3GH9A

Crystal structure of edta-treated bdbd (oxidised)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
186
structure length
186
Chain Sequence
NDAVSGQPSIKGQPVLGKDDAPVTVVEFGDYKCPSCKVFNSDIFPKIQKDFIDKGDVKFSFVNVMFHGKGSRLAALASEEVWKEDPDSFWDFHEKLFEKQPDTEQEWVTPGLLGDLAKSTTKIKPETLKENLDKETFASQVEKDSDLNQKMNIQATPTIYVNDKVIKNFADYDEIKETIEKELKGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Disulfide bond formation protein D
publication title Crystal Structure and Biophysical Properties of Bacillus subtilis BdbD: AN OXIDIZING THIOL:DISULFIDE OXIDOREDUCTASE CONTAINING A NOVEL METAL SITE
pubmed doi rcsb
source organism Bacillus subtilis
total genus 76
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3gh9A00
4AF2A 1SU9A 3VFIA 1X9WB 2JU5A 5HR0A 4GTUA 3TDGA 4HZ4A 4XHMA 3HVSA 2C3NA 4KCAA 2WRTA 1GSQA 2AAWA 3TJGA 1AAZA 3GURA 5GSSA 5ELAA 3F6DA 1B9XC 1B8XA 1MTCA 1LBKA 2HI7A 2YOIA 1DSBA 4HJ2A 3FR6A 1K0AA 2H76A 1MDKA 4IJ3A 3WT2A 1ZYEA 2V6KA 4CDOA 2KUCA 3ZYWA 3TB2A 6GSVA 1GSYA 1GULA 2NDOA 2K9FA 3IAS2 1PMTA 3LORA 2JSZA 3ZMKA 5IPHA 1NW2A 3GKKA 2PPTA 2EIQA 2LQOA 3KXOA 2YPMA 1V98A 4ZBAA 3HZ4A 4MDCA 5GZZB 3F3RA 4HEA2 2LNSA 1MD4A 2XBIA 3GHAA 1XWBA 4MZCA 5EL8A 3P8WA 4JBBA 1PN9A 2F51A 2O89A 3VWXA 1T3BA 3GFKA 2L5LA 3WYWA 3CXGA 1JLVA 4OFMA 2VD0A 5G1LA 2LRTA 4O92A 1XCCA 1BX9A 2V41A 1V58A 1JZWA 5CP1A 5IM9A 3TRXA 2C3QA 3ZZXA 3UVHA 3VI5A 2LRCA 3TOUA 5IO2A 2FCHA 3KCMA 3J7Yb 4Q5FA 4IW9A 3QCPA 4PX1A 5EVOA 4L0WA 1HD2A 4MABA 3KTLA 3FZ4A 3A2VA 1SD8A 5IOWA 2VCVA 2GZZA 3US3A 1BEDA 4F82A 2TIRA 1K0BA 4ZBBA 6GSSA 3UBLA 1O73A 1WRYA 3IHQA 4NMUA 4TN8A 2LNTA 2LS5A 2DJ0A 4IKHA 2HZEA 4GWRA 4HDEA 2WB9A 2X99A 3HCZA 1O85A 3G9BA 3VWUA 11GSA 4V1Ag 5G2ZA 1XVWA 2GT5A 1TW9A 1O7UA 3Q6OA 5HR1A 3JCML 3TCOA 1QK8A 4TXOB 5ECMB 3M1GA 4OD7A 2FA4A 1EOHA 2LEGA 4MJBA 3CRUA 4L5OA 2VUPA 5L71A 3F4SA 4OWYA 4O5RA 1GTAA 4KX4A 4ZXGA 4RQRA 8GSSA 4K9ZA 2NVLA 5A4VA 1HNCA 4NPBA 1SK2A 3C1SA 2YZUA 5IMVA 1Z3EA 4J2FA 3IAM2 2B7JA 2K8VA 3GRXA 3LYKA 3TUEA 5IMDA 3A2XA 1BJXA 1AXDA 4DEJA 2DJ3A 4TR4A 1BG5A 3IOSA 4MJAA 4MZWA 4ECJA 1F3AA 2IJYA 2IFQA 3FW2A 2DIYA 4X43A 2A2RA 1Y6EA 3TGZA 1VRSD 1SJZA 2X8GA 2HSHA 2ON7A 5A4WA 1X5CA 1GUHA 1YF1A 1GSFA 1QFNA 3M8NA 1M2BA 2A2SA 4L8EA 5IIZA 4EXJA 2RUFA 2YJHA 1TU8A 5IMZA 4IVFA 5J3RA 4PURA 3CSHA 3ME7A 2P0GA 3ZIJA 5INYA 4E8HA 3TKSA 3QFBC 4V1Ap 2MBSA 3GN3A 4KE3A 1R5AA 2FWEA 2AUVA 1ZMAA 2I3YA 4I5QA 3RBTA 2YV9A 4EE0A 4XCSA 2HE3A 3KP9A 5B7CA 3WD6A 4DSRA 4ZBDA 1GLQA 1J08A 3EMXA 2YN1A 2H6XA 4TR1A 4MPFA 4KUNA 1ILOA 2YNXA 2WFCA 1LU4A 2VCXA 4K7OA 2HZFA 3FK8A 1QUWA 2H8LA 4GXZA 4MH3A 2XC2A 3IK9A 2R37A 4GCIA 4WR4A 2ZNMA 4WXTA 3LYPA 2G2QA 3E0UA 3U6VA 1G6YA 4MMMA 4XS4A 1UN2A 3BBYA 2H01A 3KP8A 3PR8A 1UA5A 1Z9HA 5DCHA 3DKSA 1SJIA 3VWVA 1SL0B 1SL1B 1WE0A 4GLTA 5G1KA 4O7HA 2OE3A 3GNJA 3C73A 4AJ6A 1HYUA 2JSYA 5GSTA 3W8SA 4OFTA 3NOFA 4HQZA 2VLUA 2VIMA 3GL5A 1PQNA 4YQVA 3ERFA 1AQWA 1K0OA 5DQYA 2V1MA 3P7XA 5GAPD 1G0TA 4TR0A 4K0NA 2HXKA 1GSUA 1SKRB 3IBHA 3FRCA 4I6XA 4L0UA 2D2ZA 4Q5RA 4K2DA 1N2AA 3CYNA 4XRDA 2KOKA 2JL4A 5J41A 1TJDA 5IOXA 2DJJA 1TK0B 5IO0A 3QPMA 2J23A 5DCGA 3HHVA 2LQQA 1B9YC 1A2LA 2FGXA 4KA0A 1F2EA 3KMOA 3UMAA 4EDYA 4EKZA 2QC7A 1TTZA 1GNEA 2C4JA 3GTUB 5IMCA 5FT3A 4IQAA 3TOTA 4PUFC 1PSQA 1V57A 3GKXA 1J9BA 4POKA 5ABRA 1J0FA 3TRPA 2L6DA 2H0GA 4GSSA 5KN3A 1F37A 4DVCA 1G6WA 3IK7A 3GH9A 4H86A 3I9V2 1T00A 3HDCA 3MAKA 4YAVA 5HQPA 2IMEA 3TKSC 3F9UA 2VO4A 1M99A 3DIEA 4OCFA 5H5SA 5COHA 5D93A 3GMFA 3KIJA 2XBQA 2K18A 3ISOA 3VI7A 4EF0A 3ZMLA 4K7NA 1XBSA 1T1VA 2MMAA 1EGRA 1ZOFA 2WULA 1YJ6A 10GSA 3PH9A 3F6FA 1EV9A 2E2MA 4PXOA 1AUCA 1Z5YE 2J9HA 3ZTLA 3UJ1A 3NZNA 3CTGA 4V2MA 5AIVA 1Z6MA 3GSSA 4WBJA 3BCKA 2PU9C 1KTEA 5AIXA 3TKSE 1E6BA 2ZUPA 1O8XA 3CSJA 1S3AA 5EY6A 3EWLA 2H72A 4HZ2A 2TRXA 2VL3A 5CRHA 2FNOA 6GSTA 2OBKA 5GAND 1JZOA 5ENUA 2R3XA 2K6VA 4WEYA 1M7TA 3GX8A 3A2WA 3RPNA 4ML6A 3G7JA 3MWHA 4GQCA 3F8UA 1SKSB 2QKEA 3G7YA 3HKRA 2N5AA 1MD3A 2CAIA 4KH7A 1AQVA 4HUAA 3DRNA 3LXTA 2KP2A 5G5FA 3IXRA 3D4MA 3HY2A 4LL1B 3UVTA 2ZCTA 1GTUA 2B5YA 2FY6A 1R5PA 5ELGA 5ECOB 5DAKB 1SYXA 17GSA 2H1GA 1USBA 1ST9A 6GSUA 5F8BA 1XOAA 2V32A 3P90A 4IP1A 1A0FA 4RUVA 1IYIA 2P5QA 4MJCA 2EIRA 1GSDA 4BVXA 2DSAA 4CHSA 1SK0A 1ZGNA 1A0RP 2C0EA 2OBIA 2HT9A 1ZL9A 1NHOA 3ZVJA 3HJOA 2VM1A 2LRNA 2PWJA 3O3TA 2P31A 3QOUA 4NWYA 3AY8A 1K0NA 4IJIA 3UEMA 3H1NA 1NHYA 2RM5A 4DSSA 1DE1A 2FWHA 4TVEA 3WT1A 3O76A 2N5BA 3M9KA 4WF4A 1XPVA 1UC7A 3UIWA 3UOMA 3GH6A 1VF3A 4IN0A 2RIIA 2JZSA 3GL3A 5B8AA 2K8SA 2OADA 2R4VA 3RHCA 1QQ2A 2MMZA 3MNGA 2DLXA 1B4PA 1SKWB 3DEXA 3I69A 1ACVA 1C72A 5ECKB 4F0BA 2TRCP 5CNWA 4F03A 2H75A 5G30A 1TOFA 3HD5A 3FEUA 1YEPA 4I2TA 1XVQA 2LJAA 4NXIA 3EE2A 4PQIA 5LCZA 4POMA 2AYTA 5CREA 2YCDA 3E3EA 2IMIA 3DXBA 5ECLB 2VCTA 5D8IA 3FR3A 3KJYA 3D22A 3U5RE 4NV2A 1Z7RA 2IL3A 3MDKA 3C8EA 3Q18A 4JR4A 4OMVA 4LLRA 5G31A 1DE2A 4J57E 3WGDA 4KGIA 1WPIA 2EIOA 3H79A 1GSEA 4G9HA 1W4VA 1FOVA 3UARA 4PUAA 2IWTA 5KN2A 3GX0A 3RHBA 3IV4A 3GIXA 5B6MA 2L6CA 1YY7A 4HOJA 2B5XA 2F8AA 3K8NA 4RI6A 4Q5QA 5F06A 5AISA 2WDUA 4LMWA 20GSA 2PVQA 2WGRA 3L4NA 4FO5A 4FYCA 4KNDA 2C0DA 2GQKA 3BOAA 1GP1A 2FHEA 2AB6A 1PKZA 3ZREA 1BQ7A 2MMNA 2R6KA 2QGVA 5FHIA 4JRRA 4MA9A 1WOUA 2OACA 2XHFA 1BAYA 2H66A 2DBCA 5JCUA 3TJJA 5DQSA 1TK8B 1I5GA 4Z7XA 7GSSA 4P3YB 4PGTA 5ECIB 4AJ7A 4ZILA 4JEDA 2XPEA 4FIWA 3TJBA 1TP9A 1ZCPA 4AJ8A 4I8BA 1SD9A 2GSQA 3IE3A 1U87A 3IPZA 1Z6NA 1TK5B 1THXA 3KH9A 4OFNA 5HFIA 1QXHA 3LJRA 1EP7A 3I6AA 6GSWA 2PBJA 4HJMA 4ZB9A 1F9MA 2C1YA 5G5EA 1PX6A 3D5JA 4KB3A 2GVPA 3KGKA 4LA1A 1YZXA 5KN1A 1EEMA 3WGEA 3RPPA 3UAPA 2CT6A 1GLPA 4JU5A 3C1RA 22GSA 1GNWA 1NSWA 3BD2A 1B4QA 3QMXA 1RK4A 5IMAA 1A24A 3TKQA 1W89A 2NTOA 1OE7A 3EC3A 4KDXA 4JE1A 2CQ9A 3FR9A 4TXOA 3FKFA 3ZRDA 3L9VA 5JWQB 3C7MA 2DMMA 1BYEA 2FUG2 1K3OA 5DALB 4V2LA 4K8MA 3F0IA 1KEBA 4D73A 4IP6A 1GUMA 4X1UA 1CQGA 3R2QA 2GT6A 3HXSA 4EO3A 4MH2A 1EWXA 2JADA 2JACA 1XW9A 2DIZA 1OKDA 5CRGA 1K3LA 5HFKA 1E2YA 2VCQA 1PA3A 3LQ7A 3TRQA 1V2AA 4ZL8A 2O8VB 2F9SA 4NAXA 5LD0A 3WGXA 3HYPA 2YANA 2VLVA 3M9JA 1JZRA 1DUGA 2P5RA 5F05A 3MSZA 1TDIA 4MZBA 2IMDA 4F2IA 2AV4A 3APQA 5E59A 5F0GA 2CVDA 1T4YA 3HVXA 2VCZA 1QGVA 3VLNA 2H1BA 2DJ2A 2L4CA 2VM2A 1OE8A 3ZIVA 2HSYA 3QFAC 2GQMA 2AJQB 4HU7A 1S3DA 3KM6A 1O81A 1VF1A 3J7Yk 3KTBA 4N11A 5ECPB 2B6MA 1THOA 1TKDB 1Q98A 1PKWA 3F4RA 4ID0A 2GZYA 3LGCA 3HA9A 5B6NA 4MF5A 2FLSA 3ZVJD 4F0CA 1SYRA 2MMOA 1A8YA 2R5GA 3FHKA 3HJPA 4N10A 4PQHA 3H8QA 3LSZA 4YH2A 2NPBA 2HRFA 5LNKe 3A5WA 1FAAA 4JR6A 5H5RA 5H5QA 1PGTA 13GSA 5CYYA 3N5OA 4PNGA 2FD3A 5ID2A 3GUSA 2LSTA 3IC4A 4AGSA 3CTFA 3DGQA 4POBA 4QQ7A 3PINA 2FWFA 5J9BA 2X8CA 2CX3A 3VK9A 1ZYQB 4O32A 1U88A 1FVKA 1EZKA 1EV4A 2CV4A 4LMVA 1A2MA 2PERA 1WIKA 2ES7A 2L5OA 1HNAA 2WJUA 4EUYA 4BA7A 1A8LA 1FW1A 3CMIA 3M0FA 4ECBA 3IR4A 1ERVA 1X5DA 2VL2A 4G19A 1GSSA 2RM6A 3EURA 2YWIA 4YQUA 4DSSB 1Y25A 2DMLA 2VD1A 5CRDA 1V9WA 1K3YA 2IIYA 4ACSA 3O6TA 2NBSA 4KAEA 1FB0A 1FVJA 2H19A 2GSSA 2CX4A 3IRAA 2IPAA 3EVIA 3VPTA 2JZRA 19GSA 3GTUA 1PL2A 3ZITA 2N5FA 3GKMA 3S9FA 4IBPA 2LJKA 5HFGA 2I4AA 3V1WA 5ECRB 3W8JA 4TKYA 5C00A 1WJKA 4EL1A 5ECNB 2CVKA 2KP1A 2F8FA 2H73A 2VOCA 2E2GA 1R7HA 3DD3A 2CZ3A 5JWRB 2KLXA 3ZLPA 2CVBA 4KSMA 1WP0A 5DBQA 4WKWA 3HZ8A 2ALBA 1YKAA 5F07A 1VF4A 2M46A 2HZEB 2M72A 4TW5A 5A4UA 1XW6A 3ERWA 1OC9A 5DJLA 5DDLA 4LL4B 2L59A 4GQFA 3UBKA 4RI7A 4GF0A 3W6GA 4KW6A 2QSIA 1XWGA 3IDVA 2G0FA 2X8HA 1LJRA 3NIVA 5E4WA 4ZL7A 1SL2B 3CBUA 14GSA 5A5KA 2H6YA 2CZ2A 4I2UA 2C8UA 3GYKA 1FB6A 1YF0A 1GL8A 1KBNA 3F3QA 5D9VA 1XWCA 1YKCA 3BCIA 1X9SB 1ON4A 3EU3A 5DVBA 5KN0A 2DJ1A 1F3BA 3DMLA 3L78A 3EMPA 1JLWA 2LKUA 4XTSA 1I9DA 4PNFA 4K0GA 3LEFA 2GSTA 3QD9A 3P2AA 3EYTA 3VWWA 2O85A 3L9SA 5CO3A 1U6TA 5CRWA 2VAFA 1B48A 2C3TA 2VL9A 5IQYA 4BWQA 2I81A 2IFQB 3PGTA 4EVMA 2IN3A 1YDKA 5HR2A 2EC4A 1K0CA 2VL2C 2BTOT 1HQOA 2H1DA 1G7EA 4RQXA 1TXXA 6GSXA 1YQ1A 5DAKA 1OC3A 3DWVA 2H1AA 2GQLA 2REMA 5ECSA 4HI7A 3D21A 3KZQA 3QAVA 4GSTA 1Q4JA 2H30A 1HNBA 2B5EA 2HNLA 2PVOC 5EPFA 1EOGA 2OE1A 3CSIA 3RAZA 3SBCA 2MZCA 16GSA 3KD0A 3KH7A 4BL7A 2B3SA 1EGOA 2OKAA 1X5EA 1AC1A 2BJXA 3C71A 4OO5A 3FZAA 3EINA 4HQSA 1SJ6A 5FWGA 1K0MA 4TR1B 3G7IA 4FYBA 2I1UA 2X64A 2HYXA 5D9TA 3LG6A 1VGLA 2PN8A 2HFDA 3KEBA 3VURA 1JZDA 1FO5A 4XS4B 4XS6A 4D73B 1PRXA 5C04A 3FZ9A 3QR6A 2IMFA 4CW9A 2L4QA 4WETA 1OAZA 2DC5A 4WF5A 3SWLA 1UVZA 5ECQB 3KMNA 1ML6A 1ERTA 2M80A 4BPYA 1XFLA 4F9ZA 2JZTA 4MCUA 4NHZA 3DVWA 3HJMA 3GSTA 4MLYA 2GLRA 4TR3A 3QAGA 1TRUA 1O8WA 4NV5A 4ML1A 5D73A 4OCEA 4HU9A 4K7IA 1YEXA 1O6JA 2GSRA 3ERGA 4HS1A 5HR3A 5DJMA 3QAWA 1OKTA 2C80A 5KEJA 4QL9A 1AIUA 3HVVA 1H4OA 1G7OA 1FHEA 3ME8A 1M9AA 3QDNA 1TRSA 2OA7A 4PQ1A 18GSA 1PX7A 2YP6A 2MYGA 3M3MA 4I97A 4IHUA 4YQMA 2XPDA 1XZOA 3IA1A 4TXVA 1EEJA 1TRWA 1KNGA 2HRNA 5IPGA 4OO4A 5AGYA 4E8EA 4MF6A 3GKNA 3Q19A 3TKPA 2A4VA 3BJ5A 5JCWA 2PUKC 2Z9SA 1TI3A 4J56E 4EDZA 3RDWA 2H0HA 1GRXA 1XW5A 2MBTA 2YZHA 2E7PA 1TU7A 1U3AA 4XRAA 1GH2A 2WS2A 2AHEA 4N30A 2OJLA 4N0VA 1X9MB 2I9HA 1WMJA 5ID2B 3ZFBA 1TI1A 2R2JA 2H70A 2YJ7A 4IQ1A 4WR5A 1IYHA 3FYGA 2B1KA 6GSYA 1JFUA 4FYUA 3VPQA 2FWGA 4Q5NA 3D0ZA 1S3CA 1XWKA 2E0QA 4V2NA 3Q74A 4BVYA 1X0RA 1QMVA 3I43A 2H6ZA 1M0UA 2H74A 4POLA 1V40A 1F6MC 4NHWA 4YAPA 3GV1A 5CAXA 9GSSA 2CA8A 1OC8A 4ECCA 5B8BA 4IGJA 2B1LA 3D4TA 4MK3A 2YV7A 3F4TA 2GS3A 1SENA 1XOBA 1FG4A 3APSA 3L9UA 4ZL9A 4MF7A 2WCIA 4G2EA 1EP8A 2V6OA 4ULXA 3GA4A 1GTBA 4ZB6A 3F63A 5JWOB 1MEKA 4GRFA 3H93A 5D96A 3FY7A 2YWMA 5D9WA 4N0ZA 1ERUA 2FA8A 1K0DA 2BMXA 4KSOA 1JHBA 2WZ9A 2LUSA 5J4UA 1MDIA 2H71A 3ZL5A 2OE0A 1WWJA 5J5NA 1CQHA 2LJRA 2H0IA 4XIHA 3H4KA 4FH8A 3LWAA 3DYRA 4ZIJA 4MPGA 3ZFLA 5JCGA 5AN1A 3OR5A 2YWOA 1PD21 5DALA 2GGTA 1XIYA 1TRVA 4EC0A 1PL1A 2GTUA 1SK1A 3TJFA 4BWSA 1H75A 2KHPA 1DBYA 3L0HA 2LTKA 1A23A 1T7PB 1ZZYA 2F3MA 2ON5A 4G10A 5ECHB 2C0FA 1A2JA 2VLTA 1R26A 2HLSA 4QL7A 2V2GA 4ZB8A 1Z7PA 2O87A 1GUKA 4TRXA 2L57A 2DJKA 4KDYA 1GWCA 4MP4A 3ED3A 3TKRA 1ERWA 4DSQA 1OC9B 1RW1A 1M9BA 4ISDA 3TJKA 2VCWA 3UL3A 4WBRD 4XS1A 3EU4A 3LFLA 4MJEA 3N9JA 1XWAA 2PMTA 1AW9A 1M2AA 3FZ5A 1XXUA 4L5LA 4ECIA 4KCEA 2LV3A 1R4WA 1RQMA 4X0XA 12GSA 1URMA 3DVXA 5D9XA 4TOPA 1OYJA 2IMKA 3D6IA 1OVNA 2PGTA 4K1FA 3APOA 4JZQA 2YWNA 1NM3A 2O7KA 1MDJA 1N8JA 2GDRA 3E9JB 1GTIA 4IS0A 1VF2A 2GZPA 3A3TA 4ILFA 2RUEA 4K6XA 4GSNA 1T4ZA 4KDUA 1AQXA 1U3IA 2C0GA 3CRTA 2RLIA 5IMFA 1ABAA 1T8EB 1M2DA 3LXZA 2B7KA 5J9CA 2CAQA 4IELA
chains in the Genus database with same CATH superfamily
4AF2A 1SU9A 3VFIA 1X9WB 2JU5A 5HR0A 4GTUA 3TDGA 4HZ4A 4XHMA 3HVSA 2C3NA 4KCAA 2WRTA 1GSQA 2AAWA 3TJGA 1AAZA 3GURA 5GSSA 5ELAA 3F6DA 1B9XC 1B8XA 1MTCA 1LBKA 2HI7A 2YOIA 4CY6A 1DSBA 4HJ2A 3FR6A 1K0AA 2H76A 1MDKA 4IJ3A 3WT2A 1ZYEA 2V6KA 4CDOA 2KUCA 3ZYWA 3TB2A 6GSVA 1GSYA 1GULA 2NDOA 2K9FA 3IAS2 1PMTA 3LORA 2JSZA 3ZMKA 5IPHA 1NW2A 3GKKA 2PPTA 2EIQA 2LQOA 3KXOA 2YPMA 1V98A 4ZBAA 3HZ4A 4MDCA 5GZZB 3F3RA 4HEA2 2LNSA 1MD4A 2XBIA 3GHAA 1XWBA 4MZCA 5EL8A 3P8WA 4JBBA 1PN9A 2F51A 2O89A 3VWXA 1T3BA 3GFKA 2L5LA 3WYWA 3CXGA 1JLVA 4OFMA 2VD0A 5G1LA 2LRTA 4O92A 1XCCA 1BX9A 2HSMA 2V41A 1V58A 1JZWA 5CP1A 5IM9A 3TRXA 2C3QA 3ZZXA 3UVHA 3VI5A 2LRCA 3TOUA 5IO2A 1ZYPA 2FCHA 3KCMA 3J7Yb 4Q5FA 4IW9A 3QCPA 4PX1A 5EVOA 4L0WA 1HD2A 4MABA 3KTLA 3FZ4A 3A2VA 1SD8A 5IOWA 3EPTA 2VCVA 2GZZA 3US3A 1BEDA 4F82A 2TIRA 1K0BA 4ZBBA 6GSSA 3UBLA 1O73A 1WRYA 3IHQA 4NMUA 4TN8A 2LNTA 2LS5A 2DJ0A 4IKHA 2HZEA 4GWRA 4HDEA 2WB9A 2X99A 3HCZA 1O85A 3G9BA 3VWUA 11GSA 4V1Ag 5G2ZA 1XVWA 2GT5A 1TW9A 1O7UA 3Q6OA 5HR1A 2QA1A 3JCML 3TCOA 1QK8A 4TXOB 5ECMB 3M1GA 4OD7A 2FA4A 1EOHA 2LEGA 4MJBA 3CRUA 4L5OA 2VUPA 5L71A 3F4SA 4OWYA 4O5RA 1GTAA 4KX4A 4ZXGA 4RQRA 8GSSA 4K9ZA 2NVLA 5A4VA 1HNCA 4NPBA 1SK2A 3C1SA 2YZUA 5IMVA 1Z3EA 4J2FA 3IAM2 2UZ8A 2B7JA 2K8VA 3GRXA 3LYKA 3TUEA 5IMDA 3A2XA 1BJXA 1AXDA 4DEJA 2DJ3A 4TR4A 4EIQA 1BG5A 3IOSA 4MJAA 4MZWA 4ECJA 1F3AA 2IJYA 2IFQA 4BIKA 3FW2A 4K2XA 2DIYA 4X43A 2A2RA 1Y6EA 3TGZA 1VRSD 1SJZA 2X8GA 4Z2RA 2HSHA 2ON7A 5A4WA 1X5CA 1GUHA 1YF1A 1GSFA 1QFNA 3M8NA 1M2BA 2A2SA 4L8EA 5IIZA 4EXJA 2RUFA 2YJHA 1TU8A 5IMZA 4IVFA 5J3RA 4PURA 3CSHA 3ME7A 2P0GA 3ZIJA 5INYA 4E8HA 3TKSA 3QFBC 4V1Ap 2MBSA 3GN3A 5BMUA 4KE3A 1R5AA 2FWEA 2AUVA 1ZMAA 2I3YA 4I5QA 3RBTA 2YV9A 4EE0A 4XCSA 2HE3A 3KP9A 5B7CA 3WD6A 4DSRA 4ZBDA 1GLQA 1J08A 3EMXA 2YN1A 2H6XA 4TR1A 4MPFA 4KUNA 1ILOA 2YNXA 2WFCA 1LU4A 2VCXA 4K7OA 2HZFA 3FK8A 1QUWA 2H8LA 4GXZA 4MH3A 2XC2A 3IK9A 2R37A 4GCIA 4WR4A 2ZNMA 4WXTA 3LYPA 2G2QA 3E0UA 3U6VA 1G6YA 2DKHA 4MMMA 4XS4A 1UN2A 3BBYA 2H01A 3KP8A 3PR8A 1UA5A 1Z9HA 5DCHA 3DKSA 1SJIA 3VWVA 1SL0B 1SL1B 1WE0A 4GLTA 5G1KA 4O7HA 2OE3A 3GNJA 3C73A 4AJ6A 1HYUA 2JSYA 5GSTA 3W8SA 4OFTA 2HRAA 3NOFA 4HQZA 2VLUA 2VIMA 3GL5A 1PQNA 4YQVA 3ERFA 1AQWA 1K0OA 5DQYA 2V1MA 3P7XA 5GAPD 1G0TA 4TR0A 4K0NA 2HXKA 1GSUA 1SKRB 3IBHA 3FRCA 4I6XA 4L0UA 2D2ZA 4Q5RA 4K2DA 1N2AA 3CYNA 4XRDA 2KOKA 2JL4A 5J41A 1TJDA 5IOXA 2DJJA 1TK0B 5IO0A 3QPMA 2J23A 5DCGA 3HHVA 2LQQA 1B9YC 1A2LA 2FGXA 4KA0A 1F2EA 3KMOA 3UMAA 4EDYA 4EKZA 2QC7A 1TTZA 1GNEA 2C4JA 3GTUB 5IMCA 5FT3A 4IQAA 3TOTA 4PUFC 1PSQA 1V57A 3GKXA 1J9BA 4POKA 5ABRA 1J0FA 3TRPA 2L6DA 2H0GA 4GSSA 5KN3A 1F37A 3A5IA 4DVCA 1G6WA 4KF9A 3IK7A 3GH9A 4H86A 3I9V2 1T00A 3HDCA 3MAKA 4YAVA 5HQPA 2IMEA 3TKSC 3F9UA 2VO4A 1M99A 3DIEA 4OCFA 5H5SA 5COHA 5D93A 3GMFA 3KIJA 2XBQA 2K18A 3ISOA 3VI7A 4EF0A 3ZMLA 4K7NA 1XBSA 1M3IA 1T1VA 2MMAA 1EGRA 1ZOFA 2WULA 1YJ6A 10GSA 3PH9A 3F6FA 1EV9A 2E2MA 4PXOA 1AUCA 1Z5YE 2J9HA 3ZTLA 3UJ1A 3NZNA 3CTGA 4V2MA 5AIVA 1Z6MA 3GSSA 4WBJA 3BCKA 2PU9C 1KTEA 5AIXA 3TKSE 1E6BA 2ZUPA 1O8XA 5KOXA 3CSJA 1S3AA 5EY6A 3EWLA 2H72A 4HZ2A 2TRXA 2VL3A 5CRHA 2FNOA 6GSTA 2OBKA 5GAND 1JZOA 4YKFA 5ENUA 2R3XA 2K6VA 4WEYA 1M7TA 3GX8A 3A2WA 3RPNA 4ML6A 3G7JA 3MWHA 4GQCA 3F8UA 1SKSB 2QKEA 3G7YA 3HKRA 2N5AA 1MD3A 2CAIA 4KH7A 1AQVA 4HUAA 3DRNA 3LXTA 2KP2A 5G5FA 3IXRA 3D4MA 3HY2A 4LL1B 3UVTA 2ZCTA 1GTUA 2B5YA 2FY6A 1R5PA 5ELGA 5ECOB 4MNNA 5DAKB 1SYXA 17GSA 2H1GA 1USBA 1ST9A 6GSUA 5F8BA 4G0LA 1XOAA 2V32A 3P90A 4IP1A 1A0FA 4RUVA 1IYIA 2P5QA 4MJCA 2EIRA 1GSDA 4BVXA 2DSAA 4CHSA 1SK0A 1ZGNA 1A0RP 2C0EA 2OBIA 2HT9A 1ZL9A 1NHOA 3ZVJA 3HJOA 2VM1A 2LRNA 2PWJA 3O3TA 2P31A 3QOUA 4NWYA 3AY8A 4BL7B 1K0NA 4IJIA 4X4JA 3UEMA 3H1NA 1NHYA 2RM5A 4DSSA 1DE1A 4Z2TA 2FWHA 4TVEA 3WT1A 3O76A 2N5BA 3M9KA 4WF4A 1XPVA 1UC7A 3UIWA 3UOMA 3GH6A 1VF3A 4IN0A 2RIIA 2JZSA 3GL3A 5B8AA 1XG8A 2K8SA 2OADA 2R4VA 3RHCA 1QQ2A 2MMZA 3MNGA 2DLXA 1B4PA 1SKWB 3DEXA 3I69A 1ACVA 1C72A 5ECKB 4F0BA 2TRCP 5CNWA 4F03A 2H75A 5G30A 1TOFA 3HD5A 3FEUA 1YEPA 4I2TA 1XVQA 2LJAA 4NXIA 3EE2A 4PQIA 5LCZA 4POMA 2AYTA 5CREA 2YCDA 3E3EA 2IMIA 3DXBA 5ECLB 2VCTA 5D8IA 3FR3A 3KJYA 3MYDA 3D22A 3U5RE 4NV2A 1Z7RA 2IL3A 3MDKA 3C8EA 3Q18A 4JR4A 4OMVA 4LLRA 5G31A 1DE2A 4J57E 3WGDA 4KGIA 1WPIA 2EIOA 3H79A 1GSEA 4G9HA 1W4VA 1FOVA 3UARA 4PUAA 2IWTA 5KN2A 3GX0A 3RHBA 3IV4A 3GIXA 5B6MA 2L6CA 1YY7A 4HOJA 2B5XA 2F8AA 3K8NA 4RI6A 4Q5QA 5F06A 4ICYA 5AISA 2WDUA 4LMWA 20GSA 2PVQA 2WGRA 3L4NA 4FO5A 4FYCA 4KNDA 2C0DA 2GQKA 3BOAA 1GP1A 2FHEA 2AB6A 1PKZA 3ZREA 1BQ7A 2MMNA 2R6KA 2QGVA 5FHIA 4JRRA 4MA9A 1WOUA 2OACA 2XHFA 1BAYA 2H66A 2DBCA 5JCUA 3TJJA 5DQSA 1TK8B 1I5GA 4Z7XA 7GSSA 4P3YB 4PGTA 5ECIB 4AJ7A 4BVYB 4ZILA 4JEDA 2XPEA 4FIWA 3TJBA 1TP9A 1ZCPA 4AJ8A 4I8BA 1SD9A 2GSQA 3IE3A 1U87A 4G0IA 3IPZA 1Z6NA 1TK5B 1THXA 3KH9A 4OFNA 5HFIA 1QXHA 3LJRA 1EP7A 3I6AA 6GSWA 2PBJA 4HJMA 4ZB9A 1F9MA 2C1YA 5G5EA 1PX6A 3D5JA 4KB3A 2GVPA 2R0PA 3KGKA 4LA1A 1YZXA 5KN1A 1EEMA 3WGEA 3RPPA 3UAPA 2CT6A 1GLPA 4JU5A 3C1RA 22GSA 1GNWA 1NSWA 3BD2A 1B4QA 3QMXA 1RK4A 5IMAA 1A24A 3TKQA 1W89A 2NTOA 1OE7A 3EC3A 4KDXA 4JE1A 2CQ9A 3FR9A 4TXOA 3FKFA 3ZRDA 3L9VA 5JWQB 2DKIA 3C7MA 2DMMA 1BYEA 2FUG2 1K3OA 5DALB 4V2LA 4K8MA 3F0IA 1KEBA 4D73A 4IP6A 1GUMA 4X1UA 1CQGA 3R2QA 2GT6A 3HXSA 4EO3A 4MH2A 1EWXA 2JADA 2JACA 1XW9A 2DIZA 1OKDA 5CRGA 1K3LA 1FOHA 5HFKA 1E2YA 2VCQA 1PA3A 3LQ7A 3TRQA 1V2AA 4ZL8A 2O8VB 2F9SA 4NAXA 5LD0A 3WGXA 3HYPA 2YANA 2VLVA 3M9JA 1JZRA 1DUGA 2P5RA 3MIXA 5F05A 3MSZA 1TDIA 4MZBA 2IMDA 4F2IA 2AV4A 3APQA 5E59A 5F0GA 2CVDA 1T4YA 3HVXA 2VCZA 1QGVA 3VLNA 2H1BA 2DJ2A 2L4CA 2VM2A 1OE8A 3ZIVA 2HSYA 3QFAC 2GQMA 1M3JA 2AJQB 4HU7A 1S3DA 3KM6A 1O81A 1VF1A 3J7Yk 3KTBA 4N11A 5ECPB 2B6MA 1ZYNA 1THOA 1TKDB 1Q98A 1PKWA 3F4RA 4ID0A 2GZYA 3LGCA 3HA9A 5B6NA 4MF5A 4PTSA 2FLSA 3ZVJD 4F0CA 1SYRA 2MMOA 1A8YA 2R5GA 3FHKA 3HJPA 4N10A 4PQHA 3H8QA 3LSZA 4YH2A 2NPBA 2HRFA 5LNKe 3A5WA 1FAAA 2X4AA 4JR6A 5H5RA 5H5QA 1PGTA 13GSA 5CYYA 3N5OA 4PNGA 2FD3A 5ID2A 3GUSA 2LSTA 3IC4A 4AGSA 3CTFA 3DGQA 4POBA 4QQ7A 3PINA 2FWFA 5J9BA 2A4HA 2X8CA 2CX3A 3VK9A 1ZYQB 4O32A 1U88A 1FVKA 1EZKA 1EV4A 2CV4A 4LMVA 1A2MA 2PERA 1WIKA 2ES7A 2L5OA 1HNAA 2WJUA 4EUYA 4BA7A 1A8LA 1FW1A 3CMIA 3M0FA 4FQUA 4ECBA 3IR4A 1ERVA 1X5DA 3PPUA 2VL2A 4G19A 1GSSA 2RM6A 3EURA 2YWIA 4YQUA 4DSSB 4O5UA 1Y25A 2DMLA 2VD1A 2A2PA 5CRDA 1V9WA 1K3YA 2IIYA 4ACSA 2X49A 3IC8A 3O6TA 2NBSA 4KAEA 2QA2A 1FB0A 1FVJA 2H19A 2GSSA 2CX4A 3IRAA 2IPAA 3EVIA 3VPTA 2JZRA 19GSA 3GTUA 1PL2A 3ZITA 2N5FA 3GKMA 3S9FA 4IBPA 2LJKA 5HFGA 2I4AA 3V1WA 5ECRB 3W8JA 4TKYA 5C00A 1WJKA 4EL1A 2R0GA 5ECNB 2CVKA 2KP1A 2F8FA 2H73A 2VOCA 2E2GA 1R7HA 3DD3A 2CZ3A 5JWRB 2KLXA 3ZLPA 2CVBA 4KSMA 1WP0A 5DBQA 4WKWA 3HZ8A 2ALBA 1YKAA 5F07A 1VF4A 2M46A 2HZEB 2M72A 4TW5A 5A4UA 1XW6A 3ERWA 1OC9A 5DJLA 5DDLA 4LL4B 2L59A 4GQFA 3UBKA 4RI7A 4GF0A 3W6GA 4KW6A 2QSIA 1XWGA 3IDVA 2G0FA 2X8HA 1LJRA 3NIVA 5E4WA 4ZL7A 4O5QA 1SL2B 3CBUA 14GSA 5A5KA 2H6YA 2CZ2A 4I2UA 2C8UA 3GYKA 1FB6A 1YF0A 1GL8A 1KBNA 3F3QA 5D9VA 1XWCA 1YKCA 3BCIA 1X9SB 1ON4A 3HVNA 3EU3A 5DVBA 5KN0A 2DJ1A 1F3BA 3DMLA 3L78A 3EMPA 1JLWA 2LKUA 4XTSA 1I9DA 4PNFA 4K0GA 3LEFA 2GSTA 3QD9A 3P2AA 3EYTA 3VWWA 2O85A 3L9SA 5CO3A 1U6TA 5CRWA 2VAFA 1B48A 2C3TA 2VL9A 5IQYA 4BWQA 2I81A 2IFQB 3PGTA 4EVMA 2IN3A 1YDKA 5HR2A 3IHGA 2EC4A 1K0CA 2VL2C 2BTOT 1HQOA 2H1DA 1G7EA 4RQXA 1TXXA 6GSXA 1YQ1A 5DAKA 1OC3A 3DWVA 2H1AA 2GQLA 2REMA 4EIPA 5ECSA 4HI7A 3D21A 4CY8A 3KZQA 3QAVA 4GSTA 1Q4JA 2H30A 1HNBA 2B5EA 2HNLA 2PVOC 5EPFA 4HSCX 1EOGA 2OE1A 3CSIA 3RAZA 3SBCA 2MZCA 16GSA 3KD0A 3KH7A 4BL7A 2B3SA 1EGOA 2OKAA 1X5EA 1AC1A 2BJXA 3C71A 4OO5A 3FZAA 3EINA 4HQSA 1SJ6A 5FWGA 1K0MA 3R3EA 4TR1B 3G7IA 4FYBA 2I1UA 2X64A 2HYXA 5D9TA 3LG6A 1VGLA 2PN8A 2HFDA 3KEBA 3VURA 4Z2UA 1JZDA 1FO5A 4XS4B 4XS6A 4D73B 1PRXA 5C04A 3FZ9A 3QR6A 2IMFA 4CW9A 2L4QA 4WETA 1PN0A 1OAZA 2DC5A 4WF5A 3SWLA 1UVZA 5ECQB 3KMNA 1ML6A 1ERTA 2M80A 4BPYA 1XFLA 4F9ZA 2JZTA 4MCUA 4NHZA 3DVWA 3HJMA 3GSTA 4MLYA 2GLRA 4TR3A 3QAGA 1TRUA 1O8WA 4NV5A 4ML1A 5D73A 4OCEA 4HU9A 4K7IA 1YEXA 1O6JA 2GSRA 3ERGA 4HS1A 5HR3A 5DJMA 3QAWA 1OKTA 2C80A 5KEJA 4QL9A 1AIUA 3HVVA 1H4OA 1G7OA 1FHEA 3ME8A 1M9AA 3QDNA 1TRSA 2OA7A 4PQ1A 18GSA 1PX7A 2YP6A 2MYGA 3M3MA 4I97A 4IHUA 4YQMA 2XPDA 1XZOA 3IA1A 4TXVA 1EEJA 1TRWA 1KNGA 2HRNA 5IPGA 4OO4A 5AGYA 4E8EA 4MF6A 3GKNA 3Q19A 3TKPA 2A4VA 3BJ5A 5JCWA 2PUKC 2Z9SA 1TI3A 4J56E 4G0KA 4EDZA 3RDWA 2H0HA 1GRXA 1XW5A 2MBTA 4K5SA 2YZHA 2E7PA 1TU7A 1U3AA 4XRAA 1GH2A 2WS2A 2AHEA 4N30A 2OJLA 4N0VA 1X9MB 2I9HA 1WMJA 5ID2B 3ZFBA 1TI1A 2R2JA 2H70A 2YJ7A 4IQ1A 4WR5A 1IYHA 3FYGA 2B1KA 6GSYA 1JFUA 4FYUA 3VPQA 2FWGA 4Q5NA 3D0ZA 1S3CA 1XWKA 2E0QA 4V2NA 3Q74A 4BVYA 1X0RA 1S3RA 1QMVA 3I43A 2H6ZA 1M0UA 2H74A 4POLA 1V40A 1F6MC 4NHWA 4YAPA 3GV1A 5CAXA 9GSSA 2CA8A 1OC8A 4ECCA 5B8BA 4IGJA 2B1LA 3D4TA 4MK3A 2YV7A 3F4TA 2GS3A 1SENA 1XOBA 1FG4A 3APSA 3L9UA 4ZL9A 4MF7A 2WCIA 4G2EA 1EP8A 2V6OA 4ULXA 3GA4A 1GTBA 4ZB6A 3F63A 5JWOB 1MEKA 4GRFA 3H93A 5D96A 3FY7A 5KOWA 2YWMA 4K5RA 4N0ZA 5D9WA 1ERUA 2FA8A 1K0DA 2BMXA 4KSOA 1JHBA 2WZ9A 2LUSA 5J4UA 1MDIA 2H71A 4USSA 3ZL5A 2OE0A 1WWJA 5J5NA 1CQHA 2LJRA 2H0IA 4XIHA 3H4KA 4FH8A 3LWAA 3DYRA 4ZIJA 3LW9A 4MPGA 2HRKA 3ZFLA 5JCGA 5AN1A 3OR5A 2YWOA 1PD21 5DALA 2GGTA 1XIYA 1TRVA 1PFOA 4EC0A 1PL1A 2GTUA 1SK1A 3TJFA 4BWSA 4A5PA 1H75A 2KHPA 1DBYA 3L0HA 2LTKA 1A23A 1T7PB 1ZZYA 2F3MA 2ON5A 4G10A 5ECHB 2C0FA 1A2JA 2VLTA 1R26A 2HLSA 4QL7A 2V2GA 4ZB8A 1Z7PA 2O87A 1GUKA 4TRXA 2L57A 2DJKA 4KDYA 1GWCA 4MP4A 3ED3A 4BVXB 3TKRA 1ERWA 4DSQA 4YKGA 5BRTA 1OC9B 1RW1A 1M9BA 4ISDA 3TJKA 2VCWA 3UL3A 4WBRD 3CQFA 4XS1A 3EU4A 3LFLA 4MJEA 3N9JA 1XWAA 2PMTA 1AW9A 1M2AA 3FZ5A 2R0CA 1XXUA 4L5LA 4ECIA 4KCEA 2LV3A 1R4WA 1RQMA 4X0XA 12GSA 1URMA 3DVXA 5D9XA 4TOPA 1OYJA 2IMKA 3D6IA 1OVNA 2PGTA 4K1FA 3APOA 4JZQA 2YWNA 3FMWA 1NM3A 2O7KA 1MDJA 1N8JA 2GDRA 3E9JB 1GTIA 4IS0A 1VF2A 2GZPA 3A3TA 4ILFA 2RUEA 4K6XA 4GSNA 1T4ZA 4KDUA 1AQXA 1U3IA 2C0GA 3CRTA 2RLIA 5IMFA 1ABAA 1T8EB 1M2DA 3LXZA 2B7KA 5J9CA 2CAQA 4IELA
chains in the Genus database with same CATH topology
4AF2A 1SU9A 3VFIA 1X9WB 2JU5A 5HR0A 4GTUA 3TDGA 4HZ4A 4XHMA 3HVSA 2C3NA 4KCAA 2WRTA 1GSQA 2AAWA 3TJGA 1AAZA 3GURA 5GSSA 5ELAA 3F6DA 1B9XC 1B8XA 1MTCA 1LBKA 2HI7A 2YOIA 4CY6A 1DSBA 4HJ2A 3FR6A 1K0AA 2H76A 1MDKA 4IJ3A 3WT2A 1ZYEA 2V6KA 4CDOA 2KUCA 3ZYWA 3TB2A 6GSVA 1GSYA 1GULA 2NDOA 2K9FA 3IAS2 1PMTA 3LORA 2JSZA 3ZMKA 5IPHA 1NW2A 3GKKA 2PPTA 2EIQA 2LQOA 3KXOA 2YPMA 1V98A 4ZBAA 3HZ4A 4MDCA 5GZZB 3F3RA 4HEA2 2LNSA 1MD4A 2XBIA 3GHAA 1XWBA 4MZCA 5EL8A 3P8WA 4JBBA 1PN9A 2F51A 2O89A 3VWXA 1T3BA 3GFKA 2L5LA 3WYWA 3CXGA 1JLVA 4OFMA 2VD0A 5G1LA 2LRTA 4O92A 1XCCA 1BX9A 2HSMA 2V41A 1V58A 1JZWA 5CP1A 5IM9A 3TRXA 2C3QA 3ZZXA 3UVHA 3VI5A 2LRCA 3TOUA 5IO2A 1ZYPA 2FCHA 3KCMA 3J7Yb 4Q5FA 4IW9A 3QCPA 4PX1A 5EVOA 4L0WA 1HD2A 4MABA 3KTLA 3FZ4A 3A2VA 1SD8A 5IOWA 3EPTA 2VCVA 2GZZA 3US3A 1BEDA 4F82A 2TIRA 1K0BA 4ZBBA 6GSSA 3UBLA 1O73A 1WRYA 3IHQA 4NMUA 4TN8A 2LNTA 2LS5A 2DJ0A 4IKHA 2HZEA 4GWRA 4HDEA 2WB9A 2X99A 3HCZA 1O85A 3G9BA 3VWUA 11GSA 4V1Ag 5G2ZA 1XVWA 2GT5A 1TW9A 1O7UA 3Q6OA 5HR1A 2QA1A 3JCML 3TCOA 1QK8A 4TXOB 5ECMB 3M1GA 4OD7A 2FA4A 1EOHA 2LEGA 4MJBA 3CRUA 4L5OA 2VUPA 5L71A 3F4SA 4OWYA 4O5RA 1GTAA 4KX4A 4ZXGA 4RQRA 8GSSA 4K9ZA 2NVLA 5A4VA 1HNCA 4NPBA 1SK2A 3C1SA 2YZUA 5IMVA 1Z3EA 4J2FA 3IAM2 2UZ8A 2B7JA 2K8VA 3GRXA 3LYKA 3TUEA 5IMDA 3A2XA 1BJXA 1AXDA 4DEJA 2DJ3A 4TR4A 4EIQA 1BG5A 3IOSA 4MJAA 4MZWA 4ECJA 1F3AA 2IJYA 2IFQA 3FW2A 4K2XA 2DIYA 4X43A 2A2RA 1Y6EA 3TGZA 1VRSD 1SJZA 2X8GA 4Z2RA 2HSHA 2ON7A 5A4WA 1X5CA 1GUHA 1YF1A 1GSFA 1QFNA 3M8NA 1M2BA 2A2SA 4L8EA 5IIZA 4EXJA 2RUFA 2YJHA 1TU8A 5IMZA 4IVFA 5J3RA 4PURA 3CSHA 3ME7A 2P0GA 3ZIJA 5INYA 4E8HA 3TKSA 3QFBC 4V1Ap 2MBSA 3GN3A 5BMUA 4KE3A 1R5AA 2FWEA 2AUVA 1ZMAA 2I3YA 4I5QA 3RBTA 2YV9A 4EE0A 4XCSA 2HE3A 3KP9A 5B7CA 3WD6A 4DSRA 4ZBDA 1GLQA 1J08A 3EMXA 2YN1A 2H6XA 4TR1A 4MPFA 4KUNA 1ILOA 2YNXA 2WFCA 1LU4A 2VCXA 4K7OA 2HZFA 3FK8A 1QUWA 2H8LA 4GXZA 4MH3A 2XC2A 3IK9A 2R37A 4GCIA 4WR4A 2ZNMA 4WXTA 3LYPA 2G2QA 3E0UA 3U6VA 1G6YA 2DKHA 4MMMA 4XS4A 1UN2A 3BBYA 2H01A 3KP8A 3PR8A 1UA5A 1Z9HA 5DCHA 3DKSA 1SJIA 3VWVA 1SL0B 1SL1B 1WE0A 4GLTA 5G1KA 4O7HA 2OE3A 3GNJA 3C73A 4AJ6A 1HYUA 2JSYA 5GSTA 3W8SA 4OFTA 2HRAA 3NOFA 4HQZA 2VLUA 2VIMA 3GL5A 1PQNA 4YQVA 3ERFA 1AQWA 1K0OA 5DQYA 2V1MA 3P7XA 5GAPD 1G0TA 4TR0A 4K0NA 2HXKA 1GSUA 1SKRB 3IBHA 3FRCA 4I6XA 4L0UA 2D2ZA 4Q5RA 4K2DA 1N2AA 3CYNA 4XRDA 2KOKA 2JL4A 5J41A 1TJDA 5IOXA 2DJJA 1TK0B 5IO0A 3QPMA 2J23A 5DCGA 3HHVA 2LQQA 1B9YC 1A2LA 2FGXA 4KA0A 1F2EA 3KMOA 3UMAA 4EDYA 4EKZA 2QC7A 1TTZA 1GNEA 2C4JA 3GTUB 5IMCA 5FT3A 4IQAA 3TOTA 4PUFC 1PSQA 1V57A 3GKXA 1J9BA 4POKA 5ABRA 1J0FA 3TRPA 2L6DA 2H0GA 4GSSA 5KN3A 1F37A 3A5IA 4DVCA 1G6WA 4KF9A 3IK7A 3GH9A 4H86A 3I9V2 1T00A 3HDCA 3MAKA 4YAVA 5HQPA 2IMEA 3TKSC 3F9UA 2VO4A 1M99A 3DIEA 4OCFA 5H5SA 5COHA 5D93A 3GMFA 3KIJA 2XBQA 2K18A 3ISOA 3VI7A 4EF0A 3ZMLA 4K7NA 1XBSA 1T1VA 2MMAA 1EGRA 1ZOFA 2WULA 1YJ6A 10GSA 3PH9A 3F6FA 1EV9A 2E2MA 4PXOA 1AUCA 1Z5YE 2J9HA 3ZTLA 3UJ1A 3NZNA 3CTGA 4V2MA 5AIVA 1Z6MA 3GSSA 4WBJA 3BCKA 2PU9C 1KTEA 5AIXA 3TKSE 1E6BA 2ZUPA 1O8XA 5KOXA 3CSJA 1S3AA 5EY6A 3EWLA 2H72A 4HZ2A 2TRXA 2VL3A 5CRHA 2FNOA 6GSTA 2OBKA 5GAND 1JZOA 4YKFA 5ENUA 2R3XA 2K6VA 4WEYA 1M7TA 3GX8A 3A2WA 3RPNA 4ML6A 3G7JA 3MWHA 4GQCA 3F8UA 1SKSB 2QKEA 3G7YA 3HKRA 2N5AA 1MD3A 2CAIA 4KH7A 1AQVA 4HUAA 3DRNA 3LXTA 2KP2A 5G5FA 3IXRA 3D4MA 3HY2A 4LL1B 3UVTA 2ZCTA 1GTUA 2B5YA 2FY6A 1R5PA 5ELGA 5ECOB 4MNNA 5DAKB 1SYXA 17GSA 2H1GA 1USBA 1ST9A 6GSUA 5F8BA 4G0LA 1XOAA 2V32A 3P90A 4IP1A 1A0FA 4RUVA 1IYIA 2P5QA 4MJCA 2EIRA 1GSDA 4BVXA 2DSAA 4CHSA 1SK0A 1ZGNA 1A0RP 2C0EA 2OBIA 2HT9A 1ZL9A 1NHOA 3ZVJA 3HJOA 2VM1A 2LRNA 2PWJA 3O3TA 2P31A 3QOUA 4NWYA 3AY8A 4BL7B 1K0NA 4IJIA 4X4JA 3UEMA 3H1NA 1NHYA 2RM5A 4DSSA 1DE1A 4Z2TA 2FWHA 4TVEA 3WT1A 3O76A 2N5BA 3M9KA 4WF4A 1XPVA 1UC7A 3UIWA 3UOMA 3GH6A 1VF3A 4IN0A 2RIIA 2JZSA 3GL3A 5B8AA 2K8SA 2OADA 2R4VA 3RHCA 1QQ2A 2MMZA 3MNGA 2DLXA 1B4PA 1SKWB 3DEXA 3I69A 1ACVA 1C72A 5ECKB 4F0BA 2TRCP 5CNWA 4F03A 2H75A 5G30A 1TOFA 3HD5A 3FEUA 1YEPA 4I2TA 1XVQA 2LJAA 4NXIA 3EE2A 4PQIA 5LCZA 4POMA 2AYTA 5CREA 2YCDA 3E3EA 2IMIA 3DXBA 5ECLB 2VCTA 5D8IA 3FR3A 3KJYA 3MYDA 3D22A 3U5RE 4NV2A 1Z7RA 2IL3A 3MDKA 3C8EA 3Q18A 4JR4A 4OMVA 4LLRA 5G31A 1DE2A 4J57E 3WGDA 4KGIA 1WPIA 2EIOA 3H79A 1GSEA 4G9HA 1W4VA 1FOVA 3UARA 4PUAA 2IWTA 5KN2A 3GX0A 3RHBA 3IV4A 3GIXA 5B6MA 2L6CA 1YY7A 4HOJA 2B5XA 2F8AA 3K8NA 4RI6A 4Q5QA 5F06A 4ICYA 5AISA 2WDUA 4LMWA 20GSA 2PVQA 2WGRA 3L4NA 4FO5A 4FYCA 4KNDA 2C0DA 2GQKA 3BOAA 1GP1A 2FHEA 2AB6A 1PKZA 3ZREA 1BQ7A 2MMNA 2R6KA 2QGVA 5FHIA 4JRRA 4MA9A 1WOUA 2OACA 2XHFA 1BAYA 2H66A 2DBCA 5JCUA 3TJJA 5DQSA 1TK8B 1I5GA 4Z7XA 7GSSA 4P3YB 4PGTA 5ECIB 4AJ7A 4BVYB 4ZILA 4JEDA 2XPEA 4FIWA 3TJBA 1TP9A 1ZCPA 4AJ8A 4I8BA 1SD9A 2GSQA 3IE3A 1U87A 4G0IA 3IPZA 1Z6NA 1TK5B 1THXA 3KH9A 4OFNA 5HFIA 1QXHA 3LJRA 1EP7A 3I6AA 6GSWA 2PBJA 4HJMA 4ZB9A 1F9MA 2C1YA 5G5EA 1PX6A 3D5JA 4KB3A 2GVPA 2R0PA 3KGKA 4LA1A 1YZXA 5KN1A 1EEMA 3WGEA 3RPPA 3UAPA 2CT6A 1GLPA 4JU5A 3C1RA 22GSA 1GNWA 1NSWA 3BD2A 1B4QA 3QMXA 1RK4A 5IMAA 1A24A 3TKQA 1W89A 2NTOA 1OE7A 3EC3A 4KDXA 4JE1A 2CQ9A 3FR9A 4TXOA 3FKFA 3ZRDA 3L9VA 5JWQB 2DKIA 3C7MA 2DMMA 1BYEA 2FUG2 1K3OA 5DALB 4V2LA 4K8MA 3F0IA 1KEBA 4D73A 4IP6A 1GUMA 4X1UA 1CQGA 3R2QA 2GT6A 3HXSA 4EO3A 4MH2A 1EWXA 2JADA 2JACA 1XW9A 2DIZA 1OKDA 5CRGA 1K3LA 1FOHA 5HFKA 1E2YA 2VCQA 1PA3A 3LQ7A 3TRQA 1V2AA 4ZL8A 2O8VB 2F9SA 4NAXA 5LD0A 3WGXA 3HYPA 2YANA 2VLVA 3M9JA 1JZRA 1DUGA 2P5RA 3MIXA 5F05A 3MSZA 1TDIA 4MZBA 2IMDA 4F2IA 2AV4A 3APQA 5E59A 5F0GA 2CVDA 1T4YA 3HVXA 2VCZA 1QGVA 3VLNA 2H1BA 2DJ2A 2L4CA 2VM2A 1OE8A 3ZIVA 2HSYA 3QFAC 2GQMA 2AJQB 4HU7A 1S3DA 3KM6A 1O81A 1VF1A 3J7Yk 3KTBA 4N11A 5ECPB 2B6MA 1ZYNA 1THOA 1TKDB 1Q98A 1PKWA 3F4RA 4ID0A 2GZYA 3LGCA 3HA9A 5B6NA 4MF5A 4PTSA 2FLSA 3ZVJD 4F0CA 1SYRA 2MMOA 1A8YA 2R5GA 3FHKA 3HJPA 4N10A 4PQHA 3H8QA 3LSZA 4YH2A 2NPBA 2HRFA 5LNKe 3A5WA 1FAAA 2X4AA 4JR6A 5H5RA 5H5QA 1PGTA 13GSA 5CYYA 3N5OA 4PNGA 2FD3A 5ID2A 3GUSA 2LSTA 3IC4A 4AGSA 3CTFA 3DGQA 4POBA 4QQ7A 3PINA 2FWFA 5J9BA 2A4HA 2X8CA 2CX3A 3VK9A 1ZYQB 4O32A 1U88A 1FVKA 1EZKA 1EV4A 2CV4A 4LMVA 1A2MA 2PERA 1WIKA 2ES7A 2L5OA 1HNAA 2WJUA 4EUYA 4BA7A 1A8LA 1FW1A 3CMIA 3M0FA 4FQUA 4ECBA 3IR4A 1ERVA 1X5DA 3PPUA 2VL2A 4G19A 1GSSA 2RM6A 3EURA 2YWIA 4YQUA 4DSSB 4O5UA 1Y25A 2DMLA 2VD1A 2A2PA 5CRDA 1V9WA 1K3YA 2IIYA 4ACSA 2X49A 3IC8A 3O6TA 2NBSA 4KAEA 2QA2A 1FB0A 1FVJA 2H19A 2GSSA 2CX4A 3IRAA 2IPAA 3EVIA 3VPTA 2JZRA 19GSA 3GTUA 1PL2A 3ZITA 2N5FA 3GKMA 3S9FA 4IBPA 2LJKA 5HFGA 2I4AA 3V1WA 5ECRB 3W8JA 4TKYA 5C00A 1WJKA 4EL1A 2R0GA 5ECNB 2CVKA 2KP1A 2F8FA 2H73A 2VOCA 2E2GA 1R7HA 3DD3A 2CZ3A 5JWRB 2KLXA 3ZLPA 2CVBA 4KSMA 1WP0A 5DBQA 4WKWA 3HZ8A 2ALBA 1YKAA 5F07A 1VF4A 2M46A 2HZEB 2M72A 4TW5A 5A4UA 1XW6A 3ERWA 1OC9A 5DJLA 5DDLA 4LL4B 2L59A 4GQFA 3UBKA 4RI7A 4GF0A 3W6GA 4KW6A 2QSIA 1XWGA 3IDVA 2G0FA 2X8HA 1LJRA 3NIVA 5E4WA 4ZL7A 4O5QA 1SL2B 3CBUA 14GSA 5A5KA 2H6YA 2CZ2A 4I2UA 2C8UA 3GYKA 1FB6A 1YF0A 1GL8A 1KBNA 3F3QA 5D9VA 1XWCA 1YKCA 3BCIA 1X9SB 1ON4A 3EU3A 5DVBA 5KN0A 2DJ1A 1F3BA 3DMLA 3L78A 3EMPA 1JLWA 2LKUA 4XTSA 1I9DA 4PNFA 4K0GA 3LEFA 2GSTA 3QD9A 3P2AA 3EYTA 3VWWA 2O85A 3L9SA 5CO3A 1U6TA 5CRWA 2VAFA 1B48A 2C3TA 2VL9A 5IQYA 4BWQA 2I81A 2IFQB 3PGTA 4EVMA 2IN3A 1YDKA 5HR2A 3IHGA 2EC4A 1K0CA 2VL2C 2BTOT 1HQOA 2H1DA 1G7EA 4RQXA 1TXXA 6GSXA 1YQ1A 5DAKA 1OC3A 3DWVA 2H1AA 2GQLA 2REMA 4EIPA 5ECSA 4HI7A 3D21A 4CY8A 3KZQA 3QAVA 4GSTA 1Q4JA 2H30A 1HNBA 2B5EA 2HNLA 2PVOC 5EPFA 1EOGA 2OE1A 3CSIA 3RAZA 3SBCA 2MZCA 16GSA 3KD0A 3KH7A 4BL7A 2B3SA 1EGOA 2OKAA 1X5EA 1AC1A 2BJXA 3C71A 4OO5A 3FZAA 3EINA 4HQSA 1SJ6A 5FWGA 1K0MA 3R3EA 4TR1B 3G7IA 4FYBA 2I1UA 2X64A 2HYXA 5D9TA 3LG6A 1VGLA 2PN8A 2HFDA 3KEBA 3VURA 4Z2UA 1JZDA 1FO5A 4XS4B 4XS6A 4D73B 1PRXA 5C04A 3FZ9A 3QR6A 2IMFA 4CW9A 2L4QA 4WETA 1PN0A 1OAZA 2DC5A 4WF5A 3SWLA 1UVZA 5ECQB 3KMNA 1ML6A 1ERTA 2M80A 4BPYA 1XFLA 4F9ZA 2JZTA 4MCUA 4NHZA 3DVWA 3HJMA 3GSTA 4MLYA 2GLRA 4TR3A 3QAGA 1TRUA 1O8WA 4NV5A 4ML1A 5D73A 4OCEA 4HU9A 4K7IA 1YEXA 1O6JA 2GSRA 3ERGA 4HS1A 5HR3A 5DJMA 3QAWA 1OKTA 2C80A 5KEJA 4QL9A 1AIUA 3HVVA 1H4OA 1G7OA 1FHEA 3ME8A 1M9AA 3QDNA 1TRSA 2OA7A 4PQ1A 18GSA 1PX7A 2YP6A 2MYGA 3M3MA 4I97A 4IHUA 4YQMA 2XPDA 1XZOA 3IA1A 4TXVA 1EEJA 1TRWA 1KNGA 2HRNA 5IPGA 4OO4A 5AGYA 4E8EA 4MF6A 3GKNA 3Q19A 3TKPA 2A4VA 3BJ5A 5JCWA 2PUKC 2Z9SA 1TI3A 4J56E 4G0KA 4EDZA 3RDWA 2H0HA 1GRXA 1XW5A 2MBTA 4K5SA 2YZHA 2E7PA 1TU7A 1U3AA 4XRAA 1GH2A 2WS2A 2AHEA 4N30A 2OJLA 4N0VA 1X9MB 2I9HA 1WMJA 5ID2B 3ZFBA 1TI1A 2R2JA 2H70A 2YJ7A 4IQ1A 4WR5A 1IYHA 3FYGA 2B1KA 6GSYA 1JFUA 4FYUA 3VPQA 2FWGA 4Q5NA 3D0ZA 1S3CA 1XWKA 2E0QA 4V2NA 3Q74A 4BVYA 1X0RA 1QMVA 3I43A 2H6ZA 1M0UA 2H74A 4POLA 1V40A 1F6MC 4NHWA 4YAPA 3GV1A 5CAXA 9GSSA 2CA8A 1OC8A 4ECCA 5B8BA 4IGJA 2B1LA 3D4TA 4MK3A 2YV7A 3F4TA 2GS3A 1SENA 1XOBA 1FG4A 3APSA 3L9UA 4ZL9A 4MF7A 2WCIA 4G2EA 1EP8A 2V6OA 4ULXA 3GA4A 1GTBA 4ZB6A 3F63A 5JWOB 1MEKA 4GRFA 3H93A 5D96A 3FY7A 5KOWA 2YWMA 4K5RA 4N0ZA 5D9WA 1ERUA 2FA8A 1K0DA 2BMXA 4KSOA 1JHBA 2WZ9A 2LUSA 5J4UA 1MDIA 2H71A 4USSA 3ZL5A 2OE0A 1WWJA 5J5NA 1CQHA 2LJRA 2H0IA 4XIHA 3H4KA 4FH8A 3LWAA 3DYRA 4ZIJA 3LW9A 4MPGA 2HRKA 3ZFLA 5JCGA 5AN1A 3OR5A 2YWOA 1PD21 5DALA 2GGTA 1XIYA 1TRVA 4EC0A 1PL1A 2GTUA 1SK1A 3TJFA 4BWSA 4A5PA 1H75A 2KHPA 1DBYA 3L0HA 2LTKA 1A23A 1T7PB 1ZZYA 2F3MA 2ON5A 4G10A 5ECHB 2C0FA 1A2JA 2VLTA 1R26A 2HLSA 4QL7A 2V2GA 4ZB8A 1Z7PA 2O87A 1GUKA 4TRXA 2L57A 2DJKA 4KDYA 1GWCA 4MP4A 3ED3A 4BVXB 3TKRA 1ERWA 4DSQA 4YKGA 5BRTA 1OC9B 1RW1A 1M9BA 4ISDA 3TJKA 2VCWA 3UL3A 4WBRD 4XS1A 3EU4A 3LFLA 4MJEA 3N9JA 1XWAA 2PMTA 1AW9A 1M2AA 3FZ5A 2R0CA 1XXUA 4L5LA 4ECIA 4KCEA 2LV3A 1R4WA 1RQMA 4X0XA 12GSA 1URMA 3DVXA 5D9XA 4TOPA 1OYJA 2IMKA 3D6IA 1OVNA 2PGTA 4K1FA 3APOA 4JZQA 2YWNA 3FMWA 1NM3A 2O7KA 1MDJA 1N8JA 2GDRA 3E9JB 1GTIA 4IS0A 1VF2A 2GZPA 3A3TA 4ILFA 2RUEA 4K6XA 4GSNA 1T4ZA 4KDUA 1AQXA 1U3IA 2C0GA 3CRTA 2RLIA 5IMFA 1ABAA 1T8EB 1M2DA 3LXZA 2B7KA 5J9CA 2CAQA 4IELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AF2 A;  1SU9 A;  3VFI A;  1X9W B;  2JU5 A;  5HR0 A;  4GTU A;  3TDG A;  4HZ4 A;  4XHM A;  3HVS A;  2C3N A;  4KCA A;  2WRT A;  1GSQ A;  2AAW A;  3TJG A;  1AAZ A;  3GUR A;  5GSS A;  5ELA A;  3F6D A;  1B9X C;  1B8X A;  1MTC A;  1LBK A;  2HI7 A;  2YOI A;  1DSB A;  4HJ2 A;  3FR6 A;  1K0A A;  2H76 A;  1MDK A;  4IJ3 A;  3WT2 A;  1ZYE A;  2V6K A;  4CDO A;  2KUC A;  3ZYW A;  3TB2 A;  6GSV A;  1GSY A;  1GUL A;  2NDO A;  2K9F A;  3IAS 2;  1PMT A;  3LOR A;  2JSZ A;  3ZMK A;  5IPH A;  1NW2 A;  3GKK A;  2PPT A;  2EIQ A;  2LQO A;  3KXO A;  2YPM A;  1V98 A;  4ZBA A;  3HZ4 A;  4MDC A;  5GZZ B;  3F3R A;  4HEA 2;  2LNS A;  1MD4 A;  2XBI A;  3GHA A;  1XWB A;  4MZC A;  5EL8 A;  3P8W A;  4JBB A;  1PN9 A;  2F51 A;  2O89 A;  3VWX A;  1T3B A;  3GFK A;  2L5L A;  3WYW A;  3CXG A;  1JLV A;  4OFM A;  2VD0 A;  5G1L A;  2LRT A;  4O92 A;  1XCC A;  1BX9 A;  2V41 A;  1V58 A;  1JZW A;  5CP1 A;  5IM9 A;  3TRX A;  2C3Q A;  3ZZX A;  3UVH A;  3VI5 A;  2LRC A;  3TOU A;  5IO2 A;  2FCH A;  3KCM A;  3J7Y b;  4Q5F A;  4IW9 A;  3QCP A;  4PX1 A;  5EVO A;  4L0W A;  1HD2 A;  4MAB A;  3KTL A;  3FZ4 A;  3A2V A;  1SD8 A;  5IOW A;  2VCV A;  2GZZ A;  3US3 A;  1BED A;  4F82 A;  2TIR A;  1K0B A;  4ZBB A;  6GSS A;  3UBL A;  1O73 A;  1WRY A;  3IHQ A;  4NMU A;  4TN8 A;  2LNT A;  2LS5 A;  2DJ0 A;  4IKH A;  2HZE A;  4GWR A;  4HDE A;  2WB9 A;  2X99 A;  3HCZ A;  1O85 A;  3G9B A;  3VWU A;  11GS A;  4V1A g;  5G2Z A;  1XVW A;  2GT5 A;  1TW9 A;  1O7U A;  3Q6O A;  5HR1 A;  3JCM L;  3TCO A;  1QK8 A;  4TXO B;  5ECM B;  3M1G A;  4OD7 A;  2FA4 A;  1EOH A;  2LEG A;  4MJB A;  3CRU A;  4L5O A;  2VUP A;  5L71 A;  3F4S A;  4OWY A;  4O5R A;  1GTA A;  4KX4 A;  4ZXG A;  4RQR A;  8GSS A;  4K9Z A;  2NVL A;  5A4V A;  1HNC A;  4NPB A;  1SK2 A;  3C1S A;  2YZU A;  5IMV A;  1Z3E A;  4J2F A;  3IAM 2;  2B7J A;  2K8V A;  3GRX A;  3LYK A;  3TUE A;  5IMD A;  3A2X A;  1BJX A;  1AXD A;  4DEJ A;  2DJ3 A;  4TR4 A;  1BG5 A;  3IOS A;  4MJA A;  4MZW A;  4ECJ A;  1F3A A;  2IJY A;  2IFQ A;  3FW2 A;  2DIY A;  4X43 A;  2A2R A;  1Y6E A;  3TGZ A;  1VRS D;  1SJZ A;  2X8G A;  2HSH A;  2ON7 A;  5A4W A;  1X5C A;  1GUH A;  1YF1 A;  1GSF A;  1QFN A;  3M8N A;  1M2B A;  2A2S A;  4L8E A;  5IIZ A;  4EXJ A;  2RUF A;  2YJH A;  1TU8 A;  5IMZ A;  4IVF A;  5J3R A;  4PUR A;  3CSH A;  3ME7 A;  2P0G A;  3ZIJ A;  5INY A;  4E8H A;  3TKS A;  3QFB C;  4V1A p;  2MBS A;  3GN3 A;  4KE3 A;  1R5A A;  2FWE A;  2AUV A;  1ZMA A;  2I3Y A;  4I5Q A;  3RBT A;  2YV9 A;  4EE0 A;  4XCS A;  2HE3 A;  3KP9 A;  5B7C A;  3WD6 A;  4DSR A;  4ZBD A;  1GLQ A;  1J08 A;  3EMX A;  2YN1 A;  2H6X A;  4TR1 A;  4MPF A;  4KUN A;  1ILO A;  2YNX A;  2WFC A;  1LU4 A;  2VCX A;  4K7O A;  2HZF A;  3FK8 A;  1QUW A;  2H8L A;  4GXZ A;  4MH3 A;  2XC2 A;  3IK9 A;  2R37 A;  4GCI A;  4WR4 A;  2ZNM A;  4WXT A;  3LYP A;  2G2Q A;  3E0U A;  3U6V A;  1G6Y A;  4MMM A;  4XS4 A;  1UN2 A;  3BBY A;  2H01 A;  3KP8 A;  3PR8 A;  1UA5 A;  1Z9H A;  5DCH A;  3DKS A;  1SJI A;  3VWV A;  1SL0 B;  1SL1 B;  1WE0 A;  4GLT A;  5G1K A;  4O7H A;  2OE3 A;  3GNJ A;  3C73 A;  4AJ6 A;  1HYU A;  2JSY A;  5GST A;  3W8S A;  4OFT A;  3NOF A;  4HQZ A;  2VLU A;  2VIM A;  3GL5 A;  1PQN A;  4YQV A;  3ERF A;  1AQW A;  1K0O A;  5DQY A;  2V1M A;  3P7X A;  5GAP D;  1G0T A;  4TR0 A;  4K0N A;  2HXK A;  1GSU A;  1SKR B;  3IBH A;  3FRC A;  4I6X A;  4L0U A;  2D2Z A;  4Q5R A;  4K2D A;  1N2A A;  3CYN A;  4XRD A;  2KOK A;  2JL4 A;  5J41 A;  1TJD A;  5IOX A;  2DJJ A;  1TK0 B;  5IO0 A;  3QPM A;  2J23 A;  5DCG A;  3HHV A;  2LQQ A;  1B9Y C;  1A2L A;  2FGX A;  4KA0 A;  1F2E A;  3KMO A;  3UMA A;  4EDY A;  4EKZ A;  2QC7 A;  1TTZ A;  1GNE A;  2C4J A;  3GTU B;  5IMC A;  5FT3 A;  4IQA A;  3TOT A;  4PUF C;  1PSQ A;  1V57 A;  3GKX A;  1J9B A;  4POK A;  5ABR A;  1J0F A;  3TRP A;  2L6D A;  2H0G A;  4GSS A;  5KN3 A;  1F37 A;  4DVC A;  1G6W A;  3IK7 A;  3GH9 A;  4H86 A;  3I9V 2;  1T00 A;  3HDC A;  3MAK A;  4YAV A;  5HQP A;  2IME A;  3TKS C;  3F9U A;  2VO4 A;  1M99 A;  3DIE A;  4OCF A;  5H5S A;  5COH A;  5D93 A;  3GMF A;  3KIJ A;  2XBQ A;  2K18 A;  3ISO A;  3VI7 A;  4EF0 A;  3ZML A;  4K7N A;  1XBS A;  1T1V A;  2MMA A;  1EGR A;  1ZOF A;  2WUL A;  1YJ6 A;  10GS A;  3PH9 A;  3F6F A;  1EV9 A;  2E2M A;  4PXO A;  1AUC A;  1Z5Y E;  2J9H A;  3ZTL A;  3UJ1 A;  3NZN A;  3CTG A;  4V2M A;  5AIV A;  1Z6M A;  3GSS A;  4WBJ A;  3BCK A;  2PU9 C;  1KTE A;  5AIX A;  3TKS E;  1E6B A;  2ZUP A;  1O8X A;  3CSJ A;  1S3A A;  5EY6 A;  3EWL A;  2H72 A;  4HZ2 A;  2TRX A;  2VL3 A;  5CRH A;  2FNO A;  6GST A;  2OBK A;  5GAN D;  1JZO A;  5ENU A;  2R3X A;  2K6V A;  4WEY A;  1M7T A;  3GX8 A;  3A2W A;  3RPN A;  4ML6 A;  3G7J A;  3MWH A;  4GQC A;  3F8U A;  1SKS B;  2QKE A;  3G7Y A;  3HKR A;  2N5A A;  1MD3 A;  2CAI A;  4KH7 A;  1AQV A;  4HUA A;  3DRN A;  3LXT A;  2KP2 A;  5G5F A;  3IXR A;  3D4M A;  3HY2 A;  4LL1 B;  3UVT A;  2ZCT A;  1GTU A;  2B5Y A;  2FY6 A;  1R5P A;  5ELG A;  5ECO B;  5DAK B;  1SYX A;  17GS A;  2H1G A;  1USB A;  1ST9 A;  6GSU A;  5F8B A;  1XOA A;  2V32 A;  3P90 A;  4IP1 A;  1A0F A;  4RUV A;  1IYI A;  2P5Q A;  4MJC A;  2EIR A;  1GSD A;  4BVX A;  2DSA A;  4CHS A;  1SK0 A;  1ZGN A;  1A0R P;  2C0E A;  2OBI A;  2HT9 A;  1ZL9 A;  1NHO A;  3ZVJ A;  3HJO A;  2VM1 A;  2LRN A;  2PWJ A;  3O3T A;  2P31 A;  3QOU A;  4NWY A;  3AY8 A;  1K0N A;  4IJI A;  3UEM A;  3H1N A;  1NHY A;  2RM5 A;  4DSS A;  1DE1 A;  2FWH A;  4TVE A;  3WT1 A;  3O76 A;  2N5B A;  3M9K A;  4WF4 A;  1XPV A;  1UC7 A;  3UIW A;  3UOM A;  3GH6 A;  1VF3 A;  4IN0 A;  2RII A;  2JZS A;  3GL3 A;  5B8A A;  2K8S A;  2OAD A;  2R4V A;  3RHC A;  1QQ2 A;  2MMZ A;  3MNG A;  2DLX A;  1B4P A;  1SKW B;  3DEX A;  3I69 A;  1ACV A;  1C72 A;  5ECK B;  4F0B A;  2TRC P;  5CNW A;  4F03 A;  2H75 A;  5G30 A;  1TOF A;  3HD5 A;  3FEU A;  1YEP A;  4I2T A;  1XVQ A;  2LJA A;  4NXI A;  3EE2 A;  4PQI A;  5LCZ A;  4POM A;  2AYT A;  5CRE A;  2YCD A;  3E3E A;  2IMI A;  3DXB A;  5ECL B;  2VCT A;  5D8I A;  3FR3 A;  3KJY A;  3D22 A;  3U5R E;  4NV2 A;  1Z7R A;  2IL3 A;  3MDK A;  3C8E A;  3Q18 A;  4JR4 A;  4OMV A;  4LLR A;  5G31 A;  1DE2 A;  4J57 E;  3WGD A;  4KGI A;  1WPI A;  2EIO A;  3H79 A;  1GSE A;  4G9H A;  1W4V A;  1FOV A;  3UAR A;  4PUA A;  2IWT A;  5KN2 A;  3GX0 A;  3RHB A;  3IV4 A;  3GIX A;  5B6M A;  2L6C A;  1YY7 A;  4HOJ A;  2B5X A;  2F8A A;  3K8N A;  4RI6 A;  4Q5Q A;  5F06 A;  5AIS A;  2WDU A;  4LMW A;  20GS A;  2PVQ A;  2WGR A;  3L4N A;  4FO5 A;  4FYC A;  4KND A;  2C0D A;  2GQK A;  3BOA A;  1GP1 A;  2FHE A;  2AB6 A;  1PKZ A;  3ZRE A;  1BQ7 A;  2MMN A;  2R6K A;  2QGV A;  5FHI A;  4JRR A;  4MA9 A;  1WOU A;  2OAC A;  2XHF A;  1BAY A;  2H66 A;  2DBC A;  5JCU A;  3TJJ A;  5DQS A;  1TK8 B;  1I5G A;  4Z7X A;  7GSS A;  4P3Y B;  4PGT A;  5ECI B;  4AJ7 A;  4ZIL A;  4JED A;  2XPE A;  4FIW A;  3TJB A;  1TP9 A;  1ZCP A;  4AJ8 A;  4I8B A;  1SD9 A;  2GSQ A;  3IE3 A;  1U87 A;  3IPZ A;  1Z6N A;  1TK5 B;  1THX A;  3KH9 A;  4OFN A;  5HFI A;  1QXH A;  3LJR A;  1EP7 A;  3I6A A;  6GSW A;  2PBJ A;  4HJM A;  4ZB9 A;  1F9M A;  2C1Y A;  5G5E A;  1PX6 A;  3D5J A;  4KB3 A;  2GVP A;  3KGK A;  4LA1 A;  1YZX A;  5KN1 A;  1EEM A;  3WGE A;  3RPP A;  3UAP A;  2CT6 A;  1GLP A;  4JU5 A;  3C1R A;  22GS A;  1GNW A;  1NSW A;  3BD2 A;  1B4Q A;  3QMX A;  1RK4 A;  5IMA A;  1A24 A;  3TKQ A;  1W89 A;  2NTO A;  1OE7 A;  3EC3 A;  4KDX A;  4JE1 A;  2CQ9 A;  3FR9 A;  4TXO A;  3FKF A;  3ZRD A;  3L9V A;  5JWQ B;  3C7M A;  2DMM A;  1BYE A;  2FUG 2;  1K3O A;  5DAL B;  4V2L A;  4K8M A;  3F0I A;  1KEB A;  4D73 A;  4IP6 A;  1GUM A;  4X1U A;  1CQG A;  3R2Q A;  2GT6 A;  3HXS A;  4EO3 A;  4MH2 A;  1EWX A;  2JAD A;  2JAC A;  1XW9 A;  2DIZ A;  1OKD A;  5CRG A;  1K3L A;  5HFK A;  1E2Y A;  2VCQ A;  1PA3 A;  3LQ7 A;  3TRQ A;  1V2A A;  4ZL8 A;  2O8V B;  2F9S A;  4NAX A;  5LD0 A;  3WGX A;  3HYP A;  2YAN A;  2VLV A;  3M9J A;  1JZR A;  1DUG A;  2P5R A;  5F05 A;  3MSZ A;  1TDI A;  4MZB A;  2IMD A;  4F2I A;  2AV4 A;  3APQ A;  5E59 A;  5F0G A;  2CVD A;  1T4Y A;  3HVX A;  2VCZ A;  1QGV A;  3VLN A;  2H1B A;  2DJ2 A;  2L4C A;  2VM2 A;  1OE8 A;  3ZIV A;  2HSY A;  3QFA C;  2GQM A;  2AJQ B;  4HU7 A;  1S3D A;  3KM6 A;  1O81 A;  1VF1 A;  3J7Y k;  3KTB A;  4N11 A;  5ECP B;  2B6M A;  1THO A;  1TKD B;  1Q98 A;  1PKW A;  3F4R A;  4ID0 A;  2GZY A;  3LGC A;  3HA9 A;  5B6N A;  4MF5 A;  2FLS A;  3ZVJ D;  4F0C A;  1SYR A;  2MMO A;  1A8Y A;  2R5G A;  3FHK A;  3HJP A;  4N10 A;  4PQH A;  3H8Q A;  3LSZ A;  4YH2 A;  2NPB A;  2HRF A;  5LNK e;  3A5W A;  1FAA A;  4JR6 A;  5H5R A;  5H5Q A;  1PGT A;  13GS A;  5CYY A;  3N5O A;  4PNG A;  2FD3 A;  5ID2 A;  3GUS A;  2LST A;  3IC4 A;  4AGS A;  3CTF A;  3DGQ A;  4POB A;  4QQ7 A;  3PIN A;  2FWF A;  5J9B A;  2X8C A;  2CX3 A;  3VK9 A;  1ZYQ B;  4O32 A;  1U88 A;  1FVK A;  1EZK A;  1EV4 A;  2CV4 A;  4LMV A;  1A2M A;  2PER A;  1WIK A;  2ES7 A;  2L5O A;  1HNA A;  2WJU A;  4EUY A;  4BA7 A;  1A8L A;  1FW1 A;  3CMI A;  3M0F A;  4ECB A;  3IR4 A;  1ERV A;  1X5D A;  2VL2 A;  4G19 A;  1GSS A;  2RM6 A;  3EUR A;  2YWI A;  4YQU A;  4DSS B;  1Y25 A;  2DML A;  2VD1 A;  5CRD A;  1V9W A;  1K3Y A;  2IIY A;  4ACS A;  3O6T A;  2NBS A;  4KAE A;  1FB0 A;  1FVJ A;  2H19 A;  2GSS A;  2CX4 A;  3IRA A;  2IPA A;  3EVI A;  3VPT A;  2JZR A;  19GS A;  3GTU A;  1PL2 A;  3ZIT A;  2N5F A;  3GKM A;  3S9F A;  4IBP A;  2LJK A;  5HFG A;  2I4A A;  3V1W A;  5ECR B;  3W8J A;  4TKY A;  5C00 A;  1WJK A;  4EL1 A;  5ECN B;  2CVK A;  2KP1 A;  2F8F A;  2H73 A;  2VOC A;  2E2G A;  1R7H A;  3DD3 A;  2CZ3 A;  5JWR B;  2KLX A;  3ZLP A;  2CVB A;  4KSM A;  1WP0 A;  5DBQ A;  4WKW A;  3HZ8 A;  2ALB A;  1YKA A;  5F07 A;  1VF4 A;  2M46 A;  2HZE B;  2M72 A;  4TW5 A;  5A4U A;  1XW6 A;  3ERW A;  1OC9 A;  5DJL A;  5DDL A;  4LL4 B;  2L59 A;  4GQF A;  3UBK A;  4RI7 A;  4GF0 A;  3W6G A;  4KW6 A;  2QSI A;  1XWG A;  3IDV A;  2G0F A;  2X8H A;  1LJR A;  3NIV A;  5E4W A;  4ZL7 A;  1SL2 B;  3CBU A;  14GS A;  5A5K A;  2H6Y A;  2CZ2 A;  4I2U A;  2C8U A;  3GYK A;  1FB6 A;  1YF0 A;  1GL8 A;  1KBN A;  3F3Q A;  5D9V A;  1XWC A;  1YKC A;  3BCI A;  1X9S B;  1ON4 A;  3EU3 A;  5DVB A;  5KN0 A;  2DJ1 A;  1F3B A;  3DML A;  3L78 A;  3EMP A;  1JLW A;  2LKU A;  4XTS A;  1I9D A;  4PNF A;  4K0G A;  3LEF A;  2GST A;  3QD9 A;  3P2A A;  3EYT A;  3VWW A;  2O85 A;  3L9S A;  5CO3 A;  1U6T A;  5CRW A;  2VAF A;  1B48 A;  2C3T A;  2VL9 A;  5IQY A;  4BWQ A;  2I81 A;  2IFQ B;  3PGT A;  4EVM A;  2IN3 A;  1YDK A;  5HR2 A;  2EC4 A;  1K0C A;  2VL2 C;  2BTO T;  1HQO A;  2H1D A;  1G7E A;  4RQX A;  1TXX A;  6GSX A;  1YQ1 A;  5DAK A;  1OC3 A;  3DWV A;  2H1A A;  2GQL A;  2REM A;  5ECS A;  4HI7 A;  3D21 A;  3KZQ A;  3QAV A;  4GST A;  1Q4J A;  2H30 A;  1HNB A;  2B5E A;  2HNL A;  2PVO C;  5EPF A;  1EOG A;  2OE1 A;  3CSI A;  3RAZ A;  3SBC A;  2MZC A;  16GS A;  3KD0 A;  3KH7 A;  4BL7 A;  2B3S A;  1EGO A;  2OKA A;  1X5E A;  1AC1 A;  2BJX A;  3C71 A;  4OO5 A;  3FZA A;  3EIN A;  4HQS A;  1SJ6 A;  5FWG A;  1K0M A;  4TR1 B;  3G7I A;  4FYB A;  2I1U A;  2X64 A;  2HYX A;  5D9T A;  3LG6 A;  1VGL A;  2PN8 A;  2HFD A;  3KEB A;  3VUR A;  1JZD A;  1FO5 A;  4XS4 B;  4XS6 A;  4D73 B;  1PRX A;  5C04 A;  3FZ9 A;  3QR6 A;  2IMF A;  4CW9 A;  2L4Q A;  4WET A;  1OAZ A;  2DC5 A;  4WF5 A;  3SWL A;  1UVZ A;  5ECQ B;  3KMN A;  1ML6 A;  1ERT A;  2M80 A;  4BPY A;  1XFL A;  4F9Z A;  2JZT A;  4MCU A;  4NHZ A;  3DVW A;  3HJM A;  3GST A;  4MLY A;  2GLR A;  4TR3 A;  3QAG A;  1TRU A;  1O8W A;  4NV5 A;  4ML1 A;  5D73 A;  4OCE A;  4HU9 A;  4K7I A;  1YEX A;  1O6J A;  2GSR A;  3ERG A;  4HS1 A;  5HR3 A;  5DJM A;  3QAW A;  1OKT A;  2C80 A;  5KEJ A;  4QL9 A;  1AIU A;  3HVV A;  1H4O A;  1G7O A;  1FHE A;  3ME8 A;  1M9A A;  3QDN A;  1TRS A;  2OA7 A;  4PQ1 A;  18GS A;  1PX7 A;  2YP6 A;  2MYG A;  3M3M A;  4I97 A;  4IHU A;  4YQM A;  2XPD A;  1XZO A;  3IA1 A;  4TXV A;  1EEJ A;  1TRW A;  1KNG A;  2HRN A;  5IPG A;  4OO4 A;  5AGY A;  4E8E A;  4MF6 A;  3GKN A;  3Q19 A;  3TKP A;  2A4V A;  3BJ5 A;  5JCW A;  2PUK C;  2Z9S A;  1TI3 A;  4J56 E;  4EDZ A;  3RDW A;  2H0H A;  1GRX A;  1XW5 A;  2MBT A;  2YZH A;  2E7P A;  1TU7 A;  1U3A A;  4XRA A;  1GH2 A;  2WS2 A;  2AHE A;  4N30 A;  2OJL A;  4N0V A;  1X9M B;  2I9H A;  1WMJ A;  5ID2 B;  3ZFB A;  1TI1 A;  2R2J A;  2H70 A;  2YJ7 A;  4IQ1 A;  4WR5 A;  1IYH A;  3FYG A;  2B1K A;  6GSY A;  1JFU A;  4FYU A;  3VPQ A;  2FWG A;  4Q5N A;  3D0Z A;  1S3C A;  1XWK A;  2E0Q A;  4V2N A;  3Q74 A;  4BVY A;  1X0R A;  1QMV A;  3I43 A;  2H6Z A;  1M0U A;  2H74 A;  4POL A;  1V40 A;  1F6M C;  4NHW A;  4YAP A;  3GV1 A;  5CAX A;  9GSS A;  2CA8 A;  1OC8 A;  4ECC A;  5B8B A;  4IGJ A;  2B1L A;  3D4T A;  4MK3 A;  2YV7 A;  3F4T A;  2GS3 A;  1SEN A;  1XOB A;  1FG4 A;  3APS A;  3L9U A;  4ZL9 A;  4MF7 A;  2WCI A;  4G2E A;  1EP8 A;  2V6O A;  4ULX A;  3GA4 A;  1GTB A;  4ZB6 A;  3F63 A;  5JWO B;  1MEK A;  4GRF A;  3H93 A;  5D96 A;  3FY7 A;  2YWM A;  5D9W A;  4N0Z A;  1ERU A;  2FA8 A;  1K0D A;  2BMX A;  4KSO A;  1JHB A;  2WZ9 A;  2LUS A;  5J4U A;  1MDI A;  2H71 A;  3ZL5 A;  2OE0 A;  1WWJ A;  5J5N A;  1CQH A;  2LJR A;  2H0I A;  4XIH A;  3H4K A;  4FH8 A;  3LWA A;  3DYR A;  4ZIJ A;  4MPG A;  3ZFL A;  5JCG A;  5AN1 A;  3OR5 A;  2YWO A;  1PD2 1;  5DAL A;  2GGT A;  1XIY A;  1TRV A;  4EC0 A;  1PL1 A;  2GTU A;  1SK1 A;  3TJF A;  4BWS A;  1H75 A;  2KHP A;  1DBY A;  3L0H A;  2LTK A;  1A23 A;  1T7P B;  1ZZY A;  2F3M A;  2ON5 A;  4G10 A;  5ECH B;  2C0F A;  1A2J A;  2VLT A;  1R26 A;  2HLS A;  4QL7 A;  2V2G A;  4ZB8 A;  1Z7P A;  2O87 A;  1GUK A;  4TRX A;  2L57 A;  2DJK A;  4KDY A;  1GWC A;  4MP4 A;  3ED3 A;  3TKR A;  1ERW A;  4DSQ A;  1OC9 B;  1RW1 A;  1M9B A;  4ISD A;  3TJK A;  2VCW A;  3UL3 A;  4WBR D;  4XS1 A;  3EU4 A;  3LFL A;  4MJE A;  3N9J A;  1XWA A;  2PMT A;  1AW9 A;  1M2A A;  3FZ5 A;  1XXU A;  4L5L A;  4ECI A;  4KCE A;  2LV3 A;  1R4W A;  1RQM A;  4X0X A;  12GS A;  1URM A;  3DVX A;  5D9X A;  4TOP A;  1OYJ A;  2IMK A;  3D6I A;  1OVN A;  2PGT A;  4K1F A;  3APO A;  4JZQ A;  2YWN A;  1NM3 A;  2O7K A;  1MDJ A;  1N8J A;  2GDR A;  3E9J B;  1GTI A;  4IS0 A;  1VF2 A;  2GZP A;  3A3T A;  4ILF A;  2RUE A;  4K6X A;  4GSN A;  1T4Z A;  4KDU A;  1AQX A;  1U3I A;  2C0G A;  3CRT A;  2RLI A;  5IMF A;  1ABA A;  1T8E B;  1M2D A;  3LXZ A;  2B7K A;  5J9C A;  2CAQ A;  4IEL A; 
#chains in the Genus database with same CATH topology
 4AF2 A;  1SU9 A;  3VFI A;  1X9W B;  2JU5 A;  5HR0 A;  4GTU A;  3TDG A;  4HZ4 A;  4XHM A;  3HVS A;  2C3N A;  4KCA A;  2WRT A;  1GSQ A;  2AAW A;  3TJG A;  1AAZ A;  3GUR A;  5GSS A;  5ELA A;  3F6D A;  1B9X C;  1B8X A;  1MTC A;  1LBK A;  2HI7 A;  2YOI A;  4CY6 A;  1DSB A;  4HJ2 A;  3FR6 A;  1K0A A;  2H76 A;  1MDK A;  4IJ3 A;  3WT2 A;  1ZYE A;  2V6K A;  4CDO A;  2KUC A;  3ZYW A;  3TB2 A;  6GSV A;  1GSY A;  1GUL A;  2NDO A;  2K9F A;  3IAS 2;  1PMT A;  3LOR A;  2JSZ A;  3ZMK A;  5IPH A;  1NW2 A;  3GKK A;  2PPT A;  2EIQ A;  2LQO A;  3KXO A;  2YPM A;  1V98 A;  4ZBA A;  3HZ4 A;  4MDC A;  5GZZ B;  3F3R A;  4HEA 2;  2LNS A;  1MD4 A;  2XBI A;  3GHA A;  1XWB A;  4MZC A;  5EL8 A;  3P8W A;  4JBB A;  1PN9 A;  2F51 A;  2O89 A;  3VWX A;  1T3B A;  3GFK A;  2L5L A;  3WYW A;  3CXG A;  1JLV A;  4OFM A;  2VD0 A;  5G1L A;  2LRT A;  4O92 A;  1XCC A;  1BX9 A;  2HSM A;  2V41 A;  1V58 A;  1JZW A;  5CP1 A;  5IM9 A;  3TRX A;  2C3Q A;  3ZZX A;  3UVH A;  3VI5 A;  2LRC A;  3TOU A;  5IO2 A;  1ZYP A;  2FCH A;  3KCM A;  3J7Y b;  4Q5F A;  4IW9 A;  3QCP A;  4PX1 A;  5EVO A;  4L0W A;  1HD2 A;  4MAB A;  3KTL A;  3FZ4 A;  3A2V A;  1SD8 A;  5IOW A;  3EPT A;  2VCV A;  2GZZ A;  3US3 A;  1BED A;  4F82 A;  2TIR A;  1K0B A;  4ZBB A;  6GSS A;  3UBL A;  1O73 A;  1WRY A;  3IHQ A;  4NMU A;  4TN8 A;  2LNT A;  2LS5 A;  2DJ0 A;  4IKH A;  2HZE A;  4GWR A;  4HDE A;  2WB9 A;  2X99 A;  3HCZ A;  1O85 A;  3G9B A;  3VWU A;  11GS A;  4V1A g;  5G2Z A;  1XVW A;  2GT5 A;  1TW9 A;  1O7U A;  3Q6O A;  5HR1 A;  2QA1 A;  3JCM L;  3TCO A;  1QK8 A;  4TXO B;  5ECM B;  3M1G A;  4OD7 A;  2FA4 A;  1EOH A;  2LEG A;  4MJB A;  3CRU A;  4L5O A;  2VUP A;  5L71 A;  3F4S A;  4OWY A;  4O5R A;  1GTA A;  4KX4 A;  4ZXG A;  4RQR A;  8GSS A;  4K9Z A;  2NVL A;  5A4V A;  1HNC A;  4NPB A;  1SK2 A;  3C1S A;  2YZU A;  5IMV A;  1Z3E A;  4J2F A;  3IAM 2;  2UZ8 A;  2B7J A;  2K8V A;  3GRX A;  3LYK A;  3TUE A;  5IMD A;  3A2X A;  1BJX A;  1AXD A;  4DEJ A;  2DJ3 A;  4TR4 A;  4EIQ A;  1BG5 A;  3IOS A;  4MJA A;  4MZW A;  4ECJ A;  1F3A A;  2IJY A;  2IFQ A;  4BIK A;  3FW2 A;  4K2X A;  2DIY A;  4X43 A;  2A2R A;  1Y6E A;  3TGZ A;  1VRS D;  1SJZ A;  2X8G A;  4Z2R A;  2HSH A;  2ON7 A;  5A4W A;  1X5C A;  1GUH A;  1YF1 A;  1GSF A;  1QFN A;  3M8N A;  1M2B A;  2A2S A;  4L8E A;  5IIZ A;  4EXJ A;  2RUF A;  2YJH A;  1TU8 A;  5IMZ A;  4IVF A;  5J3R A;  4PUR A;  3CSH A;  3ME7 A;  2P0G A;  3ZIJ A;  5INY A;  4E8H A;  3TKS A;  3QFB C;  4V1A p;  2MBS A;  3GN3 A;  5BMU A;  4KE3 A;  1R5A A;  2FWE A;  2AUV A;  1ZMA A;  2I3Y A;  4I5Q A;  3RBT A;  2YV9 A;  4EE0 A;  4XCS A;  2HE3 A;  3KP9 A;  5B7C A;  3WD6 A;  4DSR A;  4ZBD A;  1GLQ A;  1J08 A;  3EMX A;  2YN1 A;  2H6X A;  4TR1 A;  4MPF A;  4KUN A;  1ILO A;  2YNX A;  2WFC A;  1LU4 A;  2VCX A;  4K7O A;  2HZF A;  3FK8 A;  1QUW A;  2H8L A;  4GXZ A;  4MH3 A;  2XC2 A;  3IK9 A;  2R37 A;  4GCI A;  4WR4 A;  2ZNM A;  4WXT A;  3LYP A;  2G2Q A;  3E0U A;  3U6V A;  1G6Y A;  2DKH A;  4MMM A;  4XS4 A;  1UN2 A;  3BBY A;  2H01 A;  3KP8 A;  3PR8 A;  1UA5 A;  1Z9H A;  5DCH A;  3DKS A;  1SJI A;  3VWV A;  1SL0 B;  1SL1 B;  1WE0 A;  4GLT A;  5G1K A;  4O7H A;  2OE3 A;  3GNJ A;  3C73 A;  4AJ6 A;  1HYU A;  2JSY A;  5GST A;  3W8S A;  4OFT A;  2HRA A;  3NOF A;  4HQZ A;  2VLU A;  2VIM A;  3GL5 A;  1PQN A;  4YQV A;  3ERF A;  1AQW A;  1K0O A;  5DQY A;  2V1M A;  3P7X A;  5GAP D;  1G0T A;  4TR0 A;  4K0N A;  2HXK A;  1GSU A;  1SKR B;  3IBH A;  3FRC A;  4I6X A;  4L0U A;  2D2Z A;  4Q5R A;  4K2D A;  1N2A A;  3CYN A;  4XRD A;  2KOK A;  2JL4 A;  5J41 A;  1TJD A;  5IOX A;  2DJJ A;  1TK0 B;  5IO0 A;  3QPM A;  2J23 A;  5DCG A;  3HHV A;  2LQQ A;  1B9Y C;  1A2L A;  2FGX A;  4KA0 A;  1F2E A;  3KMO A;  3UMA A;  4EDY A;  4EKZ A;  2QC7 A;  1TTZ A;  1GNE A;  2C4J A;  3GTU B;  5IMC A;  5FT3 A;  4IQA A;  3TOT A;  4PUF C;  1PSQ A;  1V57 A;  3GKX A;  1J9B A;  4POK A;  5ABR A;  1J0F A;  3TRP A;  2L6D A;  2H0G A;  4GSS A;  5KN3 A;  1F37 A;  3A5I A;  4DVC A;  1G6W A;  4KF9 A;  3IK7 A;  3GH9 A;  4H86 A;  3I9V 2;  1T00 A;  3HDC A;  3MAK A;  4YAV A;  5HQP A;  2IME A;  3TKS C;  3F9U A;  2VO4 A;  1M99 A;  3DIE A;  4OCF A;  5H5S A;  5COH A;  5D93 A;  3GMF A;  3KIJ A;  2XBQ A;  2K18 A;  3ISO A;  3VI7 A;  4EF0 A;  3ZML A;  4K7N A;  1XBS A;  1M3I A;  1T1V A;  2MMA A;  1EGR A;  1ZOF A;  2WUL A;  1YJ6 A;  10GS A;  3PH9 A;  3F6F A;  1EV9 A;  2E2M A;  4PXO A;  1AUC A;  1Z5Y E;  2J9H A;  3ZTL A;  3UJ1 A;  3NZN A;  3CTG A;  4V2M A;  5AIV A;  1Z6M A;  3GSS A;  4WBJ A;  3BCK A;  2PU9 C;  1KTE A;  5AIX A;  3TKS E;  1E6B A;  2ZUP A;  1O8X A;  5KOX A;  3CSJ A;  1S3A A;  5EY6 A;  3EWL A;  2H72 A;  4HZ2 A;  2TRX A;  2VL3 A;  5CRH A;  2FNO A;  6GST A;  2OBK A;  5GAN D;  1JZO A;  4YKF A;  5ENU A;  2R3X A;  2K6V A;  4WEY A;  1M7T A;  3GX8 A;  3A2W A;  3RPN A;  4ML6 A;  3G7J A;  3MWH A;  4GQC A;  3F8U A;  1SKS B;  2QKE A;  3G7Y A;  3HKR A;  2N5A A;  1MD3 A;  2CAI A;  4KH7 A;  1AQV A;  4HUA A;  3DRN A;  3LXT A;  2KP2 A;  5G5F A;  3IXR A;  3D4M A;  3HY2 A;  4LL1 B;  3UVT A;  2ZCT A;  1GTU A;  2B5Y A;  2FY6 A;  1R5P A;  5ELG A;  5ECO B;  4MNN A;  5DAK B;  1SYX A;  17GS A;  2H1G A;  1USB A;  1ST9 A;  6GSU A;  5F8B A;  4G0L A;  1XOA A;  2V32 A;  3P90 A;  4IP1 A;  1A0F A;  4RUV A;  1IYI A;  2P5Q A;  4MJC A;  2EIR A;  1GSD A;  4BVX A;  2DSA A;  4CHS A;  1SK0 A;  1ZGN A;  1A0R P;  2C0E A;  2OBI A;  2HT9 A;  1ZL9 A;  1NHO A;  3ZVJ A;  3HJO A;  2VM1 A;  2LRN A;  2PWJ A;  3O3T A;  2P31 A;  3QOU A;  4NWY A;  3AY8 A;  4BL7 B;  1K0N A;  4IJI A;  4X4J A;  3UEM A;  3H1N A;  1NHY A;  2RM5 A;  4DSS A;  1DE1 A;  4Z2T A;  2FWH A;  4TVE A;  3WT1 A;  3O76 A;  2N5B A;  3M9K A;  4WF4 A;  1XPV A;  1UC7 A;  3UIW A;  3UOM A;  3GH6 A;  1VF3 A;  4IN0 A;  2RII A;  2JZS A;  3GL3 A;  5B8A A;  1XG8 A;  2K8S A;  2OAD A;  2R4V A;  3RHC A;  1QQ2 A;  2MMZ A;  3MNG A;  2DLX A;  1B4P A;  1SKW B;  3DEX A;  3I69 A;  1ACV A;  1C72 A;  5ECK B;  4F0B A;  2TRC P;  5CNW A;  4F03 A;  2H75 A;  5G30 A;  1TOF A;  3HD5 A;  3FEU A;  1YEP A;  4I2T A;  1XVQ A;  2LJA A;  4NXI A;  3EE2 A;  4PQI A;  5LCZ A;  4POM A;  2AYT A;  5CRE A;  2YCD A;  3E3E A;  2IMI A;  3DXB A;  5ECL B;  2VCT A;  5D8I A;  3FR3 A;  3KJY A;  3MYD A;  3D22 A;  3U5R E;  4NV2 A;  1Z7R A;  2IL3 A;  3MDK A;  3C8E A;  3Q18 A;  4JR4 A;  4OMV A;  4LLR A;  5G31 A;  1DE2 A;  4J57 E;  3WGD A;  4KGI A;  1WPI A;  2EIO A;  3H79 A;  1GSE A;  4G9H A;  1W4V A;  1FOV A;  3UAR A;  4PUA A;  2IWT A;  5KN2 A;  3GX0 A;  3RHB A;  3IV4 A;  3GIX A;  5B6M A;  2L6C A;  1YY7 A;  4HOJ A;  2B5X A;  2F8A A;  3K8N A;  4RI6 A;  4Q5Q A;  5F06 A;  4ICY A;  5AIS A;  2WDU A;  4LMW A;  20GS A;  2PVQ A;  2WGR A;  3L4N A;  4FO5 A;  4FYC A;  4KND A;  2C0D A;  2GQK A;  3BOA A;  1GP1 A;  2FHE A;  2AB6 A;  1PKZ A;  3ZRE A;  1BQ7 A;  2MMN A;  2R6K A;  2QGV A;  5FHI A;  4JRR A;  4MA9 A;  1WOU A;  2OAC A;  2XHF A;  1BAY A;  2H66 A;  2DBC A;  5JCU A;  3TJJ A;  5DQS A;  1TK8 B;  1I5G A;  4Z7X A;  7GSS A;  4P3Y B;  4PGT A;  5ECI B;  4AJ7 A;  4BVY B;  4ZIL A;  4JED A;  2XPE A;  4FIW A;  3TJB A;  1TP9 A;  1ZCP A;  4AJ8 A;  4I8B A;  1SD9 A;  2GSQ A;  3IE3 A;  1U87 A;  4G0I A;  3IPZ A;  1Z6N A;  1TK5 B;  1THX A;  3KH9 A;  4OFN A;  5HFI A;  1QXH A;  3LJR A;  1EP7 A;  3I6A A;  6GSW A;  2PBJ A;  4HJM A;  4ZB9 A;  1F9M A;  2C1Y A;  5G5E A;  1PX6 A;  3D5J A;  4KB3 A;  2GVP A;  2R0P A;  3KGK A;  4LA1 A;  1YZX A;  5KN1 A;  1EEM A;  3WGE A;  3RPP A;  3UAP A;  2CT6 A;  1GLP A;  4JU5 A;  3C1R A;  22GS A;  1GNW A;  1NSW A;  3BD2 A;  1B4Q A;  3QMX A;  1RK4 A;  5IMA A;  1A24 A;  3TKQ A;  1W89 A;  2NTO A;  1OE7 A;  3EC3 A;  4KDX A;  4JE1 A;  2CQ9 A;  3FR9 A;  4TXO A;  3FKF A;  3ZRD A;  3L9V A;  5JWQ B;  2DKI A;  3C7M A;  2DMM A;  1BYE A;  2FUG 2;  1K3O A;  5DAL B;  4V2L A;  4K8M A;  3F0I A;  1KEB A;  4D73 A;  4IP6 A;  1GUM A;  4X1U A;  1CQG A;  3R2Q A;  2GT6 A;  3HXS A;  4EO3 A;  4MH2 A;  1EWX A;  2JAD A;  2JAC A;  1XW9 A;  2DIZ A;  1OKD A;  5CRG A;  1K3L A;  1FOH A;  5HFK A;  1E2Y A;  2VCQ A;  1PA3 A;  3LQ7 A;  3TRQ A;  1V2A A;  4ZL8 A;  2O8V B;  2F9S A;  4NAX A;  5LD0 A;  3WGX A;  3HYP A;  2YAN A;  2VLV A;  3M9J A;  1JZR A;  1DUG A;  2P5R A;  3MIX A;  5F05 A;  3MSZ A;  1TDI A;  4MZB A;  2IMD A;  4F2I A;  2AV4 A;  3APQ A;  5E59 A;  5F0G A;  2CVD A;  1T4Y A;  3HVX A;  2VCZ A;  1QGV A;  3VLN A;  2H1B A;  2DJ2 A;  2L4C A;  2VM2 A;  1OE8 A;  3ZIV A;  2HSY A;  3QFA C;  2GQM A;  1M3J A;  2AJQ B;  4HU7 A;  1S3D A;  3KM6 A;  1O81 A;  1VF1 A;  3J7Y k;  3KTB A;  4N11 A;  5ECP B;  2B6M A;  1ZYN A;  1THO A;  1TKD B;  1Q98 A;  1PKW A;  3F4R A;  4ID0 A;  2GZY A;  3LGC A;  3HA9 A;  5B6N A;  4MF5 A;  4PTS A;  2FLS A;  3ZVJ D;  4F0C A;  1SYR A;  2MMO A;  1A8Y A;  2R5G A;  3FHK A;  3HJP A;  4N10 A;  4PQH A;  3H8Q A;  3LSZ A;  4YH2 A;  2NPB A;  2HRF A;  5LNK e;  3A5W A;  1FAA A;  2X4A A;  4JR6 A;  5H5R A;  5H5Q A;  1PGT A;  13GS A;  5CYY A;  3N5O A;  4PNG A;  2FD3 A;  5ID2 A;  3GUS A;  2LST A;  3IC4 A;  4AGS A;  3CTF A;  3DGQ A;  4POB A;  4QQ7 A;  3PIN A;  2FWF A;  5J9B A;  2A4H A;  2X8C A;  2CX3 A;  3VK9 A;  1ZYQ B;  4O32 A;  1U88 A;  1FVK A;  1EZK A;  1EV4 A;  2CV4 A;  4LMV A;  1A2M A;  2PER A;  1WIK A;  2ES7 A;  2L5O A;  1HNA A;  2WJU A;  4EUY A;  4BA7 A;  1A8L A;  1FW1 A;  3CMI A;  3M0F A;  4FQU A;  4ECB A;  3IR4 A;  1ERV A;  1X5D A;  3PPU A;  2VL2 A;  4G19 A;  1GSS A;  2RM6 A;  3EUR A;  2YWI A;  4YQU A;  4DSS B;  4O5U A;  1Y25 A;  2DML A;  2VD1 A;  2A2P A;  5CRD A;  1V9W A;  1K3Y A;  2IIY A;  4ACS A;  2X49 A;  3IC8 A;  3O6T A;  2NBS A;  4KAE A;  2QA2 A;  1FB0 A;  1FVJ A;  2H19 A;  2GSS A;  2CX4 A;  3IRA A;  2IPA A;  3EVI A;  3VPT A;  2JZR A;  19GS A;  3GTU A;  1PL2 A;  3ZIT A;  2N5F A;  3GKM A;  3S9F A;  4IBP A;  2LJK A;  5HFG A;  2I4A A;  3V1W A;  5ECR B;  3W8J A;  4TKY A;  5C00 A;  1WJK A;  4EL1 A;  2R0G A;  5ECN B;  2CVK A;  2KP1 A;  2F8F A;  2H73 A;  2VOC A;  2E2G A;  1R7H A;  3DD3 A;  2CZ3 A;  5JWR B;  2KLX A;  3ZLP A;  2CVB A;  4KSM A;  1WP0 A;  5DBQ A;  4WKW A;  3HZ8 A;  2ALB A;  1YKA A;  5F07 A;  1VF4 A;  2M46 A;  2HZE B;  2M72 A;  4TW5 A;  5A4U A;  1XW6 A;  3ERW A;  1OC9 A;  5DJL A;  5DDL A;  4LL4 B;  2L59 A;  4GQF A;  3UBK A;  4RI7 A;  4GF0 A;  3W6G A;  4KW6 A;  2QSI A;  1XWG A;  3IDV A;  2G0F A;  2X8H A;  1LJR A;  3NIV A;  5E4W A;  4ZL7 A;  4O5Q A;  1SL2 B;  3CBU A;  14GS A;  5A5K A;  2H6Y A;  2CZ2 A;  4I2U A;  2C8U A;  3GYK A;  1FB6 A;  1YF0 A;  1GL8 A;  1KBN A;  3F3Q A;  5D9V A;  1XWC A;  1YKC A;  3BCI A;  1X9S B;  1ON4 A;  3HVN A;  3EU3 A;  5DVB A;  5KN0 A;  2DJ1 A;  1F3B A;  3DML A;  3L78 A;  3EMP A;  1JLW A;  2LKU A;  4XTS A;  1I9D A;  4PNF A;  4K0G A;  3LEF A;  2GST A;  3QD9 A;  3P2A A;  3EYT A;  3VWW A;  2O85 A;  3L9S A;  5CO3 A;  1U6T A;  5CRW A;  2VAF A;  1B48 A;  2C3T A;  2VL9 A;  5IQY A;  4BWQ A;  2I81 A;  2IFQ B;  3PGT A;  4EVM A;  2IN3 A;  1YDK A;  5HR2 A;  3IHG A;  2EC4 A;  1K0C A;  2VL2 C;  2BTO T;  1HQO A;  2H1D A;  1G7E A;  4RQX A;  1TXX A;  6GSX A;  1YQ1 A;  5DAK A;  1OC3 A;  3DWV A;  2H1A A;  2GQL A;  2REM A;  4EIP A;  5ECS A;  4HI7 A;  3D21 A;  4CY8 A;  3KZQ A;  3QAV A;  4GST A;  1Q4J A;  2H30 A;  1HNB A;  2B5E A;  2HNL A;  2PVO C;  5EPF A;  4HSC X;  1EOG A;  2OE1 A;  3CSI A;  3RAZ A;  3SBC A;  2MZC A;  16GS A;  3KD0 A;  3KH7 A;  4BL7 A;  2B3S A;  1EGO A;  2OKA A;  1X5E A;  1AC1 A;  2BJX A;  3C71 A;  4OO5 A;  3FZA A;  3EIN A;  4HQS A;  1SJ6 A;  5FWG A;  1K0M A;  3R3E A;  4TR1 B;  3G7I A;  4FYB A;  2I1U A;  2X64 A;  2HYX A;  5D9T A;  3LG6 A;  1VGL A;  2PN8 A;  2HFD A;  3KEB A;  3VUR A;  4Z2U A;  1JZD A;  1FO5 A;  4XS4 B;  4XS6 A;  4D73 B;  1PRX A;  5C04 A;  3FZ9 A;  3QR6 A;  2IMF A;  4CW9 A;  2L4Q A;  4WET A;  1PN0 A;  1OAZ A;  2DC5 A;  4WF5 A;  3SWL A;  1UVZ A;  5ECQ B;  3KMN A;  1ML6 A;  1ERT A;  2M80 A;  4BPY A;  1XFL A;  4F9Z A;  2JZT A;  4MCU A;  4NHZ A;  3DVW A;  3HJM A;  3GST A;  4MLY A;  2GLR A;  4TR3 A;  3QAG A;  1TRU A;  1O8W A;  4NV5 A;  4ML1 A;  5D73 A;  4OCE A;  4HU9 A;  4K7I A;  1YEX A;  1O6J A;  2GSR A;  3ERG A;  4HS1 A;  5HR3 A;  5DJM A;  3QAW A;  1OKT A;  2C80 A;  5KEJ A;  4QL9 A;  1AIU A;  3HVV A;  1H4O A;  1G7O A;  1FHE A;  3ME8 A;  1M9A A;  3QDN A;  1TRS A;  2OA7 A;  4PQ1 A;  18GS A;  1PX7 A;  2YP6 A;  2MYG A;  3M3M A;  4I97 A;  4IHU A;  4YQM A;  2XPD A;  1XZO A;  3IA1 A;  4TXV A;  1EEJ A;  1TRW A;  1KNG A;  2HRN A;  5IPG A;  4OO4 A;  5AGY A;  4E8E A;  4MF6 A;  3GKN A;  3Q19 A;  3TKP A;  2A4V A;  3BJ5 A;  5JCW A;  2PUK C;  2Z9S A;  1TI3 A;  4J56 E;  4G0K A;  4EDZ A;  3RDW A;  2H0H A;  1GRX A;  1XW5 A;  2MBT A;  4K5S A;  2YZH A;  2E7P A;  1TU7 A;  1U3A A;  4XRA A;  1GH2 A;  2WS2 A;  2AHE A;  4N30 A;  2OJL A;  4N0V A;  1X9M B;  2I9H A;  1WMJ A;  5ID2 B;  3ZFB A;  1TI1 A;  2R2J A;  2H70 A;  2YJ7 A;  4IQ1 A;  4WR5 A;  1IYH A;  3FYG A;  2B1K A;  6GSY A;  1JFU A;  4FYU A;  3VPQ A;  2FWG A;  4Q5N A;  3D0Z A;  1S3C A;  1XWK A;  2E0Q A;  4V2N A;  3Q74 A;  4BVY A;  1X0R A;  1S3R A;  1QMV A;  3I43 A;  2H6Z A;  1M0U A;  2H74 A;  4POL A;  1V40 A;  1F6M C;  4NHW A;  4YAP A;  3GV1 A;  5CAX A;  9GSS A;  2CA8 A;  1OC8 A;  4ECC A;  5B8B A;  4IGJ A;  2B1L A;  3D4T A;  4MK3 A;  2YV7 A;  3F4T A;  2GS3 A;  1SEN A;  1XOB A;  1FG4 A;  3APS A;  3L9U A;  4ZL9 A;  4MF7 A;  2WCI A;  4G2E A;  1EP8 A;  2V6O A;  4ULX A;  3GA4 A;  1GTB A;  4ZB6 A;  3F63 A;  5JWO B;  1MEK A;  4GRF A;  3H93 A;  5D96 A;  3FY7 A;  5KOW A;  2YWM A;  4K5R A;  4N0Z A;  5D9W A;  1ERU A;  2FA8 A;  1K0D A;  2BMX A;  4KSO A;  1JHB A;  2WZ9 A;  2LUS A;  5J4U A;  1MDI A;  2H71 A;  4USS A;  3ZL5 A;  2OE0 A;  1WWJ A;  5J5N A;  1CQH A;  2LJR A;  2H0I A;  4XIH A;  3H4K A;  4FH8 A;  3LWA A;  3DYR A;  4ZIJ A;  3LW9 A;  4MPG A;  2HRK A;  3ZFL A;  5JCG A;  5AN1 A;  3OR5 A;  2YWO A;  1PD2 1;  5DAL A;  2GGT A;  1XIY A;  1TRV A;  1PFO A;  4EC0 A;  1PL1 A;  2GTU A;  1SK1 A;  3TJF A;  4BWS A;  4A5P A;  1H75 A;  2KHP A;  1DBY A;  3L0H A;  2LTK A;  1A23 A;  1T7P B;  1ZZY A;  2F3M A;  2ON5 A;  4G10 A;  5ECH B;  2C0F A;  1A2J A;  2VLT A;  1R26 A;  2HLS A;  4QL7 A;  2V2G A;  4ZB8 A;  1Z7P A;  2O87 A;  1GUK A;  4TRX A;  2L57 A;  2DJK A;  4KDY A;  1GWC A;  4MP4 A;  3ED3 A;  4BVX B;  3TKR A;  1ERW A;  4DSQ A;  4YKG A;  5BRT A;  1OC9 B;  1RW1 A;  1M9B A;  4ISD A;  3TJK A;  2VCW A;  3UL3 A;  4WBR D;  3CQF A;  4XS1 A;  3EU4 A;  3LFL A;  4MJE A;  3N9J A;  1XWA A;  2PMT A;  1AW9 A;  1M2A A;  3FZ5 A;  2R0C A;  1XXU A;  4L5L A;  4ECI A;  4KCE A;  2LV3 A;  1R4W A;  1RQM A;  4X0X A;  12GS A;  1URM A;  3DVX A;  5D9X A;  4TOP A;  1OYJ A;  2IMK A;  3D6I A;  1OVN A;  2PGT A;  4K1F A;  3APO A;  4JZQ A;  2YWN A;  3FMW A;  1NM3 A;  2O7K A;  1MDJ A;  1N8J A;  2GDR A;  3E9J B;  1GTI A;  4IS0 A;  1VF2 A;  2GZP A;  3A3T A;  4ILF A;  2RUE A;  4K6X A;  4GSN A;  1T4Z A;  4KDU A;  1AQX A;  1U3I A;  2C0G A;  3CRT A;  2RLI A;  5IMF A;  1ABA A;  1T8E B;  1M2D A;  3LXZ A;  2B7K A;  5J9C A;  2CAQ A;  4IEL A; 
#chains in the Genus database with same CATH homology
 4AF2 A;  1SU9 A;  3VFI A;  1X9W B;  2JU5 A;  5HR0 A;  4GTU A;  3TDG A;  4HZ4 A;  4XHM A;  3HVS A;  2C3N A;  4KCA A;  2WRT A;  1GSQ A;  2AAW A;  3TJG A;  1AAZ A;  3GUR A;  5GSS A;  5ELA A;  3F6D A;  1B9X C;  1B8X A;  1MTC A;  1LBK A;  2HI7 A;  2YOI A;  4CY6 A;  1DSB A;  4HJ2 A;  3FR6 A;  1K0A A;  2H76 A;  1MDK A;  4IJ3 A;  3WT2 A;  1ZYE A;  2V6K A;  4CDO A;  2KUC A;  3ZYW A;  3TB2 A;  6GSV A;  1GSY A;  1GUL A;  2NDO A;  2K9F A;  3IAS 2;  1PMT A;  3LOR A;  2JSZ A;  3ZMK A;  5IPH A;  1NW2 A;  3GKK A;  2PPT A;  2EIQ A;  2LQO A;  3KXO A;  2YPM A;  1V98 A;  4ZBA A;  3HZ4 A;  4MDC A;  5GZZ B;  3F3R A;  4HEA 2;  2LNS A;  1MD4 A;  2XBI A;  3GHA A;  1XWB A;  4MZC A;  5EL8 A;  3P8W A;  4JBB A;  1PN9 A;  2F51 A;  2O89 A;  3VWX A;  1T3B A;  3GFK A;  2L5L A;  3WYW A;  3CXG A;  1JLV A;  4OFM A;  2VD0 A;  5G1L A;  2LRT A;  4O92 A;  1XCC A;  1BX9 A;  2HSM A;  2V41 A;  1V58 A;  1JZW A;  5CP1 A;  5IM9 A;  3TRX A;  2C3Q A;  3ZZX A;  3UVH A;  3VI5 A;  2LRC A;  3TOU A;  5IO2 A;  1ZYP A;  2FCH A;  3KCM A;  3J7Y b;  4Q5F A;  4IW9 A;  3QCP A;  4PX1 A;  5EVO A;  4L0W A;  1HD2 A;  4MAB A;  3KTL A;  3FZ4 A;  3A2V A;  1SD8 A;  5IOW A;  3EPT A;  2VCV A;  2GZZ A;  3US3 A;  1BED A;  4F82 A;  2TIR A;  1K0B A;  4ZBB A;  6GSS A;  3UBL A;  1O73 A;  1WRY A;  3IHQ A;  4NMU A;  4TN8 A;  2LNT A;  2LS5 A;  2DJ0 A;  4IKH A;  2HZE A;  4GWR A;  4HDE A;  2WB9 A;  2X99 A;  3HCZ A;  1O85 A;  3G9B A;  3VWU A;  11GS A;  4V1A g;  5G2Z A;  1XVW A;  2GT5 A;  1TW9 A;  1O7U A;  3Q6O A;  5HR1 A;  2QA1 A;  3JCM L;  3TCO A;  1QK8 A;  4TXO B;  5ECM B;  3M1G A;  4OD7 A;  2FA4 A;  1EOH A;  2LEG A;  4MJB A;  3CRU A;  4L5O A;  2VUP A;  5L71 A;  3F4S A;  4OWY A;  4O5R A;  1GTA A;  4KX4 A;  4ZXG A;  4RQR A;  8GSS A;  4K9Z A;  2NVL A;  5A4V A;  1HNC A;  4NPB A;  1SK2 A;  3C1S A;  2YZU A;  5IMV A;  1Z3E A;  4J2F A;  3IAM 2;  2UZ8 A;  2B7J A;  2K8V A;  3GRX A;  3LYK A;  3TUE A;  5IMD A;  3A2X A;  1BJX A;  1AXD A;  4DEJ A;  2DJ3 A;  4TR4 A;  4EIQ A;  1BG5 A;  3IOS A;  4MJA A;  4MZW A;  4ECJ A;  1F3A A;  2IJY A;  2IFQ A;  3FW2 A;  4K2X A;  2DIY A;  4X43 A;  2A2R A;  1Y6E A;  3TGZ A;  1VRS D;  1SJZ A;  2X8G A;  4Z2R A;  2HSH A;  2ON7 A;  5A4W A;  1X5C A;  1GUH A;  1YF1 A;  1GSF A;  1QFN A;  3M8N A;  1M2B A;  2A2S A;  4L8E A;  5IIZ A;  4EXJ A;  2RUF A;  2YJH A;  1TU8 A;  5IMZ A;  4IVF A;  5J3R A;  4PUR A;  3CSH A;  3ME7 A;  2P0G A;  3ZIJ A;  5INY A;  4E8H A;  3TKS A;  3QFB C;  4V1A p;  2MBS A;  3GN3 A;  5BMU A;  4KE3 A;  1R5A A;  2FWE A;  2AUV A;  1ZMA A;  2I3Y A;  4I5Q A;  3RBT A;  2YV9 A;  4EE0 A;  4XCS A;  2HE3 A;  3KP9 A;  5B7C A;  3WD6 A;  4DSR A;  4ZBD A;  1GLQ A;  1J08 A;  3EMX A;  2YN1 A;  2H6X A;  4TR1 A;  4MPF A;  4KUN A;  1ILO A;  2YNX A;  2WFC A;  1LU4 A;  2VCX A;  4K7O A;  2HZF A;  3FK8 A;  1QUW A;  2H8L A;  4GXZ A;  4MH3 A;  2XC2 A;  3IK9 A;  2R37 A;  4GCI A;  4WR4 A;  2ZNM A;  4WXT A;  3LYP A;  2G2Q A;  3E0U A;  3U6V A;  1G6Y A;  2DKH A;  4MMM A;  4XS4 A;  1UN2 A;  3BBY A;  2H01 A;  3KP8 A;  3PR8 A;  1UA5 A;  1Z9H A;  5DCH A;  3DKS A;  1SJI A;  3VWV A;  1SL0 B;  1SL1 B;  1WE0 A;  4GLT A;  5G1K A;  4O7H A;  2OE3 A;  3GNJ A;  3C73 A;  4AJ6 A;  1HYU A;  2JSY A;  5GST A;  3W8S A;  4OFT A;  2HRA A;  3NOF A;  4HQZ A;  2VLU A;  2VIM A;  3GL5 A;  1PQN A;  4YQV A;  3ERF A;  1AQW A;  1K0O A;  5DQY A;  2V1M A;  3P7X A;  5GAP D;  1G0T A;  4TR0 A;  4K0N A;  2HXK A;  1GSU A;  1SKR B;  3IBH A;  3FRC A;  4I6X A;  4L0U A;  2D2Z A;  4Q5R A;  4K2D A;  1N2A A;  3CYN A;  4XRD A;  2KOK A;  2JL4 A;  5J41 A;  1TJD A;  5IOX A;  2DJJ A;  1TK0 B;  5IO0 A;  3QPM A;  2J23 A;  5DCG A;  3HHV A;  2LQQ A;  1B9Y C;  1A2L A;  2FGX A;  4KA0 A;  1F2E A;  3KMO A;  3UMA A;  4EDY A;  4EKZ A;  2QC7 A;  1TTZ A;  1GNE A;  2C4J A;  3GTU B;  5IMC A;  5FT3 A;  4IQA A;  3TOT A;  4PUF C;  1PSQ A;  1V57 A;  3GKX A;  1J9B A;  4POK A;  5ABR A;  1J0F A;  3TRP A;  2L6D A;  2H0G A;  4GSS A;  5KN3 A;  1F37 A;  3A5I A;  4DVC A;  1G6W A;  4KF9 A;  3IK7 A;  3GH9 A;  4H86 A;  3I9V 2;  1T00 A;  3HDC A;  3MAK A;  4YAV A;  5HQP A;  2IME A;  3TKS C;  3F9U A;  2VO4 A;  1M99 A;  3DIE A;  4OCF A;  5H5S A;  5COH A;  5D93 A;  3GMF A;  3KIJ A;  2XBQ A;  2K18 A;  3ISO A;  3VI7 A;  4EF0 A;  3ZML A;  4K7N A;  1XBS A;  1T1V A;  2MMA A;  1EGR A;  1ZOF A;  2WUL A;  1YJ6 A;  10GS A;  3PH9 A;  3F6F A;  1EV9 A;  2E2M A;  4PXO A;  1AUC A;  1Z5Y E;  2J9H A;  3ZTL A;  3UJ1 A;  3NZN A;  3CTG A;  4V2M A;  5AIV A;  1Z6M A;  3GSS A;  4WBJ A;  3BCK A;  2PU9 C;  1KTE A;  5AIX A;  3TKS E;  1E6B A;  2ZUP A;  1O8X A;  5KOX A;  3CSJ A;  1S3A A;  5EY6 A;  3EWL A;  2H72 A;  4HZ2 A;  2TRX A;  2VL3 A;  5CRH A;  2FNO A;  6GST A;  2OBK A;  5GAN D;  1JZO A;  4YKF A;  5ENU A;  2R3X A;  2K6V A;  4WEY A;  1M7T A;  3GX8 A;  3A2W A;  3RPN A;  4ML6 A;  3G7J A;  3MWH A;  4GQC A;  3F8U A;  1SKS B;  2QKE A;  3G7Y A;  3HKR A;  2N5A A;  1MD3 A;  2CAI A;  4KH7 A;  1AQV A;  4HUA A;  3DRN A;  3LXT A;  2KP2 A;  5G5F A;  3IXR A;  3D4M A;  3HY2 A;  4LL1 B;  3UVT A;  2ZCT A;  1GTU A;  2B5Y A;  2FY6 A;  1R5P A;  5ELG A;  5ECO B;  4MNN A;  5DAK B;  1SYX A;  17GS A;  2H1G A;  1USB A;  1ST9 A;  6GSU A;  5F8B A;  4G0L A;  1XOA A;  2V32 A;  3P90 A;  4IP1 A;  1A0F A;  4RUV A;  1IYI A;  2P5Q A;  4MJC A;  2EIR A;  1GSD A;  4BVX A;  2DSA A;  4CHS A;  1SK0 A;  1ZGN A;  1A0R P;  2C0E A;  2OBI A;  2HT9 A;  1ZL9 A;  1NHO A;  3ZVJ A;  3HJO A;  2VM1 A;  2LRN A;  2PWJ A;  3O3T A;  2P31 A;  3QOU A;  4NWY A;  3AY8 A;  4BL7 B;  1K0N A;  4IJI A;  4X4J A;  3UEM A;  3H1N A;  1NHY A;  2RM5 A;  4DSS A;  1DE1 A;  4Z2T A;  2FWH A;  4TVE A;  3WT1 A;  3O76 A;  2N5B A;  3M9K A;  4WF4 A;  1XPV A;  1UC7 A;  3UIW A;  3UOM A;  3GH6 A;  1VF3 A;  4IN0 A;  2RII A;  2JZS A;  3GL3 A;  5B8A A;  2K8S A;  2OAD A;  2R4V A;  3RHC A;  1QQ2 A;  2MMZ A;  3MNG A;  2DLX A;  1B4P A;  1SKW B;  3DEX A;  3I69 A;  1ACV A;  1C72 A;  5ECK B;  4F0B A;  2TRC P;  5CNW A;  4F03 A;  2H75 A;  5G30 A;  1TOF A;  3HD5 A;  3FEU A;  1YEP A;  4I2T A;  1XVQ A;  2LJA A;  4NXI A;  3EE2 A;  4PQI A;  5LCZ A;  4POM A;  2AYT A;  5CRE A;  2YCD A;  3E3E A;  2IMI A;  3DXB A;  5ECL B;  2VCT A;  5D8I A;  3FR3 A;  3KJY A;  3MYD A;  3D22 A;  3U5R E;  4NV2 A;  1Z7R A;  2IL3 A;  3MDK A;  3C8E A;  3Q18 A;  4JR4 A;  4OMV A;  4LLR A;  5G31 A;  1DE2 A;  4J57 E;  3WGD A;  4KGI A;  1WPI A;  2EIO A;  3H79 A;  1GSE A;  4G9H A;  1W4V A;  1FOV A;  3UAR A;  4PUA A;  2IWT A;  5KN2 A;  3GX0 A;  3RHB A;  3IV4 A;  3GIX A;  5B6M A;  2L6C A;  1YY7 A;  4HOJ A;  2B5X A;  2F8A A;  3K8N A;  4RI6 A;  4Q5Q A;  5F06 A;  4ICY A;  5AIS A;  2WDU A;  4LMW A;  20GS A;  2PVQ A;  2WGR A;  3L4N A;  4FO5 A;  4FYC A;  4KND A;  2C0D A;  2GQK A;  3BOA A;  1GP1 A;  2FHE A;  2AB6 A;  1PKZ A;  3ZRE A;  1BQ7 A;  2MMN A;  2R6K A;  2QGV A;  5FHI A;  4JRR A;  4MA9 A;  1WOU A;  2OAC A;  2XHF A;  1BAY A;  2H66 A;  2DBC A;  5JCU A;  3TJJ A;  5DQS A;  1TK8 B;  1I5G A;  4Z7X A;  7GSS A;  4P3Y B;  4PGT A;  5ECI B;  4AJ7 A;  4BVY B;  4ZIL A;  4JED A;  2XPE A;  4FIW A;  3TJB A;  1TP9 A;  1ZCP A;  4AJ8 A;  4I8B A;  1SD9 A;  2GSQ A;  3IE3 A;  1U87 A;  4G0I A;  3IPZ A;  1Z6N A;  1TK5 B;  1THX A;  3KH9 A;  4OFN A;  5HFI A;  1QXH A;  3LJR A;  1EP7 A;  3I6A A;  6GSW A;  2PBJ A;  4HJM A;  4ZB9 A;  1F9M A;  2C1Y A;  5G5E A;  1PX6 A;  3D5J A;  4KB3 A;  2GVP A;  2R0P A;  3KGK A;  4LA1 A;  1YZX A;  5KN1 A;  1EEM A;  3WGE A;  3RPP A;  3UAP A;  2CT6 A;  1GLP A;  4JU5 A;  3C1R A;  22GS A;  1GNW A;  1NSW A;  3BD2 A;  1B4Q A;  3QMX A;  1RK4 A;  5IMA A;  1A24 A;  3TKQ A;  1W89 A;  2NTO A;  1OE7 A;  3EC3 A;  4KDX A;  4JE1 A;  2CQ9 A;  3FR9 A;  4TXO A;  3FKF A;  3ZRD A;  3L9V A;  5JWQ B;  2DKI A;  3C7M A;  2DMM A;  1BYE A;  2FUG 2;  1K3O A;  5DAL B;  4V2L A;  4K8M A;  3F0I A;  1KEB A;  4D73 A;  4IP6 A;  1GUM A;  4X1U A;  1CQG A;  3R2Q A;  2GT6 A;  3HXS A;  4EO3 A;  4MH2 A;  1EWX A;  2JAD A;  2JAC A;  1XW9 A;  2DIZ A;  1OKD A;  5CRG A;  1K3L A;  1FOH A;  5HFK A;  1E2Y A;  2VCQ A;  1PA3 A;  3LQ7 A;  3TRQ A;  1V2A A;  4ZL8 A;  2O8V B;  2F9S A;  4NAX A;  5LD0 A;  3WGX A;  3HYP A;  2YAN A;  2VLV A;  3M9J A;  1JZR A;  1DUG A;  2P5R A;  3MIX A;  5F05 A;  3MSZ A;  1TDI A;  4MZB A;  2IMD A;  4F2I A;  2AV4 A;  3APQ A;  5E59 A;  5F0G A;  2CVD A;  1T4Y A;  3HVX A;  2VCZ A;  1QGV A;  3VLN A;  2H1B A;  2DJ2 A;  2L4C A;  2VM2 A;  1OE8 A;  3ZIV A;  2HSY A;  3QFA C;  2GQM A;  2AJQ B;  4HU7 A;  1S3D A;  3KM6 A;  1O81 A;  1VF1 A;  3J7Y k;  3KTB A;  4N11 A;  5ECP B;  2B6M A;  1ZYN A;  1THO A;  1TKD B;  1Q98 A;  1PKW A;  3F4R A;  4ID0 A;  2GZY A;  3LGC A;  3HA9 A;  5B6N A;  4MF5 A;  4PTS A;  2FLS A;  3ZVJ D;  4F0C A;  1SYR A;  2MMO A;  1A8Y A;  2R5G A;  3FHK A;  3HJP A;  4N10 A;  4PQH A;  3H8Q A;  3LSZ A;  4YH2 A;  2NPB A;  2HRF A;  5LNK e;  3A5W A;  1FAA A;  2X4A A;  4JR6 A;  5H5R A;  5H5Q A;  1PGT A;  13GS A;  5CYY A;  3N5O A;  4PNG A;  2FD3 A;  5ID2 A;  3GUS A;  2LST A;  3IC4 A;  4AGS A;  3CTF A;  3DGQ A;  4POB A;  4QQ7 A;  3PIN A;  2FWF A;  5J9B A;  2A4H A;  2X8C A;  2CX3 A;  3VK9 A;  1ZYQ B;  4O32 A;  1U88 A;  1FVK A;  1EZK A;  1EV4 A;  2CV4 A;  4LMV A;  1A2M A;  2PER A;  1WIK A;  2ES7 A;  2L5O A;  1HNA A;  2WJU A;  4EUY A;  4BA7 A;  1A8L A;  1FW1 A;  3CMI A;  3M0F A;  4FQU A;  4ECB A;  3IR4 A;  1ERV A;  1X5D A;  3PPU A;  2VL2 A;  4G19 A;  1GSS A;  2RM6 A;  3EUR A;  2YWI A;  4YQU A;  4DSS B;  4O5U A;  1Y25 A;  2DML A;  2VD1 A;  2A2P A;  5CRD A;  1V9W A;  1K3Y A;  2IIY A;  4ACS A;  2X49 A;  3IC8 A;  3O6T A;  2NBS A;  4KAE A;  2QA2 A;  1FB0 A;  1FVJ A;  2H19 A;  2GSS A;  2CX4 A;  3IRA A;  2IPA A;  3EVI A;  3VPT A;  2JZR A;  19GS A;  3GTU A;  1PL2 A;  3ZIT A;  2N5F A;  3GKM A;  3S9F A;  4IBP A;  2LJK A;  5HFG A;  2I4A A;  3V1W A;  5ECR B;  3W8J A;  4TKY A;  5C00 A;  1WJK A;  4EL1 A;  2R0G A;  5ECN B;  2CVK A;  2KP1 A;  2F8F A;  2H73 A;  2VOC A;  2E2G A;  1R7H A;  3DD3 A;  2CZ3 A;  5JWR B;  2KLX A;  3ZLP A;  2CVB A;  4KSM A;  1WP0 A;  5DBQ A;  4WKW A;  3HZ8 A;  2ALB A;  1YKA A;  5F07 A;  1VF4 A;  2M46 A;  2HZE B;  2M72 A;  4TW5 A;  5A4U A;  1XW6 A;  3ERW A;  1OC9 A;  5DJL A;  5DDL A;  4LL4 B;  2L59 A;  4GQF A;  3UBK A;  4RI7 A;  4GF0 A;  3W6G A;  4KW6 A;  2QSI A;  1XWG A;  3IDV A;  2G0F A;  2X8H A;  1LJR A;  3NIV A;  5E4W A;  4ZL7 A;  4O5Q A;  1SL2 B;  3CBU A;  14GS A;  5A5K A;  2H6Y A;  2CZ2 A;  4I2U A;  2C8U A;  3GYK A;  1FB6 A;  1YF0 A;  1GL8 A;  1KBN A;  3F3Q A;  5D9V A;  1XWC A;  1YKC A;  3BCI A;  1X9S B;  1ON4 A;  3EU3 A;  5DVB A;  5KN0 A;  2DJ1 A;  1F3B A;  3DML A;  3L78 A;  3EMP A;  1JLW A;  2LKU A;  4XTS A;  1I9D A;  4PNF A;  4K0G A;  3LEF A;  2GST A;  3QD9 A;  3P2A A;  3EYT A;  3VWW A;  2O85 A;  3L9S A;  5CO3 A;  1U6T A;  5CRW A;  2VAF A;  1B48 A;  2C3T A;  2VL9 A;  5IQY A;  4BWQ A;  2I81 A;  2IFQ B;  3PGT A;  4EVM A;  2IN3 A;  1YDK A;  5HR2 A;  3IHG A;  2EC4 A;  1K0C A;  2VL2 C;  2BTO T;  1HQO A;  2H1D A;  1G7E A;  4RQX A;  1TXX A;  6GSX A;  1YQ1 A;  5DAK A;  1OC3 A;  3DWV A;  2H1A A;  2GQL A;  2REM A;  4EIP A;  5ECS A;  4HI7 A;  3D21 A;  4CY8 A;  3KZQ A;  3QAV A;  4GST A;  1Q4J A;  2H30 A;  1HNB A;  2B5E A;  2HNL A;  2PVO C;  5EPF A;  1EOG A;  2OE1 A;  3CSI A;  3RAZ A;  3SBC A;  2MZC A;  16GS A;  3KD0 A;  3KH7 A;  4BL7 A;  2B3S A;  1EGO A;  2OKA A;  1X5E A;  1AC1 A;  2BJX A;  3C71 A;  4OO5 A;  3FZA A;  3EIN A;  4HQS A;  1SJ6 A;  5FWG A;  1K0M A;  3R3E A;  4TR1 B;  3G7I A;  4FYB A;  2I1U A;  2X64 A;  2HYX A;  5D9T A;  3LG6 A;  1VGL A;  2PN8 A;  2HFD A;  3KEB A;  3VUR A;  4Z2U A;  1JZD A;  1FO5 A;  4XS4 B;  4XS6 A;  4D73 B;  1PRX A;  5C04 A;  3FZ9 A;  3QR6 A;  2IMF A;  4CW9 A;  2L4Q A;  4WET A;  1PN0 A;  1OAZ A;  2DC5 A;  4WF5 A;  3SWL A;  1UVZ A;  5ECQ B;  3KMN A;  1ML6 A;  1ERT A;  2M80 A;  4BPY A;  1XFL A;  4F9Z A;  2JZT A;  4MCU A;  4NHZ A;  3DVW A;  3HJM A;  3GST A;  4MLY A;  2GLR A;  4TR3 A;  3QAG A;  1TRU A;  1O8W A;  4NV5 A;  4ML1 A;  5D73 A;  4OCE A;  4HU9 A;  4K7I A;  1YEX A;  1O6J A;  2GSR A;  3ERG A;  4HS1 A;  5HR3 A;  5DJM A;  3QAW A;  1OKT A;  2C80 A;  5KEJ A;  4QL9 A;  1AIU A;  3HVV A;  1H4O A;  1G7O A;  1FHE A;  3ME8 A;  1M9A A;  3QDN A;  1TRS A;  2OA7 A;  4PQ1 A;  18GS A;  1PX7 A;  2YP6 A;  2MYG A;  3M3M A;  4I97 A;  4IHU A;  4YQM A;  2XPD A;  1XZO A;  3IA1 A;  4TXV A;  1EEJ A;  1TRW A;  1KNG A;  2HRN A;  5IPG A;  4OO4 A;  5AGY A;  4E8E A;  4MF6 A;  3GKN A;  3Q19 A;  3TKP A;  2A4V A;  3BJ5 A;  5JCW A;  2PUK C;  2Z9S A;  1TI3 A;  4J56 E;  4G0K A;  4EDZ A;  3RDW A;  2H0H A;  1GRX A;  1XW5 A;  2MBT A;  4K5S A;  2YZH A;  2E7P A;  1TU7 A;  1U3A A;  4XRA A;  1GH2 A;  2WS2 A;  2AHE A;  4N30 A;  2OJL A;  4N0V A;  1X9M B;  2I9H A;  1WMJ A;  5ID2 B;  3ZFB A;  1TI1 A;  2R2J A;  2H70 A;  2YJ7 A;  4IQ1 A;  4WR5 A;  1IYH A;  3FYG A;  2B1K A;  6GSY A;  1JFU A;  4FYU A;  3VPQ A;  2FWG A;  4Q5N A;  3D0Z A;  1S3C A;  1XWK A;  2E0Q A;  4V2N A;  3Q74 A;  4BVY A;  1X0R A;  1QMV A;  3I43 A;  2H6Z A;  1M0U A;  2H74 A;  4POL A;  1V40 A;  1F6M C;  4NHW A;  4YAP A;  3GV1 A;  5CAX A;  9GSS A;  2CA8 A;  1OC8 A;  4ECC A;  5B8B A;  4IGJ A;  2B1L A;  3D4T A;  4MK3 A;  2YV7 A;  3F4T A;  2GS3 A;  1SEN A;  1XOB A;  1FG4 A;  3APS A;  3L9U A;  4ZL9 A;  4MF7 A;  2WCI A;  4G2E A;  1EP8 A;  2V6O A;  4ULX A;  3GA4 A;  1GTB A;  4ZB6 A;  3F63 A;  5JWO B;  1MEK A;  4GRF A;  3H93 A;  5D96 A;  3FY7 A;  5KOW A;  2YWM A;  4K5R A;  4N0Z A;  5D9W A;  1ERU A;  2FA8 A;  1K0D A;  2BMX A;  4KSO A;  1JHB A;  2WZ9 A;  2LUS A;  5J4U A;  1MDI A;  2H71 A;  4USS A;  3ZL5 A;  2OE0 A;  1WWJ A;  5J5N A;  1CQH A;  2LJR A;  2H0I A;  4XIH A;  3H4K A;  4FH8 A;  3LWA A;  3DYR A;  4ZIJ A;  3LW9 A;  4MPG A;  2HRK A;  3ZFL A;  5JCG A;  5AN1 A;  3OR5 A;  2YWO A;  1PD2 1;  5DAL A;  2GGT A;  1XIY A;  1TRV A;  4EC0 A;  1PL1 A;  2GTU A;  1SK1 A;  3TJF A;  4BWS A;  4A5P A;  1H75 A;  2KHP A;  1DBY A;  3L0H A;  2LTK A;  1A23 A;  1T7P B;  1ZZY A;  2F3M A;  2ON5 A;  4G10 A;  5ECH B;  2C0F A;  1A2J A;  2VLT A;  1R26 A;  2HLS A;  4QL7 A;  2V2G A;  4ZB8 A;  1Z7P A;  2O87 A;  1GUK A;  4TRX A;  2L57 A;  2DJK A;  4KDY A;  1GWC A;  4MP4 A;  3ED3 A;  4BVX B;  3TKR A;  1ERW A;  4DSQ A;  4YKG A;  5BRT A;  1OC9 B;  1RW1 A;  1M9B A;  4ISD A;  3TJK A;  2VCW A;  3UL3 A;  4WBR D;  4XS1 A;  3EU4 A;  3LFL A;  4MJE A;  3N9J A;  1XWA A;  2PMT A;  1AW9 A;  1M2A A;  3FZ5 A;  2R0C A;  1XXU A;  4L5L A;  4ECI A;  4KCE A;  2LV3 A;  1R4W A;  1RQM A;  4X0X A;  12GS A;  1URM A;  3DVX A;  5D9X A;  4TOP A;  1OYJ A;  2IMK A;  3D6I A;  1OVN A;  2PGT A;  4K1F A;  3APO A;  4JZQ A;  2YWN A;  3FMW A;  1NM3 A;  2O7K A;  1MDJ A;  1N8J A;  2GDR A;  3E9J B;  1GTI A;  4IS0 A;  1VF2 A;  2GZP A;  3A3T A;  4ILF A;  2RUE A;  4K6X A;  4GSN A;  1T4Z A;  4KDU A;  1AQX A;  1U3I A;  2C0G A;  3CRT A;  2RLI A;  5IMF A;  1ABA A;  1T8E B;  1M2D A;  3LXZ A;  2B7K A;  5J9C A;  2CAQ A;  4IEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...