3GH9A

Crystal structure of edta-treated bdbd (oxidised)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
186
structure length
186
Chain Sequence
NDAVSGQPSIKGQPVLGKDDAPVTVVEFGDYKCPSCKVFNSDIFPKIQKDFIDKGDVKFSFVNVMFHGKGSRLAALASEEVWKEDPDSFWDFHEKLFEKQPDTEQEWVTPGLLGDLAKSTTKIKPETLKENLDKETFASQVEKDSDLNQKMNIQATPTIYVNDKVIKNFADYDEIKETIEKELKGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Disulfide bond formation protein D
publication title Crystal Structure and Biophysical Properties of Bacillus subtilis BdbD: AN OXIDIZING THIOL:DISULFIDE OXIDOREDUCTASE CONTAINING A NOVEL METAL SITE
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 76
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3gh9A00
5H5QA 1DUGA 3UBKA 2EIQA 2WCIA 4IP1A 3VK9A 4NAXA 2XPEA 5D96A 1IYIA 3IHQA 2H1GA 2HFDA 4XHMA 3D5JA 2FWFA 3QAGA 1OE8A 4ZB8A 1FVJA 4NHWA 3TRXA 1GSQA 2R6KA 2A2SA 3F4RA 1B48A 4NV2A 4K8MA 2JZSA 1I9DA 1AC1A 3C8EA 4L0WA 4JE1A 4I5QA 3D22A 1Z7PA 3M9JA 4HQZA 1Q98A 4ZL9A 3MSZA 5ECNB 2AYTA 3IAS2 3M9KA 3N5OA 1KTEA 2IPAA 3EWLA 4EF0A 1ACVA 1V2AA 4TR1A 2FNOA 1HQOA 1AQVA 3TKQA 4L5OA 1VF3A 1WMJA 2V1MA 2HRNA 4POKA 4XS4B 1DSBA 3M1GA 1PKWA 1GSYA 2CT6A 3RAZA 1YY7A 2GZYA 5F07A 4IVFA 1A23A 4ECIA 2XC2A 1FOVA 4PXOA 5IMVA 3G7YA 4N11A 1T00A 3DYRA 1GSSA 3FZAA 3WYWA 5ECLB 1GSFA 2DC5A 3I9V2 3APQA 1PMTA 3H1NA 2R2JA 2JADA 4EVMA 1GTBA 3KP9A 5GZZB 3VWXA 1TXXA 3L4NA 1EWXA 4KCEA 1LBKA 4BWQA 4ZBBA 3CXGA 2C1YA 5INYA 2CZ2A 4TVEA 2YP6A 4PUAA 1EOGA 5G31A 3BD2A 1X9SB 4H86A 4NHZA 3QAVA 3GA4A 1FB6A 2B5YA 4Q5FA 1NSWA 3LGCA 1S3AA 5ELAA 1TKDB 2WZ9A 1NHYA 1TRSA 3FR6A 4JBBA 3RBTA 2AHEA 3CYNA 1TK8B 2VCTA 4BVYA 2AUVA 2VCXA 3DWVA 3W8JA 3ZTLA 1PD21 4V1Ag 4MZBA 1K0DA 5A4UA 1JZWA 4IP6A 2H73A 2VM1A 2LS5A 3WGDA 3G9BA 4KW6A 1K3OA 3QR6A 1TP9A 4IELA 1YEXA 2WDUA 3M0FA 2VCVA 3VWWA 2HSHA 3CBUA 1A0FA 3FZ5A 2GTUA 3APSA 3FR9A 2JSYA 3W8SA 5GSSA 5G5EA 3IDVA 4GQCA 4J56E 1AAZA 4Q5RA 4JU5A 5G2ZA 3KTBA 1XIYA 1F6MC 1FO5A 3HDCA 6GSYA 1A24A 2QGVA 1BJXA 3HA9A 3HJOA 5EVOA 3TDGA 3TOUA 2B7KA 5IMFA 2LJKA 3ME7A 3GX8A 1EV4A 2LJRA 1F2EA 1NW2A 2WRTA 1TK0B 2G0FA 5CRDA 3PGTA 2HRFA 3CRUA 1GP1A 2KUCA 2LEGA 2MMNA 2QC7A 3C1SA 5JCUA 3HVSA 1QFNA 4IJ3A 2OBIA 1GTIA 3KM6A 3LG6A 2PERA 3UARA 5B6NA 4ILFA 3GTUA 1PGTA 1OC3A 2DJJA 3UBLA 4DSSA 3WT2A 2GSRA 2L57A 1X9WB 2CQ9A 3ZIVA 1XW9A 2IFQA 3F63A 2O8VB 1A2JA 3K8NA 3VI7A 2H6YA 4JEDA 3BJ5A 5D9TA 4D73A 1V57A 1TU8A 1K0AA 2YJHA 1GLQA 4NV5A 2B1KA 4GXZA 4JRRA 4ID0A 3L9SA 4HU7A 4BWSA 4ECJA 2DJKA 4YQMA 3F3QA 3ZITA 3ZYWA 3A2VA 3TJBA 5DAKA 4IGJA 2DMMA 3TB2A 3EINA 2IMDA 4MLYA 4K9ZA 4MDCA 2Z9SA 2VIMA 1PSQA 3HVVA 1MTCA 5CREA 4YAVA 5H5SA 1UC7A 5JCGA 5IO2A 4NWYA 2VM2A 2NTOA 4GWRA 1HNBA 1GUKA 1O8WA 5DJLA 1XCCA 2CV4A 4MF5A 1X5EA 1KNGA 2D2ZA 1T1VA 4MJAA 3QPMA 2V6KA 2ALBA 1UA5A 1V9WA 4KDXA 2KHPA 1SYXA 3J7Yk 4Q5NA 5J9CA 4POLA 1PRXA 2IIYA 1YZXA 1Z5YE 3ZLPA 2YCDA 3LWAA 3ISOA 1BX9A 4OFNA 5J41A 5JWOB 1CQHA 3IAM2 4IBPA 2H0IA 3QDNA 6GSVA 2MMAA 2CAQA 1M2DA 2GSQA 2PWJA 1PX6A 2FUG2 3EU4A 5H5RA 2YZUA 1EEJA 1ZOFA 2FLSA 4QL7A 1M99A 1QUWA 3QCPA 2H1AA 3LYPA 2ZNMA 4CW9A 3FZ9A 3KJYA 2B3SA 5KN2A 4OWYA 4F0CA 3IOSA 4OCEA 2P0GA 3KIJA 2FA4A 2H70A 1PN9A 2DIZA 4POMA 3U5RE 3HXSA 19GSA 3M3MA 4N0VA 1GSUA 4GSTA 1JHBA 1R26A 1QGVA 4NXIA 1B4PA 3KH9A 1E6BA 4HQSA 1AIUA 5D9WA 1SJZA 4HJMA 1O85A 3Q74A 5HFGA 3H4KA 5F8BA 1GUHA 5KN3A 5GSTA 3VI5A 3GTUB 4MH2A 4DSSB 1RK4A 4N10A 2JACA 3GFKA 1YKAA 2IFQB 3TKSE 3IXRA 2YV7A 3P90A 4MH3A 3UJ1A 1ZGNA 1VF2A 4D73B 2GSTA 1GSDA 2PVQA 1Z9HA 1KEBA 2YPMA 5IMCA 4MCUA 5IO0A 4HDEA 4E8HA 5DAKB 5G30A 1U3AA 5LNKe 4KE3A 4I2TA 4LLRA 4HI7A 5J9BA 3CTGA 5ECHB 2YZHA 4BL7A 3HCZA 1WP0A 3TUEA 1GTUA 6GSUA 1RW1A 2L4CA 5ECSA 1FHEA 4O92A 2H66A 1T7PB 1C72A 2B5XA 1XXUA 1N2AA 2HYXA 2YWMA 3FRCA 1QMVA 3LORA 3GL5A 3FKFA 3GMFA 1WOUA 1PL1A 4G2EA 1GNWA 5J5NA 3CSIA 3KMOA 5CRGA 3KH7A 3DVWA 2GT6A 4I6XA 2AB6A 1EOHA 4I8BA 3TRQA 3CSJA 2OA7A 2GDRA 3NZNA 2H71A 1X9MB 2IJYA 4DVCA 5CRHA 2IMFA 3HZ4A 3LXZA 1B4QA 3C73A 4IN0A 1EZKA 2WULA 3EYTA 1THXA 2WGRA 3HVXA 5EY6A 2X64A 5FT3A 8GSSA 2H1DA 2VL3A 2HZEA 3U6VA 13GSA 3CRTA 3IA1A 3UIWA 5ECRB 2REMA 4KH7A 4G9HA 2RUFA 4AF2A 1ZL9A 2X8HA 2H76A 3F9UA 2I9HA 1GLPA 2L5OA 2K9FA 4KGIA 1URMA 3RDWA 3LEFA 1PKZA 1M0UA 1VF1A 5KN0A 1G7EA 2XHFA 1T4YA 1B8XA 2C0DA 3FW2A 1ML6A 4KUNA 2A2RA 4KSOA 2DMLA 3GRXA 1I5GA 5ENUA 3TCOA 2FGXA 2HLSA 2GSSA 3HD5A 2ES7A 2DJ1A 2VD0A 1K0MA 2H01A 4IQAA 4XRDA 1SL2B 9GSSA 1GH2A 5EPFA 3TKSC 3UVTA 3KEBA 3J7Yb 3UOMA 1XVWA 1F3BA 4KDUA 3NOFA 5IIZA 3CTFA 1ILOA 1GTAA 4PQIA 1VF4A 4PNGA 4KCAA 1JFUA 5GAPD 3D6IA 2LRNA 3SBCA 2FWGA 4V1Ap 3DD3A 3APOA 1O6JA 4MA9A 1U3IA 2AAWA 2I81A 4YAPA 4X0XA 1G6YA 3M8NA 3EMPA 2OBKA 3QFAC 2K8VA 2NPBA 3H8QA 1TTZA 3DIEA 1O8XA 3BOAA 2RIIA 4E8EA 2VUPA 3ERGA 14GSA 1WJKA 2OKAA 2AV4A 1AW9A 1M9AA 3CMIA 2C0FA 1J08A 2H19A 2JZRA 2KP1A 4MF7A 1XWGA 4HOJA 1J9BA 4TKYA 4ZBAA 5IQYA 3GYKA 5ID2A 12GSA 4JR4A 5AIVA 2GT5A 4TXVA 2A4VA 2V41A 2PUKC 5IMZA 2CX4A 4XRAA 5E59A 2HI7A 2F8AA 1BYEA 3DXBA 4EO3A 5CP1A 4F03A 1WWJA 4WF4A 1THOA 3SWLA 3F4SA 4XS1A 2ZUPA 5ELGA 1KBNA 3ZREA 1E2YA 3IE3A 2L5LA 5DQYA 3ZFBA 2YWOA 6GSWA 4WKWA 4DSRA 2FWHA 1N8JA 2PN8A 1H75A 3L9UA 1FB0A 3FYGA 4ACSA 5CAXA 2KOKA 1UN2A 3W6GA 4WR5A 2PMTA 5LD0A 2VL9A 3HY2A 3VLNA 1NHOA 5B8AA 2LNSA 2K18A 4PQHA 5G1KA 3GHAA 5D8IA 4BVXA 4ZB9A 3GH9A 4K2DA 3V1WA 1R4WA 4I97A 3QD9A 1XVQA 3HJMA 3KXOA 5DALA 1Z3EA 4QQ7A 3VWUA 2CAIA 1M2BA 2FD3A 1PA3A 3TJJA 2GLRA 3QOUA 3C7MA 1XW6A 4AJ7A 1V58A 1GUMA 1O81A 3UL3A 5B8BA 2VL2C 4TR1B 5C00A 4BPYA 4EUYA 5DCGA 2C80A 2FY6A 2B7JA 3ZVJA 5E4WA 3FZ4A 4IKHA 3F8UA 1SKSB 2PPTA 1TK5B 2FA8A 3IBHA 5JWRB 4BA7A 5A4VA 3OR5A 1OYJA 2PVOC 2XBQA 3IV4A 3VPQA 2LSTA 4V2LA 3KMNA 2C0EA 2K8SA 3TJKA 4EDZA 2B5EA 4YQUA 3QMXA 1YQ1A 2H6ZA 4FO5A 3IK9A 1XWAA 1OKTA 4K1FA 1W4VA 4J2FA 1XWBA 3PINA 1VGLA 5HR2A 2RUEA 2HXKA 1JZOA 1TU7A 3G7IA 2VD1A 3EVIA 2HZFA 3E9JB 6GSTA 5ID2B 1FG4A 3FK8A 2V2GA 4AJ6A 3KP8A 3RHCA 3HKRA 2B1LA 2M72A 1LU4A 1TOFA 5HR1A 2JL4A 3TGZA 3LSZA 4LL4B 17GSA 1OVNA 4L0UA 1XZOA 4HS1A 1K0NA 1GNEA 4LA1A 20GSA 1Z6NA 2HE3A 2CVBA 3D4TA 1K0OA 3IK7A 3GKXA 3GL3A 2KLXA 2YOIA 4XIHA 1S3DA 1EGOA 2E2GA 4O32A 2K6VA 3WGXA 11GSA 2VAFA 2O87A 3LXTA 1TI3A 2E0QA 3ZMLA 1ABAA 2C4JA 1EP8A 3EE2A 4EE0A 5IOXA 4WBRD 1K0CA 1SYRA 3GKMA 1JLVA 2NVLA 1AQWA 6GSXA 1A8YA 2GZZA 2F51A 3GKKA 2YWIA 4MK3A 1HYUA 2OADA 2IWTA 5DALB 3TKSA 3GIXA 2DBCA 4FYBA 5COHA 2YWNA 5D93A 4HUAA 3NIVA 4HZ4A 1EV9A 2N5BA 4X1UA 4OD7A 4O7HA 1GULA 1TDIA 3GSTA 3H93A 1HNCA 2GQKA 3JCML 1ZYQB 5F0GA 4MJBA 3GKNA 1YEPA 2RLIA 2P5QA 3MDKA 3L78A 3G7JA 2O85A 1DE1A 2LRTA 4GSNA 3ZVJD 2OE3A 1YF0A 1ERUA 4GTUA 2N5AA 3FR3A 1G7OA 3UVHA 4G19A 5ECOB 4JZQA 1JZRA 2CA8A 4KAEA 2RM5A 2H74A 3FHKA 2FWEA 3VURA 2JZTA 1BG5A 2F8FA 2TRXA 2EIRA 3LQ7A 2CVDA 1YJ6A 4MABA 4GF0A 2F9SA 2CZ3A 1ZCPA 3HYPA 3O3TA 3GX0A 4PQ1A 5B7CA 2X8CA 4HZ2A 4TOPA 4O5RA 1OC9A 1USBA 3D21A 4TN8A 1GSEA 2QSIA 3GN3A 4IW9A 1FW1A 1HD2A 2H1BA 1K0BA 1YF1A 4MF6A 1QK8A 1X5DA 2EC4A 2OJLA 4K0GA 1EEMA 3EC3A 4FYCA 5IPGA 1SK0A 3I43A 3EURA 3Q6OA 1X0RA 5DVBA 3PH9A 1ZZYA 2E7PA 3C1RA 1TRWA 4K7IA 1U88A 4TR3A 4PGTA 4L8EA 5ECMB 4F82A 1OAZA 5KN1A 2H75A 3KTLA 4Q5QA 2H0GA 5G5FA 4K7NA 2L59A 1SL0B 3Q18A 4F2IA 3MAKA 3I6AA 3TJGA 3GNJA 4YQVA 1IYHA 3TKRA 2IL3A 4GQFA 1PL2A 3IPZA 4GLTA 2VCWA 1XOAA 1K3YA 1XWKA 2NBSA 5CNWA 3BCKA 3ZL5A 4POBA 3D0ZA 2VL2A 4Z7XA 2B6MA 4HJ2A 2BTOT 3DVXA 4ZILA 22GSA 1AUCA 1G6WA 3LJRA 3VPTA 2PBJA 3F3RA 2VLUA 5IMAA 4ISDA 1MD4A 1VRSD 3E3EA 4GSSA 5DJMA 1K3LA 4CHSA 3KGKA 4WR4A 3WT1A 1O73A 1SENA 2VLTA 3WD6A 3KD0A 2LKUA 4OCFA 1J0FA 4OFMA 1MDIA 3A5WA 2N5FA 3N9JA 4PURA 2XBIA 1M9BA 3F4TA 1PX7A 4LL1B 4IS0A 1F37A 2IMKA 5GAND 2HNLA 3HZ8A 3A2XA 2E2MA 5A4WA 2WJUA 5D9VA 5A5KA 2O89A 5IM9A 4ZIJA 2WB9A 3ZZXA 4N0ZA 5F06A 3C71A 3BBYA 2MYGA 1EP7A 1V98A 2DJ2A 4XS6A 3GUSA 4KX4A 4AJ8A 1BQ7A 2C0GA 4MZCA 2RM6A 3TOTA 1BAYA 3PR8A 5DQSA 2EIOA 1FVKA 1T3BA 2M80A 2J23A 3BCIA 1U6TA 1TI1A 2BJXA 2FHEA 2OE1A 2YN1A 4IJIA 4EDYA 2GZPA 4MPGA 4P3YB 3RPPA 2OACA 2R4VA 4KDYA 4LMWA 1OC9B 5F05A 1A0RP 1JZDA 4XTSA 2DSAA 4KNDA 5C04A 2I1UA 3UEMA 1W89A 3RPNA 3WGEA 5HFKA 1R5PA 1F3AA 1RQMA 5HR0A 4OFTA 4ML6A 4ZL7A 1OKDA 4TRXA 1SKRB 1X5CA 3UMAA 2L4QA 3VFIA 5D73A 2IMEA 5DDLA 4TR4A 2P5RA 2VCZA 3TKPA 2HZEB 1T4ZA 2H72A 2LV3A 1QQ2A 1ZYEA 5AISA 1WIKA 5DCHA 1ERVA 1SD8A 3F6FA 2V32A 1MEKA 4DEJA 2NDOA 3HHVA 4RQRA 1ERTA 1O7UA 3F6DA 2HT9A 4K0NA 4ECBA 4ML1A 2M46A 4WETA 2O7KA 1XPVA 1R5AA 2I4AA 4KSMA 4F0BA 5IMDA 7GSSA 3FEUA 1LJRA 3GV1A 1A2MA 4MJCA 3O6TA 3Q19A 2CVKA 2GQLA 4WXTA 1V40A 3TRPA 2C8UA 1JLWA 4N30A 1MDKA 3LYKA 2ON5A 3MNGA 2L6DA 5AN1A 4NPBA 5CRWA 4FH8A 3GURA 2DJ0A 1XW5A 3GSSA 3HJPA 6GSSA 1UVZA 1NM3A 1FAAA 1T8EB 4ZB6A 5AIXA 3QAWA 3UAPA 1Z7RA 4XCSA 4CDOA 3P8WA 2VCQA 1EGRA 2C3TA 2XPDA 3DRNA 2IN3A 4PUFC 2H0HA 5JWQB 2F3MA 2BMXA 3KCMA 2CX3A 3D4MA 2OE0A 4IQ1A 2AJQB 1SD9A 2IMIA 4G10A 2TRCP 4L5LA 3AY8A 2DIYA 2HSYA 2LQQA 2PU9C 1MD3A 2YV9A 2LTKA 1ERWA 2KP2A 4LMVA 5FHIA 4QL9A 1DBYA 4DSQA 3IC4A 4FYUA 5L71A 4TXOA 1R7HA 2QKEA 4ZL8A 16GSA 3S9FA 4KA0A 5D9XA 4RI7A 3DKSA 5HQPA 2LQOA 1B9XC 3KZQA 4HU9A 1SJ6A 5JCWA 4WEYA 3US3A 3P2AA 1B9YC 4ULXA 4EC0A 1XWCA 1AQXA 2J9HA 3A3TA 5HR3A 2GGTA 4MZWA 10GSA 3QFBC 3ZFLA 3ERWA 2MBTA 1F9MA 4KB3A 4NMUA 3ME8A 4GCIA 3VWVA 2JU5A 3EU3A 4X43A 1G0TA 1ON4A 4MMMA 1AXDA 1SK1A 1WE0A 2VOCA 2G2QA 2MMZA 4K6XA 3EMXA 2PGTA 18GSA 4ZBDA 1TW9A 2MMOA 2JSZA 4MP4A 5EL8A 4TR0A 2MZCA 2R5GA 1GRXA 2YJ7A 3IRAA 1M2AA 1GWCA 1OE7A 1S3CA 4IHUA 4MPFA 3A2WA 2P31A 3P7XA 1U87A 1Z6MA 2H6XA 2YANA 2DLXA 4ZXGA 1TJDA 2C3QA 1Y25A 5B6MA 3O76A 1DE2A 3LFLA 4F9ZA 1XOBA 1TRUA 4TW5A 2YNXA 5ECKB 1Y6EA 3L9VA 3TJFA 4WF5A 1TRVA 2R37A 4GRFA 2X99A 3DGQA 1XBSA 1GL8A 2DJ3A 4I2UA 4EXJA 2X8GA 2GVPA 3MWHA 4FIWA 5ECPB 4XS4A 4ECCA 1BEDA 4AGSA 2H30A 1SJIA 5CYYA 5FWGA 2R3XA 1SKWB 3IR4A 3I69A 4RQXA 5J4UA 2LJAA 2TIRA 3ZIJA 3RHBA 4RI6A 3DEXA 2WFCA 1ZMAA 5ECIB 1Q4JA 2H8LA 3E0UA 4MJEA 5AGYA 4PX1A 4V2MA 2ON7A 4V2NA 2L6CA 3ED3A 5CO3A 4YH2A 4EKZA 5DBQA 3F0IA 1OC8A 1A8LA 4EL1A 5J3RA 3ZRDA 3DMLA 2GS3A 3ERFA 4TXOB 2FCHA 3FY7A 1H4OA 3CSHA 3H79A 2VLVA 5KEJA 1M7TA 2C3NA 1YKCA 1WPIA 4OO4A 1A2LA 4RUVA 1SL1B 5ECQB 2LRCA 2V6OA 2WS2A 1WRYA 4HEA2 1CQGA 4K7OA 5LCZA 1PQNA 4J57E 5ABRA 1QXHA 3R2QA 1ST9A 3GH6A 5HFIA 2VO4A 5IPHA 4WBJA 2GQMA 1YDKA 4OO5A 2I3YA 1SU9A 2LNTA 5G1LA 1SK2A 2LUSA 3ZMKA 2MBSA 4OMVA 5IOWA 1MDJA 3L0HA 1XFLA 2ZCTA 4JR6A 1HNAA 4PNFA
chains in the Genus database with same CATH superfamily
5H5QA 1DUGA 3UBKA 2EIQA 2WCIA 4IP1A 3VK9A 4NAXA 2XPEA 5D96A 1IYIA 3IHQA 2H1GA 2HFDA 4XHMA 3D5JA 2FWFA 3QAGA 1OE8A 4ZB8A 1FVJA 4NHWA 3TRXA 1GSQA 2R6KA 4O5UA 2A2SA 3F4RA 1B48A 4NV2A 4K8MA 2JZSA 1I9DA 1AC1A 3C8EA 4L0WA 4JE1A 4I5QA 3D22A 1Z7PA 3M9JA 4HQZA 3FMWA 1Q98A 4ZL9A 3MSZA 5ECNB 2AYTA 3IAS2 3M9KA 3N5OA 1KTEA 2IPAA 3EWLA 4EF0A 1ACVA 1V2AA 4TR1A 2FNOA 1HQOA 1AQVA 3TKQA 4L5OA 1VF3A 1WMJA 2V1MA 2HRNA 4POKA 4XS4B 1DSBA 3M1GA 1PKWA 1GSYA 2CT6A 3RAZA 1YY7A 2GZYA 5F07A 4IVFA 1A23A 4ECIA 2XC2A 1FOVA 4PXOA 5IMVA 3G7YA 4N11A 1T00A 3CQFA 3DYRA 1GSSA 3FZAA 3WYWA 5ECLB 1GSFA 2DC5A 3I9V2 3APQA 1PMTA 3H1NA 2R2JA 2JADA 4EVMA 1GTBA 4YKGA 3KP9A 5GZZB 3VWXA 1TXXA 3L4NA 1EWXA 4KCEA 1LBKA 4BWQA 4ZBBA 3CXGA 2C1YA 5INYA 2CZ2A 4TVEA 2YP6A 4PUAA 1EOGA 5G31A 3BD2A 1X9SB 4H86A 4NHZA 3QAVA 3GA4A 1FB6A 2B5YA 4Q5FA 1NSWA 3LGCA 1S3AA 5ELAA 1TKDB 2WZ9A 1NHYA 1TRSA 3FR6A 4JBBA 3RBTA 2AHEA 3CYNA 1TK8B 2VCTA 4BVYA 2AUVA 2VCXA 3DWVA 3W8JA 3ZTLA 1PD21 4V1Ag 4MZBA 1K0DA 5A4UA 1JZWA 4IP6A 2H73A 2VM1A 2LS5A 4G0KA 3G9BA 3WGDA 4KW6A 2X49A 1K3OA 3QR6A 1TP9A 1S3RA 4IELA 1YEXA 2WDUA 3M0FA 2VCVA 3VWWA 2HSHA 3CBUA 2HSMA 1A0FA 3FZ5A 2GTUA 3APSA 3FR9A 2JSYA 3W8SA 5GSSA 5G5EA 3IDVA 4GQCA 4J56E 4CY8A 1AAZA 4Q5RA 4JU5A 5G2ZA 3KTBA 1XIYA 1F6MC 1FO5A 3HDCA 6GSYA 1A24A 2QGVA 1BJXA 3HA9A 3HJOA 5EVOA 3TDGA 3TOUA 2B7KA 5IMFA 2LJKA 3ME7A 3GX8A 2DKIA 1EV4A 2LJRA 1F2EA 1NW2A 2WRTA 1TK0B 2G0FA 5CRDA 3PGTA 2HRFA 3CRUA 1GP1A 2KUCA 2LEGA 2MMNA 2QC7A 3C1SA 5JCUA 3HVSA 1QFNA 4IJ3A 2OBIA 1GTIA 3KM6A 3LG6A 2PERA 3UARA 5B6NA 4ILFA 3GTUA 1PGTA 1OC3A 1XG8A 2DJJA 3UBLA 4DSSA 3WT2A 2GSRA 2L57A 1X9WB 2CQ9A 3ZIVA 1XW9A 2IFQA 3F63A 2O8VB 1A2JA 3K8NA 3VI7A 2H6YA 4JEDA 3BJ5A 5D9TA 4D73A 1V57A 1TU8A 1K0AA 2YJHA 1GLQA 4NV5A 2B1KA 4GXZA 4JRRA 4ID0A 3L9SA 4HU7A 4BWSA 4ECJA 2DJKA 4YQMA 3F3QA 3ZITA 4G0IA 3ZYWA 3A2VA 3TJBA 5DAKA 4IGJA 2DMMA 3TB2A 3EINA 2IMDA 4MLYA 4K9ZA 4MDCA 2Z9SA 2VIMA 1PSQA 3HVVA 1MTCA 4MNNA 5CREA 4YAVA 5H5SA 1UC7A 5JCGA 5IO2A 4NWYA 2VM2A 2NTOA 4GWRA 1HNBA 1GUKA 1O8WA 5DJLA 4G0LA 2DKHA 1XCCA 2CV4A 4MF5A 2UZ8A 1X5EA 1KNGA 2D2ZA 1T1VA 4MJAA 3QPMA 2V6KA 2ALBA 1UA5A 2R0GA 1V9WA 4BVYB 4KDXA 2KHPA 1SYXA 3J7Yk 4Q5NA 5J9CA 4POLA 1PRXA 2IIYA 1YZXA 1Z5YE 3ZLPA 2YCDA 3LWAA 3ISOA 1BX9A 4OFNA 5J41A 5JWOB 1CQHA 3IAM2 4IBPA 2H0IA 3QDNA 6GSVA 2MMAA 2CAQA 1M2DA 2GSQA 2PWJA 1PX6A 2FUG2 3EU4A 5H5RA 2YZUA 1EEJA 1ZOFA 2FLSA 4QL7A 1M99A 1QUWA 3QCPA 2H1AA 3LYPA 2ZNMA 4CW9A 3FZ9A 3KJYA 2B3SA 3IC8A 5KN2A 4OWYA 4F0CA 3IOSA 4OCEA 2P0GA 3KIJA 2FA4A 2H70A 1PN9A 2DIZA 4POMA 3U5RE 3HXSA 19GSA 4Z2RA 3M3MA 4N0VA 1GSUA 4GSTA 1JHBA 1R26A 1QGVA 4NXIA 1B4PA 3KH9A 1E6BA 4HQSA 1AIUA 5D9WA 1SJZA 4HJMA 1O85A 3Q74A 5HFGA 3H4KA 5F8BA 1GUHA 5KN3A 5GSTA 3VI5A 3GTUB 4MH2A 4DSSB 1RK4A 4USSA 4N10A 2JACA 3GFKA 1YKAA 2IFQB 3TKSE 3IXRA 2YV7A 3P90A 4MH3A 3UJ1A 1ZGNA 1VF2A 4D73B 2GSTA 1GSDA 2PVQA 1Z9HA 1KEBA 2YPMA 5IMCA 4MCUA 4Z2TA 5IO0A 4HDEA 4E8HA 5DAKB 5G30A 4O5QA 1U3AA 5LNKe 4KE3A 4I2TA 4LLRA 4HI7A 5J9BA 3CTGA 5ECHB 2YZHA 4BL7A 3HCZA 1WP0A 3TUEA 1GTUA 6GSUA 1RW1A 2L4CA 3PPUA 5ECSA 1FHEA 4O92A 2H66A 1T7PB 1C72A 2B5XA 1XXUA 1N2AA 2HYXA 2YWMA 3FRCA 1QMVA 3LORA 3GL5A 3FKFA 3GMFA 1WOUA 1PL1A 4G2EA 1GNWA 5J5NA 3CSIA 3KMOA 5CRGA 3KH7A 3DVWA 2GT6A 4I6XA 2AB6A 1EOHA 4I8BA 3TRQA 3CSJA 2OA7A 2GDRA 3NZNA 2H71A 1X9MB 2IJYA 1PFOA 4DVCA 5CRHA 2IMFA 3HZ4A 3LXZA 1B4QA 3C73A 4IN0A 1EZKA 2WULA 3EYTA 1THXA 2WGRA 3HVXA 5EY6A 2X64A 5FT3A 8GSSA 2H1DA 2VL3A 2HZEA 3U6VA 13GSA 3CRTA 3IA1A 3UIWA 5ECRB 2REMA 4KH7A 4G9HA 2RUFA 4AF2A 1ZL9A 2X8HA 2H76A 3F9UA 3LW9A 2I9HA 1GLPA 2L5OA 2K9FA 4KGIA 1URMA 3RDWA 3LEFA 1PKZA 1M0UA 1VF1A 5KN0A 1G7EA 2XHFA 1T4YA 1B8XA 2C0DA 3FW2A 1ML6A 4KUNA 2A2RA 4KSOA 2DMLA 3GRXA 1I5GA 5ENUA 3TCOA 2FGXA 2HLSA 2GSSA 3HD5A 2ES7A 2DJ1A 2VD0A 1K0MA 2H01A 4IQAA 4XRDA 1SL2B 9GSSA 1GH2A 5EPFA 3TKSC 3UVTA 5KOWA 3KEBA 3J7Yb 3UOMA 1XVWA 1F3BA 4KDUA 3NOFA 5IIZA 3CTFA 1ILOA 1GTAA 4PQIA 1VF4A 4PNGA 4KCAA 1JFUA 5GAPD 3D6IA 2LRNA 3SBCA 2FWGA 4V1Ap 3DD3A 3APOA 1O6JA 4MA9A 1U3IA 2AAWA 2I81A 4YAPA 4X0XA 1G6YA 3M8NA 3EMPA 2OBKA 3QFAC 2K8VA 2NPBA 3H8QA 1TTZA 3DIEA 1O8XA 3BOAA 2RIIA 4E8EA 2VUPA 3ERGA 14GSA 3IHGA 1WJKA 2OKAA 2AV4A 1AW9A 1M9AA 3CMIA 2C0FA 1J08A 2H19A 2JZRA 2KP1A 4MF7A 1XWGA 4HOJA 1J9BA 4TKYA 4ZBAA 5IQYA 3GYKA 5ID2A 12GSA 4JR4A 4EIPA 5AIVA 2GT5A 4TXVA 2A4VA 2V41A 2PUKC 5IMZA 2CX4A 4XRAA 5E59A 2HI7A 2F8AA 1BYEA 3DXBA 4EO3A 5CP1A 4F03A 1WWJA 4WF4A 1THOA 3SWLA 3F4SA 4XS1A 2ZUPA 5ELGA 1KBNA 3ZREA 1E2YA 3IE3A 2L5LA 1FOHA 5DQYA 3ZFBA 2YWOA 6GSWA 4WKWA 4DSRA 2FWHA 1N8JA 2PN8A 3R3EA 1H75A 3L9UA 1FB0A 3FYGA 4ACSA 5CAXA 2KOKA 1UN2A 3W6GA 4WR5A 2PMTA 5LD0A 2VL9A 3HY2A 3VLNA 1NHOA 5B8AA 2LNSA 2K18A 4PQHA 5G1KA 3GHAA 5D8IA 4BVXA 4ZB9A 3GH9A 4K2DA 3V1WA 1R4WA 4I97A 3QD9A 1XVQA 3HJMA 3KXOA 5DALA 1Z3EA 4ICYA 4QQ7A 3VWUA 2CAIA 1M2BA 2FD3A 1PA3A 3TJJA 2GLRA 3QOUA 3C7MA 1XW6A 4AJ7A 1V58A 1GUMA 1O81A 3UL3A 5B8BA 2VL2C 4TR1B 5C00A 4BPYA 4EUYA 5DCGA 2C80A 2FY6A 2B7JA 3ZVJA 5E4WA 3FZ4A 4IKHA 3F8UA 1SKSB 2PPTA 1TK5B 2FA8A 3IBHA 5JWRB 4BA7A 5A4VA 3OR5A 1OYJA 2PVOC 2XBQA 3IV4A 3VPQA 2LSTA 4V2LA 3KMNA 2C0EA 2K8SA 3TJKA 4EDZA 2B5EA 4YQUA 3QMXA 1YQ1A 2H6ZA 4FO5A 3IK9A 1XWAA 1OKTA 4K1FA 1W4VA 4J2FA 1XWBA 1ZYNA 3PINA 1VGLA 5HR2A 2RUEA 2HXKA 1JZOA 1TU7A 3G7IA 2VD1A 3EVIA 2HZFA 3E9JB 6GSTA 4CY6A 5ID2B 1FG4A 3FK8A 2V2GA 4AJ6A 3KP8A 3RHCA 3HKRA 2B1LA 2M72A 1LU4A 1TOFA 5HR1A 2JL4A 3TGZA 3LSZA 4LL4B 17GSA 1OVNA 4L0UA 1XZOA 2A4HA 4HS1A 1K0NA 1GNEA 4LA1A 20GSA 1Z6NA 2HE3A 2CVBA 3D4TA 1K0OA 3IK7A 3GKXA 3GL3A 2KLXA 2YOIA 4XIHA 1S3DA 1EGOA 2E2GA 4O32A 1M3JA 2K6VA 3WGXA 11GSA 2VAFA 2O87A 3LXTA 1TI3A 2E0QA 3ZMLA 1ABAA 2C4JA 1EP8A 3EE2A 4EE0A 5IOXA 4WBRD 1K0CA 1SYRA 4BVXB 3GKMA 1JLVA 2NVLA 1AQWA 6GSXA 1A8YA 2GZZA 2F51A 3GKKA 2YWIA 4MK3A 1HYUA 2OADA 2IWTA 5DALB 3TKSA 3GIXA 2DBCA 4K2XA 4FYBA 5COHA 2YWNA 5D93A 4HUAA 5BRTA 3NIVA 4HZ4A 1EV9A 2N5BA 4X1UA 4OD7A 4O7HA 1GULA 1TDIA 3GSTA 3H93A 1HNCA 2GQKA 3JCML 1ZYQB 4A5PA 5F0GA 4MJBA 3GKNA 1YEPA 2RLIA 2P5QA 3MDKA 3L78A 3G7JA 2O85A 1DE1A 2LRTA 4GSNA 3ZVJD 2OE3A 1YF0A 1ERUA 4GTUA 2N5AA 3FR3A 1G7OA 3UVHA 4G19A 5ECOB 4JZQA 1JZRA 2CA8A 3MIXA 4KAEA 2RM5A 2R0CA 2H74A 3FHKA 2FWEA 3VURA 2JZTA 1BG5A 2F8FA 2TRXA 2EIRA 1ZYPA 3LQ7A 2CVDA 1YJ6A 4MABA 4GF0A 2F9SA 2CZ3A 1ZCPA 2A2PA 3HYPA 3O3TA 3GX0A 4PQ1A 5B7CA 2X8CA 4HZ2A 4PTSA 4TOPA 4O5RA 1OC9A 1USBA 4KF9A 3D21A 4TN8A 1GSEA 2QSIA 3GN3A 4IW9A 1FW1A 1HD2A 2H1BA 1K0BA 1YF1A 4MF6A 1QK8A 1X5DA 2EC4A 2OJLA 4K0GA 1EEMA 3EC3A 4FYCA 5IPGA 1SK0A 3I43A 3EURA 3Q6OA 1X0RA 5DVBA 3PH9A 1ZZYA 2E7PA 3C1RA 1TRWA 4K7IA 1U88A 4TR3A 4PGTA 4L8EA 5ECMB 4F82A 1OAZA 5KN1A 2H75A 3KTLA 4Q5QA 2H0GA 5G5FA 4K7NA 2L59A 1SL0B 3Q18A 2QA2A 4F2IA 3MAKA 3I6AA 3TJGA 3GNJA 4YQVA 1IYHA 3TKRA 2IL3A 4GQFA 1PL2A 3IPZA 4GLTA 5BMUA 2VCWA 1XOAA 1K3YA 1XWKA 2NBSA 5CNWA 3BCKA 3ZL5A 4POBA 3D0ZA 2VL2A 4Z7XA 2B6MA 4HJ2A 2BTOT 3DVXA 4ZILA 22GSA 1AUCA 1G6WA 3LJRA 3VPTA 2PBJA 3EPTA 3F3RA 2VLUA 5IMAA 4ISDA 1MD4A 1VRSD 3E3EA 4GSSA 5DJMA 1K3LA 4Z2UA 4CHSA 3KGKA 4WR4A 3WT1A 1O73A 1SENA 5KOXA 2VLTA 3WD6A 3KD0A 2LKUA 4OCFA 1J0FA 4OFMA 1MDIA 3A5WA 3N9JA 2N5FA 4PURA 4FQUA 2XBIA 1M9BA 3F4TA 1PX7A 4LL1B 4IS0A 1F37A 2IMKA 5GAND 2HNLA 3HZ8A 3A2XA 2E2MA 5A4WA 2WJUA 5D9VA 5A5KA 2O89A 5IM9A 2QA1A 4ZIJA 2WB9A 3ZZXA 4N0ZA 5F06A 3C71A 3BBYA 2MYGA 1EP7A 1V98A 2DJ2A 4XS6A 3GUSA 4KX4A 4AJ8A 1BQ7A 2C0GA 4MZCA 2RM6A 3TOTA 1BAYA 3PR8A 5DQSA 2EIOA 1FVKA 1T3BA 2M80A 2J23A 3BCIA 1U6TA 4BL7B 1TI1A 2BJXA 2FHEA 2OE1A 2YN1A 4IJIA 4EDYA 2GZPA 4MPGA 4P3YB 3RPPA 2OACA 2R4VA 4KDYA 4LMWA 1OC9B 5F05A 1A0RP 1JZDA 4XTSA 4K5RA 2DSAA 4KNDA 5C04A 2I1UA 3UEMA 1W89A 3RPNA 3WGEA 4YKFA 5HFKA 1R5PA 1F3AA 1RQMA 5HR0A 4OFTA 4ML6A 4ZL7A 1OKDA 4TRXA 1SKRB 1X5CA 3UMAA 2L4QA 3VFIA 5D73A 2IMEA 5DDLA 4TR4A 2P5RA 2VCZA 3TKPA 2HZEB 1T4ZA 2H72A 2LV3A 1QQ2A 1ZYEA 5AISA 1WIKA 5DCHA 1ERVA 1SD8A 3F6FA 2V32A 1MEKA 4DEJA 2NDOA 3HHVA 4RQRA 1ERTA 1O7UA 3F6DA 2HT9A 4K0NA 4ECBA 4ML1A 2M46A 4WETA 2O7KA 1XPVA 1R5AA 2I4AA 4KSMA 4F0BA 5IMDA 7GSSA 3FEUA 1LJRA 3GV1A 1A2MA 4MJCA 3O6TA 3Q19A 2CVKA 2GQLA 4WXTA 1V40A 3TRPA 2C8UA 1JLWA 4N30A 1MDKA 4X4JA 3LYKA 2ON5A 3MNGA 2L6DA 5AN1A 4NPBA 5CRWA 4FH8A 3GURA 2DJ0A 1XW5A 3GSSA 3HJPA 6GSSA 2R0PA 1UVZA 1NM3A 1FAAA 1T8EB 4ZB6A 5AIXA 3QAWA 3UAPA 1Z7RA 4XCSA 4CDOA 1PN0A 3P8WA 2VCQA 1EGRA 2C3TA 2XPDA 3DRNA 2IN3A 4K5SA 4PUFC 2H0HA 5JWQB 2F3MA 2BMXA 3KCMA 2CX3A 3D4MA 2OE0A 4IQ1A 2AJQB 1SD9A 2IMIA 4G10A 2TRCP 4L5LA 3AY8A 2DIYA 2HSYA 2LQQA 2PU9C 1MD3A 2YV9A 2LTKA 1ERWA 2KP2A 4LMVA 5FHIA 4QL9A 1DBYA 4DSQA 3IC4A 4FYUA 5L71A 4TXOA 1R7HA 2QKEA 4ZL8A 16GSA 3S9FA 2HRKA 4KA0A 5D9XA 4RI7A 3DKSA 5HQPA 2LQOA 1B9XC 3KZQA 4HU9A 1SJ6A 5JCWA 4WEYA 3US3A 3P2AA 1B9YC 4ULXA 4EC0A 1XWCA 3MYDA 1AQXA 2J9HA 3A3TA 5HR3A 2GGTA 4MZWA 10GSA 3QFBC 3ZFLA 3ERWA 2MBTA 1F9MA 4KB3A 4NMUA 3ME8A 4GCIA 3VWVA 2JU5A 3EU3A 4X43A 1G0TA 1ON4A 4MMMA 1AXDA 1SK1A 1WE0A 2VOCA 2G2QA 2MMZA 4K6XA 3EMXA 2PGTA 18GSA 4ZBDA 1TW9A 2MMOA 2JSZA 4MP4A 5EL8A 4BIKA 4TR0A 2MZCA 2R5GA 1GRXA 2YJ7A 3IRAA 1M2AA 1GWCA 1OE7A 1S3CA 4IHUA 4MPFA 3A2WA 2P31A 3P7XA 1U87A 1Z6MA 2H6XA 2YANA 2DLXA 4ZXGA 1TJDA 2C3QA 1Y25A 5B6MA 3O76A 1DE2A 3LFLA 4F9ZA 1XOBA 1TRUA 4TW5A 2YNXA 5ECKB 1Y6EA 3L9VA 3TJFA 4WF5A 1TRVA 2R37A 4GRFA 2X99A 3DGQA 1XBSA 1GL8A 2DJ3A 4I2UA 4EXJA 2X8GA 2GVPA 3MWHA 4FIWA 5ECPB 4XS4A 4ECCA 1BEDA 4AGSA 2H30A 1SJIA 5CYYA 5FWGA 2R3XA 1SKWB 3IR4A 3I69A 4RQXA 5J4UA 2LJAA 2TIRA 3ZIJA 4EIQA 3RHBA 4RI6A 3DEXA 2WFCA 1ZMAA 5ECIB 1Q4JA 2H8LA 3E0UA 4MJEA 5AGYA 4PX1A 4V2MA 2ON7A 4V2NA 2L6CA 3ED3A 1M3IA 5CO3A 4YH2A 4EKZA 5DBQA 3F0IA 1OC8A 1A8LA 4EL1A 5J3RA 3ZRDA 3DMLA 2GS3A 3ERFA 4TXOB 2FCHA 3FY7A 1H4OA 3CSHA 3H79A 2VLVA 5KEJA 1M7TA 2HRAA 2C3NA 1YKCA 1WPIA 4OO4A 1A2LA 4RUVA 1SL1B 5ECQB 2LRCA 2V6OA 2WS2A 1WRYA 4HEA2 1CQGA 4K7OA 5LCZA 1PQNA 4J57E 5ABRA 1QXHA 3HVNA 3R2QA 1ST9A 3GH6A 5HFIA 2VO4A 5IPHA 4WBJA 2GQMA 4HSCX 1YDKA 4OO5A 2I3YA 1SU9A 2LNTA 5G1LA 1SK2A 2LUSA 3ZMKA 2MBSA 4OMVA 5IOWA 2X4AA 1MDJA 3L0HA 1XFLA 2ZCTA 4JR6A 3A5IA 1HNAA 4PNFA
chains in the Genus database with same CATH topology
5H5QA 1DUGA 3UBKA 2EIQA 2WCIA 4IP1A 3VK9A 4NAXA 2XPEA 5D96A 1IYIA 3IHQA 2H1GA 2HFDA 4XHMA 3D5JA 2FWFA 3QAGA 1OE8A 4ZB8A 1FVJA 4NHWA 3TRXA 1GSQA 2R6KA 4O5UA 2A2SA 3F4RA 1B48A 4NV2A 4K8MA 2JZSA 1I9DA 1AC1A 3C8EA 4L0WA 4JE1A 4I5QA 3D22A 1Z7PA 3M9JA 4HQZA 3FMWA 1Q98A 4ZL9A 3MSZA 5ECNB 2AYTA 3IAS2 3M9KA 3N5OA 1KTEA 2IPAA 3EWLA 4EF0A 1ACVA 1V2AA 4TR1A 2FNOA 1HQOA 1AQVA 3TKQA 4L5OA 1VF3A 1WMJA 2V1MA 2HRNA 4POKA 4XS4B 1DSBA 3M1GA 1PKWA 1GSYA 2CT6A 3RAZA 1YY7A 2GZYA 5F07A 4IVFA 1A23A 4ECIA 2XC2A 1FOVA 4PXOA 5IMVA 3G7YA 4N11A 1T00A 3DYRA 1GSSA 3FZAA 3WYWA 5ECLB 1GSFA 2DC5A 3I9V2 3APQA 1PMTA 3H1NA 2R2JA 2JADA 4EVMA 1GTBA 4YKGA 3KP9A 5GZZB 3VWXA 1TXXA 3L4NA 1EWXA 4KCEA 1LBKA 4BWQA 4ZBBA 3CXGA 2C1YA 5INYA 2CZ2A 4TVEA 2YP6A 4PUAA 1EOGA 5G31A 3BD2A 1X9SB 4H86A 4NHZA 3QAVA 3GA4A 1FB6A 2B5YA 4Q5FA 1NSWA 3LGCA 1S3AA 5ELAA 1TKDB 2WZ9A 1NHYA 1TRSA 3FR6A 4JBBA 3RBTA 2AHEA 3CYNA 1TK8B 2VCTA 4BVYA 2AUVA 2VCXA 3DWVA 3W8JA 3ZTLA 1PD21 4V1Ag 4MZBA 1K0DA 5A4UA 1JZWA 4IP6A 2H73A 2VM1A 2LS5A 4G0KA 3G9BA 3WGDA 4KW6A 2X49A 1K3OA 3QR6A 1TP9A 4IELA 1YEXA 2WDUA 3M0FA 2VCVA 3VWWA 2HSHA 3CBUA 2HSMA 1A0FA 3FZ5A 2GTUA 3APSA 3FR9A 2JSYA 3W8SA 5GSSA 5G5EA 3IDVA 4GQCA 4J56E 4CY8A 1AAZA 4Q5RA 4JU5A 5G2ZA 3KTBA 1XIYA 1F6MC 1FO5A 3HDCA 6GSYA 1A24A 2QGVA 1BJXA 3HA9A 3HJOA 5EVOA 3TDGA 3TOUA 2B7KA 5IMFA 2LJKA 3ME7A 3GX8A 2DKIA 1EV4A 2LJRA 1F2EA 1NW2A 2WRTA 1TK0B 2G0FA 5CRDA 3PGTA 2HRFA 3CRUA 1GP1A 2KUCA 2LEGA 2MMNA 2QC7A 3C1SA 5JCUA 3HVSA 1QFNA 4IJ3A 2OBIA 1GTIA 3KM6A 3LG6A 2PERA 3UARA 5B6NA 4ILFA 3GTUA 1PGTA 1OC3A 2DJJA 3UBLA 4DSSA 3WT2A 2GSRA 2L57A 1X9WB 2CQ9A 3ZIVA 1XW9A 2IFQA 3F63A 2O8VB 1A2JA 3K8NA 3VI7A 2H6YA 4JEDA 3BJ5A 5D9TA 4D73A 1V57A 1TU8A 1K0AA 2YJHA 1GLQA 4NV5A 2B1KA 4GXZA 4JRRA 4ID0A 3L9SA 4HU7A 4BWSA 4ECJA 2DJKA 4YQMA 3F3QA 3ZITA 4G0IA 3ZYWA 3A2VA 3TJBA 5DAKA 4IGJA 2DMMA 3TB2A 3EINA 2IMDA 4MLYA 4K9ZA 4MDCA 2Z9SA 2VIMA 1PSQA 3HVVA 1MTCA 4MNNA 5CREA 4YAVA 5H5SA 1UC7A 5JCGA 5IO2A 4NWYA 2VM2A 2NTOA 4GWRA 1HNBA 1GUKA 1O8WA 5DJLA 4G0LA 2DKHA 1XCCA 2CV4A 4MF5A 2UZ8A 1X5EA 1KNGA 2D2ZA 1T1VA 4MJAA 3QPMA 2V6KA 2ALBA 1UA5A 2R0GA 1V9WA 4BVYB 4KDXA 2KHPA 1SYXA 3J7Yk 4Q5NA 5J9CA 4POLA 1PRXA 2IIYA 1YZXA 1Z5YE 3ZLPA 2YCDA 3LWAA 3ISOA 1BX9A 4OFNA 5J41A 5JWOB 1CQHA 3IAM2 4IBPA 2H0IA 3QDNA 6GSVA 2MMAA 2CAQA 1M2DA 2GSQA 2PWJA 1PX6A 2FUG2 3EU4A 5H5RA 2YZUA 1EEJA 1ZOFA 2FLSA 4QL7A 1M99A 1QUWA 3QCPA 2H1AA 3LYPA 2ZNMA 4CW9A 3FZ9A 3KJYA 2B3SA 3IC8A 5KN2A 4OWYA 4F0CA 3IOSA 4OCEA 2P0GA 3KIJA 2FA4A 2H70A 1PN9A 2DIZA 4POMA 3U5RE 3HXSA 19GSA 4Z2RA 3M3MA 4N0VA 1GSUA 4GSTA 1JHBA 1R26A 1QGVA 4NXIA 1B4PA 3KH9A 1E6BA 4HQSA 1AIUA 5D9WA 1SJZA 4HJMA 1O85A 3Q74A 5HFGA 3H4KA 5F8BA 1GUHA 5KN3A 5GSTA 3VI5A 3GTUB 4MH2A 4DSSB 1RK4A 4USSA 4N10A 2JACA 3GFKA 1YKAA 2IFQB 3TKSE 3IXRA 2YV7A 3P90A 4MH3A 3UJ1A 1ZGNA 1VF2A 4D73B 2GSTA 1GSDA 2PVQA 1Z9HA 1KEBA 2YPMA 5IMCA 4MCUA 4Z2TA 5IO0A 4HDEA 4E8HA 5DAKB 5G30A 4O5QA 1U3AA 5LNKe 4KE3A 4I2TA 4LLRA 4HI7A 5J9BA 3CTGA 5ECHB 2YZHA 4BL7A 3HCZA 1WP0A 3TUEA 1GTUA 6GSUA 1RW1A 2L4CA 3PPUA 5ECSA 1FHEA 4O92A 2H66A 1T7PB 1C72A 2B5XA 1XXUA 1N2AA 2HYXA 2YWMA 3FRCA 1QMVA 3LORA 3GL5A 3FKFA 3GMFA 1WOUA 1PL1A 4G2EA 1GNWA 5J5NA 3CSIA 3KMOA 5CRGA 3KH7A 3DVWA 2GT6A 4I6XA 2AB6A 1EOHA 4I8BA 3TRQA 3CSJA 2OA7A 2GDRA 3NZNA 2H71A 1X9MB 2IJYA 4DVCA 5CRHA 2IMFA 3HZ4A 3LXZA 1B4QA 3C73A 4IN0A 1EZKA 2WULA 3EYTA 1THXA 2WGRA 3HVXA 5EY6A 2X64A 5FT3A 8GSSA 2H1DA 2VL3A 2HZEA 3U6VA 13GSA 3CRTA 3IA1A 3UIWA 5ECRB 2REMA 4KH7A 4G9HA 2RUFA 4AF2A 1ZL9A 2X8HA 2H76A 3F9UA 3LW9A 2I9HA 1GLPA 2L5OA 2K9FA 4KGIA 1URMA 3RDWA 3LEFA 1PKZA 1M0UA 1VF1A 5KN0A 1G7EA 2XHFA 1T4YA 1B8XA 2C0DA 3FW2A 1ML6A 4KUNA 2A2RA 4KSOA 2DMLA 3GRXA 1I5GA 5ENUA 3TCOA 2FGXA 2HLSA 2GSSA 3HD5A 2ES7A 2DJ1A 2VD0A 1K0MA 2H01A 4IQAA 4XRDA 1SL2B 9GSSA 1GH2A 5EPFA 3TKSC 3UVTA 5KOWA 3KEBA 3J7Yb 3UOMA 1XVWA 1F3BA 4KDUA 3NOFA 5IIZA 3CTFA 1ILOA 1GTAA 4PQIA 1VF4A 4PNGA 4KCAA 1JFUA 5GAPD 3D6IA 2LRNA 3SBCA 2FWGA 4V1Ap 3DD3A 3APOA 1O6JA 4MA9A 1U3IA 2AAWA 2I81A 4YAPA 4X0XA 1G6YA 3M8NA 3EMPA 2OBKA 3QFAC 2K8VA 2NPBA 3H8QA 1TTZA 3DIEA 1O8XA 3BOAA 2RIIA 4E8EA 2VUPA 3ERGA 14GSA 3IHGA 1WJKA 2OKAA 2AV4A 1AW9A 1M9AA 3CMIA 2C0FA 1J08A 2H19A 2JZRA 2KP1A 4MF7A 1XWGA 4HOJA 1J9BA 4TKYA 4ZBAA 5IQYA 3GYKA 5ID2A 12GSA 4JR4A 4EIPA 5AIVA 2GT5A 4TXVA 2A4VA 2V41A 2PUKC 5IMZA 2CX4A 4XRAA 5E59A 2HI7A 2F8AA 1BYEA 3DXBA 4EO3A 5CP1A 4F03A 1WWJA 4WF4A 1THOA 3SWLA 3F4SA 4XS1A 2ZUPA 5ELGA 1KBNA 3ZREA 1E2YA 3IE3A 2L5LA 1FOHA 5DQYA 3ZFBA 2YWOA 6GSWA 4WKWA 4DSRA 2FWHA 1N8JA 2PN8A 3R3EA 1H75A 3L9UA 1FB0A 3FYGA 4ACSA 5CAXA 2KOKA 1UN2A 3W6GA 4WR5A 2PMTA 5LD0A 2VL9A 3HY2A 3VLNA 1NHOA 5B8AA 2LNSA 2K18A 4PQHA 5G1KA 3GHAA 5D8IA 4BVXA 4ZB9A 3GH9A 4K2DA 3V1WA 1R4WA 4I97A 3QD9A 1XVQA 3HJMA 3KXOA 5DALA 1Z3EA 4ICYA 4QQ7A 3VWUA 2CAIA 1M2BA 2FD3A 1PA3A 3TJJA 2GLRA 3QOUA 3C7MA 1XW6A 4AJ7A 1V58A 1GUMA 1O81A 3UL3A 5B8BA 2VL2C 4TR1B 5C00A 4BPYA 4EUYA 5DCGA 2C80A 2FY6A 2B7JA 3ZVJA 5E4WA 3FZ4A 4IKHA 3F8UA 1SKSB 2PPTA 1TK5B 2FA8A 3IBHA 5JWRB 4BA7A 5A4VA 3OR5A 1OYJA 2PVOC 2XBQA 3IV4A 3VPQA 2LSTA 4V2LA 3KMNA 2C0EA 2K8SA 3TJKA 4EDZA 2B5EA 4YQUA 3QMXA 1YQ1A 2H6ZA 4FO5A 3IK9A 1XWAA 1OKTA 4K1FA 1W4VA 4J2FA 1XWBA 1ZYNA 3PINA 1VGLA 5HR2A 2RUEA 2HXKA 1JZOA 1TU7A 3G7IA 2VD1A 3EVIA 2HZFA 3E9JB 6GSTA 4CY6A 5ID2B 1FG4A 3FK8A 2V2GA 4AJ6A 3KP8A 3RHCA 3HKRA 2B1LA 2M72A 1LU4A 1TOFA 5HR1A 2JL4A 3TGZA 3LSZA 4LL4B 17GSA 1OVNA 4L0UA 1XZOA 2A4HA 4HS1A 1K0NA 1GNEA 4LA1A 20GSA 1Z6NA 2HE3A 2CVBA 3D4TA 1K0OA 3IK7A 3GKXA 3GL3A 2KLXA 2YOIA 4XIHA 1S3DA 1EGOA 2E2GA 4O32A 2K6VA 3WGXA 11GSA 2VAFA 2O87A 3LXTA 1TI3A 2E0QA 3ZMLA 1ABAA 2C4JA 1EP8A 3EE2A 4EE0A 5IOXA 4WBRD 1K0CA 1SYRA 4BVXB 3GKMA 1JLVA 2NVLA 1AQWA 6GSXA 1A8YA 2GZZA 2F51A 3GKKA 2YWIA 4MK3A 1HYUA 2OADA 2IWTA 5DALB 3TKSA 3GIXA 2DBCA 4K2XA 4FYBA 5COHA 2YWNA 5D93A 4HUAA 5BRTA 3NIVA 4HZ4A 1EV9A 2N5BA 4X1UA 4OD7A 4O7HA 1GULA 1TDIA 3GSTA 3H93A 1HNCA 2GQKA 3JCML 1ZYQB 4A5PA 5F0GA 4MJBA 3GKNA 1YEPA 2RLIA 2P5QA 3MDKA 3L78A 3G7JA 2O85A 1DE1A 2LRTA 4GSNA 3ZVJD 2OE3A 1YF0A 1ERUA 4GTUA 2N5AA 3FR3A 1G7OA 3UVHA 4G19A 5ECOB 4JZQA 1JZRA 2CA8A 3MIXA 4KAEA 2RM5A 2R0CA 2H74A 3FHKA 2FWEA 3VURA 2JZTA 1BG5A 2F8FA 2TRXA 2EIRA 1ZYPA 3LQ7A 2CVDA 1YJ6A 4MABA 4GF0A 2F9SA 2CZ3A 1ZCPA 2A2PA 3HYPA 3O3TA 3GX0A 4PQ1A 5B7CA 2X8CA 4HZ2A 4PTSA 4TOPA 4O5RA 1OC9A 1USBA 4KF9A 3D21A 4TN8A 1GSEA 2QSIA 3GN3A 4IW9A 1FW1A 1HD2A 2H1BA 1K0BA 1YF1A 4MF6A 1QK8A 1X5DA 2EC4A 2OJLA 4K0GA 1EEMA 3EC3A 4FYCA 5IPGA 1SK0A 3I43A 3EURA 3Q6OA 1X0RA 5DVBA 3PH9A 1ZZYA 2E7PA 3C1RA 1TRWA 4K7IA 1U88A 4TR3A 4PGTA 4L8EA 5ECMB 4F82A 1OAZA 5KN1A 2H75A 3KTLA 4Q5QA 2H0GA 5G5FA 4K7NA 2L59A 1SL0B 3Q18A 2QA2A 4F2IA 3MAKA 3I6AA 3TJGA 3GNJA 4YQVA 1IYHA 3TKRA 2IL3A 4GQFA 1PL2A 3IPZA 4GLTA 5BMUA 2VCWA 1XOAA 1K3YA 1XWKA 2NBSA 5CNWA 3BCKA 3ZL5A 4POBA 3D0ZA 2VL2A 4Z7XA 2B6MA 4HJ2A 2BTOT 3DVXA 4ZILA 22GSA 1AUCA 1G6WA 3LJRA 3VPTA 2PBJA 3EPTA 3F3RA 2VLUA 5IMAA 4ISDA 1MD4A 1VRSD 3E3EA 4GSSA 5DJMA 1K3LA 4Z2UA 4CHSA 3KGKA 4WR4A 3WT1A 1O73A 1SENA 5KOXA 2VLTA 3WD6A 3KD0A 2LKUA 4OCFA 1J0FA 4OFMA 1MDIA 3A5WA 3N9JA 2N5FA 4PURA 4FQUA 2XBIA 1M9BA 3F4TA 1PX7A 4LL1B 4IS0A 1F37A 2IMKA 5GAND 2HNLA 3HZ8A 3A2XA 2E2MA 5A4WA 2WJUA 5D9VA 5A5KA 2O89A 5IM9A 2QA1A 4ZIJA 2WB9A 3ZZXA 4N0ZA 5F06A 3C71A 3BBYA 2MYGA 1EP7A 1V98A 2DJ2A 4XS6A 3GUSA 4KX4A 4AJ8A 1BQ7A 2C0GA 4MZCA 2RM6A 3TOTA 1BAYA 3PR8A 5DQSA 2EIOA 1FVKA 1T3BA 2M80A 2J23A 3BCIA 1U6TA 4BL7B 1TI1A 2BJXA 2FHEA 2OE1A 2YN1A 4IJIA 4EDYA 2GZPA 4MPGA 4P3YB 3RPPA 2OACA 2R4VA 4KDYA 4LMWA 1OC9B 5F05A 1A0RP 1JZDA 4XTSA 4K5RA 2DSAA 4KNDA 5C04A 2I1UA 3UEMA 1W89A 3RPNA 3WGEA 4YKFA 5HFKA 1R5PA 1F3AA 1RQMA 5HR0A 4OFTA 4ML6A 4ZL7A 1OKDA 4TRXA 1SKRB 1X5CA 3UMAA 2L4QA 3VFIA 5D73A 2IMEA 5DDLA 4TR4A 2P5RA 2VCZA 3TKPA 2HZEB 1T4ZA 2H72A 2LV3A 1QQ2A 1ZYEA 5AISA 1WIKA 5DCHA 1ERVA 1SD8A 3F6FA 2V32A 1MEKA 4DEJA 2NDOA 3HHVA 4RQRA 1ERTA 1O7UA 3F6DA 2HT9A 4K0NA 4ECBA 4ML1A 2M46A 4WETA 2O7KA 1XPVA 1R5AA 2I4AA 4KSMA 4F0BA 5IMDA 7GSSA 3FEUA 1LJRA 3GV1A 1A2MA 4MJCA 3O6TA 3Q19A 2CVKA 2GQLA 4WXTA 1V40A 3TRPA 2C8UA 1JLWA 4N30A 1MDKA 4X4JA 3LYKA 2ON5A 3MNGA 2L6DA 5AN1A 4NPBA 5CRWA 4FH8A 3GURA 2DJ0A 1XW5A 3GSSA 3HJPA 6GSSA 2R0PA 1UVZA 1NM3A 1FAAA 1T8EB 4ZB6A 5AIXA 3QAWA 3UAPA 1Z7RA 4XCSA 4CDOA 1PN0A 3P8WA 2VCQA 1EGRA 2C3TA 2XPDA 3DRNA 2IN3A 4K5SA 4PUFC 2H0HA 5JWQB 2F3MA 2BMXA 3KCMA 2CX3A 3D4MA 2OE0A 4IQ1A 2AJQB 1SD9A 2IMIA 4G10A 2TRCP 4L5LA 3AY8A 2DIYA 2HSYA 2LQQA 2PU9C 1MD3A 2YV9A 2LTKA 1ERWA 2KP2A 4LMVA 5FHIA 4QL9A 1DBYA 4DSQA 3IC4A 4FYUA 5L71A 4TXOA 1R7HA 2QKEA 4ZL8A 16GSA 3S9FA 2HRKA 4KA0A 5D9XA 4RI7A 3DKSA 5HQPA 2LQOA 1B9XC 3KZQA 4HU9A 1SJ6A 5JCWA 4WEYA 3US3A 3P2AA 1B9YC 4ULXA 4EC0A 1XWCA 3MYDA 1AQXA 2J9HA 3A3TA 5HR3A 2GGTA 4MZWA 10GSA 3QFBC 3ZFLA 3ERWA 2MBTA 1F9MA 4KB3A 4NMUA 3ME8A 4GCIA 3VWVA 2JU5A 3EU3A 4X43A 1G0TA 1ON4A 4MMMA 1AXDA 1SK1A 1WE0A 2VOCA 2G2QA 2MMZA 4K6XA 3EMXA 2PGTA 18GSA 4ZBDA 1TW9A 2MMOA 2JSZA 4MP4A 5EL8A 4TR0A 2MZCA 2R5GA 1GRXA 2YJ7A 3IRAA 1M2AA 1GWCA 1OE7A 1S3CA 4IHUA 4MPFA 3A2WA 2P31A 3P7XA 1U87A 1Z6MA 2H6XA 2YANA 2DLXA 4ZXGA 1TJDA 2C3QA 1Y25A 5B6MA 3O76A 1DE2A 3LFLA 4F9ZA 1XOBA 1TRUA 4TW5A 2YNXA 5ECKB 1Y6EA 3L9VA 3TJFA 4WF5A 1TRVA 2R37A 4GRFA 2X99A 3DGQA 1XBSA 1GL8A 2DJ3A 4I2UA 4EXJA 2X8GA 2GVPA 3MWHA 4FIWA 5ECPB 4XS4A 4ECCA 1BEDA 4AGSA 2H30A 1SJIA 5CYYA 5FWGA 2R3XA 1SKWB 3IR4A 3I69A 4RQXA 5J4UA 2LJAA 2TIRA 3ZIJA 4EIQA 3RHBA 4RI6A 3DEXA 2WFCA 1ZMAA 5ECIB 1Q4JA 2H8LA 3E0UA 4MJEA 5AGYA 4PX1A 4V2MA 2ON7A 4V2NA 2L6CA 3ED3A 5CO3A 4YH2A 4EKZA 5DBQA 3F0IA 1OC8A 1A8LA 4EL1A 5J3RA 3ZRDA 3DMLA 2GS3A 3ERFA 4TXOB 2FCHA 3FY7A 1H4OA 3CSHA 3H79A 2VLVA 5KEJA 1M7TA 2HRAA 2C3NA 1YKCA 1WPIA 4OO4A 1A2LA 4RUVA 1SL1B 5ECQB 2LRCA 2V6OA 2WS2A 1WRYA 4HEA2 1CQGA 4K7OA 5LCZA 1PQNA 4J57E 5ABRA 1QXHA 3R2QA 1ST9A 3GH6A 5HFIA 2VO4A 5IPHA 4WBJA 2GQMA 1YDKA 4OO5A 2I3YA 1SU9A 2LNTA 5G1LA 1SK2A 2LUSA 3ZMKA 2MBSA 4OMVA 5IOWA 2X4AA 1MDJA 3L0HA 1XFLA 2ZCTA 4JR6A 3A5IA 1HNAA 4PNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H5Q A;  1DUG A;  3UBK A;  2EIQ A;  2WCI A;  4IP1 A;  3VK9 A;  4NAX A;  2XPE A;  5D96 A;  1IYI A;  3IHQ A;  2H1G A;  2HFD A;  4XHM A;  3D5J A;  2FWF A;  3QAG A;  1OE8 A;  4ZB8 A;  1FVJ A;  4NHW A;  3TRX A;  1GSQ A;  2R6K A;  2A2S A;  3F4R A;  1B48 A;  4NV2 A;  4K8M A;  2JZS A;  1I9D A;  1AC1 A;  3C8E A;  4L0W A;  4JE1 A;  4I5Q A;  3D22 A;  1Z7P A;  3M9J A;  4HQZ A;  1Q98 A;  4ZL9 A;  3MSZ A;  5ECN B;  2AYT A;  3IAS 2;  3M9K A;  3N5O A;  1KTE A;  2IPA A;  3EWL A;  4EF0 A;  1ACV A;  1V2A A;  4TR1 A;  2FNO A;  1HQO A;  1AQV A;  3TKQ A;  4L5O A;  1VF3 A;  1WMJ A;  2V1M A;  2HRN A;  4POK A;  4XS4 B;  1DSB A;  3M1G A;  1PKW A;  1GSY A;  2CT6 A;  3RAZ A;  1YY7 A;  2GZY A;  5F07 A;  4IVF A;  1A23 A;  4ECI A;  2XC2 A;  1FOV A;  4PXO A;  5IMV A;  3G7Y A;  4N11 A;  1T00 A;  3DYR A;  1GSS A;  3FZA A;  3WYW A;  5ECL B;  1GSF A;  2DC5 A;  3I9V 2;  3APQ A;  1PMT A;  3H1N A;  2R2J A;  2JAD A;  4EVM A;  1GTB A;  3KP9 A;  5GZZ B;  3VWX A;  1TXX A;  3L4N A;  1EWX A;  4KCE A;  1LBK A;  4BWQ A;  4ZBB A;  3CXG A;  2C1Y A;  5INY A;  2CZ2 A;  4TVE A;  2YP6 A;  4PUA A;  1EOG A;  5G31 A;  3BD2 A;  1X9S B;  4H86 A;  4NHZ A;  3QAV A;  3GA4 A;  1FB6 A;  2B5Y A;  4Q5F A;  1NSW A;  3LGC A;  1S3A A;  5ELA A;  1TKD B;  2WZ9 A;  1NHY A;  1TRS A;  3FR6 A;  4JBB A;  3RBT A;  2AHE A;  3CYN A;  1TK8 B;  2VCT A;  4BVY A;  2AUV A;  2VCX A;  3DWV A;  3W8J A;  3ZTL A;  1PD2 1;  4V1A g;  4MZB A;  1K0D A;  5A4U A;  1JZW A;  4IP6 A;  2H73 A;  2VM1 A;  2LS5 A;  3WGD A;  3G9B A;  4KW6 A;  1K3O A;  3QR6 A;  1TP9 A;  4IEL A;  1YEX A;  2WDU A;  3M0F A;  2VCV A;  3VWW A;  2HSH A;  3CBU A;  1A0F A;  3FZ5 A;  2GTU A;  3APS A;  3FR9 A;  2JSY A;  3W8S A;  5GSS A;  5G5E A;  3IDV A;  4GQC A;  4J56 E;  1AAZ A;  4Q5R A;  4JU5 A;  5G2Z A;  3KTB A;  1XIY A;  1F6M C;  1FO5 A;  3HDC A;  6GSY A;  1A24 A;  2QGV A;  1BJX A;  3HA9 A;  3HJO A;  5EVO A;  3TDG A;  3TOU A;  2B7K A;  5IMF A;  2LJK A;  3ME7 A;  3GX8 A;  1EV4 A;  2LJR A;  1F2E A;  1NW2 A;  2WRT A;  1TK0 B;  2G0F A;  5CRD A;  3PGT A;  2HRF A;  3CRU A;  1GP1 A;  2KUC A;  2LEG A;  2MMN A;  2QC7 A;  3C1S A;  5JCU A;  3HVS A;  1QFN A;  4IJ3 A;  2OBI A;  1GTI A;  3KM6 A;  3LG6 A;  2PER A;  3UAR A;  5B6N A;  4ILF A;  3GTU A;  1PGT A;  1OC3 A;  2DJJ A;  3UBL A;  4DSS A;  3WT2 A;  2GSR A;  2L57 A;  1X9W B;  2CQ9 A;  3ZIV A;  1XW9 A;  2IFQ A;  3F63 A;  2O8V B;  1A2J A;  3K8N A;  3VI7 A;  2H6Y A;  4JED A;  3BJ5 A;  5D9T A;  4D73 A;  1V57 A;  1TU8 A;  1K0A A;  2YJH A;  1GLQ A;  4NV5 A;  2B1K A;  4GXZ A;  4JRR A;  4ID0 A;  3L9S A;  4HU7 A;  4BWS A;  4ECJ A;  2DJK A;  4YQM A;  3F3Q A;  3ZIT A;  3ZYW A;  3A2V A;  3TJB A;  5DAK A;  4IGJ A;  2DMM A;  3TB2 A;  3EIN A;  2IMD A;  4MLY A;  4K9Z A;  4MDC A;  2Z9S A;  2VIM A;  1PSQ A;  3HVV A;  1MTC A;  5CRE A;  4YAV A;  5H5S A;  1UC7 A;  5JCG A;  5IO2 A;  4NWY A;  2VM2 A;  2NTO A;  4GWR A;  1HNB A;  1GUK A;  1O8W A;  5DJL A;  1XCC A;  2CV4 A;  4MF5 A;  1X5E A;  1KNG A;  2D2Z A;  1T1V A;  4MJA A;  3QPM A;  2V6K A;  2ALB A;  1UA5 A;  1V9W A;  4KDX A;  2KHP A;  1SYX A;  3J7Y k;  4Q5N A;  5J9C A;  4POL A;  1PRX A;  2IIY A;  1YZX A;  1Z5Y E;  3ZLP A;  2YCD A;  3LWA A;  3ISO A;  1BX9 A;  4OFN A;  5J41 A;  5JWO B;  1CQH A;  3IAM 2;  4IBP A;  2H0I A;  3QDN A;  6GSV A;  2MMA A;  2CAQ A;  1M2D A;  2GSQ A;  2PWJ A;  1PX6 A;  2FUG 2;  3EU4 A;  5H5R A;  2YZU A;  1EEJ A;  1ZOF A;  2FLS A;  4QL7 A;  1M99 A;  1QUW A;  3QCP A;  2H1A A;  3LYP A;  2ZNM A;  4CW9 A;  3FZ9 A;  3KJY A;  2B3S A;  5KN2 A;  4OWY A;  4F0C A;  3IOS A;  4OCE A;  2P0G A;  3KIJ A;  2FA4 A;  2H70 A;  1PN9 A;  2DIZ A;  4POM A;  3U5R E;  3HXS A;  19GS A;  3M3M A;  4N0V A;  1GSU A;  4GST A;  1JHB A;  1R26 A;  1QGV A;  4NXI A;  1B4P A;  3KH9 A;  1E6B A;  4HQS A;  1AIU A;  5D9W A;  1SJZ A;  4HJM A;  1O85 A;  3Q74 A;  5HFG A;  3H4K A;  5F8B A;  1GUH A;  5KN3 A;  5GST A;  3VI5 A;  3GTU B;  4MH2 A;  4DSS B;  1RK4 A;  4N10 A;  2JAC A;  3GFK A;  1YKA A;  2IFQ B;  3TKS E;  3IXR A;  2YV7 A;  3P90 A;  4MH3 A;  3UJ1 A;  1ZGN A;  1VF2 A;  4D73 B;  2GST A;  1GSD A;  2PVQ A;  1Z9H A;  1KEB A;  2YPM A;  5IMC A;  4MCU A;  5IO0 A;  4HDE A;  4E8H A;  5DAK B;  5G30 A;  1U3A A;  5LNK e;  4KE3 A;  4I2T A;  4LLR A;  4HI7 A;  5J9B A;  3CTG A;  5ECH B;  2YZH A;  4BL7 A;  3HCZ A;  1WP0 A;  3TUE A;  1GTU A;  6GSU A;  1RW1 A;  2L4C A;  5ECS A;  1FHE A;  4O92 A;  2H66 A;  1T7P B;  1C72 A;  2B5X A;  1XXU A;  1N2A A;  2HYX A;  2YWM A;  3FRC A;  1QMV A;  3LOR A;  3GL5 A;  3FKF A;  3GMF A;  1WOU A;  1PL1 A;  4G2E A;  1GNW A;  5J5N A;  3CSI A;  3KMO A;  5CRG A;  3KH7 A;  3DVW A;  2GT6 A;  4I6X A;  2AB6 A;  1EOH A;  4I8B A;  3TRQ A;  3CSJ A;  2OA7 A;  2GDR A;  3NZN A;  2H71 A;  1X9M B;  2IJY A;  4DVC A;  5CRH A;  2IMF A;  3HZ4 A;  3LXZ A;  1B4Q A;  3C73 A;  4IN0 A;  1EZK A;  2WUL A;  3EYT A;  1THX A;  2WGR A;  3HVX A;  5EY6 A;  2X64 A;  5FT3 A;  8GSS A;  2H1D A;  2VL3 A;  2HZE A;  3U6V A;  13GS A;  3CRT A;  3IA1 A;  3UIW A;  5ECR B;  2REM A;  4KH7 A;  4G9H A;  2RUF A;  4AF2 A;  1ZL9 A;  2X8H A;  2H76 A;  3F9U A;  2I9H A;  1GLP A;  2L5O A;  2K9F A;  4KGI A;  1URM A;  3RDW A;  3LEF A;  1PKZ A;  1M0U A;  1VF1 A;  5KN0 A;  1G7E A;  2XHF A;  1T4Y A;  1B8X A;  2C0D A;  3FW2 A;  1ML6 A;  4KUN A;  2A2R A;  4KSO A;  2DML A;  3GRX A;  1I5G A;  5ENU A;  3TCO A;  2FGX A;  2HLS A;  2GSS A;  3HD5 A;  2ES7 A;  2DJ1 A;  2VD0 A;  1K0M A;  2H01 A;  4IQA A;  4XRD A;  1SL2 B;  9GSS A;  1GH2 A;  5EPF A;  3TKS C;  3UVT A;  3KEB A;  3J7Y b;  3UOM A;  1XVW A;  1F3B A;  4KDU A;  3NOF A;  5IIZ A;  3CTF A;  1ILO A;  1GTA A;  4PQI A;  1VF4 A;  4PNG A;  4KCA A;  1JFU A;  5GAP D;  3D6I A;  2LRN A;  3SBC A;  2FWG A;  4V1A p;  3DD3 A;  3APO A;  1O6J A;  4MA9 A;  1U3I A;  2AAW A;  2I81 A;  4YAP A;  4X0X A;  1G6Y A;  3M8N A;  3EMP A;  2OBK A;  3QFA C;  2K8V A;  2NPB A;  3H8Q A;  1TTZ A;  3DIE A;  1O8X A;  3BOA A;  2RII A;  4E8E A;  2VUP A;  3ERG A;  14GS A;  1WJK A;  2OKA A;  2AV4 A;  1AW9 A;  1M9A A;  3CMI A;  2C0F A;  1J08 A;  2H19 A;  2JZR A;  2KP1 A;  4MF7 A;  1XWG A;  4HOJ A;  1J9B A;  4TKY A;  4ZBA A;  5IQY A;  3GYK A;  5ID2 A;  12GS A;  4JR4 A;  5AIV A;  2GT5 A;  4TXV A;  2A4V A;  2V41 A;  2PUK C;  5IMZ A;  2CX4 A;  4XRA A;  5E59 A;  2HI7 A;  2F8A A;  1BYE A;  3DXB A;  4EO3 A;  5CP1 A;  4F03 A;  1WWJ A;  4WF4 A;  1THO A;  3SWL A;  3F4S A;  4XS1 A;  2ZUP A;  5ELG A;  1KBN A;  3ZRE A;  1E2Y A;  3IE3 A;  2L5L A;  5DQY A;  3ZFB A;  2YWO A;  6GSW A;  4WKW A;  4DSR A;  2FWH A;  1N8J A;  2PN8 A;  1H75 A;  3L9U A;  1FB0 A;  3FYG A;  4ACS A;  5CAX A;  2KOK A;  1UN2 A;  3W6G A;  4WR5 A;  2PMT A;  5LD0 A;  2VL9 A;  3HY2 A;  3VLN A;  1NHO A;  5B8A A;  2LNS A;  2K18 A;  4PQH A;  5G1K A;  3GHA A;  5D8I A;  4BVX A;  4ZB9 A;  3GH9 A;  4K2D A;  3V1W A;  1R4W A;  4I97 A;  3QD9 A;  1XVQ A;  3HJM A;  3KXO A;  5DAL A;  1Z3E A;  4QQ7 A;  3VWU A;  2CAI A;  1M2B A;  2FD3 A;  1PA3 A;  3TJJ A;  2GLR A;  3QOU A;  3C7M A;  1XW6 A;  4AJ7 A;  1V58 A;  1GUM A;  1O81 A;  3UL3 A;  5B8B A;  2VL2 C;  4TR1 B;  5C00 A;  4BPY A;  4EUY A;  5DCG A;  2C80 A;  2FY6 A;  2B7J A;  3ZVJ A;  5E4W A;  3FZ4 A;  4IKH A;  3F8U A;  1SKS B;  2PPT A;  1TK5 B;  2FA8 A;  3IBH A;  5JWR B;  4BA7 A;  5A4V A;  3OR5 A;  1OYJ A;  2PVO C;  2XBQ A;  3IV4 A;  3VPQ A;  2LST A;  4V2L A;  3KMN A;  2C0E A;  2K8S A;  3TJK A;  4EDZ A;  2B5E A;  4YQU A;  3QMX A;  1YQ1 A;  2H6Z A;  4FO5 A;  3IK9 A;  1XWA A;  1OKT A;  4K1F A;  1W4V A;  4J2F A;  1XWB A;  3PIN A;  1VGL A;  5HR2 A;  2RUE A;  2HXK A;  1JZO A;  1TU7 A;  3G7I A;  2VD1 A;  3EVI A;  2HZF A;  3E9J B;  6GST A;  5ID2 B;  1FG4 A;  3FK8 A;  2V2G A;  4AJ6 A;  3KP8 A;  3RHC A;  3HKR A;  2B1L A;  2M72 A;  1LU4 A;  1TOF A;  5HR1 A;  2JL4 A;  3TGZ A;  3LSZ A;  4LL4 B;  17GS A;  1OVN A;  4L0U A;  1XZO A;  4HS1 A;  1K0N A;  1GNE A;  4LA1 A;  20GS A;  1Z6N A;  2HE3 A;  2CVB A;  3D4T A;  1K0O A;  3IK7 A;  3GKX A;  3GL3 A;  2KLX A;  2YOI A;  4XIH A;  1S3D A;  1EGO A;  2E2G A;  4O32 A;  2K6V A;  3WGX A;  11GS A;  2VAF A;  2O87 A;  3LXT A;  1TI3 A;  2E0Q A;  3ZML A;  1ABA A;  2C4J A;  1EP8 A;  3EE2 A;  4EE0 A;  5IOX A;  4WBR D;  1K0C A;  1SYR A;  3GKM A;  1JLV A;  2NVL A;  1AQW A;  6GSX A;  1A8Y A;  2GZZ A;  2F51 A;  3GKK A;  2YWI A;  4MK3 A;  1HYU A;  2OAD A;  2IWT A;  5DAL B;  3TKS A;  3GIX A;  2DBC A;  4FYB A;  5COH A;  2YWN A;  5D93 A;  4HUA A;  3NIV A;  4HZ4 A;  1EV9 A;  2N5B A;  4X1U A;  4OD7 A;  4O7H A;  1GUL A;  1TDI A;  3GST A;  3H93 A;  1HNC A;  2GQK A;  3JCM L;  1ZYQ B;  5F0G A;  4MJB A;  3GKN A;  1YEP A;  2RLI A;  2P5Q A;  3MDK A;  3L78 A;  3G7J A;  2O85 A;  1DE1 A;  2LRT A;  4GSN A;  3ZVJ D;  2OE3 A;  1YF0 A;  1ERU A;  4GTU A;  2N5A A;  3FR3 A;  1G7O A;  3UVH A;  4G19 A;  5ECO B;  4JZQ A;  1JZR A;  2CA8 A;  4KAE A;  2RM5 A;  2H74 A;  3FHK A;  2FWE A;  3VUR A;  2JZT A;  1BG5 A;  2F8F A;  2TRX A;  2EIR A;  3LQ7 A;  2CVD A;  1YJ6 A;  4MAB A;  4GF0 A;  2F9S A;  2CZ3 A;  1ZCP A;  3HYP A;  3O3T A;  3GX0 A;  4PQ1 A;  5B7C A;  2X8C A;  4HZ2 A;  4TOP A;  4O5R A;  1OC9 A;  1USB A;  3D21 A;  4TN8 A;  1GSE A;  2QSI A;  3GN3 A;  4IW9 A;  1FW1 A;  1HD2 A;  2H1B A;  1K0B A;  1YF1 A;  4MF6 A;  1QK8 A;  1X5D A;  2EC4 A;  2OJL A;  4K0G A;  1EEM A;  3EC3 A;  4FYC A;  5IPG A;  1SK0 A;  3I43 A;  3EUR A;  3Q6O A;  1X0R A;  5DVB A;  3PH9 A;  1ZZY A;  2E7P A;  3C1R A;  1TRW A;  4K7I A;  1U88 A;  4TR3 A;  4PGT A;  4L8E A;  5ECM B;  4F82 A;  1OAZ A;  5KN1 A;  2H75 A;  3KTL A;  4Q5Q A;  2H0G A;  5G5F A;  4K7N A;  2L59 A;  1SL0 B;  3Q18 A;  4F2I A;  3MAK A;  3I6A A;  3TJG A;  3GNJ A;  4YQV A;  1IYH A;  3TKR A;  2IL3 A;  4GQF A;  1PL2 A;  3IPZ A;  4GLT A;  2VCW A;  1XOA A;  1K3Y A;  1XWK A;  2NBS A;  5CNW A;  3BCK A;  3ZL5 A;  4POB A;  3D0Z A;  2VL2 A;  4Z7X A;  2B6M A;  4HJ2 A;  2BTO T;  3DVX A;  4ZIL A;  22GS A;  1AUC A;  1G6W A;  3LJR A;  3VPT A;  2PBJ A;  3F3R A;  2VLU A;  5IMA A;  4ISD A;  1MD4 A;  1VRS D;  3E3E A;  4GSS A;  5DJM A;  1K3L A;  4CHS A;  3KGK A;  4WR4 A;  3WT1 A;  1O73 A;  1SEN A;  2VLT A;  3WD6 A;  3KD0 A;  2LKU A;  4OCF A;  1J0F A;  4OFM A;  1MDI A;  3A5W A;  2N5F A;  3N9J A;  4PUR A;  2XBI A;  1M9B A;  3F4T A;  1PX7 A;  4LL1 B;  4IS0 A;  1F37 A;  2IMK A;  5GAN D;  2HNL A;  3HZ8 A;  3A2X A;  2E2M A;  5A4W A;  2WJU A;  5D9V A;  5A5K A;  2O89 A;  5IM9 A;  4ZIJ A;  2WB9 A;  3ZZX A;  4N0Z A;  5F06 A;  3C71 A;  3BBY A;  2MYG A;  1EP7 A;  1V98 A;  2DJ2 A;  4XS6 A;  3GUS A;  4KX4 A;  4AJ8 A;  1BQ7 A;  2C0G A;  4MZC A;  2RM6 A;  3TOT A;  1BAY A;  3PR8 A;  5DQS A;  2EIO A;  1FVK A;  1T3B A;  2M80 A;  2J23 A;  3BCI A;  1U6T A;  1TI1 A;  2BJX A;  2FHE A;  2OE1 A;  2YN1 A;  4IJI A;  4EDY A;  2GZP A;  4MPG A;  4P3Y B;  3RPP A;  2OAC A;  2R4V A;  4KDY A;  4LMW A;  1OC9 B;  5F05 A;  1A0R P;  1JZD A;  4XTS A;  2DSA A;  4KND A;  5C04 A;  2I1U A;  3UEM A;  1W89 A;  3RPN A;  3WGE A;  5HFK A;  1R5P A;  1F3A A;  1RQM A;  5HR0 A;  4OFT A;  4ML6 A;  4ZL7 A;  1OKD A;  4TRX A;  1SKR B;  1X5C A;  3UMA A;  2L4Q A;  3VFI A;  5D73 A;  2IME A;  5DDL A;  4TR4 A;  2P5R A;  2VCZ A;  3TKP A;  2HZE B;  1T4Z A;  2H72 A;  2LV3 A;  1QQ2 A;  1ZYE A;  5AIS A;  1WIK A;  5DCH A;  1ERV A;  1SD8 A;  3F6F A;  2V32 A;  1MEK A;  4DEJ A;  2NDO A;  3HHV A;  4RQR A;  1ERT A;  1O7U A;  3F6D A;  2HT9 A;  4K0N A;  4ECB A;  4ML1 A;  2M46 A;  4WET A;  2O7K A;  1XPV A;  1R5A A;  2I4A A;  4KSM A;  4F0B A;  5IMD A;  7GSS A;  3FEU A;  1LJR A;  3GV1 A;  1A2M A;  4MJC A;  3O6T A;  3Q19 A;  2CVK A;  2GQL A;  4WXT A;  1V40 A;  3TRP A;  2C8U A;  1JLW A;  4N30 A;  1MDK A;  3LYK A;  2ON5 A;  3MNG A;  2L6D A;  5AN1 A;  4NPB A;  5CRW A;  4FH8 A;  3GUR A;  2DJ0 A;  1XW5 A;  3GSS A;  3HJP A;  6GSS A;  1UVZ A;  1NM3 A;  1FAA A;  1T8E B;  4ZB6 A;  5AIX A;  3QAW A;  3UAP A;  1Z7R A;  4XCS A;  4CDO A;  3P8W A;  2VCQ A;  1EGR A;  2C3T A;  2XPD A;  3DRN A;  2IN3 A;  4PUF C;  2H0H A;  5JWQ B;  2F3M A;  2BMX A;  3KCM A;  2CX3 A;  3D4M A;  2OE0 A;  4IQ1 A;  2AJQ B;  1SD9 A;  2IMI A;  4G10 A;  2TRC P;  4L5L A;  3AY8 A;  2DIY A;  2HSY A;  2LQQ A;  2PU9 C;  1MD3 A;  2YV9 A;  2LTK A;  1ERW A;  2KP2 A;  4LMV A;  5FHI A;  4QL9 A;  1DBY A;  4DSQ A;  3IC4 A;  4FYU A;  5L71 A;  4TXO A;  1R7H A;  2QKE A;  4ZL8 A;  16GS A;  3S9F A;  4KA0 A;  5D9X A;  4RI7 A;  3DKS A;  5HQP A;  2LQO A;  1B9X C;  3KZQ A;  4HU9 A;  1SJ6 A;  5JCW A;  4WEY A;  3US3 A;  3P2A A;  1B9Y C;  4ULX A;  4EC0 A;  1XWC A;  1AQX A;  2J9H A;  3A3T A;  5HR3 A;  2GGT A;  4MZW A;  10GS A;  3QFB C;  3ZFL A;  3ERW A;  2MBT A;  1F9M A;  4KB3 A;  4NMU A;  3ME8 A;  4GCI A;  3VWV A;  2JU5 A;  3EU3 A;  4X43 A;  1G0T A;  1ON4 A;  4MMM A;  1AXD A;  1SK1 A;  1WE0 A;  2VOC A;  2G2Q A;  2MMZ A;  4K6X A;  3EMX A;  2PGT A;  18GS A;  4ZBD A;  1TW9 A;  2MMO A;  2JSZ A;  4MP4 A;  5EL8 A;  4TR0 A;  2MZC A;  2R5G A;  1GRX A;  2YJ7 A;  3IRA A;  1M2A A;  1GWC A;  1OE7 A;  1S3C A;  4IHU A;  4MPF A;  3A2W A;  2P31 A;  3P7X A;  1U87 A;  1Z6M A;  2H6X A;  2YAN A;  2DLX A;  4ZXG A;  1TJD A;  2C3Q A;  1Y25 A;  5B6M A;  3O76 A;  1DE2 A;  3LFL A;  4F9Z A;  1XOB A;  1TRU A;  4TW5 A;  2YNX A;  5ECK B;  1Y6E A;  3L9V A;  3TJF A;  4WF5 A;  1TRV A;  2R37 A;  4GRF A;  2X99 A;  3DGQ A;  1XBS A;  1GL8 A;  2DJ3 A;  4I2U A;  4EXJ A;  2X8G A;  2GVP A;  3MWH A;  4FIW A;  5ECP B;  4XS4 A;  4ECC A;  1BED A;  4AGS A;  2H30 A;  1SJI A;  5CYY A;  5FWG A;  2R3X A;  1SKW B;  3IR4 A;  3I69 A;  4RQX A;  5J4U A;  2LJA A;  2TIR A;  3ZIJ A;  3RHB A;  4RI6 A;  3DEX A;  2WFC A;  1ZMA A;  5ECI B;  1Q4J A;  2H8L A;  3E0U A;  4MJE A;  5AGY A;  4PX1 A;  4V2M A;  2ON7 A;  4V2N A;  2L6C A;  3ED3 A;  5CO3 A;  4YH2 A;  4EKZ A;  5DBQ A;  3F0I A;  1OC8 A;  1A8L A;  4EL1 A;  5J3R A;  3ZRD A;  3DML A;  2GS3 A;  3ERF A;  4TXO B;  2FCH A;  3FY7 A;  1H4O A;  3CSH A;  3H79 A;  2VLV A;  5KEJ A;  1M7T A;  2C3N A;  1YKC A;  1WPI A;  4OO4 A;  1A2L A;  4RUV A;  1SL1 B;  5ECQ B;  2LRC A;  2V6O A;  2WS2 A;  1WRY A;  4HEA 2;  1CQG A;  4K7O A;  5LCZ A;  1PQN A;  4J57 E;  5ABR A;  1QXH A;  3R2Q A;  1ST9 A;  3GH6 A;  5HFI A;  2VO4 A;  5IPH A;  4WBJ A;  2GQM A;  1YDK A;  4OO5 A;  2I3Y A;  1SU9 A;  2LNT A;  5G1L A;  1SK2 A;  2LUS A;  3ZMK A;  2MBS A;  4OMV A;  5IOW A;  1MDJ A;  3L0H A;  1XFL A;  2ZCT A;  4JR6 A;  1HNA A;  4PNF A; 
#chains in the Genus database with same CATH topology
 5H5Q A;  1DUG A;  3UBK A;  2EIQ A;  2WCI A;  4IP1 A;  3VK9 A;  4NAX A;  2XPE A;  5D96 A;  1IYI A;  3IHQ A;  2H1G A;  2HFD A;  4XHM A;  3D5J A;  2FWF A;  3QAG A;  1OE8 A;  4ZB8 A;  1FVJ A;  4NHW A;  3TRX A;  1GSQ A;  2R6K A;  4O5U A;  2A2S A;  3F4R A;  1B48 A;  4NV2 A;  4K8M A;  2JZS A;  1I9D A;  1AC1 A;  3C8E A;  4L0W A;  4JE1 A;  4I5Q A;  3D22 A;  1Z7P A;  3M9J A;  4HQZ A;  3FMW A;  1Q98 A;  4ZL9 A;  3MSZ A;  5ECN B;  2AYT A;  3IAS 2;  3M9K A;  3N5O A;  1KTE A;  2IPA A;  3EWL A;  4EF0 A;  1ACV A;  1V2A A;  4TR1 A;  2FNO A;  1HQO A;  1AQV A;  3TKQ A;  4L5O A;  1VF3 A;  1WMJ A;  2V1M A;  2HRN A;  4POK A;  4XS4 B;  1DSB A;  3M1G A;  1PKW A;  1GSY A;  2CT6 A;  3RAZ A;  1YY7 A;  2GZY A;  5F07 A;  4IVF A;  1A23 A;  4ECI A;  2XC2 A;  1FOV A;  4PXO A;  5IMV A;  3G7Y A;  4N11 A;  1T00 A;  3CQF A;  3DYR A;  1GSS A;  3FZA A;  3WYW A;  5ECL B;  1GSF A;  2DC5 A;  3I9V 2;  3APQ A;  1PMT A;  3H1N A;  2R2J A;  2JAD A;  4EVM A;  1GTB A;  4YKG A;  3KP9 A;  5GZZ B;  3VWX A;  1TXX A;  3L4N A;  1EWX A;  4KCE A;  1LBK A;  4BWQ A;  4ZBB A;  3CXG A;  2C1Y A;  5INY A;  2CZ2 A;  4TVE A;  2YP6 A;  4PUA A;  1EOG A;  5G31 A;  3BD2 A;  1X9S B;  4H86 A;  4NHZ A;  3QAV A;  3GA4 A;  1FB6 A;  2B5Y A;  4Q5F A;  1NSW A;  3LGC A;  1S3A A;  5ELA A;  1TKD B;  2WZ9 A;  1NHY A;  1TRS A;  3FR6 A;  4JBB A;  3RBT A;  2AHE A;  3CYN A;  1TK8 B;  2VCT A;  4BVY A;  2AUV A;  2VCX A;  3DWV A;  3W8J A;  3ZTL A;  1PD2 1;  4V1A g;  4MZB A;  1K0D A;  5A4U A;  1JZW A;  4IP6 A;  2H73 A;  2VM1 A;  2LS5 A;  4G0K A;  3G9B A;  3WGD A;  4KW6 A;  2X49 A;  1K3O A;  3QR6 A;  1TP9 A;  1S3R A;  4IEL A;  1YEX A;  2WDU A;  3M0F A;  2VCV A;  3VWW A;  2HSH A;  3CBU A;  2HSM A;  1A0F A;  3FZ5 A;  2GTU A;  3APS A;  3FR9 A;  2JSY A;  3W8S A;  5GSS A;  5G5E A;  3IDV A;  4GQC A;  4J56 E;  4CY8 A;  1AAZ A;  4Q5R A;  4JU5 A;  5G2Z A;  3KTB A;  1XIY A;  1F6M C;  1FO5 A;  3HDC A;  6GSY A;  1A24 A;  2QGV A;  1BJX A;  3HA9 A;  3HJO A;  5EVO A;  3TDG A;  3TOU A;  2B7K A;  5IMF A;  2LJK A;  3ME7 A;  3GX8 A;  2DKI A;  1EV4 A;  2LJR A;  1F2E A;  1NW2 A;  2WRT A;  1TK0 B;  2G0F A;  5CRD A;  3PGT A;  2HRF A;  3CRU A;  1GP1 A;  2KUC A;  2LEG A;  2MMN A;  2QC7 A;  3C1S A;  5JCU A;  3HVS A;  1QFN A;  4IJ3 A;  2OBI A;  1GTI A;  3KM6 A;  3LG6 A;  2PER A;  3UAR A;  5B6N A;  4ILF A;  3GTU A;  1PGT A;  1OC3 A;  1XG8 A;  2DJJ A;  3UBL A;  4DSS A;  3WT2 A;  2GSR A;  2L57 A;  1X9W B;  2CQ9 A;  3ZIV A;  1XW9 A;  2IFQ A;  3F63 A;  2O8V B;  1A2J A;  3K8N A;  3VI7 A;  2H6Y A;  4JED A;  3BJ5 A;  5D9T A;  4D73 A;  1V57 A;  1TU8 A;  1K0A A;  2YJH A;  1GLQ A;  4NV5 A;  2B1K A;  4GXZ A;  4JRR A;  4ID0 A;  3L9S A;  4HU7 A;  4BWS A;  4ECJ A;  2DJK A;  4YQM A;  3F3Q A;  3ZIT A;  4G0I A;  3ZYW A;  3A2V A;  3TJB A;  5DAK A;  4IGJ A;  2DMM A;  3TB2 A;  3EIN A;  2IMD A;  4MLY A;  4K9Z A;  4MDC A;  2Z9S A;  2VIM A;  1PSQ A;  3HVV A;  1MTC A;  4MNN A;  5CRE A;  4YAV A;  5H5S A;  1UC7 A;  5JCG A;  5IO2 A;  4NWY A;  2VM2 A;  2NTO A;  4GWR A;  1HNB A;  1GUK A;  1O8W A;  5DJL A;  4G0L A;  2DKH A;  1XCC A;  2CV4 A;  4MF5 A;  2UZ8 A;  1X5E A;  1KNG A;  2D2Z A;  1T1V A;  4MJA A;  3QPM A;  2V6K A;  2ALB A;  1UA5 A;  2R0G A;  1V9W A;  4BVY B;  4KDX A;  2KHP A;  1SYX A;  3J7Y k;  4Q5N A;  5J9C A;  4POL A;  1PRX A;  2IIY A;  1YZX A;  1Z5Y E;  3ZLP A;  2YCD A;  3LWA A;  3ISO A;  1BX9 A;  4OFN A;  5J41 A;  5JWO B;  1CQH A;  3IAM 2;  4IBP A;  2H0I A;  3QDN A;  6GSV A;  2MMA A;  2CAQ A;  1M2D A;  2GSQ A;  2PWJ A;  1PX6 A;  2FUG 2;  3EU4 A;  5H5R A;  2YZU A;  1EEJ A;  1ZOF A;  2FLS A;  4QL7 A;  1M99 A;  1QUW A;  3QCP A;  2H1A A;  3LYP A;  2ZNM A;  4CW9 A;  3FZ9 A;  3KJY A;  2B3S A;  3IC8 A;  5KN2 A;  4OWY A;  4F0C A;  3IOS A;  4OCE A;  2P0G A;  3KIJ A;  2FA4 A;  2H70 A;  1PN9 A;  2DIZ A;  4POM A;  3U5R E;  3HXS A;  19GS A;  4Z2R A;  3M3M A;  4N0V A;  1GSU A;  4GST A;  1JHB A;  1R26 A;  1QGV A;  4NXI A;  1B4P A;  3KH9 A;  1E6B A;  4HQS A;  1AIU A;  5D9W A;  1SJZ A;  4HJM A;  1O85 A;  3Q74 A;  5HFG A;  3H4K A;  5F8B A;  1GUH A;  5KN3 A;  5GST A;  3VI5 A;  3GTU B;  4MH2 A;  4DSS B;  1RK4 A;  4USS A;  4N10 A;  2JAC A;  3GFK A;  1YKA A;  2IFQ B;  3TKS E;  3IXR A;  2YV7 A;  3P90 A;  4MH3 A;  3UJ1 A;  1ZGN A;  1VF2 A;  4D73 B;  2GST A;  1GSD A;  2PVQ A;  1Z9H A;  1KEB A;  2YPM A;  5IMC A;  4MCU A;  4Z2T A;  5IO0 A;  4HDE A;  4E8H A;  5DAK B;  5G30 A;  4O5Q A;  1U3A A;  5LNK e;  4KE3 A;  4I2T A;  4LLR A;  4HI7 A;  5J9B A;  3CTG A;  5ECH B;  2YZH A;  4BL7 A;  3HCZ A;  1WP0 A;  3TUE A;  1GTU A;  6GSU A;  1RW1 A;  2L4C A;  3PPU A;  5ECS A;  1FHE A;  4O92 A;  2H66 A;  1T7P B;  1C72 A;  2B5X A;  1XXU A;  1N2A A;  2HYX A;  2YWM A;  3FRC A;  1QMV A;  3LOR A;  3GL5 A;  3FKF A;  3GMF A;  1WOU A;  1PL1 A;  4G2E A;  1GNW A;  5J5N A;  3CSI A;  3KMO A;  5CRG A;  3KH7 A;  3DVW A;  2GT6 A;  4I6X A;  2AB6 A;  1EOH A;  4I8B A;  3TRQ A;  3CSJ A;  2OA7 A;  2GDR A;  3NZN A;  2H71 A;  1X9M B;  2IJY A;  1PFO A;  4DVC A;  5CRH A;  2IMF A;  3HZ4 A;  3LXZ A;  1B4Q A;  3C73 A;  4IN0 A;  1EZK A;  2WUL A;  3EYT A;  1THX A;  2WGR A;  3HVX A;  5EY6 A;  2X64 A;  5FT3 A;  8GSS A;  2H1D A;  2VL3 A;  2HZE A;  3U6V A;  13GS A;  3CRT A;  3IA1 A;  3UIW A;  5ECR B;  2REM A;  4KH7 A;  4G9H A;  2RUF A;  4AF2 A;  1ZL9 A;  2X8H A;  2H76 A;  3F9U A;  3LW9 A;  2I9H A;  1GLP A;  2L5O A;  2K9F A;  4KGI A;  1URM A;  3RDW A;  3LEF A;  1PKZ A;  1M0U A;  1VF1 A;  5KN0 A;  1G7E A;  2XHF A;  1T4Y A;  1B8X A;  2C0D A;  3FW2 A;  1ML6 A;  4KUN A;  2A2R A;  4KSO A;  2DML A;  3GRX A;  1I5G A;  5ENU A;  3TCO A;  2FGX A;  2HLS A;  2GSS A;  3HD5 A;  2ES7 A;  2DJ1 A;  2VD0 A;  1K0M A;  2H01 A;  4IQA A;  4XRD A;  1SL2 B;  9GSS A;  1GH2 A;  5EPF A;  3TKS C;  3UVT A;  5KOW A;  3KEB A;  3J7Y b;  3UOM A;  1XVW A;  1F3B A;  4KDU A;  3NOF A;  5IIZ A;  3CTF A;  1ILO A;  1GTA A;  4PQI A;  1VF4 A;  4PNG A;  4KCA A;  1JFU A;  5GAP D;  3D6I A;  2LRN A;  3SBC A;  2FWG A;  4V1A p;  3DD3 A;  3APO A;  1O6J A;  4MA9 A;  1U3I A;  2AAW A;  2I81 A;  4YAP A;  4X0X A;  1G6Y A;  3M8N A;  3EMP A;  2OBK A;  3QFA C;  2K8V A;  2NPB A;  3H8Q A;  1TTZ A;  3DIE A;  1O8X A;  3BOA A;  2RII A;  4E8E A;  2VUP A;  3ERG A;  14GS A;  3IHG A;  1WJK A;  2OKA A;  2AV4 A;  1AW9 A;  1M9A A;  3CMI A;  2C0F A;  1J08 A;  2H19 A;  2JZR A;  2KP1 A;  4MF7 A;  1XWG A;  4HOJ A;  1J9B A;  4TKY A;  4ZBA A;  5IQY A;  3GYK A;  5ID2 A;  12GS A;  4JR4 A;  4EIP A;  5AIV A;  2GT5 A;  4TXV A;  2A4V A;  2V41 A;  2PUK C;  5IMZ A;  2CX4 A;  4XRA A;  5E59 A;  2HI7 A;  2F8A A;  1BYE A;  3DXB A;  4EO3 A;  5CP1 A;  4F03 A;  1WWJ A;  4WF4 A;  1THO A;  3SWL A;  3F4S A;  4XS1 A;  2ZUP A;  5ELG A;  1KBN A;  3ZRE A;  1E2Y A;  3IE3 A;  2L5L A;  1FOH A;  5DQY A;  3ZFB A;  2YWO A;  6GSW A;  4WKW A;  4DSR A;  2FWH A;  1N8J A;  2PN8 A;  3R3E A;  1H75 A;  3L9U A;  1FB0 A;  3FYG A;  4ACS A;  5CAX A;  2KOK A;  1UN2 A;  3W6G A;  4WR5 A;  2PMT A;  5LD0 A;  2VL9 A;  3HY2 A;  3VLN A;  1NHO A;  5B8A A;  2LNS A;  2K18 A;  4PQH A;  5G1K A;  3GHA A;  5D8I A;  4BVX A;  4ZB9 A;  3GH9 A;  4K2D A;  3V1W A;  1R4W A;  4I97 A;  3QD9 A;  1XVQ A;  3HJM A;  3KXO A;  5DAL A;  1Z3E A;  4ICY A;  4QQ7 A;  3VWU A;  2CAI A;  1M2B A;  2FD3 A;  1PA3 A;  3TJJ A;  2GLR A;  3QOU A;  3C7M A;  1XW6 A;  4AJ7 A;  1V58 A;  1GUM A;  1O81 A;  3UL3 A;  5B8B A;  2VL2 C;  4TR1 B;  5C00 A;  4BPY A;  4EUY A;  5DCG A;  2C80 A;  2FY6 A;  2B7J A;  3ZVJ A;  5E4W A;  3FZ4 A;  4IKH A;  3F8U A;  1SKS B;  2PPT A;  1TK5 B;  2FA8 A;  3IBH A;  5JWR B;  4BA7 A;  5A4V A;  3OR5 A;  1OYJ A;  2PVO C;  2XBQ A;  3IV4 A;  3VPQ A;  2LST A;  4V2L A;  3KMN A;  2C0E A;  2K8S A;  3TJK A;  4EDZ A;  2B5E A;  4YQU A;  3QMX A;  1YQ1 A;  2H6Z A;  4FO5 A;  3IK9 A;  1XWA A;  1OKT A;  4K1F A;  1W4V A;  4J2F A;  1XWB A;  1ZYN A;  3PIN A;  1VGL A;  5HR2 A;  2RUE A;  2HXK A;  1JZO A;  1TU7 A;  3G7I A;  2VD1 A;  3EVI A;  2HZF A;  3E9J B;  6GST A;  4CY6 A;  5ID2 B;  1FG4 A;  3FK8 A;  2V2G A;  4AJ6 A;  3KP8 A;  3RHC A;  3HKR A;  2B1L A;  2M72 A;  1LU4 A;  1TOF A;  5HR1 A;  2JL4 A;  3TGZ A;  3LSZ A;  4LL4 B;  17GS A;  1OVN A;  4L0U A;  1XZO A;  2A4H A;  4HS1 A;  1K0N A;  1GNE A;  4LA1 A;  20GS A;  1Z6N A;  2HE3 A;  2CVB A;  3D4T A;  1K0O A;  3IK7 A;  3GKX A;  3GL3 A;  2KLX A;  2YOI A;  4XIH A;  1S3D A;  1EGO A;  2E2G A;  4O32 A;  1M3J A;  2K6V A;  3WGX A;  11GS A;  2VAF A;  2O87 A;  3LXT A;  1TI3 A;  2E0Q A;  3ZML A;  1ABA A;  2C4J A;  1EP8 A;  3EE2 A;  4EE0 A;  5IOX A;  4WBR D;  1K0C A;  1SYR A;  4BVX B;  3GKM A;  1JLV A;  2NVL A;  1AQW A;  6GSX A;  1A8Y A;  2GZZ A;  2F51 A;  3GKK A;  2YWI A;  4MK3 A;  1HYU A;  2OAD A;  2IWT A;  5DAL B;  3TKS A;  3GIX A;  2DBC A;  4K2X A;  4FYB A;  5COH A;  2YWN A;  5D93 A;  4HUA A;  5BRT A;  3NIV A;  4HZ4 A;  1EV9 A;  2N5B A;  4X1U A;  4OD7 A;  4O7H A;  1GUL A;  1TDI A;  3GST A;  3H93 A;  1HNC A;  2GQK A;  3JCM L;  1ZYQ B;  4A5P A;  5F0G A;  4MJB A;  3GKN A;  1YEP A;  2RLI A;  2P5Q A;  3MDK A;  3L78 A;  3G7J A;  2O85 A;  1DE1 A;  2LRT A;  4GSN A;  3ZVJ D;  2OE3 A;  1YF0 A;  1ERU A;  4GTU A;  2N5A A;  3FR3 A;  1G7O A;  3UVH A;  4G19 A;  5ECO B;  4JZQ A;  1JZR A;  2CA8 A;  3MIX A;  4KAE A;  2RM5 A;  2R0C A;  2H74 A;  3FHK A;  2FWE A;  3VUR A;  2JZT A;  1BG5 A;  2F8F A;  2TRX A;  2EIR A;  1ZYP A;  3LQ7 A;  2CVD A;  1YJ6 A;  4MAB A;  4GF0 A;  2F9S A;  2CZ3 A;  1ZCP A;  2A2P A;  3HYP A;  3O3T A;  3GX0 A;  4PQ1 A;  5B7C A;  2X8C A;  4HZ2 A;  4PTS A;  4TOP A;  4O5R A;  1OC9 A;  1USB A;  4KF9 A;  3D21 A;  4TN8 A;  1GSE A;  2QSI A;  3GN3 A;  4IW9 A;  1FW1 A;  1HD2 A;  2H1B A;  1K0B A;  1YF1 A;  4MF6 A;  1QK8 A;  1X5D A;  2EC4 A;  2OJL A;  4K0G A;  1EEM A;  3EC3 A;  4FYC A;  5IPG A;  1SK0 A;  3I43 A;  3EUR A;  3Q6O A;  1X0R A;  5DVB A;  3PH9 A;  1ZZY A;  2E7P A;  3C1R A;  1TRW A;  4K7I A;  1U88 A;  4TR3 A;  4PGT A;  4L8E A;  5ECM B;  4F82 A;  1OAZ A;  5KN1 A;  2H75 A;  3KTL A;  4Q5Q A;  2H0G A;  5G5F A;  4K7N A;  2L59 A;  1SL0 B;  3Q18 A;  2QA2 A;  4F2I A;  3MAK A;  3I6A A;  3TJG A;  3GNJ A;  4YQV A;  1IYH A;  3TKR A;  2IL3 A;  4GQF A;  1PL2 A;  3IPZ A;  4GLT A;  5BMU A;  2VCW A;  1XOA A;  1K3Y A;  1XWK A;  2NBS A;  5CNW A;  3BCK A;  3ZL5 A;  4POB A;  3D0Z A;  2VL2 A;  4Z7X A;  2B6M A;  4HJ2 A;  2BTO T;  3DVX A;  4ZIL A;  22GS A;  1AUC A;  1G6W A;  3LJR A;  3VPT A;  2PBJ A;  3EPT A;  3F3R A;  2VLU A;  5IMA A;  4ISD A;  1MD4 A;  1VRS D;  3E3E A;  4GSS A;  5DJM A;  1K3L A;  4Z2U A;  4CHS A;  3KGK A;  4WR4 A;  3WT1 A;  1O73 A;  1SEN A;  5KOX A;  2VLT A;  3WD6 A;  3KD0 A;  2LKU A;  4OCF A;  1J0F A;  4OFM A;  1MDI A;  3A5W A;  3N9J A;  2N5F A;  4PUR A;  4FQU A;  2XBI A;  1M9B A;  3F4T A;  1PX7 A;  4LL1 B;  4IS0 A;  1F37 A;  2IMK A;  5GAN D;  2HNL A;  3HZ8 A;  3A2X A;  2E2M A;  5A4W A;  2WJU A;  5D9V A;  5A5K A;  2O89 A;  5IM9 A;  2QA1 A;  4ZIJ A;  2WB9 A;  3ZZX A;  4N0Z A;  5F06 A;  3C71 A;  3BBY A;  2MYG A;  1EP7 A;  1V98 A;  2DJ2 A;  4XS6 A;  3GUS A;  4KX4 A;  4AJ8 A;  1BQ7 A;  2C0G A;  4MZC A;  2RM6 A;  3TOT A;  1BAY A;  3PR8 A;  5DQS A;  2EIO A;  1FVK A;  1T3B A;  2M80 A;  2J23 A;  3BCI A;  1U6T A;  4BL7 B;  1TI1 A;  2BJX A;  2FHE A;  2OE1 A;  2YN1 A;  4IJI A;  4EDY A;  2GZP A;  4MPG A;  4P3Y B;  3RPP A;  2OAC A;  2R4V A;  4KDY A;  4LMW A;  1OC9 B;  5F05 A;  1A0R P;  1JZD A;  4XTS A;  4K5R A;  2DSA A;  4KND A;  5C04 A;  2I1U A;  3UEM A;  1W89 A;  3RPN A;  3WGE A;  4YKF A;  5HFK A;  1R5P A;  1F3A A;  1RQM A;  5HR0 A;  4OFT A;  4ML6 A;  4ZL7 A;  1OKD A;  4TRX A;  1SKR B;  1X5C A;  3UMA A;  2L4Q A;  3VFI A;  5D73 A;  2IME A;  5DDL A;  4TR4 A;  2P5R A;  2VCZ A;  3TKP A;  2HZE B;  1T4Z A;  2H72 A;  2LV3 A;  1QQ2 A;  1ZYE A;  5AIS A;  1WIK A;  5DCH A;  1ERV A;  1SD8 A;  3F6F A;  2V32 A;  1MEK A;  4DEJ A;  2NDO A;  3HHV A;  4RQR A;  1ERT A;  1O7U A;  3F6D A;  2HT9 A;  4K0N A;  4ECB A;  4ML1 A;  2M46 A;  4WET A;  2O7K A;  1XPV A;  1R5A A;  2I4A A;  4KSM A;  4F0B A;  5IMD A;  7GSS A;  3FEU A;  1LJR A;  3GV1 A;  1A2M A;  4MJC A;  3O6T A;  3Q19 A;  2CVK A;  2GQL A;  4WXT A;  1V40 A;  3TRP A;  2C8U A;  1JLW A;  4N30 A;  1MDK A;  4X4J A;  3LYK A;  2ON5 A;  3MNG A;  2L6D A;  5AN1 A;  4NPB A;  5CRW A;  4FH8 A;  3GUR A;  2DJ0 A;  1XW5 A;  3GSS A;  3HJP A;  6GSS A;  2R0P A;  1UVZ A;  1NM3 A;  1FAA A;  1T8E B;  4ZB6 A;  5AIX A;  3QAW A;  3UAP A;  1Z7R A;  4XCS A;  4CDO A;  1PN0 A;  3P8W A;  2VCQ A;  1EGR A;  2C3T A;  2XPD A;  3DRN A;  2IN3 A;  4K5S A;  4PUF C;  2H0H A;  5JWQ B;  2F3M A;  2BMX A;  3KCM A;  2CX3 A;  3D4M A;  2OE0 A;  4IQ1 A;  2AJQ B;  1SD9 A;  2IMI A;  4G10 A;  2TRC P;  4L5L A;  3AY8 A;  2DIY A;  2HSY A;  2LQQ A;  2PU9 C;  1MD3 A;  2YV9 A;  2LTK A;  1ERW A;  2KP2 A;  4LMV A;  5FHI A;  4QL9 A;  1DBY A;  4DSQ A;  3IC4 A;  4FYU A;  5L71 A;  4TXO A;  1R7H A;  2QKE A;  4ZL8 A;  16GS A;  3S9F A;  2HRK A;  4KA0 A;  5D9X A;  4RI7 A;  3DKS A;  5HQP A;  2LQO A;  1B9X C;  3KZQ A;  4HU9 A;  1SJ6 A;  5JCW A;  4WEY A;  3US3 A;  3P2A A;  1B9Y C;  4ULX A;  4EC0 A;  1XWC A;  3MYD A;  1AQX A;  2J9H A;  3A3T A;  5HR3 A;  2GGT A;  4MZW A;  10GS A;  3QFB C;  3ZFL A;  3ERW A;  2MBT A;  1F9M A;  4KB3 A;  4NMU A;  3ME8 A;  4GCI A;  3VWV A;  2JU5 A;  3EU3 A;  4X43 A;  1G0T A;  1ON4 A;  4MMM A;  1AXD A;  1SK1 A;  1WE0 A;  2VOC A;  2G2Q A;  2MMZ A;  4K6X A;  3EMX A;  2PGT A;  18GS A;  4ZBD A;  1TW9 A;  2MMO A;  2JSZ A;  4MP4 A;  5EL8 A;  4BIK A;  4TR0 A;  2MZC A;  2R5G A;  1GRX A;  2YJ7 A;  3IRA A;  1M2A A;  1GWC A;  1OE7 A;  1S3C A;  4IHU A;  4MPF A;  3A2W A;  2P31 A;  3P7X A;  1U87 A;  1Z6M A;  2H6X A;  2YAN A;  2DLX A;  4ZXG A;  1TJD A;  2C3Q A;  1Y25 A;  5B6M A;  3O76 A;  1DE2 A;  3LFL A;  4F9Z A;  1XOB A;  1TRU A;  4TW5 A;  2YNX A;  5ECK B;  1Y6E A;  3L9V A;  3TJF A;  4WF5 A;  1TRV A;  2R37 A;  4GRF A;  2X99 A;  3DGQ A;  1XBS A;  1GL8 A;  2DJ3 A;  4I2U A;  4EXJ A;  2X8G A;  2GVP A;  3MWH A;  4FIW A;  5ECP B;  4XS4 A;  4ECC A;  1BED A;  4AGS A;  2H30 A;  1SJI A;  5CYY A;  5FWG A;  2R3X A;  1SKW B;  3IR4 A;  3I69 A;  4RQX A;  5J4U A;  2LJA A;  2TIR A;  3ZIJ A;  4EIQ A;  3RHB A;  4RI6 A;  3DEX A;  2WFC A;  1ZMA A;  5ECI B;  1Q4J A;  2H8L A;  3E0U A;  4MJE A;  5AGY A;  4PX1 A;  4V2M A;  2ON7 A;  4V2N A;  2L6C A;  3ED3 A;  1M3I A;  5CO3 A;  4YH2 A;  4EKZ A;  5DBQ A;  3F0I A;  1OC8 A;  1A8L A;  4EL1 A;  5J3R A;  3ZRD A;  3DML A;  2GS3 A;  3ERF A;  4TXO B;  2FCH A;  3FY7 A;  1H4O A;  3CSH A;  3H79 A;  2VLV A;  5KEJ A;  1M7T A;  2HRA A;  2C3N A;  1YKC A;  1WPI A;  4OO4 A;  1A2L A;  4RUV A;  1SL1 B;  5ECQ B;  2LRC A;  2V6O A;  2WS2 A;  1WRY A;  4HEA 2;  1CQG A;  4K7O A;  5LCZ A;  1PQN A;  4J57 E;  5ABR A;  1QXH A;  3HVN A;  3R2Q A;  1ST9 A;  3GH6 A;  5HFI A;  2VO4 A;  5IPH A;  4WBJ A;  2GQM A;  4HSC X;  1YDK A;  4OO5 A;  2I3Y A;  1SU9 A;  2LNT A;  5G1L A;  1SK2 A;  2LUS A;  3ZMK A;  2MBS A;  4OMV A;  5IOW A;  2X4A A;  1MDJ A;  3L0H A;  1XFL A;  2ZCT A;  4JR6 A;  3A5I A;  1HNA A;  4PNF A; 
#chains in the Genus database with same CATH homology
 5H5Q A;  1DUG A;  3UBK A;  2EIQ A;  2WCI A;  4IP1 A;  3VK9 A;  4NAX A;  2XPE A;  5D96 A;  1IYI A;  3IHQ A;  2H1G A;  2HFD A;  4XHM A;  3D5J A;  2FWF A;  3QAG A;  1OE8 A;  4ZB8 A;  1FVJ A;  4NHW A;  3TRX A;  1GSQ A;  2R6K A;  4O5U A;  2A2S A;  3F4R A;  1B48 A;  4NV2 A;  4K8M A;  2JZS A;  1I9D A;  1AC1 A;  3C8E A;  4L0W A;  4JE1 A;  4I5Q A;  3D22 A;  1Z7P A;  3M9J A;  4HQZ A;  3FMW A;  1Q98 A;  4ZL9 A;  3MSZ A;  5ECN B;  2AYT A;  3IAS 2;  3M9K A;  3N5O A;  1KTE A;  2IPA A;  3EWL A;  4EF0 A;  1ACV A;  1V2A A;  4TR1 A;  2FNO A;  1HQO A;  1AQV A;  3TKQ A;  4L5O A;  1VF3 A;  1WMJ A;  2V1M A;  2HRN A;  4POK A;  4XS4 B;  1DSB A;  3M1G A;  1PKW A;  1GSY A;  2CT6 A;  3RAZ A;  1YY7 A;  2GZY A;  5F07 A;  4IVF A;  1A23 A;  4ECI A;  2XC2 A;  1FOV A;  4PXO A;  5IMV A;  3G7Y A;  4N11 A;  1T00 A;  3DYR A;  1GSS A;  3FZA A;  3WYW A;  5ECL B;  1GSF A;  2DC5 A;  3I9V 2;  3APQ A;  1PMT A;  3H1N A;  2R2J A;  2JAD A;  4EVM A;  1GTB A;  4YKG A;  3KP9 A;  5GZZ B;  3VWX A;  1TXX A;  3L4N A;  1EWX A;  4KCE A;  1LBK A;  4BWQ A;  4ZBB A;  3CXG A;  2C1Y A;  5INY A;  2CZ2 A;  4TVE A;  2YP6 A;  4PUA A;  1EOG A;  5G31 A;  3BD2 A;  1X9S B;  4H86 A;  4NHZ A;  3QAV A;  3GA4 A;  1FB6 A;  2B5Y A;  4Q5F A;  1NSW A;  3LGC A;  1S3A A;  5ELA A;  1TKD B;  2WZ9 A;  1NHY A;  1TRS A;  3FR6 A;  4JBB A;  3RBT A;  2AHE A;  3CYN A;  1TK8 B;  2VCT A;  4BVY A;  2AUV A;  2VCX A;  3DWV A;  3W8J A;  3ZTL A;  1PD2 1;  4V1A g;  4MZB A;  1K0D A;  5A4U A;  1JZW A;  4IP6 A;  2H73 A;  2VM1 A;  2LS5 A;  4G0K A;  3G9B A;  3WGD A;  4KW6 A;  2X49 A;  1K3O A;  3QR6 A;  1TP9 A;  4IEL A;  1YEX A;  2WDU A;  3M0F A;  2VCV A;  3VWW A;  2HSH A;  3CBU A;  2HSM A;  1A0F A;  3FZ5 A;  2GTU A;  3APS A;  3FR9 A;  2JSY A;  3W8S A;  5GSS A;  5G5E A;  3IDV A;  4GQC A;  4J56 E;  4CY8 A;  1AAZ A;  4Q5R A;  4JU5 A;  5G2Z A;  3KTB A;  1XIY A;  1F6M C;  1FO5 A;  3HDC A;  6GSY A;  1A24 A;  2QGV A;  1BJX A;  3HA9 A;  3HJO A;  5EVO A;  3TDG A;  3TOU A;  2B7K A;  5IMF A;  2LJK A;  3ME7 A;  3GX8 A;  2DKI A;  1EV4 A;  2LJR A;  1F2E A;  1NW2 A;  2WRT A;  1TK0 B;  2G0F A;  5CRD A;  3PGT A;  2HRF A;  3CRU A;  1GP1 A;  2KUC A;  2LEG A;  2MMN A;  2QC7 A;  3C1S A;  5JCU A;  3HVS A;  1QFN A;  4IJ3 A;  2OBI A;  1GTI A;  3KM6 A;  3LG6 A;  2PER A;  3UAR A;  5B6N A;  4ILF A;  3GTU A;  1PGT A;  1OC3 A;  2DJJ A;  3UBL A;  4DSS A;  3WT2 A;  2GSR A;  2L57 A;  1X9W B;  2CQ9 A;  3ZIV A;  1XW9 A;  2IFQ A;  3F63 A;  2O8V B;  1A2J A;  3K8N A;  3VI7 A;  2H6Y A;  4JED A;  3BJ5 A;  5D9T A;  4D73 A;  1V57 A;  1TU8 A;  1K0A A;  2YJH A;  1GLQ A;  4NV5 A;  2B1K A;  4GXZ A;  4JRR A;  4ID0 A;  3L9S A;  4HU7 A;  4BWS A;  4ECJ A;  2DJK A;  4YQM A;  3F3Q A;  3ZIT A;  4G0I A;  3ZYW A;  3A2V A;  3TJB A;  5DAK A;  4IGJ A;  2DMM A;  3TB2 A;  3EIN A;  2IMD A;  4MLY A;  4K9Z A;  4MDC A;  2Z9S A;  2VIM A;  1PSQ A;  3HVV A;  1MTC A;  4MNN A;  5CRE A;  4YAV A;  5H5S A;  1UC7 A;  5JCG A;  5IO2 A;  4NWY A;  2VM2 A;  2NTO A;  4GWR A;  1HNB A;  1GUK A;  1O8W A;  5DJL A;  4G0L A;  2DKH A;  1XCC A;  2CV4 A;  4MF5 A;  2UZ8 A;  1X5E A;  1KNG A;  2D2Z A;  1T1V A;  4MJA A;  3QPM A;  2V6K A;  2ALB A;  1UA5 A;  2R0G A;  1V9W A;  4BVY B;  4KDX A;  2KHP A;  1SYX A;  3J7Y k;  4Q5N A;  5J9C A;  4POL A;  1PRX A;  2IIY A;  1YZX A;  1Z5Y E;  3ZLP A;  2YCD A;  3LWA A;  3ISO A;  1BX9 A;  4OFN A;  5J41 A;  5JWO B;  1CQH A;  3IAM 2;  4IBP A;  2H0I A;  3QDN A;  6GSV A;  2MMA A;  2CAQ A;  1M2D A;  2GSQ A;  2PWJ A;  1PX6 A;  2FUG 2;  3EU4 A;  5H5R A;  2YZU A;  1EEJ A;  1ZOF A;  2FLS A;  4QL7 A;  1M99 A;  1QUW A;  3QCP A;  2H1A A;  3LYP A;  2ZNM A;  4CW9 A;  3FZ9 A;  3KJY A;  2B3S A;  3IC8 A;  5KN2 A;  4OWY A;  4F0C A;  3IOS A;  4OCE A;  2P0G A;  3KIJ A;  2FA4 A;  2H70 A;  1PN9 A;  2DIZ A;  4POM A;  3U5R E;  3HXS A;  19GS A;  4Z2R A;  3M3M A;  4N0V A;  1GSU A;  4GST A;  1JHB A;  1R26 A;  1QGV A;  4NXI A;  1B4P A;  3KH9 A;  1E6B A;  4HQS A;  1AIU A;  5D9W A;  1SJZ A;  4HJM A;  1O85 A;  3Q74 A;  5HFG A;  3H4K A;  5F8B A;  1GUH A;  5KN3 A;  5GST A;  3VI5 A;  3GTU B;  4MH2 A;  4DSS B;  1RK4 A;  4USS A;  4N10 A;  2JAC A;  3GFK A;  1YKA A;  2IFQ B;  3TKS E;  3IXR A;  2YV7 A;  3P90 A;  4MH3 A;  3UJ1 A;  1ZGN A;  1VF2 A;  4D73 B;  2GST A;  1GSD A;  2PVQ A;  1Z9H A;  1KEB A;  2YPM A;  5IMC A;  4MCU A;  4Z2T A;  5IO0 A;  4HDE A;  4E8H A;  5DAK B;  5G30 A;  4O5Q A;  1U3A A;  5LNK e;  4KE3 A;  4I2T A;  4LLR A;  4HI7 A;  5J9B A;  3CTG A;  5ECH B;  2YZH A;  4BL7 A;  3HCZ A;  1WP0 A;  3TUE A;  1GTU A;  6GSU A;  1RW1 A;  2L4C A;  3PPU A;  5ECS A;  1FHE A;  4O92 A;  2H66 A;  1T7P B;  1C72 A;  2B5X A;  1XXU A;  1N2A A;  2HYX A;  2YWM A;  3FRC A;  1QMV A;  3LOR A;  3GL5 A;  3FKF A;  3GMF A;  1WOU A;  1PL1 A;  4G2E A;  1GNW A;  5J5N A;  3CSI A;  3KMO A;  5CRG A;  3KH7 A;  3DVW A;  2GT6 A;  4I6X A;  2AB6 A;  1EOH A;  4I8B A;  3TRQ A;  3CSJ A;  2OA7 A;  2GDR A;  3NZN A;  2H71 A;  1X9M B;  2IJY A;  4DVC A;  5CRH A;  2IMF A;  3HZ4 A;  3LXZ A;  1B4Q A;  3C73 A;  4IN0 A;  1EZK A;  2WUL A;  3EYT A;  1THX A;  2WGR A;  3HVX A;  5EY6 A;  2X64 A;  5FT3 A;  8GSS A;  2H1D A;  2VL3 A;  2HZE A;  3U6V A;  13GS A;  3CRT A;  3IA1 A;  3UIW A;  5ECR B;  2REM A;  4KH7 A;  4G9H A;  2RUF A;  4AF2 A;  1ZL9 A;  2X8H A;  2H76 A;  3F9U A;  3LW9 A;  2I9H A;  1GLP A;  2L5O A;  2K9F A;  4KGI A;  1URM A;  3RDW A;  3LEF A;  1PKZ A;  1M0U A;  1VF1 A;  5KN0 A;  1G7E A;  2XHF A;  1T4Y A;  1B8X A;  2C0D A;  3FW2 A;  1ML6 A;  4KUN A;  2A2R A;  4KSO A;  2DML A;  3GRX A;  1I5G A;  5ENU A;  3TCO A;  2FGX A;  2HLS A;  2GSS A;  3HD5 A;  2ES7 A;  2DJ1 A;  2VD0 A;  1K0M A;  2H01 A;  4IQA A;  4XRD A;  1SL2 B;  9GSS A;  1GH2 A;  5EPF A;  3TKS C;  3UVT A;  5KOW A;  3KEB A;  3J7Y b;  3UOM A;  1XVW A;  1F3B A;  4KDU A;  3NOF A;  5IIZ A;  3CTF A;  1ILO A;  1GTA A;  4PQI A;  1VF4 A;  4PNG A;  4KCA A;  1JFU A;  5GAP D;  3D6I A;  2LRN A;  3SBC A;  2FWG A;  4V1A p;  3DD3 A;  3APO A;  1O6J A;  4MA9 A;  1U3I A;  2AAW A;  2I81 A;  4YAP A;  4X0X A;  1G6Y A;  3M8N A;  3EMP A;  2OBK A;  3QFA C;  2K8V A;  2NPB A;  3H8Q A;  1TTZ A;  3DIE A;  1O8X A;  3BOA A;  2RII A;  4E8E A;  2VUP A;  3ERG A;  14GS A;  3IHG A;  1WJK A;  2OKA A;  2AV4 A;  1AW9 A;  1M9A A;  3CMI A;  2C0F A;  1J08 A;  2H19 A;  2JZR A;  2KP1 A;  4MF7 A;  1XWG A;  4HOJ A;  1J9B A;  4TKY A;  4ZBA A;  5IQY A;  3GYK A;  5ID2 A;  12GS A;  4JR4 A;  4EIP A;  5AIV A;  2GT5 A;  4TXV A;  2A4V A;  2V41 A;  2PUK C;  5IMZ A;  2CX4 A;  4XRA A;  5E59 A;  2HI7 A;  2F8A A;  1BYE A;  3DXB A;  4EO3 A;  5CP1 A;  4F03 A;  1WWJ A;  4WF4 A;  1THO A;  3SWL A;  3F4S A;  4XS1 A;  2ZUP A;  5ELG A;  1KBN A;  3ZRE A;  1E2Y A;  3IE3 A;  2L5L A;  1FOH A;  5DQY A;  3ZFB A;  2YWO A;  6GSW A;  4WKW A;  4DSR A;  2FWH A;  1N8J A;  2PN8 A;  3R3E A;  1H75 A;  3L9U A;  1FB0 A;  3FYG A;  4ACS A;  5CAX A;  2KOK A;  1UN2 A;  3W6G A;  4WR5 A;  2PMT A;  5LD0 A;  2VL9 A;  3HY2 A;  3VLN A;  1NHO A;  5B8A A;  2LNS A;  2K18 A;  4PQH A;  5G1K A;  3GHA A;  5D8I A;  4BVX A;  4ZB9 A;  3GH9 A;  4K2D A;  3V1W A;  1R4W A;  4I97 A;  3QD9 A;  1XVQ A;  3HJM A;  3KXO A;  5DAL A;  1Z3E A;  4ICY A;  4QQ7 A;  3VWU A;  2CAI A;  1M2B A;  2FD3 A;  1PA3 A;  3TJJ A;  2GLR A;  3QOU A;  3C7M A;  1XW6 A;  4AJ7 A;  1V58 A;  1GUM A;  1O81 A;  3UL3 A;  5B8B A;  2VL2 C;  4TR1 B;  5C00 A;  4BPY A;  4EUY A;  5DCG A;  2C80 A;  2FY6 A;  2B7J A;  3ZVJ A;  5E4W A;  3FZ4 A;  4IKH A;  3F8U A;  1SKS B;  2PPT A;  1TK5 B;  2FA8 A;  3IBH A;  5JWR B;  4BA7 A;  5A4V A;  3OR5 A;  1OYJ A;  2PVO C;  2XBQ A;  3IV4 A;  3VPQ A;  2LST A;  4V2L A;  3KMN A;  2C0E A;  2K8S A;  3TJK A;  4EDZ A;  2B5E A;  4YQU A;  3QMX A;  1YQ1 A;  2H6Z A;  4FO5 A;  3IK9 A;  1XWA A;  1OKT A;  4K1F A;  1W4V A;  4J2F A;  1XWB A;  1ZYN A;  3PIN A;  1VGL A;  5HR2 A;  2RUE A;  2HXK A;  1JZO A;  1TU7 A;  3G7I A;  2VD1 A;  3EVI A;  2HZF A;  3E9J B;  6GST A;  4CY6 A;  5ID2 B;  1FG4 A;  3FK8 A;  2V2G A;  4AJ6 A;  3KP8 A;  3RHC A;  3HKR A;  2B1L A;  2M72 A;  1LU4 A;  1TOF A;  5HR1 A;  2JL4 A;  3TGZ A;  3LSZ A;  4LL4 B;  17GS A;  1OVN A;  4L0U A;  1XZO A;  2A4H A;  4HS1 A;  1K0N A;  1GNE A;  4LA1 A;  20GS A;  1Z6N A;  2HE3 A;  2CVB A;  3D4T A;  1K0O A;  3IK7 A;  3GKX A;  3GL3 A;  2KLX A;  2YOI A;  4XIH A;  1S3D A;  1EGO A;  2E2G A;  4O32 A;  2K6V A;  3WGX A;  11GS A;  2VAF A;  2O87 A;  3LXT A;  1TI3 A;  2E0Q A;  3ZML A;  1ABA A;  2C4J A;  1EP8 A;  3EE2 A;  4EE0 A;  5IOX A;  4WBR D;  1K0C A;  1SYR A;  4BVX B;  3GKM A;  1JLV A;  2NVL A;  1AQW A;  6GSX A;  1A8Y A;  2GZZ A;  2F51 A;  3GKK A;  2YWI A;  4MK3 A;  1HYU A;  2OAD A;  2IWT A;  5DAL B;  3TKS A;  3GIX A;  2DBC A;  4K2X A;  4FYB A;  5COH A;  2YWN A;  5D93 A;  4HUA A;  5BRT A;  3NIV A;  4HZ4 A;  1EV9 A;  2N5B A;  4X1U A;  4OD7 A;  4O7H A;  1GUL A;  1TDI A;  3GST A;  3H93 A;  1HNC A;  2GQK A;  3JCM L;  1ZYQ B;  4A5P A;  5F0G A;  4MJB A;  3GKN A;  1YEP A;  2RLI A;  2P5Q A;  3MDK A;  3L78 A;  3G7J A;  2O85 A;  1DE1 A;  2LRT A;  4GSN A;  3ZVJ D;  2OE3 A;  1YF0 A;  1ERU A;  4GTU A;  2N5A A;  3FR3 A;  1G7O A;  3UVH A;  4G19 A;  5ECO B;  4JZQ A;  1JZR A;  2CA8 A;  3MIX A;  4KAE A;  2RM5 A;  2R0C A;  2H74 A;  3FHK A;  2FWE A;  3VUR A;  2JZT A;  1BG5 A;  2F8F A;  2TRX A;  2EIR A;  1ZYP A;  3LQ7 A;  2CVD A;  1YJ6 A;  4MAB A;  4GF0 A;  2F9S A;  2CZ3 A;  1ZCP A;  2A2P A;  3HYP A;  3O3T A;  3GX0 A;  4PQ1 A;  5B7C A;  2X8C A;  4HZ2 A;  4PTS A;  4TOP A;  4O5R A;  1OC9 A;  1USB A;  4KF9 A;  3D21 A;  4TN8 A;  1GSE A;  2QSI A;  3GN3 A;  4IW9 A;  1FW1 A;  1HD2 A;  2H1B A;  1K0B A;  1YF1 A;  4MF6 A;  1QK8 A;  1X5D A;  2EC4 A;  2OJL A;  4K0G A;  1EEM A;  3EC3 A;  4FYC A;  5IPG A;  1SK0 A;  3I43 A;  3EUR A;  3Q6O A;  1X0R A;  5DVB A;  3PH9 A;  1ZZY A;  2E7P A;  3C1R A;  1TRW A;  4K7I A;  1U88 A;  4TR3 A;  4PGT A;  4L8E A;  5ECM B;  4F82 A;  1OAZ A;  5KN1 A;  2H75 A;  3KTL A;  4Q5Q A;  2H0G A;  5G5F A;  4K7N A;  2L59 A;  1SL0 B;  3Q18 A;  2QA2 A;  4F2I A;  3MAK A;  3I6A A;  3TJG A;  3GNJ A;  4YQV A;  1IYH A;  3TKR A;  2IL3 A;  4GQF A;  1PL2 A;  3IPZ A;  4GLT A;  5BMU A;  2VCW A;  1XOA A;  1K3Y A;  1XWK A;  2NBS A;  5CNW A;  3BCK A;  3ZL5 A;  4POB A;  3D0Z A;  2VL2 A;  4Z7X A;  2B6M A;  4HJ2 A;  2BTO T;  3DVX A;  4ZIL A;  22GS A;  1AUC A;  1G6W A;  3LJR A;  3VPT A;  2PBJ A;  3EPT A;  3F3R A;  2VLU A;  5IMA A;  4ISD A;  1MD4 A;  1VRS D;  3E3E A;  4GSS A;  5DJM A;  1K3L A;  4Z2U A;  4CHS A;  3KGK A;  4WR4 A;  3WT1 A;  1O73 A;  1SEN A;  5KOX A;  2VLT A;  3WD6 A;  3KD0 A;  2LKU A;  4OCF A;  1J0F A;  4OFM A;  1MDI A;  3A5W A;  3N9J A;  2N5F A;  4PUR A;  4FQU A;  2XBI A;  1M9B A;  3F4T A;  1PX7 A;  4LL1 B;  4IS0 A;  1F37 A;  2IMK A;  5GAN D;  2HNL A;  3HZ8 A;  3A2X A;  2E2M A;  5A4W A;  2WJU A;  5D9V A;  5A5K A;  2O89 A;  5IM9 A;  2QA1 A;  4ZIJ A;  2WB9 A;  3ZZX A;  4N0Z A;  5F06 A;  3C71 A;  3BBY A;  2MYG A;  1EP7 A;  1V98 A;  2DJ2 A;  4XS6 A;  3GUS A;  4KX4 A;  4AJ8 A;  1BQ7 A;  2C0G A;  4MZC A;  2RM6 A;  3TOT A;  1BAY A;  3PR8 A;  5DQS A;  2EIO A;  1FVK A;  1T3B A;  2M80 A;  2J23 A;  3BCI A;  1U6T A;  4BL7 B;  1TI1 A;  2BJX A;  2FHE A;  2OE1 A;  2YN1 A;  4IJI A;  4EDY A;  2GZP A;  4MPG A;  4P3Y B;  3RPP A;  2OAC A;  2R4V A;  4KDY A;  4LMW A;  1OC9 B;  5F05 A;  1A0R P;  1JZD A;  4XTS A;  4K5R A;  2DSA A;  4KND A;  5C04 A;  2I1U A;  3UEM A;  1W89 A;  3RPN A;  3WGE A;  4YKF A;  5HFK A;  1R5P A;  1F3A A;  1RQM A;  5HR0 A;  4OFT A;  4ML6 A;  4ZL7 A;  1OKD A;  4TRX A;  1SKR B;  1X5C A;  3UMA A;  2L4Q A;  3VFI A;  5D73 A;  2IME A;  5DDL A;  4TR4 A;  2P5R A;  2VCZ A;  3TKP A;  2HZE B;  1T4Z A;  2H72 A;  2LV3 A;  1QQ2 A;  1ZYE A;  5AIS A;  1WIK A;  5DCH A;  1ERV A;  1SD8 A;  3F6F A;  2V32 A;  1MEK A;  4DEJ A;  2NDO A;  3HHV A;  4RQR A;  1ERT A;  1O7U A;  3F6D A;  2HT9 A;  4K0N A;  4ECB A;  4ML1 A;  2M46 A;  4WET A;  2O7K A;  1XPV A;  1R5A A;  2I4A A;  4KSM A;  4F0B A;  5IMD A;  7GSS A;  3FEU A;  1LJR A;  3GV1 A;  1A2M A;  4MJC A;  3O6T A;  3Q19 A;  2CVK A;  2GQL A;  4WXT A;  1V40 A;  3TRP A;  2C8U A;  1JLW A;  4N30 A;  1MDK A;  4X4J A;  3LYK A;  2ON5 A;  3MNG A;  2L6D A;  5AN1 A;  4NPB A;  5CRW A;  4FH8 A;  3GUR A;  2DJ0 A;  1XW5 A;  3GSS A;  3HJP A;  6GSS A;  2R0P A;  1UVZ A;  1NM3 A;  1FAA A;  1T8E B;  4ZB6 A;  5AIX A;  3QAW A;  3UAP A;  1Z7R A;  4XCS A;  4CDO A;  1PN0 A;  3P8W A;  2VCQ A;  1EGR A;  2C3T A;  2XPD A;  3DRN A;  2IN3 A;  4K5S A;  4PUF C;  2H0H A;  5JWQ B;  2F3M A;  2BMX A;  3KCM A;  2CX3 A;  3D4M A;  2OE0 A;  4IQ1 A;  2AJQ B;  1SD9 A;  2IMI A;  4G10 A;  2TRC P;  4L5L A;  3AY8 A;  2DIY A;  2HSY A;  2LQQ A;  2PU9 C;  1MD3 A;  2YV9 A;  2LTK A;  1ERW A;  2KP2 A;  4LMV A;  5FHI A;  4QL9 A;  1DBY A;  4DSQ A;  3IC4 A;  4FYU A;  5L71 A;  4TXO A;  1R7H A;  2QKE A;  4ZL8 A;  16GS A;  3S9F A;  2HRK A;  4KA0 A;  5D9X A;  4RI7 A;  3DKS A;  5HQP A;  2LQO A;  1B9X C;  3KZQ A;  4HU9 A;  1SJ6 A;  5JCW A;  4WEY A;  3US3 A;  3P2A A;  1B9Y C;  4ULX A;  4EC0 A;  1XWC A;  3MYD A;  1AQX A;  2J9H A;  3A3T A;  5HR3 A;  2GGT A;  4MZW A;  10GS A;  3QFB C;  3ZFL A;  3ERW A;  2MBT A;  1F9M A;  4KB3 A;  4NMU A;  3ME8 A;  4GCI A;  3VWV A;  2JU5 A;  3EU3 A;  4X43 A;  1G0T A;  1ON4 A;  4MMM A;  1AXD A;  1SK1 A;  1WE0 A;  2VOC A;  2G2Q A;  2MMZ A;  4K6X A;  3EMX A;  2PGT A;  18GS A;  4ZBD A;  1TW9 A;  2MMO A;  2JSZ A;  4MP4 A;  5EL8 A;  4TR0 A;  2MZC A;  2R5G A;  1GRX A;  2YJ7 A;  3IRA A;  1M2A A;  1GWC A;  1OE7 A;  1S3C A;  4IHU A;  4MPF A;  3A2W A;  2P31 A;  3P7X A;  1U87 A;  1Z6M A;  2H6X A;  2YAN A;  2DLX A;  4ZXG A;  1TJD A;  2C3Q A;  1Y25 A;  5B6M A;  3O76 A;  1DE2 A;  3LFL A;  4F9Z A;  1XOB A;  1TRU A;  4TW5 A;  2YNX A;  5ECK B;  1Y6E A;  3L9V A;  3TJF A;  4WF5 A;  1TRV A;  2R37 A;  4GRF A;  2X99 A;  3DGQ A;  1XBS A;  1GL8 A;  2DJ3 A;  4I2U A;  4EXJ A;  2X8G A;  2GVP A;  3MWH A;  4FIW A;  5ECP B;  4XS4 A;  4ECC A;  1BED A;  4AGS A;  2H30 A;  1SJI A;  5CYY A;  5FWG A;  2R3X A;  1SKW B;  3IR4 A;  3I69 A;  4RQX A;  5J4U A;  2LJA A;  2TIR A;  3ZIJ A;  4EIQ A;  3RHB A;  4RI6 A;  3DEX A;  2WFC A;  1ZMA A;  5ECI B;  1Q4J A;  2H8L A;  3E0U A;  4MJE A;  5AGY A;  4PX1 A;  4V2M A;  2ON7 A;  4V2N A;  2L6C A;  3ED3 A;  5CO3 A;  4YH2 A;  4EKZ A;  5DBQ A;  3F0I A;  1OC8 A;  1A8L A;  4EL1 A;  5J3R A;  3ZRD A;  3DML A;  2GS3 A;  3ERF A;  4TXO B;  2FCH A;  3FY7 A;  1H4O A;  3CSH A;  3H79 A;  2VLV A;  5KEJ A;  1M7T A;  2HRA A;  2C3N A;  1YKC A;  1WPI A;  4OO4 A;  1A2L A;  4RUV A;  1SL1 B;  5ECQ B;  2LRC A;  2V6O A;  2WS2 A;  1WRY A;  4HEA 2;  1CQG A;  4K7O A;  5LCZ A;  1PQN A;  4J57 E;  5ABR A;  1QXH A;  3R2Q A;  1ST9 A;  3GH6 A;  5HFI A;  2VO4 A;  5IPH A;  4WBJ A;  2GQM A;  1YDK A;  4OO5 A;  2I3Y A;  1SU9 A;  2LNT A;  5G1L A;  1SK2 A;  2LUS A;  3ZMK A;  2MBS A;  4OMV A;  5IOW A;  2X4A A;  1MDJ A;  3L0H A;  1XFL A;  2ZCT A;  4JR6 A;  3A5I A;  1HNA A;  4PNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...