5HR2A

Crystal structure of thioredoxin l94a mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
107
Chain Sequence
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAASKGQLKEFLDANL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin
publication title Structural variability of E. coli thioredoxin captured in the crystal structures of single-point mutants.
pubmed doi rcsb
source organism Escherichia coli
total genus 30
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2016-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5hr2A00
5ECQB 2H1AA 3I69A 3KTLA 4MZWA 2VD1A 1TRSA 1NW2A 4KE3A 6GSWA 1SJIA 2QSIA 4K7IA 1X9WB 4XS6A 4NPBA 3EC3A 2H19A 2L57A 1M2AA 1ZL9A 2L4QA 4X0XA 5G30A 1FVJA 3KCMA 5AISA 1M2DA 1EOHA 1XWKA 3GTUB 20GSA 4PXOA 4QQ7A 2HXKA 2H30A 3O3TA 8GSSA 1M2BA 1TXXA 4EO3A 3ZTLA 1TU8A 4BWQA 2LRCA 4LL4B 3NIVA 1O8XA 1JLWA 2H01A 1A24A 4IP1A 1SK1A 4RUVA 2OADA 2VUPA 3D4MA 1YKAA 5ECRB 3TGZA 3W8JA 1ON4A 3RPNA 1K3LA 3TRXA 1X9SB 2VAFA 1URMA 1F3BA 2H66A 4PNFA 4F9ZA 1A2JA 4IBPA 4TRXA 3ZFBA 5ECHB 3BD2A 5H5SA 4DSSA 2AJQB 2XPEA 4PQ1A 1BG5A 3MAKA 2FWGA 3GIXA 2C0FA 5ECMB 13GSA 2L6DA 5ECIB 2I9HA 3KM6A 4XRAA 1XZOA 1XVQA 2K8VA 2H1GA 4CW9A 4TR1A 2GS3A 1M0UA 4ML1A 2CZ3A 4ACSA 5FT3A 1K0OA 2FHEA 4N0VA 4E8EA 3BOAA 2E2GA 4NXIA 4OCFA 2PPTA 3K8NA 1A8YA 2M46A 7GSSA 3BCIA 2V32A 5J3RA 4PX1A 4HI7A 2LQOA 4KA0A 1HNBA 2F9SA 4ZBBA 3TUEA 2DMMA 1THXA 3KGKA 1W4VA 3KH7A 1X5EA 2VL2A 3OR5A 1HYUA 2IFQA 1A2MA 5G1KA 2LKUA 1XOAA 5AIXA 1T4ZA 1F2EA 2H6XA 5HQPA 5ELGA 3M3MA 2H76A 3VPQA 4FYBA 4IQ1A 3EE2A 2DJKA 3M0FA 5ECPB 3CSIA 3DWVA 3A3TA 3LGCA 19GSA 1O6JA 5DDLA 2XC2A 1MDIA 2IMEA 5ID2A 2K6VA 1DE2A 4KSOA 4MMMA 5GAND 2IMDA 4GQCA 4NHWA 3RAZA 3ZREA 1DBYA 5L71A 16GSA 3LQ7A 2H0IA 1QGVA 4Q5RA 3GL5A 3UBKA 2VCTA 3DD3A 3DMLA 3QAWA 2PU9C 1BQ7A 2VM2A 1F3AA 3GKKA 4AGSA 3F63A 5IOXA 1WRYA 5ABRA 2ZUPA 4EKZA 5H5RA 4LLRA 1ERWA 4WR5A 2NDOA 1FAAA 4GQFA 4ZL8A 4MF7A 4DVCA 4DSQA 1H75A 1Q98A 2DLXA 5HFGA 3G9BA 5EY6A 4HQZA 3A2WA 1J0FA 1PRXA 2HZEA 2F8AA 4HS1A 1SYRA 2NBSA 3N5OA 1N2AA 5IPGA 3Q18A 5JCUA 3TKRA 1PGTA 3P2AA 3ISOA 2ALBA 2XPDA 5IMZA 4ML6A 4GTUA 5B8AA 3WT2A 1SK0A 3CTGA 4PQIA 1JZDA 3E0UA 1V98A 9GSSA 3TRPA 1MD3A 1T3BA 2YJ7A 1PL2A 4K7NA 2YWMA 5C04A 1JHBA 5JCWA 2OE1A 1GLPA 2P31A 1KNGA 2TRXA 2C8UA 5B6MA 3DRNA 2IMIA 4TR0A 2GSQA 4G10A 3E9JB 3BCKA 3GKMA 2H74A 2LJRA 6GSUA 2A4VA 1GNEA 2CVBA 3H1NA 1YKCA 2CVDA 4PGTA 5IM9A 1UC7A 4TOPA 4BPYA 1XWGA 2R6KA 3LEFA 3TKSA 5KN0A 3DEXA 1EEJA 2O85A 4OO4A 4XIHA 1VF2A 1GLQA 2PVOC 4YAPA 2KP1A 5HFIA 4JR4A 22GSA 5HFKA 2E0QA 2YANA 3KP9A 2YP6A 3VWXA 3KP8A 3EURA 4G19A 2V41A 2GZPA 2DC5A 1ZYQB 2DIZA 4KDYA 3MSZA 2XBIA 3N9JA 1GTIA 5CRGA 5LD0A 3UARA 2YV9A 4L8EA 2JU5A 1G6YA 1R5AA 5IQYA 1U3AA 3HDCA 2B5XA 2GQKA 5F07A 2VLTA 2HI7A 1PL1A 1OC9B 2PERA 1U87A 2YWNA 3QFAC 2WS2A 1SKWB 2ON7A 5FHIA 4HJMA 4ZBDA 2PN8A 4K9ZA 1T8EB 3LXZA 1GWCA 1UVZA 1RK4A 3ZVJA 2AB6A 2TIRA 1XWCA 2GT5A 2P5QA 2VCXA 2EIRA 4MABA 1FB6A 1LJRA 3IDVA 4KUNA 4O92A 3VWUA 2RLIA 4KCEA 3R2QA 2P0GA 3DVXA 3E3EA 5JWOB 4CDOA 3LORA 1TW9A 1K3OA 1XVWA 3ZLPA 3APOA 4GSNA 3HY2A 1O85A 4BVXA 5COHA 6GSYA 3FEUA 1GSEA 1X5CA 1FB0A 4NAXA 1TRUA 3UIWA 2G0FA 3UAPA 4POKA 3G7JA 1HD2A 3WD6A 2QKEA 3IC4A 5CO3A 4N0ZA 2PWJA 2MBSA 4JE1A 4L5LA 1TK0B 4KDXA 4EF0A 1ILOA 3F4SA 2YN1A 2IIYA 4P3YB 1GUHA 5CREA 3WGXA 2FCHA 3C73A 4OCEA 5DBQA 2C0GA 2DJ3A 3FW2A 4AF2A 5IMVA 1BAYA 2AAWA 1Z7RA 1FW1A 2H71A 3FZ5A 5J41A 3ZITA 1U88A 1XWAA 4F2IA 1AUCA 4HU7A 4EVMA 5AGYA 5AN1A 1HNCA 4MDCA 1T00A 4JR6A 5J9BA 3GV1A 5DQYA 1XFLA 4IVFA 1AQXA 1Y25A 1Z3EA 4ZILA 4OMVA 4ECCA 4O32A 1YDKA 4OFTA 1MDKA 3F0IA 1OC3A 2B6MA 3CSJA 1K0DA 3F3RA 3S9FA 3GN3A 1ZZYA 3U5RE 2WRTA 3M9KA 2LJKA 6GSVA 4GWRA 2GVPA 5CAXA 1QXHA 3ME7A 1TRWA 2LV3A 4ECIA 4RI6A 2BMXA 3TB2A 1OE7A 3CRUA 3TJFA 1T4YA 1KTEA 4POMA 3H79A 10GSA 1USBA 2IN3A 5IPHA 2C0DA 5ENUA 3BJ5A 2FA4A 3ZIJA 3KTBA 1GTUA 3HJPA 2YZHA 3IK7A 2BJXA 1MTCA 1OKTA 4XS4A 1M99A 4GRFA 1ERVA 2KP2A 3F4RA 2YOIA 1G7EA 2B5EA 3FR6A 4EDYA 3CSHA 4EL1A 4N30A 2YWOA 1AQVA 5D93A 3UVTA 1IYIA 2MBTA 4OFMA 5ECSA 3LYPA 2FWEA 2IJYA 4KB3A 5AIVA 3D5JA 1GUMA 2L5OA 1AIUA 2B3SA 4PURA 2NPBA 3VK9A 2EIOA 3D22A 3BBYA 4J2FA 4XHMA 1ZOFA 2GZZA 3HVXA 5G5EA 1TRVA 4EE0A 2FNOA 3VWWA 3GX0A 4I5QA 3EU4A 3IOSA 4Q5NA 5IOWA 3GYKA 2E7PA 2LSTA 12GSA 2I4AA 2YV7A 1ACVA 1OYJA 2NTOA 2FY6A 2DMLA 2CT6A 3L0HA 2C1YA 2IPAA 2VCQA 5EL8A 5A4VA 2ZNMA 1X5DA 2H75A 5B7CA 4RQRA 2I3YA 2DBCA 4EXJA 2I1UA 4N10A 2PGTA 4CHSA 5D9TA 3W6GA 1DSBA 2GSTA 1SL1B 1SJ6A 5DAKA 3TKQA 1U6TA 3KZQA 3VLNA 4JEDA 4LMVA 1XIYA 2C80A 1VF4A 2XHFA 5J4UA 3EU3A 1V9WA 4HJ2A 2DIYA 1C72A 3DIEA 1J08A 3HCZA 3C1RA 2WZ9A 3KIJA 2GQLA 4AJ7A 2B7KA 4K0NA 3LSZA 3MWHA 3UJ1A 14GSA 3A2VA 5A4UA 3TCOA 3QCPA 2WGRA 4TKYA 1B4QA 3WGDA 1GTAA 2X8GA 4K7OA 5CRHA 4KCAA 4EUYA 2R2JA 2H6ZA 4I2TA 3CXGA 3RHCA 3RHBA 1UA5A 2HT9A 3PH9A 1B9XC 2H1BA 1EV4A 4PNGA 2CZ2A 4K0GA 1TJDA 5DALA 2YCDA 3J7Yk 1S3AA 1YJ6A 2TRCP 3D4TA 4V2LA 4D73A 1O81A 4WEYA 1TU7A 3H4KA 2WCIA 2L4CA 5IMCA 2OE3A 3GNJA 2K8SA 1F37A 3IA1A 4WF5A 1EOGA 1Z9HA 3TKPA 2HSHA 3DGQA 2A2SA 1LU4A 1OVNA 4ZIJA 1A8LA 3TJGA 4IJIA 2H6YA 2ES7A 2HZFA 3HYPA 3VPTA 3ZZXA 3LFLA 4ZL7A 1YQ1A 1B48A 3F4TA 1AAZA 2OBIA 2O89A 1V57A 2VO4A 5JWQB 1RW1A 4NMUA 3ZL5A 3GURA 1B9YC 2HRNA 3UMAA 2E2MA 3TJKA 3GSSA 3HJOA 1OC9A 4HOJA 1W89A 2YZUA 3A2XA 2RM6A 2MZCA 1Z6NA 2FD3A 3A5WA 4OO5A 2VL3A 4EDZA 3U6VA 3HXSA 2O7KA 1GSUA 1R4WA 2WJUA 2IL3A 3M8NA 1Y6EA 3PGTA 1TK8B 3IAS2 1B8XA 2R37A 1A0RP 1B4PA 1OAZA 4L0UA 2LTKA 4FYUA 1SD9A 2VD0A 4TXVA 3TRQA 4F82A 2GDRA 4HQSA 5KN2A 3ZMKA 4DEJA 4BL7A 4L0WA 2FLSA 4ID0A 1QMVA 3NZNA 4XCSA 5JCGA 5F0GA 1G6WA 4X1UA 1MDJA 4WF4A 1ZCPA 2MMAA 2MMNA 4GSSA 4ZBAA 3HD5A 2X99A 4J57E 4HU9A 1AW9A 2H0GA 1XBSA 2FA8A 3W8SA 1TI1A 1QK8A 2CVKA 1SENA 1PA3A 3TJJA 4I8BA 4KSMA 4ECBA 5IMAA 2FGXA 4ISDA 4WBRD 3ZRDA 5G5FA 1V58A 3CYNA 2BTOT 3L78A 2H0HA 2OA7A 1K0CA 1JFUA 5ECLB 4YQMA 4RI7A 4FYCA 4XTSA 5ECKB 3ERGA 4G2EA 3TOTA 1SD8A 4J56E 3GH9A 1ML6A 3Q74A 3HHVA 5B8BA 3V1WA 5ID2B 1EP8A 2CAIA 3DKSA 3ME8A 1PMTA 5ECNB 4XRDA 4MF5A 2V1MA 5GZZB 1VF1A 1YF0A 3IR4A 3GX8A 4MJCA 1XW6A 1JZOA 3KD0A 3EMPA 1EP7A 1O73A 3GUSA 5ELAA 2YJHA 1ERTA 3F8UA 2LRTA 3C1SA 4NV2A 5GSTA 2FWFA 2LJAA 1I5GA 3FK8A 4Q5QA 1EWXA 1AC1A 4BVYA 1K3YA 1T7PB 1ZGNA 4MZCA 2VCZA 1THOA 2DJ2A 1PKZA 4KX4A 2L59A 3HVVA 1OC8A 2AV4A 3QAGA 4ZB8A 3GTUA 3IAM2 2DJ1A 4IQAA 3G7IA 3GH6A 1QUWA 1ERUA 2DJJA 2HZEB 2QC7A 4IHUA 1GSYA 3DVWA 2DSAA 1PX6A 1GL8A 1OE8A 1TDIA 2GSSA 1JZWA 2PUKC 1R26A 3LWAA 2IMFA 3VI5A 4IELA 2CV4A 1OKDA 1EGOA 1EV9A 1U3IA 5LNKe 4OD7A 5F05A 2ZCTA 5KEJA 1JLVA 3I43A 1WP0A 1SYXA 4OFNA 3G7YA 1YZXA 4ULXA 3EWLA 2CX3A 2XBQA 3RBTA 3QR6A 3M9JA 4V2MA 4HEA2 5DVBA 4V2NA 2IMKA 4RQXA 4MP4A 1SL0B 1GULA 1A0FA 1WWJA 2VL2C 1K0AA 4ZB9A 1MEKA 3IXRA 1V2AA 4DSRA 4N11A 4PUAA 1PX7A 1SJZA 3RDWA 4QL7A 2C0EA 5B6NA 4KDUA 1I9DA 1V40A 5HR0A 1NHOA 3C7MA 4ZXGA 1VGLA 3TJBA 2FUG2 2OKAA 3P8WA 2DJ0A 1Z7PA 2MMOA 3HZ4A 1XOBA 2CQ9A 4QL9A 2F8FA 3HJMA 2V2GA 1XPVA 3QMXA 4TR3A 1Z6MA 2F3MA 1QFNA 1FHEA 3DXBA 1TOFA 6GSSA 3D6IA 2O87A 3FZAA 2HLSA 3LYKA 3GSTA 4X43A 2B7JA 2GTUA 5GAPD 3KMNA 1N8JA 4WXTA 3D0ZA 4TW5A 3QOUA 4Z7XA 1A23A 3QDNA 2P5RA 3LJRA 2N5FA 3CTFA 1AXDA 1EZKA 2VOCA 4MA9A 2LUSA 3P7XA 3KJYA 3O76A 3VURA 3LXTA 1Z5YE 4BA7A 3UOMA 2B1LA 3US3A 3WGEA 1GP1A 2VCWA 1WJKA 3IV4A 3UVHA 1YEXA 2AHEA 2VIMA 1WPIA 3MDKA 4TVEA 1WE0A 2WULA 3PINA 2B1KA 5GSSA 2B5YA 3IHQA 2VCVA 2IWTA 1FO5A 2KHPA 1JZRA 2AUVA 4HDEA 3ZYWA 1SKRB 4TN8A 4IKHA 5HR1A 1TKDB 5INYA 2I81A 1O7UA 2GLRA 3GRXA 2VLVA 5C00A 2LQQA 2N5AA 3FZ9A 1GSFA 3Q6OA 4MZBA 1RQMA 6GSXA 3IK9A 1ZYEA 1FVKA 3TDGA 3I9V2 3DYRA 4MPFA 3GL3A 5DCHA 4WBJA 5CNWA 3APSA 4K2DA 4JRRA 4Q5FA 3L9VA 4TXOB 2RUFA 2HRFA 3ERWA 3FKFA 3TKSC 1XW5A 3QFBC 5J5NA 1EEMA 3EMXA 2WFCA 4ZB6A 1TI3A 2C3QA 5JWRB 2F51A 2C3NA 4HZ2A 2LEGA 4GLTA 5D9XA 18GSA 1TTZA 3HA9A 3P90A 2AYTA 4K1FA 2HE3A 1PN9A 1CQGA 1E6BA 5CYYA 4GCIA 4OWYA 3FYGA 5HR3A 1GNWA 1R7HA 4MF6A 5DCGA 2PVQA 3D21A 2VLUA 2X8CA 4LMWA 3GHAA 1CQHA 3EVIA 5G1LA 1ZMAA 5KN1A 4XS1A 4IGJA 4MLYA 4LA1A 1HQOA 1PQNA 3ZIVA 3ZMLA 5CRWA 2FWHA 2WB9A 4XS4B 2YWIA 2RIIA 1NHYA 3M1GA 11GSA 4POBA 3TKSE 4O7HA 1ST9A 1TK5B 1GUKA 3I6AA 1H4OA 3FHKA 3SBCA 3ED3A 2RM5A 2HNLA 4NV5A 1TP9A 4MH2A 3KXOA 3L9SA 1BEDA 2J9HA 4JZQA 2OACA 2PBJA 1AQWA 3CMIA 3HKRA 2M80A 2H1DA 1Q4JA 4V1Ap 5IMFA 3UBLA 1PSQA 1GSDA 3C71A 1O8WA 3H93A 3F6DA 5LCZA 3QPMA 3IE3A 4DSSB 1M9BA 5F8BA 3Q19A 4ILFA 2M72A 3GFKA 4MJEA 1S3DA 4IP6A 4E8HA 4WR4A 4HZ4A 1UN2A 1MD4A 4KNDA 5H5QA 4TR1B 1BYEA 3KMOA 2HFDA 2OBKA 4YQUA 1G7OA 4PQHA 1G0TA 3CRTA 1M9AA 2L6CA 3LG6A 1NSWA 1E2YA 1KBNA 2L5LA 5DAKB 2LNSA 4MJAA 4GXZA 1X0RA 2KOKA 3F6FA 3F3QA 4PUFC 3UL3A 1GSQA 5DJMA 1QQ2A 5A4WA 2LS5A 5D9VA 1IYHA 2MYGA 2C3TA 1F9MA 4FH8A 3O6TA 2RUEA 4O5RA 2O8VB 4NHZA 2JZTA 2WDUA 3VI7A 4AJ6A 5DJLA 2MMZA 3VFIA 1XCCA 1VF3A 2H72A 1YF1A 4IJ3A 2IFQB 2R3XA 3IPZA 2CX4A 4POLA 1BX9A 6GSTA 5EVOA 2LNTA 4IN0A 1PD21 5DALB 5G31A 4I97A 1J9BA 3PR8A 1BJXA 5E4WA 3HVSA 4D73B 1YEPA 5D8IA 2JSYA 1WMJA 2EIQA 4MPGA 5D96A 1EGRA 2YNXA 3AY8A 4G9HA 2GT6A 1ABAA 3ZVJD 1GRXA 2JACA 3RPPA 4YQVA 2NVLA 3EINA 1HNAA 2LRNA 5D73A 2X64A 1NM3A 2D2ZA 1GSSA 1SL2B 4I2UA 1GTBA 1WOUA 4MCUA 3GMFA 4I6XA 2GSRA 5FWGA 4MJBA 2H8LA 5A5KA 4ZL9A 3FZ4A 2K18A 3WT1A 3IBHA 5ECOB 17GSA 2JZSA 4K8MA 4AJ8A 4YAVA 3NOFA 4L5OA 2C4JA 3C8EA 3GKXA 3FY7A 5HR2A 2JSZA 4K6XA 1SU9A 2VM1A 4MK3A 2GGTA 3QAVA 2OE0A 3VWVA 4WKWA 5F06A 3ZFLA 2R5GA 1S3CA 1XWBA 3IRAA 2V6KA 4F0CA 1F6MC 1VRSD 2PMTA 1GH2A 1FG4A 5IO2A 3HZ8A 4HUAA 1FOVA 2J23A 3ERFA 1X9MB 4KH7A 2JADA 2HSYA 2H70A 3SWLA 3KH9A 4EC0A 3JCML 1XW9A 1R5PA 3J7Yb 2EC4A 2JZRA 4KGIA 1T1VA 2REMA 4YH2A 2KUCA 5CP1A 5DQSA 4TR4A 1DUGA 1PKWA 2CA8A 4IS0A 4FIWA 4IW9A 4FO5A 4GF0A 2GZYA 4KAEA 2GQMA 4LL1B 4H86A 4ECJA 5IMDA 3FR3A 5E59A 5D9WA 1XXUA 2X8HA 3CBUA 5IIZA 2Z9SA 2H73A 4NWYA 4KW6A 3GKNA 2HYXA 1K0BA 2CAQA 2A2RA 3APQA 4WETA 5J9CA 3UEMA 4MH3A 3KEBA 2JL4A 1LBKA 1K0MA 1DE1A 4TXOA 2R4VA 3GA4A 4JU5A 3TOUA 2K9FA 4V1Ag 4JBBA 1WIKA 3QD9A 5IO0A 2OJLA 5KN3A 4F0BA 3F9UA 3H8QA 3L4NA 1SK2A 3L9UA 5CRDA 3EYTA 3WYWA 1M7TA 3FRCA 2N5BA 3FR9A 3MNGA 2VL9A 2ON5A 2V6OA 1A2LA 2G2QA 5G2ZA 4F03A 1SKSB 2KLXA 1YY7A 4GSTA 1K0NA 1KEBA 2YPMA 5EPFA 4BWSA 2QGVA
chains in the Genus database with same CATH superfamily
5ECQB 2H1AA 3I69A 3KTLA 4MZWA 2VD1A 1TRSA 1NW2A 4KE3A 6GSWA 1SJIA 2QSIA 4K7IA 1X9WB 4XS6A 4NPBA 3EC3A 2H19A 2L57A 1M2AA 1ZL9A 2L4QA 4X0XA 5G30A 1FVJA 3KCMA 5AISA 1M2DA 1EOHA 1XWKA 3GTUB 20GSA 4PXOA 4QQ7A 2HXKA 2H30A 3O3TA 8GSSA 1M2BA 1TXXA 4EO3A 3ZTLA 1TU8A 4BWQA 2LRCA 4LL4B 3NIVA 1O8XA 1JLWA 2H01A 1A24A 4IP1A 1SK1A 4RUVA 5BRTA 2OADA 2VUPA 4KF9A 3D4MA 1YKAA 5ECRB 3TGZA 3W8JA 1ON4A 3RPNA 1K3LA 3TRXA 1X9SB 2VAFA 1URMA 1F3BA 2H66A 4PNFA 4F9ZA 1A2JA 4IBPA 4TRXA 3ZFBA 5ECHB 3BD2A 5H5SA 4DSSA 2AJQB 2XPEA 4PQ1A 1BG5A 3MAKA 2FWGA 3GIXA 2C0FA 5ECMB 13GSA 2L6DA 5ECIB 2I9HA 3KM6A 4XRAA 1XZOA 1XVQA 2K8VA 2H1GA 4CW9A 4TR1A 2GS3A 1M0UA 4ML1A 2CZ3A 4ACSA 5FT3A 1K0OA 2FHEA 4N0VA 4E8EA 3BOAA 2E2GA 4NXIA 4OCFA 2PPTA 3K8NA 1A8YA 2M46A 7GSSA 3BCIA 2V32A 5J3RA 4PX1A 4HI7A 2LQOA 4KA0A 1HNBA 4G0KA 2F9SA 4ZBBA 1S3RA 3TUEA 2DMMA 1THXA 3KGKA 1W4VA 2QA1A 1ZYNA 3KH7A 1X5EA 2VL2A 3OR5A 1HYUA 2HSMA 2IFQA 1A2MA 5G1KA 2LKUA 1XOAA 5AIXA 1T4ZA 1F2EA 2H6XA 5HQPA 5ELGA 3M3MA 2H76A 3VPQA 4FYBA 4IQ1A 3EE2A 2DJKA 3M0FA 5ECPB 3CSIA 3DWVA 3A3TA 3LGCA 19GSA 1O6JA 5DDLA 2XC2A 1MDIA 2IMEA 5ID2A 2X49A 2K6VA 1DE2A 4KSOA 4MMMA 5GAND 2IMDA 4GQCA 4NHWA 3RAZA 3ZREA 1DBYA 5L71A 16GSA 3LQ7A 2H0IA 4Z2UA 1QGVA 4Q5RA 3GL5A 3HVNA 3UBKA 2VCTA 3DD3A 3DMLA 3QAWA 2PU9C 1BQ7A 2VM2A 1F3AA 3GKKA 4AGSA 3F63A 5IOXA 1WRYA 5ABRA 2ZUPA 4EKZA 5H5RA 4LLRA 1ERWA 4WR5A 2NDOA 1FAAA 3A5IA 4GQFA 4ZL8A 4MF7A 4DVCA 4DSQA 1H75A 1Q98A 2DLXA 5HFGA 3G9BA 5EY6A 3PPUA 4HQZA 3A2WA 1J0FA 1PRXA 4FQUA 2HZEA 2F8AA 4HS1A 1SYRA 2NBSA 3N5OA 1N2AA 5IPGA 3Q18A 4YKGA 5JCUA 3TKRA 2R0GA 1PGTA 3P2AA 3ISOA 2ALBA 2XPDA 5IMZA 4ML6A 4GTUA 5B8AA 3WT2A 4PTSA 1SK0A 3CTGA 4PQIA 1JZDA 3E0UA 1V98A 9GSSA 3TRPA 1MD3A 1T3BA 2YJ7A 1PL2A 4K7NA 2YWMA 5C04A 1JHBA 5JCWA 2OE1A 1GLPA 2P31A 1KNGA 2TRXA 2C8UA 5B6MA 3DRNA 2IMIA 4TR0A 2GSQA 4G10A 3E9JB 3BCKA 3GKMA 2H74A 2LJRA 6GSUA 2A4VA 1GNEA 2CVBA 3H1NA 1YKCA 2CVDA 4PGTA 5IM9A 1UC7A 4TOPA 4BPYA 1XWGA 2R6KA 3LEFA 3TKSA 5KN0A 3DEXA 1EEJA 1PN0A 2O85A 4OO4A 4XIHA 1VF2A 1GLQA 2PVOC 4YAPA 2KP1A 5HFIA 4JR4A 22GSA 5HFKA 2E0QA 2YANA 3KP9A 2YP6A 3VWXA 3KP8A 3EURA 4G19A 2V41A 2GZPA 2DC5A 1ZYQB 2DIZA 4KDYA 3MSZA 2XBIA 3N9JA 1GTIA 5CRGA 5LD0A 3UARA 2YV9A 4L8EA 2JU5A 1G6YA 1R5AA 5IQYA 1U3AA 3HDCA 2B5XA 2GQKA 5F07A 2VLTA 2HI7A 1PL1A 1OC9B 2PERA 4CY6A 1U87A 2YWNA 3QFAC 2WS2A 1SKWB 2ON7A 5FHIA 4HJMA 4ZBDA 2PN8A 4K9ZA 1T8EB 3LXZA 1GWCA 1UVZA 1RK4A 3ZVJA 2AB6A 2TIRA 1XWCA 2GT5A 2P5QA 2VCXA 2EIRA 4MABA 1FB6A 1LJRA 3IDVA 4KUNA 4O92A 3VWUA 2RLIA 4KCEA 4BL7B 3R2QA 2P0GA 3DVXA 3E3EA 5JWOB 4CDOA 3LORA 1TW9A 1K3OA 1XVWA 3ZLPA 3APOA 4GSNA 3HY2A 1O85A 4BVXA 5COHA 6GSYA 3FEUA 1GSEA 1X5CA 1FB0A 4NAXA 1TRUA 3UIWA 2G0FA 3UAPA 4POKA 3G7JA 1HD2A 3WD6A 2QKEA 3IC4A 5CO3A 4N0ZA 2PWJA 2MBSA 4JE1A 4L5LA 1TK0B 4KDXA 4EF0A 1ILOA 3F4SA 2YN1A 2IIYA 4P3YB 1GUHA 5CREA 3WGXA 2FCHA 3C73A 4OCEA 5DBQA 2C0GA 2DJ3A 3FW2A 4AF2A 5IMVA 1BAYA 2AAWA 1Z7RA 1FW1A 2H71A 3FZ5A 5J41A 3ZITA 1U88A 1XWAA 5KOWA 4F2IA 1AUCA 4HU7A 4EVMA 5AGYA 5AN1A 1HNCA 4MDCA 1T00A 4JR6A 5J9BA 3GV1A 5DQYA 1XFLA 4IVFA 1AQXA 1Y25A 1Z3EA 4ZILA 4OMVA 4ECCA 4O32A 1YDKA 4OFTA 1MDKA 3F0IA 1OC3A 2B6MA 3CSJA 1K0DA 3F3RA 3S9FA 3MIXA 3GN3A 1ZZYA 3U5RE 2WRTA 3M9KA 2LJKA 6GSVA 4GWRA 2GVPA 5CAXA 1QXHA 3ME7A 1TRWA 2LV3A 4ECIA 4RI6A 2BMXA 3TB2A 1OE7A 3CRUA 3TJFA 1T4YA 1KTEA 4POMA 3H79A 10GSA 1USBA 2IN3A 5IPHA 2C0DA 5ENUA 3BJ5A 2FA4A 3ZIJA 3KTBA 1GTUA 2DKHA 3HJPA 4BVYB 2YZHA 3IK7A 2BJXA 1MTCA 1OKTA 4XS4A 1M99A 4GRFA 1ERVA 2KP2A 3F4RA 2YOIA 1G7EA 2B5EA 3FR6A 4EDYA 3CSHA 4EL1A 4N30A 2YWOA 1AQVA 4K5SA 5D93A 3UVTA 1IYIA 2MBTA 4OFMA 5ECSA 3LYPA 2FWEA 2IJYA 4KB3A 5AIVA 3D5JA 1GUMA 2L5OA 1AIUA 2B3SA 4PURA 2NPBA 3VK9A 2EIOA 3D22A 3BBYA 4J2FA 4XHMA 1ZOFA 2GZZA 3HVXA 5G5EA 1TRVA 4EE0A 2FNOA 3VWWA 3GX0A 4I5QA 3EU4A 3IOSA 4Q5NA 5IOWA 3GYKA 2E7PA 2LSTA 12GSA 2I4AA 2YV7A 1ACVA 1OYJA 2NTOA 2FY6A 2DMLA 2CT6A 3L0HA 2C1YA 2IPAA 2VCQA 5EL8A 5A4VA 2ZNMA 4EIQA 1X5DA 2H75A 5B7CA 4RQRA 2I3YA 2DBCA 4EXJA 2I1UA 4N10A 2PGTA 4CHSA 5D9TA 3W6GA 1DSBA 2GSTA 1SL1B 1SJ6A 5DAKA 4MNNA 3TKQA 1U6TA 3KZQA 3VLNA 4JEDA 4LMVA 1XIYA 2C80A 1VF4A 2XHFA 5J4UA 3EU3A 1V9WA 4HJ2A 2DIYA 1C72A 3DIEA 1J08A 3HCZA 3C1RA 2WZ9A 3KIJA 3FMWA 2GQLA 4AJ7A 2B7KA 4K0NA 3LSZA 3MWHA 3UJ1A 14GSA 3A2VA 5A4UA 3TCOA 3QCPA 2WGRA 4TKYA 1B4QA 2X4AA 3WGDA 1GTAA 2X8GA 4K7OA 5CRHA 4KCAA 4EUYA 2R2JA 2H6ZA 4I2TA 4K2XA 3CXGA 3RHCA 3RHBA 1UA5A 2HT9A 3PH9A 1B9XC 2H1BA 1EV4A 4PNGA 2CZ2A 4K0GA 1TJDA 5DALA 2YCDA 3J7Yk 1S3AA 1YJ6A 2HRAA 2TRCP 3D4TA 4HSCX 4V2LA 4D73A 1O81A 2HRKA 4WEYA 1TU7A 3H4KA 2WCIA 2L4CA 5IMCA 2OE3A 3GNJA 2K8SA 1F37A 3IA1A 4WF5A 1EOGA 1Z9HA 3TKPA 2HSHA 3DGQA 2A2SA 1LU4A 1OVNA 4ZIJA 1A8LA 3TJGA 4IJIA 2H6YA 2ES7A 2HZFA 3HYPA 3VPTA 3ZZXA 3LFLA 4ZL7A 1YQ1A 1B48A 3F4TA 1AAZA 4A5PA 2OBIA 2O89A 1V57A 2VO4A 5JWQB 1RW1A 4NMUA 3ZL5A 3GURA 1B9YC 2HRNA 3UMAA 2E2MA 3TJKA 1XG8A 2R0PA 3GSSA 3HJOA 1OC9A 4HOJA 1W89A 2YZUA 3A2XA 2RM6A 2MZCA 1Z6NA 2FD3A 3A5WA 4OO5A 2VL3A 4EDZA 3U6VA 3HXSA 2O7KA 1GSUA 1R4WA 2WJUA 2IL3A 3M8NA 1Y6EA 3PGTA 1TK8B 3IAS2 1B8XA 2R37A 1A0RP 1B4PA 1OAZA 4L0UA 2LTKA 4FYUA 1SD9A 2VD0A 4TXVA 3TRQA 4F82A 2GDRA 4HQSA 5KN2A 3ZMKA 4DEJA 4BL7A 4L0WA 2FLSA 4ID0A 1QMVA 3NZNA 4XCSA 4BIKA 5JCGA 5F0GA 1G6WA 4X1UA 1MDJA 4WF4A 1ZCPA 2MMAA 2MMNA 3R3EA 4GSSA 4ZBAA 3HD5A 2X99A 4J57E 4HU9A 1AW9A 1M3JA 2H0GA 1XBSA 2FA8A 3W8SA 1TI1A 1QK8A 2CVKA 1SENA 1PA3A 3TJJA 2UZ8A 4I8BA 4KSMA 4ECBA 5IMAA 2FGXA 4ISDA 4WBRD 3ZRDA 5G5FA 1V58A 3CYNA 2BTOT 3L78A 2H0HA 2OA7A 1FOHA 1K0CA 1JFUA 5ECLB 4YQMA 4RI7A 4FYCA 4XTSA 5ECKB 3ERGA 4G2EA 3TOTA 1SD8A 4J56E 3GH9A 1ML6A 3Q74A 3HHVA 5B8BA 3V1WA 5ID2B 3EPTA 1EP8A 2CAIA 3DKSA 3ME8A 1PMTA 5ECNB 4XRDA 4MF5A 2V1MA 5GZZB 1VF1A 1YF0A 3IR4A 3GX8A 1PFOA 4MJCA 1XW6A 1JZOA 3KD0A 3EMPA 1EP7A 1O73A 3GUSA 5ELAA 2YJHA 1ERTA 5BMUA 3F8UA 2LRTA 3C1SA 4NV2A 5GSTA 2FWFA 2LJAA 1I5GA 3FK8A 4Q5QA 1EWXA 1AC1A 4BVYA 1K3YA 1T7PB 1ZGNA 4MZCA 2VCZA 1THOA 2DJ2A 1PKZA 4KX4A 2L59A 3HVVA 1OC8A 2AV4A 3QAGA 4ZB8A 3GTUA 3IAM2 2DJ1A 4IQAA 3G7IA 3GH6A 1QUWA 1ERUA 2DJJA 2HZEB 2QC7A 4IHUA 1GSYA 3DVWA 2DSAA 4G0IA 1PX6A 1GL8A 1OE8A 1TDIA 2GSSA 1JZWA 2PUKC 1R26A 3LWAA 2IMFA 3VI5A 4IELA 2CV4A 4USSA 1OKDA 1EGOA 1EV9A 1U3IA 5LNKe 4OD7A 5F05A 2ZCTA 5KEJA 1JLVA 3I43A 1WP0A 1SYXA 4OFNA 3G7YA 1YZXA 4ULXA 3EWLA 2CX3A 2XBQA 3RBTA 3QR6A 3M9JA 4V2MA 4HEA2 5DVBA 4V2NA 2IMKA 4RQXA 4MP4A 1SL0B 1GULA 1A0FA 1WWJA 2VL2C 1K0AA 4ZB9A 1MEKA 3IXRA 1V2AA 4DSRA 4N11A 4PUAA 1PX7A 1SJZA 4K5RA 3RDWA 4QL7A 2C0EA 5B6NA 4KDUA 1I9DA 2A4HA 1ZYPA 1V40A 5HR0A 1NHOA 3C7MA 4CY8A 4ZXGA 1VGLA 3TJBA 2FUG2 2OKAA 3P8WA 2DJ0A 1Z7PA 2MMOA 3HZ4A 1XOBA 2CQ9A 4QL9A 2F8FA 3HJMA 2V2GA 1XPVA 3QMXA 4O5QA 4TR3A 1Z6MA 2F3MA 1QFNA 1FHEA 3DXBA 1TOFA 6GSSA 3D6IA 2O87A 3FZAA 2HLSA 3LYKA 3GSTA 4X43A 2B7JA 2GTUA 5GAPD 3KMNA 1N8JA 4WXTA 3D0ZA 4TW5A 3QOUA 4Z7XA 1A23A 3QDNA 2P5RA 3LJRA 2N5FA 3CTFA 1AXDA 1EZKA 2VOCA 4MA9A 2LUSA 3P7XA 3KJYA 3O76A 3VURA 3LXTA 1Z5YE 4BA7A 3UOMA 2B1LA 3US3A 3WGEA 1GP1A 2VCWA 1WJKA 4Z2TA 3IV4A 3UVHA 1YEXA 2AHEA 2VIMA 1WPIA 3MDKA 4TVEA 1WE0A 2WULA 3PINA 2B1KA 5GSSA 2B5YA 3IHQA 2VCVA 2IWTA 1FO5A 2KHPA 1JZRA 2AUVA 4HDEA 3ZYWA 2A2PA 4BVXB 1SKRB 4TN8A 4IKHA 5HR1A 1TKDB 5INYA 2I81A 1O7UA 2GLRA 3GRXA 2VLVA 5C00A 2LQQA 2N5AA 3FZ9A 1GSFA 3Q6OA 4MZBA 1RQMA 6GSXA 3IK9A 1ZYEA 1FVKA 3TDGA 3I9V2 3DYRA 4MPFA 3GL3A 5DCHA 4WBJA 5CNWA 3APSA 4K2DA 4JRRA 4Q5FA 3L9VA 4O5UA 4TXOB 2RUFA 2HRFA 3ERWA 3FKFA 3TKSC 1XW5A 3QFBC 5J5NA 1EEMA 3EMXA 2WFCA 4ZB6A 1TI3A 3MYDA 2C3QA 5JWRB 2F51A 2C3NA 4HZ2A 2LEGA 4GLTA 5D9XA 18GSA 1TTZA 3HA9A 3P90A 2AYTA 4K1FA 2HE3A 1PN9A 1CQGA 1E6BA 3CQFA 5CYYA 4GCIA 4OWYA 3FYGA 5HR3A 1GNWA 1R7HA 4MF6A 5DCGA 2PVQA 3D21A 2VLUA 2X8CA 4LMWA 3GHAA 1CQHA 3EVIA 4EIPA 2DKIA 5G1LA 1ZMAA 5KN1A 4XS1A 4IGJA 4MLYA 4LA1A 1HQOA 1PQNA 3ZIVA 3ZMLA 5CRWA 2FWHA 2WB9A 4XS4B 2YWIA 2RIIA 3IC8A 1NHYA 3M1GA 11GSA 4POBA 3TKSE 4O7HA 1ST9A 1TK5B 1GUKA 3I6AA 1H4OA 3FHKA 3SBCA 3ED3A 2RM5A 2HNLA 4NV5A 1TP9A 4MH2A 3KXOA 3L9SA 1BEDA 2J9HA 4JZQA 2OACA 2PBJA 1AQWA 3CMIA 3HKRA 2M80A 2H1DA 1Q4JA 4V1Ap 5IMFA 3UBLA 1PSQA 1GSDA 3C71A 1O8WA 3H93A 3F6DA 5LCZA 3QPMA 3IE3A 4DSSB 1M9BA 5F8BA 3Q19A 4ILFA 2M72A 3GFKA 4MJEA 1S3DA 4IP6A 4E8HA 4WR4A 4HZ4A 1UN2A 1MD4A 4KNDA 5H5QA 2R0CA 4TR1B 1BYEA 3KMOA 2HFDA 2OBKA 4YQUA 1G7OA 4PQHA 1G0TA 3CRTA 1M9AA 2L6CA 3LG6A 1NSWA 1E2YA 1KBNA 2L5LA 5DAKB 2LNSA 4MJAA 4GXZA 1X0RA 2KOKA 3F6FA 3F3QA 4PUFC 3UL3A 1GSQA 5DJMA 1QQ2A 5A4WA 2LS5A 5D9VA 1IYHA 2MYGA 2C3TA 1F9MA 4FH8A 3O6TA 2RUEA 4O5RA 2O8VB 4NHZA 2JZTA 2WDUA 3VI7A 4AJ6A 5DJLA 2MMZA 3VFIA 1XCCA 1VF3A 2H72A 1YF1A 4IJ3A 2IFQB 2R3XA 3IPZA 2CX4A 4POLA 1BX9A 6GSTA 5EVOA 2LNTA 4IN0A 1PD21 5DALB 5G31A 4I97A 1J9BA 3PR8A 1BJXA 5E4WA 3HVSA 4D73B 1YEPA 5D8IA 2JSYA 1WMJA 2EIQA 4MPGA 5D96A 1EGRA 2YNXA 3AY8A 4G9HA 4ICYA 2GT6A 1ABAA 3ZVJD 1GRXA 2JACA 3RPPA 4YQVA 2NVLA 1M3IA 3EINA 1HNAA 2LRNA 5D73A 2X64A 1NM3A 2D2ZA 1GSSA 1SL2B 4I2UA 1GTBA 1WOUA 4MCUA 3GMFA 4I6XA 2GSRA 5FWGA 4MJBA 2H8LA 5A5KA 4ZL9A 3FZ4A 2K18A 3WT1A 3IBHA 5ECOB 17GSA 2JZSA 4K8MA 4AJ8A 4YAVA 3NOFA 4L5OA 2C4JA 3C8EA 3GKXA 3FY7A 5HR2A 2JSZA 4K6XA 2QA2A 4G0LA 1SU9A 2VM1A 4MK3A 2GGTA 3LW9A 3QAVA 2OE0A 3VWVA 4WKWA 5F06A 3ZFLA 2R5GA 1S3CA 1XWBA 3IRAA 2V6KA 4F0CA 1F6MC 1VRSD 2PMTA 1GH2A 1FG4A 5IO2A 3HZ8A 4HUAA 1FOVA 2J23A 3ERFA 1X9MB 4KH7A 2JADA 2HSYA 2H70A 3SWLA 3KH9A 4EC0A 3JCML 1XW9A 1R5PA 3J7Yb 2EC4A 2JZRA 4KGIA 1T1VA 2REMA 4YH2A 2KUCA 5CP1A 5DQSA 4TR4A 1DUGA 1PKWA 2CA8A 4IS0A 4FIWA 4X4JA 4IW9A 4FO5A 4GF0A 2GZYA 4KAEA 2GQMA 4LL1B 4H86A 4ECJA 5IMDA 4Z2RA 3FR3A 5E59A 5D9WA 1XXUA 2X8HA 3CBUA 5IIZA 2Z9SA 2H73A 4NWYA 4KW6A 3GKNA 2HYXA 1K0BA 2CAQA 2A2RA 3APQA 4WETA 5J9CA 3UEMA 4MH3A 3KEBA 2JL4A 1LBKA 1K0MA 1DE1A 4TXOA 2R4VA 3GA4A 4JU5A 3TOUA 2K9FA 4V1Ag 4JBBA 1WIKA 3QD9A 5IO0A 2OJLA 4YKFA 5KN3A 4F0BA 3F9UA 3H8QA 3L4NA 1SK2A 3L9UA 5CRDA 3EYTA 3WYWA 1M7TA 3FRCA 2N5BA 3FR9A 3MNGA 2VL9A 2ON5A 2V6OA 1A2LA 2G2QA 5G2ZA 4F03A 1SKSB 2KLXA 1YY7A 4GSTA 5KOXA 1K0NA 1KEBA 2YPMA 5EPFA 4BWSA 2QGVA 3IHGA
chains in the Genus database with same CATH topology
5ECQB 2H1AA 3I69A 3KTLA 4MZWA 2VD1A 1TRSA 1NW2A 4KE3A 6GSWA 1SJIA 2QSIA 4K7IA 1X9WB 4XS6A 4NPBA 3EC3A 2H19A 2L57A 1M2AA 1ZL9A 2L4QA 4X0XA 5G30A 1FVJA 3KCMA 5AISA 1M2DA 1EOHA 1XWKA 3GTUB 20GSA 4PXOA 4QQ7A 2HXKA 2H30A 3O3TA 8GSSA 1M2BA 1TXXA 4EO3A 3ZTLA 1TU8A 4BWQA 2LRCA 4LL4B 3NIVA 1O8XA 1JLWA 2H01A 1A24A 4IP1A 1SK1A 4RUVA 5BRTA 2OADA 2VUPA 4KF9A 3D4MA 1YKAA 5ECRB 3TGZA 3W8JA 1ON4A 3RPNA 1K3LA 3TRXA 1X9SB 2VAFA 1URMA 1F3BA 2H66A 4PNFA 4F9ZA 1A2JA 4IBPA 4TRXA 3ZFBA 5ECHB 3BD2A 5H5SA 4DSSA 2AJQB 2XPEA 4PQ1A 1BG5A 3MAKA 2FWGA 3GIXA 2C0FA 5ECMB 13GSA 2L6DA 5ECIB 2I9HA 3KM6A 4XRAA 1XZOA 1XVQA 2K8VA 2H1GA 4CW9A 4TR1A 2GS3A 1M0UA 4ML1A 2CZ3A 4ACSA 5FT3A 1K0OA 2FHEA 4N0VA 4E8EA 3BOAA 2E2GA 4NXIA 4OCFA 2PPTA 3K8NA 1A8YA 2M46A 7GSSA 3BCIA 2V32A 5J3RA 4PX1A 4HI7A 2LQOA 4KA0A 1HNBA 4G0KA 2F9SA 4ZBBA 3TUEA 2DMMA 1THXA 3KGKA 1W4VA 2QA1A 1ZYNA 3KH7A 1X5EA 2VL2A 3OR5A 1HYUA 2HSMA 2IFQA 1A2MA 5G1KA 2LKUA 1XOAA 5AIXA 1T4ZA 1F2EA 2H6XA 5HQPA 5ELGA 3M3MA 2H76A 3VPQA 4FYBA 4IQ1A 3EE2A 2DJKA 3M0FA 5ECPB 3CSIA 3DWVA 3A3TA 3LGCA 19GSA 1O6JA 5DDLA 2XC2A 1MDIA 2IMEA 5ID2A 2X49A 2K6VA 1DE2A 4KSOA 4MMMA 5GAND 2IMDA 4GQCA 4NHWA 3RAZA 3ZREA 1DBYA 5L71A 16GSA 3LQ7A 2H0IA 4Z2UA 1QGVA 4Q5RA 3GL5A 3UBKA 2VCTA 3DD3A 3DMLA 3QAWA 2PU9C 1BQ7A 2VM2A 1F3AA 3GKKA 4AGSA 3F63A 5IOXA 1WRYA 5ABRA 2ZUPA 4EKZA 5H5RA 4LLRA 1ERWA 4WR5A 2NDOA 1FAAA 3A5IA 4GQFA 4ZL8A 4MF7A 4DVCA 4DSQA 1H75A 1Q98A 2DLXA 5HFGA 3G9BA 5EY6A 3PPUA 4HQZA 3A2WA 1J0FA 1PRXA 4FQUA 2HZEA 2F8AA 4HS1A 1SYRA 2NBSA 3N5OA 1N2AA 5IPGA 3Q18A 4YKGA 5JCUA 3TKRA 2R0GA 1PGTA 3P2AA 3ISOA 2ALBA 2XPDA 5IMZA 4ML6A 4GTUA 5B8AA 3WT2A 4PTSA 1SK0A 3CTGA 4PQIA 1JZDA 3E0UA 1V98A 9GSSA 3TRPA 1MD3A 1T3BA 2YJ7A 1PL2A 4K7NA 2YWMA 5C04A 1JHBA 5JCWA 2OE1A 1GLPA 2P31A 1KNGA 2TRXA 2C8UA 5B6MA 3DRNA 2IMIA 4TR0A 2GSQA 4G10A 3E9JB 3BCKA 3GKMA 2H74A 2LJRA 6GSUA 2A4VA 1GNEA 2CVBA 3H1NA 1YKCA 2CVDA 4PGTA 5IM9A 1UC7A 4TOPA 4BPYA 1XWGA 2R6KA 3LEFA 3TKSA 5KN0A 3DEXA 1EEJA 1PN0A 2O85A 4OO4A 4XIHA 1VF2A 1GLQA 2PVOC 4YAPA 2KP1A 5HFIA 4JR4A 22GSA 5HFKA 2E0QA 2YANA 3KP9A 2YP6A 3VWXA 3KP8A 3EURA 4G19A 2V41A 2GZPA 2DC5A 1ZYQB 2DIZA 4KDYA 3MSZA 2XBIA 3N9JA 1GTIA 5CRGA 5LD0A 3UARA 2YV9A 4L8EA 2JU5A 1G6YA 1R5AA 5IQYA 1U3AA 3HDCA 2B5XA 2GQKA 5F07A 2VLTA 2HI7A 1PL1A 1OC9B 2PERA 4CY6A 1U87A 2YWNA 3QFAC 2WS2A 1SKWB 2ON7A 5FHIA 4HJMA 4ZBDA 2PN8A 4K9ZA 1T8EB 3LXZA 1GWCA 1UVZA 1RK4A 3ZVJA 2AB6A 2TIRA 1XWCA 2GT5A 2P5QA 2VCXA 2EIRA 4MABA 1FB6A 1LJRA 3IDVA 4KUNA 4O92A 3VWUA 2RLIA 4KCEA 4BL7B 3R2QA 2P0GA 3DVXA 3E3EA 5JWOB 4CDOA 3LORA 1TW9A 1K3OA 1XVWA 3ZLPA 3APOA 4GSNA 3HY2A 1O85A 4BVXA 5COHA 6GSYA 3FEUA 1GSEA 1X5CA 1FB0A 4NAXA 1TRUA 3UIWA 2G0FA 3UAPA 4POKA 3G7JA 1HD2A 3WD6A 2QKEA 3IC4A 5CO3A 4N0ZA 2PWJA 2MBSA 4JE1A 4L5LA 1TK0B 4KDXA 4EF0A 1ILOA 3F4SA 2YN1A 2IIYA 4P3YB 1GUHA 5CREA 3WGXA 2FCHA 3C73A 4OCEA 5DBQA 2C0GA 2DJ3A 3FW2A 4AF2A 5IMVA 1BAYA 2AAWA 1Z7RA 1FW1A 2H71A 3FZ5A 5J41A 3ZITA 1U88A 1XWAA 5KOWA 4F2IA 1AUCA 4HU7A 4EVMA 5AGYA 5AN1A 1HNCA 4MDCA 1T00A 4JR6A 5J9BA 3GV1A 5DQYA 1XFLA 4IVFA 1AQXA 1Y25A 1Z3EA 4ZILA 4OMVA 4ECCA 4O32A 1YDKA 4OFTA 1MDKA 3F0IA 1OC3A 2B6MA 3CSJA 1K0DA 3F3RA 3S9FA 3MIXA 3GN3A 1ZZYA 3U5RE 2WRTA 3M9KA 2LJKA 6GSVA 4GWRA 2GVPA 5CAXA 1QXHA 3ME7A 1TRWA 2LV3A 4ECIA 4RI6A 2BMXA 3TB2A 1OE7A 3CRUA 3TJFA 1T4YA 1KTEA 4POMA 3H79A 10GSA 1USBA 2IN3A 5IPHA 2C0DA 5ENUA 3BJ5A 2FA4A 3ZIJA 3KTBA 1GTUA 2DKHA 3HJPA 4BVYB 2YZHA 3IK7A 2BJXA 1MTCA 1OKTA 4XS4A 1M99A 4GRFA 1ERVA 2KP2A 3F4RA 2YOIA 1G7EA 2B5EA 3FR6A 4EDYA 3CSHA 4EL1A 4N30A 2YWOA 1AQVA 4K5SA 5D93A 3UVTA 1IYIA 2MBTA 4OFMA 5ECSA 3LYPA 2FWEA 2IJYA 4KB3A 5AIVA 3D5JA 1GUMA 2L5OA 1AIUA 2B3SA 4PURA 2NPBA 3VK9A 2EIOA 3D22A 3BBYA 4J2FA 4XHMA 1ZOFA 2GZZA 3HVXA 5G5EA 1TRVA 4EE0A 2FNOA 3VWWA 3GX0A 4I5QA 3EU4A 3IOSA 4Q5NA 5IOWA 3GYKA 2E7PA 2LSTA 12GSA 2I4AA 2YV7A 1ACVA 1OYJA 2NTOA 2FY6A 2DMLA 2CT6A 3L0HA 2C1YA 2IPAA 2VCQA 5EL8A 5A4VA 2ZNMA 4EIQA 1X5DA 2H75A 5B7CA 4RQRA 2I3YA 2DBCA 4EXJA 2I1UA 4N10A 2PGTA 4CHSA 5D9TA 3W6GA 1DSBA 2GSTA 1SL1B 1SJ6A 5DAKA 4MNNA 3TKQA 1U6TA 3KZQA 3VLNA 4JEDA 4LMVA 1XIYA 2C80A 1VF4A 2XHFA 5J4UA 3EU3A 1V9WA 4HJ2A 2DIYA 1C72A 3DIEA 1J08A 3HCZA 3C1RA 2WZ9A 3KIJA 3FMWA 2GQLA 4AJ7A 2B7KA 4K0NA 3LSZA 3MWHA 3UJ1A 14GSA 3A2VA 5A4UA 3TCOA 3QCPA 2WGRA 4TKYA 1B4QA 2X4AA 3WGDA 1GTAA 2X8GA 4K7OA 5CRHA 4KCAA 4EUYA 2R2JA 2H6ZA 4I2TA 4K2XA 3CXGA 3RHCA 3RHBA 1UA5A 2HT9A 3PH9A 1B9XC 2H1BA 1EV4A 4PNGA 2CZ2A 4K0GA 1TJDA 5DALA 2YCDA 3J7Yk 1S3AA 1YJ6A 2HRAA 2TRCP 3D4TA 4V2LA 4D73A 1O81A 2HRKA 4WEYA 1TU7A 3H4KA 2WCIA 2L4CA 5IMCA 2OE3A 3GNJA 2K8SA 1F37A 3IA1A 4WF5A 1EOGA 1Z9HA 3TKPA 2HSHA 3DGQA 2A2SA 1LU4A 1OVNA 4ZIJA 1A8LA 3TJGA 4IJIA 2H6YA 2ES7A 2HZFA 3HYPA 3VPTA 3ZZXA 3LFLA 4ZL7A 1YQ1A 1B48A 3F4TA 1AAZA 4A5PA 2OBIA 2O89A 1V57A 2VO4A 5JWQB 1RW1A 4NMUA 3ZL5A 3GURA 1B9YC 2HRNA 3UMAA 2E2MA 3TJKA 2R0PA 3GSSA 3HJOA 1OC9A 4HOJA 1W89A 2YZUA 3A2XA 2RM6A 2MZCA 1Z6NA 2FD3A 3A5WA 4OO5A 2VL3A 4EDZA 3U6VA 3HXSA 2O7KA 1GSUA 1R4WA 2WJUA 2IL3A 3M8NA 1Y6EA 3PGTA 1TK8B 3IAS2 1B8XA 2R37A 1A0RP 1B4PA 1OAZA 4L0UA 2LTKA 4FYUA 1SD9A 2VD0A 4TXVA 3TRQA 4F82A 2GDRA 4HQSA 5KN2A 3ZMKA 4DEJA 4BL7A 4L0WA 2FLSA 4ID0A 1QMVA 3NZNA 4XCSA 5JCGA 5F0GA 1G6WA 4X1UA 1MDJA 4WF4A 1ZCPA 2MMAA 2MMNA 3R3EA 4GSSA 4ZBAA 3HD5A 2X99A 4J57E 4HU9A 1AW9A 2H0GA 1XBSA 2FA8A 3W8SA 1TI1A 1QK8A 2CVKA 1SENA 1PA3A 3TJJA 2UZ8A 4I8BA 4KSMA 4ECBA 5IMAA 2FGXA 4ISDA 4WBRD 3ZRDA 5G5FA 1V58A 3CYNA 2BTOT 3L78A 2H0HA 2OA7A 1FOHA 1K0CA 1JFUA 5ECLB 4YQMA 4RI7A 4FYCA 4XTSA 5ECKB 3ERGA 4G2EA 3TOTA 1SD8A 4J56E 3GH9A 1ML6A 3Q74A 3HHVA 5B8BA 3V1WA 5ID2B 3EPTA 1EP8A 2CAIA 3DKSA 3ME8A 1PMTA 5ECNB 4XRDA 4MF5A 2V1MA 5GZZB 1VF1A 1YF0A 3IR4A 3GX8A 4MJCA 1XW6A 1JZOA 3KD0A 3EMPA 1EP7A 1O73A 3GUSA 5ELAA 2YJHA 1ERTA 5BMUA 3F8UA 2LRTA 3C1SA 4NV2A 5GSTA 2FWFA 2LJAA 1I5GA 3FK8A 4Q5QA 1EWXA 1AC1A 4BVYA 1K3YA 1T7PB 1ZGNA 4MZCA 2VCZA 1THOA 2DJ2A 1PKZA 4KX4A 2L59A 3HVVA 1OC8A 2AV4A 3QAGA 4ZB8A 3GTUA 3IAM2 2DJ1A 4IQAA 3G7IA 3GH6A 1QUWA 1ERUA 2DJJA 2HZEB 2QC7A 4IHUA 1GSYA 3DVWA 2DSAA 4G0IA 1PX6A 1GL8A 1OE8A 1TDIA 2GSSA 1JZWA 2PUKC 1R26A 3LWAA 2IMFA 3VI5A 4IELA 2CV4A 4USSA 1OKDA 1EGOA 1EV9A 1U3IA 5LNKe 4OD7A 5F05A 2ZCTA 5KEJA 1JLVA 3I43A 1WP0A 1SYXA 4OFNA 3G7YA 1YZXA 4ULXA 3EWLA 2CX3A 2XBQA 3RBTA 3QR6A 3M9JA 4V2MA 4HEA2 5DVBA 4V2NA 2IMKA 4RQXA 4MP4A 1SL0B 1GULA 1A0FA 1WWJA 2VL2C 1K0AA 4ZB9A 1MEKA 3IXRA 1V2AA 4DSRA 4N11A 4PUAA 1PX7A 1SJZA 4K5RA 3RDWA 4QL7A 2C0EA 5B6NA 4KDUA 1I9DA 2A4HA 1ZYPA 1V40A 5HR0A 1NHOA 3C7MA 4CY8A 4ZXGA 1VGLA 3TJBA 2FUG2 2OKAA 3P8WA 2DJ0A 1Z7PA 2MMOA 3HZ4A 1XOBA 2CQ9A 4QL9A 2F8FA 3HJMA 2V2GA 1XPVA 3QMXA 4O5QA 4TR3A 1Z6MA 2F3MA 1QFNA 1FHEA 3DXBA 1TOFA 6GSSA 3D6IA 2O87A 3FZAA 2HLSA 3LYKA 3GSTA 4X43A 2B7JA 2GTUA 5GAPD 3KMNA 1N8JA 4WXTA 3D0ZA 4TW5A 3QOUA 4Z7XA 1A23A 3QDNA 2P5RA 3LJRA 2N5FA 3CTFA 1AXDA 1EZKA 2VOCA 4MA9A 2LUSA 3P7XA 3KJYA 3O76A 3VURA 3LXTA 1Z5YE 4BA7A 3UOMA 2B1LA 3US3A 3WGEA 1GP1A 2VCWA 1WJKA 4Z2TA 3IV4A 3UVHA 1YEXA 2AHEA 2VIMA 1WPIA 3MDKA 4TVEA 1WE0A 2WULA 3PINA 2B1KA 5GSSA 2B5YA 3IHQA 2VCVA 2IWTA 1FO5A 2KHPA 1JZRA 2AUVA 4HDEA 3ZYWA 2A2PA 4BVXB 1SKRB 4TN8A 4IKHA 5HR1A 1TKDB 5INYA 2I81A 1O7UA 2GLRA 3GRXA 2VLVA 5C00A 2LQQA 2N5AA 3FZ9A 1GSFA 3Q6OA 4MZBA 1RQMA 6GSXA 3IK9A 1ZYEA 1FVKA 3TDGA 3I9V2 3DYRA 4MPFA 3GL3A 5DCHA 4WBJA 5CNWA 3APSA 4K2DA 4JRRA 4Q5FA 3L9VA 4O5UA 4TXOB 2RUFA 2HRFA 3ERWA 3FKFA 3TKSC 1XW5A 3QFBC 5J5NA 1EEMA 3EMXA 2WFCA 4ZB6A 1TI3A 3MYDA 2C3QA 5JWRB 2F51A 2C3NA 4HZ2A 2LEGA 4GLTA 5D9XA 18GSA 1TTZA 3HA9A 3P90A 2AYTA 4K1FA 2HE3A 1PN9A 1CQGA 1E6BA 5CYYA 4GCIA 4OWYA 3FYGA 5HR3A 1GNWA 1R7HA 4MF6A 5DCGA 2PVQA 3D21A 2VLUA 2X8CA 4LMWA 3GHAA 1CQHA 3EVIA 4EIPA 2DKIA 5G1LA 1ZMAA 5KN1A 4XS1A 4IGJA 4MLYA 4LA1A 1HQOA 1PQNA 3ZIVA 3ZMLA 5CRWA 2FWHA 2WB9A 4XS4B 2YWIA 2RIIA 3IC8A 1NHYA 3M1GA 11GSA 4POBA 3TKSE 4O7HA 1ST9A 1TK5B 1GUKA 3I6AA 1H4OA 3FHKA 3SBCA 3ED3A 2RM5A 2HNLA 4NV5A 1TP9A 4MH2A 3KXOA 3L9SA 1BEDA 2J9HA 4JZQA 2OACA 2PBJA 1AQWA 3CMIA 3HKRA 2M80A 2H1DA 1Q4JA 4V1Ap 5IMFA 3UBLA 1PSQA 1GSDA 3C71A 1O8WA 3H93A 3F6DA 5LCZA 3QPMA 3IE3A 4DSSB 1M9BA 5F8BA 3Q19A 4ILFA 2M72A 3GFKA 4MJEA 1S3DA 4IP6A 4E8HA 4WR4A 4HZ4A 1UN2A 1MD4A 4KNDA 5H5QA 2R0CA 4TR1B 1BYEA 3KMOA 2HFDA 2OBKA 4YQUA 1G7OA 4PQHA 1G0TA 3CRTA 1M9AA 2L6CA 3LG6A 1NSWA 1E2YA 1KBNA 2L5LA 5DAKB 2LNSA 4MJAA 4GXZA 1X0RA 2KOKA 3F6FA 3F3QA 4PUFC 3UL3A 1GSQA 5DJMA 1QQ2A 5A4WA 2LS5A 5D9VA 1IYHA 2MYGA 2C3TA 1F9MA 4FH8A 3O6TA 2RUEA 4O5RA 2O8VB 4NHZA 2JZTA 2WDUA 3VI7A 4AJ6A 5DJLA 2MMZA 3VFIA 1XCCA 1VF3A 2H72A 1YF1A 4IJ3A 2IFQB 2R3XA 3IPZA 2CX4A 4POLA 1BX9A 6GSTA 5EVOA 2LNTA 4IN0A 1PD21 5DALB 5G31A 4I97A 1J9BA 3PR8A 1BJXA 5E4WA 3HVSA 4D73B 1YEPA 5D8IA 2JSYA 1WMJA 2EIQA 4MPGA 5D96A 1EGRA 2YNXA 3AY8A 4G9HA 4ICYA 2GT6A 1ABAA 3ZVJD 1GRXA 2JACA 3RPPA 4YQVA 2NVLA 3EINA 1HNAA 2LRNA 5D73A 2X64A 1NM3A 2D2ZA 1GSSA 1SL2B 4I2UA 1GTBA 1WOUA 4MCUA 3GMFA 4I6XA 2GSRA 5FWGA 4MJBA 2H8LA 5A5KA 4ZL9A 3FZ4A 2K18A 3WT1A 3IBHA 5ECOB 17GSA 2JZSA 4K8MA 4AJ8A 4YAVA 3NOFA 4L5OA 2C4JA 3C8EA 3GKXA 3FY7A 5HR2A 2JSZA 4K6XA 2QA2A 4G0LA 1SU9A 2VM1A 4MK3A 2GGTA 3LW9A 3QAVA 2OE0A 3VWVA 4WKWA 5F06A 3ZFLA 2R5GA 1S3CA 1XWBA 3IRAA 2V6KA 4F0CA 1F6MC 1VRSD 2PMTA 1GH2A 1FG4A 5IO2A 3HZ8A 4HUAA 1FOVA 2J23A 3ERFA 1X9MB 4KH7A 2JADA 2HSYA 2H70A 3SWLA 3KH9A 4EC0A 3JCML 1XW9A 1R5PA 3J7Yb 2EC4A 2JZRA 4KGIA 1T1VA 2REMA 4YH2A 2KUCA 5CP1A 5DQSA 4TR4A 1DUGA 1PKWA 2CA8A 4IS0A 4FIWA 4X4JA 4IW9A 4FO5A 4GF0A 2GZYA 4KAEA 2GQMA 4LL1B 4H86A 4ECJA 5IMDA 4Z2RA 3FR3A 5E59A 5D9WA 1XXUA 2X8HA 3CBUA 5IIZA 2Z9SA 2H73A 4NWYA 4KW6A 3GKNA 2HYXA 1K0BA 2CAQA 2A2RA 3APQA 4WETA 5J9CA 3UEMA 4MH3A 3KEBA 2JL4A 1LBKA 1K0MA 1DE1A 4TXOA 2R4VA 3GA4A 4JU5A 3TOUA 2K9FA 4V1Ag 4JBBA 1WIKA 3QD9A 5IO0A 2OJLA 4YKFA 5KN3A 4F0BA 3F9UA 3H8QA 3L4NA 1SK2A 3L9UA 5CRDA 3EYTA 3WYWA 1M7TA 3FRCA 2N5BA 3FR9A 3MNGA 2VL9A 2ON5A 2V6OA 1A2LA 2G2QA 5G2ZA 4F03A 1SKSB 2KLXA 1YY7A 4GSTA 5KOXA 1K0NA 1KEBA 2YPMA 5EPFA 4BWSA 2QGVA 3IHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ECQ B;  2H1A A;  3I69 A;  3KTL A;  4MZW A;  2VD1 A;  1TRS A;  1NW2 A;  4KE3 A;  6GSW A;  1SJI A;  2QSI A;  4K7I A;  1X9W B;  4XS6 A;  4NPB A;  3EC3 A;  2H19 A;  2L57 A;  1M2A A;  1ZL9 A;  2L4Q A;  4X0X A;  5G30 A;  1FVJ A;  3KCM A;  5AIS A;  1M2D A;  1EOH A;  1XWK A;  3GTU B;  20GS A;  4PXO A;  4QQ7 A;  2HXK A;  2H30 A;  3O3T A;  8GSS A;  1M2B A;  1TXX A;  4EO3 A;  3ZTL A;  1TU8 A;  4BWQ A;  2LRC A;  4LL4 B;  3NIV A;  1O8X A;  1JLW A;  2H01 A;  1A24 A;  4IP1 A;  1SK1 A;  4RUV A;  2OAD A;  2VUP A;  3D4M A;  1YKA A;  5ECR B;  3TGZ A;  3W8J A;  1ON4 A;  3RPN A;  1K3L A;  3TRX A;  1X9S B;  2VAF A;  1URM A;  1F3B A;  2H66 A;  4PNF A;  4F9Z A;  1A2J A;  4IBP A;  4TRX A;  3ZFB A;  5ECH B;  3BD2 A;  5H5S A;  4DSS A;  2AJQ B;  2XPE A;  4PQ1 A;  1BG5 A;  3MAK A;  2FWG A;  3GIX A;  2C0F A;  5ECM B;  13GS A;  2L6D A;  5ECI B;  2I9H A;  3KM6 A;  4XRA A;  1XZO A;  1XVQ A;  2K8V A;  2H1G A;  4CW9 A;  4TR1 A;  2GS3 A;  1M0U A;  4ML1 A;  2CZ3 A;  4ACS A;  5FT3 A;  1K0O A;  2FHE A;  4N0V A;  4E8E A;  3BOA A;  2E2G A;  4NXI A;  4OCF A;  2PPT A;  3K8N A;  1A8Y A;  2M46 A;  7GSS A;  3BCI A;  2V32 A;  5J3R A;  4PX1 A;  4HI7 A;  2LQO A;  4KA0 A;  1HNB A;  2F9S A;  4ZBB A;  3TUE A;  2DMM A;  1THX A;  3KGK A;  1W4V A;  3KH7 A;  1X5E A;  2VL2 A;  3OR5 A;  1HYU A;  2IFQ A;  1A2M A;  5G1K A;  2LKU A;  1XOA A;  5AIX A;  1T4Z A;  1F2E A;  2H6X A;  5HQP A;  5ELG A;  3M3M A;  2H76 A;  3VPQ A;  4FYB A;  4IQ1 A;  3EE2 A;  2DJK A;  3M0F A;  5ECP B;  3CSI A;  3DWV A;  3A3T A;  3LGC A;  19GS A;  1O6J A;  5DDL A;  2XC2 A;  1MDI A;  2IME A;  5ID2 A;  2K6V A;  1DE2 A;  4KSO A;  4MMM A;  5GAN D;  2IMD A;  4GQC A;  4NHW A;  3RAZ A;  3ZRE A;  1DBY A;  5L71 A;  16GS A;  3LQ7 A;  2H0I A;  1QGV A;  4Q5R A;  3GL5 A;  3UBK A;  2VCT A;  3DD3 A;  3DML A;  3QAW A;  2PU9 C;  1BQ7 A;  2VM2 A;  1F3A A;  3GKK A;  4AGS A;  3F63 A;  5IOX A;  1WRY A;  5ABR A;  2ZUP A;  4EKZ A;  5H5R A;  4LLR A;  1ERW A;  4WR5 A;  2NDO A;  1FAA A;  4GQF A;  4ZL8 A;  4MF7 A;  4DVC A;  4DSQ A;  1H75 A;  1Q98 A;  2DLX A;  5HFG A;  3G9B A;  5EY6 A;  4HQZ A;  3A2W A;  1J0F A;  1PRX A;  2HZE A;  2F8A A;  4HS1 A;  1SYR A;  2NBS A;  3N5O A;  1N2A A;  5IPG A;  3Q18 A;  5JCU A;  3TKR A;  1PGT A;  3P2A A;  3ISO A;  2ALB A;  2XPD A;  5IMZ A;  4ML6 A;  4GTU A;  5B8A A;  3WT2 A;  1SK0 A;  3CTG A;  4PQI A;  1JZD A;  3E0U A;  1V98 A;  9GSS A;  3TRP A;  1MD3 A;  1T3B A;  2YJ7 A;  1PL2 A;  4K7N A;  2YWM A;  5C04 A;  1JHB A;  5JCW A;  2OE1 A;  1GLP A;  2P31 A;  1KNG A;  2TRX A;  2C8U A;  5B6M A;  3DRN A;  2IMI A;  4TR0 A;  2GSQ A;  4G10 A;  3E9J B;  3BCK A;  3GKM A;  2H74 A;  2LJR A;  6GSU A;  2A4V A;  1GNE A;  2CVB A;  3H1N A;  1YKC A;  2CVD A;  4PGT A;  5IM9 A;  1UC7 A;  4TOP A;  4BPY A;  1XWG A;  2R6K A;  3LEF A;  3TKS A;  5KN0 A;  3DEX A;  1EEJ A;  2O85 A;  4OO4 A;  4XIH A;  1VF2 A;  1GLQ A;  2PVO C;  4YAP A;  2KP1 A;  5HFI A;  4JR4 A;  22GS A;  5HFK A;  2E0Q A;  2YAN A;  3KP9 A;  2YP6 A;  3VWX A;  3KP8 A;  3EUR A;  4G19 A;  2V41 A;  2GZP A;  2DC5 A;  1ZYQ B;  2DIZ A;  4KDY A;  3MSZ A;  2XBI A;  3N9J A;  1GTI A;  5CRG A;  5LD0 A;  3UAR A;  2YV9 A;  4L8E A;  2JU5 A;  1G6Y A;  1R5A A;  5IQY A;  1U3A A;  3HDC A;  2B5X A;  2GQK A;  5F07 A;  2VLT A;  2HI7 A;  1PL1 A;  1OC9 B;  2PER A;  1U87 A;  2YWN A;  3QFA C;  2WS2 A;  1SKW B;  2ON7 A;  5FHI A;  4HJM A;  4ZBD A;  2PN8 A;  4K9Z A;  1T8E B;  3LXZ A;  1GWC A;  1UVZ A;  1RK4 A;  3ZVJ A;  2AB6 A;  2TIR A;  1XWC A;  2GT5 A;  2P5Q A;  2VCX A;  2EIR A;  4MAB A;  1FB6 A;  1LJR A;  3IDV A;  4KUN A;  4O92 A;  3VWU A;  2RLI A;  4KCE A;  3R2Q A;  2P0G A;  3DVX A;  3E3E A;  5JWO B;  4CDO A;  3LOR A;  1TW9 A;  1K3O A;  1XVW A;  3ZLP A;  3APO A;  4GSN A;  3HY2 A;  1O85 A;  4BVX A;  5COH A;  6GSY A;  3FEU A;  1GSE A;  1X5C A;  1FB0 A;  4NAX A;  1TRU A;  3UIW A;  2G0F A;  3UAP A;  4POK A;  3G7J A;  1HD2 A;  3WD6 A;  2QKE A;  3IC4 A;  5CO3 A;  4N0Z A;  2PWJ A;  2MBS A;  4JE1 A;  4L5L A;  1TK0 B;  4KDX A;  4EF0 A;  1ILO A;  3F4S A;  2YN1 A;  2IIY A;  4P3Y B;  1GUH A;  5CRE A;  3WGX A;  2FCH A;  3C73 A;  4OCE A;  5DBQ A;  2C0G A;  2DJ3 A;  3FW2 A;  4AF2 A;  5IMV A;  1BAY A;  2AAW A;  1Z7R A;  1FW1 A;  2H71 A;  3FZ5 A;  5J41 A;  3ZIT A;  1U88 A;  1XWA A;  4F2I A;  1AUC A;  4HU7 A;  4EVM A;  5AGY A;  5AN1 A;  1HNC A;  4MDC A;  1T00 A;  4JR6 A;  5J9B A;  3GV1 A;  5DQY A;  1XFL A;  4IVF A;  1AQX A;  1Y25 A;  1Z3E A;  4ZIL A;  4OMV A;  4ECC A;  4O32 A;  1YDK A;  4OFT A;  1MDK A;  3F0I A;  1OC3 A;  2B6M A;  3CSJ A;  1K0D A;  3F3R A;  3S9F A;  3GN3 A;  1ZZY A;  3U5R E;  2WRT A;  3M9K A;  2LJK A;  6GSV A;  4GWR A;  2GVP A;  5CAX A;  1QXH A;  3ME7 A;  1TRW A;  2LV3 A;  4ECI A;  4RI6 A;  2BMX A;  3TB2 A;  1OE7 A;  3CRU A;  3TJF A;  1T4Y A;  1KTE A;  4POM A;  3H79 A;  10GS A;  1USB A;  2IN3 A;  5IPH A;  2C0D A;  5ENU A;  3BJ5 A;  2FA4 A;  3ZIJ A;  3KTB A;  1GTU A;  3HJP A;  2YZH A;  3IK7 A;  2BJX A;  1MTC A;  1OKT A;  4XS4 A;  1M99 A;  4GRF A;  1ERV A;  2KP2 A;  3F4R A;  2YOI A;  1G7E A;  2B5E A;  3FR6 A;  4EDY A;  3CSH A;  4EL1 A;  4N30 A;  2YWO A;  1AQV A;  5D93 A;  3UVT A;  1IYI A;  2MBT A;  4OFM A;  5ECS A;  3LYP A;  2FWE A;  2IJY A;  4KB3 A;  5AIV A;  3D5J A;  1GUM A;  2L5O A;  1AIU A;  2B3S A;  4PUR A;  2NPB A;  3VK9 A;  2EIO A;  3D22 A;  3BBY A;  4J2F A;  4XHM A;  1ZOF A;  2GZZ A;  3HVX A;  5G5E A;  1TRV A;  4EE0 A;  2FNO A;  3VWW A;  3GX0 A;  4I5Q A;  3EU4 A;  3IOS A;  4Q5N A;  5IOW A;  3GYK A;  2E7P A;  2LST A;  12GS A;  2I4A A;  2YV7 A;  1ACV A;  1OYJ A;  2NTO A;  2FY6 A;  2DML A;  2CT6 A;  3L0H A;  2C1Y A;  2IPA A;  2VCQ A;  5EL8 A;  5A4V A;  2ZNM A;  1X5D A;  2H75 A;  5B7C A;  4RQR A;  2I3Y A;  2DBC A;  4EXJ A;  2I1U A;  4N10 A;  2PGT A;  4CHS A;  5D9T A;  3W6G A;  1DSB A;  2GST A;  1SL1 B;  1SJ6 A;  5DAK A;  3TKQ A;  1U6T A;  3KZQ A;  3VLN A;  4JED A;  4LMV A;  1XIY A;  2C80 A;  1VF4 A;  2XHF A;  5J4U A;  3EU3 A;  1V9W A;  4HJ2 A;  2DIY A;  1C72 A;  3DIE A;  1J08 A;  3HCZ A;  3C1R A;  2WZ9 A;  3KIJ A;  2GQL A;  4AJ7 A;  2B7K A;  4K0N A;  3LSZ A;  3MWH A;  3UJ1 A;  14GS A;  3A2V A;  5A4U A;  3TCO A;  3QCP A;  2WGR A;  4TKY A;  1B4Q A;  3WGD A;  1GTA A;  2X8G A;  4K7O A;  5CRH A;  4KCA A;  4EUY A;  2R2J A;  2H6Z A;  4I2T A;  3CXG A;  3RHC A;  3RHB A;  1UA5 A;  2HT9 A;  3PH9 A;  1B9X C;  2H1B A;  1EV4 A;  4PNG A;  2CZ2 A;  4K0G A;  1TJD A;  5DAL A;  2YCD A;  3J7Y k;  1S3A A;  1YJ6 A;  2TRC P;  3D4T A;  4V2L A;  4D73 A;  1O81 A;  4WEY A;  1TU7 A;  3H4K A;  2WCI A;  2L4C A;  5IMC A;  2OE3 A;  3GNJ A;  2K8S A;  1F37 A;  3IA1 A;  4WF5 A;  1EOG A;  1Z9H A;  3TKP A;  2HSH A;  3DGQ A;  2A2S A;  1LU4 A;  1OVN A;  4ZIJ A;  1A8L A;  3TJG A;  4IJI A;  2H6Y A;  2ES7 A;  2HZF A;  3HYP A;  3VPT A;  3ZZX A;  3LFL A;  4ZL7 A;  1YQ1 A;  1B48 A;  3F4T A;  1AAZ A;  2OBI A;  2O89 A;  1V57 A;  2VO4 A;  5JWQ B;  1RW1 A;  4NMU A;  3ZL5 A;  3GUR A;  1B9Y C;  2HRN A;  3UMA A;  2E2M A;  3TJK A;  3GSS A;  3HJO A;  1OC9 A;  4HOJ A;  1W89 A;  2YZU A;  3A2X A;  2RM6 A;  2MZC A;  1Z6N A;  2FD3 A;  3A5W A;  4OO5 A;  2VL3 A;  4EDZ A;  3U6V A;  3HXS A;  2O7K A;  1GSU A;  1R4W A;  2WJU A;  2IL3 A;  3M8N A;  1Y6E A;  3PGT A;  1TK8 B;  3IAS 2;  1B8X A;  2R37 A;  1A0R P;  1B4P A;  1OAZ A;  4L0U A;  2LTK A;  4FYU A;  1SD9 A;  2VD0 A;  4TXV A;  3TRQ A;  4F82 A;  2GDR A;  4HQS A;  5KN2 A;  3ZMK A;  4DEJ A;  4BL7 A;  4L0W A;  2FLS A;  4ID0 A;  1QMV A;  3NZN A;  4XCS A;  5JCG A;  5F0G A;  1G6W A;  4X1U A;  1MDJ A;  4WF4 A;  1ZCP A;  2MMA A;  2MMN A;  4GSS A;  4ZBA A;  3HD5 A;  2X99 A;  4J57 E;  4HU9 A;  1AW9 A;  2H0G A;  1XBS A;  2FA8 A;  3W8S A;  1TI1 A;  1QK8 A;  2CVK A;  1SEN A;  1PA3 A;  3TJJ A;  4I8B A;  4KSM A;  4ECB A;  5IMA A;  2FGX A;  4ISD A;  4WBR D;  3ZRD A;  5G5F A;  1V58 A;  3CYN A;  2BTO T;  3L78 A;  2H0H A;  2OA7 A;  1K0C A;  1JFU A;  5ECL B;  4YQM A;  4RI7 A;  4FYC A;  4XTS A;  5ECK B;  3ERG A;  4G2E A;  3TOT A;  1SD8 A;  4J56 E;  3GH9 A;  1ML6 A;  3Q74 A;  3HHV A;  5B8B A;  3V1W A;  5ID2 B;  1EP8 A;  2CAI A;  3DKS A;  3ME8 A;  1PMT A;  5ECN B;  4XRD A;  4MF5 A;  2V1M A;  5GZZ B;  1VF1 A;  1YF0 A;  3IR4 A;  3GX8 A;  4MJC A;  1XW6 A;  1JZO A;  3KD0 A;  3EMP A;  1EP7 A;  1O73 A;  3GUS A;  5ELA A;  2YJH A;  1ERT A;  3F8U A;  2LRT A;  3C1S A;  4NV2 A;  5GST A;  2FWF A;  2LJA A;  1I5G A;  3FK8 A;  4Q5Q A;  1EWX A;  1AC1 A;  4BVY A;  1K3Y A;  1T7P B;  1ZGN A;  4MZC A;  2VCZ A;  1THO A;  2DJ2 A;  1PKZ A;  4KX4 A;  2L59 A;  3HVV A;  1OC8 A;  2AV4 A;  3QAG A;  4ZB8 A;  3GTU A;  3IAM 2;  2DJ1 A;  4IQA A;  3G7I A;  3GH6 A;  1QUW A;  1ERU A;  2DJJ A;  2HZE B;  2QC7 A;  4IHU A;  1GSY A;  3DVW A;  2DSA A;  1PX6 A;  1GL8 A;  1OE8 A;  1TDI A;  2GSS A;  1JZW A;  2PUK C;  1R26 A;  3LWA A;  2IMF A;  3VI5 A;  4IEL A;  2CV4 A;  1OKD A;  1EGO A;  1EV9 A;  1U3I A;  5LNK e;  4OD7 A;  5F05 A;  2ZCT A;  5KEJ A;  1JLV A;  3I43 A;  1WP0 A;  1SYX A;  4OFN A;  3G7Y A;  1YZX A;  4ULX A;  3EWL A;  2CX3 A;  2XBQ A;  3RBT A;  3QR6 A;  3M9J A;  4V2M A;  4HEA 2;  5DVB A;  4V2N A;  2IMK A;  4RQX A;  4MP4 A;  1SL0 B;  1GUL A;  1A0F A;  1WWJ A;  2VL2 C;  1K0A A;  4ZB9 A;  1MEK A;  3IXR A;  1V2A A;  4DSR A;  4N11 A;  4PUA A;  1PX7 A;  1SJZ A;  3RDW A;  4QL7 A;  2C0E A;  5B6N A;  4KDU A;  1I9D A;  1V40 A;  5HR0 A;  1NHO A;  3C7M A;  4ZXG A;  1VGL A;  3TJB A;  2FUG 2;  2OKA A;  3P8W A;  2DJ0 A;  1Z7P A;  2MMO A;  3HZ4 A;  1XOB A;  2CQ9 A;  4QL9 A;  2F8F A;  3HJM A;  2V2G A;  1XPV A;  3QMX A;  4TR3 A;  1Z6M A;  2F3M A;  1QFN A;  1FHE A;  3DXB A;  1TOF A;  6GSS A;  3D6I A;  2O87 A;  3FZA A;  2HLS A;  3LYK A;  3GST A;  4X43 A;  2B7J A;  2GTU A;  5GAP D;  3KMN A;  1N8J A;  4WXT A;  3D0Z A;  4TW5 A;  3QOU A;  4Z7X A;  1A23 A;  3QDN A;  2P5R A;  3LJR A;  2N5F A;  3CTF A;  1AXD A;  1EZK A;  2VOC A;  4MA9 A;  2LUS A;  3P7X A;  3KJY A;  3O76 A;  3VUR A;  3LXT A;  1Z5Y E;  4BA7 A;  3UOM A;  2B1L A;  3US3 A;  3WGE A;  1GP1 A;  2VCW A;  1WJK A;  3IV4 A;  3UVH A;  1YEX A;  2AHE A;  2VIM A;  1WPI A;  3MDK A;  4TVE A;  1WE0 A;  2WUL A;  3PIN A;  2B1K A;  5GSS A;  2B5Y A;  3IHQ A;  2VCV A;  2IWT A;  1FO5 A;  2KHP A;  1JZR A;  2AUV A;  4HDE A;  3ZYW A;  1SKR B;  4TN8 A;  4IKH A;  5HR1 A;  1TKD B;  5INY A;  2I81 A;  1O7U A;  2GLR A;  3GRX A;  2VLV A;  5C00 A;  2LQQ A;  2N5A A;  3FZ9 A;  1GSF A;  3Q6O A;  4MZB A;  1RQM A;  6GSX A;  3IK9 A;  1ZYE A;  1FVK A;  3TDG A;  3I9V 2;  3DYR A;  4MPF A;  3GL3 A;  5DCH A;  4WBJ A;  5CNW A;  3APS A;  4K2D A;  4JRR A;  4Q5F A;  3L9V A;  4TXO B;  2RUF A;  2HRF A;  3ERW A;  3FKF A;  3TKS C;  1XW5 A;  3QFB C;  5J5N A;  1EEM A;  3EMX A;  2WFC A;  4ZB6 A;  1TI3 A;  2C3Q A;  5JWR B;  2F51 A;  2C3N A;  4HZ2 A;  2LEG A;  4GLT A;  5D9X A;  18GS A;  1TTZ A;  3HA9 A;  3P90 A;  2AYT A;  4K1F A;  2HE3 A;  1PN9 A;  1CQG A;  1E6B A;  5CYY A;  4GCI A;  4OWY A;  3FYG A;  5HR3 A;  1GNW A;  1R7H A;  4MF6 A;  5DCG A;  2PVQ A;  3D21 A;  2VLU A;  2X8C A;  4LMW A;  3GHA A;  1CQH A;  3EVI A;  5G1L A;  1ZMA A;  5KN1 A;  4XS1 A;  4IGJ A;  4MLY A;  4LA1 A;  1HQO A;  1PQN A;  3ZIV A;  3ZML A;  5CRW A;  2FWH A;  2WB9 A;  4XS4 B;  2YWI A;  2RII A;  1NHY A;  3M1G A;  11GS A;  4POB A;  3TKS E;  4O7H A;  1ST9 A;  1TK5 B;  1GUK A;  3I6A A;  1H4O A;  3FHK A;  3SBC A;  3ED3 A;  2RM5 A;  2HNL A;  4NV5 A;  1TP9 A;  4MH2 A;  3KXO A;  3L9S A;  1BED A;  2J9H A;  4JZQ A;  2OAC A;  2PBJ A;  1AQW A;  3CMI A;  3HKR A;  2M80 A;  2H1D A;  1Q4J A;  4V1A p;  5IMF A;  3UBL A;  1PSQ A;  1GSD A;  3C71 A;  1O8W A;  3H93 A;  3F6D A;  5LCZ A;  3QPM A;  3IE3 A;  4DSS B;  1M9B A;  5F8B A;  3Q19 A;  4ILF A;  2M72 A;  3GFK A;  4MJE A;  1S3D A;  4IP6 A;  4E8H A;  4WR4 A;  4HZ4 A;  1UN2 A;  1MD4 A;  4KND A;  5H5Q A;  4TR1 B;  1BYE A;  3KMO A;  2HFD A;  2OBK A;  4YQU A;  1G7O A;  4PQH A;  1G0T A;  3CRT A;  1M9A A;  2L6C A;  3LG6 A;  1NSW A;  1E2Y A;  1KBN A;  2L5L A;  5DAK B;  2LNS A;  4MJA A;  4GXZ A;  1X0R A;  2KOK A;  3F6F A;  3F3Q A;  4PUF C;  3UL3 A;  1GSQ A;  5DJM A;  1QQ2 A;  5A4W A;  2LS5 A;  5D9V A;  1IYH A;  2MYG A;  2C3T A;  1F9M A;  4FH8 A;  3O6T A;  2RUE A;  4O5R A;  2O8V B;  4NHZ A;  2JZT A;  2WDU A;  3VI7 A;  4AJ6 A;  5DJL A;  2MMZ A;  3VFI A;  1XCC A;  1VF3 A;  2H72 A;  1YF1 A;  4IJ3 A;  2IFQ B;  2R3X A;  3IPZ A;  2CX4 A;  4POL A;  1BX9 A;  6GST A;  5EVO A;  2LNT A;  4IN0 A;  1PD2 1;  5DAL B;  5G31 A;  4I97 A;  1J9B A;  3PR8 A;  1BJX A;  5E4W A;  3HVS A;  4D73 B;  1YEP A;  5D8I A;  2JSY A;  1WMJ A;  2EIQ A;  4MPG A;  5D96 A;  1EGR A;  2YNX A;  3AY8 A;  4G9H A;  2GT6 A;  1ABA A;  3ZVJ D;  1GRX A;  2JAC A;  3RPP A;  4YQV A;  2NVL A;  3EIN A;  1HNA A;  2LRN A;  5D73 A;  2X64 A;  1NM3 A;  2D2Z A;  1GSS A;  1SL2 B;  4I2U A;  1GTB A;  1WOU A;  4MCU A;  3GMF A;  4I6X A;  2GSR A;  5FWG A;  4MJB A;  2H8L A;  5A5K A;  4ZL9 A;  3FZ4 A;  2K18 A;  3WT1 A;  3IBH A;  5ECO B;  17GS A;  2JZS A;  4K8M A;  4AJ8 A;  4YAV A;  3NOF A;  4L5O A;  2C4J A;  3C8E A;  3GKX A;  3FY7 A;  5HR2 A;  2JSZ A;  4K6X A;  1SU9 A;  2VM1 A;  4MK3 A;  2GGT A;  3QAV A;  2OE0 A;  3VWV A;  4WKW A;  5F06 A;  3ZFL A;  2R5G A;  1S3C A;  1XWB A;  3IRA A;  2V6K A;  4F0C A;  1F6M C;  1VRS D;  2PMT A;  1GH2 A;  1FG4 A;  5IO2 A;  3HZ8 A;  4HUA A;  1FOV A;  2J23 A;  3ERF A;  1X9M B;  4KH7 A;  2JAD A;  2HSY A;  2H70 A;  3SWL A;  3KH9 A;  4EC0 A;  3JCM L;  1XW9 A;  1R5P A;  3J7Y b;  2EC4 A;  2JZR A;  4KGI A;  1T1V A;  2REM A;  4YH2 A;  2KUC A;  5CP1 A;  5DQS A;  4TR4 A;  1DUG A;  1PKW A;  2CA8 A;  4IS0 A;  4FIW A;  4IW9 A;  4FO5 A;  4GF0 A;  2GZY A;  4KAE A;  2GQM A;  4LL1 B;  4H86 A;  4ECJ A;  5IMD A;  3FR3 A;  5E59 A;  5D9W A;  1XXU A;  2X8H A;  3CBU A;  5IIZ A;  2Z9S A;  2H73 A;  4NWY A;  4KW6 A;  3GKN A;  2HYX A;  1K0B A;  2CAQ A;  2A2R A;  3APQ A;  4WET A;  5J9C A;  3UEM A;  4MH3 A;  3KEB A;  2JL4 A;  1LBK A;  1K0M A;  1DE1 A;  4TXO A;  2R4V A;  3GA4 A;  4JU5 A;  3TOU A;  2K9F A;  4V1A g;  4JBB A;  1WIK A;  3QD9 A;  5IO0 A;  2OJL A;  5KN3 A;  4F0B A;  3F9U A;  3H8Q A;  3L4N A;  1SK2 A;  3L9U A;  5CRD A;  3EYT A;  3WYW A;  1M7T A;  3FRC A;  2N5B A;  3FR9 A;  3MNG A;  2VL9 A;  2ON5 A;  2V6O A;  1A2L A;  2G2Q A;  5G2Z A;  4F03 A;  1SKS B;  2KLX A;  1YY7 A;  4GST A;  1K0N A;  1KEB A;  2YPM A;  5EPF A;  4BWS A;  2QGV A; 
#chains in the Genus database with same CATH topology
 5ECQ B;  2H1A A;  3I69 A;  3KTL A;  4MZW A;  2VD1 A;  1TRS A;  1NW2 A;  4KE3 A;  6GSW A;  1SJI A;  2QSI A;  4K7I A;  1X9W B;  4XS6 A;  4NPB A;  3EC3 A;  2H19 A;  2L57 A;  1M2A A;  1ZL9 A;  2L4Q A;  4X0X A;  5G30 A;  1FVJ A;  3KCM A;  5AIS A;  1M2D A;  1EOH A;  1XWK A;  3GTU B;  20GS A;  4PXO A;  4QQ7 A;  2HXK A;  2H30 A;  3O3T A;  8GSS A;  1M2B A;  1TXX A;  4EO3 A;  3ZTL A;  1TU8 A;  4BWQ A;  2LRC A;  4LL4 B;  3NIV A;  1O8X A;  1JLW A;  2H01 A;  1A24 A;  4IP1 A;  1SK1 A;  4RUV A;  5BRT A;  2OAD A;  2VUP A;  4KF9 A;  3D4M A;  1YKA A;  5ECR B;  3TGZ A;  3W8J A;  1ON4 A;  3RPN A;  1K3L A;  3TRX A;  1X9S B;  2VAF A;  1URM A;  1F3B A;  2H66 A;  4PNF A;  4F9Z A;  1A2J A;  4IBP A;  4TRX A;  3ZFB A;  5ECH B;  3BD2 A;  5H5S A;  4DSS A;  2AJQ B;  2XPE A;  4PQ1 A;  1BG5 A;  3MAK A;  2FWG A;  3GIX A;  2C0F A;  5ECM B;  13GS A;  2L6D A;  5ECI B;  2I9H A;  3KM6 A;  4XRA A;  1XZO A;  1XVQ A;  2K8V A;  2H1G A;  4CW9 A;  4TR1 A;  2GS3 A;  1M0U A;  4ML1 A;  2CZ3 A;  4ACS A;  5FT3 A;  1K0O A;  2FHE A;  4N0V A;  4E8E A;  3BOA A;  2E2G A;  4NXI A;  4OCF A;  2PPT A;  3K8N A;  1A8Y A;  2M46 A;  7GSS A;  3BCI A;  2V32 A;  5J3R A;  4PX1 A;  4HI7 A;  2LQO A;  4KA0 A;  1HNB A;  4G0K A;  2F9S A;  4ZBB A;  1S3R A;  3TUE A;  2DMM A;  1THX A;  3KGK A;  1W4V A;  2QA1 A;  1ZYN A;  3KH7 A;  1X5E A;  2VL2 A;  3OR5 A;  1HYU A;  2HSM A;  2IFQ A;  1A2M A;  5G1K A;  2LKU A;  1XOA A;  5AIX A;  1T4Z A;  1F2E A;  2H6X A;  5HQP A;  5ELG A;  3M3M A;  2H76 A;  3VPQ A;  4FYB A;  4IQ1 A;  3EE2 A;  2DJK A;  3M0F A;  5ECP B;  3CSI A;  3DWV A;  3A3T A;  3LGC A;  19GS A;  1O6J A;  5DDL A;  2XC2 A;  1MDI A;  2IME A;  5ID2 A;  2X49 A;  2K6V A;  1DE2 A;  4KSO A;  4MMM A;  5GAN D;  2IMD A;  4GQC A;  4NHW A;  3RAZ A;  3ZRE A;  1DBY A;  5L71 A;  16GS A;  3LQ7 A;  2H0I A;  4Z2U A;  1QGV A;  4Q5R A;  3GL5 A;  3HVN A;  3UBK A;  2VCT A;  3DD3 A;  3DML A;  3QAW A;  2PU9 C;  1BQ7 A;  2VM2 A;  1F3A A;  3GKK A;  4AGS A;  3F63 A;  5IOX A;  1WRY A;  5ABR A;  2ZUP A;  4EKZ A;  5H5R A;  4LLR A;  1ERW A;  4WR5 A;  2NDO A;  1FAA A;  3A5I A;  4GQF A;  4ZL8 A;  4MF7 A;  4DVC A;  4DSQ A;  1H75 A;  1Q98 A;  2DLX A;  5HFG A;  3G9B A;  5EY6 A;  3PPU A;  4HQZ A;  3A2W A;  1J0F A;  1PRX A;  4FQU A;  2HZE A;  2F8A A;  4HS1 A;  1SYR A;  2NBS A;  3N5O A;  1N2A A;  5IPG A;  3Q18 A;  4YKG A;  5JCU A;  3TKR A;  2R0G A;  1PGT A;  3P2A A;  3ISO A;  2ALB A;  2XPD A;  5IMZ A;  4ML6 A;  4GTU A;  5B8A A;  3WT2 A;  4PTS A;  1SK0 A;  3CTG A;  4PQI A;  1JZD A;  3E0U A;  1V98 A;  9GSS A;  3TRP A;  1MD3 A;  1T3B A;  2YJ7 A;  1PL2 A;  4K7N A;  2YWM A;  5C04 A;  1JHB A;  5JCW A;  2OE1 A;  1GLP A;  2P31 A;  1KNG A;  2TRX A;  2C8U A;  5B6M A;  3DRN A;  2IMI A;  4TR0 A;  2GSQ A;  4G10 A;  3E9J B;  3BCK A;  3GKM A;  2H74 A;  2LJR A;  6GSU A;  2A4V A;  1GNE A;  2CVB A;  3H1N A;  1YKC A;  2CVD A;  4PGT A;  5IM9 A;  1UC7 A;  4TOP A;  4BPY A;  1XWG A;  2R6K A;  3LEF A;  3TKS A;  5KN0 A;  3DEX A;  1EEJ A;  1PN0 A;  2O85 A;  4OO4 A;  4XIH A;  1VF2 A;  1GLQ A;  2PVO C;  4YAP A;  2KP1 A;  5HFI A;  4JR4 A;  22GS A;  5HFK A;  2E0Q A;  2YAN A;  3KP9 A;  2YP6 A;  3VWX A;  3KP8 A;  3EUR A;  4G19 A;  2V41 A;  2GZP A;  2DC5 A;  1ZYQ B;  2DIZ A;  4KDY A;  3MSZ A;  2XBI A;  3N9J A;  1GTI A;  5CRG A;  5LD0 A;  3UAR A;  2YV9 A;  4L8E A;  2JU5 A;  1G6Y A;  1R5A A;  5IQY A;  1U3A A;  3HDC A;  2B5X A;  2GQK A;  5F07 A;  2VLT A;  2HI7 A;  1PL1 A;  1OC9 B;  2PER A;  4CY6 A;  1U87 A;  2YWN A;  3QFA C;  2WS2 A;  1SKW B;  2ON7 A;  5FHI A;  4HJM A;  4ZBD A;  2PN8 A;  4K9Z A;  1T8E B;  3LXZ A;  1GWC A;  1UVZ A;  1RK4 A;  3ZVJ A;  2AB6 A;  2TIR A;  1XWC A;  2GT5 A;  2P5Q A;  2VCX A;  2EIR A;  4MAB A;  1FB6 A;  1LJR A;  3IDV A;  4KUN A;  4O92 A;  3VWU A;  2RLI A;  4KCE A;  4BL7 B;  3R2Q A;  2P0G A;  3DVX A;  3E3E A;  5JWO B;  4CDO A;  3LOR A;  1TW9 A;  1K3O A;  1XVW A;  3ZLP A;  3APO A;  4GSN A;  3HY2 A;  1O85 A;  4BVX A;  5COH A;  6GSY A;  3FEU A;  1GSE A;  1X5C A;  1FB0 A;  4NAX A;  1TRU A;  3UIW A;  2G0F A;  3UAP A;  4POK A;  3G7J A;  1HD2 A;  3WD6 A;  2QKE A;  3IC4 A;  5CO3 A;  4N0Z A;  2PWJ A;  2MBS A;  4JE1 A;  4L5L A;  1TK0 B;  4KDX A;  4EF0 A;  1ILO A;  3F4S A;  2YN1 A;  2IIY A;  4P3Y B;  1GUH A;  5CRE A;  3WGX A;  2FCH A;  3C73 A;  4OCE A;  5DBQ A;  2C0G A;  2DJ3 A;  3FW2 A;  4AF2 A;  5IMV A;  1BAY A;  2AAW A;  1Z7R A;  1FW1 A;  2H71 A;  3FZ5 A;  5J41 A;  3ZIT A;  1U88 A;  1XWA A;  5KOW A;  4F2I A;  1AUC A;  4HU7 A;  4EVM A;  5AGY A;  5AN1 A;  1HNC A;  4MDC A;  1T00 A;  4JR6 A;  5J9B A;  3GV1 A;  5DQY A;  1XFL A;  4IVF A;  1AQX A;  1Y25 A;  1Z3E A;  4ZIL A;  4OMV A;  4ECC A;  4O32 A;  1YDK A;  4OFT A;  1MDK A;  3F0I A;  1OC3 A;  2B6M A;  3CSJ A;  1K0D A;  3F3R A;  3S9F A;  3MIX A;  3GN3 A;  1ZZY A;  3U5R E;  2WRT A;  3M9K A;  2LJK A;  6GSV A;  4GWR A;  2GVP A;  5CAX A;  1QXH A;  3ME7 A;  1TRW A;  2LV3 A;  4ECI A;  4RI6 A;  2BMX A;  3TB2 A;  1OE7 A;  3CRU A;  3TJF A;  1T4Y A;  1KTE A;  4POM A;  3H79 A;  10GS A;  1USB A;  2IN3 A;  5IPH A;  2C0D A;  5ENU A;  3BJ5 A;  2FA4 A;  3ZIJ A;  3KTB A;  1GTU A;  2DKH A;  3HJP A;  4BVY B;  2YZH A;  3IK7 A;  2BJX A;  1MTC A;  1OKT A;  4XS4 A;  1M99 A;  4GRF A;  1ERV A;  2KP2 A;  3F4R A;  2YOI A;  1G7E A;  2B5E A;  3FR6 A;  4EDY A;  3CSH A;  4EL1 A;  4N30 A;  2YWO A;  1AQV A;  4K5S A;  5D93 A;  3UVT A;  1IYI A;  2MBT A;  4OFM A;  5ECS A;  3LYP A;  2FWE A;  2IJY A;  4KB3 A;  5AIV A;  3D5J A;  1GUM A;  2L5O A;  1AIU A;  2B3S A;  4PUR A;  2NPB A;  3VK9 A;  2EIO A;  3D22 A;  3BBY A;  4J2F A;  4XHM A;  1ZOF A;  2GZZ A;  3HVX A;  5G5E A;  1TRV A;  4EE0 A;  2FNO A;  3VWW A;  3GX0 A;  4I5Q A;  3EU4 A;  3IOS A;  4Q5N A;  5IOW A;  3GYK A;  2E7P A;  2LST A;  12GS A;  2I4A A;  2YV7 A;  1ACV A;  1OYJ A;  2NTO A;  2FY6 A;  2DML A;  2CT6 A;  3L0H A;  2C1Y A;  2IPA A;  2VCQ A;  5EL8 A;  5A4V A;  2ZNM A;  4EIQ A;  1X5D A;  2H75 A;  5B7C A;  4RQR A;  2I3Y A;  2DBC A;  4EXJ A;  2I1U A;  4N10 A;  2PGT A;  4CHS A;  5D9T A;  3W6G A;  1DSB A;  2GST A;  1SL1 B;  1SJ6 A;  5DAK A;  4MNN A;  3TKQ A;  1U6T A;  3KZQ A;  3VLN A;  4JED A;  4LMV A;  1XIY A;  2C80 A;  1VF4 A;  2XHF A;  5J4U A;  3EU3 A;  1V9W A;  4HJ2 A;  2DIY A;  1C72 A;  3DIE A;  1J08 A;  3HCZ A;  3C1R A;  2WZ9 A;  3KIJ A;  3FMW A;  2GQL A;  4AJ7 A;  2B7K A;  4K0N A;  3LSZ A;  3MWH A;  3UJ1 A;  14GS A;  3A2V A;  5A4U A;  3TCO A;  3QCP A;  2WGR A;  4TKY A;  1B4Q A;  2X4A A;  3WGD A;  1GTA A;  2X8G A;  4K7O A;  5CRH A;  4KCA A;  4EUY A;  2R2J A;  2H6Z A;  4I2T A;  4K2X A;  3CXG A;  3RHC A;  3RHB A;  1UA5 A;  2HT9 A;  3PH9 A;  1B9X C;  2H1B A;  1EV4 A;  4PNG A;  2CZ2 A;  4K0G A;  1TJD A;  5DAL A;  2YCD A;  3J7Y k;  1S3A A;  1YJ6 A;  2HRA A;  2TRC P;  3D4T A;  4HSC X;  4V2L A;  4D73 A;  1O81 A;  2HRK A;  4WEY A;  1TU7 A;  3H4K A;  2WCI A;  2L4C A;  5IMC A;  2OE3 A;  3GNJ A;  2K8S A;  1F37 A;  3IA1 A;  4WF5 A;  1EOG A;  1Z9H A;  3TKP A;  2HSH A;  3DGQ A;  2A2S A;  1LU4 A;  1OVN A;  4ZIJ A;  1A8L A;  3TJG A;  4IJI A;  2H6Y A;  2ES7 A;  2HZF A;  3HYP A;  3VPT A;  3ZZX A;  3LFL A;  4ZL7 A;  1YQ1 A;  1B48 A;  3F4T A;  1AAZ A;  4A5P A;  2OBI A;  2O89 A;  1V57 A;  2VO4 A;  5JWQ B;  1RW1 A;  4NMU A;  3ZL5 A;  3GUR A;  1B9Y C;  2HRN A;  3UMA A;  2E2M A;  3TJK A;  1XG8 A;  2R0P A;  3GSS A;  3HJO A;  1OC9 A;  4HOJ A;  1W89 A;  2YZU A;  3A2X A;  2RM6 A;  2MZC A;  1Z6N A;  2FD3 A;  3A5W A;  4OO5 A;  2VL3 A;  4EDZ A;  3U6V A;  3HXS A;  2O7K A;  1GSU A;  1R4W A;  2WJU A;  2IL3 A;  3M8N A;  1Y6E A;  3PGT A;  1TK8 B;  3IAS 2;  1B8X A;  2R37 A;  1A0R P;  1B4P A;  1OAZ A;  4L0U A;  2LTK A;  4FYU A;  1SD9 A;  2VD0 A;  4TXV A;  3TRQ A;  4F82 A;  2GDR A;  4HQS A;  5KN2 A;  3ZMK A;  4DEJ A;  4BL7 A;  4L0W A;  2FLS A;  4ID0 A;  1QMV A;  3NZN A;  4XCS A;  4BIK A;  5JCG A;  5F0G A;  1G6W A;  4X1U A;  1MDJ A;  4WF4 A;  1ZCP A;  2MMA A;  2MMN A;  3R3E A;  4GSS A;  4ZBA A;  3HD5 A;  2X99 A;  4J57 E;  4HU9 A;  1AW9 A;  1M3J A;  2H0G A;  1XBS A;  2FA8 A;  3W8S A;  1TI1 A;  1QK8 A;  2CVK A;  1SEN A;  1PA3 A;  3TJJ A;  2UZ8 A;  4I8B A;  4KSM A;  4ECB A;  5IMA A;  2FGX A;  4ISD A;  4WBR D;  3ZRD A;  5G5F A;  1V58 A;  3CYN A;  2BTO T;  3L78 A;  2H0H A;  2OA7 A;  1FOH A;  1K0C A;  1JFU A;  5ECL B;  4YQM A;  4RI7 A;  4FYC A;  4XTS A;  5ECK B;  3ERG A;  4G2E A;  3TOT A;  1SD8 A;  4J56 E;  3GH9 A;  1ML6 A;  3Q74 A;  3HHV A;  5B8B A;  3V1W A;  5ID2 B;  3EPT A;  1EP8 A;  2CAI A;  3DKS A;  3ME8 A;  1PMT A;  5ECN B;  4XRD A;  4MF5 A;  2V1M A;  5GZZ B;  1VF1 A;  1YF0 A;  3IR4 A;  3GX8 A;  1PFO A;  4MJC A;  1XW6 A;  1JZO A;  3KD0 A;  3EMP A;  1EP7 A;  1O73 A;  3GUS A;  5ELA A;  2YJH A;  1ERT A;  5BMU A;  3F8U A;  2LRT A;  3C1S A;  4NV2 A;  5GST A;  2FWF A;  2LJA A;  1I5G A;  3FK8 A;  4Q5Q A;  1EWX A;  1AC1 A;  4BVY A;  1K3Y A;  1T7P B;  1ZGN A;  4MZC A;  2VCZ A;  1THO A;  2DJ2 A;  1PKZ A;  4KX4 A;  2L59 A;  3HVV A;  1OC8 A;  2AV4 A;  3QAG A;  4ZB8 A;  3GTU A;  3IAM 2;  2DJ1 A;  4IQA A;  3G7I A;  3GH6 A;  1QUW A;  1ERU A;  2DJJ A;  2HZE B;  2QC7 A;  4IHU A;  1GSY A;  3DVW A;  2DSA A;  4G0I A;  1PX6 A;  1GL8 A;  1OE8 A;  1TDI A;  2GSS A;  1JZW A;  2PUK C;  1R26 A;  3LWA A;  2IMF A;  3VI5 A;  4IEL A;  2CV4 A;  4USS A;  1OKD A;  1EGO A;  1EV9 A;  1U3I A;  5LNK e;  4OD7 A;  5F05 A;  2ZCT A;  5KEJ A;  1JLV A;  3I43 A;  1WP0 A;  1SYX A;  4OFN A;  3G7Y A;  1YZX A;  4ULX A;  3EWL A;  2CX3 A;  2XBQ A;  3RBT A;  3QR6 A;  3M9J A;  4V2M A;  4HEA 2;  5DVB A;  4V2N A;  2IMK A;  4RQX A;  4MP4 A;  1SL0 B;  1GUL A;  1A0F A;  1WWJ A;  2VL2 C;  1K0A A;  4ZB9 A;  1MEK A;  3IXR A;  1V2A A;  4DSR A;  4N11 A;  4PUA A;  1PX7 A;  1SJZ A;  4K5R A;  3RDW A;  4QL7 A;  2C0E A;  5B6N A;  4KDU A;  1I9D A;  2A4H A;  1ZYP A;  1V40 A;  5HR0 A;  1NHO A;  3C7M A;  4CY8 A;  4ZXG A;  1VGL A;  3TJB A;  2FUG 2;  2OKA A;  3P8W A;  2DJ0 A;  1Z7P A;  2MMO A;  3HZ4 A;  1XOB A;  2CQ9 A;  4QL9 A;  2F8F A;  3HJM A;  2V2G A;  1XPV A;  3QMX A;  4O5Q A;  4TR3 A;  1Z6M A;  2F3M A;  1QFN A;  1FHE A;  3DXB A;  1TOF A;  6GSS A;  3D6I A;  2O87 A;  3FZA A;  2HLS A;  3LYK A;  3GST A;  4X43 A;  2B7J A;  2GTU A;  5GAP D;  3KMN A;  1N8J A;  4WXT A;  3D0Z A;  4TW5 A;  3QOU A;  4Z7X A;  1A23 A;  3QDN A;  2P5R A;  3LJR A;  2N5F A;  3CTF A;  1AXD A;  1EZK A;  2VOC A;  4MA9 A;  2LUS A;  3P7X A;  3KJY A;  3O76 A;  3VUR A;  3LXT A;  1Z5Y E;  4BA7 A;  3UOM A;  2B1L A;  3US3 A;  3WGE A;  1GP1 A;  2VCW A;  1WJK A;  4Z2T A;  3IV4 A;  3UVH A;  1YEX A;  2AHE A;  2VIM A;  1WPI A;  3MDK A;  4TVE A;  1WE0 A;  2WUL A;  3PIN A;  2B1K A;  5GSS A;  2B5Y A;  3IHQ A;  2VCV A;  2IWT A;  1FO5 A;  2KHP A;  1JZR A;  2AUV A;  4HDE A;  3ZYW A;  2A2P A;  4BVX B;  1SKR B;  4TN8 A;  4IKH A;  5HR1 A;  1TKD B;  5INY A;  2I81 A;  1O7U A;  2GLR A;  3GRX A;  2VLV A;  5C00 A;  2LQQ A;  2N5A A;  3FZ9 A;  1GSF A;  3Q6O A;  4MZB A;  1RQM A;  6GSX A;  3IK9 A;  1ZYE A;  1FVK A;  3TDG A;  3I9V 2;  3DYR A;  4MPF A;  3GL3 A;  5DCH A;  4WBJ A;  5CNW A;  3APS A;  4K2D A;  4JRR A;  4Q5F A;  3L9V A;  4O5U A;  4TXO B;  2RUF A;  2HRF A;  3ERW A;  3FKF A;  3TKS C;  1XW5 A;  3QFB C;  5J5N A;  1EEM A;  3EMX A;  2WFC A;  4ZB6 A;  1TI3 A;  3MYD A;  2C3Q A;  5JWR B;  2F51 A;  2C3N A;  4HZ2 A;  2LEG A;  4GLT A;  5D9X A;  18GS A;  1TTZ A;  3HA9 A;  3P90 A;  2AYT A;  4K1F A;  2HE3 A;  1PN9 A;  1CQG A;  1E6B A;  3CQF A;  5CYY A;  4GCI A;  4OWY A;  3FYG A;  5HR3 A;  1GNW A;  1R7H A;  4MF6 A;  5DCG A;  2PVQ A;  3D21 A;  2VLU A;  2X8C A;  4LMW A;  3GHA A;  1CQH A;  3EVI A;  4EIP A;  2DKI A;  5G1L A;  1ZMA A;  5KN1 A;  4XS1 A;  4IGJ A;  4MLY A;  4LA1 A;  1HQO A;  1PQN A;  3ZIV A;  3ZML A;  5CRW A;  2FWH A;  2WB9 A;  4XS4 B;  2YWI A;  2RII A;  3IC8 A;  1NHY A;  3M1G A;  11GS A;  4POB A;  3TKS E;  4O7H A;  1ST9 A;  1TK5 B;  1GUK A;  3I6A A;  1H4O A;  3FHK A;  3SBC A;  3ED3 A;  2RM5 A;  2HNL A;  4NV5 A;  1TP9 A;  4MH2 A;  3KXO A;  3L9S A;  1BED A;  2J9H A;  4JZQ A;  2OAC A;  2PBJ A;  1AQW A;  3CMI A;  3HKR A;  2M80 A;  2H1D A;  1Q4J A;  4V1A p;  5IMF A;  3UBL A;  1PSQ A;  1GSD A;  3C71 A;  1O8W A;  3H93 A;  3F6D A;  5LCZ A;  3QPM A;  3IE3 A;  4DSS B;  1M9B A;  5F8B A;  3Q19 A;  4ILF A;  2M72 A;  3GFK A;  4MJE A;  1S3D A;  4IP6 A;  4E8H A;  4WR4 A;  4HZ4 A;  1UN2 A;  1MD4 A;  4KND A;  5H5Q A;  2R0C A;  4TR1 B;  1BYE A;  3KMO A;  2HFD A;  2OBK A;  4YQU A;  1G7O A;  4PQH A;  1G0T A;  3CRT A;  1M9A A;  2L6C A;  3LG6 A;  1NSW A;  1E2Y A;  1KBN A;  2L5L A;  5DAK B;  2LNS A;  4MJA A;  4GXZ A;  1X0R A;  2KOK A;  3F6F A;  3F3Q A;  4PUF C;  3UL3 A;  1GSQ A;  5DJM A;  1QQ2 A;  5A4W A;  2LS5 A;  5D9V A;  1IYH A;  2MYG A;  2C3T A;  1F9M A;  4FH8 A;  3O6T A;  2RUE A;  4O5R A;  2O8V B;  4NHZ A;  2JZT A;  2WDU A;  3VI7 A;  4AJ6 A;  5DJL A;  2MMZ A;  3VFI A;  1XCC A;  1VF3 A;  2H72 A;  1YF1 A;  4IJ3 A;  2IFQ B;  2R3X A;  3IPZ A;  2CX4 A;  4POL A;  1BX9 A;  6GST A;  5EVO A;  2LNT A;  4IN0 A;  1PD2 1;  5DAL B;  5G31 A;  4I97 A;  1J9B A;  3PR8 A;  1BJX A;  5E4W A;  3HVS A;  4D73 B;  1YEP A;  5D8I A;  2JSY A;  1WMJ A;  2EIQ A;  4MPG A;  5D96 A;  1EGR A;  2YNX A;  3AY8 A;  4G9H A;  4ICY A;  2GT6 A;  1ABA A;  3ZVJ D;  1GRX A;  2JAC A;  3RPP A;  4YQV A;  2NVL A;  1M3I A;  3EIN A;  1HNA A;  2LRN A;  5D73 A;  2X64 A;  1NM3 A;  2D2Z A;  1GSS A;  1SL2 B;  4I2U A;  1GTB A;  1WOU A;  4MCU A;  3GMF A;  4I6X A;  2GSR A;  5FWG A;  4MJB A;  2H8L A;  5A5K A;  4ZL9 A;  3FZ4 A;  2K18 A;  3WT1 A;  3IBH A;  5ECO B;  17GS A;  2JZS A;  4K8M A;  4AJ8 A;  4YAV A;  3NOF A;  4L5O A;  2C4J A;  3C8E A;  3GKX A;  3FY7 A;  5HR2 A;  2JSZ A;  4K6X A;  2QA2 A;  4G0L A;  1SU9 A;  2VM1 A;  4MK3 A;  2GGT A;  3LW9 A;  3QAV A;  2OE0 A;  3VWV A;  4WKW A;  5F06 A;  3ZFL A;  2R5G A;  1S3C A;  1XWB A;  3IRA A;  2V6K A;  4F0C A;  1F6M C;  1VRS D;  2PMT A;  1GH2 A;  1FG4 A;  5IO2 A;  3HZ8 A;  4HUA A;  1FOV A;  2J23 A;  3ERF A;  1X9M B;  4KH7 A;  2JAD A;  2HSY A;  2H70 A;  3SWL A;  3KH9 A;  4EC0 A;  3JCM L;  1XW9 A;  1R5P A;  3J7Y b;  2EC4 A;  2JZR A;  4KGI A;  1T1V A;  2REM A;  4YH2 A;  2KUC A;  5CP1 A;  5DQS A;  4TR4 A;  1DUG A;  1PKW A;  2CA8 A;  4IS0 A;  4FIW A;  4X4J A;  4IW9 A;  4FO5 A;  4GF0 A;  2GZY A;  4KAE A;  2GQM A;  4LL1 B;  4H86 A;  4ECJ A;  5IMD A;  4Z2R A;  3FR3 A;  5E59 A;  5D9W A;  1XXU A;  2X8H A;  3CBU A;  5IIZ A;  2Z9S A;  2H73 A;  4NWY A;  4KW6 A;  3GKN A;  2HYX A;  1K0B A;  2CAQ A;  2A2R A;  3APQ A;  4WET A;  5J9C A;  3UEM A;  4MH3 A;  3KEB A;  2JL4 A;  1LBK A;  1K0M A;  1DE1 A;  4TXO A;  2R4V A;  3GA4 A;  4JU5 A;  3TOU A;  2K9F A;  4V1A g;  4JBB A;  1WIK A;  3QD9 A;  5IO0 A;  2OJL A;  4YKF A;  5KN3 A;  4F0B A;  3F9U A;  3H8Q A;  3L4N A;  1SK2 A;  3L9U A;  5CRD A;  3EYT A;  3WYW A;  1M7T A;  3FRC A;  2N5B A;  3FR9 A;  3MNG A;  2VL9 A;  2ON5 A;  2V6O A;  1A2L A;  2G2Q A;  5G2Z A;  4F03 A;  1SKS B;  2KLX A;  1YY7 A;  4GST A;  5KOX A;  1K0N A;  1KEB A;  2YPM A;  5EPF A;  4BWS A;  2QGV A;  3IHG A; 
#chains in the Genus database with same CATH homology
 5ECQ B;  2H1A A;  3I69 A;  3KTL A;  4MZW A;  2VD1 A;  1TRS A;  1NW2 A;  4KE3 A;  6GSW A;  1SJI A;  2QSI A;  4K7I A;  1X9W B;  4XS6 A;  4NPB A;  3EC3 A;  2H19 A;  2L57 A;  1M2A A;  1ZL9 A;  2L4Q A;  4X0X A;  5G30 A;  1FVJ A;  3KCM A;  5AIS A;  1M2D A;  1EOH A;  1XWK A;  3GTU B;  20GS A;  4PXO A;  4QQ7 A;  2HXK A;  2H30 A;  3O3T A;  8GSS A;  1M2B A;  1TXX A;  4EO3 A;  3ZTL A;  1TU8 A;  4BWQ A;  2LRC A;  4LL4 B;  3NIV A;  1O8X A;  1JLW A;  2H01 A;  1A24 A;  4IP1 A;  1SK1 A;  4RUV A;  5BRT A;  2OAD A;  2VUP A;  4KF9 A;  3D4M A;  1YKA A;  5ECR B;  3TGZ A;  3W8J A;  1ON4 A;  3RPN A;  1K3L A;  3TRX A;  1X9S B;  2VAF A;  1URM A;  1F3B A;  2H66 A;  4PNF A;  4F9Z A;  1A2J A;  4IBP A;  4TRX A;  3ZFB A;  5ECH B;  3BD2 A;  5H5S A;  4DSS A;  2AJQ B;  2XPE A;  4PQ1 A;  1BG5 A;  3MAK A;  2FWG A;  3GIX A;  2C0F A;  5ECM B;  13GS A;  2L6D A;  5ECI B;  2I9H A;  3KM6 A;  4XRA A;  1XZO A;  1XVQ A;  2K8V A;  2H1G A;  4CW9 A;  4TR1 A;  2GS3 A;  1M0U A;  4ML1 A;  2CZ3 A;  4ACS A;  5FT3 A;  1K0O A;  2FHE A;  4N0V A;  4E8E A;  3BOA A;  2E2G A;  4NXI A;  4OCF A;  2PPT A;  3K8N A;  1A8Y A;  2M46 A;  7GSS A;  3BCI A;  2V32 A;  5J3R A;  4PX1 A;  4HI7 A;  2LQO A;  4KA0 A;  1HNB A;  4G0K A;  2F9S A;  4ZBB A;  3TUE A;  2DMM A;  1THX A;  3KGK A;  1W4V A;  2QA1 A;  1ZYN A;  3KH7 A;  1X5E A;  2VL2 A;  3OR5 A;  1HYU A;  2HSM A;  2IFQ A;  1A2M A;  5G1K A;  2LKU A;  1XOA A;  5AIX A;  1T4Z A;  1F2E A;  2H6X A;  5HQP A;  5ELG A;  3M3M A;  2H76 A;  3VPQ A;  4FYB A;  4IQ1 A;  3EE2 A;  2DJK A;  3M0F A;  5ECP B;  3CSI A;  3DWV A;  3A3T A;  3LGC A;  19GS A;  1O6J A;  5DDL A;  2XC2 A;  1MDI A;  2IME A;  5ID2 A;  2X49 A;  2K6V A;  1DE2 A;  4KSO A;  4MMM A;  5GAN D;  2IMD A;  4GQC A;  4NHW A;  3RAZ A;  3ZRE A;  1DBY A;  5L71 A;  16GS A;  3LQ7 A;  2H0I A;  4Z2U A;  1QGV A;  4Q5R A;  3GL5 A;  3UBK A;  2VCT A;  3DD3 A;  3DML A;  3QAW A;  2PU9 C;  1BQ7 A;  2VM2 A;  1F3A A;  3GKK A;  4AGS A;  3F63 A;  5IOX A;  1WRY A;  5ABR A;  2ZUP A;  4EKZ A;  5H5R A;  4LLR A;  1ERW A;  4WR5 A;  2NDO A;  1FAA A;  3A5I A;  4GQF A;  4ZL8 A;  4MF7 A;  4DVC A;  4DSQ A;  1H75 A;  1Q98 A;  2DLX A;  5HFG A;  3G9B A;  5EY6 A;  3PPU A;  4HQZ A;  3A2W A;  1J0F A;  1PRX A;  4FQU A;  2HZE A;  2F8A A;  4HS1 A;  1SYR A;  2NBS A;  3N5O A;  1N2A A;  5IPG A;  3Q18 A;  4YKG A;  5JCU A;  3TKR A;  2R0G A;  1PGT A;  3P2A A;  3ISO A;  2ALB A;  2XPD A;  5IMZ A;  4ML6 A;  4GTU A;  5B8A A;  3WT2 A;  4PTS A;  1SK0 A;  3CTG A;  4PQI A;  1JZD A;  3E0U A;  1V98 A;  9GSS A;  3TRP A;  1MD3 A;  1T3B A;  2YJ7 A;  1PL2 A;  4K7N A;  2YWM A;  5C04 A;  1JHB A;  5JCW A;  2OE1 A;  1GLP A;  2P31 A;  1KNG A;  2TRX A;  2C8U A;  5B6M A;  3DRN A;  2IMI A;  4TR0 A;  2GSQ A;  4G10 A;  3E9J B;  3BCK A;  3GKM A;  2H74 A;  2LJR A;  6GSU A;  2A4V A;  1GNE A;  2CVB A;  3H1N A;  1YKC A;  2CVD A;  4PGT A;  5IM9 A;  1UC7 A;  4TOP A;  4BPY A;  1XWG A;  2R6K A;  3LEF A;  3TKS A;  5KN0 A;  3DEX A;  1EEJ A;  1PN0 A;  2O85 A;  4OO4 A;  4XIH A;  1VF2 A;  1GLQ A;  2PVO C;  4YAP A;  2KP1 A;  5HFI A;  4JR4 A;  22GS A;  5HFK A;  2E0Q A;  2YAN A;  3KP9 A;  2YP6 A;  3VWX A;  3KP8 A;  3EUR A;  4G19 A;  2V41 A;  2GZP A;  2DC5 A;  1ZYQ B;  2DIZ A;  4KDY A;  3MSZ A;  2XBI A;  3N9J A;  1GTI A;  5CRG A;  5LD0 A;  3UAR A;  2YV9 A;  4L8E A;  2JU5 A;  1G6Y A;  1R5A A;  5IQY A;  1U3A A;  3HDC A;  2B5X A;  2GQK A;  5F07 A;  2VLT A;  2HI7 A;  1PL1 A;  1OC9 B;  2PER A;  4CY6 A;  1U87 A;  2YWN A;  3QFA C;  2WS2 A;  1SKW B;  2ON7 A;  5FHI A;  4HJM A;  4ZBD A;  2PN8 A;  4K9Z A;  1T8E B;  3LXZ A;  1GWC A;  1UVZ A;  1RK4 A;  3ZVJ A;  2AB6 A;  2TIR A;  1XWC A;  2GT5 A;  2P5Q A;  2VCX A;  2EIR A;  4MAB A;  1FB6 A;  1LJR A;  3IDV A;  4KUN A;  4O92 A;  3VWU A;  2RLI A;  4KCE A;  4BL7 B;  3R2Q A;  2P0G A;  3DVX A;  3E3E A;  5JWO B;  4CDO A;  3LOR A;  1TW9 A;  1K3O A;  1XVW A;  3ZLP A;  3APO A;  4GSN A;  3HY2 A;  1O85 A;  4BVX A;  5COH A;  6GSY A;  3FEU A;  1GSE A;  1X5C A;  1FB0 A;  4NAX A;  1TRU A;  3UIW A;  2G0F A;  3UAP A;  4POK A;  3G7J A;  1HD2 A;  3WD6 A;  2QKE A;  3IC4 A;  5CO3 A;  4N0Z A;  2PWJ A;  2MBS A;  4JE1 A;  4L5L A;  1TK0 B;  4KDX A;  4EF0 A;  1ILO A;  3F4S A;  2YN1 A;  2IIY A;  4P3Y B;  1GUH A;  5CRE A;  3WGX A;  2FCH A;  3C73 A;  4OCE A;  5DBQ A;  2C0G A;  2DJ3 A;  3FW2 A;  4AF2 A;  5IMV A;  1BAY A;  2AAW A;  1Z7R A;  1FW1 A;  2H71 A;  3FZ5 A;  5J41 A;  3ZIT A;  1U88 A;  1XWA A;  5KOW A;  4F2I A;  1AUC A;  4HU7 A;  4EVM A;  5AGY A;  5AN1 A;  1HNC A;  4MDC A;  1T00 A;  4JR6 A;  5J9B A;  3GV1 A;  5DQY A;  1XFL A;  4IVF A;  1AQX A;  1Y25 A;  1Z3E A;  4ZIL A;  4OMV A;  4ECC A;  4O32 A;  1YDK A;  4OFT A;  1MDK A;  3F0I A;  1OC3 A;  2B6M A;  3CSJ A;  1K0D A;  3F3R A;  3S9F A;  3MIX A;  3GN3 A;  1ZZY A;  3U5R E;  2WRT A;  3M9K A;  2LJK A;  6GSV A;  4GWR A;  2GVP A;  5CAX A;  1QXH A;  3ME7 A;  1TRW A;  2LV3 A;  4ECI A;  4RI6 A;  2BMX A;  3TB2 A;  1OE7 A;  3CRU A;  3TJF A;  1T4Y A;  1KTE A;  4POM A;  3H79 A;  10GS A;  1USB A;  2IN3 A;  5IPH A;  2C0D A;  5ENU A;  3BJ5 A;  2FA4 A;  3ZIJ A;  3KTB A;  1GTU A;  2DKH A;  3HJP A;  4BVY B;  2YZH A;  3IK7 A;  2BJX A;  1MTC A;  1OKT A;  4XS4 A;  1M99 A;  4GRF A;  1ERV A;  2KP2 A;  3F4R A;  2YOI A;  1G7E A;  2B5E A;  3FR6 A;  4EDY A;  3CSH A;  4EL1 A;  4N30 A;  2YWO A;  1AQV A;  4K5S A;  5D93 A;  3UVT A;  1IYI A;  2MBT A;  4OFM A;  5ECS A;  3LYP A;  2FWE A;  2IJY A;  4KB3 A;  5AIV A;  3D5J A;  1GUM A;  2L5O A;  1AIU A;  2B3S A;  4PUR A;  2NPB A;  3VK9 A;  2EIO A;  3D22 A;  3BBY A;  4J2F A;  4XHM A;  1ZOF A;  2GZZ A;  3HVX A;  5G5E A;  1TRV A;  4EE0 A;  2FNO A;  3VWW A;  3GX0 A;  4I5Q A;  3EU4 A;  3IOS A;  4Q5N A;  5IOW A;  3GYK A;  2E7P A;  2LST A;  12GS A;  2I4A A;  2YV7 A;  1ACV A;  1OYJ A;  2NTO A;  2FY6 A;  2DML A;  2CT6 A;  3L0H A;  2C1Y A;  2IPA A;  2VCQ A;  5EL8 A;  5A4V A;  2ZNM A;  4EIQ A;  1X5D A;  2H75 A;  5B7C A;  4RQR A;  2I3Y A;  2DBC A;  4EXJ A;  2I1U A;  4N10 A;  2PGT A;  4CHS A;  5D9T A;  3W6G A;  1DSB A;  2GST A;  1SL1 B;  1SJ6 A;  5DAK A;  4MNN A;  3TKQ A;  1U6T A;  3KZQ A;  3VLN A;  4JED A;  4LMV A;  1XIY A;  2C80 A;  1VF4 A;  2XHF A;  5J4U A;  3EU3 A;  1V9W A;  4HJ2 A;  2DIY A;  1C72 A;  3DIE A;  1J08 A;  3HCZ A;  3C1R A;  2WZ9 A;  3KIJ A;  3FMW A;  2GQL A;  4AJ7 A;  2B7K A;  4K0N A;  3LSZ A;  3MWH A;  3UJ1 A;  14GS A;  3A2V A;  5A4U A;  3TCO A;  3QCP A;  2WGR A;  4TKY A;  1B4Q A;  2X4A A;  3WGD A;  1GTA A;  2X8G A;  4K7O A;  5CRH A;  4KCA A;  4EUY A;  2R2J A;  2H6Z A;  4I2T A;  4K2X A;  3CXG A;  3RHC A;  3RHB A;  1UA5 A;  2HT9 A;  3PH9 A;  1B9X C;  2H1B A;  1EV4 A;  4PNG A;  2CZ2 A;  4K0G A;  1TJD A;  5DAL A;  2YCD A;  3J7Y k;  1S3A A;  1YJ6 A;  2HRA A;  2TRC P;  3D4T A;  4V2L A;  4D73 A;  1O81 A;  2HRK A;  4WEY A;  1TU7 A;  3H4K A;  2WCI A;  2L4C A;  5IMC A;  2OE3 A;  3GNJ A;  2K8S A;  1F37 A;  3IA1 A;  4WF5 A;  1EOG A;  1Z9H A;  3TKP A;  2HSH A;  3DGQ A;  2A2S A;  1LU4 A;  1OVN A;  4ZIJ A;  1A8L A;  3TJG A;  4IJI A;  2H6Y A;  2ES7 A;  2HZF A;  3HYP A;  3VPT A;  3ZZX A;  3LFL A;  4ZL7 A;  1YQ1 A;  1B48 A;  3F4T A;  1AAZ A;  4A5P A;  2OBI A;  2O89 A;  1V57 A;  2VO4 A;  5JWQ B;  1RW1 A;  4NMU A;  3ZL5 A;  3GUR A;  1B9Y C;  2HRN A;  3UMA A;  2E2M A;  3TJK A;  2R0P A;  3GSS A;  3HJO A;  1OC9 A;  4HOJ A;  1W89 A;  2YZU A;  3A2X A;  2RM6 A;  2MZC A;  1Z6N A;  2FD3 A;  3A5W A;  4OO5 A;  2VL3 A;  4EDZ A;  3U6V A;  3HXS A;  2O7K A;  1GSU A;  1R4W A;  2WJU A;  2IL3 A;  3M8N A;  1Y6E A;  3PGT A;  1TK8 B;  3IAS 2;  1B8X A;  2R37 A;  1A0R P;  1B4P A;  1OAZ A;  4L0U A;  2LTK A;  4FYU A;  1SD9 A;  2VD0 A;  4TXV A;  3TRQ A;  4F82 A;  2GDR A;  4HQS A;  5KN2 A;  3ZMK A;  4DEJ A;  4BL7 A;  4L0W A;  2FLS A;  4ID0 A;  1QMV A;  3NZN A;  4XCS A;  5JCG A;  5F0G A;  1G6W A;  4X1U A;  1MDJ A;  4WF4 A;  1ZCP A;  2MMA A;  2MMN A;  3R3E A;  4GSS A;  4ZBA A;  3HD5 A;  2X99 A;  4J57 E;  4HU9 A;  1AW9 A;  2H0G A;  1XBS A;  2FA8 A;  3W8S A;  1TI1 A;  1QK8 A;  2CVK A;  1SEN A;  1PA3 A;  3TJJ A;  2UZ8 A;  4I8B A;  4KSM A;  4ECB A;  5IMA A;  2FGX A;  4ISD A;  4WBR D;  3ZRD A;  5G5F A;  1V58 A;  3CYN A;  2BTO T;  3L78 A;  2H0H A;  2OA7 A;  1FOH A;  1K0C A;  1JFU A;  5ECL B;  4YQM A;  4RI7 A;  4FYC A;  4XTS A;  5ECK B;  3ERG A;  4G2E A;  3TOT A;  1SD8 A;  4J56 E;  3GH9 A;  1ML6 A;  3Q74 A;  3HHV A;  5B8B A;  3V1W A;  5ID2 B;  3EPT A;  1EP8 A;  2CAI A;  3DKS A;  3ME8 A;  1PMT A;  5ECN B;  4XRD A;  4MF5 A;  2V1M A;  5GZZ B;  1VF1 A;  1YF0 A;  3IR4 A;  3GX8 A;  4MJC A;  1XW6 A;  1JZO A;  3KD0 A;  3EMP A;  1EP7 A;  1O73 A;  3GUS A;  5ELA A;  2YJH A;  1ERT A;  5BMU A;  3F8U A;  2LRT A;  3C1S A;  4NV2 A;  5GST A;  2FWF A;  2LJA A;  1I5G A;  3FK8 A;  4Q5Q A;  1EWX A;  1AC1 A;  4BVY A;  1K3Y A;  1T7P B;  1ZGN A;  4MZC A;  2VCZ A;  1THO A;  2DJ2 A;  1PKZ A;  4KX4 A;  2L59 A;  3HVV A;  1OC8 A;  2AV4 A;  3QAG A;  4ZB8 A;  3GTU A;  3IAM 2;  2DJ1 A;  4IQA A;  3G7I A;  3GH6 A;  1QUW A;  1ERU A;  2DJJ A;  2HZE B;  2QC7 A;  4IHU A;  1GSY A;  3DVW A;  2DSA A;  4G0I A;  1PX6 A;  1GL8 A;  1OE8 A;  1TDI A;  2GSS A;  1JZW A;  2PUK C;  1R26 A;  3LWA A;  2IMF A;  3VI5 A;  4IEL A;  2CV4 A;  4USS A;  1OKD A;  1EGO A;  1EV9 A;  1U3I A;  5LNK e;  4OD7 A;  5F05 A;  2ZCT A;  5KEJ A;  1JLV A;  3I43 A;  1WP0 A;  1SYX A;  4OFN A;  3G7Y A;  1YZX A;  4ULX A;  3EWL A;  2CX3 A;  2XBQ A;  3RBT A;  3QR6 A;  3M9J A;  4V2M A;  4HEA 2;  5DVB A;  4V2N A;  2IMK A;  4RQX A;  4MP4 A;  1SL0 B;  1GUL A;  1A0F A;  1WWJ A;  2VL2 C;  1K0A A;  4ZB9 A;  1MEK A;  3IXR A;  1V2A A;  4DSR A;  4N11 A;  4PUA A;  1PX7 A;  1SJZ A;  4K5R A;  3RDW A;  4QL7 A;  2C0E A;  5B6N A;  4KDU A;  1I9D A;  2A4H A;  1ZYP A;  1V40 A;  5HR0 A;  1NHO A;  3C7M A;  4CY8 A;  4ZXG A;  1VGL A;  3TJB A;  2FUG 2;  2OKA A;  3P8W A;  2DJ0 A;  1Z7P A;  2MMO A;  3HZ4 A;  1XOB A;  2CQ9 A;  4QL9 A;  2F8F A;  3HJM A;  2V2G A;  1XPV A;  3QMX A;  4O5Q A;  4TR3 A;  1Z6M A;  2F3M A;  1QFN A;  1FHE A;  3DXB A;  1TOF A;  6GSS A;  3D6I A;  2O87 A;  3FZA A;  2HLS A;  3LYK A;  3GST A;  4X43 A;  2B7J A;  2GTU A;  5GAP D;  3KMN A;  1N8J A;  4WXT A;  3D0Z A;  4TW5 A;  3QOU A;  4Z7X A;  1A23 A;  3QDN A;  2P5R A;  3LJR A;  2N5F A;  3CTF A;  1AXD A;  1EZK A;  2VOC A;  4MA9 A;  2LUS A;  3P7X A;  3KJY A;  3O76 A;  3VUR A;  3LXT A;  1Z5Y E;  4BA7 A;  3UOM A;  2B1L A;  3US3 A;  3WGE A;  1GP1 A;  2VCW A;  1WJK A;  4Z2T A;  3IV4 A;  3UVH A;  1YEX A;  2AHE A;  2VIM A;  1WPI A;  3MDK A;  4TVE A;  1WE0 A;  2WUL A;  3PIN A;  2B1K A;  5GSS A;  2B5Y A;  3IHQ A;  2VCV A;  2IWT A;  1FO5 A;  2KHP A;  1JZR A;  2AUV A;  4HDE A;  3ZYW A;  2A2P A;  4BVX B;  1SKR B;  4TN8 A;  4IKH A;  5HR1 A;  1TKD B;  5INY A;  2I81 A;  1O7U A;  2GLR A;  3GRX A;  2VLV A;  5C00 A;  2LQQ A;  2N5A A;  3FZ9 A;  1GSF A;  3Q6O A;  4MZB A;  1RQM A;  6GSX A;  3IK9 A;  1ZYE A;  1FVK A;  3TDG A;  3I9V 2;  3DYR A;  4MPF A;  3GL3 A;  5DCH A;  4WBJ A;  5CNW A;  3APS A;  4K2D A;  4JRR A;  4Q5F A;  3L9V A;  4O5U A;  4TXO B;  2RUF A;  2HRF A;  3ERW A;  3FKF A;  3TKS C;  1XW5 A;  3QFB C;  5J5N A;  1EEM A;  3EMX A;  2WFC A;  4ZB6 A;  1TI3 A;  3MYD A;  2C3Q A;  5JWR B;  2F51 A;  2C3N A;  4HZ2 A;  2LEG A;  4GLT A;  5D9X A;  18GS A;  1TTZ A;  3HA9 A;  3P90 A;  2AYT A;  4K1F A;  2HE3 A;  1PN9 A;  1CQG A;  1E6B A;  5CYY A;  4GCI A;  4OWY A;  3FYG A;  5HR3 A;  1GNW A;  1R7H A;  4MF6 A;  5DCG A;  2PVQ A;  3D21 A;  2VLU A;  2X8C A;  4LMW A;  3GHA A;  1CQH A;  3EVI A;  4EIP A;  2DKI A;  5G1L A;  1ZMA A;  5KN1 A;  4XS1 A;  4IGJ A;  4MLY A;  4LA1 A;  1HQO A;  1PQN A;  3ZIV A;  3ZML A;  5CRW A;  2FWH A;  2WB9 A;  4XS4 B;  2YWI A;  2RII A;  3IC8 A;  1NHY A;  3M1G A;  11GS A;  4POB A;  3TKS E;  4O7H A;  1ST9 A;  1TK5 B;  1GUK A;  3I6A A;  1H4O A;  3FHK A;  3SBC A;  3ED3 A;  2RM5 A;  2HNL A;  4NV5 A;  1TP9 A;  4MH2 A;  3KXO A;  3L9S A;  1BED A;  2J9H A;  4JZQ A;  2OAC A;  2PBJ A;  1AQW A;  3CMI A;  3HKR A;  2M80 A;  2H1D A;  1Q4J A;  4V1A p;  5IMF A;  3UBL A;  1PSQ A;  1GSD A;  3C71 A;  1O8W A;  3H93 A;  3F6D A;  5LCZ A;  3QPM A;  3IE3 A;  4DSS B;  1M9B A;  5F8B A;  3Q19 A;  4ILF A;  2M72 A;  3GFK A;  4MJE A;  1S3D A;  4IP6 A;  4E8H A;  4WR4 A;  4HZ4 A;  1UN2 A;  1MD4 A;  4KND A;  5H5Q A;  2R0C A;  4TR1 B;  1BYE A;  3KMO A;  2HFD A;  2OBK A;  4YQU A;  1G7O A;  4PQH A;  1G0T A;  3CRT A;  1M9A A;  2L6C A;  3LG6 A;  1NSW A;  1E2Y A;  1KBN A;  2L5L A;  5DAK B;  2LNS A;  4MJA A;  4GXZ A;  1X0R A;  2KOK A;  3F6F A;  3F3Q A;  4PUF C;  3UL3 A;  1GSQ A;  5DJM A;  1QQ2 A;  5A4W A;  2LS5 A;  5D9V A;  1IYH A;  2MYG A;  2C3T A;  1F9M A;  4FH8 A;  3O6T A;  2RUE A;  4O5R A;  2O8V B;  4NHZ A;  2JZT A;  2WDU A;  3VI7 A;  4AJ6 A;  5DJL A;  2MMZ A;  3VFI A;  1XCC A;  1VF3 A;  2H72 A;  1YF1 A;  4IJ3 A;  2IFQ B;  2R3X A;  3IPZ A;  2CX4 A;  4POL A;  1BX9 A;  6GST A;  5EVO A;  2LNT A;  4IN0 A;  1PD2 1;  5DAL B;  5G31 A;  4I97 A;  1J9B A;  3PR8 A;  1BJX A;  5E4W A;  3HVS A;  4D73 B;  1YEP A;  5D8I A;  2JSY A;  1WMJ A;  2EIQ A;  4MPG A;  5D96 A;  1EGR A;  2YNX A;  3AY8 A;  4G9H A;  4ICY A;  2GT6 A;  1ABA A;  3ZVJ D;  1GRX A;  2JAC A;  3RPP A;  4YQV A;  2NVL A;  3EIN A;  1HNA A;  2LRN A;  5D73 A;  2X64 A;  1NM3 A;  2D2Z A;  1GSS A;  1SL2 B;  4I2U A;  1GTB A;  1WOU A;  4MCU A;  3GMF A;  4I6X A;  2GSR A;  5FWG A;  4MJB A;  2H8L A;  5A5K A;  4ZL9 A;  3FZ4 A;  2K18 A;  3WT1 A;  3IBH A;  5ECO B;  17GS A;  2JZS A;  4K8M A;  4AJ8 A;  4YAV A;  3NOF A;  4L5O A;  2C4J A;  3C8E A;  3GKX A;  3FY7 A;  5HR2 A;  2JSZ A;  4K6X A;  2QA2 A;  4G0L A;  1SU9 A;  2VM1 A;  4MK3 A;  2GGT A;  3LW9 A;  3QAV A;  2OE0 A;  3VWV A;  4WKW A;  5F06 A;  3ZFL A;  2R5G A;  1S3C A;  1XWB A;  3IRA A;  2V6K A;  4F0C A;  1F6M C;  1VRS D;  2PMT A;  1GH2 A;  1FG4 A;  5IO2 A;  3HZ8 A;  4HUA A;  1FOV A;  2J23 A;  3ERF A;  1X9M B;  4KH7 A;  2JAD A;  2HSY A;  2H70 A;  3SWL A;  3KH9 A;  4EC0 A;  3JCM L;  1XW9 A;  1R5P A;  3J7Y b;  2EC4 A;  2JZR A;  4KGI A;  1T1V A;  2REM A;  4YH2 A;  2KUC A;  5CP1 A;  5DQS A;  4TR4 A;  1DUG A;  1PKW A;  2CA8 A;  4IS0 A;  4FIW A;  4X4J A;  4IW9 A;  4FO5 A;  4GF0 A;  2GZY A;  4KAE A;  2GQM A;  4LL1 B;  4H86 A;  4ECJ A;  5IMD A;  4Z2R A;  3FR3 A;  5E59 A;  5D9W A;  1XXU A;  2X8H A;  3CBU A;  5IIZ A;  2Z9S A;  2H73 A;  4NWY A;  4KW6 A;  3GKN A;  2HYX A;  1K0B A;  2CAQ A;  2A2R A;  3APQ A;  4WET A;  5J9C A;  3UEM A;  4MH3 A;  3KEB A;  2JL4 A;  1LBK A;  1K0M A;  1DE1 A;  4TXO A;  2R4V A;  3GA4 A;  4JU5 A;  3TOU A;  2K9F A;  4V1A g;  4JBB A;  1WIK A;  3QD9 A;  5IO0 A;  2OJL A;  4YKF A;  5KN3 A;  4F0B A;  3F9U A;  3H8Q A;  3L4N A;  1SK2 A;  3L9U A;  5CRD A;  3EYT A;  3WYW A;  1M7T A;  3FRC A;  2N5B A;  3FR9 A;  3MNG A;  2VL9 A;  2ON5 A;  2V6O A;  1A2L A;  2G2Q A;  5G2Z A;  4F03 A;  1SKS B;  2KLX A;  1YY7 A;  4GST A;  5KOX A;  1K0N A;  1KEB A;  2YPM A;  5EPF A;  4BWS A;  2QGV A;  3IHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...