2FWFA

High resolution crystal structure of the c-terminal domain of the electron transfer catalyst dsbd (reduced form)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
123
structure length
123
Chain Sequence
HLNFTQIKTVDELNQALVEAKGKPVMLDLYADWCVACKEFEKYTFSDPQVQKALADTVLLQANVTANDAQDVALLKHLNVLGLPTILFFDGQGQEHPQARVTGFMDAETFSAHLRDRQPHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Thiol:disulfide interchange protein dsbD
publication title High-resolution structures of Escherichia coli cDsbD in different redox states: A combined crystallographic, biochemical and computational study
pubmed doi rcsb
source organism Escherichia coli
total genus 45
structure length 123
sequence length 123
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13899 Thioredoxin_7 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2fwfA00
4WEYA 3HY2A 1YQ1A 3BJ5A 4FIWA 4EUYA 4F0CA 3UARA 2HE3A 5G1KA 3WGXA 3FHKA 1OC9A 5D9TA 3NOFA 3ZRDA 5CO3A 1MTCA 3ME7A 1V9WA 2OACA 1Y25A 3TKRA 3TDGA 3VFIA 2LSTA 5JWRB 20GSA 4MF5A 3HKRA 5GAPD 4QL9A 2X99A 3RPNA 1FAAA 3HVXA 5IM9A 4ML1A 3L4NA 1EEJA 3TKSE 3A3TA 1PKWA 3FZ5A 3CYNA 1DBYA 1OE7A 1K3OA 2C0EA 3H8QA 3JCML 4RQXA 4ID0A 3HZ8A 3KH9A 4J2FA 3MDKA 2AYTA 3CTGA 2PGTA 4LA1A 4NMUA 2DJKA 2LJRA 5CRHA 4K7IA 5GSSA 4YH2A 2OADA 4PQ1A 2ON5A 2WCIA 2L4QA 2KP2A 4ZL9A 1VGLA 1T1VA 4D73B 4IP6A 2FUG2 1F3BA 2AAWA 4GRFA 2LJKA 2JSYA 1XW6A 1EV9A 2LRCA 5JCUA 1V98A 1UC7A 1Z7PA 4LMVA 3ZMLA 1GTBA 3GURA 1T7PB 2IIYA 3D22A 5FHIA 3H1NA 3IE3A 5B8AA 1NW2A 2DC5A 1K0AA 4WBJA 2O7KA 4BVYA 2P0GA 3FZ9A 3HHVA 3DGQA 2CA8A 2A2SA 4RUVA 3G7IA 3EVIA 5JWQB 3F6FA 2B3SA 1THOA 2JADA 3K8NA 5ENUA 5IMAA 1NHOA 1RQMA 2F3MA 3GKXA 4KAEA 1ML6A 1XW9A 2H01A 1XVWA 4L0WA 1AC1A 4GTUA 1CQGA 1Y6EA 1YEPA 4I5QA 3APOA 4D73A 2VAFA 9GSSA 2GT5A 3O76A 3WD6A 4N11A 4LL4B 3IPZA 6GSXA 4HQZA 5F05A 5B7CA 1ABAA 4RI6A 4NHWA 3APSA 1U87A 5ECHB 4IJ3A 1T4ZA 2C0GA 4MLYA 4AJ8A 1A0RP 2OA7A 3UAPA 3LGCA 3UIWA 5D8IA 1G7OA 3HZ4A 4V1Ag 2YJHA 2NTOA 5DQYA 1F2EA 2R6KA 2MZCA 2A2RA 4G2EA 4CDOA 3ERWA 4DSSA 4GSNA 1M99A 4KB3A 2HXKA 2VCQA 4HJ2A 4GXZA 1V40A 5C04A 4MABA 3D4TA 2DJ3A 4GSSA 2WULA 4MZWA 4GSTA 2ON7A 5IIZA 3ZREA 5CREA 2FWEA 2B7JA 2LUSA 1HNBA 3O6TA 2HLSA 1WIKA 2GZYA 5F0GA 1B4PA 1XWBA 1GTAA 5ID2A 3DVXA 1BJXA 4KH7A 1VF2A 4Q5QA 3ZL5A 1BG5A 3EWLA 4KA0A 2YZUA 3KP9A 2R4VA 3D0ZA 4I6XA 2QGVA 3EINA 2ZCTA 2VLUA 22GSA 2YPMA 2H1GA 2VLTA 1VRSD 1QUWA 2IPAA 2FA4A 2OJLA 2C3NA 1H4OA 4K0NA 2I1UA 4JU5A 3U5RE 4EE0A 3ERFA 3ERGA 4OFMA 3WYWA 1OE8A 4PQIA 4X43A 2LEGA 3ZIVA 3L9UA 4MP4A 1MD4A 1EOGA 5A4VA 4FH8A 4FYCA 4AJ7A 2FHEA 2E2MA 2WDUA 1XWKA 2C80A 3KH7A 3GL3A 1EV4A 3UBKA 4TRXA 3LXTA 2DJ0A 2C4JA 4ZBDA 2DIZA 4IQAA 2KP1A 1WE0A 4TXOA 1XOAA 3GL5A 2H1DA 4POBA 4MA9A 4BPYA 3H4KA 1O73A 4YQUA 2MYGA 5IO0A 1Z3EA 3WT1A 5AIXA 3M0FA 1AQWA 4WF5A 2CZ3A 3ZYWA 12GSA 1TXXA 4EDZA 1TRSA 1F9MA 5F06A 2NVLA 3E9JB 1AUCA 2H6YA 3FW2A 3TKQA 4F0BA 1WMJA 4G19A 4LMWA 4O32A 3LQ7A 3V1WA 4ECBA 2P31A 4WR4A 4ML6A 3TKSC 4KUNA 4L8EA 3GX8A 2DJJA 2QC7A 3F8UA 3ZFLA 2VL3A 3UEMA 5DCHA 3IK7A 1GNEA 1F3AA 3EC3A 3L0HA 3UMAA 2WGRA 2CVKA 2NDOA 2QSIA 4IN0A 6GSYA 1Z7RA 4KSMA 1ZOFA 3D5JA 3I9V2 4JEDA 3US3A 1ACVA 5DQSA 3RHBA 1TU8A 3BOAA 4K9ZA 4YAVA 2GQMA 3NIVA 4MF6A 3E3EA 3GMFA 3A2VA 2C1YA 2V6OA 1FOVA 1A23A 2HI7A 1TRUA 3PH9A 2CX3A 2CX4A 4HI7A 2XBQA 2GZPA 3IAM2 4K7NA 4HZ2A 2V6KA 4PQHA 2NPBA 3U6VA 3S9FA 4GQFA 4PNFA 1LJRA 2C0DA 3TJGA 5A4UA 2LNSA 3KP8A 4NV5A 1JZRA 5DALB 5EPFA 2PWJA 1O85A 3N9JA 1GSUA 5B6MA 1F37A 3L9VA 5F07A 1K3YA 3TJKA 3H93A 4BVXA 2VL2A 4PGTA 2GDRA 3Q19A 3GTUB 3HJOA 4KX4A 1EP7A 4KSOA 3IR4A 1J0FA 4MPFA 4BWQA 2ZNMA 2MBTA 1TKDB 1ZMAA 5DJMA 3GKKA 2PBJA 2L6DA 4ZL7A 3A2WA 1DSBA 4NXIA 1W89A 2FCHA 6GSVA 1QK8A 4IKHA 1U88A 2F9SA 1EEMA 5J3RA 4MJEA 4IP1A 4XS1A 3GH6A 4G9HA 1TJDA 2KOKA 1PX7A 2J9HA 1KNGA 4N10A 2HSHA 2X8HA 3MNGA 2CVDA 1SK1A 1YJ6A 1M7TA 3EYTA 3LSZA 2CT6A 1T4YA 4N30A 2X64A 2VCXA 5H5SA 4O5RA 1PL2A 2H0GA 3GSTA 4I2TA 2L5OA 4XTSA 5DALA 1WP0A 1TI3A 2GSTA 1KEBA 2LV3A 1LBKA 4XCSA 5ELAA 3QAGA 2MMNA 4CHSA 3ED3A 2FY6A 1Q98A 4IGJA 5GAND 4LLRA 18GSA 2JL4A 3C1RA 1QMVA 1E2YA 2IWTA 1TRWA 1VF3A 1EWXA 1A2LA 1QFNA 1VF1A 4X0XA 3OR5A 1K0OA 2H19A 1XVQA 5ECPB 4EC0A 5COHA 5KN0A 3F4TA 2X8GA 1V2AA 2AV4A 1AIUA 1M2AA 1FB0A 3DMLA 2K8SA 2IFQB 4WR5A 3O3TA 3TCOA 2PVOC 5KN1A 1B8XA 1FG4A 4OWYA 4ZB6A 5G31A 3ZMKA 1WPIA 4ZB9A 3DRNA 1R7HA 3F3QA 2IJYA 4OO4A 4NWYA 5G5EA 3LWAA 1OKDA 2IMEA 3R2QA 4JR6A 2A4VA 3IC4A 2IMKA 1GP1A 4HU7A 2YJ7A 4GCIA 3UJ1A 5G5FA 3VI5A 2B1LA 5KN2A 3M9KA 2XPEA 3FYGA 4MJCA 1H75A 1PL1A 2EIRA 2RUFA 1DUGA 4MZBA 2KUCA 1QQ2A 1EP8A 4OCFA 2E2GA 2DBCA 3GA4A 1BEDA 1GSSA 4FYUA 2EIOA 4HS1A 5ECMB 1YKAA 1UA5A 1K0NA 2HYXA 1ERWA 4QL7A 3G9BA 3TOUA 4O7HA 4XHMA 4XRDA 4POLA 3GKNA 2C8UA 2V2GA 1TI1A 1HNAA 3HJPA 4MJAA 3KM6A 2B6MA 3WT2A 4MZCA 1PX6A 3IAS2 5DVBA 5IMFA 4YQVA 4IQ1A 3HDCA 1JZWA 5D96A 2CAQA 1EGRA 1TW9A 2CAIA 5HQPA 3VWWA 3FKFA 5KN3A 14GSA 1QGVA 1O81A 1OYJA 2HZEB 1VF4A 1YDKA 2RUEA 4ZXGA 3HYPA 3P90A 4F9ZA 4EF0A 4NAXA 4L5OA 2TIRA 2P5RA 4IJIA 4KE3A 2HRFA 1GSEA 4AJ6A 4EDYA 3GN3A 4EVMA 4BWSA 4HQSA 1NM3A 3E0UA 3PINA 3AY8A 5IMZA 1SKSB 1OC8A 3I69A 3FR6A 1EOHA 1TDIA 3GH9A 2H0HA 2B7KA 4OFNA 2IMIA 1MDIA 4KDXA 3LYKA 3ZITA 3A5WA 3PR8A 4WXTA 3P7XA 2MBSA 4JZQA 4KW6A 2LQQA 4XS4B 2YOIA 6GSWA 3UVTA 3FR9A 3C71A 2TRXA 3IA1A 3MAKA 1SYXA 4ZB8A 2GZZA 1LU4A 4PX1A 3IV4A 1SU9A 3LEFA 3I43A 2F8AA 2BMXA 4BA7A 2WS2A 3C8EA 2LRNA 1SL1B 3M3MA 2HZEA 5AIVA 4NV2A 2JZRA 2VM1A 2VCZA 3GSSA 5DAKB 1ERTA 4DSRA 2GQKA 2GVPA 5A5KA 2ES7A 3TJFA 4O92A 1GLPA 1F6MC 2E7PA 3TGZA 5JWOB 1GUKA 1SK2A 10GSA 5J41A 1G0TA 2YZHA 2AHEA 4MF7A 4TXVA 3GV1A 1PN9A 1HD2A 2JZSA 4ACSA 5IMVA 2C0FA 4IHUA 4KDUA 5ECNB 1G7EA 2H6ZA 5CAXA 2CQ9A 4V2LA 1TRVA 3P8WA 1SYRA 3VI7A 5IMCA 4OCEA 3W8SA 2IN3A 2O8VB 5CYYA 1XBSA 1W4VA 4K8MA 1XPVA 3J7Yk 3QMXA 2FWHA 1O8XA 2L4CA 1JZOA 3QPMA 2LQOA 4ZILA 1X9SB 4FYBA 4KGIA 5IOXA 3HVVA 3QR6A 5EY6A 4Q5RA 2FLSA 1WRYA 1SD9A 2RIIA 2ZUPA 3KZQA 4ECIA 3M8NA 3KXOA 1JLVA 3QCPA 6GSSA 2D2ZA 4JBBA 1PSQA 5ECIB 2M46A 3FZAA 2B5YA 3W8JA 4ULXA 4K2DA 2OBKA 3F0IA 5G30A 1IYIA 3F6DA 1Z6MA 1XOBA 3DYRA 1ZYQB 4MH2A 3LXZA 2OE0A 4LL1B 4ZBAA 1T00A 1X5DA 5IPHA 4HUAA 5L71A 3D4MA 4PXOA 4WF4A 1IYHA 2H72A 2H73A 1SENA 2BJXA 2JZTA 1J08A 1BX9A 5CRGA 1FHEA 2X8CA 1GSDA 2WFCA 4MMMA 2CZ2A 5ELGA 1GH2A 3UOMA 2FA8A 3J7Yb 2H66A 5ECLB 1EZKA 5LD0A 3DWVA 3ZVJD 4AF2A 1G6WA 3WGEA 3KMNA 2YP6A 5HR1A 1OKTA 3IRAA 3APQA 3PGTA 2XC2A 3CTFA 2I9HA 2I81A 2XHFA 3GHAA 3D6IA 5A4WA 3GFKA 3BD2A 3LYPA 2H74A 1SKRB 2KHPA 4I2UA 3UL3A 4ZIJA 4NPBA 4F03A 1GSQA 1U3AA 1GUHA 2R2JA 8GSSA 1FW1A 2PVQA 4XRAA 3ZIJA 1B9XC 2TRCP 1K0CA 5ECKB 3ZTLA 5F8BA 2DSAA 3G7JA 2LRTA 5DBQA 4RI7A 3CBUA 2B5EA 4EKZA 4Q5NA 2FWFA 4E8EA 3FY7A 4JRRA 3TUEA 3DKSA 1N2AA 4RQRA 3LG6A 5H5RA 2PMTA 3WGDA 1GNWA 1BAYA 4K7OA 5ECOB 4HEA2 1N8JA 2BTOT 1WOUA 1V58A 11GSA 2L59A 1YZXA 1M2BA 1HYUA 5JCGA 2PUKC 1Z5YE 1XW5A 1AXDA 1RW1A 1E6BA 1TP9A 1TK8B 1ZYEA 3KMOA 1T8EB 2FGXA 3Q74A 4IBPA 1Q4JA 5CRWA 2YCDA 1B48A 5H5QA 2L57A 2OKAA 3EURA 3TKSA 2F51A 2Z9SA 1SJ6A 2B1KA 2K8VA 4HZ4A 1ZZYA 3IDVA 1I5GA 4WBRD 3GTUA 3HXSA 4MJBA 1HQOA 1XFLA 3CXGA 3GIXA 4POKA 3VWUA 2F8FA 2M80A 3HVSA 3FZ4A 5IQYA 1TK0B 4OD7A 3QOUA 2RM5A 3GKMA 1OC3A 5D73A 1ST9A 2YV7A 4G10A 3VWXA 1X5CA 2YWOA 2HSYA 4KCEA 2G2QA 3M1GA 5ECQB 2L5LA 4YQMA 5HR2A 3ZLPA 2C3QA 2DLXA 2G0FA 5HFKA 3GYKA 1SL2B 1U3IA 3VWVA 1YEXA 1M0UA 2YV9A 3HA9A 3L9SA 3QDNA 4POMA 2PPTA 4N0ZA 5J9CA 1AW9A 4WKWA 3FR3A 4KNDA 1SKWB 4IW9A 1A0FA 5FWGA 2O85A 2DJ1A 3BBYA 2V41A 4TR0A 1AQXA 2I3YA 2DMLA 3QAVA 4MDCA 1PGTA 1C72A 3HJMA 4PNGA 1B4QA 4V2MA 2H1AA 2OE1A 2VCWA 3HD5A 5CRDA 3VPTA 1XWCA 3CSHA 3C73A 3Q6OA 2H30A 1GWCA 2O89A 1CQHA 3TRQA 5G2ZA 3FK8A 3GX0A 3CSJA 4ZL8A 2WB9A 2EIQA 3RDWA 1S3AA 4IELA 2RM6A 1TOFA 4ISDA 2FWGA 1R5PA 3DEXA 2HNLA 1PD21 2VIMA 5IOWA 2K18A 2VO4A 2DJ2A 2IFQA 4OFTA 3SWLA 2R37A 4GWRA 2V1MA 5AN1A 1MDKA 2VLVA 1TK5B 2XBIA 5LNKe 5HFGA 1K0DA 3ZFBA 4Z7XA 3IBHA 2N5FA 4MPGA 3RAZA 3C1SA 3IHQA 3KCMA 3RHCA 1A2MA 1I9DA 4DSSB 1DE2A 2REMA 4P3YB 1FVJA 2C3TA 1MEKA 2GSRA 1U6TA 3D21A 1PRXA 2E0QA 2ALBA 3LJRA 5E4WA 3BCIA 1G6YA 1DE1A 5D93A 5GZZB 7GSSA 3EMXA 3CMIA 1SJIA 4HOJA 1JHBA 3IOSA 2YWMA 3UVHA 4V2NA 1WJKA 3IK9A 1V57A 2MMOA 3BCKA 1JZDA 2WJUA 5ID2B 5LCZA 3EMPA 1XWGA 2WZ9A 4ECJA 1GUMA 2MMAA 2HT9A 1XXUA 2JU5A 1FO5A 5D9XA 1X5EA 2LNTA 5KEJA 16GSA 4I8BA 3TJBA 2IMFA 2VM2A 1WWJA 2JACA 1R26A 3CSIA 4MK3A 3G7YA 3SBCA 2R3XA 2GSSA 2L6CA 1X9MB 4TW5A 5AGYA 4XS6A 2K9FA 1ERVA 3KIJA 2AB6A 1YF1A 3EU3A 3GUSA 1R5AA 2YNXA 1GLQA 1A8LA 2LTKA 2J23A 3KGKA 5ABRA 2HZFA 1PQNA 13GSA 1BYEA 2OE3A 5EVOA 1SD8A 4EXJA 1EGOA 3M9JA 1ON4A 2AJQB 1GSFA 2H1BA 5C00A 3TRXA 4F82A 4V1Ap 1FB6A 4XIHA 2NBSA 1M9AA 5DJLA 4TXOB 3P2AA 1GSYA 3F63A 5FT3A 3RBTA 1HNCA 1T3BA 4K6XA 2AUVA 5J4UA 5D9WA 5EL8A 4Q5FA 4DVCA 3A2XA 2JSZA 4MCUA 4E8HA 2DIYA 4XS4A 3LORA 1SL0B 1XCCA 3I6AA 2H76A 4PURA 3DD3A 4FO5A 1MDJA 1ILOA 1K0MA 2LJAA 3GRXA 1ERUA 1UVZA 3Q18A 5DDLA 2GLRA 3QD9A 6GSUA 3QFBC 5G1LA 4JR4A 4PUAA 1THXA 4NHZA 3VLNA 1YF0A 4TVEA 4HDEA 2VL2C 5CNWA 5B6NA 1SK0A 3FRCA 3L78A 5HR0A 1ZL9A 5DAKA 5CP1A 3TKPA 1MD3A 5IMDA 2PERA 4TR3A 3ME8A 2GGTA 5DCGA 2K6VA 1YKCA 1YY7A 5IPGA 3FEUA 1O7UA 2YN1A 1A24A 2RLIA 2HRNA 1M9BA 1J9BA 4GF0A 1GL8A 5INYA 3LFLA 1AQVA 2VL9A 3QFAC 4F2IA 1Z6NA 3KEBA 1QXHA 3DXBA 4TR4A 1GRXA 2PN8A 2MMZA 1O8WA 4IS0A 4GLTA 3VURA 1TU7A 4EL1A 1GULA 1USBA 1XZOA 3VPQA 2QKEA 2KLXA 2YWNA 1TTZA 4L5LA 1GTIA 5JCWA 3QAWA 2O87A 5J9BA 3TJJA 4JE1A 2VOCA 1PA3A 3H79A 2CVBA 1NHYA 1SJZA 2YANA 3CRUA 1B9YC 1X0RA 3TOTA 4MH3A 2VCTA 4H86A 1PMTA 1AAZA 5E59A 4TKYA 3NZNA 4TR1B 2H0IA 2I4AA 3N5OA 4DEJA 2B5XA 2LS5A 1S3CA 2GQLA 1OVNA 4ILFA 2OBIA 3VK9A 1BQ7A 4HU9A 6GSTA 4IVFA 5GSTA 1K3LA 3MSZA 2PU9C 2YWIA 3GNJA 4KDYA 4GQCA 4X1UA 3MWHA 2GSQA 5D9VA 2EC4A 1URMA 2VD1A 1UN2A 2R5GA 1PKZA 5J5NA 4KCAA 4OMVA 5ECRB 2H75A 19GSA 1R4WA 2P5QA 3EU4A 2VUPA 1XIYA 2H70A 2CV4A 2GT6A 5IO2A 1O6JA 4WETA 4N0VA 3DIEA 5AISA 3F3RA 3TRPA 4QQ7A 4EO3A 1FVKA 1JFUA 2N5AA 2VD0A 4HJMA 5HR3A 2LKUA 2XPDA 1OAZA 2FD3A 3ISOA 3W6GA 1NSWA 3RPPA 1GTUA 2VCVA 4TR1A 1ZCPA 1A8YA 1S3DA 3KTLA 1OC9B 4ZBBA 3HCZA 4OO5A 4CW9A 4ECCA 1KBNA 3C7MA 1A2JA 1RK4A 3ZZXA 1XWAA 4BL7A 1X9WB 3KJYA 2H8LA 2WRTA 4J57E 5B8BA 3UBLA 3TB2A 2M72A 3F9UA 4YAPA 1M2DA 2HFDA 2FNOA 5HFIA 4PUFC 2V32A 3KD0A 4K0GA 4DSQA 1JLWA 1KTEA 2DMMA 4TN8A 4J56E 3EE2A 1K0BA 2GS3A 2IMDA 2GTUA 2H6XA 3F4SA 5ECSA 3CRTA 4L0UA 3IXRA 3ZVJA 4K1FA 3DVWA 4I97A 4AGSA 1Z9HA 2IL3A 3F4RA 4TOPA 1ZGNA 3KTBA 17GSA 2H71A 2N5BA
chains in the Genus database with same CATH superfamily
4WEYA 3HY2A 1YQ1A 3BJ5A 4FIWA 2X49A 4EUYA 4F0CA 3UARA 2HE3A 5G1KA 3WGXA 3FHKA 1OC9A 5D9TA 3NOFA 3ZRDA 5CO3A 1MTCA 3ME7A 1V9WA 2OACA 1Y25A 3TKRA 3TDGA 3VFIA 2LSTA 5JWRB 5BMUA 20GSA 4MF5A 3HKRA 5GAPD 4QL9A 2X99A 3RPNA 1FAAA 3HVXA 5IM9A 4ML1A 3L4NA 4BVYB 1EEJA 3TKSE 3A3TA 1PKWA 3FZ5A 3CYNA 1DBYA 1OE7A 1K3OA 2C0EA 3H8QA 3JCML 4RQXA 4ID0A 3HZ8A 3KH9A 4J2FA 3MDKA 2AYTA 3CTGA 2PGTA 4LA1A 4NMUA 2DJKA 2LJRA 5CRHA 4K7IA 5GSSA 4YH2A 2OADA 4PQ1A 2ON5A 2R0PA 2WCIA 2L4QA 2KP2A 4ZL9A 1VGLA 1T1VA 4D73B 4IP6A 2FUG2 1F3BA 2AAWA 4GRFA 2LJKA 2JSYA 1XW6A 1EV9A 2A2PA 2LRCA 5JCUA 1V98A 1UC7A 1Z7PA 4LMVA 3ZMLA 1GTBA 3GURA 1T7PB 2IIYA 3D22A 5FHIA 3H1NA 3IE3A 5B8AA 1NW2A 2DC5A 1K0AA 4WBJA 2O7KA 4BVYA 2P0GA 3FZ9A 3HHVA 3DGQA 2CA8A 2A2SA 4RUVA 3G7IA 3EVIA 5JWQB 3F6FA 2B3SA 1THOA 4CY8A 2JADA 3K8NA 5ENUA 5IMAA 1NHOA 1RQMA 2F3MA 3GKXA 4KAEA 1ML6A 1XW9A 2H01A 1XVWA 4L0WA 1AC1A 4GTUA 1CQGA 1Y6EA 1YEPA 4I5QA 3APOA 4D73A 2VAFA 9GSSA 3EPTA 2GT5A 3O76A 1PFOA 3WD6A 4N11A 4LL4B 3IPZA 6GSXA 4HQZA 5F05A 5B7CA 4Z2UA 1ABAA 4RI6A 4NHWA 3APSA 1U87A 5ECHB 4IJ3A 1T4ZA 2C0GA 4MLYA 4AJ8A 1A0RP 2OA7A 3UAPA 3LGCA 3UIWA 5KOXA 5D8IA 1G7OA 3HZ4A 4V1Ag 2YJHA 2NTOA 5DQYA 1F2EA 2R6KA 2MZCA 2A2RA 4G2EA 4CDOA 3ERWA 4DSSA 4GSNA 1M99A 4KB3A 2HXKA 2VCQA 4HJ2A 4GXZA 1V40A 5C04A 4MABA 3D4TA 2DJ3A 4GSSA 2WULA 4MZWA 4GSTA 2ON7A 5IIZA 3ZREA 5CREA 2FWEA 2B7JA 2LUSA 1HNBA 3IC8A 3O6TA 2HLSA 1WIKA 2GZYA 5F0GA 1B4PA 1XWBA 1GTAA 5ID2A 3DVXA 1BJXA 4KH7A 1VF2A 4Q5QA 3ZL5A 1BG5A 3EWLA 4KA0A 2YZUA 3KP9A 2R4VA 3D0ZA 4I6XA 2QGVA 3EINA 2ZCTA 2VLUA 22GSA 2YPMA 2H1GA 2VLTA 3HVNA 1VRSD 4YKGA 1QUWA 2IPAA 2FA4A 2OJLA 2C3NA 1H4OA 4K0NA 2I1UA 4JU5A 3U5RE 4EE0A 3ERFA 3ERGA 4OFMA 3WYWA 1OE8A 1M3IA 4PQIA 4X43A 2LEGA 3ZIVA 3L9UA 4MP4A 1MD4A 1EOGA 5A4VA 4FH8A 4FYCA 4AJ7A 2FHEA 2E2MA 2WDUA 1XWKA 2C80A 3KH7A 3GL3A 1EV4A 3UBKA 4TRXA 3LXTA 2DJ0A 2C4JA 4ZBDA 2DIZA 4IQAA 2KP1A 1WE0A 4TXOA 1XOAA 3GL5A 2H1DA 4POBA 4MA9A 4BPYA 3H4KA 1O73A 4YQUA 2MYGA 5IO0A 1Z3EA 3WT1A 5AIXA 3M0FA 1AQWA 4WF5A 2CZ3A 3ZYWA 12GSA 1TXXA 4EDZA 1TRSA 1F9MA 5F06A 2NVLA 3E9JB 1AUCA 2H6YA 3FW2A 3TKQA 4F0BA 1WMJA 3LW9A 4G19A 4LMWA 4O32A 3LQ7A 3V1WA 4ECBA 2P31A 4WR4A 4ML6A 3TKSC 4KUNA 4L8EA 3GX8A 2DJJA 2QC7A 3F8UA 3ZFLA 2VL3A 3UEMA 5DCHA 3IK7A 1GNEA 1F3AA 3EC3A 3L0HA 3UMAA 2WGRA 2CVKA 2NDOA 2QSIA 4IN0A 6GSYA 1Z7RA 4KSMA 1ZOFA 3D5JA 3I9V2 4JEDA 3US3A 1ACVA 5DQSA 3RHBA 1TU8A 3BOAA 4K9ZA 4YAVA 2GQMA 3NIVA 4MF6A 3E3EA 3GMFA 3A2VA 2C1YA 2V6OA 1FOVA 1A23A 2HI7A 1TRUA 3PH9A 2CX3A 2CX4A 4HI7A 2XBQA 2GZPA 3IAM2 4K7NA 4HZ2A 2V6KA 4PQHA 2NPBA 3U6VA 3S9FA 4GQFA 4EIQA 4PNFA 1LJRA 2C0DA 3TJGA 5A4UA 2LNSA 3KP8A 4NV5A 1JZRA 5DALB 5EPFA 2PWJA 1O85A 3N9JA 1GSUA 5B6MA 1F37A 3L9VA 5F07A 1K3YA 3TJKA 3H93A 4BVXA 2VL2A 4PGTA 2GDRA 3Q19A 3GTUB 3HJOA 4KX4A 1EP7A 4KSOA 3IR4A 1J0FA 4MPFA 4BWQA 2ZNMA 2MBTA 1TKDB 1ZMAA 5DJMA 3GKKA 2PBJA 2L6DA 4ZL7A 3A2WA 1DSBA 4NXIA 1W89A 2FCHA 6GSVA 1QK8A 4IKHA 1ZYPA 4G0LA 1U88A 2F9SA 1EEMA 5J3RA 4MJEA 4IP1A 4XS1A 3GH6A 4G9HA 1TJDA 2KOKA 1PX7A 2J9HA 1KNGA 4N10A 2HSHA 2X8HA 3MNGA 2CVDA 1SK1A 1YJ6A 1M7TA 3EYTA 3LSZA 2CT6A 1T4YA 4N30A 2X64A 2VCXA 5H5SA 4O5RA 1PL2A 2H0GA 3GSTA 4I2TA 2L5OA 4XTSA 5DALA 1WP0A 1TI3A 2GSTA 1KEBA 2LV3A 1LBKA 4XCSA 5ELAA 3QAGA 2MMNA 4CHSA 3ED3A 2FY6A 1Q98A 4IGJA 5GAND 4LLRA 18GSA 2JL4A 3C1RA 1QMVA 1E2YA 2IWTA 1TRWA 1VF3A 1EWXA 1A2LA 1QFNA 4FQUA 1VF1A 4X0XA 3OR5A 1K0OA 2H19A 1XVQA 5ECPB 5BRTA 4EC0A 5COHA 5KN0A 3F4TA 2X8GA 1V2AA 2AV4A 1AIUA 1M2AA 1FB0A 3DMLA 2K8SA 2IFQB 4WR5A 3O3TA 3TCOA 2PVOC 5KN1A 1B8XA 1FG4A 4OWYA 4ZB6A 5G31A 3ZMKA 1WPIA 4ZB9A 3DRNA 1R7HA 3F3QA 2IJYA 4OO4A 4NWYA 5G5EA 3LWAA 1OKDA 2IMEA 3R2QA 4JR6A 2A4VA 3IC4A 2IMKA 1GP1A 4HU7A 2YJ7A 4GCIA 3UJ1A 5G5FA 3VI5A 2B1LA 5KN2A 3M9KA 2XPEA 3FYGA 4MJCA 1H75A 1PL1A 2EIRA 4USSA 2RUFA 1DUGA 4MZBA 2KUCA 1QQ2A 1EP8A 4OCFA 2E2GA 2DBCA 3GA4A 1BEDA 1GSSA 4FYUA 2EIOA 4HS1A 5ECMB 1YKAA 1UA5A 1K0NA 2HYXA 1ERWA 4QL7A 3G9BA 3TOUA 4O7HA 4XHMA 4XRDA 4POLA 3GKNA 2C8UA 2V2GA 1TI1A 1HNAA 3HJPA 4MJAA 3KM6A 2B6MA 1M3JA 3WT2A 4MZCA 1PX6A 3IAS2 5DVBA 5IMFA 4YQVA 4IQ1A 3HDCA 1JZWA 5D96A 2CAQA 1EGRA 4HSCX 1TW9A 2CAIA 5HQPA 3VWWA 3FKFA 5KN3A 14GSA 1QGVA 1O81A 1OYJA 2HZEB 1VF4A 1FOHA 1YDKA 2RUEA 4ZXGA 3HYPA 3P90A 4F9ZA 4EF0A 4NAXA 4L5OA 2TIRA 2P5RA 4IJIA 4KE3A 2HRFA 1GSEA 4AJ6A 4EDYA 3GN3A 1ZYNA 4K5SA 4BWSA 4EVMA 4HQSA 4A5PA 1NM3A 3E0UA 3PINA 3AY8A 5IMZA 1SKSB 1OC8A 2DKIA 3I69A 3FR6A 1EOHA 1TDIA 3GH9A 2H0HA 2B7KA 4OFNA 2IMIA 1MDIA 4KDXA 3LYKA 3ZITA 3A5WA 3PR8A 4WXTA 3P7XA 2MBSA 4JZQA 4KW6A 2LQQA 4XS4B 2YOIA 6GSWA 3UVTA 3FR9A 3C71A 2TRXA 3IA1A 3MAKA 1SYXA 4ZB8A 2GZZA 1LU4A 4PX1A 3IV4A 1SU9A 3LEFA 3I43A 2F8AA 2BMXA 4BA7A 2WS2A 3C8EA 2LRNA 1SL1B 3M3MA 2HZEA 4MNNA 2HSMA 5AIVA 4NV2A 2JZRA 2VM1A 2VCZA 3GSSA 5DAKB 1ERTA 4DSRA 2GQKA 2GVPA 5A5KA 2ES7A 3TJFA 4O92A 1GLPA 1F6MC 2E7PA 3TGZA 5JWOB 1GUKA 1SK2A 10GSA 5J41A 1G0TA 2YZHA 2AHEA 4MF7A 4TXVA 3GV1A 1PN9A 1HD2A 2JZSA 4ACSA 5IMVA 1PN0A 2C0FA 4IHUA 4KDUA 5ECNB 1G7EA 2H6ZA 5CAXA 2CQ9A 4V2LA 1TRVA 3P8WA 1SYRA 3VI7A 5IMCA 4OCEA 3W8SA 2IN3A 2O8VB 5CYYA 1XBSA 1W4VA 4K8MA 1XPVA 3J7Yk 3QMXA 2FWHA 1O8XA 2L4CA 1JZOA 3QPMA 2LQOA 4ZILA 1X9SB 4FYBA 4KGIA 2R0CA 5IOXA 3HVVA 3QR6A 5EY6A 4Q5RA 2FLSA 1WRYA 1SD9A 2RIIA 2ZUPA 3KZQA 4ECIA 3M8NA 3KXOA 1JLVA 3QCPA 6GSSA 2D2ZA 4JBBA 1PSQA 5ECIB 2M46A 3FZAA 2B5YA 3W8JA 4ULXA 4K2DA 2OBKA 3F0IA 5G30A 1IYIA 1S3RA 3F6DA 1Z6MA 1XOBA 3DYRA 1ZYQB 4MH2A 3LXZA 2OE0A 4LL1B 4ZBAA 1T00A 2R0GA 1X5DA 5IPHA 4HUAA 5L71A 3D4MA 4PXOA 4WF4A 1IYHA 2H72A 2H73A 1SENA 2BJXA 2DKHA 2JZTA 1J08A 1BX9A 4YKFA 5CRGA 1FHEA 2X8CA 1GSDA 2WFCA 4MMMA 4Z2TA 2CZ2A 3A5IA 5ELGA 1GH2A 3UOMA 2FA8A 3J7Yb 2H66A 5ECLB 1EZKA 5LD0A 3DWVA 3ZVJD 4AF2A 1G6WA 3WGEA 3KMNA 2YP6A 5HR1A 1OKTA 3IRAA 3APQA 3PGTA 2XC2A 3CTFA 2I9HA 4BL7B 2I81A 2XHFA 3GHAA 3D6IA 5A4WA 3GFKA 3BD2A 3LYPA 2H74A 1SKRB 2KHPA 4I2UA 3UL3A 4ZIJA 4NPBA 4F03A 1GSQA 1U3AA 1GUHA 3R3EA 2R2JA 8GSSA 1FW1A 2PVQA 4XRAA 3ZIJA 1B9XC 2TRCP 1K0CA 5ECKB 3ZTLA 5F8BA 2DSAA 3G7JA 2LRTA 5DBQA 4RI7A 3CBUA 2B5EA 4EKZA 4Q5NA 2FWFA 4E8EA 3FY7A 4JRRA 4EIPA 3TUEA 3DKSA 1N2AA 4RQRA 3LG6A 5H5RA 2PMTA 3WGDA 1GNWA 1BAYA 4K7OA 2X4AA 5ECOB 4HEA2 1N8JA 2BTOT 1WOUA 1V58A 11GSA 2L59A 1YZXA 1M2BA 1HYUA 5JCGA 2PUKC 1Z5YE 1XW5A 1AXDA 1RW1A 1E6BA 1TP9A 1TK8B 1ZYEA 3KMOA 1T8EB 2FGXA 3Q74A 4IBPA 1Q4JA 5CRWA 2YCDA 1B48A 5H5QA 2L57A 2OKAA 3EURA 3TKSA 2F51A 2Z9SA 1SJ6A 2B1KA 2K8VA 4HZ4A 1ZZYA 3IDVA 1I5GA 4WBRD 3GTUA 3HXSA 4MJBA 1HQOA 1XFLA 3CXGA 3GIXA 4POKA 3VWUA 2F8FA 2M80A 3HVSA 3FZ4A 5IQYA 3FMWA 1TK0B 4OD7A 3QOUA 2RM5A 3GKMA 1OC3A 5D73A 4KF9A 3CQFA 1ST9A 2YV7A 4G10A 3VWXA 1X5CA 2YWOA 2HSYA 4KCEA 2G2QA 3M1GA 5ECQB 2L5LA 4YQMA 5HR2A 3ZLPA 2C3QA 2DLXA 2G0FA 5HFKA 3GYKA 1SL2B 1U3IA 3VWVA 1YEXA 1M0UA 4BIKA 2A4HA 2YV9A 3HA9A 3L9SA 3QDNA 4POMA 2PPTA 4N0ZA 5J9CA 1AW9A 4WKWA 3FR3A 4KNDA 1SKWB 4IW9A 1A0FA 5FWGA 2O85A 2DJ1A 3BBYA 2V41A 4TR0A 1AQXA 2I3YA 2DMLA 3QAVA 4MDCA 1PGTA 1C72A 3HJMA 4PNGA 3PPUA 1B4QA 3IHGA 4V2MA 2H1AA 2OE1A 2VCWA 3HD5A 5CRDA 3VPTA 1XWCA 3CSHA 3C73A 3Q6OA 3MIXA 2H30A 4G0KA 1GWCA 2O89A 1CQHA 3TRQA 5G2ZA 3FK8A 3GX0A 3CSJA 4ZL8A 2WB9A 2EIQA 3RDWA 1S3AA 4IELA 2RM6A 1TOFA 4ISDA 2FWGA 1R5PA 3DEXA 2HNLA 1PD21 2VIMA 5IOWA 2K18A 2VO4A 2DJ2A 2IFQA 4OFTA 3SWLA 2R37A 4GWRA 2V1MA 5AN1A 1MDKA 2VLVA 1TK5B 2XBIA 5LNKe 5HFGA 1K0DA 3ZFBA 4Z7XA 3IBHA 2N5FA 4MPGA 3RAZA 3C1SA 3IHQA 3KCMA 3RHCA 1A2MA 1I9DA 4DSSB 4O5QA 1DE2A 2REMA 4P3YB 1FVJA 2C3TA 1MEKA 2GSRA 1U6TA 3D21A 1PRXA 2E0QA 2ALBA 3LJRA 5E4WA 3BCIA 4O5UA 1G6YA 1DE1A 5D93A 5GZZB 7GSSA 3EMXA 3CMIA 1SJIA 4HOJA 1JHBA 3IOSA 2YWMA 3UVHA 4V2NA 1WJKA 3IK9A 1V57A 2MMOA 3BCKA 1JZDA 2WJUA 5ID2B 5LCZA 3EMPA 1XWGA 2WZ9A 4ECJA 1GUMA 2MMAA 2HT9A 2QA2A 4ICYA 4Z2RA 1XXUA 2JU5A 1FO5A 5D9XA 1X5EA 2LNTA 5KEJA 16GSA 4I8BA 3TJBA 2IMFA 2VM2A 4PTSA 1WWJA 2JACA 1R26A 3CSIA 4MK3A 2HRKA 3G7YA 3SBCA 2R3XA 2GSSA 2L6CA 1X9MB 4TW5A 5AGYA 4XS6A 2K9FA 1ERVA 3KIJA 2AB6A 1YF1A 3EU3A 3GUSA 1R5AA 2YNXA 1GLQA 1A8LA 2LTKA 2J23A 3KGKA 5ABRA 2HZFA 1PQNA 13GSA 1BYEA 2OE3A 5EVOA 1SD8A 4EXJA 1EGOA 3M9JA 1ON4A 2AJQB 1GSFA 2H1BA 4X4JA 5C00A 3TRXA 4F82A 4V1Ap 1FB6A 4XIHA 2NBSA 2HRAA 1M9AA 5DJLA 4TXOB 3P2AA 1GSYA 3F63A 5FT3A 3RBTA 1HNCA 1T3BA 4K6XA 2AUVA 5J4UA 5D9WA 5EL8A 4Q5FA 4DVCA 3A2XA 2JSZA 4MCUA 4E8HA 2DIYA 4XS4A 3LORA 1SL0B 1XCCA 3I6AA 2H76A 4PURA 3DD3A 4FO5A 1MDJA 1ILOA 1K0MA 2LJAA 3GRXA 1ERUA 1UVZA 3Q18A 5DDLA 2GLRA 3QD9A 6GSUA 3QFBC 5G1LA 4JR4A 4PUAA 1THXA 4NHZA 3VLNA 1YF0A 4TVEA 4HDEA 2VL2C 5CNWA 5B6NA 1SK0A 3FRCA 3L78A 4K2XA 5HR0A 1ZL9A 5DAKA 5CP1A 3TKPA 1MD3A 5IMDA 2PERA 4TR3A 3ME8A 2UZ8A 2GGTA 5DCGA 2K6VA 1YKCA 1YY7A 5IPGA 3FEUA 1O7UA 2YN1A 1A24A 2RLIA 2HRNA 4K5RA 1M9BA 1J9BA 4GF0A 1GL8A 5INYA 3LFLA 1AQVA 2VL9A 3QFAC 4F2IA 1Z6NA 3KEBA 1QXHA 3DXBA 4TR4A 1GRXA 2PN8A 2MMZA 1O8WA 4IS0A 4GLTA 3VURA 1TU7A 4EL1A 1GULA 1USBA 1XZOA 3VPQA 2QKEA 2KLXA 2YWNA 1TTZA 4L5LA 1GTIA 5JCWA 3QAWA 1XG8A 2O87A 5J9BA 3TJJA 4JE1A 2VOCA 1PA3A 3H79A 2CVBA 1NHYA 1SJZA 2YANA 3CRUA 1B9YC 1X0RA 3TOTA 4BVXB 3MYDA 4MH3A 2VCTA 4H86A 1PMTA 1AAZA 5E59A 4TKYA 3NZNA 4TR1B 2H0IA 2I4AA 3N5OA 4DEJA 2B5XA 2LS5A 1S3CA 2GQLA 1OVNA 4ILFA 4CY6A 2OBIA 3VK9A 1BQ7A 4HU9A 2QA1A 6GSTA 4IVFA 5GSTA 1K3LA 3MSZA 2PU9C 2YWIA 3GNJA 4KDYA 4GQCA 4X1UA 3MWHA 2GSQA 4G0IA 5D9VA 2EC4A 1URMA 2VD1A 1UN2A 2R5GA 1PKZA 5J5NA 4KCAA 4OMVA 5ECRB 2H75A 19GSA 1R4WA 2P5QA 3EU4A 2VUPA 1XIYA 2H70A 2CV4A 2GT6A 5IO2A 1O6JA 4WETA 4N0VA 3DIEA 5AISA 3F3RA 3TRPA 4QQ7A 4EO3A 1FVKA 5KOWA 1JFUA 2N5AA 2VD0A 4HJMA 5HR3A 2LKUA 2XPDA 1OAZA 2FD3A 3ISOA 3W6GA 1NSWA 3RPPA 1GTUA 2VCVA 4TR1A 1ZCPA 1A8YA 1S3DA 3KTLA 1OC9B 4ZBBA 3HCZA 4OO5A 4CW9A 4ECCA 1KBNA 3C7MA 1A2JA 1RK4A 3ZZXA 1XWAA 4BL7A 1X9WB 3KJYA 2H8LA 2WRTA 4J57E 5B8BA 3UBLA 3TB2A 2M72A 3F9UA 4YAPA 1M2DA 2HFDA 2FNOA 5HFIA 4PUFC 2V32A 3KD0A 4K0GA 4DSQA 1JLWA 1KTEA 2DMMA 4TN8A 4J56E 3EE2A 1K0BA 2GS3A 2IMDA 2GTUA 2H6XA 3F4SA 5ECSA 3CRTA 4L0UA 3IXRA 3ZVJA 4K1FA 3DVWA 4I97A 4AGSA 1Z9HA 2IL3A 3F4RA 4TOPA 1ZGNA 3KTBA 17GSA 2H71A 2N5BA
chains in the Genus database with same CATH topology
4WEYA 3HY2A 1YQ1A 3BJ5A 4FIWA 2X49A 4EUYA 4F0CA 3UARA 2HE3A 5G1KA 3WGXA 3FHKA 1OC9A 5D9TA 3NOFA 3ZRDA 5CO3A 1MTCA 3ME7A 1V9WA 2OACA 1Y25A 3TKRA 3TDGA 3VFIA 2LSTA 5JWRB 5BMUA 20GSA 4MF5A 3HKRA 5GAPD 4QL9A 2X99A 3RPNA 1FAAA 3HVXA 5IM9A 4ML1A 3L4NA 4BVYB 1EEJA 3TKSE 3A3TA 1PKWA 3FZ5A 3CYNA 1DBYA 1OE7A 1K3OA 2C0EA 3H8QA 3JCML 4RQXA 4ID0A 3HZ8A 3KH9A 4J2FA 3MDKA 2AYTA 3CTGA 2PGTA 4LA1A 4NMUA 2DJKA 2LJRA 5CRHA 4K7IA 5GSSA 4YH2A 2OADA 4PQ1A 2ON5A 2R0PA 2WCIA 2L4QA 2KP2A 4ZL9A 1VGLA 1T1VA 4D73B 4IP6A 2FUG2 1F3BA 2AAWA 4GRFA 2LJKA 2JSYA 1XW6A 1EV9A 2A2PA 2LRCA 5JCUA 1V98A 1UC7A 1Z7PA 4LMVA 3ZMLA 1GTBA 3GURA 1T7PB 2IIYA 3D22A 5FHIA 3H1NA 3IE3A 5B8AA 1NW2A 2DC5A 1K0AA 4WBJA 2O7KA 4BVYA 2P0GA 3FZ9A 3HHVA 3DGQA 2CA8A 2A2SA 4RUVA 3G7IA 3EVIA 5JWQB 3F6FA 2B3SA 1THOA 4CY8A 2JADA 3K8NA 5ENUA 5IMAA 1NHOA 1RQMA 2F3MA 3GKXA 4KAEA 1ML6A 1XW9A 2H01A 1XVWA 4L0WA 1AC1A 4GTUA 1CQGA 1Y6EA 1YEPA 4I5QA 3APOA 4D73A 2VAFA 9GSSA 3EPTA 2GT5A 3O76A 3WD6A 4N11A 4LL4B 3IPZA 6GSXA 4HQZA 5F05A 5B7CA 4Z2UA 1ABAA 4RI6A 4NHWA 3APSA 1U87A 5ECHB 4IJ3A 1T4ZA 2C0GA 4MLYA 4AJ8A 1A0RP 2OA7A 3UAPA 3LGCA 3UIWA 5KOXA 5D8IA 1G7OA 3HZ4A 4V1Ag 2YJHA 2NTOA 5DQYA 1F2EA 2R6KA 2MZCA 2A2RA 4G2EA 4CDOA 3ERWA 4DSSA 4GSNA 1M99A 4KB3A 2HXKA 2VCQA 4HJ2A 4GXZA 1V40A 5C04A 4MABA 3D4TA 2DJ3A 4GSSA 2WULA 4MZWA 4GSTA 2ON7A 5IIZA 3ZREA 5CREA 2FWEA 2B7JA 2LUSA 1HNBA 3IC8A 3O6TA 2HLSA 1WIKA 2GZYA 5F0GA 1B4PA 1XWBA 1GTAA 5ID2A 3DVXA 1BJXA 4KH7A 1VF2A 4Q5QA 3ZL5A 1BG5A 3EWLA 4KA0A 2YZUA 3KP9A 2R4VA 3D0ZA 4I6XA 2QGVA 3EINA 2ZCTA 2VLUA 22GSA 2YPMA 2H1GA 2VLTA 1VRSD 4YKGA 1QUWA 2IPAA 2FA4A 2OJLA 2C3NA 1H4OA 4K0NA 2I1UA 4JU5A 3U5RE 4EE0A 3ERFA 3ERGA 4OFMA 3WYWA 1OE8A 4PQIA 4X43A 2LEGA 3ZIVA 3L9UA 4MP4A 1MD4A 1EOGA 5A4VA 4FH8A 4FYCA 4AJ7A 2FHEA 2E2MA 2WDUA 1XWKA 2C80A 3KH7A 3GL3A 1EV4A 3UBKA 4TRXA 3LXTA 2DJ0A 2C4JA 4ZBDA 2DIZA 4IQAA 2KP1A 1WE0A 4TXOA 1XOAA 3GL5A 2H1DA 4POBA 4MA9A 4BPYA 3H4KA 1O73A 4YQUA 2MYGA 5IO0A 1Z3EA 3WT1A 5AIXA 3M0FA 1AQWA 4WF5A 2CZ3A 3ZYWA 12GSA 1TXXA 4EDZA 1TRSA 1F9MA 5F06A 2NVLA 3E9JB 1AUCA 2H6YA 3FW2A 3TKQA 4F0BA 1WMJA 3LW9A 4G19A 4LMWA 4O32A 3LQ7A 3V1WA 4ECBA 2P31A 4WR4A 4ML6A 3TKSC 4KUNA 4L8EA 3GX8A 2DJJA 2QC7A 3F8UA 3ZFLA 2VL3A 3UEMA 5DCHA 3IK7A 1GNEA 1F3AA 3EC3A 3L0HA 3UMAA 2WGRA 2CVKA 2NDOA 2QSIA 4IN0A 6GSYA 1Z7RA 4KSMA 1ZOFA 3D5JA 3I9V2 4JEDA 3US3A 1ACVA 5DQSA 3RHBA 1TU8A 3BOAA 4K9ZA 4YAVA 2GQMA 3NIVA 4MF6A 3E3EA 3GMFA 3A2VA 2C1YA 2V6OA 1FOVA 1A23A 2HI7A 1TRUA 3PH9A 2CX3A 2CX4A 4HI7A 2XBQA 2GZPA 3IAM2 4K7NA 4HZ2A 2V6KA 4PQHA 2NPBA 3U6VA 3S9FA 4GQFA 4EIQA 4PNFA 1LJRA 2C0DA 3TJGA 5A4UA 2LNSA 3KP8A 4NV5A 1JZRA 5DALB 5EPFA 2PWJA 1O85A 3N9JA 1GSUA 5B6MA 1F37A 3L9VA 5F07A 1K3YA 3TJKA 3H93A 4BVXA 2VL2A 4PGTA 2GDRA 3Q19A 3GTUB 3HJOA 4KX4A 1EP7A 4KSOA 3IR4A 1J0FA 4MPFA 4BWQA 2ZNMA 2MBTA 1TKDB 1ZMAA 5DJMA 3GKKA 2PBJA 2L6DA 4ZL7A 3A2WA 1DSBA 4NXIA 1W89A 2FCHA 6GSVA 1QK8A 4IKHA 1ZYPA 4G0LA 1U88A 2F9SA 1EEMA 5J3RA 4MJEA 4IP1A 4XS1A 3GH6A 4G9HA 1TJDA 2KOKA 1PX7A 2J9HA 1KNGA 4N10A 2HSHA 2X8HA 3MNGA 2CVDA 1SK1A 1YJ6A 1M7TA 3EYTA 3LSZA 2CT6A 1T4YA 4N30A 2X64A 2VCXA 5H5SA 4O5RA 1PL2A 2H0GA 3GSTA 4I2TA 2L5OA 4XTSA 5DALA 1WP0A 1TI3A 2GSTA 1KEBA 2LV3A 1LBKA 4XCSA 5ELAA 3QAGA 2MMNA 4CHSA 3ED3A 2FY6A 1Q98A 4IGJA 5GAND 4LLRA 18GSA 2JL4A 3C1RA 1QMVA 1E2YA 2IWTA 1TRWA 1VF3A 1EWXA 1A2LA 1QFNA 4FQUA 1VF1A 4X0XA 3OR5A 1K0OA 2H19A 1XVQA 5ECPB 5BRTA 4EC0A 5COHA 5KN0A 3F4TA 2X8GA 1V2AA 2AV4A 1AIUA 1M2AA 1FB0A 3DMLA 2K8SA 2IFQB 4WR5A 3O3TA 3TCOA 2PVOC 5KN1A 1B8XA 1FG4A 4OWYA 4ZB6A 5G31A 3ZMKA 1WPIA 4ZB9A 3DRNA 1R7HA 3F3QA 2IJYA 4OO4A 4NWYA 5G5EA 3LWAA 1OKDA 2IMEA 3R2QA 4JR6A 2A4VA 3IC4A 2IMKA 1GP1A 4HU7A 2YJ7A 4GCIA 3UJ1A 5G5FA 3VI5A 2B1LA 5KN2A 3M9KA 2XPEA 3FYGA 4MJCA 1H75A 1PL1A 2EIRA 4USSA 2RUFA 1DUGA 4MZBA 2KUCA 1QQ2A 1EP8A 4OCFA 2E2GA 2DBCA 3GA4A 1BEDA 1GSSA 4FYUA 2EIOA 4HS1A 5ECMB 1YKAA 1UA5A 1K0NA 2HYXA 1ERWA 4QL7A 3G9BA 3TOUA 4O7HA 4XHMA 4XRDA 4POLA 3GKNA 2C8UA 2V2GA 1TI1A 1HNAA 3HJPA 4MJAA 3KM6A 2B6MA 3WT2A 4MZCA 1PX6A 3IAS2 5DVBA 5IMFA 4YQVA 4IQ1A 3HDCA 1JZWA 5D96A 2CAQA 1EGRA 1TW9A 2CAIA 5HQPA 3VWWA 3FKFA 5KN3A 14GSA 1QGVA 1O81A 1OYJA 2HZEB 1VF4A 1YDKA 1FOHA 2RUEA 4ZXGA 3HYPA 3P90A 4F9ZA 4EF0A 4NAXA 4L5OA 2TIRA 2P5RA 4IJIA 4KE3A 2HRFA 1GSEA 4AJ6A 4EDYA 3GN3A 1ZYNA 4K5SA 4BWSA 4EVMA 4HQSA 4A5PA 1NM3A 3E0UA 3PINA 3AY8A 5IMZA 1SKSB 1OC8A 2DKIA 3I69A 3FR6A 1EOHA 1TDIA 3GH9A 2H0HA 2B7KA 4OFNA 2IMIA 1MDIA 4KDXA 3LYKA 3ZITA 3A5WA 3PR8A 4WXTA 3P7XA 2MBSA 4JZQA 4KW6A 2LQQA 4XS4B 2YOIA 6GSWA 3UVTA 3FR9A 3C71A 2TRXA 3IA1A 3MAKA 1SYXA 4ZB8A 2GZZA 1LU4A 4PX1A 3IV4A 1SU9A 3LEFA 3I43A 2F8AA 2BMXA 4BA7A 2WS2A 3C8EA 2LRNA 1SL1B 3M3MA 2HZEA 4MNNA 2HSMA 5AIVA 4NV2A 2JZRA 2VM1A 2VCZA 3GSSA 5DAKB 1ERTA 4DSRA 2GQKA 2GVPA 5A5KA 2ES7A 3TJFA 4O92A 1GLPA 1F6MC 2E7PA 3TGZA 5JWOB 1GUKA 1SK2A 10GSA 5J41A 1G0TA 2YZHA 2AHEA 4MF7A 4TXVA 3GV1A 1PN9A 1HD2A 2JZSA 4ACSA 5IMVA 1PN0A 2C0FA 4IHUA 4KDUA 5ECNB 1G7EA 2H6ZA 5CAXA 2CQ9A 4V2LA 1TRVA 3P8WA 1SYRA 3VI7A 5IMCA 4OCEA 3W8SA 2IN3A 2O8VB 5CYYA 1XBSA 1W4VA 4K8MA 1XPVA 3J7Yk 3QMXA 2FWHA 1O8XA 2L4CA 1JZOA 3QPMA 2LQOA 4ZILA 1X9SB 4FYBA 4KGIA 2R0CA 5IOXA 3HVVA 3QR6A 5EY6A 4Q5RA 2FLSA 1WRYA 1SD9A 2RIIA 2ZUPA 3KZQA 4ECIA 3M8NA 3KXOA 1JLVA 3QCPA 6GSSA 2D2ZA 4JBBA 1PSQA 5ECIB 2M46A 3FZAA 2B5YA 3W8JA 4ULXA 4K2DA 2OBKA 3F0IA 5G30A 1IYIA 3F6DA 1Z6MA 1XOBA 3DYRA 1ZYQB 4MH2A 3LXZA 2OE0A 4LL1B 4ZBAA 1T00A 2R0GA 1X5DA 5IPHA 4HUAA 5L71A 3D4MA 4PXOA 4WF4A 1IYHA 2H72A 2H73A 1SENA 2BJXA 2DKHA 2JZTA 1J08A 1BX9A 4YKFA 5CRGA 1FHEA 2X8CA 1GSDA 2WFCA 4MMMA 4Z2TA 2CZ2A 3A5IA 5ELGA 1GH2A 3UOMA 2FA8A 3J7Yb 2H66A 5ECLB 1EZKA 5LD0A 3DWVA 3ZVJD 4AF2A 1G6WA 3WGEA 3KMNA 2YP6A 5HR1A 1OKTA 3IRAA 3APQA 3PGTA 2XC2A 3CTFA 2I9HA 4BL7B 2I81A 2XHFA 3GHAA 3D6IA 5A4WA 3GFKA 3BD2A 3LYPA 2H74A 1SKRB 2KHPA 4I2UA 3UL3A 4ZIJA 4NPBA 4F03A 1GSQA 1U3AA 1GUHA 3R3EA 2R2JA 8GSSA 1FW1A 2PVQA 4XRAA 3ZIJA 1B9XC 2TRCP 1K0CA 5ECKB 3ZTLA 5F8BA 2DSAA 3G7JA 2LRTA 5DBQA 4RI7A 3CBUA 2B5EA 4EKZA 4Q5NA 2FWFA 4E8EA 3FY7A 4JRRA 4EIPA 3TUEA 3DKSA 1N2AA 4RQRA 3LG6A 5H5RA 2PMTA 3WGDA 1GNWA 1BAYA 4K7OA 2X4AA 5ECOB 4HEA2 1N8JA 2BTOT 1WOUA 1V58A 11GSA 2L59A 1YZXA 1M2BA 1HYUA 5JCGA 2PUKC 1Z5YE 1XW5A 1AXDA 1RW1A 1E6BA 1TP9A 1TK8B 1ZYEA 3KMOA 1T8EB 2FGXA 3Q74A 4IBPA 1Q4JA 5CRWA 2YCDA 1B48A 5H5QA 2L57A 2OKAA 3EURA 3TKSA 2F51A 2Z9SA 1SJ6A 2B1KA 2K8VA 4HZ4A 1ZZYA 3IDVA 1I5GA 4WBRD 3GTUA 3HXSA 4MJBA 1HQOA 1XFLA 3CXGA 3GIXA 4POKA 3VWUA 2F8FA 2M80A 3HVSA 3FZ4A 5IQYA 3FMWA 1TK0B 4OD7A 3QOUA 2RM5A 3GKMA 1OC3A 5D73A 4KF9A 1ST9A 2YV7A 4G10A 3VWXA 1X5CA 2YWOA 2HSYA 4KCEA 2G2QA 3M1GA 5ECQB 2L5LA 4YQMA 5HR2A 3ZLPA 2C3QA 2DLXA 2G0FA 5HFKA 3GYKA 1SL2B 1U3IA 3VWVA 1YEXA 1M0UA 2A4HA 2YV9A 3HA9A 3L9SA 3QDNA 4POMA 2PPTA 4N0ZA 5J9CA 1AW9A 4WKWA 3FR3A 4KNDA 1SKWB 4IW9A 1A0FA 5FWGA 2O85A 2DJ1A 3BBYA 2V41A 4TR0A 1AQXA 2I3YA 2DMLA 3QAVA 4MDCA 1PGTA 1C72A 3HJMA 4PNGA 3PPUA 1B4QA 3IHGA 4V2MA 2H1AA 2OE1A 2VCWA 3HD5A 5CRDA 3VPTA 1XWCA 3CSHA 3C73A 3Q6OA 3MIXA 2H30A 4G0KA 1GWCA 2O89A 1CQHA 3TRQA 5G2ZA 3FK8A 3GX0A 3CSJA 4ZL8A 2WB9A 2EIQA 3RDWA 1S3AA 4IELA 2RM6A 1TOFA 4ISDA 2FWGA 1R5PA 3DEXA 2HNLA 1PD21 2VIMA 5IOWA 2K18A 2VO4A 2DJ2A 2IFQA 4OFTA 3SWLA 2R37A 4GWRA 2V1MA 5AN1A 1MDKA 2VLVA 1TK5B 2XBIA 5LNKe 5HFGA 1K0DA 3ZFBA 4Z7XA 3IBHA 2N5FA 4MPGA 3RAZA 3C1SA 3IHQA 3KCMA 3RHCA 1A2MA 1I9DA 4DSSB 4O5QA 1DE2A 2REMA 4P3YB 1FVJA 2C3TA 1MEKA 2GSRA 1U6TA 3D21A 1PRXA 2E0QA 2ALBA 3LJRA 5E4WA 3BCIA 4O5UA 1G6YA 1DE1A 5D93A 5GZZB 7GSSA 3EMXA 3CMIA 1SJIA 4HOJA 1JHBA 3IOSA 2YWMA 3UVHA 4V2NA 1WJKA 3IK9A 1V57A 2MMOA 3BCKA 1JZDA 2WJUA 5ID2B 5LCZA 3EMPA 1XWGA 2WZ9A 4ECJA 1GUMA 2MMAA 2HT9A 2QA2A 4ICYA 4Z2RA 1XXUA 2JU5A 1FO5A 5D9XA 1X5EA 2LNTA 5KEJA 16GSA 4I8BA 3TJBA 2IMFA 2VM2A 4PTSA 1WWJA 2JACA 1R26A 3CSIA 4MK3A 2HRKA 3G7YA 3SBCA 2R3XA 2GSSA 2L6CA 1X9MB 4TW5A 5AGYA 4XS6A 2K9FA 1ERVA 3KIJA 2AB6A 1YF1A 3EU3A 3GUSA 1R5AA 2YNXA 1GLQA 1A8LA 2LTKA 2J23A 3KGKA 5ABRA 2HZFA 1PQNA 13GSA 1BYEA 2OE3A 5EVOA 1SD8A 4EXJA 1EGOA 3M9JA 1ON4A 2AJQB 1GSFA 2H1BA 4X4JA 5C00A 3TRXA 4F82A 4V1Ap 1FB6A 4XIHA 2NBSA 2HRAA 1M9AA 5DJLA 4TXOB 3P2AA 1GSYA 3F63A 5FT3A 3RBTA 1HNCA 1T3BA 4K6XA 2AUVA 5J4UA 5D9WA 5EL8A 4Q5FA 4DVCA 3A2XA 2JSZA 4MCUA 4E8HA 2DIYA 4XS4A 3LORA 1SL0B 1XCCA 3I6AA 2H76A 4PURA 3DD3A 4FO5A 1MDJA 1ILOA 1K0MA 2LJAA 3GRXA 1ERUA 1UVZA 3Q18A 5DDLA 2GLRA 3QD9A 6GSUA 3QFBC 5G1LA 4JR4A 4PUAA 1THXA 4NHZA 3VLNA 1YF0A 4TVEA 4HDEA 2VL2C 5CNWA 5B6NA 1SK0A 3FRCA 3L78A 4K2XA 5HR0A 1ZL9A 5DAKA 5CP1A 3TKPA 1MD3A 5IMDA 2PERA 4TR3A 3ME8A 2UZ8A 2GGTA 5DCGA 2K6VA 1YKCA 1YY7A 5IPGA 3FEUA 1O7UA 2YN1A 1A24A 2RLIA 2HRNA 4K5RA 1M9BA 1J9BA 4GF0A 1GL8A 5INYA 3LFLA 1AQVA 2VL9A 3QFAC 4F2IA 1Z6NA 3KEBA 1QXHA 3DXBA 4TR4A 1GRXA 2PN8A 2MMZA 1O8WA 4IS0A 4GLTA 3VURA 1TU7A 4EL1A 1GULA 1USBA 1XZOA 3VPQA 2QKEA 2KLXA 2YWNA 1TTZA 4L5LA 1GTIA 5JCWA 3QAWA 2O87A 5J9BA 3TJJA 4JE1A 2VOCA 1PA3A 3H79A 2CVBA 1NHYA 1SJZA 2YANA 3CRUA 1B9YC 1X0RA 3TOTA 4BVXB 3MYDA 4MH3A 2VCTA 4H86A 1PMTA 1AAZA 5E59A 4TKYA 3NZNA 4TR1B 2H0IA 2I4AA 3N5OA 4DEJA 2B5XA 2LS5A 1S3CA 2GQLA 1OVNA 4ILFA 4CY6A 2OBIA 3VK9A 1BQ7A 4HU9A 2QA1A 6GSTA 4IVFA 5GSTA 1K3LA 3MSZA 2PU9C 2YWIA 3GNJA 4KDYA 4GQCA 4X1UA 3MWHA 2GSQA 4G0IA 5D9VA 2EC4A 1URMA 2VD1A 1UN2A 2R5GA 1PKZA 5J5NA 4KCAA 4OMVA 5ECRB 2H75A 19GSA 1R4WA 2P5QA 3EU4A 2VUPA 1XIYA 2H70A 2CV4A 2GT6A 5IO2A 1O6JA 4WETA 4N0VA 3DIEA 5AISA 3F3RA 3TRPA 4QQ7A 4EO3A 1FVKA 5KOWA 1JFUA 2N5AA 2VD0A 4HJMA 5HR3A 2LKUA 2XPDA 1OAZA 2FD3A 3ISOA 3W6GA 1NSWA 3RPPA 1GTUA 2VCVA 4TR1A 1ZCPA 1A8YA 1S3DA 3KTLA 1OC9B 4ZBBA 3HCZA 4OO5A 4CW9A 4ECCA 1KBNA 3C7MA 1A2JA 1RK4A 3ZZXA 1XWAA 4BL7A 1X9WB 3KJYA 2H8LA 2WRTA 4J57E 5B8BA 3UBLA 3TB2A 2M72A 3F9UA 4YAPA 1M2DA 2HFDA 2FNOA 5HFIA 4PUFC 2V32A 3KD0A 4K0GA 4DSQA 1JLWA 1KTEA 2DMMA 4TN8A 4J56E 3EE2A 1K0BA 2GS3A 2IMDA 2GTUA 2H6XA 3F4SA 5ECSA 3CRTA 4L0UA 3IXRA 3ZVJA 4K1FA 3DVWA 4I97A 4AGSA 1Z9HA 2IL3A 3F4RA 4TOPA 1ZGNA 3KTBA 17GSA 2H71A 2N5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WEY A;  3HY2 A;  1YQ1 A;  3BJ5 A;  4FIW A;  4EUY A;  4F0C A;  3UAR A;  2HE3 A;  5G1K A;  3WGX A;  3FHK A;  1OC9 A;  5D9T A;  3NOF A;  3ZRD A;  5CO3 A;  1MTC A;  3ME7 A;  1V9W A;  2OAC A;  1Y25 A;  3TKR A;  3TDG A;  3VFI A;  2LST A;  5JWR B;  20GS A;  4MF5 A;  3HKR A;  5GAP D;  4QL9 A;  2X99 A;  3RPN A;  1FAA A;  3HVX A;  5IM9 A;  4ML1 A;  3L4N A;  1EEJ A;  3TKS E;  3A3T A;  1PKW A;  3FZ5 A;  3CYN A;  1DBY A;  1OE7 A;  1K3O A;  2C0E A;  3H8Q A;  3JCM L;  4RQX A;  4ID0 A;  3HZ8 A;  3KH9 A;  4J2F A;  3MDK A;  2AYT A;  3CTG A;  2PGT A;  4LA1 A;  4NMU A;  2DJK A;  2LJR A;  5CRH A;  4K7I A;  5GSS A;  4YH2 A;  2OAD A;  4PQ1 A;  2ON5 A;  2WCI A;  2L4Q A;  2KP2 A;  4ZL9 A;  1VGL A;  1T1V A;  4D73 B;  4IP6 A;  2FUG 2;  1F3B A;  2AAW A;  4GRF A;  2LJK A;  2JSY A;  1XW6 A;  1EV9 A;  2LRC A;  5JCU A;  1V98 A;  1UC7 A;  1Z7P A;  4LMV A;  3ZML A;  1GTB A;  3GUR A;  1T7P B;  2IIY A;  3D22 A;  5FHI A;  3H1N A;  3IE3 A;  5B8A A;  1NW2 A;  2DC5 A;  1K0A A;  4WBJ A;  2O7K A;  4BVY A;  2P0G A;  3FZ9 A;  3HHV A;  3DGQ A;  2CA8 A;  2A2S A;  4RUV A;  3G7I A;  3EVI A;  5JWQ B;  3F6F A;  2B3S A;  1THO A;  2JAD A;  3K8N A;  5ENU A;  5IMA A;  1NHO A;  1RQM A;  2F3M A;  3GKX A;  4KAE A;  1ML6 A;  1XW9 A;  2H01 A;  1XVW A;  4L0W A;  1AC1 A;  4GTU A;  1CQG A;  1Y6E A;  1YEP A;  4I5Q A;  3APO A;  4D73 A;  2VAF A;  9GSS A;  2GT5 A;  3O76 A;  3WD6 A;  4N11 A;  4LL4 B;  3IPZ A;  6GSX A;  4HQZ A;  5F05 A;  5B7C A;  1ABA A;  4RI6 A;  4NHW A;  3APS A;  1U87 A;  5ECH B;  4IJ3 A;  1T4Z A;  2C0G A;  4MLY A;  4AJ8 A;  1A0R P;  2OA7 A;  3UAP A;  3LGC A;  3UIW A;  5D8I A;  1G7O A;  3HZ4 A;  4V1A g;  2YJH A;  2NTO A;  5DQY A;  1F2E A;  2R6K A;  2MZC A;  2A2R A;  4G2E A;  4CDO A;  3ERW A;  4DSS A;  4GSN A;  1M99 A;  4KB3 A;  2HXK A;  2VCQ A;  4HJ2 A;  4GXZ A;  1V40 A;  5C04 A;  4MAB A;  3D4T A;  2DJ3 A;  4GSS A;  2WUL A;  4MZW A;  4GST A;  2ON7 A;  5IIZ A;  3ZRE A;  5CRE A;  2FWE A;  2B7J A;  2LUS A;  1HNB A;  3O6T A;  2HLS A;  1WIK A;  2GZY A;  5F0G A;  1B4P A;  1XWB A;  1GTA A;  5ID2 A;  3DVX A;  1BJX A;  4KH7 A;  1VF2 A;  4Q5Q A;  3ZL5 A;  1BG5 A;  3EWL A;  4KA0 A;  2YZU A;  3KP9 A;  2R4V A;  3D0Z A;  4I6X A;  2QGV A;  3EIN A;  2ZCT A;  2VLU A;  22GS A;  2YPM A;  2H1G A;  2VLT A;  1VRS D;  1QUW A;  2IPA A;  2FA4 A;  2OJL A;  2C3N A;  1H4O A;  4K0N A;  2I1U A;  4JU5 A;  3U5R E;  4EE0 A;  3ERF A;  3ERG A;  4OFM A;  3WYW A;  1OE8 A;  4PQI A;  4X43 A;  2LEG A;  3ZIV A;  3L9U A;  4MP4 A;  1MD4 A;  1EOG A;  5A4V A;  4FH8 A;  4FYC A;  4AJ7 A;  2FHE A;  2E2M A;  2WDU A;  1XWK A;  2C80 A;  3KH7 A;  3GL3 A;  1EV4 A;  3UBK A;  4TRX A;  3LXT A;  2DJ0 A;  2C4J A;  4ZBD A;  2DIZ A;  4IQA A;  2KP1 A;  1WE0 A;  4TXO A;  1XOA A;  3GL5 A;  2H1D A;  4POB A;  4MA9 A;  4BPY A;  3H4K A;  1O73 A;  4YQU A;  2MYG A;  5IO0 A;  1Z3E A;  3WT1 A;  5AIX A;  3M0F A;  1AQW A;  4WF5 A;  2CZ3 A;  3ZYW A;  12GS A;  1TXX A;  4EDZ A;  1TRS A;  1F9M A;  5F06 A;  2NVL A;  3E9J B;  1AUC A;  2H6Y A;  3FW2 A;  3TKQ A;  4F0B A;  1WMJ A;  4G19 A;  4LMW A;  4O32 A;  3LQ7 A;  3V1W A;  4ECB A;  2P31 A;  4WR4 A;  4ML6 A;  3TKS C;  4KUN A;  4L8E A;  3GX8 A;  2DJJ A;  2QC7 A;  3F8U A;  3ZFL A;  2VL3 A;  3UEM A;  5DCH A;  3IK7 A;  1GNE A;  1F3A A;  3EC3 A;  3L0H A;  3UMA A;  2WGR A;  2CVK A;  2NDO A;  2QSI A;  4IN0 A;  6GSY A;  1Z7R A;  4KSM A;  1ZOF A;  3D5J A;  3I9V 2;  4JED A;  3US3 A;  1ACV A;  5DQS A;  3RHB A;  1TU8 A;  3BOA A;  4K9Z A;  4YAV A;  2GQM A;  3NIV A;  4MF6 A;  3E3E A;  3GMF A;  3A2V A;  2C1Y A;  2V6O A;  1FOV A;  1A23 A;  2HI7 A;  1TRU A;  3PH9 A;  2CX3 A;  2CX4 A;  4HI7 A;  2XBQ A;  2GZP A;  3IAM 2;  4K7N A;  4HZ2 A;  2V6K A;  4PQH A;  2NPB A;  3U6V A;  3S9F A;  4GQF A;  4PNF A;  1LJR A;  2C0D A;  3TJG A;  5A4U A;  2LNS A;  3KP8 A;  4NV5 A;  1JZR A;  5DAL B;  5EPF A;  2PWJ A;  1O85 A;  3N9J A;  1GSU A;  5B6M A;  1F37 A;  3L9V A;  5F07 A;  1K3Y A;  3TJK A;  3H93 A;  4BVX A;  2VL2 A;  4PGT A;  2GDR A;  3Q19 A;  3GTU B;  3HJO A;  4KX4 A;  1EP7 A;  4KSO A;  3IR4 A;  1J0F A;  4MPF A;  4BWQ A;  2ZNM A;  2MBT A;  1TKD B;  1ZMA A;  5DJM A;  3GKK A;  2PBJ A;  2L6D A;  4ZL7 A;  3A2W A;  1DSB A;  4NXI A;  1W89 A;  2FCH A;  6GSV A;  1QK8 A;  4IKH A;  1U88 A;  2F9S A;  1EEM A;  5J3R A;  4MJE A;  4IP1 A;  4XS1 A;  3GH6 A;  4G9H A;  1TJD A;  2KOK A;  1PX7 A;  2J9H A;  1KNG A;  4N10 A;  2HSH A;  2X8H A;  3MNG A;  2CVD A;  1SK1 A;  1YJ6 A;  1M7T A;  3EYT A;  3LSZ A;  2CT6 A;  1T4Y A;  4N30 A;  2X64 A;  2VCX A;  5H5S A;  4O5R A;  1PL2 A;  2H0G A;  3GST A;  4I2T A;  2L5O A;  4XTS A;  5DAL A;  1WP0 A;  1TI3 A;  2GST A;  1KEB A;  2LV3 A;  1LBK A;  4XCS A;  5ELA A;  3QAG A;  2MMN A;  4CHS A;  3ED3 A;  2FY6 A;  1Q98 A;  4IGJ A;  5GAN D;  4LLR A;  18GS A;  2JL4 A;  3C1R A;  1QMV A;  1E2Y A;  2IWT A;  1TRW A;  1VF3 A;  1EWX A;  1A2L A;  1QFN A;  1VF1 A;  4X0X A;  3OR5 A;  1K0O A;  2H19 A;  1XVQ A;  5ECP B;  4EC0 A;  5COH A;  5KN0 A;  3F4T A;  2X8G A;  1V2A A;  2AV4 A;  1AIU A;  1M2A A;  1FB0 A;  3DML A;  2K8S A;  2IFQ B;  4WR5 A;  3O3T A;  3TCO A;  2PVO C;  5KN1 A;  1B8X A;  1FG4 A;  4OWY A;  4ZB6 A;  5G31 A;  3ZMK A;  1WPI A;  4ZB9 A;  3DRN A;  1R7H A;  3F3Q A;  2IJY A;  4OO4 A;  4NWY A;  5G5E A;  3LWA A;  1OKD A;  2IME A;  3R2Q A;  4JR6 A;  2A4V A;  3IC4 A;  2IMK A;  1GP1 A;  4HU7 A;  2YJ7 A;  4GCI A;  3UJ1 A;  5G5F A;  3VI5 A;  2B1L A;  5KN2 A;  3M9K A;  2XPE A;  3FYG A;  4MJC A;  1H75 A;  1PL1 A;  2EIR A;  2RUF A;  1DUG A;  4MZB A;  2KUC A;  1QQ2 A;  1EP8 A;  4OCF A;  2E2G A;  2DBC A;  3GA4 A;  1BED A;  1GSS A;  4FYU A;  2EIO A;  4HS1 A;  5ECM B;  1YKA A;  1UA5 A;  1K0N A;  2HYX A;  1ERW A;  4QL7 A;  3G9B A;  3TOU A;  4O7H A;  4XHM A;  4XRD A;  4POL A;  3GKN A;  2C8U A;  2V2G A;  1TI1 A;  1HNA A;  3HJP A;  4MJA A;  3KM6 A;  2B6M A;  3WT2 A;  4MZC A;  1PX6 A;  3IAS 2;  5DVB A;  5IMF A;  4YQV A;  4IQ1 A;  3HDC A;  1JZW A;  5D96 A;  2CAQ A;  1EGR A;  1TW9 A;  2CAI A;  5HQP A;  3VWW A;  3FKF A;  5KN3 A;  14GS A;  1QGV A;  1O81 A;  1OYJ A;  2HZE B;  1VF4 A;  1YDK A;  2RUE A;  4ZXG A;  3HYP A;  3P90 A;  4F9Z A;  4EF0 A;  4NAX A;  4L5O A;  2TIR A;  2P5R A;  4IJI A;  4KE3 A;  2HRF A;  1GSE A;  4AJ6 A;  4EDY A;  3GN3 A;  4EVM A;  4BWS A;  4HQS A;  1NM3 A;  3E0U A;  3PIN A;  3AY8 A;  5IMZ A;  1SKS B;  1OC8 A;  3I69 A;  3FR6 A;  1EOH A;  1TDI A;  3GH9 A;  2H0H A;  2B7K A;  4OFN A;  2IMI A;  1MDI A;  4KDX A;  3LYK A;  3ZIT A;  3A5W A;  3PR8 A;  4WXT A;  3P7X A;  2MBS A;  4JZQ A;  4KW6 A;  2LQQ A;  4XS4 B;  2YOI A;  6GSW A;  3UVT A;  3FR9 A;  3C71 A;  2TRX A;  3IA1 A;  3MAK A;  1SYX A;  4ZB8 A;  2GZZ A;  1LU4 A;  4PX1 A;  3IV4 A;  1SU9 A;  3LEF A;  3I43 A;  2F8A A;  2BMX A;  4BA7 A;  2WS2 A;  3C8E A;  2LRN A;  1SL1 B;  3M3M A;  2HZE A;  5AIV A;  4NV2 A;  2JZR A;  2VM1 A;  2VCZ A;  3GSS A;  5DAK B;  1ERT A;  4DSR A;  2GQK A;  2GVP A;  5A5K A;  2ES7 A;  3TJF A;  4O92 A;  1GLP A;  1F6M C;  2E7P A;  3TGZ A;  5JWO B;  1GUK A;  1SK2 A;  10GS A;  5J41 A;  1G0T A;  2YZH A;  2AHE A;  4MF7 A;  4TXV A;  3GV1 A;  1PN9 A;  1HD2 A;  2JZS A;  4ACS A;  5IMV A;  2C0F A;  4IHU A;  4KDU A;  5ECN B;  1G7E A;  2H6Z A;  5CAX A;  2CQ9 A;  4V2L A;  1TRV A;  3P8W A;  1SYR A;  3VI7 A;  5IMC A;  4OCE A;  3W8S A;  2IN3 A;  2O8V B;  5CYY A;  1XBS A;  1W4V A;  4K8M A;  1XPV A;  3J7Y k;  3QMX A;  2FWH A;  1O8X A;  2L4C A;  1JZO A;  3QPM A;  2LQO A;  4ZIL A;  1X9S B;  4FYB A;  4KGI A;  5IOX A;  3HVV A;  3QR6 A;  5EY6 A;  4Q5R A;  2FLS A;  1WRY A;  1SD9 A;  2RII A;  2ZUP A;  3KZQ A;  4ECI A;  3M8N A;  3KXO A;  1JLV A;  3QCP A;  6GSS A;  2D2Z A;  4JBB A;  1PSQ A;  5ECI B;  2M46 A;  3FZA A;  2B5Y A;  3W8J A;  4ULX A;  4K2D A;  2OBK A;  3F0I A;  5G30 A;  1IYI A;  3F6D A;  1Z6M A;  1XOB A;  3DYR A;  1ZYQ B;  4MH2 A;  3LXZ A;  2OE0 A;  4LL1 B;  4ZBA A;  1T00 A;  1X5D A;  5IPH A;  4HUA A;  5L71 A;  3D4M A;  4PXO A;  4WF4 A;  1IYH A;  2H72 A;  2H73 A;  1SEN A;  2BJX A;  2JZT A;  1J08 A;  1BX9 A;  5CRG A;  1FHE A;  2X8C A;  1GSD A;  2WFC A;  4MMM A;  2CZ2 A;  5ELG A;  1GH2 A;  3UOM A;  2FA8 A;  3J7Y b;  2H66 A;  5ECL B;  1EZK A;  5LD0 A;  3DWV A;  3ZVJ D;  4AF2 A;  1G6W A;  3WGE A;  3KMN A;  2YP6 A;  5HR1 A;  1OKT A;  3IRA A;  3APQ A;  3PGT A;  2XC2 A;  3CTF A;  2I9H A;  2I81 A;  2XHF A;  3GHA A;  3D6I A;  5A4W A;  3GFK A;  3BD2 A;  3LYP A;  2H74 A;  1SKR B;  2KHP A;  4I2U A;  3UL3 A;  4ZIJ A;  4NPB A;  4F03 A;  1GSQ A;  1U3A A;  1GUH A;  2R2J A;  8GSS A;  1FW1 A;  2PVQ A;  4XRA A;  3ZIJ A;  1B9X C;  2TRC P;  1K0C A;  5ECK B;  3ZTL A;  5F8B A;  2DSA A;  3G7J A;  2LRT A;  5DBQ A;  4RI7 A;  3CBU A;  2B5E A;  4EKZ A;  4Q5N A;  2FWF A;  4E8E A;  3FY7 A;  4JRR A;  3TUE A;  3DKS A;  1N2A A;  4RQR A;  3LG6 A;  5H5R A;  2PMT A;  3WGD A;  1GNW A;  1BAY A;  4K7O A;  5ECO B;  4HEA 2;  1N8J A;  2BTO T;  1WOU A;  1V58 A;  11GS A;  2L59 A;  1YZX A;  1M2B A;  1HYU A;  5JCG A;  2PUK C;  1Z5Y E;  1XW5 A;  1AXD A;  1RW1 A;  1E6B A;  1TP9 A;  1TK8 B;  1ZYE A;  3KMO A;  1T8E B;  2FGX A;  3Q74 A;  4IBP A;  1Q4J A;  5CRW A;  2YCD A;  1B48 A;  5H5Q A;  2L57 A;  2OKA A;  3EUR A;  3TKS A;  2F51 A;  2Z9S A;  1SJ6 A;  2B1K A;  2K8V A;  4HZ4 A;  1ZZY A;  3IDV A;  1I5G A;  4WBR D;  3GTU A;  3HXS A;  4MJB A;  1HQO A;  1XFL A;  3CXG A;  3GIX A;  4POK A;  3VWU A;  2F8F A;  2M80 A;  3HVS A;  3FZ4 A;  5IQY A;  1TK0 B;  4OD7 A;  3QOU A;  2RM5 A;  3GKM A;  1OC3 A;  5D73 A;  1ST9 A;  2YV7 A;  4G10 A;  3VWX A;  1X5C A;  2YWO A;  2HSY A;  4KCE A;  2G2Q A;  3M1G A;  5ECQ B;  2L5L A;  4YQM A;  5HR2 A;  3ZLP A;  2C3Q A;  2DLX A;  2G0F A;  5HFK A;  3GYK A;  1SL2 B;  1U3I A;  3VWV A;  1YEX A;  1M0U A;  2YV9 A;  3HA9 A;  3L9S A;  3QDN A;  4POM A;  2PPT A;  4N0Z A;  5J9C A;  1AW9 A;  4WKW A;  3FR3 A;  4KND A;  1SKW B;  4IW9 A;  1A0F A;  5FWG A;  2O85 A;  2DJ1 A;  3BBY A;  2V41 A;  4TR0 A;  1AQX A;  2I3Y A;  2DML A;  3QAV A;  4MDC A;  1PGT A;  1C72 A;  3HJM A;  4PNG A;  1B4Q A;  4V2M A;  2H1A A;  2OE1 A;  2VCW A;  3HD5 A;  5CRD A;  3VPT A;  1XWC A;  3CSH A;  3C73 A;  3Q6O A;  2H30 A;  1GWC A;  2O89 A;  1CQH A;  3TRQ A;  5G2Z A;  3FK8 A;  3GX0 A;  3CSJ A;  4ZL8 A;  2WB9 A;  2EIQ A;  3RDW A;  1S3A A;  4IEL A;  2RM6 A;  1TOF A;  4ISD A;  2FWG A;  1R5P A;  3DEX A;  2HNL A;  1PD2 1;  2VIM A;  5IOW A;  2K18 A;  2VO4 A;  2DJ2 A;  2IFQ A;  4OFT A;  3SWL A;  2R37 A;  4GWR A;  2V1M A;  5AN1 A;  1MDK A;  2VLV A;  1TK5 B;  2XBI A;  5LNK e;  5HFG A;  1K0D A;  3ZFB A;  4Z7X A;  3IBH A;  2N5F A;  4MPG A;  3RAZ A;  3C1S A;  3IHQ A;  3KCM A;  3RHC A;  1A2M A;  1I9D A;  4DSS B;  1DE2 A;  2REM A;  4P3Y B;  1FVJ A;  2C3T A;  1MEK A;  2GSR A;  1U6T A;  3D21 A;  1PRX A;  2E0Q A;  2ALB A;  3LJR A;  5E4W A;  3BCI A;  1G6Y A;  1DE1 A;  5D93 A;  5GZZ B;  7GSS A;  3EMX A;  3CMI A;  1SJI A;  4HOJ A;  1JHB A;  3IOS A;  2YWM A;  3UVH A;  4V2N A;  1WJK A;  3IK9 A;  1V57 A;  2MMO A;  3BCK A;  1JZD A;  2WJU A;  5ID2 B;  5LCZ A;  3EMP A;  1XWG A;  2WZ9 A;  4ECJ A;  1GUM A;  2MMA A;  2HT9 A;  1XXU A;  2JU5 A;  1FO5 A;  5D9X A;  1X5E A;  2LNT A;  5KEJ A;  16GS A;  4I8B A;  3TJB A;  2IMF A;  2VM2 A;  1WWJ A;  2JAC A;  1R26 A;  3CSI A;  4MK3 A;  3G7Y A;  3SBC A;  2R3X A;  2GSS A;  2L6C A;  1X9M B;  4TW5 A;  5AGY A;  4XS6 A;  2K9F A;  1ERV A;  3KIJ A;  2AB6 A;  1YF1 A;  3EU3 A;  3GUS A;  1R5A A;  2YNX A;  1GLQ A;  1A8L A;  2LTK A;  2J23 A;  3KGK A;  5ABR A;  2HZF A;  1PQN A;  13GS A;  1BYE A;  2OE3 A;  5EVO A;  1SD8 A;  4EXJ A;  1EGO A;  3M9J A;  1ON4 A;  2AJQ B;  1GSF A;  2H1B A;  5C00 A;  3TRX A;  4F82 A;  4V1A p;  1FB6 A;  4XIH A;  2NBS A;  1M9A A;  5DJL A;  4TXO B;  3P2A A;  1GSY A;  3F63 A;  5FT3 A;  3RBT A;  1HNC A;  1T3B A;  4K6X A;  2AUV A;  5J4U A;  5D9W A;  5EL8 A;  4Q5F A;  4DVC A;  3A2X A;  2JSZ A;  4MCU A;  4E8H A;  2DIY A;  4XS4 A;  3LOR A;  1SL0 B;  1XCC A;  3I6A A;  2H76 A;  4PUR A;  3DD3 A;  4FO5 A;  1MDJ A;  1ILO A;  1K0M A;  2LJA A;  3GRX A;  1ERU A;  1UVZ A;  3Q18 A;  5DDL A;  2GLR A;  3QD9 A;  6GSU A;  3QFB C;  5G1L A;  4JR4 A;  4PUA A;  1THX A;  4NHZ A;  3VLN A;  1YF0 A;  4TVE A;  4HDE A;  2VL2 C;  5CNW A;  5B6N A;  1SK0 A;  3FRC A;  3L78 A;  5HR0 A;  1ZL9 A;  5DAK A;  5CP1 A;  3TKP A;  1MD3 A;  5IMD A;  2PER A;  4TR3 A;  3ME8 A;  2GGT A;  5DCG A;  2K6V A;  1YKC A;  1YY7 A;  5IPG A;  3FEU A;  1O7U A;  2YN1 A;  1A24 A;  2RLI A;  2HRN A;  1M9B A;  1J9B A;  4GF0 A;  1GL8 A;  5INY A;  3LFL A;  1AQV A;  2VL9 A;  3QFA C;  4F2I A;  1Z6N A;  3KEB A;  1QXH A;  3DXB A;  4TR4 A;  1GRX A;  2PN8 A;  2MMZ A;  1O8W A;  4IS0 A;  4GLT A;  3VUR A;  1TU7 A;  4EL1 A;  1GUL A;  1USB A;  1XZO A;  3VPQ A;  2QKE A;  2KLX A;  2YWN A;  1TTZ A;  4L5L A;  1GTI A;  5JCW A;  3QAW A;  2O87 A;  5J9B A;  3TJJ A;  4JE1 A;  2VOC A;  1PA3 A;  3H79 A;  2CVB A;  1NHY A;  1SJZ A;  2YAN A;  3CRU A;  1B9Y C;  1X0R A;  3TOT A;  4MH3 A;  2VCT A;  4H86 A;  1PMT A;  1AAZ A;  5E59 A;  4TKY A;  3NZN A;  4TR1 B;  2H0I A;  2I4A A;  3N5O A;  4DEJ A;  2B5X A;  2LS5 A;  1S3C A;  2GQL A;  1OVN A;  4ILF A;  2OBI A;  3VK9 A;  1BQ7 A;  4HU9 A;  6GST A;  4IVF A;  5GST A;  1K3L A;  3MSZ A;  2PU9 C;  2YWI A;  3GNJ A;  4KDY A;  4GQC A;  4X1U A;  3MWH A;  2GSQ A;  5D9V A;  2EC4 A;  1URM A;  2VD1 A;  1UN2 A;  2R5G A;  1PKZ A;  5J5N A;  4KCA A;  4OMV A;  5ECR B;  2H75 A;  19GS A;  1R4W A;  2P5Q A;  3EU4 A;  2VUP A;  1XIY A;  2H70 A;  2CV4 A;  2GT6 A;  5IO2 A;  1O6J A;  4WET A;  4N0V A;  3DIE A;  5AIS A;  3F3R A;  3TRP A;  4QQ7 A;  4EO3 A;  1FVK A;  1JFU A;  2N5A A;  2VD0 A;  4HJM A;  5HR3 A;  2LKU A;  2XPD A;  1OAZ A;  2FD3 A;  3ISO A;  3W6G A;  1NSW A;  3RPP A;  1GTU A;  2VCV A;  4TR1 A;  1ZCP A;  1A8Y A;  1S3D A;  3KTL A;  1OC9 B;  4ZBB A;  3HCZ A;  4OO5 A;  4CW9 A;  4ECC A;  1KBN A;  3C7M A;  1A2J A;  1RK4 A;  3ZZX A;  1XWA A;  4BL7 A;  1X9W B;  3KJY A;  2H8L A;  2WRT A;  4J57 E;  5B8B A;  3UBL A;  3TB2 A;  2M72 A;  3F9U A;  4YAP A;  1M2D A;  2HFD A;  2FNO A;  5HFI A;  4PUF C;  2V32 A;  3KD0 A;  4K0G A;  4DSQ A;  1JLW A;  1KTE A;  2DMM A;  4TN8 A;  4J56 E;  3EE2 A;  1K0B A;  2GS3 A;  2IMD A;  2GTU A;  2H6X A;  3F4S A;  5ECS A;  3CRT A;  4L0U A;  3IXR A;  3ZVJ A;  4K1F A;  3DVW A;  4I97 A;  4AGS A;  1Z9H A;  2IL3 A;  3F4R A;  4TOP A;  1ZGN A;  3KTB A;  17GS A;  2H71 A;  2N5B A; 
#chains in the Genus database with same CATH topology
 4WEY A;  3HY2 A;  1YQ1 A;  3BJ5 A;  4FIW A;  2X49 A;  4EUY A;  4F0C A;  3UAR A;  2HE3 A;  5G1K A;  3WGX A;  3FHK A;  1OC9 A;  5D9T A;  3NOF A;  3ZRD A;  5CO3 A;  1MTC A;  3ME7 A;  1V9W A;  2OAC A;  1Y25 A;  3TKR A;  3TDG A;  3VFI A;  2LST A;  5JWR B;  5BMU A;  20GS A;  4MF5 A;  3HKR A;  5GAP D;  4QL9 A;  2X99 A;  3RPN A;  1FAA A;  3HVX A;  5IM9 A;  4ML1 A;  3L4N A;  4BVY B;  1EEJ A;  3TKS E;  3A3T A;  1PKW A;  3FZ5 A;  3CYN A;  1DBY A;  1OE7 A;  1K3O A;  2C0E A;  3H8Q A;  3JCM L;  4RQX A;  4ID0 A;  3HZ8 A;  3KH9 A;  4J2F A;  3MDK A;  2AYT A;  3CTG A;  2PGT A;  4LA1 A;  4NMU A;  2DJK A;  2LJR A;  5CRH A;  4K7I A;  5GSS A;  4YH2 A;  2OAD A;  4PQ1 A;  2ON5 A;  2R0P A;  2WCI A;  2L4Q A;  2KP2 A;  4ZL9 A;  1VGL A;  1T1V A;  4D73 B;  4IP6 A;  2FUG 2;  1F3B A;  2AAW A;  4GRF A;  2LJK A;  2JSY A;  1XW6 A;  1EV9 A;  2A2P A;  2LRC A;  5JCU A;  1V98 A;  1UC7 A;  1Z7P A;  4LMV A;  3ZML A;  1GTB A;  3GUR A;  1T7P B;  2IIY A;  3D22 A;  5FHI A;  3H1N A;  3IE3 A;  5B8A A;  1NW2 A;  2DC5 A;  1K0A A;  4WBJ A;  2O7K A;  4BVY A;  2P0G A;  3FZ9 A;  3HHV A;  3DGQ A;  2CA8 A;  2A2S A;  4RUV A;  3G7I A;  3EVI A;  5JWQ B;  3F6F A;  2B3S A;  1THO A;  4CY8 A;  2JAD A;  3K8N A;  5ENU A;  5IMA A;  1NHO A;  1RQM A;  2F3M A;  3GKX A;  4KAE A;  1ML6 A;  1XW9 A;  2H01 A;  1XVW A;  4L0W A;  1AC1 A;  4GTU A;  1CQG A;  1Y6E A;  1YEP A;  4I5Q A;  3APO A;  4D73 A;  2VAF A;  9GSS A;  3EPT A;  2GT5 A;  3O76 A;  1PFO A;  3WD6 A;  4N11 A;  4LL4 B;  3IPZ A;  6GSX A;  4HQZ A;  5F05 A;  5B7C A;  4Z2U A;  1ABA A;  4RI6 A;  4NHW A;  3APS A;  1U87 A;  5ECH B;  4IJ3 A;  1T4Z A;  2C0G A;  4MLY A;  4AJ8 A;  1A0R P;  2OA7 A;  3UAP A;  3LGC A;  3UIW A;  5KOX A;  5D8I A;  1G7O A;  3HZ4 A;  4V1A g;  2YJH A;  2NTO A;  5DQY A;  1F2E A;  2R6K A;  2MZC A;  2A2R A;  4G2E A;  4CDO A;  3ERW A;  4DSS A;  4GSN A;  1M99 A;  4KB3 A;  2HXK A;  2VCQ A;  4HJ2 A;  4GXZ A;  1V40 A;  5C04 A;  4MAB A;  3D4T A;  2DJ3 A;  4GSS A;  2WUL A;  4MZW A;  4GST A;  2ON7 A;  5IIZ A;  3ZRE A;  5CRE A;  2FWE A;  2B7J A;  2LUS A;  1HNB A;  3IC8 A;  3O6T A;  2HLS A;  1WIK A;  2GZY A;  5F0G A;  1B4P A;  1XWB A;  1GTA A;  5ID2 A;  3DVX A;  1BJX A;  4KH7 A;  1VF2 A;  4Q5Q A;  3ZL5 A;  1BG5 A;  3EWL A;  4KA0 A;  2YZU A;  3KP9 A;  2R4V A;  3D0Z A;  4I6X A;  2QGV A;  3EIN A;  2ZCT A;  2VLU A;  22GS A;  2YPM A;  2H1G A;  2VLT A;  3HVN A;  1VRS D;  4YKG A;  1QUW A;  2IPA A;  2FA4 A;  2OJL A;  2C3N A;  1H4O A;  4K0N A;  2I1U A;  4JU5 A;  3U5R E;  4EE0 A;  3ERF A;  3ERG A;  4OFM A;  3WYW A;  1OE8 A;  1M3I A;  4PQI A;  4X43 A;  2LEG A;  3ZIV A;  3L9U A;  4MP4 A;  1MD4 A;  1EOG A;  5A4V A;  4FH8 A;  4FYC A;  4AJ7 A;  2FHE A;  2E2M A;  2WDU A;  1XWK A;  2C80 A;  3KH7 A;  3GL3 A;  1EV4 A;  3UBK A;  4TRX A;  3LXT A;  2DJ0 A;  2C4J A;  4ZBD A;  2DIZ A;  4IQA A;  2KP1 A;  1WE0 A;  4TXO A;  1XOA A;  3GL5 A;  2H1D A;  4POB A;  4MA9 A;  4BPY A;  3H4K A;  1O73 A;  4YQU A;  2MYG A;  5IO0 A;  1Z3E A;  3WT1 A;  5AIX A;  3M0F A;  1AQW A;  4WF5 A;  2CZ3 A;  3ZYW A;  12GS A;  1TXX A;  4EDZ A;  1TRS A;  1F9M A;  5F06 A;  2NVL A;  3E9J B;  1AUC A;  2H6Y A;  3FW2 A;  3TKQ A;  4F0B A;  1WMJ A;  3LW9 A;  4G19 A;  4LMW A;  4O32 A;  3LQ7 A;  3V1W A;  4ECB A;  2P31 A;  4WR4 A;  4ML6 A;  3TKS C;  4KUN A;  4L8E A;  3GX8 A;  2DJJ A;  2QC7 A;  3F8U A;  3ZFL A;  2VL3 A;  3UEM A;  5DCH A;  3IK7 A;  1GNE A;  1F3A A;  3EC3 A;  3L0H A;  3UMA A;  2WGR A;  2CVK A;  2NDO A;  2QSI A;  4IN0 A;  6GSY A;  1Z7R A;  4KSM A;  1ZOF A;  3D5J A;  3I9V 2;  4JED A;  3US3 A;  1ACV A;  5DQS A;  3RHB A;  1TU8 A;  3BOA A;  4K9Z A;  4YAV A;  2GQM A;  3NIV A;  4MF6 A;  3E3E A;  3GMF A;  3A2V A;  2C1Y A;  2V6O A;  1FOV A;  1A23 A;  2HI7 A;  1TRU A;  3PH9 A;  2CX3 A;  2CX4 A;  4HI7 A;  2XBQ A;  2GZP A;  3IAM 2;  4K7N A;  4HZ2 A;  2V6K A;  4PQH A;  2NPB A;  3U6V A;  3S9F A;  4GQF A;  4EIQ A;  4PNF A;  1LJR A;  2C0D A;  3TJG A;  5A4U A;  2LNS A;  3KP8 A;  4NV5 A;  1JZR A;  5DAL B;  5EPF A;  2PWJ A;  1O85 A;  3N9J A;  1GSU A;  5B6M A;  1F37 A;  3L9V A;  5F07 A;  1K3Y A;  3TJK A;  3H93 A;  4BVX A;  2VL2 A;  4PGT A;  2GDR A;  3Q19 A;  3GTU B;  3HJO A;  4KX4 A;  1EP7 A;  4KSO A;  3IR4 A;  1J0F A;  4MPF A;  4BWQ A;  2ZNM A;  2MBT A;  1TKD B;  1ZMA A;  5DJM A;  3GKK A;  2PBJ A;  2L6D A;  4ZL7 A;  3A2W A;  1DSB A;  4NXI A;  1W89 A;  2FCH A;  6GSV A;  1QK8 A;  4IKH A;  1ZYP A;  4G0L A;  1U88 A;  2F9S A;  1EEM A;  5J3R A;  4MJE A;  4IP1 A;  4XS1 A;  3GH6 A;  4G9H A;  1TJD A;  2KOK A;  1PX7 A;  2J9H A;  1KNG A;  4N10 A;  2HSH A;  2X8H A;  3MNG A;  2CVD A;  1SK1 A;  1YJ6 A;  1M7T A;  3EYT A;  3LSZ A;  2CT6 A;  1T4Y A;  4N30 A;  2X64 A;  2VCX A;  5H5S A;  4O5R A;  1PL2 A;  2H0G A;  3GST A;  4I2T A;  2L5O A;  4XTS A;  5DAL A;  1WP0 A;  1TI3 A;  2GST A;  1KEB A;  2LV3 A;  1LBK A;  4XCS A;  5ELA A;  3QAG A;  2MMN A;  4CHS A;  3ED3 A;  2FY6 A;  1Q98 A;  4IGJ A;  5GAN D;  4LLR A;  18GS A;  2JL4 A;  3C1R A;  1QMV A;  1E2Y A;  2IWT A;  1TRW A;  1VF3 A;  1EWX A;  1A2L A;  1QFN A;  4FQU A;  1VF1 A;  4X0X A;  3OR5 A;  1K0O A;  2H19 A;  1XVQ A;  5ECP B;  5BRT A;  4EC0 A;  5COH A;  5KN0 A;  3F4T A;  2X8G A;  1V2A A;  2AV4 A;  1AIU A;  1M2A A;  1FB0 A;  3DML A;  2K8S A;  2IFQ B;  4WR5 A;  3O3T A;  3TCO A;  2PVO C;  5KN1 A;  1B8X A;  1FG4 A;  4OWY A;  4ZB6 A;  5G31 A;  3ZMK A;  1WPI A;  4ZB9 A;  3DRN A;  1R7H A;  3F3Q A;  2IJY A;  4OO4 A;  4NWY A;  5G5E A;  3LWA A;  1OKD A;  2IME A;  3R2Q A;  4JR6 A;  2A4V A;  3IC4 A;  2IMK A;  1GP1 A;  4HU7 A;  2YJ7 A;  4GCI A;  3UJ1 A;  5G5F A;  3VI5 A;  2B1L A;  5KN2 A;  3M9K A;  2XPE A;  3FYG A;  4MJC A;  1H75 A;  1PL1 A;  2EIR A;  4USS A;  2RUF A;  1DUG A;  4MZB A;  2KUC A;  1QQ2 A;  1EP8 A;  4OCF A;  2E2G A;  2DBC A;  3GA4 A;  1BED A;  1GSS A;  4FYU A;  2EIO A;  4HS1 A;  5ECM B;  1YKA A;  1UA5 A;  1K0N A;  2HYX A;  1ERW A;  4QL7 A;  3G9B A;  3TOU A;  4O7H A;  4XHM A;  4XRD A;  4POL A;  3GKN A;  2C8U A;  2V2G A;  1TI1 A;  1HNA A;  3HJP A;  4MJA A;  3KM6 A;  2B6M A;  1M3J A;  3WT2 A;  4MZC A;  1PX6 A;  3IAS 2;  5DVB A;  5IMF A;  4YQV A;  4IQ1 A;  3HDC A;  1JZW A;  5D96 A;  2CAQ A;  1EGR A;  4HSC X;  1TW9 A;  2CAI A;  5HQP A;  3VWW A;  3FKF A;  5KN3 A;  14GS A;  1QGV A;  1O81 A;  1OYJ A;  2HZE B;  1VF4 A;  1FOH A;  1YDK A;  2RUE A;  4ZXG A;  3HYP A;  3P90 A;  4F9Z A;  4EF0 A;  4NAX A;  4L5O A;  2TIR A;  2P5R A;  4IJI A;  4KE3 A;  2HRF A;  1GSE A;  4AJ6 A;  4EDY A;  3GN3 A;  1ZYN A;  4K5S A;  4BWS A;  4EVM A;  4HQS A;  4A5P A;  1NM3 A;  3E0U A;  3PIN A;  3AY8 A;  5IMZ A;  1SKS B;  1OC8 A;  2DKI A;  3I69 A;  3FR6 A;  1EOH A;  1TDI A;  3GH9 A;  2H0H A;  2B7K A;  4OFN A;  2IMI A;  1MDI A;  4KDX A;  3LYK A;  3ZIT A;  3A5W A;  3PR8 A;  4WXT A;  3P7X A;  2MBS A;  4JZQ A;  4KW6 A;  2LQQ A;  4XS4 B;  2YOI A;  6GSW A;  3UVT A;  3FR9 A;  3C71 A;  2TRX A;  3IA1 A;  3MAK A;  1SYX A;  4ZB8 A;  2GZZ A;  1LU4 A;  4PX1 A;  3IV4 A;  1SU9 A;  3LEF A;  3I43 A;  2F8A A;  2BMX A;  4BA7 A;  2WS2 A;  3C8E A;  2LRN A;  1SL1 B;  3M3M A;  2HZE A;  4MNN A;  2HSM A;  5AIV A;  4NV2 A;  2JZR A;  2VM1 A;  2VCZ A;  3GSS A;  5DAK B;  1ERT A;  4DSR A;  2GQK A;  2GVP A;  5A5K A;  2ES7 A;  3TJF A;  4O92 A;  1GLP A;  1F6M C;  2E7P A;  3TGZ A;  5JWO B;  1GUK A;  1SK2 A;  10GS A;  5J41 A;  1G0T A;  2YZH A;  2AHE A;  4MF7 A;  4TXV A;  3GV1 A;  1PN9 A;  1HD2 A;  2JZS A;  4ACS A;  5IMV A;  1PN0 A;  2C0F A;  4IHU A;  4KDU A;  5ECN B;  1G7E A;  2H6Z A;  5CAX A;  2CQ9 A;  4V2L A;  1TRV A;  3P8W A;  1SYR A;  3VI7 A;  5IMC A;  4OCE A;  3W8S A;  2IN3 A;  2O8V B;  5CYY A;  1XBS A;  1W4V A;  4K8M A;  1XPV A;  3J7Y k;  3QMX A;  2FWH A;  1O8X A;  2L4C A;  1JZO A;  3QPM A;  2LQO A;  4ZIL A;  1X9S B;  4FYB A;  4KGI A;  2R0C A;  5IOX A;  3HVV A;  3QR6 A;  5EY6 A;  4Q5R A;  2FLS A;  1WRY A;  1SD9 A;  2RII A;  2ZUP A;  3KZQ A;  4ECI A;  3M8N A;  3KXO A;  1JLV A;  3QCP A;  6GSS A;  2D2Z A;  4JBB A;  1PSQ A;  5ECI B;  2M46 A;  3FZA A;  2B5Y A;  3W8J A;  4ULX A;  4K2D A;  2OBK A;  3F0I A;  5G30 A;  1IYI A;  1S3R A;  3F6D A;  1Z6M A;  1XOB A;  3DYR A;  1ZYQ B;  4MH2 A;  3LXZ A;  2OE0 A;  4LL1 B;  4ZBA A;  1T00 A;  2R0G A;  1X5D A;  5IPH A;  4HUA A;  5L71 A;  3D4M A;  4PXO A;  4WF4 A;  1IYH A;  2H72 A;  2H73 A;  1SEN A;  2BJX A;  2DKH A;  2JZT A;  1J08 A;  1BX9 A;  4YKF A;  5CRG A;  1FHE A;  2X8C A;  1GSD A;  2WFC A;  4MMM A;  4Z2T A;  2CZ2 A;  3A5I A;  5ELG A;  1GH2 A;  3UOM A;  2FA8 A;  3J7Y b;  2H66 A;  5ECL B;  1EZK A;  5LD0 A;  3DWV A;  3ZVJ D;  4AF2 A;  1G6W A;  3WGE A;  3KMN A;  2YP6 A;  5HR1 A;  1OKT A;  3IRA A;  3APQ A;  3PGT A;  2XC2 A;  3CTF A;  2I9H A;  4BL7 B;  2I81 A;  2XHF A;  3GHA A;  3D6I A;  5A4W A;  3GFK A;  3BD2 A;  3LYP A;  2H74 A;  1SKR B;  2KHP A;  4I2U A;  3UL3 A;  4ZIJ A;  4NPB A;  4F03 A;  1GSQ A;  1U3A A;  1GUH A;  3R3E A;  2R2J A;  8GSS A;  1FW1 A;  2PVQ A;  4XRA A;  3ZIJ A;  1B9X C;  2TRC P;  1K0C A;  5ECK B;  3ZTL A;  5F8B A;  2DSA A;  3G7J A;  2LRT A;  5DBQ A;  4RI7 A;  3CBU A;  2B5E A;  4EKZ A;  4Q5N A;  2FWF A;  4E8E A;  3FY7 A;  4JRR A;  4EIP A;  3TUE A;  3DKS A;  1N2A A;  4RQR A;  3LG6 A;  5H5R A;  2PMT A;  3WGD A;  1GNW A;  1BAY A;  4K7O A;  2X4A A;  5ECO B;  4HEA 2;  1N8J A;  2BTO T;  1WOU A;  1V58 A;  11GS A;  2L59 A;  1YZX A;  1M2B A;  1HYU A;  5JCG A;  2PUK C;  1Z5Y E;  1XW5 A;  1AXD A;  1RW1 A;  1E6B A;  1TP9 A;  1TK8 B;  1ZYE A;  3KMO A;  1T8E B;  2FGX A;  3Q74 A;  4IBP A;  1Q4J A;  5CRW A;  2YCD A;  1B48 A;  5H5Q A;  2L57 A;  2OKA A;  3EUR A;  3TKS A;  2F51 A;  2Z9S A;  1SJ6 A;  2B1K A;  2K8V A;  4HZ4 A;  1ZZY A;  3IDV A;  1I5G A;  4WBR D;  3GTU A;  3HXS A;  4MJB A;  1HQO A;  1XFL A;  3CXG A;  3GIX A;  4POK A;  3VWU A;  2F8F A;  2M80 A;  3HVS A;  3FZ4 A;  5IQY A;  3FMW A;  1TK0 B;  4OD7 A;  3QOU A;  2RM5 A;  3GKM A;  1OC3 A;  5D73 A;  4KF9 A;  3CQF A;  1ST9 A;  2YV7 A;  4G10 A;  3VWX A;  1X5C A;  2YWO A;  2HSY A;  4KCE A;  2G2Q A;  3M1G A;  5ECQ B;  2L5L A;  4YQM A;  5HR2 A;  3ZLP A;  2C3Q A;  2DLX A;  2G0F A;  5HFK A;  3GYK A;  1SL2 B;  1U3I A;  3VWV A;  1YEX A;  1M0U A;  4BIK A;  2A4H A;  2YV9 A;  3HA9 A;  3L9S A;  3QDN A;  4POM A;  2PPT A;  4N0Z A;  5J9C A;  1AW9 A;  4WKW A;  3FR3 A;  4KND A;  1SKW B;  4IW9 A;  1A0F A;  5FWG A;  2O85 A;  2DJ1 A;  3BBY A;  2V41 A;  4TR0 A;  1AQX A;  2I3Y A;  2DML A;  3QAV A;  4MDC A;  1PGT A;  1C72 A;  3HJM A;  4PNG A;  3PPU A;  1B4Q A;  3IHG A;  4V2M A;  2H1A A;  2OE1 A;  2VCW A;  3HD5 A;  5CRD A;  3VPT A;  1XWC A;  3CSH A;  3C73 A;  3Q6O A;  3MIX A;  2H30 A;  4G0K A;  1GWC A;  2O89 A;  1CQH A;  3TRQ A;  5G2Z A;  3FK8 A;  3GX0 A;  3CSJ A;  4ZL8 A;  2WB9 A;  2EIQ A;  3RDW A;  1S3A A;  4IEL A;  2RM6 A;  1TOF A;  4ISD A;  2FWG A;  1R5P A;  3DEX A;  2HNL A;  1PD2 1;  2VIM A;  5IOW A;  2K18 A;  2VO4 A;  2DJ2 A;  2IFQ A;  4OFT A;  3SWL A;  2R37 A;  4GWR A;  2V1M A;  5AN1 A;  1MDK A;  2VLV A;  1TK5 B;  2XBI A;  5LNK e;  5HFG A;  1K0D A;  3ZFB A;  4Z7X A;  3IBH A;  2N5F A;  4MPG A;  3RAZ A;  3C1S A;  3IHQ A;  3KCM A;  3RHC A;  1A2M A;  1I9D A;  4DSS B;  4O5Q A;  1DE2 A;  2REM A;  4P3Y B;  1FVJ A;  2C3T A;  1MEK A;  2GSR A;  1U6T A;  3D21 A;  1PRX A;  2E0Q A;  2ALB A;  3LJR A;  5E4W A;  3BCI A;  4O5U A;  1G6Y A;  1DE1 A;  5D93 A;  5GZZ B;  7GSS A;  3EMX A;  3CMI A;  1SJI A;  4HOJ A;  1JHB A;  3IOS A;  2YWM A;  3UVH A;  4V2N A;  1WJK A;  3IK9 A;  1V57 A;  2MMO A;  3BCK A;  1JZD A;  2WJU A;  5ID2 B;  5LCZ A;  3EMP A;  1XWG A;  2WZ9 A;  4ECJ A;  1GUM A;  2MMA A;  2HT9 A;  2QA2 A;  4ICY A;  4Z2R A;  1XXU A;  2JU5 A;  1FO5 A;  5D9X A;  1X5E A;  2LNT A;  5KEJ A;  16GS A;  4I8B A;  3TJB A;  2IMF A;  2VM2 A;  4PTS A;  1WWJ A;  2JAC A;  1R26 A;  3CSI A;  4MK3 A;  2HRK A;  3G7Y A;  3SBC A;  2R3X A;  2GSS A;  2L6C A;  1X9M B;  4TW5 A;  5AGY A;  4XS6 A;  2K9F A;  1ERV A;  3KIJ A;  2AB6 A;  1YF1 A;  3EU3 A;  3GUS A;  1R5A A;  2YNX A;  1GLQ A;  1A8L A;  2LTK A;  2J23 A;  3KGK A;  5ABR A;  2HZF A;  1PQN A;  13GS A;  1BYE A;  2OE3 A;  5EVO A;  1SD8 A;  4EXJ A;  1EGO A;  3M9J A;  1ON4 A;  2AJQ B;  1GSF A;  2H1B A;  4X4J A;  5C00 A;  3TRX A;  4F82 A;  4V1A p;  1FB6 A;  4XIH A;  2NBS A;  2HRA A;  1M9A A;  5DJL A;  4TXO B;  3P2A A;  1GSY A;  3F63 A;  5FT3 A;  3RBT A;  1HNC A;  1T3B A;  4K6X A;  2AUV A;  5J4U A;  5D9W A;  5EL8 A;  4Q5F A;  4DVC A;  3A2X A;  2JSZ A;  4MCU A;  4E8H A;  2DIY A;  4XS4 A;  3LOR A;  1SL0 B;  1XCC A;  3I6A A;  2H76 A;  4PUR A;  3DD3 A;  4FO5 A;  1MDJ A;  1ILO A;  1K0M A;  2LJA A;  3GRX A;  1ERU A;  1UVZ A;  3Q18 A;  5DDL A;  2GLR A;  3QD9 A;  6GSU A;  3QFB C;  5G1L A;  4JR4 A;  4PUA A;  1THX A;  4NHZ A;  3VLN A;  1YF0 A;  4TVE A;  4HDE A;  2VL2 C;  5CNW A;  5B6N A;  1SK0 A;  3FRC A;  3L78 A;  4K2X A;  5HR0 A;  1ZL9 A;  5DAK A;  5CP1 A;  3TKP A;  1MD3 A;  5IMD A;  2PER A;  4TR3 A;  3ME8 A;  2UZ8 A;  2GGT A;  5DCG A;  2K6V A;  1YKC A;  1YY7 A;  5IPG A;  3FEU A;  1O7U A;  2YN1 A;  1A24 A;  2RLI A;  2HRN A;  4K5R A;  1M9B A;  1J9B A;  4GF0 A;  1GL8 A;  5INY A;  3LFL A;  1AQV A;  2VL9 A;  3QFA C;  4F2I A;  1Z6N A;  3KEB A;  1QXH A;  3DXB A;  4TR4 A;  1GRX A;  2PN8 A;  2MMZ A;  1O8W A;  4IS0 A;  4GLT A;  3VUR A;  1TU7 A;  4EL1 A;  1GUL A;  1USB A;  1XZO A;  3VPQ A;  2QKE A;  2KLX A;  2YWN A;  1TTZ A;  4L5L A;  1GTI A;  5JCW A;  3QAW A;  1XG8 A;  2O87 A;  5J9B A;  3TJJ A;  4JE1 A;  2VOC A;  1PA3 A;  3H79 A;  2CVB A;  1NHY A;  1SJZ A;  2YAN A;  3CRU A;  1B9Y C;  1X0R A;  3TOT A;  4BVX B;  3MYD A;  4MH3 A;  2VCT A;  4H86 A;  1PMT A;  1AAZ A;  5E59 A;  4TKY A;  3NZN A;  4TR1 B;  2H0I A;  2I4A A;  3N5O A;  4DEJ A;  2B5X A;  2LS5 A;  1S3C A;  2GQL A;  1OVN A;  4ILF A;  4CY6 A;  2OBI A;  3VK9 A;  1BQ7 A;  4HU9 A;  2QA1 A;  6GST A;  4IVF A;  5GST A;  1K3L A;  3MSZ A;  2PU9 C;  2YWI A;  3GNJ A;  4KDY A;  4GQC A;  4X1U A;  3MWH A;  2GSQ A;  4G0I A;  5D9V A;  2EC4 A;  1URM A;  2VD1 A;  1UN2 A;  2R5G A;  1PKZ A;  5J5N A;  4KCA A;  4OMV A;  5ECR B;  2H75 A;  19GS A;  1R4W A;  2P5Q A;  3EU4 A;  2VUP A;  1XIY A;  2H70 A;  2CV4 A;  2GT6 A;  5IO2 A;  1O6J A;  4WET A;  4N0V A;  3DIE A;  5AIS A;  3F3R A;  3TRP A;  4QQ7 A;  4EO3 A;  1FVK A;  5KOW A;  1JFU A;  2N5A A;  2VD0 A;  4HJM A;  5HR3 A;  2LKU A;  2XPD A;  1OAZ A;  2FD3 A;  3ISO A;  3W6G A;  1NSW A;  3RPP A;  1GTU A;  2VCV A;  4TR1 A;  1ZCP A;  1A8Y A;  1S3D A;  3KTL A;  1OC9 B;  4ZBB A;  3HCZ A;  4OO5 A;  4CW9 A;  4ECC A;  1KBN A;  3C7M A;  1A2J A;  1RK4 A;  3ZZX A;  1XWA A;  4BL7 A;  1X9W B;  3KJY A;  2H8L A;  2WRT A;  4J57 E;  5B8B A;  3UBL A;  3TB2 A;  2M72 A;  3F9U A;  4YAP A;  1M2D A;  2HFD A;  2FNO A;  5HFI A;  4PUF C;  2V32 A;  3KD0 A;  4K0G A;  4DSQ A;  1JLW A;  1KTE A;  2DMM A;  4TN8 A;  4J56 E;  3EE2 A;  1K0B A;  2GS3 A;  2IMD A;  2GTU A;  2H6X A;  3F4S A;  5ECS A;  3CRT A;  4L0U A;  3IXR A;  3ZVJ A;  4K1F A;  3DVW A;  4I97 A;  4AGS A;  1Z9H A;  2IL3 A;  3F4R A;  4TOP A;  1ZGN A;  3KTB A;  17GS A;  2H71 A;  2N5B A; 
#chains in the Genus database with same CATH homology
 4WEY A;  3HY2 A;  1YQ1 A;  3BJ5 A;  4FIW A;  2X49 A;  4EUY A;  4F0C A;  3UAR A;  2HE3 A;  5G1K A;  3WGX A;  3FHK A;  1OC9 A;  5D9T A;  3NOF A;  3ZRD A;  5CO3 A;  1MTC A;  3ME7 A;  1V9W A;  2OAC A;  1Y25 A;  3TKR A;  3TDG A;  3VFI A;  2LST A;  5JWR B;  5BMU A;  20GS A;  4MF5 A;  3HKR A;  5GAP D;  4QL9 A;  2X99 A;  3RPN A;  1FAA A;  3HVX A;  5IM9 A;  4ML1 A;  3L4N A;  4BVY B;  1EEJ A;  3TKS E;  3A3T A;  1PKW A;  3FZ5 A;  3CYN A;  1DBY A;  1OE7 A;  1K3O A;  2C0E A;  3H8Q A;  3JCM L;  4RQX A;  4ID0 A;  3HZ8 A;  3KH9 A;  4J2F A;  3MDK A;  2AYT A;  3CTG A;  2PGT A;  4LA1 A;  4NMU A;  2DJK A;  2LJR A;  5CRH A;  4K7I A;  5GSS A;  4YH2 A;  2OAD A;  4PQ1 A;  2ON5 A;  2R0P A;  2WCI A;  2L4Q A;  2KP2 A;  4ZL9 A;  1VGL A;  1T1V A;  4D73 B;  4IP6 A;  2FUG 2;  1F3B A;  2AAW A;  4GRF A;  2LJK A;  2JSY A;  1XW6 A;  1EV9 A;  2A2P A;  2LRC A;  5JCU A;  1V98 A;  1UC7 A;  1Z7P A;  4LMV A;  3ZML A;  1GTB A;  3GUR A;  1T7P B;  2IIY A;  3D22 A;  5FHI A;  3H1N A;  3IE3 A;  5B8A A;  1NW2 A;  2DC5 A;  1K0A A;  4WBJ A;  2O7K A;  4BVY A;  2P0G A;  3FZ9 A;  3HHV A;  3DGQ A;  2CA8 A;  2A2S A;  4RUV A;  3G7I A;  3EVI A;  5JWQ B;  3F6F A;  2B3S A;  1THO A;  4CY8 A;  2JAD A;  3K8N A;  5ENU A;  5IMA A;  1NHO A;  1RQM A;  2F3M A;  3GKX A;  4KAE A;  1ML6 A;  1XW9 A;  2H01 A;  1XVW A;  4L0W A;  1AC1 A;  4GTU A;  1CQG A;  1Y6E A;  1YEP A;  4I5Q A;  3APO A;  4D73 A;  2VAF A;  9GSS A;  3EPT A;  2GT5 A;  3O76 A;  3WD6 A;  4N11 A;  4LL4 B;  3IPZ A;  6GSX A;  4HQZ A;  5F05 A;  5B7C A;  4Z2U A;  1ABA A;  4RI6 A;  4NHW A;  3APS A;  1U87 A;  5ECH B;  4IJ3 A;  1T4Z A;  2C0G A;  4MLY A;  4AJ8 A;  1A0R P;  2OA7 A;  3UAP A;  3LGC A;  3UIW A;  5KOX A;  5D8I A;  1G7O A;  3HZ4 A;  4V1A g;  2YJH A;  2NTO A;  5DQY A;  1F2E A;  2R6K A;  2MZC A;  2A2R A;  4G2E A;  4CDO A;  3ERW A;  4DSS A;  4GSN A;  1M99 A;  4KB3 A;  2HXK A;  2VCQ A;  4HJ2 A;  4GXZ A;  1V40 A;  5C04 A;  4MAB A;  3D4T A;  2DJ3 A;  4GSS A;  2WUL A;  4MZW A;  4GST A;  2ON7 A;  5IIZ A;  3ZRE A;  5CRE A;  2FWE A;  2B7J A;  2LUS A;  1HNB A;  3IC8 A;  3O6T A;  2HLS A;  1WIK A;  2GZY A;  5F0G A;  1B4P A;  1XWB A;  1GTA A;  5ID2 A;  3DVX A;  1BJX A;  4KH7 A;  1VF2 A;  4Q5Q A;  3ZL5 A;  1BG5 A;  3EWL A;  4KA0 A;  2YZU A;  3KP9 A;  2R4V A;  3D0Z A;  4I6X A;  2QGV A;  3EIN A;  2ZCT A;  2VLU A;  22GS A;  2YPM A;  2H1G A;  2VLT A;  1VRS D;  4YKG A;  1QUW A;  2IPA A;  2FA4 A;  2OJL A;  2C3N A;  1H4O A;  4K0N A;  2I1U A;  4JU5 A;  3U5R E;  4EE0 A;  3ERF A;  3ERG A;  4OFM A;  3WYW A;  1OE8 A;  4PQI A;  4X43 A;  2LEG A;  3ZIV A;  3L9U A;  4MP4 A;  1MD4 A;  1EOG A;  5A4V A;  4FH8 A;  4FYC A;  4AJ7 A;  2FHE A;  2E2M A;  2WDU A;  1XWK A;  2C80 A;  3KH7 A;  3GL3 A;  1EV4 A;  3UBK A;  4TRX A;  3LXT A;  2DJ0 A;  2C4J A;  4ZBD A;  2DIZ A;  4IQA A;  2KP1 A;  1WE0 A;  4TXO A;  1XOA A;  3GL5 A;  2H1D A;  4POB A;  4MA9 A;  4BPY A;  3H4K A;  1O73 A;  4YQU A;  2MYG A;  5IO0 A;  1Z3E A;  3WT1 A;  5AIX A;  3M0F A;  1AQW A;  4WF5 A;  2CZ3 A;  3ZYW A;  12GS A;  1TXX A;  4EDZ A;  1TRS A;  1F9M A;  5F06 A;  2NVL A;  3E9J B;  1AUC A;  2H6Y A;  3FW2 A;  3TKQ A;  4F0B A;  1WMJ A;  3LW9 A;  4G19 A;  4LMW A;  4O32 A;  3LQ7 A;  3V1W A;  4ECB A;  2P31 A;  4WR4 A;  4ML6 A;  3TKS C;  4KUN A;  4L8E A;  3GX8 A;  2DJJ A;  2QC7 A;  3F8U A;  3ZFL A;  2VL3 A;  3UEM A;  5DCH A;  3IK7 A;  1GNE A;  1F3A A;  3EC3 A;  3L0H A;  3UMA A;  2WGR A;  2CVK A;  2NDO A;  2QSI A;  4IN0 A;  6GSY A;  1Z7R A;  4KSM A;  1ZOF A;  3D5J A;  3I9V 2;  4JED A;  3US3 A;  1ACV A;  5DQS A;  3RHB A;  1TU8 A;  3BOA A;  4K9Z A;  4YAV A;  2GQM A;  3NIV A;  4MF6 A;  3E3E A;  3GMF A;  3A2V A;  2C1Y A;  2V6O A;  1FOV A;  1A23 A;  2HI7 A;  1TRU A;  3PH9 A;  2CX3 A;  2CX4 A;  4HI7 A;  2XBQ A;  2GZP A;  3IAM 2;  4K7N A;  4HZ2 A;  2V6K A;  4PQH A;  2NPB A;  3U6V A;  3S9F A;  4GQF A;  4EIQ A;  4PNF A;  1LJR A;  2C0D A;  3TJG A;  5A4U A;  2LNS A;  3KP8 A;  4NV5 A;  1JZR A;  5DAL B;  5EPF A;  2PWJ A;  1O85 A;  3N9J A;  1GSU A;  5B6M A;  1F37 A;  3L9V A;  5F07 A;  1K3Y A;  3TJK A;  3H93 A;  4BVX A;  2VL2 A;  4PGT A;  2GDR A;  3Q19 A;  3GTU B;  3HJO A;  4KX4 A;  1EP7 A;  4KSO A;  3IR4 A;  1J0F A;  4MPF A;  4BWQ A;  2ZNM A;  2MBT A;  1TKD B;  1ZMA A;  5DJM A;  3GKK A;  2PBJ A;  2L6D A;  4ZL7 A;  3A2W A;  1DSB A;  4NXI A;  1W89 A;  2FCH A;  6GSV A;  1QK8 A;  4IKH A;  1ZYP A;  4G0L A;  1U88 A;  2F9S A;  1EEM A;  5J3R A;  4MJE A;  4IP1 A;  4XS1 A;  3GH6 A;  4G9H A;  1TJD A;  2KOK A;  1PX7 A;  2J9H A;  1KNG A;  4N10 A;  2HSH A;  2X8H A;  3MNG A;  2CVD A;  1SK1 A;  1YJ6 A;  1M7T A;  3EYT A;  3LSZ A;  2CT6 A;  1T4Y A;  4N30 A;  2X64 A;  2VCX A;  5H5S A;  4O5R A;  1PL2 A;  2H0G A;  3GST A;  4I2T A;  2L5O A;  4XTS A;  5DAL A;  1WP0 A;  1TI3 A;  2GST A;  1KEB A;  2LV3 A;  1LBK A;  4XCS A;  5ELA A;  3QAG A;  2MMN A;  4CHS A;  3ED3 A;  2FY6 A;  1Q98 A;  4IGJ A;  5GAN D;  4LLR A;  18GS A;  2JL4 A;  3C1R A;  1QMV A;  1E2Y A;  2IWT A;  1TRW A;  1VF3 A;  1EWX A;  1A2L A;  1QFN A;  4FQU A;  1VF1 A;  4X0X A;  3OR5 A;  1K0O A;  2H19 A;  1XVQ A;  5ECP B;  5BRT A;  4EC0 A;  5COH A;  5KN0 A;  3F4T A;  2X8G A;  1V2A A;  2AV4 A;  1AIU A;  1M2A A;  1FB0 A;  3DML A;  2K8S A;  2IFQ B;  4WR5 A;  3O3T A;  3TCO A;  2PVO C;  5KN1 A;  1B8X A;  1FG4 A;  4OWY A;  4ZB6 A;  5G31 A;  3ZMK A;  1WPI A;  4ZB9 A;  3DRN A;  1R7H A;  3F3Q A;  2IJY A;  4OO4 A;  4NWY A;  5G5E A;  3LWA A;  1OKD A;  2IME A;  3R2Q A;  4JR6 A;  2A4V A;  3IC4 A;  2IMK A;  1GP1 A;  4HU7 A;  2YJ7 A;  4GCI A;  3UJ1 A;  5G5F A;  3VI5 A;  2B1L A;  5KN2 A;  3M9K A;  2XPE A;  3FYG A;  4MJC A;  1H75 A;  1PL1 A;  2EIR A;  4USS A;  2RUF A;  1DUG A;  4MZB A;  2KUC A;  1QQ2 A;  1EP8 A;  4OCF A;  2E2G A;  2DBC A;  3GA4 A;  1BED A;  1GSS A;  4FYU A;  2EIO A;  4HS1 A;  5ECM B;  1YKA A;  1UA5 A;  1K0N A;  2HYX A;  1ERW A;  4QL7 A;  3G9B A;  3TOU A;  4O7H A;  4XHM A;  4XRD A;  4POL A;  3GKN A;  2C8U A;  2V2G A;  1TI1 A;  1HNA A;  3HJP A;  4MJA A;  3KM6 A;  2B6M A;  3WT2 A;  4MZC A;  1PX6 A;  3IAS 2;  5DVB A;  5IMF A;  4YQV A;  4IQ1 A;  3HDC A;  1JZW A;  5D96 A;  2CAQ A;  1EGR A;  1TW9 A;  2CAI A;  5HQP A;  3VWW A;  3FKF A;  5KN3 A;  14GS A;  1QGV A;  1O81 A;  1OYJ A;  2HZE B;  1VF4 A;  1YDK A;  1FOH A;  2RUE A;  4ZXG A;  3HYP A;  3P90 A;  4F9Z A;  4EF0 A;  4NAX A;  4L5O A;  2TIR A;  2P5R A;  4IJI A;  4KE3 A;  2HRF A;  1GSE A;  4AJ6 A;  4EDY A;  3GN3 A;  1ZYN A;  4K5S A;  4BWS A;  4EVM A;  4HQS A;  4A5P A;  1NM3 A;  3E0U A;  3PIN A;  3AY8 A;  5IMZ A;  1SKS B;  1OC8 A;  2DKI A;  3I69 A;  3FR6 A;  1EOH A;  1TDI A;  3GH9 A;  2H0H A;  2B7K A;  4OFN A;  2IMI A;  1MDI A;  4KDX A;  3LYK A;  3ZIT A;  3A5W A;  3PR8 A;  4WXT A;  3P7X A;  2MBS A;  4JZQ A;  4KW6 A;  2LQQ A;  4XS4 B;  2YOI A;  6GSW A;  3UVT A;  3FR9 A;  3C71 A;  2TRX A;  3IA1 A;  3MAK A;  1SYX A;  4ZB8 A;  2GZZ A;  1LU4 A;  4PX1 A;  3IV4 A;  1SU9 A;  3LEF A;  3I43 A;  2F8A A;  2BMX A;  4BA7 A;  2WS2 A;  3C8E A;  2LRN A;  1SL1 B;  3M3M A;  2HZE A;  4MNN A;  2HSM A;  5AIV A;  4NV2 A;  2JZR A;  2VM1 A;  2VCZ A;  3GSS A;  5DAK B;  1ERT A;  4DSR A;  2GQK A;  2GVP A;  5A5K A;  2ES7 A;  3TJF A;  4O92 A;  1GLP A;  1F6M C;  2E7P A;  3TGZ A;  5JWO B;  1GUK A;  1SK2 A;  10GS A;  5J41 A;  1G0T A;  2YZH A;  2AHE A;  4MF7 A;  4TXV A;  3GV1 A;  1PN9 A;  1HD2 A;  2JZS A;  4ACS A;  5IMV A;  1PN0 A;  2C0F A;  4IHU A;  4KDU A;  5ECN B;  1G7E A;  2H6Z A;  5CAX A;  2CQ9 A;  4V2L A;  1TRV A;  3P8W A;  1SYR A;  3VI7 A;  5IMC A;  4OCE A;  3W8S A;  2IN3 A;  2O8V B;  5CYY A;  1XBS A;  1W4V A;  4K8M A;  1XPV A;  3J7Y k;  3QMX A;  2FWH A;  1O8X A;  2L4C A;  1JZO A;  3QPM A;  2LQO A;  4ZIL A;  1X9S B;  4FYB A;  4KGI A;  2R0C A;  5IOX A;  3HVV A;  3QR6 A;  5EY6 A;  4Q5R A;  2FLS A;  1WRY A;  1SD9 A;  2RII A;  2ZUP A;  3KZQ A;  4ECI A;  3M8N A;  3KXO A;  1JLV A;  3QCP A;  6GSS A;  2D2Z A;  4JBB A;  1PSQ A;  5ECI B;  2M46 A;  3FZA A;  2B5Y A;  3W8J A;  4ULX A;  4K2D A;  2OBK A;  3F0I A;  5G30 A;  1IYI A;  3F6D A;  1Z6M A;  1XOB A;  3DYR A;  1ZYQ B;  4MH2 A;  3LXZ A;  2OE0 A;  4LL1 B;  4ZBA A;  1T00 A;  2R0G A;  1X5D A;  5IPH A;  4HUA A;  5L71 A;  3D4M A;  4PXO A;  4WF4 A;  1IYH A;  2H72 A;  2H73 A;  1SEN A;  2BJX A;  2DKH A;  2JZT A;  1J08 A;  1BX9 A;  4YKF A;  5CRG A;  1FHE A;  2X8C A;  1GSD A;  2WFC A;  4MMM A;  4Z2T A;  2CZ2 A;  3A5I A;  5ELG A;  1GH2 A;  3UOM A;  2FA8 A;  3J7Y b;  2H66 A;  5ECL B;  1EZK A;  5LD0 A;  3DWV A;  3ZVJ D;  4AF2 A;  1G6W A;  3WGE A;  3KMN A;  2YP6 A;  5HR1 A;  1OKT A;  3IRA A;  3APQ A;  3PGT A;  2XC2 A;  3CTF A;  2I9H A;  4BL7 B;  2I81 A;  2XHF A;  3GHA A;  3D6I A;  5A4W A;  3GFK A;  3BD2 A;  3LYP A;  2H74 A;  1SKR B;  2KHP A;  4I2U A;  3UL3 A;  4ZIJ A;  4NPB A;  4F03 A;  1GSQ A;  1U3A A;  1GUH A;  3R3E A;  2R2J A;  8GSS A;  1FW1 A;  2PVQ A;  4XRA A;  3ZIJ A;  1B9X C;  2TRC P;  1K0C A;  5ECK B;  3ZTL A;  5F8B A;  2DSA A;  3G7J A;  2LRT A;  5DBQ A;  4RI7 A;  3CBU A;  2B5E A;  4EKZ A;  4Q5N A;  2FWF A;  4E8E A;  3FY7 A;  4JRR A;  4EIP A;  3TUE A;  3DKS A;  1N2A A;  4RQR A;  3LG6 A;  5H5R A;  2PMT A;  3WGD A;  1GNW A;  1BAY A;  4K7O A;  2X4A A;  5ECO B;  4HEA 2;  1N8J A;  2BTO T;  1WOU A;  1V58 A;  11GS A;  2L59 A;  1YZX A;  1M2B A;  1HYU A;  5JCG A;  2PUK C;  1Z5Y E;  1XW5 A;  1AXD A;  1RW1 A;  1E6B A;  1TP9 A;  1TK8 B;  1ZYE A;  3KMO A;  1T8E B;  2FGX A;  3Q74 A;  4IBP A;  1Q4J A;  5CRW A;  2YCD A;  1B48 A;  5H5Q A;  2L57 A;  2OKA A;  3EUR A;  3TKS A;  2F51 A;  2Z9S A;  1SJ6 A;  2B1K A;  2K8V A;  4HZ4 A;  1ZZY A;  3IDV A;  1I5G A;  4WBR D;  3GTU A;  3HXS A;  4MJB A;  1HQO A;  1XFL A;  3CXG A;  3GIX A;  4POK A;  3VWU A;  2F8F A;  2M80 A;  3HVS A;  3FZ4 A;  5IQY A;  3FMW A;  1TK0 B;  4OD7 A;  3QOU A;  2RM5 A;  3GKM A;  1OC3 A;  5D73 A;  4KF9 A;  1ST9 A;  2YV7 A;  4G10 A;  3VWX A;  1X5C A;  2YWO A;  2HSY A;  4KCE A;  2G2Q A;  3M1G A;  5ECQ B;  2L5L A;  4YQM A;  5HR2 A;  3ZLP A;  2C3Q A;  2DLX A;  2G0F A;  5HFK A;  3GYK A;  1SL2 B;  1U3I A;  3VWV A;  1YEX A;  1M0U A;  2A4H A;  2YV9 A;  3HA9 A;  3L9S A;  3QDN A;  4POM A;  2PPT A;  4N0Z A;  5J9C A;  1AW9 A;  4WKW A;  3FR3 A;  4KND A;  1SKW B;  4IW9 A;  1A0F A;  5FWG A;  2O85 A;  2DJ1 A;  3BBY A;  2V41 A;  4TR0 A;  1AQX A;  2I3Y A;  2DML A;  3QAV A;  4MDC A;  1PGT A;  1C72 A;  3HJM A;  4PNG A;  3PPU A;  1B4Q A;  3IHG A;  4V2M A;  2H1A A;  2OE1 A;  2VCW A;  3HD5 A;  5CRD A;  3VPT A;  1XWC A;  3CSH A;  3C73 A;  3Q6O A;  3MIX A;  2H30 A;  4G0K A;  1GWC A;  2O89 A;  1CQH A;  3TRQ A;  5G2Z A;  3FK8 A;  3GX0 A;  3CSJ A;  4ZL8 A;  2WB9 A;  2EIQ A;  3RDW A;  1S3A A;  4IEL A;  2RM6 A;  1TOF A;  4ISD A;  2FWG A;  1R5P A;  3DEX A;  2HNL A;  1PD2 1;  2VIM A;  5IOW A;  2K18 A;  2VO4 A;  2DJ2 A;  2IFQ A;  4OFT A;  3SWL A;  2R37 A;  4GWR A;  2V1M A;  5AN1 A;  1MDK A;  2VLV A;  1TK5 B;  2XBI A;  5LNK e;  5HFG A;  1K0D A;  3ZFB A;  4Z7X A;  3IBH A;  2N5F A;  4MPG A;  3RAZ A;  3C1S A;  3IHQ A;  3KCM A;  3RHC A;  1A2M A;  1I9D A;  4DSS B;  4O5Q A;  1DE2 A;  2REM A;  4P3Y B;  1FVJ A;  2C3T A;  1MEK A;  2GSR A;  1U6T A;  3D21 A;  1PRX A;  2E0Q A;  2ALB A;  3LJR A;  5E4W A;  3BCI A;  4O5U A;  1G6Y A;  1DE1 A;  5D93 A;  5GZZ B;  7GSS A;  3EMX A;  3CMI A;  1SJI A;  4HOJ A;  1JHB A;  3IOS A;  2YWM A;  3UVH A;  4V2N A;  1WJK A;  3IK9 A;  1V57 A;  2MMO A;  3BCK A;  1JZD A;  2WJU A;  5ID2 B;  5LCZ A;  3EMP A;  1XWG A;  2WZ9 A;  4ECJ A;  1GUM A;  2MMA A;  2HT9 A;  2QA2 A;  4ICY A;  4Z2R A;  1XXU A;  2JU5 A;  1FO5 A;  5D9X A;  1X5E A;  2LNT A;  5KEJ A;  16GS A;  4I8B A;  3TJB A;  2IMF A;  2VM2 A;  4PTS A;  1WWJ A;  2JAC A;  1R26 A;  3CSI A;  4MK3 A;  2HRK A;  3G7Y A;  3SBC A;  2R3X A;  2GSS A;  2L6C A;  1X9M B;  4TW5 A;  5AGY A;  4XS6 A;  2K9F A;  1ERV A;  3KIJ A;  2AB6 A;  1YF1 A;  3EU3 A;  3GUS A;  1R5A A;  2YNX A;  1GLQ A;  1A8L A;  2LTK A;  2J23 A;  3KGK A;  5ABR A;  2HZF A;  1PQN A;  13GS A;  1BYE A;  2OE3 A;  5EVO A;  1SD8 A;  4EXJ A;  1EGO A;  3M9J A;  1ON4 A;  2AJQ B;  1GSF A;  2H1B A;  4X4J A;  5C00 A;  3TRX A;  4F82 A;  4V1A p;  1FB6 A;  4XIH A;  2NBS A;  2HRA A;  1M9A A;  5DJL A;  4TXO B;  3P2A A;  1GSY A;  3F63 A;  5FT3 A;  3RBT A;  1HNC A;  1T3B A;  4K6X A;  2AUV A;  5J4U A;  5D9W A;  5EL8 A;  4Q5F A;  4DVC A;  3A2X A;  2JSZ A;  4MCU A;  4E8H A;  2DIY A;  4XS4 A;  3LOR A;  1SL0 B;  1XCC A;  3I6A A;  2H76 A;  4PUR A;  3DD3 A;  4FO5 A;  1MDJ A;  1ILO A;  1K0M A;  2LJA A;  3GRX A;  1ERU A;  1UVZ A;  3Q18 A;  5DDL A;  2GLR A;  3QD9 A;  6GSU A;  3QFB C;  5G1L A;  4JR4 A;  4PUA A;  1THX A;  4NHZ A;  3VLN A;  1YF0 A;  4TVE A;  4HDE A;  2VL2 C;  5CNW A;  5B6N A;  1SK0 A;  3FRC A;  3L78 A;  4K2X A;  5HR0 A;  1ZL9 A;  5DAK A;  5CP1 A;  3TKP A;  1MD3 A;  5IMD A;  2PER A;  4TR3 A;  3ME8 A;  2UZ8 A;  2GGT A;  5DCG A;  2K6V A;  1YKC A;  1YY7 A;  5IPG A;  3FEU A;  1O7U A;  2YN1 A;  1A24 A;  2RLI A;  2HRN A;  4K5R A;  1M9B A;  1J9B A;  4GF0 A;  1GL8 A;  5INY A;  3LFL A;  1AQV A;  2VL9 A;  3QFA C;  4F2I A;  1Z6N A;  3KEB A;  1QXH A;  3DXB A;  4TR4 A;  1GRX A;  2PN8 A;  2MMZ A;  1O8W A;  4IS0 A;  4GLT A;  3VUR A;  1TU7 A;  4EL1 A;  1GUL A;  1USB A;  1XZO A;  3VPQ A;  2QKE A;  2KLX A;  2YWN A;  1TTZ A;  4L5L A;  1GTI A;  5JCW A;  3QAW A;  2O87 A;  5J9B A;  3TJJ A;  4JE1 A;  2VOC A;  1PA3 A;  3H79 A;  2CVB A;  1NHY A;  1SJZ A;  2YAN A;  3CRU A;  1B9Y C;  1X0R A;  3TOT A;  4BVX B;  3MYD A;  4MH3 A;  2VCT A;  4H86 A;  1PMT A;  1AAZ A;  5E59 A;  4TKY A;  3NZN A;  4TR1 B;  2H0I A;  2I4A A;  3N5O A;  4DEJ A;  2B5X A;  2LS5 A;  1S3C A;  2GQL A;  1OVN A;  4ILF A;  4CY6 A;  2OBI A;  3VK9 A;  1BQ7 A;  4HU9 A;  2QA1 A;  6GST A;  4IVF A;  5GST A;  1K3L A;  3MSZ A;  2PU9 C;  2YWI A;  3GNJ A;  4KDY A;  4GQC A;  4X1U A;  3MWH A;  2GSQ A;  4G0I A;  5D9V A;  2EC4 A;  1URM A;  2VD1 A;  1UN2 A;  2R5G A;  1PKZ A;  5J5N A;  4KCA A;  4OMV A;  5ECR B;  2H75 A;  19GS A;  1R4W A;  2P5Q A;  3EU4 A;  2VUP A;  1XIY A;  2H70 A;  2CV4 A;  2GT6 A;  5IO2 A;  1O6J A;  4WET A;  4N0V A;  3DIE A;  5AIS A;  3F3R A;  3TRP A;  4QQ7 A;  4EO3 A;  1FVK A;  5KOW A;  1JFU A;  2N5A A;  2VD0 A;  4HJM A;  5HR3 A;  2LKU A;  2XPD A;  1OAZ A;  2FD3 A;  3ISO A;  3W6G A;  1NSW A;  3RPP A;  1GTU A;  2VCV A;  4TR1 A;  1ZCP A;  1A8Y A;  1S3D A;  3KTL A;  1OC9 B;  4ZBB A;  3HCZ A;  4OO5 A;  4CW9 A;  4ECC A;  1KBN A;  3C7M A;  1A2J A;  1RK4 A;  3ZZX A;  1XWA A;  4BL7 A;  1X9W B;  3KJY A;  2H8L A;  2WRT A;  4J57 E;  5B8B A;  3UBL A;  3TB2 A;  2M72 A;  3F9U A;  4YAP A;  1M2D A;  2HFD A;  2FNO A;  5HFI A;  4PUF C;  2V32 A;  3KD0 A;  4K0G A;  4DSQ A;  1JLW A;  1KTE A;  2DMM A;  4TN8 A;  4J56 E;  3EE2 A;  1K0B A;  2GS3 A;  2IMD A;  2GTU A;  2H6X A;  3F4S A;  5ECS A;  3CRT A;  4L0U A;  3IXR A;  3ZVJ A;  4K1F A;  3DVW A;  4I97 A;  4AGS A;  1Z9H A;  2IL3 A;  3F4R A;  4TOP A;  1ZGN A;  3KTB A;  17GS A;  2H71 A;  2N5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...