1K0CA 4BVYB 2YP6A 3GKKA 4BA7A 1OC3A 1EEMA 3M9JA 5J41A 4IQAA 3HXSA 3Q18A 3H1NA 1URMA 3IE3A 3HVVA 3IAS2 5EL8A 1R5PA 3APSA 3DKSA 3GH6A 5AN1A 2E0QA 1E6BA 4JEDA 2ZCTA 3KXOA 3D4MA 2FWFA 2QA1A 2CQ9A 3LXZA 5J9BA 3GYKA 3GIXA 1XZOA 1AW9A 2IMFA 1A23A 2HRAA 2LQOA 4V2MA 1EGOA 3EC3A 3EMPA 5D9TA 3F9UA 2CZ3A 1ZYPA 2C8UA 1EWXA 4MABA 3HVSA 2JZRA 1M9AA 1A0FA 3HKRA 4HJ2A 2C3QA 2AHEA 2NVLA 6GSUA 3LYPA 4ULXA 1TK5B 2HZEA 2J9HA 3TJGA 2LJAA 1A2MA 1KEBA 1GNEA 4TXOA 1S3AA 4MDCA 1Q98A 1A0RP 2J23A 3CSJA 3ZMLA 2QC7A 4GXZA 2H6XA 5IMFA 3LW9A 5F8BA 5B7CA 1K3YA 3BCIA 4KDUA 4TR0A 3BCKA 4AJ8A 1HYUA 2GQMA 1Y25A 1XIYA 2UZ8A 2GSSA 5J3RA 4MPFA 2HT9A 3VLNA 1A2LA 2LUSA 3GFKA 1Z5YE 1SJ6A 1Z7PA 3VPQA 2YWIA 5IPHA 1MD4A 1VRSD 3HJOA 4FYBA 4IN0A 3WGDA 3OR5A 1GUKA 3HA9A 4HU9A 4Q5RA 3RAZA 2H73A 3GUSA 5ELAA 1QFNA 5B6NA 2B7KA 5FWGA 5D8IA 4N10A 4V1Ag 3A2VA 2LRCA 19GSA 3IDVA 3GV1A 1YQ1A 2OACA 4G0KA 5JCWA 2X49A 1PKZA 4CY8A 3RBTA 1XFLA 3ZMKA 1YKCA 4OFMA 5FT3A 3GRXA 2XC2A 1DE1A 3WT2A 1TK0B 4NXIA 3TJBA 3KMOA 6GSXA 1XOAA 12GSA 3O76A 4MJAA 1ACVA 4CW9A 2H66A 5JCGA 5HFKA 1FOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XVW A;  1EOG A;  4X1U A;  3WT1 A;  5HR3 A;  2GLR A;  1XWC A;  3QAV A;  3NZN A;  1B8X A;  2I3Y A;  2EC4 A;  1XW5 A;  4DSS A;  1T3B A;  1OE7 A;  1QK8 A;  4I5Q A;  1VF2 A;  1G7O A;  5ECL B;  2OAD A;  2KOK A;  1ZCP A;  1EEJ A;  2ON5 A;  4EO3 A;  3IK9 A;  2R5G A;  5DAK B;  1N8J A;  5IO2 A;  4WBJ A;  2GS3 A;  2X8G A;  4ECB A;  3D21 A;  3MNG A;  1TW9 A;  3N9J A;  2YOI A;  2PVO C;  5CRW A;  2KP1 A;  1UA5 A;  4NV2 A;  2NDO A;  4X43 A;  4YAP A;  4FYU A;  4LA1 A;  3WGX A;  18GS A;  3KP8 A;  2BJX A;  1T8E B;  1SU9 A;  3CYN A;  2LST A;  5GSS A;  5ECI B;  22GS A;  4ZL8 A;  4EXJ A;  4PGT A;  4K0N A;  1GSY A;  3P90 A;  4HI7 A;  1KNG A;  3LWA A;  2HYX A;  1VF4 A;  1IYI A;  3MWH A;  4Q5N A;  4G2E A;  5HFG A;  4TOP A;  3GL3 A;  2PMT A;  5ECK B;  3FZ5 A;  4TKY A;  1GSF A;  2FCH A;  2IFQ B;  2FUG 2;  1ERV A;  3FHK A;  1T7P B;  4I2T A;  1BX9 A;  1TRU A;  3DVW A;  1AXD A;  3APO A;  2B1L A;  3HZ4 A;  2B7J A;  3KMN A;  2VCQ A;  3UAP A;  2IWT A;  4X0X A;  3ED3 A;  1H4O A;  3HY2 A;  1V40 A;  1QGV A;  1WJK A;  2X8C A;  1OKT A;  2YV9 A;  4HUA A;  1E2Y A;  4BVY A;  2C0G A;  4JRR A;  3CSI A;  3KP9 A;  3L0H A;  2GQL A;  4DVC A;  5E59 A;  3APQ A;  4EDZ A;  4MLY A;  2AUV A;  2FA4 A;  4Z7X A;  1ON4 A;  3H8Q A;  1AC1 A;  5J4U A;  1FB6 A;  2V2G A;  1OE8 A;  2TRX A;  1ERT A;  3TUE A;  4O7H A;  1BJX A;  5G1L A;  2L6D A;  2YWM A;  2FA8 A;  1GTB A;  3QDN A;  2YCD A;  5IQY A;  1ZMA A;  3H4K A;  3CTF A;  3EWL A;  1YJ6 A;  3FRC A;  2XBQ A;  4AF2 A;  2JAC A;  2EIO A;  2H1G A;  5AIS A;  3NOF A;  2OBI A;  1X9M B;  5KN2 A;  1AAZ A;  2HZE B;  2C4J A;  3K8N A;  4O92 A;  1ZOF A;  1ZL9 A;  3ME8 A;  2V41 A;  4TXO B;  1LBK A;  1YF1 A;  2VL2 A;  1BQ7 A;  4PX1 A;  4ZIL A;  2L57 A;  2IN3 A;  1R4W A;  5A5K A;  2VIM A;  2B6M A;  1Q4J A;  4KDX A;  5ABR A;  1K0B A;  2C1Y A;  1SL2 B;  1U87 A;  2H30 A;  3SWL A;  5ECQ B;  3UEM A;  2PBJ A;  5HR1 A;  1M2D A;  3J7Y k;  4FH8 A;  3CRT A;  2JAD A;  3ZL5 A;  4BVX A;  4FIW A;  2H0I A;  2CX4 A;  3TJJ A;  4POL A;  6GSW A;  4MCU A;  2LKU A;  1G6Y A;  3QPM A;  2ON7 A;  1V58 A;  3UAR A;  4IKH A;  4JU5 A;  4F0B A;  5IMA A;  1TU8 A;  2DML A;  2H1A A;  4IBP A;  5A4U A;  4DEJ A;  3HVX A;  2RUE A;  1OKD A;  3ZIT A;  2HXK A;  3BD2 A;  3I69 A;  3VK9 A;  5KN0 A;  3DVX A;  1PMT A;  5KN3 A;  3GA4 A;  4L5L A;  2R3X A;  1RW1 A;  2QGV A;  2R6K A;  1SD8 A;  2NTO A;  3GMF A;  4HEA 2;  2H6Y A;  1MD3 A;  2LQQ A;  1EV9 A;  1LJR A;  4ZB6 A;  4ACS A;  2YNX A;  4J56 E;  1ILO A;  1WRY A;  1J9B A;  1GTU A;  1YF0 A;  1SK0 A;  1OYJ A;  2DJK A;  2V1M A;  3Q6O A;  3TKS E;  4HQS A;  5D96 A;  5IOW A;  2VAF A;  1GSE A;  1PSQ A;  5FHI A;  5ECM B;  3RHC A;  2PER A;  1QXH A;  4GTU A;  4L8E A;  1GWC A;  1GRX A;  3KJY A;  4XHM A;  4WBR D;  2H1D A;  2GZP A;  5D73 A;  3IOS A;  2H71 A;  4Q5Q A;  5GAN D;  2HFD A;  3PR8 A;  4WXT A;  3FYG A;  2REM A;  2H72 A;  1U3I A;  4AJ7 A;  1FAA A;  1AIU A;  3GX0 A;  2CVD A;  2Z9S A;  3GL5 A;  1HNC A;  4TR4 A;  1SKW B;  1MTC A;  4WEY A;  1U88 A;  1PL1 A;  2MBS A;  3VUR A;  2F3M A;  4MP4 A;  4P3Y B;  3GH9 A;  5G2Z A;  4EVM A;  3E9J B;  4HOJ A;  1TRV A;  2GVP A;  3KIJ A;  2HE3 A;  3C1R A;  2AYT A;  1AQX A;  4MJC A;  2VUP A;  1S3D A;  2FD3 A;  3IC4 A;  3ZIV A;  4MK3 A;  1MDJ A;  1PRX A;  5LD0 A;  5D9X A;  4N0Z A;  2FWH A;  4OMV A;  3D22 A;  3LQ7 A;  5CP1 A;  4JE1 A;  3VFI A;  2G0F A;  5GAP D;  2A2S A;  1PD2 1;  1J0F A;  5IMV A;  5F0G A;  1TOF A;  4CHS A;  1OC9 B;  2AAW A;  5IPG A;  1XW9 A;  3HZ8 A;  1GSS A;  5JWO B;  1SJZ A;  3TJF A;  1J08 A;  2WRT A;  4PQ1 A;  4GSN A;  1V9W A;  5DAL A;  2A4V A;  4POB A;  1WPI A;  2WDU A;  3GKX A;  4FYC A;  2IJY A;  2DJ1 A;  2CT6 A;  1ERW A;  2H0G A;  4GRF A;  4XCS A;  3W6G A;  1UN2 A;  1AQV A;  4ZBD A;  2DC5 A;  3RHB A;  3P2A A;  4GLT A;  1XWA A;  3Q74 A;  3ZLP A;  5CRD A;  4WET A;  1YDK A;  3L9U A;  4HZ2 A;  5JWQ B;  2E7P A;  3ERW A;  2B5X A;  2LS5 A;  1H75 A;  3DWV A;  4I97 A;  4MZW A;  1HNA A;  4MZB A;  4HQZ A;  4NV5 A;  5DQS A;  3C71 A;  3VPT A;  3GSS A;  2HZF A;  1XPV A;  1B9Y C;  1C72 A;  2MZC A;  4D73 B;  3C73 A;  2GST A;  3G7J A;  5D93 A;  4V2L A;  1K3O A;  2P31 A;  1PX6 A;  2M72 A;  3ZTL A;  1NM3 A;  1A8L A;  3U5R E;  4EKZ A;  3FZA A;  3O3T A;  2JL4 A;  3GNJ A;  2H8L A;  3BOA A;  2X99 A;  4NHZ A;  3DML A;  2VCW A;  4TN8 A;  5H5R A;  2B1K A;  1OC8 A;  2M46 A;  4BL7 A;  5H5S A;  4TR1 B;  3GKM A;  10GS A;  2P5R A;  2C0E A;  4LL4 B;  2V6K A;  4WKW A;  1Z6M A;  2MBT A;  2C80 A;  4NWY A;  2YPM A;  6GST A;  1GNW A;  2IIY A;  1KTE A;  5IM9 A;  3F6F A;  2DJ0 A;  3G7Y A;  1GH2 A;  4LL1 B;  4TVE A;  1O85 A;  3FKF A;  5JCU A;  2MMZ A;  2H01 A;  2JSZ A;  5CRH A;  4MF5 A;  3EVI A;  2VL3 A;  2GTU A;  1G0T A;  3CRU A;  2LJK A;  2O87 A;  1CQH A;  3ZFB A;  4I2U A;  1JZO A;  1R26 A;  1I5G A;  1THX A;  2C0D A;  2EIQ A;  1RQM A;  1WP0 A;  1TDI A;  2GSQ A;  2AJQ B;  3IPZ A;  4XS6 A;  2H75 A;  1Z3E A;  5J5N A;  2KP2 A;  4POM A;  1YEP A;  1UVZ A;  4GST A;  2F9S A;  2H6Z A;  2ZNM A;  1BED A;  3E3E A;  4MF6 A;  1TI1 A;  3W8J A;  3MDK A;  1K0O A;  4K1F A;  2O7K A;  4K2D A;  5HFI A;  4HDE A;  5ECN B;  14GS A;  3GN3 A;  3FR9 A;  5J9C A;  5ECR B;  1PA3 A;  1FB0 A;  3IR4 A;  3UBK A;  3EMX A;  4N0V A;  2F51 A;  3D5J A;  1NHO A;  3I9V 2;  2KHP A;  5LCZ A;  3I43 A;  1WWJ A;  3KCM A;  4KCE A;  2JSY A;  4LLR A;  5ID2 A;  1K0M A;  2JZT A;  3GKN A;  4KUN A;  5AGY A;  1HNB A;  4I6X A;  1K0N A;  1QUW A;  3IRA A;  4XIH A;  4KND A;  1SL0 B;  3JCM L;  2K8S A;  1SD9 A;  2H0H A;  2BTO T;  3M9K A;  5GZZ B;  2K6V A;  2TRC P;  3UIW A;  4ISD A;  3LFL A;  4IEL A;  3KGK A;  4HU7 A;  1LU4 A;  1NHY A;  3DD3 A;  3IXR A;  3H93 A;  3QOU A;  3QFA C;  2IMI A;  2MMN A;  5EY6 A;  5CYY A;  1W4V A;  2GZZ A;  3G9B A;  2PGT A;  3ZRE A;  4V2N A;  3FR3 A;  1GSQ A;  1F37 A;  3IHQ A;  3UMA A;  4AJ6 A;  1WE0 A;  2G2Q A;  3LGC A;  4DSR A;  2IME A;  1ZGN A;  2AV4 A;  4RQR A;  2VL9 A;  3TGZ A;  4E8E A;  1OC9 A;  4MH3 A;  3I6A A;  3F8U A;  1M2B A;  3TRP A;  3US3 A;  1UC7 A;  5DAL B;  2YJ7 A;  1B48 A;  4PQI A;  3L9S A;  1ABA A;  2LNS A;  4K8M A;  2LRT A;  3HD5 A;  4L0U A;  1DBY A;  3H79 A;  4O5R A;  2ZUP A;  4GF0 A;  2OE3 A;  2L59 A;  4WF5 A;  4IGJ A;  3QAG A;  2OKA A;  3SBC A;  4ML6 A;  2P0G A;  4ID0 A;  2DSA A;  3CMI A;  2GQK A;  1EV4 A;  1M9B A;  4G10 A;  4PXO A;  4TW5 A;  1JLW A;  4HJM A;  4GCI A;  1HQO A;  3MSZ A;  5B8B A;  2CA8 A;  2K9F A;  1BAY A;  2XHF A;  4ML1 A;  1EP8 A;  1WMJ A;  5ECS A;  8GSS A;  2IPA A;  1EZK A;  4ZB8 A;  4D73 A;  2X64 A;  2C0F A;  3VI7 A;  2FGX A;  2H76 A;  5IMC A;  3TKS A;  4BWQ A;  1T4Y A;  2ALB A;  3RPN A;  2YJH A;  2TIR A;  3F4R A;  4KH7 A;  3DEX A;  4N11 A;  2PVQ A;  4FO5 A;  5EVO A;  1FW1 A;  1I9D A;  5DJM A;  5B6M A;  4KGI A;  4TR1 A;  2HRF A;  3QFB C;  4IP1 A;  2VL2 C;  2RM6 A;  2E2G A;  4YH2 A;  1EOH A;  3WD6 A;  3EU4 A;  3Q19 A;  5G31 A;  4JR4 A;  3QAW A;  3HDC A;  5L71 A;  2DLX A;  1GUL A;  1B9X C;  4NHW A;  1JFU A;  4G19 A;  1T1V A;  1JZD A;  5LNK e;  4OCF A;  2V6O A;  3QMX A;  2QSI A;  11GS A;  4JBB A;  4PNF A;  2MMO A;  2D2Z A;  3M3M A;  9GSS A;  1TK8 B;  4EL1 A;  5HQP A;  1WIK A;  2EIR A;  3L9V A;  4OCE A;  4XS4 B;  2IL3 A;  3MAK A;  3CTG A;  1O8X A;  3TDG A;  1A2J A;  1ZYE A;  3UVT A;  2VM1 A;  1TI3 A;  2LRN A;  4K6X A;  2CVB A;  2BMX A;  3IV4 A;  3IBH A;  1B4Q A;  3ERG A;  3TKQ A;  1S3C A;  1XOB A;  3C7M A;  2L5L A;  4XRD A;  5ID2 B;  3ERF A;  3F3Q A;  5CNW A;  5E4W A;  2CV4 A;  3DRN A;  1X5D A;  3A2W A;  1FG4 A;  4EC0 A;  1XWK A;  3LXT A;  5KN1 A;  1XVQ A;  4K0G A;  4PNG A;  5DCH A;  4ZBA A;  1G7E A;  3L78 A;  2R2J A;  4MA9 A;  2H74 A;  4YAV A;  4ZL7 A;  20GS A;  4OO4 A;  5ENU A;  1R5A A;  3DGQ A;  1YKA A;  4OO5 A;  3M1G A;  6GSS A;  4TR3 A;  5AIV A;  4JZQ A;  3W8S A;  2VD0 A;  3C1S A;  1PKW A;  2YWO A;  3LYK A;  2B5E A;  2QKE A;  1X9W B;  4XS1 A;  4KAE A;  2NBS A;  3FK8 A;  3PH9 A;  3LJR A;  2WZ9 A;  5DVB A;  2VLV A;  4QQ7 A;  2GGT A;  5IMZ A;  4EE0 A;  3DYR A;  4Q5F A;  3TJK A;  3GUR A;  3G7I A;  1EP7 A;  4GSS A;  4IQ1 A;  5D9V A;  2OE0 A;  4HZ4 A;  4K7O A;  3QR6 A;  5JWR B;  1FO5 A;  3HJM A;  2O8V B;  3LSZ A;  5AIX A;  1FVK A;  1VF1 A;  3UOM A;  4F0C A;  2PPT A;  4OFT A;  1USB A;  3WGE A;  2PUK C;  3HHV A;  4MPG A;  1V57 A;  3HYP A;  1X5E A;  1FHE A;  2DJ2 A;  1GLP A;  5GST A;  2DBC A;  3EIN A;  5ECH B;  4MZC A;  2AB6 A;  1SK1 A;  3GHA A;  1N2A A;  1K3L A;  3CXG A;  2VLT A;  3UBL A;  5DDL A;  3HCZ A;  4IP6 A;  2LNT A;  4L0W A;  3VWU A;  2LTK A;  1G6W A;  1R7H A;  3QD9 A;  1U6T A;  3D6I A;  3KH7 A;  2RM5 A;  1SYR A;  2VD1 A;  5IOX A;  5IIZ A;  1XCC A;  1GTI A;  5F05 A;  3N5O A;  1ZYQ B;  1JHB A;  2L6C A;  2FY6 A;  4IJI A;  3F4S A;  1TTZ A;  3UVH A;  3IK7 A;  6GSV A;  5DCG A;  2A2R A;  1O73 A;  2F8A A;  4KX4 A;  1VF3 A;  3BJ5 A;  2GZY A;  3VWV A;  1PN9 A;  2O85 A;  2YN1 A;  1PX7 A;  1X0R A;  4RUV A;  3IA1 A;  2WGR A;  4TXV A;  2RUF A;  4O32 A;  3VWW A;  16GS A;  5IMD A;  4ECJ A;  3ZRD A;  1TRW A;  4F82 A;  3IAM 2;  1NSW A;  2YZH A;  4KE3 A;  1TP9 A;  1M7T A;  3R2Q A;  4LMV A;  5CRG A;  1O6J A;  4WF4 A;  1Z6N A;  2GSR A;  2YWN A;  1PQN A;  1TKD B;  1O8W A;  2I4A A;  3BBY A;  2CAQ A;  3F3R A;  1K0D A;  1ZZY A;  1F3B A;  2VCX A;  2NPB A;  1BG5 A;  2WJU A;  4OD7 A;  1V2A A;  1XXU A;  5DQY A;  2VCZ A;  3FZ4 A;  1AQW A;  3V1W A;  1T00 A;  2GDR A;  1K0A A;  2B5Y A;  2WFC A;  4ECC A;  1DSB A;  2FWG A;  3KTL A;  4KW6 A;  1RK4 A;  3KD0 A;  4V1A p;  3FEU A;  1IYH A;  3PGT A;  4XS4 A;  4OFN A;  2M80 A;  3ZVJ A;  2IMK A;  1GSD A;  2WS2 A;  2YZU A;  3GTU B;  2LV3 A;  3KTB A;  2HSY A;  3J7Y b;  1FVJ A;  1JLV A;  4ILF A;  2YV7 A;  3A3T A;  4ZBB A;  2L4C A;  5KEJ A;  2HSH A;  2CAI A;  4QL9 A;  4KSO A;  4EDY A;  3M0F A;  2PU9 C;  2DMM A;  2HNL A;  1SJI A;  2I9H A;  4ZIJ A;  3NIV A;  1SKR B;  2HLS A;  2OBK A;  3LG6 A;  3F4T A;  2C3T A;  2WB9 A;  1F9M A;  2XBI A;  3TKR A;  1PGT A;  3ISO A;  2YAN A;  4WR4 A;  2RLI A;  1SK2 A;  3CBU A;  2N5F A;  4CDO A;  3ZYW A;  4EF0 A;  3EUR A;  1T4Z A;  1XWB A;  1XW6 A;  3KEB A;  1U3A A;  1F3A A;  3EE2 A;  3ZZX A;  2KLX A;  2FNO A;  4E8H A;  1SYX A;  3L4N A;  2LJR A;  1B4P A;  1SL1 B;  5CAX A;  4G9H A;  1BYE A;  1JZW A;  1M0U A;  5A4V A;  2LEG A;  1ERU A;  4WR5 A;  17GS A;  1EGR A;  1PL2 A;  2H19 A;  1XBS A;  1SKS B;  2RII A;  4YQV A;  2DJ3 A;  2F8F A;  2OE1 A;  1CQG A;  1W89 A;  2P5Q A;  5CRE A;  4F03 A;  3S9F A;  1TRS A;  3TOU A;  3GST A;  1TXX A;  4BPY A;  4MJB A;  3LOR A;  4I8B A;  3FW2 A;  4AGS A;  2DJJ A;  5G1K A;  3D0Z A;  1HD2 A;  3GX8 A;  2K8V A;  2DIZ A;  4DSQ A;  3FR6 A;  4ZXG A;  1QQ2 A;  3FY7 A;  3UJ1 A;  1Y6E A;  2GT5 A;  4KB3 A;  4GQC A;  3WYW A;  1TU7 A;  4L5O A;  4PUF C;  4BWS A;  4J2F A;  4ZL9 A;  3M8N A;  1GUM A;  1NW2 A;  4K7I A;  3A2X A;  2VO4 A;  4GQF A;  1QMV A;  4QL7 A;  2N5A A;  5IO0 A;  4K7N A;  3DIE A;  4XRA A;  2K18 A;  2R4V A;  4H86 A;  3TKP A;  1XWG A;  2L4Q A;  1GSU A;  3FZ9 A;  4HS1 A;  2V32 A;  4EUY A;  4MF7 A;  4OWY A;  3C8E A;  2L5O A;  4RI6 A;  2XPE A;  6GSY A;  3F63 A;  2IMD A;  2XPD A;  5HR0 A;  3TRX A;  4J57 E;  4KDY A;  4NMU A;  2PWJ A;  2VOC A;  5HR2 A;  4KA0 A;  5INY A;  4MH2 A;  4TRX A;  2N5B A;  1OAZ A;  1V98 A;  5COH A;  1TJD A;  2C3N A;  1THO A;  4N30 A;  2X8H A;  4ECI A;  3TKS C;  2VCV A;  4IVF A;  1F2E A;  1Z9H A;  4RI7 A;  4IHU A;  1A8Y A;  2JU5 A;  1VGL A;  3KM6 A;  2MYG A;  3EYT A;  2HI7 A;  3EU3 A;  1F6M C;  5ECO B;  3RDW A;  2E2M A;  1GLQ A;  5G5E A;  1GL8 A;  3A5W A;  1O7U A;  4XTS A;  4POK A;  3TCO A;  3KZQ A;  3CSH A;  2MMA A;  5C04 A;  4ZB9 A;  3RPP A;  1YY7 A;  2FHE A;  4YQU A;  3U6V A;  3KH9 A;  2O89 A;  2CX3 A;  5G5F A;  2B3S A;  4JR6 A;  1MEK A;  2WUL A;  3VWX A;  1AUC A;  2VM2 A;  4NPB A;  5EPF A;  3TRQ A;  1MDK A;  3AY8 A;  3F6D A;  3HJP A;  4MJE A;  3ZVJ D;  1YEX A;  2JZS A;  13GS A;  7GSS A;  1YZX A;  4NAX A;  2DIY A;  2HRN A;  1MDI A;  2FWE A;  4LMW A;  4IJ3 A;  4F2I A;  2OA7 A;  2OJL A;  3O6T A;  1X9S B;  1GUH A;  4PUR A;  3VI5 A;  3GTU A;  3UL3 A;  1GP1 A;  4DSS B;  3TOT A;  3P7X A;  1O81 A;  3PIN A;  4PUA A;  1JZR A;  2CZ2 A;  3F0I A;  4PQH A;  3P8W A;  1M99 A;  3TB2 A;  1ST9 A;  1Z7R A;  2H1B A;  5A4W A;  5DAK A;  3DXB A;  4KSM A;  1X5C A;  3ZFL A;  5ELG A;  3ZIJ A;  2KUC A;  4F9Z A;  4IW9 A;  2PN8 A;  2WCI A;  2GT6 A;  3E0U A;  5D9W A;  5H5Q A;  5DBQ A;  4GWR A;  1DE2 A;  5DJL A;  3LEF A;  3ME7 A;  3D4T A;  5F07 A;  1A24 A;  2H70 A;  1DUG A;  5C00 A;  2CVK A;  1SEN A;  2VLU A;  2R37 A;  5ECP B;  4MMM A;  4YQM A;  2ES7 A;  2IFQ A;  4K9Z A;  1KBN A;  4IS0 A;  4KCA A;  5B8A A;  2I81 A;  4RQX A;  3QCP A;  2VCT A;  5G30 A;  5F06 A;  5CO3 A;  2FLS A;  1ML6 A;  1M2A A;  1WOU A;  2I1U A;  1OVN A;  1GTA A;  1K0C A;  2YP6 A;  3GKK A;  4BA7 A;  1OC3 A;  1EEM A;  3M9J A;  5J41 A;  4IQA A;  3HXS A;  3Q18 A;  3H1N A;  1URM A;  3IE3 A;  3HVV A;  3IAS 2;  5EL8 A;  1R5P A;  3APS A;  3DKS A;  3GH6 A;  5AN1 A;  2E0Q A;  1E6B A;  4JED A;  2ZCT A;  3KXO A;  3D4M A;  2FWF A;  2CQ9 A;  3LXZ A;  5J9B A;  3GYK A;  3GIX A;  1XZO A;  1AW9 A;  2IMF A;  1A23 A;  2LQO A;  4V2M A;  1EGO A;  3EC3 A;  3EMP A;  5D9T A;  3F9U A;  2CZ3 A;  2C8U A;  1EWX A;  4MAB A;  3HVS A;  2JZR A;  1M9A A;  1A0F A;  3HKR A;  4HJ2 A;  2C3Q A;  2AHE A;  2NVL A;  6GSU A;  3LYP A;  4ULX A;  1TK5 B;  2HZE A;  2J9H A;  3TJG A;  2LJA A;  1A2M A;  1KEB A;  1GNE A;  4TXO A;  1S3A A;  4MDC A;  1Q98 A;  1A0R P;  2J23 A;  3CSJ A;  3ZML A;  2QC7 A;  4GXZ A;  2H6X A;  5IMF A;  5F8B A;  5B7C A;  1K3Y A;  3BCI A;  4KDU A;  4TR0 A;  3BCK A;  4AJ8 A;  1HYU A;  2GQM A;  1Y25 A;  1XIY A;  2GSS A;  5J3R A;  4MPF A;  2HT9 A;  3VLN A;  1A2L A;  2LUS A;  3GFK A;  1Z5Y E;  1SJ6 A;  1Z7P A;  3VPQ A;  2YWI A;  5IPH A;  1MD4 A;  1VRS D;  3HJO A;  4FYB A;  4IN0 A;  3WGD A;  3OR5 A;  1GUK A;  3HA9 A;  4HU9 A;  4Q5R A;  3RAZ A;  2H73 A;  3GUS A;  5ELA A;  1QFN A;  5B6N A;  2B7K A;  5FWG A;  5D8I A;  4N10 A;  4V1A g;  3A2V A;  2LRC A;  19GS A;  3IDV A;  3GV1 A;  1YQ1 A;  2OAC A;  5JCW A;  1PKZ A;  3RBT A;  1XFL A;  3ZMK A;  1YKC A;  4OFM A;  5FT3 A;  3GRX A;  2XC2 A;  1DE1 A;  3WT2 A;  1TK0 B;  4NXI A;  3TJB A;  3KMO A;  6GSX A;  1XOA A;  12GS A;  3O76 A;  4MJA A;  1ACV A;  4CW9 A;  2H66 A;  5JCG A;  5HFK A;  1FOV A; 
#chains in the Genus database with same CATH topology
 1XVW A;  1EOG A;  4X1U A;  3WT1 A;  5HR3 A;  2GLR A;  1XWC A;  3QAV A;  3NZN A;  1B8X A;  2I3Y A;  2EC4 A;  1XW5 A;  4DSS A;  1T3B A;  1OE7 A;  1QK8 A;  4I5Q A;  1VF2 A;  1G7O A;  5ECL B;  5BRT A;  2OAD A;  2KOK A;  1ZCP A;  1EEJ A;  2ON5 A;  4EO3 A;  3IK9 A;  2R5G A;  4EIP A;  5DAK B;  1N8J A;  5IO2 A;  4WBJ A;  2GS3 A;  2X8G A;  4ECB A;  3D21 A;  3MNG A;  1TW9 A;  3N9J A;  2YOI A;  2PVO C;  5CRW A;  2KP1 A;  1UA5 A;  4NV2 A;  2NDO A;  4X43 A;  4YAP A;  4FYU A;  4LA1 A;  3WGX A;  18GS A;  3KP8 A;  2BJX A;  1T8E B;  1SU9 A;  3CYN A;  2LST A;  5GSS A;  5ECI B;  22GS A;  4ZL8 A;  4EXJ A;  4PGT A;  4K0N A;  1GSY A;  3P90 A;  4HI7 A;  1KNG A;  3LWA A;  2HYX A;  1VF4 A;  1IYI A;  3MWH A;  4Q5N A;  4G2E A;  5HFG A;  4TOP A;  3GL3 A;  2PMT A;  5ECK B;  3FZ5 A;  4TKY A;  1GSF A;  2FCH A;  2IFQ B;  2FUG 2;  1ERV A;  3FHK A;  1T7P B;  4I2T A;  1BX9 A;  1TRU A;  3DVW A;  1AXD A;  3APO A;  2B1L A;  3HZ4 A;  2B7J A;  3KMN A;  2VCQ A;  3UAP A;  2IWT A;  4X0X A;  3ED3 A;  1H4O A;  3HY2 A;  1V40 A;  1QGV A;  1WJK A;  2X8C A;  1OKT A;  2YV9 A;  4Z2T A;  4HUA A;  1E2Y A;  4BVY A;  2C0G A;  4JRR A;  3R3E A;  3CSI A;  3KP9 A;  3L0H A;  2GQL A;  4DVC A;  5E59 A;  3APQ A;  4EDZ A;  4MLY A;  2AUV A;  4MNN A;  2FA4 A;  4Z7X A;  1ON4 A;  3H8Q A;  1AC1 A;  5J4U A;  1FB6 A;  2V2G A;  1OE8 A;  2TRX A;  1ERT A;  3TUE A;  4O7H A;  1BJX A;  4X4J A;  5G1L A;  2L6D A;  2YWM A;  2FA8 A;  1GTB A;  3QDN A;  2YCD A;  4ICY A;  5IQY A;  1ZMA A;  3H4K A;  1PN0 A;  3CTF A;  3EWL A;  1YJ6 A;  3FRC A;  2XBQ A;  4AF2 A;  2JAC A;  2EIO A;  2H1G A;  5AIS A;  4O5U A;  3NOF A;  2OBI A;  1X9M B;  5KN2 A;  1AAZ A;  2HZE B;  2C4J A;  3K8N A;  4O92 A;  1ZOF A;  1ZL9 A;  3ME8 A;  2V41 A;  4TXO B;  1LBK A;  1YF1 A;  2VL2 A;  1BQ7 A;  4PX1 A;  4ZIL A;  2L57 A;  2IN3 A;  1R4W A;  5A5K A;  2VIM A;  2B6M A;  1Q4J A;  4KDX A;  5ABR A;  1K0B A;  2C1Y A;  1SL2 B;  1U87 A;  2H30 A;  3SWL A;  4BL7 B;  5ECQ B;  3UEM A;  2PBJ A;  5HR1 A;  1M2D A;  3J7Y k;  4FH8 A;  3CRT A;  2JAD A;  3ZL5 A;  4BVX A;  4FIW A;  2H0I A;  2CX4 A;  3TJJ A;  4POL A;  6GSW A;  4MCU A;  2LKU A;  1G6Y A;  3QPM A;  2ON7 A;  1V58 A;  3UAR A;  4IKH A;  4JU5 A;  4F0B A;  5IMA A;  1TU8 A;  2DML A;  2H1A A;  4IBP A;  5A4U A;  4DEJ A;  3HVX A;  2RUE A;  1OKD A;  3ZIT A;  2HXK A;  3BD2 A;  3I69 A;  3VK9 A;  5KN0 A;  3DVX A;  1PMT A;  5KN3 A;  3GA4 A;  4L5L A;  2R3X A;  1RW1 A;  2QGV A;  2R6K A;  1SD8 A;  2NTO A;  4HEA 2;  3GMF A;  4EIQ A;  2H6Y A;  1MD3 A;  2LQQ A;  1EV9 A;  1LJR A;  4ZB6 A;  4ACS A;  3FMW A;  2YNX A;  4J56 E;  1ILO A;  1WRY A;  1J9B A;  1GTU A;  1YF0 A;  1SK0 A;  1OYJ A;  2DJK A;  2V1M A;  3Q6O A;  3TKS E;  4HQS A;  5D96 A;  5IOW A;  2VAF A;  1GSE A;  1PSQ A;  3IC8 A;  5FHI A;  5ECM B;  3RHC A;  2PER A;  1QXH A;  4GTU A;  4L8E A;  1GWC A;  1GRX A;  3KJY A;  4XHM A;  4WBR D;  2H1D A;  2GZP A;  5D73 A;  3IOS A;  2H71 A;  4Q5Q A;  5GAN D;  2HFD A;  3PR8 A;  4WXT A;  3FYG A;  2REM A;  2H72 A;  5KOW A;  1U3I A;  4AJ7 A;  1FAA A;  1AIU A;  4USS A;  3GX0 A;  2CVD A;  2Z9S A;  3GL5 A;  1HNC A;  3IHG A;  4TR4 A;  1SKW B;  1MTC A;  4WEY A;  1U88 A;  1PL1 A;  2A2P A;  2MBS A;  3VUR A;  2F3M A;  4MP4 A;  4P3Y B;  3GH9 A;  5G2Z A;  4EVM A;  3E9J B;  4HOJ A;  1TRV A;  2GVP A;  3KIJ A;  2HE3 A;  3C1R A;  2AYT A;  1AQX A;  4MJC A;  2VUP A;  1S3D A;  2FD3 A;  3IC4 A;  3ZIV A;  1FOH A;  4MK3 A;  1MDJ A;  1PRX A;  5LD0 A;  5D9X A;  4N0Z A;  2FWH A;  4OMV A;  3D22 A;  3LQ7 A;  5CP1 A;  4JE1 A;  3VFI A;  2G0F A;  5GAP D;  2A2S A;  1PD2 1;  1J0F A;  5IMV A;  5F0G A;  1TOF A;  4CHS A;  1OC9 B;  2AAW A;  5IPG A;  1XW9 A;  2HSM A;  3HZ8 A;  1GSS A;  5JWO B;  1SJZ A;  3TJF A;  1J08 A;  2WRT A;  4PQ1 A;  4HSC X;  4GSN A;  1V9W A;  5DAL A;  2A4V A;  4POB A;  1WPI A;  2WDU A;  3GKX A;  4FYC A;  2IJY A;  2DJ1 A;  2CT6 A;  1ERW A;  2H0G A;  1M3J A;  4GRF A;  4XCS A;  3W6G A;  1UN2 A;  1AQV A;  4ZBD A;  4FQU A;  2DC5 A;  3RHB A;  3P2A A;  4GLT A;  1XWA A;  3Q74 A;  3ZLP A;  5CRD A;  4WET A;  1YDK A;  3L9U A;  4HZ2 A;  5JWQ B;  2E7P A;  3ERW A;  3MYD A;  2B5X A;  2LS5 A;  1H75 A;  3DWV A;  4I97 A;  4MZW A;  1HNA A;  4MZB A;  4HQZ A;  4NV5 A;  5DQS A;  3C71 A;  3VPT A;  3GSS A;  2HZF A;  1XPV A;  1B9Y C;  1C72 A;  2MZC A;  4D73 B;  3C73 A;  2GST A;  3G7J A;  5D93 A;  4V2L A;  1K3O A;  2P31 A;  1PX6 A;  2M72 A;  3ZTL A;  1NM3 A;  1A8L A;  3U5R E;  4EKZ A;  3FZA A;  3O3T A;  2JL4 A;  3GNJ A;  2H8L A;  3BOA A;  2X99 A;  4NHZ A;  3DML A;  2VCW A;  4TN8 A;  5H5R A;  2B1K A;  1OC8 A;  2M46 A;  4BL7 A;  5H5S A;  4TR1 B;  3GKM A;  10GS A;  1XG8 A;  2P5R A;  4BVX B;  2C0E A;  4LL4 B;  2V6K A;  4WKW A;  1Z6M A;  2MBT A;  2C80 A;  4NWY A;  2YPM A;  6GST A;  1GNW A;  2IIY A;  1KTE A;  4K5S A;  5IM9 A;  3F6F A;  2DJ0 A;  3G7Y A;  1GH2 A;  4LL1 B;  4TVE A;  1O85 A;  3FKF A;  5JCU A;  2MMZ A;  2H01 A;  2JSZ A;  5CRH A;  4MF5 A;  3EVI A;  2VL3 A;  2GTU A;  1G0T A;  3CRU A;  2LJK A;  2O87 A;  1CQH A;  3ZFB A;  4I2U A;  1JZO A;  1R26 A;  1I5G A;  1THX A;  2C0D A;  2EIQ A;  1RQM A;  1WP0 A;  1TDI A;  2GSQ A;  2AJQ B;  3IPZ A;  4XS6 A;  3PPU A;  2H75 A;  1Z3E A;  5J5N A;  2KP2 A;  4POM A;  1YEP A;  1UVZ A;  4GST A;  2F9S A;  2H6Z A;  2ZNM A;  1BED A;  3E3E A;  4MF6 A;  1TI1 A;  3W8J A;  3MDK A;  1K0O A;  4K1F A;  2O7K A;  4K2D A;  5HFI A;  4HDE A;  5ECN B;  14GS A;  3GN3 A;  4YKG A;  3FR9 A;  5J9C A;  5ECR B;  1PA3 A;  1FB0 A;  3IR4 A;  3UBK A;  3EMX A;  4N0V A;  2F51 A;  3D5J A;  1NHO A;  3I9V 2;  2KHP A;  5LCZ A;  3I43 A;  1WWJ A;  3KCM A;  4KCE A;  2JSY A;  4LLR A;  5ID2 A;  1K0M A;  2JZT A;  3GKN A;  4KUN A;  5AGY A;  1HNB A;  4I6X A;  1K0N A;  1QUW A;  3IRA A;  4XIH A;  4KND A;  1SL0 B;  3JCM L;  2K8S A;  1SD9 A;  2H0H A;  2BTO T;  3M9K A;  5GZZ B;  2K6V A;  2TRC P;  3UIW A;  4ISD A;  3LFL A;  4IEL A;  3KGK A;  4HU7 A;  1LU4 A;  1NHY A;  3DD3 A;  3IXR A;  3H93 A;  3QOU A;  3QFA C;  2IMI A;  2MMN A;  5EY6 A;  5CYY A;  1W4V A;  2GZZ A;  3G9B A;  2PGT A;  3ZRE A;  4V2N A;  3FR3 A;  1GSQ A;  3CQF A;  1F37 A;  3IHQ A;  3UMA A;  4AJ6 A;  1WE0 A;  2G2Q A;  3LGC A;  4DSR A;  2IME A;  1ZGN A;  2AV4 A;  4RQR A;  2VL9 A;  2R0C A;  3TGZ A;  4E8E A;  1OC9 A;  4MH3 A;  3I6A A;  3F8U A;  1M2B A;  3TRP A;  3US3 A;  1UC7 A;  5DAL B;  2YJ7 A;  1B48 A;  4PQI A;  3L9S A;  1ABA A;  2LNS A;  4K8M A;  2LRT A;  3HD5 A;  4KF9 A;  4L0U A;  1DBY A;  3H79 A;  4O5R A;  2ZUP A;  4GF0 A;  2OE3 A;  2L59 A;  4WF5 A;  4IGJ A;  3QAG A;  2OKA A;  3SBC A;  4ML6 A;  2P0G A;  4ID0 A;  2DSA A;  3CMI A;  2GQK A;  1EV4 A;  1M9B A;  4G10 A;  4PXO A;  4TW5 A;  4CY6 A;  1JLW A;  4HJM A;  4GCI A;  1HQO A;  3MSZ A;  5B8B A;  2CA8 A;  2K9F A;  1BAY A;  2R0G A;  2XHF A;  4ML1 A;  1EP8 A;  1WMJ A;  5ECS A;  8GSS A;  2IPA A;  1EZK A;  4ZB8 A;  4D73 A;  2X64 A;  2C0F A;  3VI7 A;  2FGX A;  2H76 A;  5IMC A;  3TKS A;  4BWQ A;  1T4Y A;  2ALB A;  3RPN A;  2YJH A;  3EPT A;  2TIR A;  3F4R A;  4KH7 A;  3DEX A;  4N11 A;  2PVQ A;  4FO5 A;  5EVO A;  1FW1 A;  1I9D A;  5DJM A;  5B6M A;  4KGI A;  4TR1 A;  2HRF A;  3QFB C;  4IP1 A;  2VL2 C;  2RM6 A;  2E2G A;  4YH2 A;  1EOH A;  3WD6 A;  3EU4 A;  2HRK A;  3Q19 A;  5G31 A;  4JR4 A;  3QAW A;  3HDC A;  5L71 A;  2DLX A;  1GUL A;  1B9X C;  4NHW A;  1JFU A;  4G19 A;  1T1V A;  1JZD A;  5LNK e;  4OCF A;  2V6O A;  3QMX A;  2QSI A;  11GS A;  4JBB A;  4PNF A;  2MMO A;  2D2Z A;  3M3M A;  9GSS A;  1TK8 B;  4EL1 A;  5HQP A;  1WIK A;  4G0L A;  2EIR A;  3L9V A;  4OCE A;  4XS4 B;  2IL3 A;  3MAK A;  3CTG A;  1O8X A;  3TDG A;  1A2J A;  1ZYE A;  3UVT A;  2VM1 A;  1TI3 A;  2LRN A;  4K6X A;  2CVB A;  2BMX A;  3IV4 A;  3IBH A;  1B4Q A;  3ERG A;  3TKQ A;  1S3C A;  1XOB A;  3C7M A;  2L5L A;  4XRD A;  5ID2 B;  3ERF A;  3F3Q A;  5CNW A;  5E4W A;  2CV4 A;  3DRN A;  1X5D A;  3A2W A;  1FG4 A;  4EC0 A;  1XWK A;  3LXT A;  5KN1 A;  1XVQ A;  4K0G A;  4PNG A;  2A4H A;  5DCH A;  4ZBA A;  1G7E A;  3L78 A;  2R2J A;  4MA9 A;  2H74 A;  4YAV A;  4ZL7 A;  20GS A;  4OO4 A;  5ENU A;  1R5A A;  3DGQ A;  1YKA A;  4OO5 A;  3M1G A;  6GSS A;  4TR3 A;  5AIV A;  4JZQ A;  3W8S A;  2VD0 A;  3C1S A;  1PKW A;  2YWO A;  3LYK A;  2B5E A;  2QKE A;  1X9W B;  4XS1 A;  4KAE A;  2NBS A;  3FK8 A;  3PH9 A;  3LJR A;  3A5I A;  2WZ9 A;  5DVB A;  4K2X A;  2VLV A;  4QQ7 A;  2GGT A;  5IMZ A;  4EE0 A;  3DYR A;  4Q5F A;  3TJK A;  3GUR A;  3G7I A;  1EP7 A;  4GSS A;  4IQ1 A;  3HVN A;  5D9V A;  2OE0 A;  4HZ4 A;  4K7O A;  3QR6 A;  5JWR B;  1FO5 A;  3HJM A;  2O8V B;  3LSZ A;  5AIX A;  1FVK A;  1VF1 A;  3UOM A;  4F0C A;  2PPT A;  4OFT A;  1USB A;  3WGE A;  2PUK C;  3HHV A;  4MPG A;  1V57 A;  3HYP A;  1X5E A;  1FHE A;  2DJ2 A;  1GLP A;  5GST A;  1M3I A;  2DBC A;  3EIN A;  5ECH B;  4MZC A;  2AB6 A;  1SK1 A;  3GHA A;  1N2A A;  1K3L A;  3CXG A;  2VLT A;  3UBL A;  5DDL A;  3HCZ A;  4IP6 A;  2LNT A;  4L0W A;  3VWU A;  2LTK A;  1G6W A;  1R7H A;  3QD9 A;  1U6T A;  3D6I A;  3KH7 A;  2RM5 A;  1SYR A;  2VD1 A;  5IOX A;  5IIZ A;  1XCC A;  1GTI A;  5F05 A;  3N5O A;  1ZYQ B;  4YKF A;  1JHB A;  2L6C A;  2DKI A;  2FY6 A;  4IJI A;  3F4S A;  1TTZ A;  3UVH A;  3IK7 A;  6GSV A;  5DCG A;  2A2R A;  1O73 A;  2F8A A;  4KX4 A;  1VF3 A;  3BJ5 A;  2GZY A;  3VWV A;  1PN9 A;  2O85 A;  2YN1 A;  1PX7 A;  1X0R A;  4RUV A;  3IA1 A;  2WGR A;  4TXV A;  2RUF A;  4O32 A;  3VWW A;  16GS A;  5IMD A;  4ECJ A;  3ZRD A;  1TRW A;  4F82 A;  3IAM 2;  1NSW A;  2X4A A;  2YZH A;  4KE3 A;  1TP9 A;  1M7T A;  3R2Q A;  4LMV A;  5CRG A;  1O6J A;  4WF4 A;  1Z6N A;  2GSR A;  2YWN A;  1PQN A;  1TKD B;  1O8W A;  2I4A A;  3BBY A;  2CAQ A;  3F3R A;  1K0D A;  1ZZY A;  1F3B A;  2VCX A;  2NPB A;  1BG5 A;  2WJU A;  4OD7 A;  1V2A A;  1XXU A;  5DQY A;  2VCZ A;  3FZ4 A;  1AQW A;  3V1W A;  1T00 A;  2GDR A;  1K0A A;  2B5Y A;  2WFC A;  4ECC A;  1DSB A;  2FWG A;  3KTL A;  4KW6 A;  1RK4 A;  2R0P A;  3KD0 A;  4V1A p;  3FEU A;  2QA2 A;  1IYH A;  3PGT A;  4XS4 A;  4OFN A;  2M80 A;  3ZVJ A;  2IMK A;  1S3R A;  1GSD A;  2WS2 A;  2YZU A;  3GTU B;  2LV3 A;  3KTB A;  2HSY A;  3J7Y b;  1FVJ A;  1JLV A;  4ILF A;  2YV7 A;  3A3T A;  4ZBB A;  2L4C A;  5KEJ A;  2HSH A;  2CAI A;  4QL9 A;  4KSO A;  4EDY A;  3M0F A;  2PU9 C;  2DMM A;  2HNL A;  1SJI A;  2I9H A;  4ZIJ A;  3NIV A;  1SKR B;  2HLS A;  2OBK A;  3LG6 A;  3F4T A;  2C3T A;  2WB9 A;  1F9M A;  2XBI A;  3TKR A;  1PGT A;  3ISO A;  3MIX A;  2YAN A;  4WR4 A;  2RLI A;  1SK2 A;  3CBU A;  2N5F A;  4CDO A;  3ZYW A;  4EF0 A;  4G0I A;  3EUR A;  1T4Z A;  1XWB A;  1XW6 A;  3KEB A;  1U3A A;  1F3A A;  3EE2 A;  3ZZX A;  2KLX A;  2FNO A;  4E8H A;  1SYX A;  3L4N A;  2LJR A;  1B4P A;  1SL1 B;  5CAX A;  4G9H A;  1BYE A;  1JZW A;  1M0U A;  5A4V A;  2LEG A;  1ERU A;  4WR5 A;  5KOX A;  17GS A;  1EGR A;  1PL2 A;  2H19 A;  1XBS A;  1SKS B;  2RII A;  4YQV A;  2DJ3 A;  2F8F A;  2OE1 A;  1CQG A;  1W89 A;  2P5Q A;  5CRE A;  4F03 A;  3S9F A;  4Z2U A;  1TRS A;  3TOU A;  3GST A;  1TXX A;  4BPY A;  4MJB A;  3LOR A;  4I8B A;  3FW2 A;  4AGS A;  2DJJ A;  5G1K A;  3D0Z A;  1HD2 A;  3GX8 A;  2K8V A;  2DIZ A;  4DSQ A;  3FR6 A;  4ZXG A;  1QQ2 A;  3FY7 A;  3UJ1 A;  1Y6E A;  2GT5 A;  4KB3 A;  4GQC A;  3WYW A;  1TU7 A;  4L5O A;  4PUF C;  4BWS A;  4J2F A;  4ZL9 A;  3M8N A;  1GUM A;  1NW2 A;  4K7I A;  3A2X A;  2VO4 A;  4GQF A;  1QMV A;  4QL7 A;  2N5A A;  5IO0 A;  4K7N A;  3DIE A;  4XRA A;  2K18 A;  2R4V A;  4H86 A;  3TKP A;  1XWG A;  2L4Q A;  1GSU A;  3FZ9 A;  4O5Q A;  4HS1 A;  2V32 A;  4EUY A;  4MF7 A;  4OWY A;  3C8E A;  2L5O A;  4RI6 A;  2XPE A;  6GSY A;  1ZYN A;  3F63 A;  2IMD A;  2XPD A;  5HR0 A;  3TRX A;  4J57 E;  4KDY A;  4NMU A;  2PWJ A;  2VOC A;  5HR2 A;  4KA0 A;  5INY A;  4MH2 A;  4TRX A;  2N5B A;  1OAZ A;  1V98 A;  5COH A;  1TJD A;  2C3N A;  1THO A;  4N30 A;  2X8H A;  4ECI A;  3TKS C;  2VCV A;  4IVF A;  1F2E A;  1Z9H A;  4RI7 A;  4PTS A;  4IHU A;  1A8Y A;  2JU5 A;  1VGL A;  3KM6 A;  2MYG A;  3EYT A;  2HI7 A;  3EU3 A;  1F6M C;  5ECO B;  3RDW A;  2E2M A;  1GLQ A;  5G5E A;  4K5R A;  1GL8 A;  3A5W A;  1O7U A;  4XTS A;  5BMU A;  4POK A;  3TCO A;  3KZQ A;  3CSH A;  2MMA A;  5C04 A;  4ZB9 A;  3RPP A;  1YY7 A;  2FHE A;  4YQU A;  3U6V A;  3KH9 A;  2O89 A;  2CX3 A;  5G5F A;  2B3S A;  4JR6 A;  1MEK A;  2WUL A;  3VWX A;  1AUC A;  2VM2 A;  4NPB A;  5EPF A;  3TRQ A;  1MDK A;  3AY8 A;  3F6D A;  3HJP A;  4MJE A;  3ZVJ D;  1YEX A;  2JZS A;  13GS A;  7GSS A;  1YZX A;  4NAX A;  2DIY A;  2HRN A;  1MDI A;  2FWE A;  4LMW A;  4IJ3 A;  4F2I A;  2OA7 A;  2OJL A;  3O6T A;  1X9S B;  1GUH A;  4PUR A;  3VI5 A;  3GTU A;  3UL3 A;  1GP1 A;  4DSS B;  3TOT A;  3P7X A;  1O81 A;  3PIN A;  4PUA A;  1JZR A;  2CZ2 A;  3F0I A;  4PQH A;  3P8W A;  1M99 A;  3TB2 A;  1ST9 A;  1Z7R A;  2H1B A;  5A4W A;  5DAK A;  3DXB A;  4KSM A;  1X5C A;  3ZFL A;  5ELG A;  3ZIJ A;  1PFO A;  2KUC A;  2DKH A;  4F9Z A;  4IW9 A;  2PN8 A;  2WCI A;  2GT6 A;  3E0U A;  5D9W A;  5H5Q A;  5DBQ A;  4GWR A;  1DE2 A;  5DJL A;  3LEF A;  4Z2R A;  3ME7 A;  3D4T A;  5F07 A;  1A24 A;  2H70 A;  1DUG A;  5C00 A;  2CVK A;  1SEN A;  2VLU A;  2R37 A;  5ECP B;  4MMM A;  4YQM A;  2ES7 A;  2IFQ A;  4K9Z A;  1KBN A;  4IS0 A;  4KCA A;  5B8A A;  2I81 A;  4RQX A;  3QCP A;  2VCT A;  5G30 A;  5F06 A;  5CO3 A;  2FLS A;  1ML6 A;  1M2A A;  1WOU A;  2I1U A;  1OVN A;  4A5P A;  1GTA A;  1K0C A;  4BVY B;  2YP6 A;  3GKK A;  4BA7 A;  1OC3 A;  1EEM A;  3M9J A;  5J41 A;  4IQA A;  3HXS A;  3Q18 A;  3H1N A;  1URM A;  3IE3 A;  3HVV A;  3IAS 2;  5EL8 A;  1R5P A;  3APS A;  3DKS A;  3GH6 A;  5AN1 A;  2E0Q A;  1E6B A;  4JED A;  2ZCT A;  3KXO A;  3D4M A;  2FWF A;  2QA1 A;  2CQ9 A;  3LXZ A;  5J9B A;  3GYK A;  3GIX A;  1XZO A;  1AW9 A;  2IMF A;  1A23 A;  2HRA A;  2LQO A;  4V2M A;  1EGO A;  3EC3 A;  3EMP A;  5D9T A;  3F9U A;  2CZ3 A;  1ZYP A;  2C8U A;  1EWX A;  4MAB A;  3HVS A;  2JZR A;  1M9A A;  1A0F A;  3HKR A;  4HJ2 A;  2C3Q A;  2AHE A;  2NVL A;  6GSU A;  3LYP A;  4ULX A;  1TK5 B;  2HZE A;  2J9H A;  3TJG A;  2LJA A;  1A2M A;  1KEB A;  1GNE A;  4TXO A;  1S3A A;  4MDC A;  1Q98 A;  1A0R P;  2J23 A;  3CSJ A;  3ZML A;  4BIK A;  2QC7 A;  4GXZ A;  2H6X A;  5IMF A;  3LW9 A;  5F8B A;  5B7C A;  1K3Y A;  3BCI A;  4KDU A;  4TR0 A;  3BCK A;  4AJ8 A;  1HYU A;  2GQM A;  1Y25 A;  1XIY A;  2UZ8 A;  2GSS A;  5J3R A;  4MPF A;  2HT9 A;  3VLN A;  1A2L A;  2LUS A;  3GFK A;  1Z5Y E;  1SJ6 A;  1Z7P A;  3VPQ A;  2YWI A;  5IPH A;  1MD4 A;  1VRS D;  3HJO A;  4FYB A;  4IN0 A;  3WGD A;  3OR5 A;  1GUK A;  3HA9 A;  4HU9 A;  4Q5R A;  3RAZ A;  2H73 A;  3GUS A;  5ELA A;  1QFN A;  5B6N A;  2B7K A;  5FWG A;  5D8I A;  4N10 A;  4V1A g;  3A2V A;  2LRC A;  19GS A;  3IDV A;  3GV1 A;  1YQ1 A;  2OAC A;  4G0K A;  5JCW A;  2X49 A;  1PKZ A;  4CY8 A;  3RBT A;  1XFL A;  3ZMK A;  1YKC A;  4OFM A;  5FT3 A;  3GRX A;  2XC2 A;  1DE1 A;  3WT2 A;  1TK0 B;  4NXI A;  3TJB A;  3KMO A;  6GSX A;  1XOA A;  12GS A;  3O76 A;  4MJA A;  1ACV A;  4CW9 A;  2H66 A;  5JCG A;  5HFK A;  1FOV A; 
#chains in the Genus database with same CATH homology
 1XVW A;  1EOG A;  4X1U A;  3WT1 A;  5HR3 A;  2GLR A;  1XWC A;  3QAV A;  3NZN A;  1B8X A;  2I3Y A;  2EC4 A;  1XW5 A;  4DSS A;  1T3B A;  1OE7 A;  1QK8 A;  4I5Q A;  1VF2 A;  1G7O A;  5ECL B;  5BRT A;  2OAD A;  2KOK A;  1ZCP A;  1EEJ A;  2ON5 A;  4EO3 A;  3IK9 A;  2R5G A;  4EIP A;  5DAK B;  1N8J A;  5IO2 A;  4WBJ A;  2GS3 A;  2X8G A;  4ECB A;  3D21 A;  3MNG A;  1TW9 A;  3N9J A;  2YOI A;  2PVO C;  5CRW A;  2KP1 A;  1UA5 A;  4NV2 A;  2NDO A;  4X43 A;  4YAP A;  4FYU A;  4LA1 A;  3WGX A;  18GS A;  3KP8 A;  2BJX A;  1T8E B;  1SU9 A;  3CYN A;  2LST A;  5GSS A;  5ECI B;  22GS A;  4ZL8 A;  4EXJ A;  4PGT A;  4K0N A;  1GSY A;  3P90 A;  4HI7 A;  1KNG A;  3LWA A;  2HYX A;  1VF4 A;  1IYI A;  3MWH A;  4Q5N A;  4G2E A;  5HFG A;  4TOP A;  3GL3 A;  2PMT A;  5ECK B;  3FZ5 A;  4TKY A;  1GSF A;  2FCH A;  2IFQ B;  2FUG 2;  1ERV A;  3FHK A;  1T7P B;  4I2T A;  1BX9 A;  1TRU A;  3DVW A;  1AXD A;  3APO A;  2B1L A;  3HZ4 A;  2B7J A;  3KMN A;  2VCQ A;  3UAP A;  2IWT A;  4X0X A;  3ED3 A;  1H4O A;  3HY2 A;  1V40 A;  1QGV A;  1WJK A;  2X8C A;  1OKT A;  2YV9 A;  4Z2T A;  4HUA A;  1E2Y A;  4BVY A;  2C0G A;  4JRR A;  3R3E A;  3CSI A;  3KP9 A;  3L0H A;  2GQL A;  4DVC A;  5E59 A;  3APQ A;  4EDZ A;  4MLY A;  2AUV A;  4MNN A;  2FA4 A;  4Z7X A;  1ON4 A;  3H8Q A;  1AC1 A;  5J4U A;  1FB6 A;  2V2G A;  1OE8 A;  2TRX A;  1ERT A;  3TUE A;  4O7H A;  1BJX A;  4X4J A;  5G1L A;  2L6D A;  2YWM A;  2FA8 A;  1GTB A;  3QDN A;  2YCD A;  4ICY A;  5IQY A;  1ZMA A;  3H4K A;  1PN0 A;  3CTF A;  3EWL A;  1YJ6 A;  3FRC A;  2XBQ A;  4AF2 A;  2JAC A;  2EIO A;  2H1G A;  5AIS A;  4O5U A;  3NOF A;  2OBI A;  1X9M B;  5KN2 A;  1AAZ A;  2HZE B;  2C4J A;  3K8N A;  4O92 A;  1ZOF A;  1ZL9 A;  3ME8 A;  2V41 A;  4TXO B;  1LBK A;  1YF1 A;  2VL2 A;  1BQ7 A;  4PX1 A;  4ZIL A;  2L57 A;  2IN3 A;  1R4W A;  5A5K A;  2VIM A;  2B6M A;  1Q4J A;  4KDX A;  5ABR A;  1K0B A;  2C1Y A;  1SL2 B;  1U87 A;  2H30 A;  3SWL A;  4BL7 B;  5ECQ B;  3UEM A;  2PBJ A;  5HR1 A;  1M2D A;  3J7Y k;  4FH8 A;  3CRT A;  2JAD A;  3ZL5 A;  4BVX A;  4FIW A;  2H0I A;  2CX4 A;  3TJJ A;  4POL A;  6GSW A;  4MCU A;  2LKU A;  1G6Y A;  3QPM A;  2ON7 A;  1V58 A;  3UAR A;  4IKH A;  4JU5 A;  4F0B A;  5IMA A;  1TU8 A;  2DML A;  2H1A A;  4IBP A;  5A4U A;  4DEJ A;  3HVX A;  2RUE A;  1OKD A;  3ZIT A;  2HXK A;  3BD2 A;  3I69 A;  3VK9 A;  5KN0 A;  3DVX A;  1PMT A;  5KN3 A;  3GA4 A;  4L5L A;  2R3X A;  1RW1 A;  2QGV A;  2R6K A;  1SD8 A;  2NTO A;  4HEA 2;  3GMF A;  4EIQ A;  2H6Y A;  1MD3 A;  2LQQ A;  1EV9 A;  1LJR A;  4ZB6 A;  4ACS A;  3FMW A;  2YNX A;  4J56 E;  1ILO A;  1WRY A;  1J9B A;  1GTU A;  1YF0 A;  1SK0 A;  1OYJ A;  2DJK A;  2V1M A;  3Q6O A;  3TKS E;  4HQS A;  5D96 A;  5IOW A;  2VAF A;  1GSE A;  1PSQ A;  3IC8 A;  5FHI A;  5ECM B;  3RHC A;  2PER A;  1QXH A;  4GTU A;  4L8E A;  1GWC A;  1GRX A;  3KJY A;  4XHM A;  4WBR D;  2H1D A;  2GZP A;  5D73 A;  3IOS A;  2H71 A;  4Q5Q A;  5GAN D;  2HFD A;  3PR8 A;  4WXT A;  3FYG A;  2REM A;  2H72 A;  5KOW A;  1U3I A;  4AJ7 A;  1FAA A;  1AIU A;  4USS A;  3GX0 A;  2CVD A;  2Z9S A;  3GL5 A;  1HNC A;  3IHG A;  4TR4 A;  1SKW B;  1MTC A;  4WEY A;  1U88 A;  1PL1 A;  2A2P A;  2MBS A;  3VUR A;  2F3M A;  4MP4 A;  4P3Y B;  3GH9 A;  5G2Z A;  4EVM A;  3E9J B;  4HOJ A;  1TRV A;  2GVP A;  3KIJ A;  2HE3 A;  3C1R A;  2AYT A;  1AQX A;  4MJC A;  2VUP A;  1S3D A;  2FD3 A;  3IC4 A;  3ZIV A;  1FOH A;  4MK3 A;  1MDJ A;  1PRX A;  5LD0 A;  5D9X A;  4N0Z A;  2FWH A;  4OMV A;  3D22 A;  3LQ7 A;  5CP1 A;  4JE1 A;  3VFI A;  2G0F A;  5GAP D;  2A2S A;  1PD2 1;  1J0F A;  5IMV A;  5F0G A;  1TOF A;  4CHS A;  1OC9 B;  2AAW A;  5IPG A;  1XW9 A;  2HSM A;  3HZ8 A;  1GSS A;  5JWO B;  1SJZ A;  3TJF A;  1J08 A;  2WRT A;  4PQ1 A;  4GSN A;  1V9W A;  5DAL A;  2A4V A;  4POB A;  1WPI A;  2WDU A;  3GKX A;  4FYC A;  2IJY A;  2DJ1 A;  2CT6 A;  1ERW A;  2H0G A;  4GRF A;  4XCS A;  3W6G A;  1UN2 A;  1AQV A;  4ZBD A;  4FQU A;  2DC5 A;  3RHB A;  3P2A A;  4GLT A;  1XWA A;  3Q74 A;  3ZLP A;  5CRD A;  4WET A;  1YDK A;  3L9U A;  4HZ2 A;  5JWQ B;  2E7P A;  3ERW A;  3MYD A;  2B5X A;  2LS5 A;  1H75 A;  3DWV A;  4I97 A;  4MZW A;  1HNA A;  4MZB A;  4HQZ A;  4NV5 A;  5DQS A;  3C71 A;  3VPT A;  3GSS A;  2HZF A;  1XPV A;  1B9Y C;  1C72 A;  2MZC A;  4D73 B;  3C73 A;  2GST A;  3G7J A;  5D93 A;  4V2L A;  1K3O A;  2P31 A;  1PX6 A;  2M72 A;  3ZTL A;  1NM3 A;  1A8L A;  3U5R E;  4EKZ A;  3FZA A;  3O3T A;  2JL4 A;  3GNJ A;  2H8L A;  3BOA A;  2X99 A;  4NHZ A;  3DML A;  2VCW A;  4TN8 A;  5H5R A;  2B1K A;  1OC8 A;  2M46 A;  4BL7 A;  5H5S A;  4TR1 B;  3GKM A;  10GS A;  2P5R A;  4BVX B;  2C0E A;  4LL4 B;  2V6K A;  4WKW A;  1Z6M A;  2MBT A;  2C80 A;  4NWY A;  2YPM A;  6GST A;  1GNW A;  2IIY A;  1KTE A;  4K5S A;  5IM9 A;  3F6F A;  2DJ0 A;  3G7Y A;  1GH2 A;  4LL1 B;  4TVE A;  1O85 A;  3FKF A;  5JCU A;  2MMZ A;  2H01 A;  2JSZ A;  5CRH A;  4MF5 A;  3EVI A;  2VL3 A;  2GTU A;  1G0T A;  3CRU A;  2LJK A;  2O87 A;  1CQH A;  3ZFB A;  4I2U A;  1JZO A;  1R26 A;  1I5G A;  1THX A;  2C0D A;  2EIQ A;  1RQM A;  1WP0 A;  1TDI A;  2GSQ A;  2AJQ B;  3IPZ A;  4XS6 A;  3PPU A;  2H75 A;  1Z3E A;  5J5N A;  2KP2 A;  4POM A;  1YEP A;  1UVZ A;  4GST A;  2F9S A;  2H6Z A;  2ZNM A;  1BED A;  3E3E A;  4MF6 A;  1TI1 A;  3W8J A;  3MDK A;  1K0O A;  4K1F A;  2O7K A;  4K2D A;  5HFI A;  4HDE A;  5ECN B;  14GS A;  3GN3 A;  4YKG A;  3FR9 A;  5J9C A;  5ECR B;  1PA3 A;  1FB0 A;  3IR4 A;  3UBK A;  3EMX A;  4N0V A;  2F51 A;  3D5J A;  1NHO A;  3I9V 2;  2KHP A;  5LCZ A;  3I43 A;  1WWJ A;  3KCM A;  4KCE A;  2JSY A;  4LLR A;  5ID2 A;  1K0M A;  2JZT A;  3GKN A;  4KUN A;  5AGY A;  1HNB A;  4I6X A;  1K0N A;  1QUW A;  3IRA A;  4XIH A;  4KND A;  1SL0 B;  3JCM L;  2K8S A;  1SD9 A;  2H0H A;  2BTO T;  3M9K A;  5GZZ B;  2K6V A;  2TRC P;  3UIW A;  4ISD A;  3LFL A;  4IEL A;  3KGK A;  4HU7 A;  1LU4 A;  1NHY A;  3DD3 A;  3IXR A;  3H93 A;  3QOU A;  3QFA C;  2IMI A;  2MMN A;  5EY6 A;  5CYY A;  1W4V A;  2GZZ A;  3G9B A;  2PGT A;  3ZRE A;  4V2N A;  3FR3 A;  1GSQ A;  1F37 A;  3IHQ A;  3UMA A;  4AJ6 A;  1WE0 A;  2G2Q A;  3LGC A;  4DSR A;  2IME A;  1ZGN A;  2AV4 A;  4RQR A;  2VL9 A;  2R0C A;  3TGZ A;  4E8E A;  1OC9 A;  4MH3 A;  3I6A A;  3F8U A;  1M2B A;  3TRP A;  3US3 A;  1UC7 A;  5DAL B;  2YJ7 A;  1B48 A;  4PQI A;  3L9S A;  1ABA A;  2LNS A;  4K8M A;  2LRT A;  3HD5 A;  4KF9 A;  4L0U A;  1DBY A;  3H79 A;  4O5R A;  2ZUP A;  4GF0 A;  2OE3 A;  2L59 A;  4WF5 A;  4IGJ A;  3QAG A;  2OKA A;  3SBC A;  4ML6 A;  2P0G A;  4ID0 A;  2DSA A;  3CMI A;  2GQK A;  1EV4 A;  1M9B A;  4G10 A;  4PXO A;  4TW5 A;  4CY6 A;  1JLW A;  4HJM A;  4GCI A;  1HQO A;  3MSZ A;  5B8B A;  2CA8 A;  2K9F A;  1BAY A;  2R0G A;  2XHF A;  4ML1 A;  1EP8 A;  1WMJ A;  5ECS A;  8GSS A;  2IPA A;  1EZK A;  4ZB8 A;  4D73 A;  2X64 A;  2C0F A;  3VI7 A;  2FGX A;  2H76 A;  5IMC A;  3TKS A;  4BWQ A;  1T4Y A;  2ALB A;  3RPN A;  2YJH A;  3EPT A;  2TIR A;  3F4R A;  4KH7 A;  3DEX A;  4N11 A;  2PVQ A;  4FO5 A;  5EVO A;  1FW1 A;  1I9D A;  5DJM A;  5B6M A;  4KGI A;  4TR1 A;  2HRF A;  3QFB C;  4IP1 A;  2VL2 C;  2RM6 A;  2E2G A;  4YH2 A;  1EOH A;  3WD6 A;  3EU4 A;  2HRK A;  3Q19 A;  5G31 A;  4JR4 A;  3QAW A;  3HDC A;  5L71 A;  2DLX A;  1GUL A;  1B9X C;  4NHW A;  1JFU A;  4G19 A;  1T1V A;  1JZD A;  5LNK e;  4OCF A;  2V6O A;  3QMX A;  2QSI A;  11GS A;  4JBB A;  4PNF A;  2MMO A;  2D2Z A;  3M3M A;  9GSS A;  1TK8 B;  4EL1 A;  5HQP A;  1WIK A;  4G0L A;  2EIR A;  3L9V A;  4OCE A;  4XS4 B;  2IL3 A;  3MAK A;  3CTG A;  1O8X A;  3TDG A;  1A2J A;  1ZYE A;  3UVT A;  2VM1 A;  1TI3 A;  2LRN A;  4K6X A;  2CVB A;  2BMX A;  3IV4 A;  3IBH A;  1B4Q A;  3ERG A;  3TKQ A;  1S3C A;  1XOB A;  3C7M A;  2L5L A;  4XRD A;  5ID2 B;  3ERF A;  3F3Q A;  5CNW A;  5E4W A;  2CV4 A;  3DRN A;  1X5D A;  3A2W A;  1FG4 A;  4EC0 A;  1XWK A;  3LXT A;  5KN1 A;  1XVQ A;  4K0G A;  4PNG A;  2A4H A;  5DCH A;  4ZBA A;  1G7E A;  3L78 A;  2R2J A;  4MA9 A;  2H74 A;  4YAV A;  4ZL7 A;  20GS A;  4OO4 A;  5ENU A;  1R5A A;  3DGQ A;  1YKA A;  4OO5 A;  3M1G A;  6GSS A;  4TR3 A;  5AIV A;  4JZQ A;  3W8S A;  2VD0 A;  3C1S A;  1PKW A;  2YWO A;  3LYK A;  2B5E A;  2QKE A;  1X9W B;  4XS1 A;  4KAE A;  2NBS A;  3FK8 A;  3PH9 A;  3LJR A;  3A5I A;  2WZ9 A;  5DVB A;  4K2X A;  2VLV A;  4QQ7 A;  2GGT A;  5IMZ A;  4EE0 A;  3DYR A;  4Q5F A;  3TJK A;  3GUR A;  3G7I A;  1EP7 A;  4GSS A;  4IQ1 A;  5D9V A;  2OE0 A;  4HZ4 A;  4K7O A;  3QR6 A;  5JWR B;  1FO5 A;  3HJM A;  2O8V B;  3LSZ A;  5AIX A;  1FVK A;  1VF1 A;  3UOM A;  4F0C A;  2PPT A;  4OFT A;  1USB A;  3WGE A;  2PUK C;  3HHV A;  4MPG A;  1V57 A;  3HYP A;  1X5E A;  1FHE A;  2DJ2 A;  1GLP A;  5GST A;  2DBC A;  3EIN A;  5ECH B;  4MZC A;  2AB6 A;  1SK1 A;  3GHA A;  1N2A A;  1K3L A;  3CXG A;  2VLT A;  3UBL A;  5DDL A;  3HCZ A;  4IP6 A;  2LNT A;  4L0W A;  3VWU A;  2LTK A;  1G6W A;  1R7H A;  3QD9 A;  1U6T A;  3D6I A;  3KH7 A;  2RM5 A;  1SYR A;  2VD1 A;  5IOX A;  5IIZ A;  1XCC A;  1GTI A;  5F05 A;  3N5O A;  1ZYQ B;  4YKF A;  1JHB A;  2L6C A;  2DKI A;  2FY6 A;  4IJI A;  3F4S A;  1TTZ A;  3UVH A;  3IK7 A;  6GSV A;  5DCG A;  2A2R A;  1O73 A;  2F8A A;  4KX4 A;  1VF3 A;  3BJ5 A;  2GZY A;  3VWV A;  1PN9 A;  2O85 A;  2YN1 A;  1PX7 A;  1X0R A;  4RUV A;  3IA1 A;  2WGR A;  4TXV A;  2RUF A;  4O32 A;  3VWW A;  16GS A;  5IMD A;  4ECJ A;  3ZRD A;  1TRW A;  4F82 A;  3IAM 2;  1NSW A;  2X4A A;  2YZH A;  4KE3 A;  1TP9 A;  1M7T A;  3R2Q A;  4LMV A;  5CRG A;  1O6J A;  4WF4 A;  1Z6N A;  2GSR A;  2YWN A;  1PQN A;  1TKD B;  1O8W A;  2I4A A;  3BBY A;  2CAQ A;  3F3R A;  1K0D A;  1ZZY A;  1F3B A;  2VCX A;  2NPB A;  1BG5 A;  2WJU A;  4OD7 A;  1V2A A;  1XXU A;  5DQY A;  2VCZ A;  3FZ4 A;  1AQW A;  3V1W A;  1T00 A;  2GDR A;  1K0A A;  2B5Y A;  2WFC A;  4ECC A;  1DSB A;  2FWG A;  3KTL A;  4KW6 A;  1RK4 A;  2R0P A;  3KD0 A;  4V1A p;  3FEU A;  2QA2 A;  1IYH A;  3PGT A;  4XS4 A;  4OFN A;  2M80 A;  3ZVJ A;  2IMK A;  1GSD A;  2WS2 A;  2YZU A;  3GTU B;  2LV3 A;  3KTB A;  2HSY A;  3J7Y b;  1FVJ A;  1JLV A;  4ILF A;  2YV7 A;  3A3T A;  4ZBB A;  2L4C A;  5KEJ A;  2HSH A;  2CAI A;  4QL9 A;  4KSO A;  4EDY A;  3M0F A;  2PU9 C;  2DMM A;  2HNL A;  1SJI A;  2I9H A;  4ZIJ A;  3NIV A;  1SKR B;  2HLS A;  2OBK A;  3LG6 A;  3F4T A;  2C3T A;  2WB9 A;  1F9M A;  2XBI A;  3TKR A;  1PGT A;  3ISO A;  3MIX A;  2YAN A;  4WR4 A;  2RLI A;  1SK2 A;  3CBU A;  2N5F A;  4CDO A;  3ZYW A;  4EF0 A;  4G0I A;  3EUR A;  1T4Z A;  1XWB A;  1XW6 A;  3KEB A;  1U3A A;  1F3A A;  3EE2 A;  3ZZX A;  2KLX A;  2FNO A;  4E8H A;  1SYX A;  3L4N A;  2LJR A;  1B4P A;  1SL1 B;  5CAX A;  4G9H A;  1BYE A;  1JZW A;  1M0U A;  5A4V A;  2LEG A;  1ERU A;  4WR5 A;  5KOX A;  17GS A;  1EGR A;  1PL2 A;  2H19 A;  1XBS A;  1SKS B;  2RII A;  4YQV A;  2DJ3 A;  2F8F A;  2OE1 A;  1CQG A;  1W89 A;  2P5Q A;  5CRE A;  4F03 A;  3S9F A;  4Z2U A;  1TRS A;  3TOU A;  3GST A;  1TXX A;  4BPY A;  4MJB A;  3LOR A;  4I8B A;  3FW2 A;  4AGS A;  2DJJ A;  5G1K A;  3D0Z A;  1HD2 A;  3GX8 A;  2K8V A;  2DIZ A;  4DSQ A;  3FR6 A;  4ZXG A;  1QQ2 A;  3FY7 A;  3UJ1 A;  1Y6E A;  2GT5 A;  4KB3 A;  4GQC A;  3WYW A;  1TU7 A;  4L5O A;  4PUF C;  4BWS A;  4J2F A;  4ZL9 A;  3M8N A;  1GUM A;  1NW2 A;  4K7I A;  3A2X A;  2VO4 A;  4GQF A;  1QMV A;  4QL7 A;  2N5A A;  5IO0 A;  4K7N A;  3DIE A;  4XRA A;  2K18 A;  2R4V A;  4H86 A;  3TKP A;  1XWG A;  2L4Q A;  1GSU A;  3FZ9 A;  4O5Q A;  4HS1 A;  2V32 A;  4EUY A;  4MF7 A;  4OWY A;  3C8E A;  2L5O A;  4RI6 A;  2XPE A;  6GSY A;  1ZYN A;  3F63 A;  2IMD A;  2XPD A;  5HR0 A;  3TRX A;  4J57 E;  4KDY A;  4NMU A;  2PWJ A;  2VOC A;  5HR2 A;  4KA0 A;  5INY A;  4MH2 A;  4TRX A;  2N5B A;  1OAZ A;  1V98 A;  5COH A;  1TJD A;  2C3N A;  1THO A;  4N30 A;  2X8H A;  4ECI A;  3TKS C;  2VCV A;  4IVF A;  1F2E A;  1Z9H A;  4RI7 A;  4PTS A;  4IHU A;  1A8Y A;  2JU5 A;  1VGL A;  3KM6 A;  2MYG A;  3EYT A;  2HI7 A;  3EU3 A;  1F6M C;  5ECO B;  3RDW A;  2E2M A;  1GLQ A;  5G5E A;  4K5R A;  1GL8 A;  3A5W A;  1O7U A;  4XTS A;  5BMU A;  4POK A;  3TCO A;  3KZQ A;  3CSH A;  2MMA A;  5C04 A;  4ZB9 A;  3RPP A;  1YY7 A;  2FHE A;  4YQU A;  3U6V A;  3KH9 A;  2O89 A;  2CX3 A;  5G5F A;  2B3S A;  4JR6 A;  1MEK A;  2WUL A;  3VWX A;  1AUC A;  2VM2 A;  4NPB A;  5EPF A;  3TRQ A;  1MDK A;  3AY8 A;  3F6D A;  3HJP A;  4MJE A;  3ZVJ D;  1YEX A;  2JZS A;  13GS A;  7GSS A;  1YZX A;  4NAX A;  2DIY A;  2HRN A;  1MDI A;  2FWE A;  4LMW A;  4IJ3 A;  4F2I A;  2OA7 A;  2OJL A;  3O6T A;  1X9S B;  1GUH A;  4PUR A;  3VI5 A;  3GTU A;  3UL3 A;  1GP1 A;  4DSS B;  3TOT A;  3P7X A;  1O81 A;  3PIN A;  4PUA A;  1JZR A;  2CZ2 A;  3F0I A;  4PQH A;  3P8W A;  1M99 A;  3TB2 A;  1ST9 A;  1Z7R A;  2H1B A;  5A4W A;  5DAK A;  3DXB A;  4KSM A;  1X5C A;  3ZFL A;  5ELG A;  3ZIJ A;  2KUC A;  2DKH A;  4F9Z A;  4IW9 A;  2PN8 A;  2WCI A;  2GT6 A;  3E0U A;  5D9W A;  5H5Q A;  5DBQ A;  4GWR A;  1DE2 A;  5DJL A;  3LEF A;  4Z2R A;  3ME7 A;  3D4T A;  5F07 A;  1A24 A;  2H70 A;  1DUG A;  5C00 A;  2CVK A;  1SEN A;  2VLU A;  2R37 A;  5ECP B;  4MMM A;  4YQM A;  2ES7 A;  2IFQ A;  4K9Z A;  1KBN A;  4IS0 A;  4KCA A;  5B8A A;  2I81 A;  4RQX A;  3QCP A;  2VCT A;  5G30 A;  5F06 A;  5CO3 A;  2FLS A;  1ML6 A;  1M2A A;  1WOU A;  2I1U A;  1OVN A;  4A5P A;  1GTA A;  1K0C A;  4BVY B;  2YP6 A;  3GKK A;  4BA7 A;  1OC3 A;  1EEM A;  3M9J A;  5J41 A;  4IQA A;  3HXS A;  3Q18 A;  3H1N A;  1URM A;  3IE3 A;  3HVV A;  3IAS 2;  5EL8 A;  1R5P A;  3APS A;  3DKS A;  3GH6 A;  5AN1 A;  2E0Q A;  1E6B A;  4JED A;  2ZCT A;  3KXO A;  3D4M A;  2FWF A;  2QA1 A;  2CQ9 A;  3LXZ A;  5J9B A;  3GYK A;  3GIX A;  1XZO A;  1AW9 A;  2IMF A;  1A23 A;  2HRA A;  2LQO A;  4V2M A;  1EGO A;  3EC3 A;  3EMP A;  5D9T A;  3F9U A;  2CZ3 A;  1ZYP A;  2C8U A;  1EWX A;  4MAB A;  3HVS A;  2JZR A;  1M9A A;  1A0F A;  3HKR A;  4HJ2 A;  2C3Q A;  2AHE A;  2NVL A;  6GSU A;  3LYP A;  4ULX A;  1TK5 B;  2HZE A;  2J9H A;  3TJG A;  2LJA A;  1A2M A;  1KEB A;  1GNE A;  4TXO A;  1S3A A;  4MDC A;  1Q98 A;  1A0R P;  2J23 A;  3CSJ A;  3ZML A;  2QC7 A;  4GXZ A;  2H6X A;  5IMF A;  3LW9 A;  5F8B A;  5B7C A;  1K3Y A;  3BCI A;  4KDU A;  4TR0 A;  3BCK A;  4AJ8 A;  1HYU A;  2GQM A;  1Y25 A;  1XIY A;  2UZ8 A;  2GSS A;  5J3R A;  4MPF A;  2HT9 A;  3VLN A;  1A2L A;  2LUS A;  3GFK A;  1Z5Y E;  1SJ6 A;  1Z7P A;  3VPQ A;  2YWI A;  5IPH A;  1MD4 A;  1VRS D;  3HJO A;  4FYB A;  4IN0 A;  3WGD A;  3OR5 A;  1GUK A;  3HA9 A;  4HU9 A;  4Q5R A;  3RAZ A;  2H73 A;  3GUS A;  5ELA A;  1QFN A;  5B6N A;  2B7K A;  5FWG A;  5D8I A;  4N10 A;  4V1A g;  3A2V A;  2LRC A;  19GS A;  3IDV A;  3GV1 A;  1YQ1 A;  2OAC A;  4G0K A;  5JCW A;  2X49 A;  1PKZ A;  4CY8 A;  3RBT A;  1XFL A;  3ZMK A;  1YKC A;  4OFM A;  5FT3 A;  3GRX A;  2XC2 A;  1DE1 A;  3WT2 A;  1TK0 B;  4NXI A;  3TJB A;  3KMO A;  6GSX A;  1XOA A;  12GS A;  3O76 A;  4MJA A;  1ACV A;  4CW9 A;  2H66 A;  5JCG A;  5HFK A;  1FOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...