1FB6A

Crystal structure of thioredoxin m from spinach chloroplast (oxidized form)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
104
structure length
104
Chain Sequence
VQDVNDSSWKEFVLESEVPVMVDFWAPWCGPCKLIAPVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAVPKSTLTDSIEKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords THIOREDOXIN M
publication title Crystal structures of two functionally different thioredoxins in spinach chloroplasts.
pubmed doi rcsb
source organism Spinacia oleracea
total genus 30
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1fb6A00
2C0EA 4I8BA 5A4WA 4Z7XA 3LORA 3IC4A 5F8BA 2H73A 3G7YA 2HYXA 4F0BA 3F3RA 3P90A 3QAVA 1RQMA 2XC2A 4BWQA 1B48A 1M99A 2CA8A 6GSUA 2JSYA 5JCUA 2LQOA 1X5DA 2GQLA 2H6ZA 1OC9A 1YEPA 4LL4B 1G6YA 4OFNA 3CTFA 2WZ9A 1SD8A 4OFMA 2L4CA 2CT6A 2VM2A 1HNBA 3BBYA 2O7KA 3PR8A 2C0FA 1GSDA 4ID0A 1JZRA 2JL4A 2HXKA 4L8EA 5J9BA 3GRXA 2DJ0A 2PERA 1OC3A 2J9HA 4ZL8A 4JE1A 3LXTA 3TUEA 6GSWA 4HJ2A 1WIKA 5ECQB 1SJIA 4XHMA 4TR3A 2B3SA 4ZILA 2H74A 1TRUA 3MNGA 1EGOA 4JBBA 4XIHA 4YH2A 2LQQA 5AISA 4KUNA 3VURA 5JCGA 5IO0A 3LJRA 5CRHA 1TXXA 3ZL5A 2KUCA 3ZMLA 4KAEA 1ZYEA 2LJKA 4AJ7A 4N0ZA 4L5LA 2DMLA 2E2GA 2K8SA 5G1KA 2DJ2A 2JZSA 4IN0A 4K7NA 1AXDA 1KBNA 5IMVA 1IYHA 4PURA 2YV9A 5G5EA 1GUMA 4E8HA 3ISOA 2FWEA 3DIEA 1AIUA 4IJIA 2FY6A 2PPTA 3DVXA 1SU9A 1AC1A 1ACVA 1EV9A 2I4AA 4J2FA 4O5RA 1K0BA 2QKEA 4ZB6A 2C3QA 1XWBA 3QFBC 3LEFA 2NPBA 3NOFA 1LU4A 2J23A 4JRRA 2WCIA 3HJPA 2B5YA 4G19A 4BVYA 1YF1A 3GHAA 5J41A 1BAYA 4V2MA 3IDVA 2A2SA 3IA1A 4WBJA 1ZL9A 1URMA 1KTEA 4TR4A 3QMXA 5CRDA 1XOBA 1V58A 5D93A 1SYXA 12GSA 1PX7A 3ZMKA 2LRCA 1M2DA 3FW2A 1QMVA 2FNOA 2LUSA 3QOUA 3TKQA 2JU5A 1SL1B 2O8VB 1CQHA 1PD21 3F63A 3SBCA 4MF6A 4FYCA 3GX8A 1QGVA 3G7IA 3H1NA 1T8EB 3C7MA 4J57E 3VWUA 1K3YA 3HD5A 3PH9A 3EVIA 3EC3A 2WGRA 2GQMA 1A8YA 3D21A 4TXVA 2YANA 4TRXA 2RLIA 1XIYA 4PNFA 2AHEA 3G9BA 2WFCA 4WXTA 1WP0A 2B1KA 3L9UA 1YKCA 3HCZA 4NV5A 3UEMA 2H6XA 3RAZA 2YNXA 2R5GA 2IN3A 2YN1A 5ENUA 2BJXA 3F9UA 5J5NA 1A23A 2AB6A 2H01A 2WS2A 5ELAA 1G6WA 1GTUA 4EF0A 2VCWA 3RPPA 3IK9A 2YWMA 4F2IA 4ILFA 1VF2A 1VRSD 1YDKA 3QCPA 1GSUA 1GL8A 4ZXGA 1THOA 4I2UA 2GQKA 5EY6A 1OE8A 3GSTA 5H5SA 4G2EA 5EPFA 2PGTA 2AUVA 4DEJA 4AJ8A 1XBSA 4MZBA 3GKKA 4YAVA 4LMVA 2YV7A 1GUHA 4I97A 1J9BA 2VLTA 1OVNA 1QFNA 3M8NA 1XFLA 5FWGA 1GSSA 1VF1A 5DBQA 2H1BA 1FVJA 5G1LA 1LJRA 2VM1A 2FLSA 1Z7PA 5HFGA 2HRFA 3VPTA 4EDYA 4GQFA 5DQSA 1ML6A 1SL2B 3KTBA 4MH2A 3Q19A 4XRDA 5D96A 1FO5A 2KHPA 5B8BA 5JCWA 1PRXA 1T1VA 2YWIA 1O8WA 4TOPA 4LLRA 3G7JA 3TKPA 3GTUA 4K7IA 3KXOA 2C80A 4QL7A 2YOIA 2H8LA 3LWAA 2FA8A 5G2ZA 4Q5QA 2GT6A 1G7EA 3BD2A 1MDIA 1UC7A 4IQ1A 1FHEA 4MPGA 4IGJA 2RUEA 5IOXA 2K18A 14GSA 2YJ7A 2H71A 3KP9A 2RUFA 1E6BA 2HZFA 3GH6A 3KGKA 1GSYA 2TRXA 4IHUA 4PX1A 1Z6NA 1Y25A 2H0HA 1O73A 4KSOA 3ERWA 1M2BA 2XPEA 2CX3A 2H72A 2H30A 1Z3EA 2F9SA 5D9TA 2I9HA 3EE2A 4HI7A 2YPMA 2GDRA 3GN3A 3ERFA 4JR4A 3CTGA 3CSIA 4L0WA 2VL3A 4OCEA 1JZOA 4X0XA 1M7TA 1J0FA 2LRTA 3I6AA 4YQVA 2IFQA 2BMXA 1KNGA 5E59A 1JLWA 4V1Ag 5DCHA 2GZPA 3H93A 4TR1B 5A4VA 5CRGA 2P31A 3FZ9A 2HE3A 5ID2B 4G10A 5DVBA 1RK4A 5IMCA 3F3QA 2FUG2 1OC8A 2F51A 1GWCA 4RQRA 1SJZA 3VK9A 20GSA 1EZKA 4GF0A 3F4TA 4NAXA 3VWVA 3GMFA 4HJMA 1TJDA 1EP8A 3KP8A 2PU9C 1UN2A 3GL5A 5IOWA 2FHEA 3H8QA 2XBQA 3I9V2 3FZAA 5DALB 3C73A 4WR5A 5F06A 4HOJA 2GS3A 4L0UA 3HDCA 5HQPA 1M9BA 2V32A 1FW1A 4YQMA 3ZIJA 4IS0A 3E0UA 5HFIA 3C71A 2DSAA 3WT1A 4DVCA 3J7Yk 2WULA 2H0GA 1BEDA 4GLTA 4XS4A 3IHQA 2VCQA 1TP9A 3TJKA 1T4ZA 1FVKA 3RHBA 4RQXA 2VL2C 1GTIA 4MZWA 3RHCA 1EEJA 3KCMA 4NMUA 4GSNA 3A2VA 4IW9A 4ML6A 1XXUA 3L0HA 1ZOFA 1ERVA 4BPYA 5F05A 4KGIA 3D4TA 1A0RP 2E0QA 3AY8A 1X9WB 1K0OA 1X0RA 2KP1A 2PVQA 1WRYA 3D0ZA 3OR5A 3GL3A 3UVTA 1SJ6A 1HQOA 3W8JA 2M46A 2EIOA 2IMEA 2I3YA 4XS6A 1MD3A 2DMMA 1X9MB 5G5FA 2L59A 3EINA 3UOMA 4ZBDA 2F8FA 2VO4A 2L6CA 5JWOB 3A2XA 1WWJA 4K8MA 2DIYA 3VWWA 3DGQA 6GSTA 1TRWA 4ECIA 1T7PB 5F07A 5ABRA 4MH3A 1SD9A 4X43A 4ZBBA 3FEUA 5JWRB 1T00A 3RPNA 3H79A 1JLVA 2CZ3A 1GNWA 1PKZA 4GCIA 1OC9B 4MK3A 1R26A 4PQIA 1GP1A 2AJQB 1VF4A 4ZL9A 2R3XA 2A2RA 4D73A 1GNEA 4CW9A 4CDOA 3WT2A 4OFTA 3O6TA 3N9JA 3MWHA 3QPMA 4WEYA 3DVWA 3TKSC 4KCEA 7GSSA 4KA0A 1B4PA 2H19A 1V98A 4MABA 1OKTA 1GRXA 4JR6A 2HSHA 4MJCA 1QQ2A 2WDUA 1GUKA 2VCZA 3EWLA 3DEXA 3LQ7A 2AYTA 2TIRA 1FB6A 4O32A 3MSZA 4I6XA 2CVBA 1XVWA 3F4RA 4IELA 4FIWA 2DJ3A 5LCZA 2I81A 3LYPA 4F0CA 3F8UA 3W6GA 2CV4A 1O7UA 4L5OA 1GH2A 2I1UA 2H1AA 2XBIA 2MBSA 3EU3A 4MDCA 4N10A 2R6KA 3C1RA 2KP2A 3I69A 5GSSA 3BJ5A 1DE2A 2GVPA 4XS1A 2LS5A 3GFKA 1GSQA 1F37A 2KLXA 5C00A 3I43A 1XWKA 2DLXA 2EC4A 3EYTA 5KEJA 3Q6OA 4RUVA 3APQA 3M1GA 4EL1A 4YQUA 1T4YA 4H86A 3L9VA 1OAZA 2IIYA 4MJAA 1GTAA 3FZ4A 1Q4JA 1ZZYA 2Z9SA 1TI1A 3KJYA 4POMA 2FWFA 3R2QA 1XCCA 5IO2A 5B6NA 3HVVA 3RDWA 2REMA 3CYNA 4BWSA 1I5GA 1PSQA 2VLVA 1Z6MA 4O7HA 2PUKC 3HXSA 2AV4A 4K0NA 3TKSE 2FCHA 2P5RA 5JWQB 2LNTA 4OMVA 5IMDA 3GKMA 1YZXA 4OO4A 1YJ6A 5GSTA 4E8EA 4ZBAA 2H70A 3QAWA 5CP1A 4DSSA 3TCOA 1KEBA 6GSVA 2CVKA 3ZZXA 1R7HA 5ECKB 2O87A 2VL2A 3N5OA 2G2QA 4NWYA 1FAAA 2ON5A 4N11A 5IMAA 2P0GA 3V1WA 3JCML 5B8AA 3ZTLA 1TTZA 4FYBA 3QR6A 2C0DA 5B7CA 1EEMA 4MJBA 2ES7A 4POKA 1XWCA 4GXZA 2JACA 4IKHA 4K1FA 3HKRA 2L57A 3IPZA 4GSTA 4K0GA 1XPVA 1PQNA 1QK8A 1JZDA 4TVEA 1DSBA 1MD4A 5CRWA 1K0CA 3H4KA 2OE3A 2PN8A 3F4SA 2D2ZA 1TU7A 3A3TA 1PL1A 2YZHA 5IMFA 1SKRB 1V9WA 3GNJA 2IMDA 3A2WA 2LNSA 3PGTA 2GT5A 3P8WA 10GSA 1XWGA 1V2AA 1TRVA 2PMTA 2VL9A 2F3MA 5GZZB 1Z5YE 1AQXA 4IJ3A 4KH7A 4EDZA 4TR0A 1HNCA 5HFKA 2HLSA 2FA4A 4POBA 1U3AA 3EMPA 5AIVA 3RBTA 2X99A 3U5RE 2IL3A 1XW9A 1JZWA 4IBPA 3D22A 4N30A 2PWJA 3APOA 1ZYQB 1FOVA 3BCKA 1SL0B 3US3A 1XW6A 3UIWA 3ERGA 1USBA 1B9XC 1YF0A 4NHZA 3P7XA 1XZOA 1PMTA 2PVOC 1O6JA 3GTUB 2H75A 3CBUA 4HZ4A 3C8EA 6GSYA 3L78A 1HNAA 3TKSA 3IXRA 3UAPA 4F82A 1TK8B 2MBTA 2CQ9A 4V2LA 2QSIA 3F6DA 3ZRDA 2O89A 5HR0A 4RI7A 3HJOA 4ML1A 1VF3A 4HDEA 5J4UA 3FR6A 3ZREA 2DIZA 3WYWA 4HZ2A 3TOTA 2F8AA 3VLNA 1U3IA 1T3BA 2C3TA 2V1MA 4K9ZA 2OBIA 2OA7A 3FK8A 6GSXA 4I5QA 3KZQA 1AUCA 2WJUA 2LRNA 1R5PA 3TJBA 1YKAA 1JFUA 2QGVA 17GSA 1SK0A 3KTLA 1SKSB 2LJAA 5IM9A 1ON4A 1H4OA 2JADA 1JHBA 2DBCA 2IFQB 5DJMA 5IIZA 1BX9A 3DYRA 4Q5NA 2GTUA 2YWOA 4PQ1A 4AGSA 2R2JA 3HYPA 1GSFA 4GQCA 5EL8A 1TK5B 2X64A 3ZFBA 4G9HA 4KSMA 4TN8A 2DJJA 5ECOB 4KE3A 2C1YA 2B5EA 1F3BA 1G7OA 1F2EA 4ECCA 4LMWA 2JZRA 2C3NA 2B5XA 1CQGA 3TKRA 1R4WA 2RM5A 4POLA 4GTUA 3FRCA 3EMXA 1E2YA 5DAKA 3O76A 1B8XA 2K9FA 1DUGA 4V2NA 4XRAA 3ME7A 4OWYA 3IOSA 3WGDA 1LBKA 2N5AA 4JEDA 4KDXA 4FYUA 2LJRA 5INYA 4K2DA 4KNDA 2LV3A 5IQYA 1A2MA 1ILOA 5H5QA 4PQHA 5FHIA 2VUPA 2N5BA 4XS4B 3GSSA 3J7Yb 5ECIB 3M0FA 3ZLPA 4JZQA 5CO3A 5DQYA 3U6VA 1ERTA 1ZGNA 3FYGA 3BCIA 4KX4A 4MP4A 1K0AA 4EUYA 1N8JA 5KN1A 1I9DA 3O3TA 1AQWA 2DC5A 5HR1A 2MMOA 1N2AA 2EIRA 2TRCP 1A8LA 2HZEA 3ZIVA 2IMIA 4MA9A 1ERUA 1MDKA 1QXHA 1AAZA 1EP7A 2L6DA 2FD3A 2OADA 1R5AA 2DJKA 3TRQA 5D73A 1NHOA 2GSQA 2MMAA 3VFIA 3KEBA 2BTOT 1PX6A 2V6OA 3TB2A 4PNGA 4MF7A 5DDLA 4Q5FA 3GX0A 2FGXA 3M9KA 3UBKA 2GZZA 2B6MA 1SKWB 4CHSA 4EVMA 2PBJA 1NHYA 5CNWA 2GZYA 1O81A 1W89A 2O85A 1YQ1A 3GA4A 4KW6A 4TXOA 5G30A 5CYYA 1V57A 3ZVJA 3CSHA 1UVZA 2MZCA 3F0IA 4EO3A 3VPQA 1TI3A 3NZNA 4HUAA 3HJMA 2WB9A 2IPAA 2E7PA 1GTBA 4I2TA 4D73B 2VAFA 5IPGA 3ZYWA 3DRNA 4NHWA 2CVDA 3HZ8A 1OE7A 4HQZA 3P2AA 1ZMAA 1EGRA 1NM3A 3FKFA 4OD7A 16GSA 1PA3A 2OACA 4PUFC 3E9JB 2OJLA 1A24A 1SENA 5CREA 3DKSA 3ZFLA 4BVXA 19GSA 3KMOA 5D9VA 1X5EA 2H1DA 4MZCA 18GSA 2ALBA 4QQ7A 2L5OA 2CAQA 2X8HA 1YEXA 4NV2A 1WE0A 5L71A 3LYKA 4V1Ap 1XW5A 4DSRA 1J08A 4HU9A 3PINA 4KB3A 2K6VA 4MPFA 1A2LA 4ZB8A 5B6MA 1K3OA 4MF5A 2HSYA 2HFDA 2AAWA 4ZL7A 1VGLA 1MEKA 1W4VA 3WGXA 1MTCA 1TK0B 3M3MA 1C72A 3TGZA 5DCGA 4QL9A 1FG4A 1H75A 5FT3A 3Q18A 4EXJA 2MYGA 5HR3A 1HD2A 4AF2A 3LG6A 2R4VA 5ECRB 4NXIA 2ZCTA 4ZIJA 4J56E 3HA9A 3QAGA 4N0VA 3QFAC 3GV1A 5AIXA 3E3EA 2VOCA 5GAPD 2M80A 4WR4A 5E4WA 1PGTA 3VWXA 1BG5A 1THXA 4WBRD 3LFLA 1TW9A 2CZ2A 4X1UA 2HT9A 3TRXA 8GSSA 4ULXA 1EOHA 3APSA 2GLRA 4WF5A 5DJLA 1ZCPA 2LKUA 5ECSA 5D9WA 5G31A 3C1SA 3TDGA 1DBYA 3DD3A 4PXOA 1O8XA 3GKNA 1X9SB 2B7JA 2YCDA 1G0TA 5KN2A 1FB0A 4DSSB 3IRAA 4MJEA 1U87A 1XVQA 1BQ7A 4FO5A 4EC0A 2QC7A 1UA5A 3EURA 3MAKA 3LGCA 3NIVA 2E2MA 4AJ6A 22GSA 1WPIA 1OYJA 4O92A 1WOUA 3FR9A 3KD0A 2B1LA 4K6XA 3M9JA 1M2AA 1TDIA 2B7KA 2ZUPA 4OCFA 2KOKA 5IPHA 1GLPA 1HYUA 3FY7A 2C8UA 4XCSA 3QDNA 3K8NA 1YY7A 3KMNA 4OO5A 2HRNA 4KCAA 2HNLA 3LXZA 4ISDA 1ST9A 5CAXA 4XTSA 3UMAA 2NDOA 1K0NA 2G0FA 2H66A 1S3DA 1A2JA 4PUAA 4LL1B 4KDYA 3VI5A 3TJJA 4Q5RA 4MLYA 3ME8A 3IAS2 5COHA 2CAIA 3ED3A 3L9SA 2RM6A 2JSZA 5KN3A 3D4MA 2RIIA 4ACSA 3VI7A 1U6TA 6GSSA 3CRUA 3L4NA 5KN0A 1DE1A 1WJKA 4K7OA 3ZITA 3EU4A 4IP1A 4GWRA 3D5JA 1X5CA 3KIJA 3LSZA 4YAPA 3KM6A 5D8IA 2ZNMA 2NTOA 3CMIA 3IBHA 4HU7A 2V2GA 2DJ1A 4WF4A 13GSA 4ECJA 5AGYA 2JZTA 1F6MC 3DWVA 4P3YB 5ECNB 3IK7A 4F03A 3UVHA 4IQAA 5GAND 2OKAA 4NPBA 5IMZA 3TOUA 2LSTA 2EIQA 2GSRA 4DSQA 1GLQA 4HEA2 2YWNA 3FZ5A 1TU8A 3W8SA 4MMMA 3DXBA 2WRTA 4KDUA 2GGTA 1Y6EA 3CXGA 2NVLA 1A0FA 1TOFA 2IMKA 5F0GA 2XHFA 2FWGA 2VCXA 2V41A 4TKYA 1EV4A 3GURA 3WGEA 1K0DA 5AN1A 2VCVA 4GSSA 2R37A 4IP6A 2HI7A 3TJGA 3KH9A 3TRPA 1SK1A 1BJXA 1MDJA 2X8GA 1F3AA 5J3RA 3TJFA 3GUSA 2C4JA 4TW5A 1S3AA 2L4QA 2IMFA 2VIMA 2VD0A 1BYEA 1PL2A 2MMNA 4WKWA 3DMLA 1SK2A 4PGTA 1NSWA 2H76A 5A4UA 3QD9A 5C04A 2X8CA 5DAKB 2VLUA 1Q98A 5ECLB 1K3LA 2YP6A 1K0MA 3BOAA 4LA1A 9GSSA 5A5KA 2L5LA 4EE0A 1NW2A 2C0GA 4JU5A 2VCTA 1EWXA 3IV4A 3GKXA 2OE1A 4BA7A 1IYIA 3UJ1A 2OE0A 2H0IA 1RW1A 2A4VA 5ELGA 1EOGA 2YZUA 2MMZA 1O85A 1Z7RA 3FHKA 2NBSA 4RI6A 4TR1A 1B9YC 3GH9A 4EKZA 4WETA 5ID2A 5EVOA 1XOAA 2H1GA 3HZ4A 3IR4A 3HVSA 3GIXA 1GULA 3HHVA 4ZB9A 3CSJA 2LTKA 3GYKA 3ZVJD 2HZEB 1S3CA 2IWTA 2YJHA 3D6IA 2H6YA 3IE3A 3WD6A 4HQSA 11GSA 3IAM2 1M9AA 2GSTA 3Q74A 2P5QA 5ECHB 1PN9A 1SYRA 2OBKA 3F6FA 3FR3A 2V6KA 1XWAA 3KH7A 2M72A 2XPDA 1QUWA 3A5WA 5DALA 3UARA 4ECBA 5J9CA 1B4QA 1AQVA 4IVFA 1TRSA 4BL7A 5ECMB 2LEGA 3HY2A 4F9ZA 3UBLA 1OKDA 4HS1A 1ABAA 5HR2A 5D9XA 4TXOB 5H5RA 2GSSA 5ECPB 2ON7A 3SWLA 1M0UA 1ERWA 1F9MA 1WMJA 1Z9HA 5LNKe 4MCUA 2FWHA 3HVXA 2IJYA 1TKDB 1U88A 4FH8A 2K8VA 2N5FA 3MDKA 4GRFA 5LD0A 2CX4A 1V40A 3S9FA 3UL3A 3CRTA 1GSEA 2VD1A 1PKWA 1AW9A
chains in the Genus database with same CATH superfamily
2C0EA 4I8BA 5A4WA 4Z7XA 3LORA 3IC4A 5F8BA 2H73A 3G7YA 2HYXA 4F0BA 3F3RA 3P90A 3QAVA 1RQMA 2XC2A 4BVXB 4BWQA 1B48A 1M99A 2CA8A 1S3RA 6GSUA 2JSYA 5JCUA 2LQOA 1X5DA 2GQLA 2H6ZA 1OC9A 1YEPA 4LL4B 1G6YA 4OFNA 3CTFA 2WZ9A 1SD8A 4OFMA 2L4CA 2CT6A 4HSCX 2VM2A 1HNBA 3BBYA 2O7KA 3PR8A 2C0FA 1GSDA 4ID0A 1JZRA 2JL4A 2HXKA 4L8EA 5J9BA 3GRXA 2DJ0A 2PERA 1OC3A 2J9HA 4ZL8A 4JE1A 3LXTA 3TUEA 6GSWA 4HJ2A 1WIKA 5ECQB 1SJIA 4XHMA 4TR3A 2B3SA 4ZILA 2H74A 1TRUA 3MNGA 1EGOA 4JBBA 4XIHA 4YH2A 2LQQA 5AISA 4KUNA 3VURA 5JCGA 5IO0A 3LJRA 5CRHA 1TXXA 3ZL5A 2KUCA 3ZMLA 4KAEA 1ZYEA 2LJKA 4AJ7A 4N0ZA 4L5LA 2DMLA 2E2GA 2K8SA 5G1KA 2DJ2A 2JZSA 4IN0A 4K7NA 1AXDA 1KBNA 5IMVA 1IYHA 4PURA 2YV9A 5G5EA 1GUMA 4E8HA 3ISOA 2FWEA 3DIEA 1AIUA 4IJIA 2FY6A 2PPTA 3DVXA 1SU9A 1AC1A 1ACVA 1EV9A 2I4AA 4J2FA 4O5RA 1K0BA 2QKEA 4ZB6A 3HVNA 4Z2RA 2C3QA 1XWBA 3QFBC 2HRKA 3LEFA 2NPBA 3NOFA 1LU4A 2J23A 4JRRA 2WCIA 3HJPA 2B5YA 4G19A 4BVYA 1YF1A 3GHAA 5J41A 1BAYA 4V2MA 3IDVA 2A2SA 3IA1A 4WBJA 1ZL9A 1URMA 1KTEA 4TR4A 3QMXA 5CRDA 1XOBA 1V58A 5D93A 1SYXA 12GSA 1PX7A 3R3EA 3ZMKA 2LRCA 1M2DA 3FW2A 1QMVA 2FNOA 2LUSA 3QOUA 3TKQA 2JU5A 1SL1B 2O8VB 1CQHA 1PD21 3F63A 3SBCA 4MF6A 4FYCA 3GX8A 1QGVA 3G7IA 3H1NA 1T8EB 3C7MA 4J57E 3VWUA 1K3YA 3HD5A 3PH9A 3EVIA 3EC3A 2WGRA 2GQMA 1A8YA 3D21A 4TXVA 2YANA 4TRXA 2RLIA 1XIYA 4PNFA 2AHEA 1XG8A 3G9BA 2WFCA 4WXTA 1WP0A 2B1KA 3L9UA 1YKCA 3HCZA 4NV5A 3UEMA 2H6XA 3RAZA 2YNXA 2R5GA 2IN3A 2YN1A 2X4AA 5ENUA 2BJXA 3F9UA 5J5NA 1A23A 2AB6A 2H01A 2WS2A 5ELAA 1G6WA 1GTUA 4EF0A 2VCWA 3RPPA 3IK9A 2YWMA 4F2IA 4ILFA 1VF2A 1VRSD 1YDKA 3QCPA 1GSUA 1GL8A 4ZXGA 1THOA 4I2UA 2GQKA 5EY6A 1OE8A 3GSTA 5H5SA 4G2EA 5EPFA 2PGTA 2AUVA 4DEJA 4AJ8A 1XBSA 4MZBA 3GKKA 4YAVA 4O5QA 4LMVA 2YV7A 1GUHA 4I97A 1J9BA 1FOHA 2VLTA 1OVNA 1QFNA 3M8NA 1XFLA 5FWGA 1GSSA 1VF1A 5DBQA 2H1BA 1FVJA 5G1LA 1LJRA 2VM1A 2FLSA 1Z7PA 5HFGA 2HRFA 3VPTA 4EDYA 4GQFA 5DQSA 1ML6A 1SL2B 3KTBA 4MH2A 3Q19A 4XRDA 5D96A 1FO5A 2KHPA 5B8BA 5JCWA 3MYDA 1PRXA 1T1VA 2YWIA 1O8WA 4TOPA 4LLRA 3G7JA 3TKPA 3GTUA 4K7IA 3KXOA 2C80A 4QL7A 2YOIA 2H8LA 3LWAA 2FA8A 5G2ZA 4Q5QA 2GT6A 1G7EA 3BD2A 1MDIA 1UC7A 4IQ1A 1FHEA 4MPGA 1ZYPA 4IGJA 2RUEA 5IOXA 2K18A 14GSA 2YJ7A 2H71A 3KP9A 2RUFA 1E6BA 2HZFA 3GH6A 3KGKA 1GSYA 2TRXA 4IHUA 4PX1A 1Z6NA 1Y25A 2H0HA 1O73A 4KSOA 3ERWA 1M2BA 2XPEA 2CX3A 2H72A 4MNNA 2H30A 1Z3EA 2F9SA 5D9TA 2I9HA 3EE2A 4HI7A 2YPMA 2GDRA 3GN3A 3ERFA 4JR4A 3CTGA 3CSIA 4L0WA 2VL3A 4OCEA 1JZOA 4X0XA 1M7TA 1J0FA 2LRTA 3I6AA 4YQVA 2IFQA 2BMXA 1KNGA 5E59A 3A5IA 1JLWA 4V1Ag 5DCHA 2GZPA 3H93A 4TR1B 5A4VA 5CRGA 2P31A 3FZ9A 5KOWA 2HE3A 5ID2B 4G10A 5DVBA 1RK4A 5IMCA 3F3QA 2FUG2 1OC8A 2F51A 1GWCA 4RQRA 1SJZA 3VK9A 20GSA 1EZKA 4GF0A 3IHGA 3F4TA 4NAXA 3VWVA 3GMFA 4HJMA 1TJDA 1EP8A 3KP8A 2PU9C 1UN2A 3GL5A 5IOWA 2FHEA 3H8QA 2XBQA 3I9V2 3FZAA 5DALB 3C73A 4WR5A 5F06A 4HOJA 2GS3A 4L0UA 3HDCA 5HQPA 1M9BA 4BL7B 2V32A 1FW1A 4YQMA 3ZIJA 4IS0A 3E0UA 5HFIA 4G0KA 3C71A 2DSAA 3WT1A 4DVCA 3J7Yk 2WULA 2H0GA 1BEDA 4GLTA 4XS4A 3IHQA 2VCQA 1TP9A 3TJKA 1T4ZA 1FVKA 3RHBA 4RQXA 2VL2C 1GTIA 4MZWA 3RHCA 1EEJA 3KCMA 4NMUA 4GSNA 3A2VA 4IW9A 4ML6A 1XXUA 3L0HA 1ZOFA 1ERVA 4BPYA 5F05A 4KGIA 3D4TA 1A0RP 2E0QA 3AY8A 1X9WB 1K0OA 1X0RA 2KP1A 2PVQA 1WRYA 3D0ZA 3OR5A 3GL3A 3UVTA 1SJ6A 1HQOA 3W8JA 2M46A 2EIOA 2IMEA 2I3YA 4XS6A 1MD3A 2DMMA 1X9MB 5G5FA 2L59A 3EINA 3UOMA 4ZBDA 2F8FA 2VO4A 2L6CA 5JWOB 3A2XA 1WWJA 4K8MA 2DIYA 3VWWA 4K5RA 3DGQA 6GSTA 1TRWA 4ECIA 1T7PB 5F07A 5ABRA 4MH3A 1SD9A 4X43A 4ZBBA 3FEUA 5JWRB 1T00A 3RPNA 3H79A 1JLVA 2CZ3A 1GNWA 1PKZA 4GCIA 1OC9B 4MK3A 1R26A 4PQIA 3EPTA 1GP1A 2AJQB 1VF4A 4ZL9A 2R3XA 2A2RA 1ZYNA 4D73A 4G0LA 1GNEA 4CW9A 4CDOA 3WT2A 4OFTA 3O6TA 3N9JA 3MWHA 4X4JA 3QPMA 4WEYA 3DVWA 3TKSC 4KCEA 7GSSA 4KA0A 1B4PA 2H19A 1V98A 4MABA 4ICYA 1OKTA 1GRXA 4JR6A 2HSHA 4MJCA 1QQ2A 2WDUA 1GUKA 2VCZA 3EWLA 3DEXA 3LQ7A 2AYTA 2TIRA 1FB6A 4O32A 3MSZA 4I6XA 2CVBA 1XVWA 3F4RA 4IELA 4FIWA 2DJ3A 5LCZA 2I81A 2R0CA 3LYPA 4F0CA 3F8UA 3W6GA 2CV4A 1O7UA 4L5OA 1GH2A 2I1UA 2H1AA 2XBIA 2MBSA 3EU3A 4MDCA 4N10A 2R6KA 3C1RA 2KP2A 3I69A 5GSSA 3BJ5A 1DE2A 2GVPA 4XS1A 2LS5A 3GFKA 1GSQA 1F37A 2KLXA 5C00A 4Z2UA 3MIXA 3I43A 1XWKA 2DLXA 2EC4A 3EYTA 5KEJA 3Q6OA 4RUVA 3APQA 3M1GA 4EL1A 4YQUA 1T4YA 2UZ8A 4H86A 3L9VA 4BVYB 1OAZA 2IIYA 4MJAA 4EIPA 1GTAA 3FZ4A 1Q4JA 1ZZYA 4Z2TA 2Z9SA 1TI1A 3KJYA 4POMA 2FWFA 3R2QA 1XCCA 4K5SA 5IO2A 5B6NA 3HVVA 3RDWA 2REMA 3CYNA 5KOXA 4BWSA 1I5GA 1PSQA 2VLVA 1Z6MA 4O7HA 2PUKC 3HXSA 2AV4A 4K0NA 3TKSE 2FCHA 2P5RA 5JWQB 2LNTA 4OMVA 5IMDA 3GKMA 1YZXA 4OO4A 1YJ6A 5GSTA 4E8EA 4ZBAA 2H70A 3QAWA 5CP1A 4DSSA 3TCOA 1KEBA 6GSVA 2CVKA 3ZZXA 1R7HA 5ECKB 2O87A 2VL2A 3N5OA 2G2QA 4NWYA 1FAAA 2ON5A 4N11A 5IMAA 2P0GA 3V1WA 3JCML 5B8AA 3ZTLA 1TTZA 4FYBA 3QR6A 2C0DA 5B7CA 1EEMA 4MJBA 2ES7A 4POKA 1XWCA 4CY8A 4GXZA 2JACA 4IKHA 4K1FA 3HKRA 2L57A 3IPZA 4GSTA 4K0GA 1XPVA 1PQNA 1QK8A 1JZDA 4TVEA 1DSBA 1MD4A 5CRWA 1K0CA 3H4KA 2OE3A 2PN8A 3F4SA 2D2ZA 1TU7A 3A3TA 1PL1A 2YZHA 5IMFA 1SKRB 1V9WA 3GNJA 2IMDA 3A2WA 4G0IA 2LNSA 3PPUA 3PGTA 2GT5A 3P8WA 10GSA 1XWGA 1V2AA 1TRVA 2PMTA 2VL9A 2F3MA 5GZZB 1Z5YE 1AQXA 4IJ3A 4KH7A 4EDZA 4TR0A 1HNCA 5HFKA 2HLSA 2FA4A 4POBA 1U3AA 3EMPA 5AIVA 3RBTA 2X99A 3U5RE 2IL3A 1XW9A 1JZWA 4IBPA 4A5PA 3D22A 4N30A 2PWJA 3APOA 1ZYQB 1FOVA 3BCKA 1SL0B 3US3A 1XW6A 3UIWA 3ERGA 1USBA 1B9XC 1YF0A 4NHZA 3P7XA 1XZOA 1PMTA 2PVOC 1O6JA 3GTUB 2H75A 4KF9A 3CBUA 4HZ4A 3C8EA 6GSYA 3L78A 1HNAA 3TKSA 1M3JA 3IXRA 3UAPA 4F82A 1TK8B 2MBTA 2CQ9A 4V2LA 2QSIA 3F6DA 3ZRDA 2O89A 5HR0A 4RI7A 3HJOA 4ML1A 1VF3A 4HDEA 5J4UA 3FR6A 3ZREA 2DIZA 3WYWA 4HZ2A 3TOTA 2F8AA 3VLNA 1U3IA 1T3BA 2C3TA 2V1MA 4K9ZA 2OBIA 2OA7A 3FK8A 6GSXA 4CY6A 4I5QA 3KZQA 1AUCA 1M3IA 2WJUA 2LRNA 1R5PA 3TJBA 1YKAA 1JFUA 2QGVA 17GSA 1SK0A 3KTLA 1SKSB 2LJAA 5IM9A 1ON4A 1H4OA 2JADA 1JHBA 2DBCA 2IFQB 5DJMA 5IIZA 1BX9A 2QA1A 3DYRA 4Q5NA 2GTUA 2YWOA 4PQ1A 4AGSA 2R2JA 3HYPA 1GSFA 4GQCA 5EL8A 1TK5B 2X64A 3ZFBA 4G9HA 4KSMA 4TN8A 2DJJA 5ECOB 4KE3A 2C1YA 2B5EA 2QA2A 1F3BA 1G7OA 1F2EA 4ECCA 4LMWA 2JZRA 2C3NA 2B5XA 4O5UA 1CQGA 3TKRA 1R4WA 2RM5A 4POLA 4GTUA 3FRCA 3EMXA 1E2YA 5DAKA 3O76A 1B8XA 2K9FA 1DUGA 4V2NA 4XRAA 3ME7A 4OWYA 3IOSA 3WGDA 1LBKA 2N5AA 4JEDA 4KDXA 4FYUA 2LJRA 5INYA 4K2DA 4KNDA 2LV3A 5IQYA 1A2MA 1ILOA 5H5QA 4PQHA 5FHIA 2VUPA 2N5BA 4XS4B 3GSSA 3J7Yb 5ECIB 3M0FA 3ZLPA 4JZQA 5CO3A 5DQYA 3U6VA 1ERTA 1ZGNA 3FYGA 3BCIA 4KX4A 4MP4A 1K0AA 4EUYA 1N8JA 5KN1A 1I9DA 2HRAA 3O3TA 1AQWA 2DC5A 5HR1A 2MMOA 1N2AA 2EIRA 2TRCP 1A8LA 2HZEA 3ZIVA 2IMIA 4MA9A 1ERUA 1MDKA 1QXHA 1AAZA 1EP7A 2L6DA 2FD3A 2OADA 1R5AA 2DJKA 3TRQA 5D73A 1NHOA 2GSQA 2MMAA 3VFIA 3KEBA 2BTOT 1PX6A 2V6OA 3TB2A 4PNGA 2DKHA 4MF7A 5DDLA 4Q5FA 3GX0A 2FGXA 3M9KA 3UBKA 2GZZA 2B6MA 1SKWB 4CHSA 4EVMA 2PBJA 1NHYA 5CNWA 2GZYA 1O81A 1W89A 2O85A 1YQ1A 3GA4A 4KW6A 4TXOA 5G30A 5CYYA 1V57A 3ZVJA 3CSHA 1UVZA 2MZCA 3F0IA 4EO3A 3VPQA 1TI3A 3NZNA 4HUAA 3HJMA 2WB9A 2IPAA 2E7PA 1GTBA 4I2TA 4D73B 2VAFA 5IPGA 3ZYWA 3DRNA 4NHWA 2CVDA 3HZ8A 1OE7A 4YKGA 4HQZA 3P2AA 1ZMAA 1EGRA 1NM3A 3FKFA 4OD7A 16GSA 1PA3A 2OACA 4PUFC 3E9JB 2OJLA 1A24A 1SENA 5CREA 3DKSA 3ZFLA 4BVXA 19GSA 3KMOA 3IC8A 5D9VA 1X5EA 2H1DA 4MZCA 18GSA 2ALBA 4QQ7A 2L5OA 2CAQA 2X8HA 1YEXA 4NV2A 1WE0A 5L71A 3LYKA 4V1Ap 1XW5A 4DSRA 1J08A 4HU9A 3PINA 2A4HA 4KB3A 2K6VA 4MPFA 1A2LA 4ZB8A 5B6MA 1K3OA 4MF5A 2HSYA 2HFDA 2AAWA 4ZL7A 1VGLA 1MEKA 1W4VA 3WGXA 1MTCA 1TK0B 3M3MA 1C72A 3TGZA 5DCGA 4QL9A 1FG4A 1H75A 5FT3A 3Q18A 4EXJA 2MYGA 5HR3A 1HD2A 4AF2A 3LG6A 2R4VA 5ECRB 2X49A 4NXIA 2ZCTA 4ZIJA 4J56E 3HA9A 3QAGA 4N0VA 3QFAC 3GV1A 5AIXA 3E3EA 2VOCA 5GAPD 2M80A 2A2PA 4WR4A 1PGTA 5E4WA 3VWXA 1BG5A 1THXA 4WBRD 3LFLA 1TW9A 2CZ2A 2R0PA 4X1UA 2HT9A 3TRXA 8GSSA 4ULXA 1EOHA 3APSA 2GLRA 4WF5A 3CQFA 5DJLA 1ZCPA 2LKUA 5ECSA 5D9WA 5G31A 3C1SA 3TDGA 1DBYA 3DD3A 4PXOA 1O8XA 3GKNA 1X9SB 2B7JA 2YCDA 1G0TA 5KN2A 1FB0A 4DSSB 3IRAA 4MJEA 1U87A 1XVQA 1BQ7A 2R0GA 4FO5A 4EC0A 2QC7A 1UA5A 3EURA 3MAKA 3LGCA 3NIVA 2E2MA 4AJ6A 22GSA 1WPIA 1OYJA 4O92A 1WOUA 3FR9A 3KD0A 2B1LA 4K6XA 3M9JA 1M2AA 1TDIA 2B7KA 2ZUPA 4EIQA 4OCFA 2KOKA 5IPHA 1GLPA 1HYUA 3FY7A 2C8UA 2DKIA 4XCSA 3QDNA 3K8NA 1YY7A 3KMNA 4OO5A 2HRNA 2HSMA 4KCAA 2HNLA 3LXZA 4ISDA 1ST9A 5CAXA 4XTSA 3UMAA 2NDOA 1K0NA 2G0FA 2H66A 1S3DA 1A2JA 4PUAA 4LL1B 4KDYA 3VI5A 3TJJA 4Q5RA 4MLYA 3ME8A 3IAS2 5COHA 2CAIA 3ED3A 3L9SA 2RM6A 2JSZA 5KN3A 3D4MA 2RIIA 4ACSA 3VI7A 1U6TA 4USSA 4YKFA 6GSSA 3CRUA 3L4NA 5KN0A 1DE1A 1WJKA 4K7OA 3ZITA 3EU4A 4IP1A 4GWRA 3D5JA 1X5CA 3KIJA 3LSZA 4YAPA 3KM6A 5D8IA 2ZNMA 2NTOA 3CMIA 5BMUA 3IBHA 4HU7A 2V2GA 2DJ1A 4WF4A 4BIKA 13GSA 4ECJA 5AGYA 2JZTA 1F6MC 3DWVA 4P3YB 5ECNB 3IK7A 4F03A 3UVHA 4IQAA 5GAND 2OKAA 4NPBA 5IMZA 3TOUA 2LSTA 2EIQA 2GSRA 4DSQA 1GLQA 4HEA2 2YWNA 3FZ5A 1TU8A 3W8SA 4MMMA 3DXBA 2WRTA 4KDUA 2GGTA 1Y6EA 3CXGA 2NVLA 1A0FA 1TOFA 2IMKA 5F0GA 4PTSA 2XHFA 2FWGA 2VCXA 2V41A 4TKYA 1EV4A 3GURA 3WGEA 1K0DA 5AN1A 2VCVA 4GSSA 2R37A 4IP6A 2HI7A 3TJGA 3KH9A 3TRPA 1SK1A 1BJXA 1MDJA 2X8GA 1F3AA 5J3RA 3TJFA 3GUSA 2C4JA 4TW5A 1S3AA 2L4QA 2IMFA 2VIMA 2VD0A 1BYEA 1PL2A 2MMNA 4FQUA 4WKWA 3DMLA 1SK2A 4PGTA 1NSWA 4K2XA 2H76A 5A4UA 3QD9A 5C04A 2X8CA 5DAKB 2VLUA 1Q98A 5ECLB 1K3LA 2YP6A 1K0MA 3BOAA 4LA1A 9GSSA 5A5KA 2L5LA 4EE0A 1NW2A 2C0GA 4JU5A 1PN0A 2VCTA 1EWXA 3IV4A 3GKXA 2OE1A 4BA7A 1IYIA 3UJ1A 2OE0A 2H0IA 1RW1A 2A4VA 5ELGA 1EOGA 2YZUA 2MMZA 1O85A 1Z7RA 3FHKA 2NBSA 4RI6A 4TR1A 1B9YC 3GH9A 4EKZA 4WETA 5ID2A 5EVOA 1XOAA 2H1GA 3HZ4A 3IR4A 3HVSA 3GIXA 1GULA 3HHVA 3FMWA 4ZB9A 3CSJA 2LTKA 3GYKA 3ZVJD 2HZEB 1S3CA 2IWTA 2YJHA 3D6IA 2H6YA 3IE3A 3WD6A 4HQSA 11GSA 3IAM2 1M9AA 2GSTA 3Q74A 2P5QA 5ECHB 1PN9A 1SYRA 2OBKA 3F6FA 3FR3A 2V6KA 1XWAA 3KH7A 2M72A 2XPDA 1QUWA 3A5WA 5DALA 3UARA 4ECBA 5J9CA 1B4QA 1AQVA 4IVFA 1TRSA 4BL7A 5ECMB 2LEGA 3HY2A 4F9ZA 3UBLA 3LW9A 1OKDA 4HS1A 1ABAA 5HR2A 5D9XA 4TXOB 5H5RA 2GSSA 5ECPB 2ON7A 3SWLA 1M0UA 1ERWA 1F9MA 1WMJA 1Z9HA 5LNKe 4MCUA 1PFOA 2FWHA 3HVXA 2IJYA 1TKDB 1U88A 4FH8A 2K8VA 2N5FA 5BRTA 3MDKA 4GRFA 5LD0A 2CX4A 1V40A 3S9FA 3UL3A 3CRTA 1GSEA 2VD1A 1PKWA 1AW9A
chains in the Genus database with same CATH topology
2C0EA 4I8BA 5A4WA 4Z7XA 3LORA 3IC4A 5F8BA 2H73A 3G7YA 2HYXA 4F0BA 3F3RA 3P90A 3QAVA 1RQMA 2XC2A 4BVXB 4BWQA 1B48A 1M99A 2CA8A 6GSUA 2JSYA 5JCUA 2LQOA 1X5DA 2GQLA 2H6ZA 1OC9A 1YEPA 4LL4B 1G6YA 4OFNA 3CTFA 2WZ9A 1SD8A 4OFMA 2L4CA 2CT6A 2VM2A 1HNBA 3BBYA 2O7KA 3PR8A 2C0FA 1GSDA 4ID0A 1JZRA 2JL4A 2HXKA 4L8EA 5J9BA 3GRXA 2DJ0A 2PERA 1OC3A 2J9HA 4ZL8A 4JE1A 3LXTA 3TUEA 6GSWA 4HJ2A 1WIKA 5ECQB 1SJIA 4XHMA 4TR3A 2B3SA 4ZILA 2H74A 1TRUA 3MNGA 1EGOA 4JBBA 4XIHA 4YH2A 2LQQA 5AISA 4KUNA 3VURA 5JCGA 5IO0A 3LJRA 5CRHA 1TXXA 3ZL5A 2KUCA 3ZMLA 4KAEA 1ZYEA 2LJKA 4AJ7A 4N0ZA 4L5LA 2DMLA 2E2GA 2K8SA 5G1KA 2DJ2A 2JZSA 4IN0A 4K7NA 1AXDA 1KBNA 5IMVA 1IYHA 4PURA 2YV9A 5G5EA 1GUMA 4E8HA 3ISOA 2FWEA 3DIEA 1AIUA 4IJIA 2FY6A 2PPTA 3DVXA 1SU9A 1AC1A 1ACVA 1EV9A 2I4AA 4J2FA 4O5RA 1K0BA 2QKEA 4ZB6A 4Z2RA 2C3QA 1XWBA 3QFBC 2HRKA 3LEFA 2NPBA 3NOFA 1LU4A 2J23A 4JRRA 2WCIA 3HJPA 2B5YA 4G19A 4BVYA 1YF1A 3GHAA 5J41A 1BAYA 4V2MA 3IDVA 2A2SA 3IA1A 4WBJA 1ZL9A 1URMA 1KTEA 4TR4A 3QMXA 5CRDA 1XOBA 1V58A 5D93A 1SYXA 12GSA 1PX7A 3R3EA 3ZMKA 2LRCA 1M2DA 3FW2A 1QMVA 2FNOA 2LUSA 3QOUA 3TKQA 2JU5A 1SL1B 2O8VB 1CQHA 1PD21 3F63A 3SBCA 4MF6A 4FYCA 3GX8A 1QGVA 3G7IA 3H1NA 1T8EB 3C7MA 4J57E 3VWUA 1K3YA 3HD5A 3PH9A 3EVIA 3EC3A 2WGRA 2GQMA 1A8YA 3D21A 4TXVA 2YANA 4TRXA 2RLIA 1XIYA 4PNFA 2AHEA 3G9BA 2WFCA 4WXTA 1WP0A 2B1KA 3L9UA 1YKCA 3HCZA 4NV5A 3UEMA 2H6XA 3RAZA 2YNXA 2R5GA 2IN3A 2YN1A 2X4AA 5ENUA 2BJXA 3F9UA 5J5NA 1A23A 2AB6A 2H01A 2WS2A 5ELAA 1G6WA 1GTUA 4EF0A 2VCWA 3RPPA 3IK9A 2YWMA 4F2IA 4ILFA 1VF2A 1VRSD 1YDKA 3QCPA 1GSUA 1GL8A 4ZXGA 1THOA 4I2UA 2GQKA 5EY6A 1OE8A 3GSTA 5H5SA 4G2EA 5EPFA 2PGTA 2AUVA 4DEJA 4AJ8A 1XBSA 4MZBA 3GKKA 4YAVA 4O5QA 4LMVA 2YV7A 1GUHA 4I97A 1J9BA 1FOHA 2VLTA 1OVNA 1QFNA 3M8NA 1XFLA 5FWGA 1GSSA 1VF1A 5DBQA 2H1BA 1FVJA 5G1LA 1LJRA 2VM1A 2FLSA 1Z7PA 5HFGA 2HRFA 3VPTA 4EDYA 4GQFA 5DQSA 1ML6A 1SL2B 3KTBA 4MH2A 3Q19A 4XRDA 5D96A 1FO5A 2KHPA 5B8BA 5JCWA 3MYDA 1PRXA 1T1VA 2YWIA 1O8WA 4TOPA 4LLRA 3G7JA 3TKPA 3GTUA 4K7IA 3KXOA 2C80A 4QL7A 2YOIA 2H8LA 3LWAA 2FA8A 5G2ZA 4Q5QA 2GT6A 1G7EA 3BD2A 1MDIA 1UC7A 4IQ1A 1FHEA 4MPGA 1ZYPA 4IGJA 2RUEA 5IOXA 2K18A 14GSA 2YJ7A 2H71A 3KP9A 2RUFA 1E6BA 2HZFA 3GH6A 3KGKA 1GSYA 2TRXA 4IHUA 4PX1A 1Z6NA 1Y25A 2H0HA 1O73A 4KSOA 3ERWA 1M2BA 2XPEA 2CX3A 2H72A 4MNNA 2H30A 1Z3EA 2F9SA 5D9TA 2I9HA 3EE2A 4HI7A 2YPMA 2GDRA 3GN3A 3ERFA 4JR4A 3CTGA 3CSIA 4L0WA 2VL3A 4OCEA 1JZOA 4X0XA 1M7TA 1J0FA 2LRTA 3I6AA 4YQVA 2IFQA 2BMXA 1KNGA 5E59A 3A5IA 1JLWA 4V1Ag 5DCHA 2GZPA 3H93A 4TR1B 5A4VA 5CRGA 2P31A 3FZ9A 5KOWA 2HE3A 5ID2B 4G10A 5DVBA 1RK4A 5IMCA 3F3QA 2FUG2 1OC8A 2F51A 1GWCA 4RQRA 1SJZA 3VK9A 20GSA 1EZKA 4GF0A 3IHGA 3F4TA 4NAXA 3VWVA 3GMFA 4HJMA 1TJDA 1EP8A 3KP8A 2PU9C 1UN2A 3GL5A 5IOWA 2FHEA 3H8QA 2XBQA 3I9V2 3FZAA 5DALB 3C73A 4WR5A 5F06A 4HOJA 2GS3A 4L0UA 3HDCA 5HQPA 1M9BA 4BL7B 2V32A 1FW1A 4YQMA 3ZIJA 4IS0A 3E0UA 5HFIA 4G0KA 3C71A 2DSAA 3WT1A 4DVCA 3J7Yk 2WULA 2H0GA 1BEDA 4GLTA 4XS4A 3IHQA 2VCQA 1TP9A 3TJKA 1T4ZA 1FVKA 3RHBA 4RQXA 2VL2C 1GTIA 4MZWA 3RHCA 1EEJA 3KCMA 4NMUA 4GSNA 3A2VA 4IW9A 4ML6A 1XXUA 3L0HA 1ZOFA 1ERVA 4BPYA 5F05A 4KGIA 3D4TA 1A0RP 2E0QA 3AY8A 1X9WB 1K0OA 1X0RA 2KP1A 2PVQA 1WRYA 3D0ZA 3OR5A 3GL3A 3UVTA 1SJ6A 1HQOA 3W8JA 2M46A 2EIOA 2IMEA 2I3YA 4XS6A 1MD3A 2DMMA 1X9MB 5G5FA 2L59A 3EINA 3UOMA 4ZBDA 2F8FA 2VO4A 2L6CA 5JWOB 3A2XA 1WWJA 4K8MA 2DIYA 3VWWA 4K5RA 3DGQA 6GSTA 1TRWA 4ECIA 1T7PB 5F07A 5ABRA 4MH3A 1SD9A 4X43A 4ZBBA 3FEUA 5JWRB 1T00A 3RPNA 3H79A 1JLVA 2CZ3A 1GNWA 1PKZA 4GCIA 1OC9B 4MK3A 1R26A 4PQIA 3EPTA 1GP1A 2AJQB 1VF4A 4ZL9A 2R3XA 2A2RA 1ZYNA 4D73A 4G0LA 1GNEA 4CW9A 4CDOA 3WT2A 4OFTA 3O6TA 3N9JA 3MWHA 4X4JA 3QPMA 4WEYA 3DVWA 3TKSC 4KCEA 7GSSA 4KA0A 1B4PA 2H19A 1V98A 4MABA 4ICYA 1OKTA 1GRXA 4JR6A 2HSHA 4MJCA 1QQ2A 2WDUA 1GUKA 2VCZA 3EWLA 3DEXA 3LQ7A 2AYTA 2TIRA 1FB6A 4O32A 3MSZA 4I6XA 2CVBA 1XVWA 3F4RA 4IELA 4FIWA 2DJ3A 5LCZA 2I81A 2R0CA 3LYPA 4F0CA 3F8UA 3W6GA 2CV4A 1O7UA 4L5OA 1GH2A 2I1UA 2H1AA 2XBIA 2MBSA 3EU3A 4MDCA 4N10A 2R6KA 3C1RA 2KP2A 3I69A 5GSSA 3BJ5A 1DE2A 2GVPA 4XS1A 2LS5A 3GFKA 1GSQA 1F37A 2KLXA 5C00A 4Z2UA 3MIXA 3I43A 1XWKA 2DLXA 2EC4A 3EYTA 5KEJA 3Q6OA 4RUVA 3APQA 3M1GA 4EL1A 4YQUA 1T4YA 2UZ8A 4H86A 3L9VA 4BVYB 1OAZA 2IIYA 4MJAA 4EIPA 1GTAA 3FZ4A 1Q4JA 1ZZYA 4Z2TA 2Z9SA 1TI1A 3KJYA 4POMA 2FWFA 3R2QA 1XCCA 4K5SA 5IO2A 5B6NA 3HVVA 3RDWA 2REMA 3CYNA 5KOXA 4BWSA 1I5GA 1PSQA 2VLVA 1Z6MA 4O7HA 2PUKC 3HXSA 2AV4A 4K0NA 3TKSE 2FCHA 2P5RA 5JWQB 2LNTA 4OMVA 5IMDA 3GKMA 1YZXA 4OO4A 1YJ6A 5GSTA 4E8EA 4ZBAA 2H70A 3QAWA 5CP1A 4DSSA 3TCOA 1KEBA 6GSVA 2CVKA 3ZZXA 1R7HA 5ECKB 2O87A 2VL2A 3N5OA 2G2QA 4NWYA 1FAAA 2ON5A 4N11A 5IMAA 2P0GA 3V1WA 3JCML 5B8AA 3ZTLA 1TTZA 4FYBA 3QR6A 2C0DA 5B7CA 1EEMA 4MJBA 2ES7A 4POKA 1XWCA 4CY8A 4GXZA 2JACA 4IKHA 4K1FA 3HKRA 2L57A 3IPZA 4GSTA 4K0GA 1XPVA 1PQNA 1QK8A 1JZDA 4TVEA 1DSBA 1MD4A 5CRWA 1K0CA 3H4KA 2OE3A 2PN8A 3F4SA 2D2ZA 1TU7A 3A3TA 1PL1A 2YZHA 5IMFA 1SKRB 1V9WA 3GNJA 2IMDA 3A2WA 4G0IA 2LNSA 3PPUA 3PGTA 2GT5A 3P8WA 10GSA 1XWGA 1V2AA 1TRVA 2PMTA 2VL9A 2F3MA 5GZZB 1Z5YE 1AQXA 4IJ3A 4KH7A 4EDZA 4TR0A 1HNCA 5HFKA 2HLSA 2FA4A 4POBA 1U3AA 3EMPA 5AIVA 3RBTA 2X99A 3U5RE 2IL3A 1XW9A 1JZWA 4IBPA 4A5PA 3D22A 4N30A 2PWJA 3APOA 1ZYQB 1FOVA 3BCKA 1SL0B 3US3A 1XW6A 3UIWA 3ERGA 1USBA 1B9XC 1YF0A 4NHZA 3P7XA 1XZOA 1PMTA 2PVOC 1O6JA 3GTUB 2H75A 4KF9A 3CBUA 4HZ4A 3C8EA 6GSYA 3L78A 1HNAA 3TKSA 3IXRA 3UAPA 4F82A 1TK8B 2MBTA 2CQ9A 4V2LA 2QSIA 3F6DA 3ZRDA 2O89A 5HR0A 4RI7A 3HJOA 4ML1A 1VF3A 4HDEA 5J4UA 3FR6A 3ZREA 2DIZA 3WYWA 4HZ2A 3TOTA 2F8AA 3VLNA 1U3IA 1T3BA 2C3TA 2V1MA 4K9ZA 2OBIA 2OA7A 3FK8A 6GSXA 4CY6A 4I5QA 3KZQA 1AUCA 2WJUA 2LRNA 1R5PA 3TJBA 1YKAA 1JFUA 2QGVA 17GSA 1SK0A 3KTLA 1SKSB 2LJAA 5IM9A 1ON4A 1H4OA 2JADA 1JHBA 2DBCA 2IFQB 5DJMA 5IIZA 1BX9A 2QA1A 3DYRA 4Q5NA 2GTUA 2YWOA 4PQ1A 4AGSA 2R2JA 3HYPA 1GSFA 4GQCA 5EL8A 1TK5B 2X64A 3ZFBA 4G9HA 4KSMA 4TN8A 2DJJA 5ECOB 4KE3A 2C1YA 2B5EA 2QA2A 1F3BA 1G7OA 1F2EA 4ECCA 4LMWA 2JZRA 2C3NA 2B5XA 4O5UA 1CQGA 3TKRA 1R4WA 2RM5A 4POLA 4GTUA 3FRCA 3EMXA 1E2YA 5DAKA 3O76A 1B8XA 2K9FA 1DUGA 4V2NA 4XRAA 3ME7A 4OWYA 3IOSA 3WGDA 1LBKA 2N5AA 4JEDA 4KDXA 4FYUA 2LJRA 5INYA 4K2DA 4KNDA 2LV3A 5IQYA 1A2MA 1ILOA 5H5QA 4PQHA 5FHIA 2VUPA 2N5BA 4XS4B 3GSSA 3J7Yb 5ECIB 3M0FA 3ZLPA 4JZQA 5CO3A 5DQYA 3U6VA 1ERTA 1ZGNA 3FYGA 3BCIA 4KX4A 4MP4A 1K0AA 4EUYA 1N8JA 5KN1A 1I9DA 2HRAA 3O3TA 1AQWA 2DC5A 5HR1A 2MMOA 1N2AA 2EIRA 2TRCP 1A8LA 2HZEA 3ZIVA 2IMIA 4MA9A 1ERUA 1MDKA 1QXHA 1AAZA 1EP7A 2L6DA 2FD3A 2OADA 1R5AA 2DJKA 3TRQA 5D73A 1NHOA 2GSQA 2MMAA 3VFIA 3KEBA 2BTOT 1PX6A 2V6OA 3TB2A 4PNGA 2DKHA 4MF7A 5DDLA 4Q5FA 3GX0A 2FGXA 3M9KA 3UBKA 2GZZA 2B6MA 1SKWB 4CHSA 4EVMA 2PBJA 1NHYA 5CNWA 2GZYA 1O81A 1W89A 2O85A 1YQ1A 3GA4A 4KW6A 4TXOA 5G30A 5CYYA 1V57A 3ZVJA 3CSHA 1UVZA 2MZCA 3F0IA 4EO3A 3VPQA 1TI3A 3NZNA 4HUAA 3HJMA 2WB9A 2IPAA 2E7PA 1GTBA 4I2TA 4D73B 2VAFA 5IPGA 3ZYWA 3DRNA 4NHWA 2CVDA 3HZ8A 1OE7A 4YKGA 4HQZA 3P2AA 1ZMAA 1EGRA 1NM3A 3FKFA 4OD7A 16GSA 1PA3A 2OACA 4PUFC 3E9JB 2OJLA 1A24A 1SENA 5CREA 3DKSA 3ZFLA 4BVXA 19GSA 3KMOA 3IC8A 5D9VA 1X5EA 2H1DA 4MZCA 18GSA 2ALBA 4QQ7A 2L5OA 2CAQA 2X8HA 1YEXA 4NV2A 1WE0A 5L71A 3LYKA 4V1Ap 1XW5A 4DSRA 1J08A 4HU9A 3PINA 2A4HA 4KB3A 2K6VA 4MPFA 1A2LA 4ZB8A 5B6MA 1K3OA 4MF5A 2HSYA 2HFDA 2AAWA 4ZL7A 1VGLA 1MEKA 1W4VA 3WGXA 1MTCA 1TK0B 3M3MA 1C72A 3TGZA 5DCGA 4QL9A 1FG4A 1H75A 5FT3A 3Q18A 4EXJA 2MYGA 5HR3A 1HD2A 4AF2A 3LG6A 2R4VA 5ECRB 2X49A 4NXIA 2ZCTA 4ZIJA 4J56E 3HA9A 3QAGA 4N0VA 3QFAC 3GV1A 5AIXA 3E3EA 2VOCA 5GAPD 2M80A 2A2PA 4WR4A 1PGTA 5E4WA 3VWXA 1BG5A 1THXA 4WBRD 3LFLA 1TW9A 2CZ2A 2R0PA 4X1UA 2HT9A 3TRXA 8GSSA 4ULXA 1EOHA 3APSA 2GLRA 4WF5A 5DJLA 1ZCPA 2LKUA 5ECSA 5D9WA 5G31A 3C1SA 3TDGA 1DBYA 3DD3A 4PXOA 1O8XA 3GKNA 1X9SB 2B7JA 2YCDA 1G0TA 5KN2A 1FB0A 4DSSB 3IRAA 4MJEA 1U87A 1XVQA 1BQ7A 2R0GA 4FO5A 4EC0A 2QC7A 1UA5A 3EURA 3MAKA 3LGCA 3NIVA 2E2MA 4AJ6A 22GSA 1WPIA 1OYJA 4O92A 1WOUA 3FR9A 3KD0A 2B1LA 4K6XA 3M9JA 1M2AA 1TDIA 2B7KA 2ZUPA 4EIQA 4OCFA 2KOKA 5IPHA 1GLPA 1HYUA 3FY7A 2C8UA 2DKIA 4XCSA 3QDNA 3K8NA 1YY7A 3KMNA 4OO5A 2HRNA 2HSMA 4KCAA 2HNLA 3LXZA 4ISDA 1ST9A 5CAXA 4XTSA 3UMAA 2NDOA 1K0NA 2G0FA 2H66A 1S3DA 1A2JA 4PUAA 4LL1B 4KDYA 3VI5A 3TJJA 4Q5RA 4MLYA 3ME8A 3IAS2 5COHA 2CAIA 3ED3A 3L9SA 2RM6A 2JSZA 5KN3A 3D4MA 2RIIA 4ACSA 3VI7A 1U6TA 4USSA 4YKFA 6GSSA 3CRUA 3L4NA 5KN0A 1DE1A 1WJKA 4K7OA 3ZITA 3EU4A 4IP1A 4GWRA 3D5JA 1X5CA 3KIJA 3LSZA 4YAPA 3KM6A 5D8IA 2ZNMA 2NTOA 3CMIA 5BMUA 3IBHA 4HU7A 2V2GA 2DJ1A 4WF4A 13GSA 4ECJA 5AGYA 2JZTA 1F6MC 3DWVA 4P3YB 5ECNB 3IK7A 4F03A 3UVHA 4IQAA 5GAND 2OKAA 4NPBA 5IMZA 3TOUA 2LSTA 2EIQA 2GSRA 4DSQA 1GLQA 4HEA2 2YWNA 3FZ5A 1TU8A 3W8SA 4MMMA 3DXBA 2WRTA 4KDUA 2GGTA 1Y6EA 3CXGA 2NVLA 1A0FA 1TOFA 2IMKA 5F0GA 4PTSA 2XHFA 2FWGA 2VCXA 2V41A 4TKYA 1EV4A 3GURA 3WGEA 1K0DA 5AN1A 2VCVA 4GSSA 2R37A 4IP6A 2HI7A 3TJGA 3KH9A 3TRPA 1SK1A 1BJXA 1MDJA 2X8GA 1F3AA 5J3RA 3TJFA 3GUSA 2C4JA 4TW5A 1S3AA 2L4QA 2IMFA 2VIMA 2VD0A 1BYEA 1PL2A 2MMNA 4FQUA 4WKWA 3DMLA 1SK2A 4PGTA 1NSWA 4K2XA 2H76A 5A4UA 3QD9A 5C04A 2X8CA 5DAKB 2VLUA 1Q98A 5ECLB 1K3LA 2YP6A 1K0MA 3BOAA 4LA1A 9GSSA 5A5KA 2L5LA 4EE0A 1NW2A 2C0GA 4JU5A 1PN0A 2VCTA 1EWXA 3IV4A 3GKXA 2OE1A 4BA7A 1IYIA 3UJ1A 2OE0A 2H0IA 1RW1A 2A4VA 5ELGA 1EOGA 2YZUA 2MMZA 1O85A 1Z7RA 3FHKA 2NBSA 4RI6A 4TR1A 1B9YC 3GH9A 4EKZA 4WETA 5ID2A 5EVOA 1XOAA 2H1GA 3HZ4A 3IR4A 3HVSA 3GIXA 1GULA 3HHVA 3FMWA 4ZB9A 3CSJA 2LTKA 3GYKA 3ZVJD 2HZEB 1S3CA 2IWTA 2YJHA 3D6IA 2H6YA 3IE3A 3WD6A 4HQSA 11GSA 3IAM2 1M9AA 2GSTA 3Q74A 2P5QA 5ECHB 1PN9A 1SYRA 2OBKA 3F6FA 3FR3A 2V6KA 1XWAA 3KH7A 2M72A 2XPDA 1QUWA 3A5WA 5DALA 3UARA 4ECBA 5J9CA 1B4QA 1AQVA 4IVFA 1TRSA 4BL7A 5ECMB 2LEGA 3HY2A 4F9ZA 3UBLA 3LW9A 1OKDA 4HS1A 1ABAA 5HR2A 5D9XA 4TXOB 5H5RA 2GSSA 5ECPB 2ON7A 3SWLA 1M0UA 1ERWA 1F9MA 1WMJA 1Z9HA 5LNKe 4MCUA 2FWHA 3HVXA 2IJYA 1TKDB 1U88A 4FH8A 2K8VA 2N5FA 5BRTA 3MDKA 4GRFA 5LD0A 2CX4A 1V40A 3S9FA 3UL3A 3CRTA 1GSEA 2VD1A 1PKWA 1AW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0E A;  4I8B A;  5A4W A;  4Z7X A;  3LOR A;  3IC4 A;  5F8B A;  2H73 A;  3G7Y A;  2HYX A;  4F0B A;  3F3R A;  3P90 A;  3QAV A;  1RQM A;  2XC2 A;  4BWQ A;  1B48 A;  1M99 A;  2CA8 A;  6GSU A;  2JSY A;  5JCU A;  2LQO A;  1X5D A;  2GQL A;  2H6Z A;  1OC9 A;  1YEP A;  4LL4 B;  1G6Y A;  4OFN A;  3CTF A;  2WZ9 A;  1SD8 A;  4OFM A;  2L4C A;  2CT6 A;  2VM2 A;  1HNB A;  3BBY A;  2O7K A;  3PR8 A;  2C0F A;  1GSD A;  4ID0 A;  1JZR A;  2JL4 A;  2HXK A;  4L8E A;  5J9B A;  3GRX A;  2DJ0 A;  2PER A;  1OC3 A;  2J9H A;  4ZL8 A;  4JE1 A;  3LXT A;  3TUE A;  6GSW A;  4HJ2 A;  1WIK A;  5ECQ B;  1SJI A;  4XHM A;  4TR3 A;  2B3S A;  4ZIL A;  2H74 A;  1TRU A;  3MNG A;  1EGO A;  4JBB A;  4XIH A;  4YH2 A;  2LQQ A;  5AIS A;  4KUN A;  3VUR A;  5JCG A;  5IO0 A;  3LJR A;  5CRH A;  1TXX A;  3ZL5 A;  2KUC A;  3ZML A;  4KAE A;  1ZYE A;  2LJK A;  4AJ7 A;  4N0Z A;  4L5L A;  2DML A;  2E2G A;  2K8S A;  5G1K A;  2DJ2 A;  2JZS A;  4IN0 A;  4K7N A;  1AXD A;  1KBN A;  5IMV A;  1IYH A;  4PUR A;  2YV9 A;  5G5E A;  1GUM A;  4E8H A;  3ISO A;  2FWE A;  3DIE A;  1AIU A;  4IJI A;  2FY6 A;  2PPT A;  3DVX A;  1SU9 A;  1AC1 A;  1ACV A;  1EV9 A;  2I4A A;  4J2F A;  4O5R A;  1K0B A;  2QKE A;  4ZB6 A;  2C3Q A;  1XWB A;  3QFB C;  3LEF A;  2NPB A;  3NOF A;  1LU4 A;  2J23 A;  4JRR A;  2WCI A;  3HJP A;  2B5Y A;  4G19 A;  4BVY A;  1YF1 A;  3GHA A;  5J41 A;  1BAY A;  4V2M A;  3IDV A;  2A2S A;  3IA1 A;  4WBJ A;  1ZL9 A;  1URM A;  1KTE A;  4TR4 A;  3QMX A;  5CRD A;  1XOB A;  1V58 A;  5D93 A;  1SYX A;  12GS A;  1PX7 A;  3ZMK A;  2LRC A;  1M2D A;  3FW2 A;  1QMV A;  2FNO A;  2LUS A;  3QOU A;  3TKQ A;  2JU5 A;  1SL1 B;  2O8V B;  1CQH A;  1PD2 1;  3F63 A;  3SBC A;  4MF6 A;  4FYC A;  3GX8 A;  1QGV A;  3G7I A;  3H1N A;  1T8E B;  3C7M A;  4J57 E;  3VWU A;  1K3Y A;  3HD5 A;  3PH9 A;  3EVI A;  3EC3 A;  2WGR A;  2GQM A;  1A8Y A;  3D21 A;  4TXV A;  2YAN A;  4TRX A;  2RLI A;  1XIY A;  4PNF A;  2AHE A;  3G9B A;  2WFC A;  4WXT A;  1WP0 A;  2B1K A;  3L9U A;  1YKC A;  3HCZ A;  4NV5 A;  3UEM A;  2H6X A;  3RAZ A;  2YNX A;  2R5G A;  2IN3 A;  2YN1 A;  5ENU A;  2BJX A;  3F9U A;  5J5N A;  1A23 A;  2AB6 A;  2H01 A;  2WS2 A;  5ELA A;  1G6W A;  1GTU A;  4EF0 A;  2VCW A;  3RPP A;  3IK9 A;  2YWM A;  4F2I A;  4ILF A;  1VF2 A;  1VRS D;  1YDK A;  3QCP A;  1GSU A;  1GL8 A;  4ZXG A;  1THO A;  4I2U A;  2GQK A;  5EY6 A;  1OE8 A;  3GST A;  5H5S A;  4G2E A;  5EPF A;  2PGT A;  2AUV A;  4DEJ A;  4AJ8 A;  1XBS A;  4MZB A;  3GKK A;  4YAV A;  4LMV A;  2YV7 A;  1GUH A;  4I97 A;  1J9B A;  2VLT A;  1OVN A;  1QFN A;  3M8N A;  1XFL A;  5FWG A;  1GSS A;  1VF1 A;  5DBQ A;  2H1B A;  1FVJ A;  5G1L A;  1LJR A;  2VM1 A;  2FLS A;  1Z7P A;  5HFG A;  2HRF A;  3VPT A;  4EDY A;  4GQF A;  5DQS A;  1ML6 A;  1SL2 B;  3KTB A;  4MH2 A;  3Q19 A;  4XRD A;  5D96 A;  1FO5 A;  2KHP A;  5B8B A;  5JCW A;  1PRX A;  1T1V A;  2YWI A;  1O8W A;  4TOP A;  4LLR A;  3G7J A;  3TKP A;  3GTU A;  4K7I A;  3KXO A;  2C80 A;  4QL7 A;  2YOI A;  2H8L A;  3LWA A;  2FA8 A;  5G2Z A;  4Q5Q A;  2GT6 A;  1G7E A;  3BD2 A;  1MDI A;  1UC7 A;  4IQ1 A;  1FHE A;  4MPG A;  4IGJ A;  2RUE A;  5IOX A;  2K18 A;  14GS A;  2YJ7 A;  2H71 A;  3KP9 A;  2RUF A;  1E6B A;  2HZF A;  3GH6 A;  3KGK A;  1GSY A;  2TRX A;  4IHU A;  4PX1 A;  1Z6N A;  1Y25 A;  2H0H A;  1O73 A;  4KSO A;  3ERW A;  1M2B A;  2XPE A;  2CX3 A;  2H72 A;  2H30 A;  1Z3E A;  2F9S A;  5D9T A;  2I9H A;  3EE2 A;  4HI7 A;  2YPM A;  2GDR A;  3GN3 A;  3ERF A;  4JR4 A;  3CTG A;  3CSI A;  4L0W A;  2VL3 A;  4OCE A;  1JZO A;  4X0X A;  1M7T A;  1J0F A;  2LRT A;  3I6A A;  4YQV A;  2IFQ A;  2BMX A;  1KNG A;  5E59 A;  1JLW A;  4V1A g;  5DCH A;  2GZP A;  3H93 A;  4TR1 B;  5A4V A;  5CRG A;  2P31 A;  3FZ9 A;  2HE3 A;  5ID2 B;  4G10 A;  5DVB A;  1RK4 A;  5IMC A;  3F3Q A;  2FUG 2;  1OC8 A;  2F51 A;  1GWC A;  4RQR A;  1SJZ A;  3VK9 A;  20GS A;  1EZK A;  4GF0 A;  3F4T A;  4NAX A;  3VWV A;  3GMF A;  4HJM A;  1TJD A;  1EP8 A;  3KP8 A;  2PU9 C;  1UN2 A;  3GL5 A;  5IOW A;  2FHE A;  3H8Q A;  2XBQ A;  3I9V 2;  3FZA A;  5DAL B;  3C73 A;  4WR5 A;  5F06 A;  4HOJ A;  2GS3 A;  4L0U A;  3HDC A;  5HQP A;  1M9B A;  2V32 A;  1FW1 A;  4YQM A;  3ZIJ A;  4IS0 A;  3E0U A;  5HFI A;  3C71 A;  2DSA A;  3WT1 A;  4DVC A;  3J7Y k;  2WUL A;  2H0G A;  1BED A;  4GLT A;  4XS4 A;  3IHQ A;  2VCQ A;  1TP9 A;  3TJK A;  1T4Z A;  1FVK A;  3RHB A;  4RQX A;  2VL2 C;  1GTI A;  4MZW A;  3RHC A;  1EEJ A;  3KCM A;  4NMU A;  4GSN A;  3A2V A;  4IW9 A;  4ML6 A;  1XXU A;  3L0H A;  1ZOF A;  1ERV A;  4BPY A;  5F05 A;  4KGI A;  3D4T A;  1A0R P;  2E0Q A;  3AY8 A;  1X9W B;  1K0O A;  1X0R A;  2KP1 A;  2PVQ A;  1WRY A;  3D0Z A;  3OR5 A;  3GL3 A;  3UVT A;  1SJ6 A;  1HQO A;  3W8J A;  2M46 A;  2EIO A;  2IME A;  2I3Y A;  4XS6 A;  1MD3 A;  2DMM A;  1X9M B;  5G5F A;  2L59 A;  3EIN A;  3UOM A;  4ZBD A;  2F8F A;  2VO4 A;  2L6C A;  5JWO B;  3A2X A;  1WWJ A;  4K8M A;  2DIY A;  3VWW A;  3DGQ A;  6GST A;  1TRW A;  4ECI A;  1T7P B;  5F07 A;  5ABR A;  4MH3 A;  1SD9 A;  4X43 A;  4ZBB A;  3FEU A;  5JWR B;  1T00 A;  3RPN A;  3H79 A;  1JLV A;  2CZ3 A;  1GNW A;  1PKZ A;  4GCI A;  1OC9 B;  4MK3 A;  1R26 A;  4PQI A;  1GP1 A;  2AJQ B;  1VF4 A;  4ZL9 A;  2R3X A;  2A2R A;  4D73 A;  1GNE A;  4CW9 A;  4CDO A;  3WT2 A;  4OFT A;  3O6T A;  3N9J A;  3MWH A;  3QPM A;  4WEY A;  3DVW A;  3TKS C;  4KCE A;  7GSS A;  4KA0 A;  1B4P A;  2H19 A;  1V98 A;  4MAB A;  1OKT A;  1GRX A;  4JR6 A;  2HSH A;  4MJC A;  1QQ2 A;  2WDU A;  1GUK A;  2VCZ A;  3EWL A;  3DEX A;  3LQ7 A;  2AYT A;  2TIR A;  1FB6 A;  4O32 A;  3MSZ A;  4I6X A;  2CVB A;  1XVW A;  3F4R A;  4IEL A;  4FIW A;  2DJ3 A;  5LCZ A;  2I81 A;  3LYP A;  4F0C A;  3F8U A;  3W6G A;  2CV4 A;  1O7U A;  4L5O A;  1GH2 A;  2I1U A;  2H1A A;  2XBI A;  2MBS A;  3EU3 A;  4MDC A;  4N10 A;  2R6K A;  3C1R A;  2KP2 A;  3I69 A;  5GSS A;  3BJ5 A;  1DE2 A;  2GVP A;  4XS1 A;  2LS5 A;  3GFK A;  1GSQ A;  1F37 A;  2KLX A;  5C00 A;  3I43 A;  1XWK A;  2DLX A;  2EC4 A;  3EYT A;  5KEJ A;  3Q6O A;  4RUV A;  3APQ A;  3M1G A;  4EL1 A;  4YQU A;  1T4Y A;  4H86 A;  3L9V A;  1OAZ A;  2IIY A;  4MJA A;  1GTA A;  3FZ4 A;  1Q4J A;  1ZZY A;  2Z9S A;  1TI1 A;  3KJY A;  4POM A;  2FWF A;  3R2Q A;  1XCC A;  5IO2 A;  5B6N A;  3HVV A;  3RDW A;  2REM A;  3CYN A;  4BWS A;  1I5G A;  1PSQ A;  2VLV A;  1Z6M A;  4O7H A;  2PUK C;  3HXS A;  2AV4 A;  4K0N A;  3TKS E;  2FCH A;  2P5R A;  5JWQ B;  2LNT A;  4OMV A;  5IMD A;  3GKM A;  1YZX A;  4OO4 A;  1YJ6 A;  5GST A;  4E8E A;  4ZBA A;  2H70 A;  3QAW A;  5CP1 A;  4DSS A;  3TCO A;  1KEB A;  6GSV A;  2CVK A;  3ZZX A;  1R7H A;  5ECK B;  2O87 A;  2VL2 A;  3N5O A;  2G2Q A;  4NWY A;  1FAA A;  2ON5 A;  4N11 A;  5IMA A;  2P0G A;  3V1W A;  3JCM L;  5B8A A;  3ZTL A;  1TTZ A;  4FYB A;  3QR6 A;  2C0D A;  5B7C A;  1EEM A;  4MJB A;  2ES7 A;  4POK A;  1XWC A;  4GXZ A;  2JAC A;  4IKH A;  4K1F A;  3HKR A;  2L57 A;  3IPZ A;  4GST A;  4K0G A;  1XPV A;  1PQN A;  1QK8 A;  1JZD A;  4TVE A;  1DSB A;  1MD4 A;  5CRW A;  1K0C A;  3H4K A;  2OE3 A;  2PN8 A;  3F4S A;  2D2Z A;  1TU7 A;  3A3T A;  1PL1 A;  2YZH A;  5IMF A;  1SKR B;  1V9W A;  3GNJ A;  2IMD A;  3A2W A;  2LNS A;  3PGT A;  2GT5 A;  3P8W A;  10GS A;  1XWG A;  1V2A A;  1TRV A;  2PMT A;  2VL9 A;  2F3M A;  5GZZ B;  1Z5Y E;  1AQX A;  4IJ3 A;  4KH7 A;  4EDZ A;  4TR0 A;  1HNC A;  5HFK A;  2HLS A;  2FA4 A;  4POB A;  1U3A A;  3EMP A;  5AIV A;  3RBT A;  2X99 A;  3U5R E;  2IL3 A;  1XW9 A;  1JZW A;  4IBP A;  3D22 A;  4N30 A;  2PWJ A;  3APO A;  1ZYQ B;  1FOV A;  3BCK A;  1SL0 B;  3US3 A;  1XW6 A;  3UIW A;  3ERG A;  1USB A;  1B9X C;  1YF0 A;  4NHZ A;  3P7X A;  1XZO A;  1PMT A;  2PVO C;  1O6J A;  3GTU B;  2H75 A;  3CBU A;  4HZ4 A;  3C8E A;  6GSY A;  3L78 A;  1HNA A;  3TKS A;  3IXR A;  3UAP A;  4F82 A;  1TK8 B;  2MBT A;  2CQ9 A;  4V2L A;  2QSI A;  3F6D A;  3ZRD A;  2O89 A;  5HR0 A;  4RI7 A;  3HJO A;  4ML1 A;  1VF3 A;  4HDE A;  5J4U A;  3FR6 A;  3ZRE A;  2DIZ A;  3WYW A;  4HZ2 A;  3TOT A;  2F8A A;  3VLN A;  1U3I A;  1T3B A;  2C3T A;  2V1M A;  4K9Z A;  2OBI A;  2OA7 A;  3FK8 A;  6GSX A;  4I5Q A;  3KZQ A;  1AUC A;  2WJU A;  2LRN A;  1R5P A;  3TJB A;  1YKA A;  1JFU A;  2QGV A;  17GS A;  1SK0 A;  3KTL A;  1SKS B;  2LJA A;  5IM9 A;  1ON4 A;  1H4O A;  2JAD A;  1JHB A;  2DBC A;  2IFQ B;  5DJM A;  5IIZ A;  1BX9 A;  3DYR A;  4Q5N A;  2GTU A;  2YWO A;  4PQ1 A;  4AGS A;  2R2J A;  3HYP A;  1GSF A;  4GQC A;  5EL8 A;  1TK5 B;  2X64 A;  3ZFB A;  4G9H A;  4KSM A;  4TN8 A;  2DJJ A;  5ECO B;  4KE3 A;  2C1Y A;  2B5E A;  1F3B A;  1G7O A;  1F2E A;  4ECC A;  4LMW A;  2JZR A;  2C3N A;  2B5X A;  1CQG A;  3TKR A;  1R4W A;  2RM5 A;  4POL A;  4GTU A;  3FRC A;  3EMX A;  1E2Y A;  5DAK A;  3O76 A;  1B8X A;  2K9F A;  1DUG A;  4V2N A;  4XRA A;  3ME7 A;  4OWY A;  3IOS A;  3WGD A;  1LBK A;  2N5A A;  4JED A;  4KDX A;  4FYU A;  2LJR A;  5INY A;  4K2D A;  4KND A;  2LV3 A;  5IQY A;  1A2M A;  1ILO A;  5H5Q A;  4PQH A;  5FHI A;  2VUP A;  2N5B A;  4XS4 B;  3GSS A;  3J7Y b;  5ECI B;  3M0F A;  3ZLP A;  4JZQ A;  5CO3 A;  5DQY A;  3U6V A;  1ERT A;  1ZGN A;  3FYG A;  3BCI A;  4KX4 A;  4MP4 A;  1K0A A;  4EUY A;  1N8J A;  5KN1 A;  1I9D A;  3O3T A;  1AQW A;  2DC5 A;  5HR1 A;  2MMO A;  1N2A A;  2EIR A;  2TRC P;  1A8L A;  2HZE A;  3ZIV A;  2IMI A;  4MA9 A;  1ERU A;  1MDK A;  1QXH A;  1AAZ A;  1EP7 A;  2L6D A;  2FD3 A;  2OAD A;  1R5A A;  2DJK A;  3TRQ A;  5D73 A;  1NHO A;  2GSQ A;  2MMA A;  3VFI A;  3KEB A;  2BTO T;  1PX6 A;  2V6O A;  3TB2 A;  4PNG A;  4MF7 A;  5DDL A;  4Q5F A;  3GX0 A;  2FGX A;  3M9K A;  3UBK A;  2GZZ A;  2B6M A;  1SKW B;  4CHS A;  4EVM A;  2PBJ A;  1NHY A;  5CNW A;  2GZY A;  1O81 A;  1W89 A;  2O85 A;  1YQ1 A;  3GA4 A;  4KW6 A;  4TXO A;  5G30 A;  5CYY A;  1V57 A;  3ZVJ A;  3CSH A;  1UVZ A;  2MZC A;  3F0I A;  4EO3 A;  3VPQ A;  1TI3 A;  3NZN A;  4HUA A;  3HJM A;  2WB9 A;  2IPA A;  2E7P A;  1GTB A;  4I2T A;  4D73 B;  2VAF A;  5IPG A;  3ZYW A;  3DRN A;  4NHW A;  2CVD A;  3HZ8 A;  1OE7 A;  4HQZ A;  3P2A A;  1ZMA A;  1EGR A;  1NM3 A;  3FKF A;  4OD7 A;  16GS A;  1PA3 A;  2OAC A;  4PUF C;  3E9J B;  2OJL A;  1A24 A;  1SEN A;  5CRE A;  3DKS A;  3ZFL A;  4BVX A;  19GS A;  3KMO A;  5D9V A;  1X5E A;  2H1D A;  4MZC A;  18GS A;  2ALB A;  4QQ7 A;  2L5O A;  2CAQ A;  2X8H A;  1YEX A;  4NV2 A;  1WE0 A;  5L71 A;  3LYK A;  4V1A p;  1XW5 A;  4DSR A;  1J08 A;  4HU9 A;  3PIN A;  4KB3 A;  2K6V A;  4MPF A;  1A2L A;  4ZB8 A;  5B6M A;  1K3O A;  4MF5 A;  2HSY A;  2HFD A;  2AAW A;  4ZL7 A;  1VGL A;  1MEK A;  1W4V A;  3WGX A;  1MTC A;  1TK0 B;  3M3M A;  1C72 A;  3TGZ A;  5DCG A;  4QL9 A;  1FG4 A;  1H75 A;  5FT3 A;  3Q18 A;  4EXJ A;  2MYG A;  5HR3 A;  1HD2 A;  4AF2 A;  3LG6 A;  2R4V A;  5ECR B;  4NXI A;  2ZCT A;  4ZIJ A;  4J56 E;  3HA9 A;  3QAG A;  4N0V A;  3QFA C;  3GV1 A;  5AIX A;  3E3E A;  2VOC A;  5GAP D;  2M80 A;  4WR4 A;  5E4W A;  1PGT A;  3VWX A;  1BG5 A;  1THX A;  4WBR D;  3LFL A;  1TW9 A;  2CZ2 A;  4X1U A;  2HT9 A;  3TRX A;  8GSS A;  4ULX A;  1EOH A;  3APS A;  2GLR A;  4WF5 A;  5DJL A;  1ZCP A;  2LKU A;  5ECS A;  5D9W A;  5G31 A;  3C1S A;  3TDG A;  1DBY A;  3DD3 A;  4PXO A;  1O8X A;  3GKN A;  1X9S B;  2B7J A;  2YCD A;  1G0T A;  5KN2 A;  1FB0 A;  4DSS B;  3IRA A;  4MJE A;  1U87 A;  1XVQ A;  1BQ7 A;  4FO5 A;  4EC0 A;  2QC7 A;  1UA5 A;  3EUR A;  3MAK A;  3LGC A;  3NIV A;  2E2M A;  4AJ6 A;  22GS A;  1WPI A;  1OYJ A;  4O92 A;  1WOU A;  3FR9 A;  3KD0 A;  2B1L A;  4K6X A;  3M9J A;  1M2A A;  1TDI A;  2B7K A;  2ZUP A;  4OCF A;  2KOK A;  5IPH A;  1GLP A;  1HYU A;  3FY7 A;  2C8U A;  4XCS A;  3QDN A;  3K8N A;  1YY7 A;  3KMN A;  4OO5 A;  2HRN A;  4KCA A;  2HNL A;  3LXZ A;  4ISD A;  1ST9 A;  5CAX A;  4XTS A;  3UMA A;  2NDO A;  1K0N A;  2G0F A;  2H66 A;  1S3D A;  1A2J A;  4PUA A;  4LL1 B;  4KDY A;  3VI5 A;  3TJJ A;  4Q5R A;  4MLY A;  3ME8 A;  3IAS 2;  5COH A;  2CAI A;  3ED3 A;  3L9S A;  2RM6 A;  2JSZ A;  5KN3 A;  3D4M A;  2RII A;  4ACS A;  3VI7 A;  1U6T A;  6GSS A;  3CRU A;  3L4N A;  5KN0 A;  1DE1 A;  1WJK A;  4K7O A;  3ZIT A;  3EU4 A;  4IP1 A;  4GWR A;  3D5J A;  1X5C A;  3KIJ A;  3LSZ A;  4YAP A;  3KM6 A;  5D8I A;  2ZNM A;  2NTO A;  3CMI A;  3IBH A;  4HU7 A;  2V2G A;  2DJ1 A;  4WF4 A;  13GS A;  4ECJ A;  5AGY A;  2JZT A;  1F6M C;  3DWV A;  4P3Y B;  5ECN B;  3IK7 A;  4F03 A;  3UVH A;  4IQA A;  5GAN D;  2OKA A;  4NPB A;  5IMZ A;  3TOU A;  2LST A;  2EIQ A;  2GSR A;  4DSQ A;  1GLQ A;  4HEA 2;  2YWN A;  3FZ5 A;  1TU8 A;  3W8S A;  4MMM A;  3DXB A;  2WRT A;  4KDU A;  2GGT A;  1Y6E A;  3CXG A;  2NVL A;  1A0F A;  1TOF A;  2IMK A;  5F0G A;  2XHF A;  2FWG A;  2VCX A;  2V41 A;  4TKY A;  1EV4 A;  3GUR A;  3WGE A;  1K0D A;  5AN1 A;  2VCV A;  4GSS A;  2R37 A;  4IP6 A;  2HI7 A;  3TJG A;  3KH9 A;  3TRP A;  1SK1 A;  1BJX A;  1MDJ A;  2X8G A;  1F3A A;  5J3R A;  3TJF A;  3GUS A;  2C4J A;  4TW5 A;  1S3A A;  2L4Q A;  2IMF A;  2VIM A;  2VD0 A;  1BYE A;  1PL2 A;  2MMN A;  4WKW A;  3DML A;  1SK2 A;  4PGT A;  1NSW A;  2H76 A;  5A4U A;  3QD9 A;  5C04 A;  2X8C A;  5DAK B;  2VLU A;  1Q98 A;  5ECL B;  1K3L A;  2YP6 A;  1K0M A;  3BOA A;  4LA1 A;  9GSS A;  5A5K A;  2L5L A;  4EE0 A;  1NW2 A;  2C0G A;  4JU5 A;  2VCT A;  1EWX A;  3IV4 A;  3GKX A;  2OE1 A;  4BA7 A;  1IYI A;  3UJ1 A;  2OE0 A;  2H0I A;  1RW1 A;  2A4V A;  5ELG A;  1EOG A;  2YZU A;  2MMZ A;  1O85 A;  1Z7R A;  3FHK A;  2NBS A;  4RI6 A;  4TR1 A;  1B9Y C;  3GH9 A;  4EKZ A;  4WET A;  5ID2 A;  5EVO A;  1XOA A;  2H1G A;  3HZ4 A;  3IR4 A;  3HVS A;  3GIX A;  1GUL A;  3HHV A;  4ZB9 A;  3CSJ A;  2LTK A;  3GYK A;  3ZVJ D;  2HZE B;  1S3C A;  2IWT A;  2YJH A;  3D6I A;  2H6Y A;  3IE3 A;  3WD6 A;  4HQS A;  11GS A;  3IAM 2;  1M9A A;  2GST A;  3Q74 A;  2P5Q A;  5ECH B;  1PN9 A;  1SYR A;  2OBK A;  3F6F A;  3FR3 A;  2V6K A;  1XWA A;  3KH7 A;  2M72 A;  2XPD A;  1QUW A;  3A5W A;  5DAL A;  3UAR A;  4ECB A;  5J9C A;  1B4Q A;  1AQV A;  4IVF A;  1TRS A;  4BL7 A;  5ECM B;  2LEG A;  3HY2 A;  4F9Z A;  3UBL A;  1OKD A;  4HS1 A;  1ABA A;  5HR2 A;  5D9X A;  4TXO B;  5H5R A;  2GSS A;  5ECP B;  2ON7 A;  3SWL A;  1M0U A;  1ERW A;  1F9M A;  1WMJ A;  1Z9H A;  5LNK e;  4MCU A;  2FWH A;  3HVX A;  2IJY A;  1TKD B;  1U88 A;  4FH8 A;  2K8V A;  2N5F A;  3MDK A;  4GRF A;  5LD0 A;  2CX4 A;  1V40 A;  3S9F A;  3UL3 A;  3CRT A;  1GSE A;  2VD1 A;  1PKW A;  1AW9 A; 
#chains in the Genus database with same CATH topology
 2C0E A;  4I8B A;  5A4W A;  4Z7X A;  3LOR A;  3IC4 A;  5F8B A;  2H73 A;  3G7Y A;  2HYX A;  4F0B A;  3F3R A;  3P90 A;  3QAV A;  1RQM A;  2XC2 A;  4BVX B;  4BWQ A;  1B48 A;  1M99 A;  2CA8 A;  1S3R A;  6GSU A;  2JSY A;  5JCU A;  2LQO A;  1X5D A;  2GQL A;  2H6Z A;  1OC9 A;  1YEP A;  4LL4 B;  1G6Y A;  4OFN A;  3CTF A;  2WZ9 A;  1SD8 A;  4OFM A;  2L4C A;  2CT6 A;  4HSC X;  2VM2 A;  1HNB A;  3BBY A;  2O7K A;  3PR8 A;  2C0F A;  1GSD A;  4ID0 A;  1JZR A;  2JL4 A;  2HXK A;  4L8E A;  5J9B A;  3GRX A;  2DJ0 A;  2PER A;  1OC3 A;  2J9H A;  4ZL8 A;  4JE1 A;  3LXT A;  3TUE A;  6GSW A;  4HJ2 A;  1WIK A;  5ECQ B;  1SJI A;  4XHM A;  4TR3 A;  2B3S A;  4ZIL A;  2H74 A;  1TRU A;  3MNG A;  1EGO A;  4JBB A;  4XIH A;  4YH2 A;  2LQQ A;  5AIS A;  4KUN A;  3VUR A;  5JCG A;  5IO0 A;  3LJR A;  5CRH A;  1TXX A;  3ZL5 A;  2KUC A;  3ZML A;  4KAE A;  1ZYE A;  2LJK A;  4AJ7 A;  4N0Z A;  4L5L A;  2DML A;  2E2G A;  2K8S A;  5G1K A;  2DJ2 A;  2JZS A;  4IN0 A;  4K7N A;  1AXD A;  1KBN A;  5IMV A;  1IYH A;  4PUR A;  2YV9 A;  5G5E A;  1GUM A;  4E8H A;  3ISO A;  2FWE A;  3DIE A;  1AIU A;  4IJI A;  2FY6 A;  2PPT A;  3DVX A;  1SU9 A;  1AC1 A;  1ACV A;  1EV9 A;  2I4A A;  4J2F A;  4O5R A;  1K0B A;  2QKE A;  4ZB6 A;  3HVN A;  4Z2R A;  2C3Q A;  1XWB A;  3QFB C;  2HRK A;  3LEF A;  2NPB A;  3NOF A;  1LU4 A;  2J23 A;  4JRR A;  2WCI A;  3HJP A;  2B5Y A;  4G19 A;  4BVY A;  1YF1 A;  3GHA A;  5J41 A;  1BAY A;  4V2M A;  3IDV A;  2A2S A;  3IA1 A;  4WBJ A;  1ZL9 A;  1URM A;  1KTE A;  4TR4 A;  3QMX A;  5CRD A;  1XOB A;  1V58 A;  5D93 A;  1SYX A;  12GS A;  1PX7 A;  3R3E A;  3ZMK A;  2LRC A;  1M2D A;  3FW2 A;  1QMV A;  2FNO A;  2LUS A;  3QOU A;  3TKQ A;  2JU5 A;  1SL1 B;  2O8V B;  1CQH A;  1PD2 1;  3F63 A;  3SBC A;  4MF6 A;  4FYC A;  3GX8 A;  1QGV A;  3G7I A;  3H1N A;  1T8E B;  3C7M A;  4J57 E;  3VWU A;  1K3Y A;  3HD5 A;  3PH9 A;  3EVI A;  3EC3 A;  2WGR A;  2GQM A;  1A8Y A;  3D21 A;  4TXV A;  2YAN A;  4TRX A;  2RLI A;  1XIY A;  4PNF A;  2AHE A;  1XG8 A;  3G9B A;  2WFC A;  4WXT A;  1WP0 A;  2B1K A;  3L9U A;  1YKC A;  3HCZ A;  4NV5 A;  3UEM A;  2H6X A;  3RAZ A;  2YNX A;  2R5G A;  2IN3 A;  2YN1 A;  2X4A A;  5ENU A;  2BJX A;  3F9U A;  5J5N A;  1A23 A;  2AB6 A;  2H01 A;  2WS2 A;  5ELA A;  1G6W A;  1GTU A;  4EF0 A;  2VCW A;  3RPP A;  3IK9 A;  2YWM A;  4F2I A;  4ILF A;  1VF2 A;  1VRS D;  1YDK A;  3QCP A;  1GSU A;  1GL8 A;  4ZXG A;  1THO A;  4I2U A;  2GQK A;  5EY6 A;  1OE8 A;  3GST A;  5H5S A;  4G2E A;  5EPF A;  2PGT A;  2AUV A;  4DEJ A;  4AJ8 A;  1XBS A;  4MZB A;  3GKK A;  4YAV A;  4O5Q A;  4LMV A;  2YV7 A;  1GUH A;  4I97 A;  1J9B A;  1FOH A;  2VLT A;  1OVN A;  1QFN A;  3M8N A;  1XFL A;  5FWG A;  1GSS A;  1VF1 A;  5DBQ A;  2H1B A;  1FVJ A;  5G1L A;  1LJR A;  2VM1 A;  2FLS A;  1Z7P A;  5HFG A;  2HRF A;  3VPT A;  4EDY A;  4GQF A;  5DQS A;  1ML6 A;  1SL2 B;  3KTB A;  4MH2 A;  3Q19 A;  4XRD A;  5D96 A;  1FO5 A;  2KHP A;  5B8B A;  5JCW A;  3MYD A;  1PRX A;  1T1V A;  2YWI A;  1O8W A;  4TOP A;  4LLR A;  3G7J A;  3TKP A;  3GTU A;  4K7I A;  3KXO A;  2C80 A;  4QL7 A;  2YOI A;  2H8L A;  3LWA A;  2FA8 A;  5G2Z A;  4Q5Q A;  2GT6 A;  1G7E A;  3BD2 A;  1MDI A;  1UC7 A;  4IQ1 A;  1FHE A;  4MPG A;  1ZYP A;  4IGJ A;  2RUE A;  5IOX A;  2K18 A;  14GS A;  2YJ7 A;  2H71 A;  3KP9 A;  2RUF A;  1E6B A;  2HZF A;  3GH6 A;  3KGK A;  1GSY A;  2TRX A;  4IHU A;  4PX1 A;  1Z6N A;  1Y25 A;  2H0H A;  1O73 A;  4KSO A;  3ERW A;  1M2B A;  2XPE A;  2CX3 A;  2H72 A;  4MNN A;  2H30 A;  1Z3E A;  2F9S A;  5D9T A;  2I9H A;  3EE2 A;  4HI7 A;  2YPM A;  2GDR A;  3GN3 A;  3ERF A;  4JR4 A;  3CTG A;  3CSI A;  4L0W A;  2VL3 A;  4OCE A;  1JZO A;  4X0X A;  1M7T A;  1J0F A;  2LRT A;  3I6A A;  4YQV A;  2IFQ A;  2BMX A;  1KNG A;  5E59 A;  3A5I A;  1JLW A;  4V1A g;  5DCH A;  2GZP A;  3H93 A;  4TR1 B;  5A4V A;  5CRG A;  2P31 A;  3FZ9 A;  5KOW A;  2HE3 A;  5ID2 B;  4G10 A;  5DVB A;  1RK4 A;  5IMC A;  3F3Q A;  2FUG 2;  1OC8 A;  2F51 A;  1GWC A;  4RQR A;  1SJZ A;  3VK9 A;  20GS A;  1EZK A;  4GF0 A;  3IHG A;  3F4T A;  4NAX A;  3VWV A;  3GMF A;  4HJM A;  1TJD A;  1EP8 A;  3KP8 A;  2PU9 C;  1UN2 A;  3GL5 A;  5IOW A;  2FHE A;  3H8Q A;  2XBQ A;  3I9V 2;  3FZA A;  5DAL B;  3C73 A;  4WR5 A;  5F06 A;  4HOJ A;  2GS3 A;  4L0U A;  3HDC A;  5HQP A;  1M9B A;  4BL7 B;  2V32 A;  1FW1 A;  4YQM A;  3ZIJ A;  4IS0 A;  3E0U A;  5HFI A;  4G0K A;  3C71 A;  2DSA A;  3WT1 A;  4DVC A;  3J7Y k;  2WUL A;  2H0G A;  1BED A;  4GLT A;  4XS4 A;  3IHQ A;  2VCQ A;  1TP9 A;  3TJK A;  1T4Z A;  1FVK A;  3RHB A;  4RQX A;  2VL2 C;  1GTI A;  4MZW A;  3RHC A;  1EEJ A;  3KCM A;  4NMU A;  4GSN A;  3A2V A;  4IW9 A;  4ML6 A;  1XXU A;  3L0H A;  1ZOF A;  1ERV A;  4BPY A;  5F05 A;  4KGI A;  3D4T A;  1A0R P;  2E0Q A;  3AY8 A;  1X9W B;  1K0O A;  1X0R A;  2KP1 A;  2PVQ A;  1WRY A;  3D0Z A;  3OR5 A;  3GL3 A;  3UVT A;  1SJ6 A;  1HQO A;  3W8J A;  2M46 A;  2EIO A;  2IME A;  2I3Y A;  4XS6 A;  1MD3 A;  2DMM A;  1X9M B;  5G5F A;  2L59 A;  3EIN A;  3UOM A;  4ZBD A;  2F8F A;  2VO4 A;  2L6C A;  5JWO B;  3A2X A;  1WWJ A;  4K8M A;  2DIY A;  3VWW A;  4K5R A;  3DGQ A;  6GST A;  1TRW A;  4ECI A;  1T7P B;  5F07 A;  5ABR A;  4MH3 A;  1SD9 A;  4X43 A;  4ZBB A;  3FEU A;  5JWR B;  1T00 A;  3RPN A;  3H79 A;  1JLV A;  2CZ3 A;  1GNW A;  1PKZ A;  4GCI A;  1OC9 B;  4MK3 A;  1R26 A;  4PQI A;  3EPT A;  1GP1 A;  2AJQ B;  1VF4 A;  4ZL9 A;  2R3X A;  2A2R A;  1ZYN A;  4D73 A;  4G0L A;  1GNE A;  4CW9 A;  4CDO A;  3WT2 A;  4OFT A;  3O6T A;  3N9J A;  3MWH A;  4X4J A;  3QPM A;  4WEY A;  3DVW A;  3TKS C;  4KCE A;  7GSS A;  4KA0 A;  1B4P A;  2H19 A;  1V98 A;  4MAB A;  4ICY A;  1OKT A;  1GRX A;  4JR6 A;  2HSH A;  4MJC A;  1QQ2 A;  2WDU A;  1GUK A;  2VCZ A;  3EWL A;  3DEX A;  3LQ7 A;  2AYT A;  2TIR A;  1FB6 A;  4O32 A;  3MSZ A;  4I6X A;  2CVB A;  1XVW A;  3F4R A;  4IEL A;  4FIW A;  2DJ3 A;  5LCZ A;  2I81 A;  2R0C A;  3LYP A;  4F0C A;  3F8U A;  3W6G A;  2CV4 A;  1O7U A;  4L5O A;  1GH2 A;  2I1U A;  2H1A A;  2XBI A;  2MBS A;  3EU3 A;  4MDC A;  4N10 A;  2R6K A;  3C1R A;  2KP2 A;  3I69 A;  5GSS A;  3BJ5 A;  1DE2 A;  2GVP A;  4XS1 A;  2LS5 A;  3GFK A;  1GSQ A;  1F37 A;  2KLX A;  5C00 A;  4Z2U A;  3MIX A;  3I43 A;  1XWK A;  2DLX A;  2EC4 A;  3EYT A;  5KEJ A;  3Q6O A;  4RUV A;  3APQ A;  3M1G A;  4EL1 A;  4YQU A;  1T4Y A;  2UZ8 A;  4H86 A;  3L9V A;  4BVY B;  1OAZ A;  2IIY A;  4MJA A;  4EIP A;  1GTA A;  3FZ4 A;  1Q4J A;  1ZZY A;  4Z2T A;  2Z9S A;  1TI1 A;  3KJY A;  4POM A;  2FWF A;  3R2Q A;  1XCC A;  4K5S A;  5IO2 A;  5B6N A;  3HVV A;  3RDW A;  2REM A;  3CYN A;  5KOX A;  4BWS A;  1I5G A;  1PSQ A;  2VLV A;  1Z6M A;  4O7H A;  2PUK C;  3HXS A;  2AV4 A;  4K0N A;  3TKS E;  2FCH A;  2P5R A;  5JWQ B;  2LNT A;  4OMV A;  5IMD A;  3GKM A;  1YZX A;  4OO4 A;  1YJ6 A;  5GST A;  4E8E A;  4ZBA A;  2H70 A;  3QAW A;  5CP1 A;  4DSS A;  3TCO A;  1KEB A;  6GSV A;  2CVK A;  3ZZX A;  1R7H A;  5ECK B;  2O87 A;  2VL2 A;  3N5O A;  2G2Q A;  4NWY A;  1FAA A;  2ON5 A;  4N11 A;  5IMA A;  2P0G A;  3V1W A;  3JCM L;  5B8A A;  3ZTL A;  1TTZ A;  4FYB A;  3QR6 A;  2C0D A;  5B7C A;  1EEM A;  4MJB A;  2ES7 A;  4POK A;  1XWC A;  4CY8 A;  4GXZ A;  2JAC A;  4IKH A;  4K1F A;  3HKR A;  2L57 A;  3IPZ A;  4GST A;  4K0G A;  1XPV A;  1PQN A;  1QK8 A;  1JZD A;  4TVE A;  1DSB A;  1MD4 A;  5CRW A;  1K0C A;  3H4K A;  2OE3 A;  2PN8 A;  3F4S A;  2D2Z A;  1TU7 A;  3A3T A;  1PL1 A;  2YZH A;  5IMF A;  1SKR B;  1V9W A;  3GNJ A;  2IMD A;  3A2W A;  4G0I A;  2LNS A;  3PPU A;  3PGT A;  2GT5 A;  3P8W A;  10GS A;  1XWG A;  1V2A A;  1TRV A;  2PMT A;  2VL9 A;  2F3M A;  5GZZ B;  1Z5Y E;  1AQX A;  4IJ3 A;  4KH7 A;  4EDZ A;  4TR0 A;  1HNC A;  5HFK A;  2HLS A;  2FA4 A;  4POB A;  1U3A A;  3EMP A;  5AIV A;  3RBT A;  2X99 A;  3U5R E;  2IL3 A;  1XW9 A;  1JZW A;  4IBP A;  4A5P A;  3D22 A;  4N30 A;  2PWJ A;  3APO A;  1ZYQ B;  1FOV A;  3BCK A;  1SL0 B;  3US3 A;  1XW6 A;  3UIW A;  3ERG A;  1USB A;  1B9X C;  1YF0 A;  4NHZ A;  3P7X A;  1XZO A;  1PMT A;  2PVO C;  1O6J A;  3GTU B;  2H75 A;  4KF9 A;  3CBU A;  4HZ4 A;  3C8E A;  6GSY A;  3L78 A;  1HNA A;  3TKS A;  1M3J A;  3IXR A;  3UAP A;  4F82 A;  1TK8 B;  2MBT A;  2CQ9 A;  4V2L A;  2QSI A;  3F6D A;  3ZRD A;  2O89 A;  5HR0 A;  4RI7 A;  3HJO A;  4ML1 A;  1VF3 A;  4HDE A;  5J4U A;  3FR6 A;  3ZRE A;  2DIZ A;  3WYW A;  4HZ2 A;  3TOT A;  2F8A A;  3VLN A;  1U3I A;  1T3B A;  2C3T A;  2V1M A;  4K9Z A;  2OBI A;  2OA7 A;  3FK8 A;  6GSX A;  4CY6 A;  4I5Q A;  3KZQ A;  1AUC A;  1M3I A;  2WJU A;  2LRN A;  1R5P A;  3TJB A;  1YKA A;  1JFU A;  2QGV A;  17GS A;  1SK0 A;  3KTL A;  1SKS B;  2LJA A;  5IM9 A;  1ON4 A;  1H4O A;  2JAD A;  1JHB A;  2DBC A;  2IFQ B;  5DJM A;  5IIZ A;  1BX9 A;  2QA1 A;  3DYR A;  4Q5N A;  2GTU A;  2YWO A;  4PQ1 A;  4AGS A;  2R2J A;  3HYP A;  1GSF A;  4GQC A;  5EL8 A;  1TK5 B;  2X64 A;  3ZFB A;  4G9H A;  4KSM A;  4TN8 A;  2DJJ A;  5ECO B;  4KE3 A;  2C1Y A;  2B5E A;  2QA2 A;  1F3B A;  1G7O A;  1F2E A;  4ECC A;  4LMW A;  2JZR A;  2C3N A;  2B5X A;  4O5U A;  1CQG A;  3TKR A;  1R4W A;  2RM5 A;  4POL A;  4GTU A;  3FRC A;  3EMX A;  1E2Y A;  5DAK A;  3O76 A;  1B8X A;  2K9F A;  1DUG A;  4V2N A;  4XRA A;  3ME7 A;  4OWY A;  3IOS A;  3WGD A;  1LBK A;  2N5A A;  4JED A;  4KDX A;  4FYU A;  2LJR A;  5INY A;  4K2D A;  4KND A;  2LV3 A;  5IQY A;  1A2M A;  1ILO A;  5H5Q A;  4PQH A;  5FHI A;  2VUP A;  2N5B A;  4XS4 B;  3GSS A;  3J7Y b;  5ECI B;  3M0F A;  3ZLP A;  4JZQ A;  5CO3 A;  5DQY A;  3U6V A;  1ERT A;  1ZGN A;  3FYG A;  3BCI A;  4KX4 A;  4MP4 A;  1K0A A;  4EUY A;  1N8J A;  5KN1 A;  1I9D A;  2HRA A;  3O3T A;  1AQW A;  2DC5 A;  5HR1 A;  2MMO A;  1N2A A;  2EIR A;  2TRC P;  1A8L A;  2HZE A;  3ZIV A;  2IMI A;  4MA9 A;  1ERU A;  1MDK A;  1QXH A;  1AAZ A;  1EP7 A;  2L6D A;  2FD3 A;  2OAD A;  1R5A A;  2DJK A;  3TRQ A;  5D73 A;  1NHO A;  2GSQ A;  2MMA A;  3VFI A;  3KEB A;  2BTO T;  1PX6 A;  2V6O A;  3TB2 A;  4PNG A;  2DKH A;  4MF7 A;  5DDL A;  4Q5F A;  3GX0 A;  2FGX A;  3M9K A;  3UBK A;  2GZZ A;  2B6M A;  1SKW B;  4CHS A;  4EVM A;  2PBJ A;  1NHY A;  5CNW A;  2GZY A;  1O81 A;  1W89 A;  2O85 A;  1YQ1 A;  3GA4 A;  4KW6 A;  4TXO A;  5G30 A;  5CYY A;  1V57 A;  3ZVJ A;  3CSH A;  1UVZ A;  2MZC A;  3F0I A;  4EO3 A;  3VPQ A;  1TI3 A;  3NZN A;  4HUA A;  3HJM A;  2WB9 A;  2IPA A;  2E7P A;  1GTB A;  4I2T A;  4D73 B;  2VAF A;  5IPG A;  3ZYW A;  3DRN A;  4NHW A;  2CVD A;  3HZ8 A;  1OE7 A;  4YKG A;  4HQZ A;  3P2A A;  1ZMA A;  1EGR A;  1NM3 A;  3FKF A;  4OD7 A;  16GS A;  1PA3 A;  2OAC A;  4PUF C;  3E9J B;  2OJL A;  1A24 A;  1SEN A;  5CRE A;  3DKS A;  3ZFL A;  4BVX A;  19GS A;  3KMO A;  3IC8 A;  5D9V A;  1X5E A;  2H1D A;  4MZC A;  18GS A;  2ALB A;  4QQ7 A;  2L5O A;  2CAQ A;  2X8H A;  1YEX A;  4NV2 A;  1WE0 A;  5L71 A;  3LYK A;  4V1A p;  1XW5 A;  4DSR A;  1J08 A;  4HU9 A;  3PIN A;  2A4H A;  4KB3 A;  2K6V A;  4MPF A;  1A2L A;  4ZB8 A;  5B6M A;  1K3O A;  4MF5 A;  2HSY A;  2HFD A;  2AAW A;  4ZL7 A;  1VGL A;  1MEK A;  1W4V A;  3WGX A;  1MTC A;  1TK0 B;  3M3M A;  1C72 A;  3TGZ A;  5DCG A;  4QL9 A;  1FG4 A;  1H75 A;  5FT3 A;  3Q18 A;  4EXJ A;  2MYG A;  5HR3 A;  1HD2 A;  4AF2 A;  3LG6 A;  2R4V A;  5ECR B;  2X49 A;  4NXI A;  2ZCT A;  4ZIJ A;  4J56 E;  3HA9 A;  3QAG A;  4N0V A;  3QFA C;  3GV1 A;  5AIX A;  3E3E A;  2VOC A;  5GAP D;  2M80 A;  2A2P A;  4WR4 A;  1PGT A;  5E4W A;  3VWX A;  1BG5 A;  1THX A;  4WBR D;  3LFL A;  1TW9 A;  2CZ2 A;  2R0P A;  4X1U A;  2HT9 A;  3TRX A;  8GSS A;  4ULX A;  1EOH A;  3APS A;  2GLR A;  4WF5 A;  3CQF A;  5DJL A;  1ZCP A;  2LKU A;  5ECS A;  5D9W A;  5G31 A;  3C1S A;  3TDG A;  1DBY A;  3DD3 A;  4PXO A;  1O8X A;  3GKN A;  1X9S B;  2B7J A;  2YCD A;  1G0T A;  5KN2 A;  1FB0 A;  4DSS B;  3IRA A;  4MJE A;  1U87 A;  1XVQ A;  1BQ7 A;  2R0G A;  4FO5 A;  4EC0 A;  2QC7 A;  1UA5 A;  3EUR A;  3MAK A;  3LGC A;  3NIV A;  2E2M A;  4AJ6 A;  22GS A;  1WPI A;  1OYJ A;  4O92 A;  1WOU A;  3FR9 A;  3KD0 A;  2B1L A;  4K6X A;  3M9J A;  1M2A A;  1TDI A;  2B7K A;  2ZUP A;  4EIQ A;  4OCF A;  2KOK A;  5IPH A;  1GLP A;  1HYU A;  3FY7 A;  2C8U A;  2DKI A;  4XCS A;  3QDN A;  3K8N A;  1YY7 A;  3KMN A;  4OO5 A;  2HRN A;  2HSM A;  4KCA A;  2HNL A;  3LXZ A;  4ISD A;  1ST9 A;  5CAX A;  4XTS A;  3UMA A;  2NDO A;  1K0N A;  2G0F A;  2H66 A;  1S3D A;  1A2J A;  4PUA A;  4LL1 B;  4KDY A;  3VI5 A;  3TJJ A;  4Q5R A;  4MLY A;  3ME8 A;  3IAS 2;  5COH A;  2CAI A;  3ED3 A;  3L9S A;  2RM6 A;  2JSZ A;  5KN3 A;  3D4M A;  2RII A;  4ACS A;  3VI7 A;  1U6T A;  4USS A;  4YKF A;  6GSS A;  3CRU A;  3L4N A;  5KN0 A;  1DE1 A;  1WJK A;  4K7O A;  3ZIT A;  3EU4 A;  4IP1 A;  4GWR A;  3D5J A;  1X5C A;  3KIJ A;  3LSZ A;  4YAP A;  3KM6 A;  5D8I A;  2ZNM A;  2NTO A;  3CMI A;  5BMU A;  3IBH A;  4HU7 A;  2V2G A;  2DJ1 A;  4WF4 A;  4BIK A;  13GS A;  4ECJ A;  5AGY A;  2JZT A;  1F6M C;  3DWV A;  4P3Y B;  5ECN B;  3IK7 A;  4F03 A;  3UVH A;  4IQA A;  5GAN D;  2OKA A;  4NPB A;  5IMZ A;  3TOU A;  2LST A;  2EIQ A;  2GSR A;  4DSQ A;  1GLQ A;  4HEA 2;  2YWN A;  3FZ5 A;  1TU8 A;  3W8S A;  4MMM A;  3DXB A;  2WRT A;  4KDU A;  2GGT A;  1Y6E A;  3CXG A;  2NVL A;  1A0F A;  1TOF A;  2IMK A;  5F0G A;  4PTS A;  2XHF A;  2FWG A;  2VCX A;  2V41 A;  4TKY A;  1EV4 A;  3GUR A;  3WGE A;  1K0D A;  5AN1 A;  2VCV A;  4GSS A;  2R37 A;  4IP6 A;  2HI7 A;  3TJG A;  3KH9 A;  3TRP A;  1SK1 A;  1BJX A;  1MDJ A;  2X8G A;  1F3A A;  5J3R A;  3TJF A;  3GUS A;  2C4J A;  4TW5 A;  1S3A A;  2L4Q A;  2IMF A;  2VIM A;  2VD0 A;  1BYE A;  1PL2 A;  2MMN A;  4FQU A;  4WKW A;  3DML A;  1SK2 A;  4PGT A;  1NSW A;  4K2X A;  2H76 A;  5A4U A;  3QD9 A;  5C04 A;  2X8C A;  5DAK B;  2VLU A;  1Q98 A;  5ECL B;  1K3L A;  2YP6 A;  1K0M A;  3BOA A;  4LA1 A;  9GSS A;  5A5K A;  2L5L A;  4EE0 A;  1NW2 A;  2C0G A;  4JU5 A;  1PN0 A;  2VCT A;  1EWX A;  3IV4 A;  3GKX A;  2OE1 A;  4BA7 A;  1IYI A;  3UJ1 A;  2OE0 A;  2H0I A;  1RW1 A;  2A4V A;  5ELG A;  1EOG A;  2YZU A;  2MMZ A;  1O85 A;  1Z7R A;  3FHK A;  2NBS A;  4RI6 A;  4TR1 A;  1B9Y C;  3GH9 A;  4EKZ A;  4WET A;  5ID2 A;  5EVO A;  1XOA A;  2H1G A;  3HZ4 A;  3IR4 A;  3HVS A;  3GIX A;  1GUL A;  3HHV A;  3FMW A;  4ZB9 A;  3CSJ A;  2LTK A;  3GYK A;  3ZVJ D;  2HZE B;  1S3C A;  2IWT A;  2YJH A;  3D6I A;  2H6Y A;  3IE3 A;  3WD6 A;  4HQS A;  11GS A;  3IAM 2;  1M9A A;  2GST A;  3Q74 A;  2P5Q A;  5ECH B;  1PN9 A;  1SYR A;  2OBK A;  3F6F A;  3FR3 A;  2V6K A;  1XWA A;  3KH7 A;  2M72 A;  2XPD A;  1QUW A;  3A5W A;  5DAL A;  3UAR A;  4ECB A;  5J9C A;  1B4Q A;  1AQV A;  4IVF A;  1TRS A;  4BL7 A;  5ECM B;  2LEG A;  3HY2 A;  4F9Z A;  3UBL A;  3LW9 A;  1OKD A;  4HS1 A;  1ABA A;  5HR2 A;  5D9X A;  4TXO B;  5H5R A;  2GSS A;  5ECP B;  2ON7 A;  3SWL A;  1M0U A;  1ERW A;  1F9M A;  1WMJ A;  1Z9H A;  5LNK e;  4MCU A;  1PFO A;  2FWH A;  3HVX A;  2IJY A;  1TKD B;  1U88 A;  4FH8 A;  2K8V A;  2N5F A;  5BRT A;  3MDK A;  4GRF A;  5LD0 A;  2CX4 A;  1V40 A;  3S9F A;  3UL3 A;  3CRT A;  1GSE A;  2VD1 A;  1PKW A;  1AW9 A; 
#chains in the Genus database with same CATH homology
 2C0E A;  4I8B A;  5A4W A;  4Z7X A;  3LOR A;  3IC4 A;  5F8B A;  2H73 A;  3G7Y A;  2HYX A;  4F0B A;  3F3R A;  3P90 A;  3QAV A;  1RQM A;  2XC2 A;  4BVX B;  4BWQ A;  1B48 A;  1M99 A;  2CA8 A;  6GSU A;  2JSY A;  5JCU A;  2LQO A;  1X5D A;  2GQL A;  2H6Z A;  1OC9 A;  1YEP A;  4LL4 B;  1G6Y A;  4OFN A;  3CTF A;  2WZ9 A;  1SD8 A;  4OFM A;  2L4C A;  2CT6 A;  2VM2 A;  1HNB A;  3BBY A;  2O7K A;  3PR8 A;  2C0F A;  1GSD A;  4ID0 A;  1JZR A;  2JL4 A;  2HXK A;  4L8E A;  5J9B A;  3GRX A;  2DJ0 A;  2PER A;  1OC3 A;  2J9H A;  4ZL8 A;  4JE1 A;  3LXT A;  3TUE A;  6GSW A;  4HJ2 A;  1WIK A;  5ECQ B;  1SJI A;  4XHM A;  4TR3 A;  2B3S A;  4ZIL A;  2H74 A;  1TRU A;  3MNG A;  1EGO A;  4JBB A;  4XIH A;  4YH2 A;  2LQQ A;  5AIS A;  4KUN A;  3VUR A;  5JCG A;  5IO0 A;  3LJR A;  5CRH A;  1TXX A;  3ZL5 A;  2KUC A;  3ZML A;  4KAE A;  1ZYE A;  2LJK A;  4AJ7 A;  4N0Z A;  4L5L A;  2DML A;  2E2G A;  2K8S A;  5G1K A;  2DJ2 A;  2JZS A;  4IN0 A;  4K7N A;  1AXD A;  1KBN A;  5IMV A;  1IYH A;  4PUR A;  2YV9 A;  5G5E A;  1GUM A;  4E8H A;  3ISO A;  2FWE A;  3DIE A;  1AIU A;  4IJI A;  2FY6 A;  2PPT A;  3DVX A;  1SU9 A;  1AC1 A;  1ACV A;  1EV9 A;  2I4A A;  4J2F A;  4O5R A;  1K0B A;  2QKE A;  4ZB6 A;  4Z2R A;  2C3Q A;  1XWB A;  3QFB C;  2HRK A;  3LEF A;  2NPB A;  3NOF A;  1LU4 A;  2J23 A;  4JRR A;  2WCI A;  3HJP A;  2B5Y A;  4G19 A;  4BVY A;  1YF1 A;  3GHA A;  5J41 A;  1BAY A;  4V2M A;  3IDV A;  2A2S A;  3IA1 A;  4WBJ A;  1ZL9 A;  1URM A;  1KTE A;  4TR4 A;  3QMX A;  5CRD A;  1XOB A;  1V58 A;  5D93 A;  1SYX A;  12GS A;  1PX7 A;  3R3E A;  3ZMK A;  2LRC A;  1M2D A;  3FW2 A;  1QMV A;  2FNO A;  2LUS A;  3QOU A;  3TKQ A;  2JU5 A;  1SL1 B;  2O8V B;  1CQH A;  1PD2 1;  3F63 A;  3SBC A;  4MF6 A;  4FYC A;  3GX8 A;  1QGV A;  3G7I A;  3H1N A;  1T8E B;  3C7M A;  4J57 E;  3VWU A;  1K3Y A;  3HD5 A;  3PH9 A;  3EVI A;  3EC3 A;  2WGR A;  2GQM A;  1A8Y A;  3D21 A;  4TXV A;  2YAN A;  4TRX A;  2RLI A;  1XIY A;  4PNF A;  2AHE A;  3G9B A;  2WFC A;  4WXT A;  1WP0 A;  2B1K A;  3L9U A;  1YKC A;  3HCZ A;  4NV5 A;  3UEM A;  2H6X A;  3RAZ A;  2YNX A;  2R5G A;  2IN3 A;  2YN1 A;  2X4A A;  5ENU A;  2BJX A;  3F9U A;  5J5N A;  1A23 A;  2AB6 A;  2H01 A;  2WS2 A;  5ELA A;  1G6W A;  1GTU A;  4EF0 A;  2VCW A;  3RPP A;  3IK9 A;  2YWM A;  4F2I A;  4ILF A;  1VF2 A;  1VRS D;  1YDK A;  3QCP A;  1GSU A;  1GL8 A;  4ZXG A;  1THO A;  4I2U A;  2GQK A;  5EY6 A;  1OE8 A;  3GST A;  5H5S A;  4G2E A;  5EPF A;  2PGT A;  2AUV A;  4DEJ A;  4AJ8 A;  1XBS A;  4MZB A;  3GKK A;  4YAV A;  4O5Q A;  4LMV A;  2YV7 A;  1GUH A;  4I97 A;  1J9B A;  1FOH A;  2VLT A;  1OVN A;  1QFN A;  3M8N A;  1XFL A;  5FWG A;  1GSS A;  1VF1 A;  5DBQ A;  2H1B A;  1FVJ A;  5G1L A;  1LJR A;  2VM1 A;  2FLS A;  1Z7P A;  5HFG A;  2HRF A;  3VPT A;  4EDY A;  4GQF A;  5DQS A;  1ML6 A;  1SL2 B;  3KTB A;  4MH2 A;  3Q19 A;  4XRD A;  5D96 A;  1FO5 A;  2KHP A;  5B8B A;  5JCW A;  3MYD A;  1PRX A;  1T1V A;  2YWI A;  1O8W A;  4TOP A;  4LLR A;  3G7J A;  3TKP A;  3GTU A;  4K7I A;  3KXO A;  2C80 A;  4QL7 A;  2YOI A;  2H8L A;  3LWA A;  2FA8 A;  5G2Z A;  4Q5Q A;  2GT6 A;  1G7E A;  3BD2 A;  1MDI A;  1UC7 A;  4IQ1 A;  1FHE A;  4MPG A;  1ZYP A;  4IGJ A;  2RUE A;  5IOX A;  2K18 A;  14GS A;  2YJ7 A;  2H71 A;  3KP9 A;  2RUF A;  1E6B A;  2HZF A;  3GH6 A;  3KGK A;  1GSY A;  2TRX A;  4IHU A;  4PX1 A;  1Z6N A;  1Y25 A;  2H0H A;  1O73 A;  4KSO A;  3ERW A;  1M2B A;  2XPE A;  2CX3 A;  2H72 A;  4MNN A;  2H30 A;  1Z3E A;  2F9S A;  5D9T A;  2I9H A;  3EE2 A;  4HI7 A;  2YPM A;  2GDR A;  3GN3 A;  3ERF A;  4JR4 A;  3CTG A;  3CSI A;  4L0W A;  2VL3 A;  4OCE A;  1JZO A;  4X0X A;  1M7T A;  1J0F A;  2LRT A;  3I6A A;  4YQV A;  2IFQ A;  2BMX A;  1KNG A;  5E59 A;  3A5I A;  1JLW A;  4V1A g;  5DCH A;  2GZP A;  3H93 A;  4TR1 B;  5A4V A;  5CRG A;  2P31 A;  3FZ9 A;  5KOW A;  2HE3 A;  5ID2 B;  4G10 A;  5DVB A;  1RK4 A;  5IMC A;  3F3Q A;  2FUG 2;  1OC8 A;  2F51 A;  1GWC A;  4RQR A;  1SJZ A;  3VK9 A;  20GS A;  1EZK A;  4GF0 A;  3IHG A;  3F4T A;  4NAX A;  3VWV A;  3GMF A;  4HJM A;  1TJD A;  1EP8 A;  3KP8 A;  2PU9 C;  1UN2 A;  3GL5 A;  5IOW A;  2FHE A;  3H8Q A;  2XBQ A;  3I9V 2;  3FZA A;  5DAL B;  3C73 A;  4WR5 A;  5F06 A;  4HOJ A;  2GS3 A;  4L0U A;  3HDC A;  5HQP A;  1M9B A;  4BL7 B;  2V32 A;  1FW1 A;  4YQM A;  3ZIJ A;  4IS0 A;  3E0U A;  5HFI A;  4G0K A;  3C71 A;  2DSA A;  3WT1 A;  4DVC A;  3J7Y k;  2WUL A;  2H0G A;  1BED A;  4GLT A;  4XS4 A;  3IHQ A;  2VCQ A;  1TP9 A;  3TJK A;  1T4Z A;  1FVK A;  3RHB A;  4RQX A;  2VL2 C;  1GTI A;  4MZW A;  3RHC A;  1EEJ A;  3KCM A;  4NMU A;  4GSN A;  3A2V A;  4IW9 A;  4ML6 A;  1XXU A;  3L0H A;  1ZOF A;  1ERV A;  4BPY A;  5F05 A;  4KGI A;  3D4T A;  1A0R P;  2E0Q A;  3AY8 A;  1X9W B;  1K0O A;  1X0R A;  2KP1 A;  2PVQ A;  1WRY A;  3D0Z A;  3OR5 A;  3GL3 A;  3UVT A;  1SJ6 A;  1HQO A;  3W8J A;  2M46 A;  2EIO A;  2IME A;  2I3Y A;  4XS6 A;  1MD3 A;  2DMM A;  1X9M B;  5G5F A;  2L59 A;  3EIN A;  3UOM A;  4ZBD A;  2F8F A;  2VO4 A;  2L6C A;  5JWO B;  3A2X A;  1WWJ A;  4K8M A;  2DIY A;  3VWW A;  4K5R A;  3DGQ A;  6GST A;  1TRW A;  4ECI A;  1T7P B;  5F07 A;  5ABR A;  4MH3 A;  1SD9 A;  4X43 A;  4ZBB A;  3FEU A;  5JWR B;  1T00 A;  3RPN A;  3H79 A;  1JLV A;  2CZ3 A;  1GNW A;  1PKZ A;  4GCI A;  1OC9 B;  4MK3 A;  1R26 A;  4PQI A;  3EPT A;  1GP1 A;  2AJQ B;  1VF4 A;  4ZL9 A;  2R3X A;  2A2R A;  1ZYN A;  4D73 A;  4G0L A;  1GNE A;  4CW9 A;  4CDO A;  3WT2 A;  4OFT A;  3O6T A;  3N9J A;  3MWH A;  4X4J A;  3QPM A;  4WEY A;  3DVW A;  3TKS C;  4KCE A;  7GSS A;  4KA0 A;  1B4P A;  2H19 A;  1V98 A;  4MAB A;  4ICY A;  1OKT A;  1GRX A;  4JR6 A;  2HSH A;  4MJC A;  1QQ2 A;  2WDU A;  1GUK A;  2VCZ A;  3EWL A;  3DEX A;  3LQ7 A;  2AYT A;  2TIR A;  1FB6 A;  4O32 A;  3MSZ A;  4I6X A;  2CVB A;  1XVW A;  3F4R A;  4IEL A;  4FIW A;  2DJ3 A;  5LCZ A;  2I81 A;  2R0C A;  3LYP A;  4F0C A;  3F8U A;  3W6G A;  2CV4 A;  1O7U A;  4L5O A;  1GH2 A;  2I1U A;  2H1A A;  2XBI A;  2MBS A;  3EU3 A;  4MDC A;  4N10 A;  2R6K A;  3C1R A;  2KP2 A;  3I69 A;  5GSS A;  3BJ5 A;  1DE2 A;  2GVP A;  4XS1 A;  2LS5 A;  3GFK A;  1GSQ A;  1F37 A;  2KLX A;  5C00 A;  4Z2U A;  3MIX A;  3I43 A;  1XWK A;  2DLX A;  2EC4 A;  3EYT A;  5KEJ A;  3Q6O A;  4RUV A;  3APQ A;  3M1G A;  4EL1 A;  4YQU A;  1T4Y A;  2UZ8 A;  4H86 A;  3L9V A;  4BVY B;  1OAZ A;  2IIY A;  4MJA A;  4EIP A;  1GTA A;  3FZ4 A;  1Q4J A;  1ZZY A;  4Z2T A;  2Z9S A;  1TI1 A;  3KJY A;  4POM A;  2FWF A;  3R2Q A;  1XCC A;  4K5S A;  5IO2 A;  5B6N A;  3HVV A;  3RDW A;  2REM A;  3CYN A;  5KOX A;  4BWS A;  1I5G A;  1PSQ A;  2VLV A;  1Z6M A;  4O7H A;  2PUK C;  3HXS A;  2AV4 A;  4K0N A;  3TKS E;  2FCH A;  2P5R A;  5JWQ B;  2LNT A;  4OMV A;  5IMD A;  3GKM A;  1YZX A;  4OO4 A;  1YJ6 A;  5GST A;  4E8E A;  4ZBA A;  2H70 A;  3QAW A;  5CP1 A;  4DSS A;  3TCO A;  1KEB A;  6GSV A;  2CVK A;  3ZZX A;  1R7H A;  5ECK B;  2O87 A;  2VL2 A;  3N5O A;  2G2Q A;  4NWY A;  1FAA A;  2ON5 A;  4N11 A;  5IMA A;  2P0G A;  3V1W A;  3JCM L;  5B8A A;  3ZTL A;  1TTZ A;  4FYB A;  3QR6 A;  2C0D A;  5B7C A;  1EEM A;  4MJB A;  2ES7 A;  4POK A;  1XWC A;  4CY8 A;  4GXZ A;  2JAC A;  4IKH A;  4K1F A;  3HKR A;  2L57 A;  3IPZ A;  4GST A;  4K0G A;  1XPV A;  1PQN A;  1QK8 A;  1JZD A;  4TVE A;  1DSB A;  1MD4 A;  5CRW A;  1K0C A;  3H4K A;  2OE3 A;  2PN8 A;  3F4S A;  2D2Z A;  1TU7 A;  3A3T A;  1PL1 A;  2YZH A;  5IMF A;  1SKR B;  1V9W A;  3GNJ A;  2IMD A;  3A2W A;  4G0I A;  2LNS A;  3PPU A;  3PGT A;  2GT5 A;  3P8W A;  10GS A;  1XWG A;  1V2A A;  1TRV A;  2PMT A;  2VL9 A;  2F3M A;  5GZZ B;  1Z5Y E;  1AQX A;  4IJ3 A;  4KH7 A;  4EDZ A;  4TR0 A;  1HNC A;  5HFK A;  2HLS A;  2FA4 A;  4POB A;  1U3A A;  3EMP A;  5AIV A;  3RBT A;  2X99 A;  3U5R E;  2IL3 A;  1XW9 A;  1JZW A;  4IBP A;  4A5P A;  3D22 A;  4N30 A;  2PWJ A;  3APO A;  1ZYQ B;  1FOV A;  3BCK A;  1SL0 B;  3US3 A;  1XW6 A;  3UIW A;  3ERG A;  1USB A;  1B9X C;  1YF0 A;  4NHZ A;  3P7X A;  1XZO A;  1PMT A;  2PVO C;  1O6J A;  3GTU B;  2H75 A;  4KF9 A;  3CBU A;  4HZ4 A;  3C8E A;  6GSY A;  3L78 A;  1HNA A;  3TKS A;  3IXR A;  3UAP A;  4F82 A;  1TK8 B;  2MBT A;  2CQ9 A;  4V2L A;  2QSI A;  3F6D A;  3ZRD A;  2O89 A;  5HR0 A;  4RI7 A;  3HJO A;  4ML1 A;  1VF3 A;  4HDE A;  5J4U A;  3FR6 A;  3ZRE A;  2DIZ A;  3WYW A;  4HZ2 A;  3TOT A;  2F8A A;  3VLN A;  1U3I A;  1T3B A;  2C3T A;  2V1M A;  4K9Z A;  2OBI A;  2OA7 A;  3FK8 A;  6GSX A;  4CY6 A;  4I5Q A;  3KZQ A;  1AUC A;  2WJU A;  2LRN A;  1R5P A;  3TJB A;  1YKA A;  1JFU A;  2QGV A;  17GS A;  1SK0 A;  3KTL A;  1SKS B;  2LJA A;  5IM9 A;  1ON4 A;  1H4O A;  2JAD A;  1JHB A;  2DBC A;  2IFQ B;  5DJM A;  5IIZ A;  1BX9 A;  2QA1 A;  3DYR A;  4Q5N A;  2GTU A;  2YWO A;  4PQ1 A;  4AGS A;  2R2J A;  3HYP A;  1GSF A;  4GQC A;  5EL8 A;  1TK5 B;  2X64 A;  3ZFB A;  4G9H A;  4KSM A;  4TN8 A;  2DJJ A;  5ECO B;  4KE3 A;  2C1Y A;  2B5E A;  2QA2 A;  1F3B A;  1G7O A;  1F2E A;  4ECC A;  4LMW A;  2JZR A;  2C3N A;  2B5X A;  4O5U A;  1CQG A;  3TKR A;  1R4W A;  2RM5 A;  4POL A;  4GTU A;  3FRC A;  3EMX A;  1E2Y A;  5DAK A;  3O76 A;  1B8X A;  2K9F A;  1DUG A;  4V2N A;  4XRA A;  3ME7 A;  4OWY A;  3IOS A;  3WGD A;  1LBK A;  2N5A A;  4JED A;  4KDX A;  4FYU A;  2LJR A;  5INY A;  4K2D A;  4KND A;  2LV3 A;  5IQY A;  1A2M A;  1ILO A;  5H5Q A;  4PQH A;  5FHI A;  2VUP A;  2N5B A;  4XS4 B;  3GSS A;  3J7Y b;  5ECI B;  3M0F A;  3ZLP A;  4JZQ A;  5CO3 A;  5DQY A;  3U6V A;  1ERT A;  1ZGN A;  3FYG A;  3BCI A;  4KX4 A;  4MP4 A;  1K0A A;  4EUY A;  1N8J A;  5KN1 A;  1I9D A;  2HRA A;  3O3T A;  1AQW A;  2DC5 A;  5HR1 A;  2MMO A;  1N2A A;  2EIR A;  2TRC P;  1A8L A;  2HZE A;  3ZIV A;  2IMI A;  4MA9 A;  1ERU A;  1MDK A;  1QXH A;  1AAZ A;  1EP7 A;  2L6D A;  2FD3 A;  2OAD A;  1R5A A;  2DJK A;  3TRQ A;  5D73 A;  1NHO A;  2GSQ A;  2MMA A;  3VFI A;  3KEB A;  2BTO T;  1PX6 A;  2V6O A;  3TB2 A;  4PNG A;  2DKH A;  4MF7 A;  5DDL A;  4Q5F A;  3GX0 A;  2FGX A;  3M9K A;  3UBK A;  2GZZ A;  2B6M A;  1SKW B;  4CHS A;  4EVM A;  2PBJ A;  1NHY A;  5CNW A;  2GZY A;  1O81 A;  1W89 A;  2O85 A;  1YQ1 A;  3GA4 A;  4KW6 A;  4TXO A;  5G30 A;  5CYY A;  1V57 A;  3ZVJ A;  3CSH A;  1UVZ A;  2MZC A;  3F0I A;  4EO3 A;  3VPQ A;  1TI3 A;  3NZN A;  4HUA A;  3HJM A;  2WB9 A;  2IPA A;  2E7P A;  1GTB A;  4I2T A;  4D73 B;  2VAF A;  5IPG A;  3ZYW A;  3DRN A;  4NHW A;  2CVD A;  3HZ8 A;  1OE7 A;  4YKG A;  4HQZ A;  3P2A A;  1ZMA A;  1EGR A;  1NM3 A;  3FKF A;  4OD7 A;  16GS A;  1PA3 A;  2OAC A;  4PUF C;  3E9J B;  2OJL A;  1A24 A;  1SEN A;  5CRE A;  3DKS A;  3ZFL A;  4BVX A;  19GS A;  3KMO A;  3IC8 A;  5D9V A;  1X5E A;  2H1D A;  4MZC A;  18GS A;  2ALB A;  4QQ7 A;  2L5O A;  2CAQ A;  2X8H A;  1YEX A;  4NV2 A;  1WE0 A;  5L71 A;  3LYK A;  4V1A p;  1XW5 A;  4DSR A;  1J08 A;  4HU9 A;  3PIN A;  2A4H A;  4KB3 A;  2K6V A;  4MPF A;  1A2L A;  4ZB8 A;  5B6M A;  1K3O A;  4MF5 A;  2HSY A;  2HFD A;  2AAW A;  4ZL7 A;  1VGL A;  1MEK A;  1W4V A;  3WGX A;  1MTC A;  1TK0 B;  3M3M A;  1C72 A;  3TGZ A;  5DCG A;  4QL9 A;  1FG4 A;  1H75 A;  5FT3 A;  3Q18 A;  4EXJ A;  2MYG A;  5HR3 A;  1HD2 A;  4AF2 A;  3LG6 A;  2R4V A;  5ECR B;  2X49 A;  4NXI A;  2ZCT A;  4ZIJ A;  4J56 E;  3HA9 A;  3QAG A;  4N0V A;  3QFA C;  3GV1 A;  5AIX A;  3E3E A;  2VOC A;  5GAP D;  2M80 A;  2A2P A;  4WR4 A;  1PGT A;  5E4W A;  3VWX A;  1BG5 A;  1THX A;  4WBR D;  3LFL A;  1TW9 A;  2CZ2 A;  2R0P A;  4X1U A;  2HT9 A;  3TRX A;  8GSS A;  4ULX A;  1EOH A;  3APS A;  2GLR A;  4WF5 A;  5DJL A;  1ZCP A;  2LKU A;  5ECS A;  5D9W A;  5G31 A;  3C1S A;  3TDG A;  1DBY A;  3DD3 A;  4PXO A;  1O8X A;  3GKN A;  1X9S B;  2B7J A;  2YCD A;  1G0T A;  5KN2 A;  1FB0 A;  4DSS B;  3IRA A;  4MJE A;  1U87 A;  1XVQ A;  1BQ7 A;  2R0G A;  4FO5 A;  4EC0 A;  2QC7 A;  1UA5 A;  3EUR A;  3MAK A;  3LGC A;  3NIV A;  2E2M A;  4AJ6 A;  22GS A;  1WPI A;  1OYJ A;  4O92 A;  1WOU A;  3FR9 A;  3KD0 A;  2B1L A;  4K6X A;  3M9J A;  1M2A A;  1TDI A;  2B7K A;  2ZUP A;  4EIQ A;  4OCF A;  2KOK A;  5IPH A;  1GLP A;  1HYU A;  3FY7 A;  2C8U A;  2DKI A;  4XCS A;  3QDN A;  3K8N A;  1YY7 A;  3KMN A;  4OO5 A;  2HRN A;  2HSM A;  4KCA A;  2HNL A;  3LXZ A;  4ISD A;  1ST9 A;  5CAX A;  4XTS A;  3UMA A;  2NDO A;  1K0N A;  2G0F A;  2H66 A;  1S3D A;  1A2J A;  4PUA A;  4LL1 B;  4KDY A;  3VI5 A;  3TJJ A;  4Q5R A;  4MLY A;  3ME8 A;  3IAS 2;  5COH A;  2CAI A;  3ED3 A;  3L9S A;  2RM6 A;  2JSZ A;  5KN3 A;  3D4M A;  2RII A;  4ACS A;  3VI7 A;  1U6T A;  4USS A;  4YKF A;  6GSS A;  3CRU A;  3L4N A;  5KN0 A;  1DE1 A;  1WJK A;  4K7O A;  3ZIT A;  3EU4 A;  4IP1 A;  4GWR A;  3D5J A;  1X5C A;  3KIJ A;  3LSZ A;  4YAP A;  3KM6 A;  5D8I A;  2ZNM A;  2NTO A;  3CMI A;  5BMU A;  3IBH A;  4HU7 A;  2V2G A;  2DJ1 A;  4WF4 A;  13GS A;  4ECJ A;  5AGY A;  2JZT A;  1F6M C;  3DWV A;  4P3Y B;  5ECN B;  3IK7 A;  4F03 A;  3UVH A;  4IQA A;  5GAN D;  2OKA A;  4NPB A;  5IMZ A;  3TOU A;  2LST A;  2EIQ A;  2GSR A;  4DSQ A;  1GLQ A;  4HEA 2;  2YWN A;  3FZ5 A;  1TU8 A;  3W8S A;  4MMM A;  3DXB A;  2WRT A;  4KDU A;  2GGT A;  1Y6E A;  3CXG A;  2NVL A;  1A0F A;  1TOF A;  2IMK A;  5F0G A;  4PTS A;  2XHF A;  2FWG A;  2VCX A;  2V41 A;  4TKY A;  1EV4 A;  3GUR A;  3WGE A;  1K0D A;  5AN1 A;  2VCV A;  4GSS A;  2R37 A;  4IP6 A;  2HI7 A;  3TJG A;  3KH9 A;  3TRP A;  1SK1 A;  1BJX A;  1MDJ A;  2X8G A;  1F3A A;  5J3R A;  3TJF A;  3GUS A;  2C4J A;  4TW5 A;  1S3A A;  2L4Q A;  2IMF A;  2VIM A;  2VD0 A;  1BYE A;  1PL2 A;  2MMN A;  4FQU A;  4WKW A;  3DML A;  1SK2 A;  4PGT A;  1NSW A;  4K2X A;  2H76 A;  5A4U A;  3QD9 A;  5C04 A;  2X8C A;  5DAK B;  2VLU A;  1Q98 A;  5ECL B;  1K3L A;  2YP6 A;  1K0M A;  3BOA A;  4LA1 A;  9GSS A;  5A5K A;  2L5L A;  4EE0 A;  1NW2 A;  2C0G A;  4JU5 A;  1PN0 A;  2VCT A;  1EWX A;  3IV4 A;  3GKX A;  2OE1 A;  4BA7 A;  1IYI A;  3UJ1 A;  2OE0 A;  2H0I A;  1RW1 A;  2A4V A;  5ELG A;  1EOG A;  2YZU A;  2MMZ A;  1O85 A;  1Z7R A;  3FHK A;  2NBS A;  4RI6 A;  4TR1 A;  1B9Y C;  3GH9 A;  4EKZ A;  4WET A;  5ID2 A;  5EVO A;  1XOA A;  2H1G A;  3HZ4 A;  3IR4 A;  3HVS A;  3GIX A;  1GUL A;  3HHV A;  3FMW A;  4ZB9 A;  3CSJ A;  2LTK A;  3GYK A;  3ZVJ D;  2HZE B;  1S3C A;  2IWT A;  2YJH A;  3D6I A;  2H6Y A;  3IE3 A;  3WD6 A;  4HQS A;  11GS A;  3IAM 2;  1M9A A;  2GST A;  3Q74 A;  2P5Q A;  5ECH B;  1PN9 A;  1SYR A;  2OBK A;  3F6F A;  3FR3 A;  2V6K A;  1XWA A;  3KH7 A;  2M72 A;  2XPD A;  1QUW A;  3A5W A;  5DAL A;  3UAR A;  4ECB A;  5J9C A;  1B4Q A;  1AQV A;  4IVF A;  1TRS A;  4BL7 A;  5ECM B;  2LEG A;  3HY2 A;  4F9Z A;  3UBL A;  3LW9 A;  1OKD A;  4HS1 A;  1ABA A;  5HR2 A;  5D9X A;  4TXO B;  5H5R A;  2GSS A;  5ECP B;  2ON7 A;  3SWL A;  1M0U A;  1ERW A;  1F9M A;  1WMJ A;  1Z9H A;  5LNK e;  4MCU A;  2FWH A;  3HVX A;  2IJY A;  1TKD B;  1U88 A;  4FH8 A;  2K8V A;  2N5F A;  5BRT A;  3MDK A;  4GRF A;  5LD0 A;  2CX4 A;  1V40 A;  3S9F A;  3UL3 A;  3CRT A;  1GSE A;  2VD1 A;  1PKW A;  1AW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...