2VM2A

Crystal structure of barley thioredoxin h isoform 1 crystallized using peg as precipitant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
109
Chain Sequence
GAVIACHTKQEFDTHMANGKDTGKLVIIDFTASWCGPCRVIAPVFAEYAKKFPGAIFLKVDVDELKDVAEAYNVEAMPTFLFIKDGEKVDSVVGGRKDDIHTKIVALMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN H ISOFORM 1.
publication title Crystal Structures of Barley Thioredoxin H Isoforms Hvtrxh1 and Hvtrxh2 Reveal Features Involved in Protein Recognition and Possibly in Discriminating the Isoform Specificity.
pubmed doi rcsb
source organism Hordeum vulgare var. distichum
molecule tags Oxidoreductase
total genus 30
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2008-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vm2A01
4YQMA 2C0GA 3P7XA 5ELGA 1SL0B 2GSRA 4MH2A 3I43A 4AJ6A 3FZ4A 5ECQB 1HD2A 2C1YA 5CNWA 5CYYA 3EURA 3KXOA 4EDZA 1O81A 4TXOB 3NZNA 4DSSB 1FVKA 5C00A 4KNDA 1ABAA 2K6VA 5HR3A 2O8VB 5HR1A 4NV2A 2NDOA 3KH7A 3UMAA 2I81A 2VLUA 2WB9A 1G6WA 4FH8A 2B1LA 2J9HA 4HDEA 1FW1A 3GL3A 2B5EA 1TKDB 2O87A 1SYRA 2H6YA 2PBJA 3VWWA 4IJ3A 3ME8A 5FT3A 1G0TA 2IMKA 6GSSA 2PVOC 2X8CA 4TR1A 4JEDA 1UA5A 1USBA 1ZZYA 4KDXA 2V6KA 3GKKA 3KTLA 2MZCA 5F8BA 3GTUA 2YWMA 2P5RA 3HZ4A 1Q4JA 2VM1A 1YEPA 2FY6A 3EWLA 4N0VA 2RLIA 4RI7A 2DIYA 3O6TA 1DBYA 2IWTA 3CTGA 3H8QA 5IMFA 4GXZA 1SJZA 1V58A 3HA9A 5DBQA 3QFAC 1M99A 3TUEA 1DE2A 3UIWA 3LQ7A 1OC3A 4HEA2 1OAZA 1OVNA 3E9JB 3IC4A 2CZ3A 4KCEA 2LEGA 3HJOA 6GSYA 2HI7A 5IMZA 2V41A 2N5AA 1ML6A 1OKTA 4D73B 2JACA 3F4SA 1W89A 4BVXA 5ELAA 3GX8A 2FUG2 2JSZA 1K0AA 1E6BA 2LJKA 4X1UA 3VI5A 3ERGA 1V2AA 5HR2A 2CVBA 2X99A 3EINA 4F9ZA 2GTUA 2HT9A 2GZZA 2FGXA 3SWLA 3ZTLA 1PX7A 1ZMAA 1QUWA 4Q5QA 2H1AA 4PUAA 3LSZA 1GLQA 3QFBC 4IQAA 1PQNA 3GA4A 2CX3A 4PNFA 3LG6A 3WD6A 5CRGA 4MJCA 2V6OA 5CRHA 1WPIA 2DJJA 1XWCA 4FYUA 4N30A 5FWGA 1XVQA 1MDJA 4KA0A 2M80A 1ST9A 1V40A 2R37A 2YANA 2B7JA 2PU9C 1A8YA 2MMNA 1F37A 3SBCA 1FHEA 3UJ1A 4X0XA 4PQ1A 4WKWA 2C0DA 1FVJA 1F2EA 4JRRA 2MBSA 4MDCA 4ECCA 4FO5A 1I5GA 4XS6A 1K0BA 3HHVA 5C04A 3LFLA 1K0DA 4MZCA 2VL2C 5IOXA 3IHQA 4IVFA 3F0IA 3K8NA 1HYUA 1EGOA 3ZREA 1AXDA 2AJQB 1SD8A 3P2AA 1M9AA 3Q74A 3HZ8A 1HNBA 1AQWA 4HU9A 1GSEA 3FW2A 5DVBA 4L0WA 4I5QA 1PKZA 1FB0A 3A2VA 3PINA 1ERTA 3GHAA 1GTIA 3QAVA 5IMDA 4JE1A 2XPEA 3P90A 4HUAA 3LWAA 2LRCA 4I97A 1A0FA 1K3OA 2JSYA 2LJRA 4TXVA 2B3SA 1WWJA 4HS1A 2RIIA 2BJXA 4V1Ap 1G7EA 5JWQB 1GP1A 6GSUA 4HZ4A 3E0UA 1R5AA 1FB6A 3KP9A 3VWVA 3GN3A 3TRPA 1ZGNA 5CO3A 1E2YA 1MD4A 1HQOA 4N0ZA 4TW5A 2VD1A 3RHBA 4PX1A 2GQKA 3HYPA 1OE7A 5IQYA 2H72A 1Z7RA 2A2SA 4WETA 3C71A 5GZZB 4WF5A 1T3BA 2DLXA 1VRSD 1JLVA 4MPGA 1ZYEA 3FK8A 3ZVJD 4KSMA 2YV7A 1M9BA 2C0EA 2C0FA 1M2AA 4ZB8A 1SK1A 2FLSA 3LYPA 4YH2A 1Q98A 1R26A 1JZDA 3TDGA 5D8IA 1QMVA 2QSIA 5D9WA 1NHOA 1EOHA 2FNOA 2LNTA 4V1Ag 2IN3A 3QMXA 5E4WA 5F06A 1JZWA 3QAGA 3F6DA 3TRQA 4TR1B 4JR6A 3BD2A 3KEBA 3MSZA 2VOCA 2FCHA 3DKSA 5J9BA 1NM3A 2OE3A 3Q19A 2IFQA 1SENA 2KP1A 3GTUB 3H93A 3IK7A 1J9BA 3UARA 2N5FA 2VO4A 3G7JA 1JLWA 2C3NA 3CRUA 2YZHA 5GSTA 2B5YA 2WRTA 4V2MA 1SKRB 5DDLA 3TJJA 2MYGA 2O7KA 1YF1A 2AYTA 1Z5YE 3DWVA 3Q18A 4ID0A 3DXBA 4HQSA 2WGRA 5D96A 4IHUA 1TI1A 4OO5A 4TKYA 2VCQA 4NAXA 4EXJA 1XIYA 5G5FA 2V1MA 4BWQA 3HCZA 2IMEA 2E2GA 2ON7A 2VL3A 2H30A 4MABA 5D73A 5JWOB 2TRXA 3J7Yk 5KN3A 2YJHA 1W4VA 3PH9A 1GUKA 3BCIA 1AIUA 3CTFA 5CP1A 3ED3A 2WZ9A 3DYRA 5ECMB 2L5OA 1HNCA 4H86A 1SK0A 8GSSA 2FWHA 4N11A 3IV4A 4WF4A 2OJLA 5INYA 2H66A 1GSQA 4GRFA 2VD0A 4I6XA 5D9TA 1GL8A 4LMWA 1NHYA 2V32A 5IM9A 4L5LA 4ECJA 2GDRA 1PMTA 1M2BA 2HZEA 1XW6A 2NVLA 3D6IA 4KH7A 4V2LA 4CW9A 1THXA 3TKQA 1J0FA 3ERWA 2LUSA 2JL4A 3DGQA 4ZL8A 5KN0A 2R5GA 5A4UA 3D4TA 4DVCA 1SL1B 5DJLA 2JADA 4IN0A 4MH3A 4WBRD 4E8EA 3E3EA 3VLNA 1TU7A 4FYBA 1VF1A 3TJFA 1Y25A 2C4JA 2H75A 4YQVA 1K0CA 2ES7A 3PGTA 2OBKA 2K18A 1V98A 5F07A 1B48A 1JHBA 1K0MA 3APQA 3A2XA 2IMIA 4K0GA 1JFUA 2YPMA 2FWFA 5HFKA 3F3RA 2E7PA 3M0FA 2H1GA 1XXUA 1TK5B 3HKRA 1T4YA 1I9DA 3FZAA 4MF6A 3HVVA 3GRXA 4ZBBA 4MMMA 4AF2A 3EU4A 2CAQA 5EY6A 5ABRA 1R7HA 2LNSA 2YWNA 2H19A 4KB3A 1X5EA 3ZIVA 1XPVA 1XOBA 1PKWA 1T1VA 2WJUA 1AAZA 4O92A 1TK0B 1A0RP 2OKAA 4XRAA 2X8HA 2PGTA 2LV3A 2JU5A 1RK4A 1S3CA 2YCDA 1B8XA 3TRXA 1J08A 5J4UA 1DSBA 22GSA 3F9UA 5HFGA 1YEXA 3ISOA 3UBLA 4IJIA 2K9FA 1YKAA 2H8LA 4IGJA 2K8VA 3L4NA 3H4KA 2EIRA 2H70A 2JZRA 3HDCA 2I1UA 2ALBA 3ZFLA 1H75A 3F6FA 4LL4B 4Q5RA 4DSQA 2IMFA 3EMXA 2YP6A 3IAS2 1IYHA 3D21A 5DQYA 5DCHA 2FWEA 2VAFA 5CRWA 2CV4A 1GTUA 4XRDA 1OE8A 2YWIA 1XFLA 4MJAA 3GNJA 2WDUA 3HJMA 2HRNA 3ZMLA 4TVEA 3I6AA 3GX0A 3M3MA 1GNWA 3GKNA 1EP8A 4RI6A 1AQVA 5JCWA 3RPPA 2VCXA 1U3IA 5A4WA 5KN2A 3D5JA 2FWGA 3ZRDA 5JCUA 3G9BA 1UVZA 2L5LA 1YY7A 1TXXA 3GSSA 3HD5A 4LMVA 1QGVA 1THOA 4X43A 2H76A 3BCKA 1F3BA 16GSA 4G9HA 1G7OA 2IFQB 2GLRA 3FZ9A 5G1KA 2F8FA 1K3LA 1WIKA 2GQMA 3TKSE 4EF0A 3LGCA 6GSTA 4OD7A 3DRNA 1ERWA 3ZVJA 2VCZA 2XC2A 2H1DA 3ZMKA 4IQ1A 2PWJA 4KE3A 1U6TA 2CAIA 2H73A 1S3DA 4GLTA 2DJ2A 2HSYA 1K0NA 2CZ2A 5GAND 4EC0A 5B6NA 5IMCA 2O85A 1HNAA 5DCGA 3WGEA 1JZRA 1KTEA 3VK9A 3OR5A 4TRXA 3C8EA 4Q5FA 4O5RA 3A3TA 4P3YB 3G7YA 2M72A 3VPTA 3TKRA 2IIYA 2IMDA 2G0FA 3BJ5A 4KGIA 1BG5A 5G30A 4NMUA 2DBCA 3GH9A 4HI7A 1EGRA 1YKCA 2F9SA 1QQ2A 4O7HA 3EC3A 2PMTA 2VL2A 3NOFA 1T4ZA 3IBHA 2KLXA 1YDKA 2QC7A 1XW5A 2GSQA 1AC1A 3EYTA 1XBSA 3GV1A 20GSA 2JZTA 3LORA 3EVIA 2LQOA 5D9XA 1SJIA 3IAM2 2A4VA 4ULXA 4PQIA 4KCAA 2IJYA 2HZEB 5G2ZA 2EC4A 4LL1B 3PR8A 2GGTA 1ZCPA 4ILFA 5AGYA 3UAPA 1VF2A 2WCIA 3UVHA 1GUHA 4RUVA 1U87A 2C8UA 2HE3A 4MF5A 2NBSA 1FO5A 6GSWA 1RW1A 4XS1A 5B8BA 4KW6A 1FG4A 5D93A 5LCZA 3ZITA 2B5XA 3L0HA 1IYIA 3KZQA 1EWXA 5AIXA 4OO4A 4OWYA 2XBQA 3W8SA 4KDUA 1X5DA 2WFCA 5HQPA 1Z6NA 1YF0A 1H4OA 1V57A 3DD3A 2LTKA 3UVTA 3QDNA 2DSAA 3F4TA 4ZL7A 2WS2A 4QL9A 2GVPA 4XIHA 1CQGA 2R2JA 4WEYA 4I2UA 3U6VA 3KJYA 1DUGA 3KP8A 3A2WA 2HSHA 5DJMA 3VFIA 1SKWB 4ZB9A 1UN2A 4WXTA 2I3YA 4KAEA 5IMAA 3IE3A 3LYKA 2X64A 4KSOA 2R4VA 4K0NA 2H6ZA 4O32A 1TI3A 2E2MA 5B6MA 2M46A 5J3RA 4IELA 4DEJA 3IA1A 4POLA 4XTSA 3F63A 4TN8A 1XW9A 1TK8B 3APOA 4PURA 1A24A 3QOUA 2ZUPA 2LS5A 3S9FA 4ZIJA 1MD3A 5G31A 2LRNA 2LKUA 5GAPD 1GNEA 3C1SA 3LXZA 4EVMA 5ECSA 1PL1A 1Z6MA 2GSSA 5ECKB 2R6KA 1A8LA 2LQQA 2FD3A 2GZPA 3L9SA 5IMVA 1SD9A 5ECLB 5HFIA 13GSA 2IL3A 1XCCA 3CRTA 3EU3A 4XHMA 5IPGA 2GZYA 2GSTA 2VLVA 5FHIA 4EO3A 5CAXA 2CX4A 4YQUA 1XWAA 3ERFA 3H79A 1SJ6A 4K8MA 1YQ1A 4PGTA 2OE1A 3CMIA 4HOJA 2I4AA 5L71A 3ZIJA 2VL9A 4J2FA 3TJKA 3VURA 3I69A 3RHCA 2A2RA 1BJXA 5IO2A 5IOWA 3BOAA 3DIEA 2ZCTA 3TOTA 3CXGA 4XS4A 3FR3A 3KGKA 2LJAA 1PRXA 5LNKe 6GSVA 1PGTA 4EUYA 5F0GA 1B9YC 1M7TA 1TTZA 5CRDA 3HXSA 2H0IA 2AUVA 4JBBA 3R2QA 4TR4A 3ME7A 4YAPA 4I2TA 5DALA 2HYXA 1TDIA 3H1NA 3UEMA 4K7NA 2KP2A 1A2LA 1PA3A 3IR4A 1TRWA 1SKSB 1F3AA 4IP6A 2QKEA 4RQXA 2RUFA 4MLYA 4EE0A 2ON5A 1NW2A 4J56E 2Z9SA 1TJDA 4PXOA 4KUNA 4J57E 3TKPA 1JZOA 4IBPA 4MZBA 3F8UA 4K1FA 3VWUA 1PL2A 5IPHA 4IW9A 1Y6EA 2FA8A 2YN1A 4NXIA 2DMMA 3W8JA 3CSJA 1XWBA 2HLSA 4ZBAA 3HVXA 2PERA 4MJBA 1GSFA 2H0GA 3BBYA 5DQSA 5J41A 2FHEA 4WBJA 4TR0A 4OFNA 2PPTA 1GTBA 1GH2A 2P5QA 2GT5A 4EL1A 2L6DA 4GQCA 3HJPA 4F0CA 2YZUA 5G1LA 5A4VA 5AIVA 4G10A 1PX6A 3FKFA 3M8NA 2X8GA 3CYNA 1VGLA 5EPFA 1X9WB 3MNGA 1O73A 4MA9A 1WP0A 2K8SA 4PNGA 4L0UA 4FYCA 1ZL9A 2DJKA 2J23A 3MAKA 2WULA 4F03A 5B8AA 4G2EA 2L4QA 3FR9A 3KCMA 5ECOB 1GSYA 3LXTA 1Z7PA 3W6GA 3ZL5A 4Q5NA 1EOGA 1WMJA 4QL7A 10GSA 5KN1A 5ECIB 9GSSA 5J5NA 5LD0A 3D0ZA 1ILOA 2AB6A 1TRUA 2VCVA 5B7CA 1KNGA 2BTOT 1BEDA 3APSA 3GIXA 4BWSA 1M0UA 5H5SA 1EZKA 1O6JA 4V2NA 1A2MA 3TKSA 4ML1A 3GURA 1WE0A 2XPDA 4WR4A 5JCGA 3VWXA 4ISDA 1FAAA 3TKSC 2NTOA 2OA7A 5A5KA 5EL8A 1ERVA 4F0BA 2HZFA 2F3MA 4HJMA 3F3QA 1OC9A 3QCPA 4GWRA 1SK2A 3C73A 1WRYA 2GS3A 1QFNA 4MK3A 4AJ8A 1VF3A 2KHPA 3N9JA 1SU9A 4HZ2A 2YNXA 2YV9A 1O85A 2AV4A 2BMXA 5E59A 3FRCA 1XWGA 2VLTA 4RQRA 4BL7A 2MBTA 3CSHA 1C72A 5G5EA 3QR6A 4BVYA 1F9MA 1B4PA 1DE1A 1GWCA 4ZXGA 1XZOA 1PD21 1B4QA 3L9UA 3WGXA 1TU8A 4LLRA 2KOKA 3LJRA 4OFTA 4ZB6A 5CREA 4YAVA 3TCOA 3D22A 4K6XA 5IO0A 2DC5A 1U3AA 4ZILA 3ZZXA 2L6CA 1GUMA 2DIZA 7GSSA 1EV9A 3DEXA 2CA8A 3G7IA 3FYGA 2B1KA 5AISA 1ZYQB 5ECHB 2H71A 4POMA 3F4RA 1AUCA 2QGVA 3UBKA 3WGDA 4JU5A 3HVSA 2PN8A 3FEUA 3WYWA 1O7UA 5F05A 1YJ6A 2EIOA 1A2JA 2TIRA 2VCWA 3GH6A 3KMOA 3QD9A 4GTUA 4L5OA 1EEJA 3FZ5A 1T7PB 1S3AA 2HFDA 18GSA 3DVWA 17GSA 4MCUA 2L59A 5ECNB 2DJ0A 1GULA 1G6YA 1VF4A 4POBA 3GL5A 5GSSA 4JZQA 1X9MB 1CQHA 2FA4A 5ID2A 1BYEA 4GCIA 4F2IA 2H01A 5H5QA 5DAKA 4ACSA 4ECIA 3EMPA 4POKA 4NHWA 2H1BA 1MDIA 3EE2A 3DMLA 11GSA 2RM5A 4K7IA 14GSA 4XS4B 1XOAA 1KBNA 1XWKA 1EP7A 4CHSA 2GT6A 1ERUA 4ML6A 1V9WA 3M9JA 3IK9A 1NSWA 4E8HA 3LEFA 3FHKA 2ZNMA 4MPFA 5DALB 1XVWA 2RM6A 4IKHA 4KDYA 3HY2A 2TRCP 1SYXA 2YJ7A 5ENUA 4TOPA 1QK8A 2MMAA 5KEJA 4TXOA 3TGZA 1UC7A 2C3TA 3UOMA 3O76A 4DSSA 4EDYA 2CVKA 2L57A 3I9V2 4GSTA 2IPAA 2NPBA 1LU4A 2V2GA 1F6MC 3MDKA 2DJ1A 1X5CA 3KIJA 2VIMA 3KTBA 3KMNA 4BPYA 4PUFC 3DVXA 2VM2A 4OFMA 3TJGA 1QXHA 3ZYWA 2E0QA 1PN9A 3RDWA 2H74A 3IOSA 4MF7A 3KD0A 4IS0A 2C3QA 3M1GA 4BA7A 2OADA 2AAWA 4HQZA 1N8JA 2VCTA 3RBTA 2MMOA 2CT6A 4XCSA 4EKZA 4PQHA 3P8WA 1K3YA 2KUCA 1PSQA 2RUEA 3M9KA 4WR5A 2DMLA 5COHA 4F82A 2L4CA 1GSSA 2DJ3A 1B9XC 2YOIA 2P0GA 2OE0A 3GSTA 4MJEA 3TB2A 1R5PA 2MMZA 3WT1A 3GKXA 1M2DA 2XHFA 4LA1A 5EVOA 1X9SB 1ACVA 3N5OA 1U88A 1T00A 2AHEA 4TR3A 1OKDA 5JWRB 3A5WA 1TP9A 4MZWA 3GUSA 3KM6A 1EV4A 3AY8A 1WOUA 4Z7XA 4D73A 12GSA 4NWYA 4ZL9A 4JR4A 19GSA 1O8XA 4OCFA 1BQ7A 1R4WA 1Z3EA 2B6MA 2B7KA 2JZSA 1TOFA 1Z9HA 3ZLPA 4GF0A 4OMVA 2F8AA 3U5RE 4HU7A 4ECBA 4FIWA 3GYKA 2YWOA 3GFKA 1GSDA 5HR0A 3WT2A 1ON4A 2VUPA 5H5RA 2PUKC 3QPMA 3O3TA 1WJKA 3GKMA 2OACA 1GSUA 4QQ7A 4I8BA 3CBUA 1AW9A 2EIQA 1FOVA 3TOUA 4K9ZA 1MEKA 4NHZA 1A23A 1LJRA 1RQMA 4GSSA 4G19A 1O8WA 2O89A 1OC9B 2HRFA 2G2QA 4CDOA 3FR6A 1URMA 5IIZA 1T8EB 3IXRA 3L9VA 3KH9A 2R3XA 1EEMA 3RPNA 3JCML 4GQFA 1KEBA 2P31A 4N10A 6GSXA 1OC8A 4K7OA 1YZXA 3ZFBA 1SL2B 2XBIA 2H0HA 1GTAA 2PVQA 1LBKA 5ECPB 2LSTA 3CSIA 1MDKA 4GSNA 3VPQA 1TW9A 5AN1A 2CQ9A 2N5BA 3GMFA 3VI7A 2F51A 3IRAA 3FY7A 4AJ7A 4OCEA 2REMA 3IPZA 3Q6OA 3QAWA 4AGSA 3UL3A 2OBIA 1AQXA 3NIVA 3IDVA 3D4MA 4K2DA 1GLPA 4ZBDA 3V1WA 3L78A 3C7MA 2LRTA 3MWHA 3RAZA 2HNLA 5D9VA 4L8EA 1OYJA 3C1RA 1X0RA 5ECRB 4IP1A 4NV5A 4DSRA 5ID2B 5J9CA 4KX4A 1N2AA 2I9HA 3TJBA 5DAKB 1ZOFA 1MTCA 4NPBA 3J7Yb 2GQLA 2C80A 2HXKA 1BAYA 1TRVA 2H6XA 2CVDA 3US3A 4MP4A 1K0OA 4HJ2A 1GRXA 1BX9A 2D2ZA 1TRSA
chains in the Genus database with same CATH superfamily
4YQMA 2C0GA 3P7XA 5ELGA 1SL0B 2GSRA 4MH2A 3I43A 4AJ6A 3FZ4A 5ECQB 1HD2A 4A5PA 2C1YA 5CNWA 5CYYA 3EURA 3KXOA 4EDZA 1O81A 4TXOB 3NZNA 4DSSB 1FVKA 5C00A 4KNDA 1ABAA 2K6VA 5HR3A 2O8VB 5HR1A 4NV2A 2NDOA 3KH7A 3UMAA 2I81A 2VLUA 2WB9A 1G6WA 4FH8A 2B1LA 2J9HA 4HDEA 1FW1A 3GL3A 2B5EA 1TKDB 2O87A 1SYRA 2H6YA 2PBJA 3VWWA 4IJ3A 3ME8A 5FT3A 1G0TA 2IMKA 6GSSA 2PVOC 2X8CA 4TR1A 4JEDA 1UA5A 1USBA 1ZZYA 4KDXA 2V6KA 3GKKA 3KTLA 1XG8A 2MZCA 5F8BA 3GTUA 2YWMA 2P5RA 3HZ4A 1Q4JA 2VM1A 1YEPA 2FY6A 3EWLA 4N0VA 2RLIA 4RI7A 2DIYA 1S3RA 3O6TA 1DBYA 2IWTA 3CTGA 3H8QA 5IMFA 4GXZA 1SJZA 1V58A 3HA9A 5DBQA 3QFAC 1M99A 3TUEA 1DE2A 3UIWA 3LQ7A 1OC3A 4HEA2 1OAZA 1OVNA 3E9JB 3IC4A 2CZ3A 4KCEA 2LEGA 3HJOA 6GSYA 2HI7A 5IMZA 2V41A 5KOXA 2N5AA 1ML6A 1OKTA 4D73B 2JACA 3F4SA 1W89A 4BVXA 5ELAA 3GX8A 2FUG2 2JSZA 1K0AA 1E6BA 2LJKA 3PPUA 4X1UA 3VI5A 3ERGA 1V2AA 5HR2A 2CVBA 2X99A 3EINA 4F9ZA 2GTUA 2HT9A 2GZZA 2FGXA 3SWLA 3ZTLA 4Z2TA 1PX7A 1ZMAA 1QUWA 4Q5QA 2H1AA 4PUAA 3LSZA 1GLQA 3QFBC 4IQAA 1PQNA 3GA4A 2CX3A 4PNFA 3LG6A 3WD6A 5CRGA 4MJCA 2V6OA 5CRHA 1WPIA 2DJJA 1XWCA 4FYUA 4N30A 5FWGA 4K2XA 1XVQA 1MDJA 4KA0A 2M80A 1ST9A 1V40A 2R37A 2YANA 2B7JA 4KF9A 2PU9C 1A8YA 2MMNA 1F37A 3SBCA 1FHEA 3UJ1A 4X0XA 4PQ1A 4WKWA 2C0DA 1FVJA 1F2EA 4JRRA 2MBSA 4MDCA 4ECCA 4FO5A 1I5GA 4XS6A 1K0BA 3HHVA 5C04A 3LFLA 1K0DA 3FMWA 4MZCA 2VL2C 5IOXA 3IHQA 4IVFA 3F0IA 3K8NA 1HYUA 1EGOA 3ZREA 1AXDA 2AJQB 1SD8A 3P2AA 1M9AA 3Q74A 3HZ8A 1HNBA 1AQWA 4HU9A 1GSEA 3FW2A 5DVBA 4L0WA 4I5QA 1PKZA 1FB0A 3A2VA 3PINA 1ERTA 3GHAA 1GTIA 3QAVA 1ZYPA 5IMDA 4JE1A 2XPEA 3P90A 4HUAA 3LWAA 2LRCA 4I97A 1A0FA 1K3OA 2JSYA 2LJRA 4TXVA 2B3SA 1WWJA 4G0IA 4HS1A 2RIIA 2BJXA 4V1Ap 1G7EA 5JWQB 1GP1A 6GSUA 4HZ4A 4O5UA 3E0UA 1R5AA 1FB6A 3KP9A 3VWVA 3GN3A 3TRPA 1ZGNA 5CO3A 1E2YA 1MD4A 1HQOA 4N0ZA 4TW5A 2VD1A 3RHBA 4PX1A 2GQKA 3HYPA 1OE7A 5BMUA 5IQYA 2H72A 1Z7RA 2A2SA 4WETA 3C71A 5GZZB 4WF5A 1T3BA 2DLXA 1VRSD 1JLVA 4MPGA 1ZYEA 3FK8A 3ZVJD 4KSMA 2YV7A 1M9BA 2C0EA 2C0FA 1M2AA 4ZB8A 1SK1A 2FLSA 3LYPA 4YH2A 1Q98A 1R26A 4X4JA 1JZDA 3TDGA 5D8IA 1QMVA 2QSIA 5D9WA 2R0CA 1NHOA 3HVNA 1EOHA 2FNOA 2LNTA 4V1Ag 2IN3A 3QMXA 5E4WA 5F06A 1JZWA 3QAGA 3F6DA 3TRQA 2QA2A 4TR1B 4JR6A 3BD2A 3KEBA 3MSZA 2VOCA 2FCHA 3DKSA 5J9BA 1NM3A 2OE3A 3Q19A 2IFQA 1SENA 2KP1A 3GTUB 3H93A 3IK7A 1J9BA 3UARA 2N5FA 2VO4A 3G7JA 1JLWA 2C3NA 3A5IA 2YZHA 3CRUA 5GSTA 2B5YA 2WRTA 4V2MA 1SKRB 3LW9A 5DDLA 3TJJA 2MYGA 2O7KA 1YF1A 2AYTA 1Z5YE 3DWVA 2X4AA 3Q18A 4ID0A 3DXBA 4HQSA 2WGRA 5D96A 4IHUA 4CY6A 1TI1A 4OO5A 4TKYA 2VCQA 4NAXA 4EXJA 1XIYA 5G5FA 2V1MA 4BWQA 3HCZA 2IMEA 5BRTA 2E2GA 2ON7A 2VL3A 2H30A 4MABA 5D73A 5JWOB 2TRXA 3J7Yk 5KN3A 2YJHA 1W4VA 3PH9A 1GUKA 3BCIA 1AIUA 3CTFA 5CP1A 3ED3A 2WZ9A 3DYRA 5ECMB 2L5OA 1HNCA 4H86A 1SK0A 8GSSA 2FWHA 4N11A 4BVXB 3IV4A 4WF4A 2OJLA 5INYA 2H66A 1GSQA 4GRFA 2VD0A 4I6XA 5D9TA 1GL8A 4LMWA 1NHYA 2V32A 5IM9A 4L5LA 2QA1A 4ECJA 2GDRA 1PMTA 2DKHA 4ICYA 1M2BA 2HZEA 1XW6A 2NVLA 3D6IA 4KH7A 4V2LA 4CW9A 1THXA 3TKQA 1J0FA 3ERWA 2LUSA 2JL4A 3DGQA 4ZL8A 5KN0A 2R5GA 5A4UA 3D4TA 4DVCA 1SL1B 5DJLA 2JADA 4IN0A 3R3EA 4MH3A 4WBRD 4E8EA 3E3EA 3VLNA 1TU7A 4FYBA 1VF1A 3TJFA 1Y25A 2C4JA 2H75A 4YQVA 1K0CA 2ES7A 3PGTA 2OBKA 2K18A 1V98A 4EIPA 5F07A 1B48A 1JHBA 1K0MA 3APQA 3A2XA 4K5SA 2IMIA 5KOWA 4K0GA 1JFUA 2YPMA 2FWFA 5HFKA 3F3RA 2UZ8A 2E7PA 3M0FA 2H1GA 1XXUA 1TK5B 3HKRA 1T4YA 1I9DA 3FZAA 4MF6A 3HVVA 3GRXA 4ZBBA 4MMMA 4AF2A 3EU4A 2CAQA 5EY6A 5ABRA 1R7HA 2LNSA 2YWNA 2H19A 4KB3A 1X5EA 3ZIVA 1XPVA 1XOBA 1PKWA 1T1VA 2WJUA 1AAZA 4O92A 1TK0B 1A0RP 2OKAA 4XRAA 2X8HA 2PGTA 2LV3A 2JU5A 1RK4A 1S3CA 2YCDA 1B8XA 3TRXA 1J08A 5J4UA 1DSBA 22GSA 3F9UA 5HFGA 1YEXA 3ISOA 4FQUA 3UBLA 4IJIA 2K9FA 1YKAA 2H8LA 4IGJA 2K8VA 3L4NA 3H4KA 2EIRA 2H70A 2JZRA 3HDCA 2I1UA 4Z2RA 2ALBA 3ZFLA 1H75A 3F6FA 4LL4B 4Q5RA 4DSQA 2IMFA 3EMXA 2YP6A 3IAS2 1IYHA 3D21A 5DQYA 5DCHA 2FWEA 2VAFA 5CRWA 2CV4A 1GTUA 4XRDA 1OE8A 2YWIA 1XFLA 4MJAA 3GNJA 2WDUA 3HJMA 2HRNA 3ZMLA 4TVEA 3I6AA 3GX0A 3M3MA 1PN0A 1GNWA 3GKNA 1EP8A 4RI6A 1AQVA 5JCWA 3RPPA 2VCXA 1U3IA 5A4WA 5KN2A 3D5JA 2FWGA 3ZRDA 5JCUA 4PTSA 3G9BA 1UVZA 2L5LA 1YY7A 2R0GA 1TXXA 3GSSA 3HD5A 4LMVA 1QGVA 1THOA 4X43A 2H76A 3BCKA 2A2PA 1F3BA 16GSA 4G9HA 1G7OA 2IFQB 2GLRA 3FZ9A 5G1KA 2F8FA 1K3LA 1WIKA 2GQMA 3TKSE 4EF0A 3LGCA 6GSTA 4OD7A 3DRNA 1ERWA 3ZVJA 2VCZA 2XC2A 2H1DA 3ZMKA 4IQ1A 2PWJA 4KE3A 1U6TA 2CAIA 2H73A 1S3DA 4GLTA 2DJ2A 2HSYA 1K0NA 2CZ2A 5GAND 4EC0A 5B6NA 5IMCA 2O85A 1HNAA 5DCGA 3WGEA 1JZRA 1KTEA 3VK9A 3OR5A 4TRXA 4Q5FA 3C8EA 4O5RA 1PFOA 3A3TA 4P3YB 3G7YA 2M72A 3VPTA 3TKRA 2IIYA 2IMDA 2G0FA 3BJ5A 4KGIA 1BG5A 5G30A 4NMUA 2DBCA 3GH9A 4HI7A 1EGRA 1YKCA 2F9SA 1QQ2A 4O7HA 3MYDA 3EC3A 2PMTA 2VL2A 3NOFA 1T4ZA 3IBHA 2KLXA 1YDKA 2QC7A 1XW5A 2GSQA 1AC1A 3EYTA 1XBSA 3GV1A 20GSA 2JZTA 3LORA 3EVIA 2LQOA 5D9XA 2HSMA 1SJIA 3IAM2 2A4VA 4ULXA 4PQIA 4KCAA 2IJYA 2HZEB 5G2ZA 2EC4A 4LL1B 3PR8A 2GGTA 1ZCPA 4ILFA 5AGYA 3UAPA 1VF2A 2WCIA 3UVHA 1GUHA 4RUVA 1U87A 2C8UA 2HE3A 4MF5A 2NBSA 1FO5A 6GSWA 1RW1A 4XS1A 5B8BA 2A4HA 4KW6A 1FG4A 5D93A 4CY8A 5LCZA 3ZITA 2B5XA 3L0HA 1IYIA 3KZQA 1EWXA 5AIXA 3IHGA 4OO4A 4OWYA 2XBQA 3W8SA 4KDUA 1X5DA 2WFCA 5HQPA 1Z6NA 1YF0A 1H4OA 1V57A 3DD3A 2LTKA 3UVTA 3QDNA 2DSAA 3F4TA 4ZL7A 2WS2A 4QL9A 2GVPA 4XIHA 1CQGA 2R2JA 4WEYA 4I2UA 3U6VA 3KJYA 1DUGA 3KP8A 3A2WA 2HSHA 5DJMA 3VFIA 1SKWB 4ZB9A 1UN2A 4WXTA 2I3YA 4KAEA 5IMAA 3IE3A 3LYKA 2X64A 4KSOA 2R4VA 4K0NA 2H6ZA 4O32A 1TI3A 2E2MA 5B6MA 2M46A 5J3RA 4IELA 4DEJA 3IA1A 4POLA 4XTSA 3F63A 4TN8A 1XW9A 1TK8B 3APOA 4PURA 1A24A 3QOUA 2ZUPA 2LS5A 4G0LA 3S9FA 4ZIJA 1MD3A 5G31A 2LRNA 2LKUA 5GAPD 1GNEA 3C1SA 3LXZA 4EVMA 2X49A 5ECSA 1PL1A 1Z6MA 2GSSA 5ECKB 2R6KA 1A8LA 2LQQA 2FD3A 2GZPA 3L9SA 5IMVA 1SD9A 5ECLB 5HFIA 13GSA 2IL3A 1XCCA 3CRTA 3EU3A 4XHMA 4Z2UA 5IPGA 2GZYA 2GSTA 2VLVA 5FHIA 4EO3A 5CAXA 2CX4A 4YQUA 1XWAA 3ERFA 3H79A 1SJ6A 4K8MA 1YQ1A 4PGTA 2OE1A 3CMIA 4HOJA 2I4AA 5L71A 3ZIJA 2VL9A 4J2FA 1M3JA 3TJKA 3VURA 3I69A 3RHCA 2A2RA 1BJXA 5IO2A 5IOWA 3CQFA 3BOAA 3DIEA 2ZCTA 3TOTA 3CXGA 4XS4A 3FR3A 3KGKA 4G0KA 2LJAA 1PRXA 3MIXA 5LNKe 6GSVA 1PGTA 4EUYA 5F0GA 1B9YC 1M7TA 1TTZA 5CRDA 3HXSA 2H0IA 2AUVA 4JBBA 3R2QA 4TR4A 3ME7A 4YAPA 4I2TA 5DALA 2HYXA 1TDIA 3H1NA 3UEMA 4K7NA 2KP2A 1A2LA 1PA3A 3IR4A 1TRWA 1SKSB 1F3AA 4IP6A 2QKEA 4RQXA 2RUFA 4MLYA 4EE0A 2ON5A 1NW2A 4J56E 2Z9SA 1TJDA 4PXOA 4KUNA 4J57E 3TKPA 1JZOA 4IBPA 4MZBA 3F8UA 4K1FA 3VWUA 1PL2A 5IPHA 4IW9A 1Y6EA 2FA8A 2YN1A 4NXIA 2DMMA 3W8JA 3CSJA 1XWBA 2HLSA 4ZBAA 3HVXA 2PERA 4MJBA 1GSFA 2H0GA 3BBYA 5DQSA 5J41A 2FHEA 4WBJA 4TR0A 4OFNA 2PPTA 1GTBA 1GH2A 2P5QA 2GT5A 4EL1A 2L6DA 4GQCA 3HJPA 4F0CA 2YZUA 5G1LA 5A4VA 5AIVA 4G10A 1PX6A 3FKFA 3M8NA 2X8GA 3CYNA 1VGLA 5EPFA 1X9WB 3MNGA 1O73A 4MA9A 1WP0A 2K8SA 4PNGA 4L0UA 4FYCA 1ZL9A 2DJKA 2J23A 3MAKA 2WULA 4F03A 5B8AA 4G2EA 2L4QA 3FR9A 3KCMA 5ECOB 1GSYA 3LXTA 1Z7PA 4HSCX 3W6GA 3ZL5A 4Q5NA 1EOGA 1WMJA 4QL7A 10GSA 5KN1A 5ECIB 9GSSA 5J5NA 5LD0A 3D0ZA 1ILOA 2AB6A 1TRUA 2VCVA 5B7CA 1KNGA 2BTOT 1BEDA 3APSA 3GIXA 4BWSA 1M0UA 5H5SA 1EZKA 1O6JA 4V2NA 1A2MA 3TKSA 4ML1A 3GURA 1WE0A 2XPDA 4WR4A 5JCGA 3VWXA 4ISDA 1FAAA 3TKSC 2NTOA 2OA7A 5A5KA 5EL8A 1ERVA 4F0BA 2HZFA 2F3MA 4HJMA 3F3QA 1OC9A 3QCPA 4GWRA 1SK2A 3C73A 1WRYA 2GS3A 1QFNA 2HRKA 4MK3A 4AJ8A 1VF3A 2KHPA 3N9JA 1SU9A 4HZ2A 2YNXA 2YV9A 1O85A 4O5QA 2AV4A 2BMXA 5E59A 3FRCA 1XWGA 1M3IA 2VLTA 4RQRA 4BL7A 2MBTA 3CSHA 1C72A 5G5EA 3QR6A 4BVYA 1F9MA 1B4PA 1DE1A 1GWCA 4ZXGA 1XZOA 1PD21 1B4QA 3L9UA 3WGXA 1TU8A 4LLRA 2KOKA 3LJRA 4OFTA 4ZB6A 5CREA 4YAVA 3TCOA 3D22A 4K6XA 5IO0A 2DC5A 1U3AA 4ZILA 3ZZXA 2L6CA 1GUMA 2DIZA 7GSSA 1EV9A 3DEXA 2CA8A 3G7IA 3FYGA 4USSA 2B1KA 5AISA 1ZYQB 5ECHB 2H71A 4POMA 3F4RA 1AUCA 2QGVA 3UBKA 3WGDA 4JU5A 3HVSA 2PN8A 3FEUA 3WYWA 1O7UA 5F05A 1YJ6A 2EIOA 1A2JA 2TIRA 2VCWA 3GH6A 3KMOA 3QD9A 4GTUA 4L5OA 1EEJA 3FZ5A 1T7PB 1S3AA 2HFDA 18GSA 3DVWA 17GSA 4MCUA 2L59A 2HRAA 5ECNB 2DJ0A 1GULA 1G6YA 1VF4A 4POBA 3GL5A 5GSSA 4JZQA 1X9MB 1CQHA 2FA4A 5ID2A 1BYEA 4GCIA 4F2IA 2H01A 5H5QA 5DAKA 4ACSA 4ECIA 3EMPA 4POKA 4NHWA 2H1BA 1MDIA 3EE2A 3DMLA 11GSA 2RM5A 4K7IA 14GSA 2R0PA 4XS4B 1XOAA 1KBNA 1XWKA 1EP7A 4CHSA 2GT6A 1ERUA 4ML6A 1V9WA 3M9JA 3IK9A 1NSWA 4E8HA 3LEFA 3FHKA 2ZNMA 4MPFA 5DALB 1XVWA 2RM6A 4IKHA 4KDYA 3HY2A 2TRCP 1SYXA 2YJ7A 5ENUA 4TOPA 1QK8A 2MMAA 5KEJA 4TXOA 3TGZA 1UC7A 2C3TA 3UOMA 3O76A 4DSSA 4EDYA 2CVKA 2L57A 3I9V2 4YKFA 4GSTA 2IPAA 2NPBA 1LU4A 2V2GA 1F6MC 3MDKA 2DJ1A 1X5CA 3KIJA 2VIMA 3KTBA 3KMNA 4BPYA 4PUFC 3DVXA 2VM2A 4OFMA 3TJGA 1QXHA 3ZYWA 2E0QA 1PN9A 3RDWA 2H74A 3IOSA 4MF7A 3KD0A 4IS0A 2C3QA 3M1GA 4BA7A 2OADA 2AAWA 4HQZA 1N8JA 2VCTA 3RBTA 2MMOA 2CT6A 4XCSA 4EKZA 4PQHA 3P8WA 1K3YA 2KUCA 1PSQA 2RUEA 3M9KA 4WR5A 2DMLA 5COHA 4F82A 2L4CA 1GSSA 2DJ3A 1B9XC 2YOIA 2P0GA 2OE0A 3GSTA 4MJEA 3TB2A 1R5PA 2MMZA 3WT1A 3GKXA 1M2DA 2XHFA 4LA1A 5EVOA 1X9SB 1ACVA 3N5OA 1U88A 1T00A 2AHEA 4TR3A 1OKDA 5JWRB 3A5WA 1TP9A 4MZWA 3GUSA 3KM6A 1EV4A 3AY8A 1WOUA 4Z7XA 4D73A 12GSA 4NWYA 4ZL9A 4JR4A 19GSA 1O8XA 4OCFA 1BQ7A 1R4WA 1Z3EA 2B6MA 2B7KA 2JZSA 1TOFA 1Z9HA 3ZLPA 4GF0A 4OMVA 2F8AA 3U5RE 4HU7A 4ECBA 4FIWA 3GYKA 2YWOA 3GFKA 1GSDA 5HR0A 3WT2A 1ON4A 2VUPA 5H5RA 2PUKC 3QPMA 1ZYNA 3O3TA 1WJKA 3GKMA 2OACA 1GSUA 4QQ7A 4I8BA 3CBUA 1AW9A 2EIQA 1FOVA 3TOUA 4K9ZA 1MEKA 4NHZA 1A23A 1LJRA 3IC8A 1RQMA 4GSSA 4G19A 1O8WA 2O89A 1OC9B 2HRFA 2G2QA 4CDOA 3FR6A 1URMA 5IIZA 1T8EB 3IXRA 4EIQA 3L9VA 3KH9A 2R3XA 1EEMA 3RPNA 3JCML 4GQFA 1KEBA 2P31A 4N10A 4BL7B 6GSXA 4BVYB 1OC8A 4K7OA 1YZXA 3ZFBA 1SL2B 2XBIA 2H0HA 1GTAA 2PVQA 1LBKA 5ECPB 2LSTA 3CSIA 1MDKA 4GSNA 3VPQA 1TW9A 5AN1A 4BIKA 2CQ9A 2N5BA 3GMFA 3VI7A 2F51A 3IRAA 3FY7A 4AJ7A 4OCEA 2REMA 3IPZA 3Q6OA 3QAWA 4AGSA 3UL3A 2OBIA 1AQXA 3NIVA 3IDVA 3D4MA 4K2DA 2DKIA 1GLPA 4ZBDA 3V1WA 3L78A 3C7MA 2LRTA 3MWHA 3RAZA 2HNLA 1FOHA 4MNNA 5D9VA 4L8EA 1OYJA 3C1RA 1X0RA 4YKGA 5ECRB 4IP1A 4NV5A 4DSRA 5ID2B 5J9CA 4K5RA 4KX4A 1N2AA 2I9HA 3TJBA 5DAKB 1ZOFA 1MTCA 4NPBA 3J7Yb 3EPTA 2GQLA 2C80A 2HXKA 1BAYA 1TRVA 2H6XA 2CVDA 3US3A 4MP4A 1K0OA 4HJ2A 1GRXA 1BX9A 2D2ZA 1TRSA
chains in the Genus database with same CATH topology
4YQMA 2C0GA 3P7XA 5ELGA 1SL0B 2GSRA 4MH2A 3I43A 4AJ6A 3FZ4A 5ECQB 1HD2A 4A5PA 2C1YA 5CNWA 5CYYA 3EURA 3KXOA 4EDZA 1O81A 4TXOB 3NZNA 4DSSB 1FVKA 5C00A 4KNDA 1ABAA 2K6VA 5HR3A 2O8VB 5HR1A 4NV2A 2NDOA 3KH7A 3UMAA 2I81A 2VLUA 2WB9A 1G6WA 4FH8A 2B1LA 2J9HA 4HDEA 1FW1A 3GL3A 2B5EA 1TKDB 2O87A 1SYRA 2H6YA 2PBJA 3VWWA 4IJ3A 3ME8A 5FT3A 1G0TA 2IMKA 6GSSA 2PVOC 2X8CA 4TR1A 4JEDA 1UA5A 1USBA 1ZZYA 4KDXA 2V6KA 3GKKA 3KTLA 2MZCA 5F8BA 3GTUA 2YWMA 2P5RA 3HZ4A 1Q4JA 2VM1A 1YEPA 2FY6A 3EWLA 4N0VA 2RLIA 4RI7A 2DIYA 3O6TA 1DBYA 2IWTA 3CTGA 3H8QA 5IMFA 4GXZA 1SJZA 1V58A 3HA9A 5DBQA 3QFAC 1M99A 3TUEA 1DE2A 3UIWA 3LQ7A 1OC3A 4HEA2 1OAZA 1OVNA 3E9JB 3IC4A 2CZ3A 4KCEA 2LEGA 3HJOA 6GSYA 2HI7A 5IMZA 2V41A 5KOXA 2N5AA 1ML6A 1OKTA 4D73B 2JACA 3F4SA 1W89A 4BVXA 5ELAA 3GX8A 2FUG2 2JSZA 1K0AA 1E6BA 2LJKA 3PPUA 4X1UA 3VI5A 3ERGA 1V2AA 5HR2A 2CVBA 2X99A 3EINA 4F9ZA 2GTUA 2HT9A 2GZZA 2FGXA 3SWLA 3ZTLA 4Z2TA 1PX7A 1ZMAA 1QUWA 4Q5QA 2H1AA 4PUAA 3LSZA 1GLQA 3QFBC 4IQAA 1PQNA 3GA4A 2CX3A 4PNFA 3LG6A 3WD6A 5CRGA 4MJCA 2V6OA 5CRHA 1WPIA 2DJJA 1XWCA 4FYUA 4N30A 5FWGA 4K2XA 1XVQA 1MDJA 4KA0A 2M80A 1ST9A 1V40A 2R37A 2YANA 2B7JA 4KF9A 2PU9C 1A8YA 2MMNA 1F37A 3SBCA 1FHEA 3UJ1A 4X0XA 4PQ1A 4WKWA 2C0DA 1FVJA 1F2EA 4JRRA 2MBSA 4MDCA 4ECCA 4FO5A 1I5GA 4XS6A 1K0BA 3HHVA 5C04A 3LFLA 1K0DA 3FMWA 4MZCA 2VL2C 5IOXA 3IHQA 4IVFA 3F0IA 3K8NA 1HYUA 1EGOA 3ZREA 1AXDA 2AJQB 1SD8A 3P2AA 1M9AA 3Q74A 3HZ8A 1HNBA 1AQWA 4HU9A 1GSEA 3FW2A 5DVBA 4L0WA 4I5QA 1PKZA 1FB0A 3A2VA 3PINA 1ERTA 3GHAA 1GTIA 3QAVA 1ZYPA 5IMDA 4JE1A 2XPEA 3P90A 4HUAA 3LWAA 2LRCA 4I97A 1A0FA 1K3OA 2JSYA 2LJRA 4TXVA 2B3SA 1WWJA 4G0IA 4HS1A 2RIIA 2BJXA 4V1Ap 1G7EA 5JWQB 1GP1A 6GSUA 4HZ4A 4O5UA 3E0UA 1R5AA 1FB6A 3KP9A 3VWVA 3GN3A 3TRPA 1ZGNA 5CO3A 1E2YA 1MD4A 1HQOA 4N0ZA 4TW5A 2VD1A 3RHBA 4PX1A 2GQKA 3HYPA 1OE7A 5BMUA 5IQYA 2H72A 1Z7RA 2A2SA 4WETA 3C71A 5GZZB 4WF5A 1T3BA 2DLXA 1VRSD 1JLVA 4MPGA 1ZYEA 3FK8A 3ZVJD 4KSMA 2YV7A 1M9BA 2C0EA 2C0FA 1M2AA 4ZB8A 1SK1A 2FLSA 3LYPA 4YH2A 1Q98A 1R26A 4X4JA 1JZDA 3TDGA 5D8IA 1QMVA 2QSIA 5D9WA 2R0CA 1NHOA 1EOHA 2FNOA 2LNTA 4V1Ag 2IN3A 3QMXA 5E4WA 5F06A 1JZWA 3QAGA 3F6DA 3TRQA 2QA2A 4TR1B 4JR6A 3BD2A 3KEBA 3MSZA 2VOCA 2FCHA 3DKSA 5J9BA 1NM3A 2OE3A 3Q19A 2IFQA 1SENA 2KP1A 3GTUB 3H93A 3IK7A 1J9BA 3UARA 2N5FA 2VO4A 3G7JA 1JLWA 2C3NA 3A5IA 2YZHA 3CRUA 5GSTA 2B5YA 2WRTA 4V2MA 1SKRB 3LW9A 5DDLA 3TJJA 2MYGA 2O7KA 1YF1A 2AYTA 1Z5YE 3DWVA 2X4AA 3Q18A 4ID0A 3DXBA 4HQSA 2WGRA 5D96A 4IHUA 4CY6A 1TI1A 4OO5A 4TKYA 2VCQA 4NAXA 4EXJA 1XIYA 5G5FA 2V1MA 4BWQA 3HCZA 2IMEA 5BRTA 2E2GA 2ON7A 2VL3A 2H30A 4MABA 5D73A 5JWOB 2TRXA 3J7Yk 5KN3A 2YJHA 1W4VA 3PH9A 1GUKA 3BCIA 1AIUA 3CTFA 5CP1A 3ED3A 2WZ9A 3DYRA 5ECMB 2L5OA 1HNCA 4H86A 1SK0A 8GSSA 2FWHA 4N11A 4BVXB 3IV4A 4WF4A 2OJLA 5INYA 2H66A 1GSQA 4GRFA 2VD0A 4I6XA 5D9TA 1GL8A 4LMWA 1NHYA 2V32A 5IM9A 4L5LA 2QA1A 4ECJA 2GDRA 1PMTA 2DKHA 4ICYA 1M2BA 2HZEA 1XW6A 2NVLA 3D6IA 4KH7A 4V2LA 4CW9A 1THXA 3TKQA 1J0FA 3ERWA 2LUSA 2JL4A 3DGQA 4ZL8A 5KN0A 2R5GA 5A4UA 3D4TA 4DVCA 1SL1B 5DJLA 2JADA 4IN0A 3R3EA 4MH3A 4WBRD 4E8EA 3E3EA 3VLNA 1TU7A 4FYBA 1VF1A 3TJFA 1Y25A 2C4JA 2H75A 4YQVA 1K0CA 2ES7A 3PGTA 2OBKA 2K18A 1V98A 4EIPA 5F07A 1B48A 1JHBA 1K0MA 3APQA 3A2XA 4K5SA 2IMIA 5KOWA 4K0GA 1JFUA 2YPMA 2FWFA 5HFKA 3F3RA 2UZ8A 2E7PA 3M0FA 2H1GA 1XXUA 1TK5B 3HKRA 1T4YA 1I9DA 3FZAA 4MF6A 3HVVA 3GRXA 4ZBBA 4MMMA 4AF2A 3EU4A 2CAQA 5EY6A 5ABRA 1R7HA 2LNSA 2YWNA 2H19A 4KB3A 1X5EA 3ZIVA 1XPVA 1XOBA 1PKWA 1T1VA 2WJUA 1AAZA 4O92A 1TK0B 1A0RP 2OKAA 4XRAA 2X8HA 2PGTA 2LV3A 2JU5A 1RK4A 1S3CA 2YCDA 1B8XA 3TRXA 1J08A 5J4UA 1DSBA 22GSA 3F9UA 5HFGA 1YEXA 3ISOA 4FQUA 3UBLA 4IJIA 2K9FA 1YKAA 2H8LA 4IGJA 2K8VA 3L4NA 3H4KA 2EIRA 2H70A 2JZRA 3HDCA 2I1UA 4Z2RA 2ALBA 3ZFLA 1H75A 3F6FA 4LL4B 4Q5RA 4DSQA 2IMFA 3EMXA 2YP6A 3IAS2 1IYHA 3D21A 5DQYA 5DCHA 2FWEA 2VAFA 5CRWA 2CV4A 1GTUA 4XRDA 1OE8A 2YWIA 1XFLA 4MJAA 3GNJA 2WDUA 3HJMA 2HRNA 3ZMLA 4TVEA 3I6AA 3GX0A 3M3MA 1PN0A 1GNWA 3GKNA 1EP8A 4RI6A 1AQVA 5JCWA 3RPPA 2VCXA 1U3IA 5A4WA 5KN2A 3D5JA 2FWGA 3ZRDA 5JCUA 4PTSA 3G9BA 1UVZA 2L5LA 1YY7A 2R0GA 1TXXA 3GSSA 3HD5A 4LMVA 1QGVA 1THOA 4X43A 2H76A 3BCKA 2A2PA 1F3BA 16GSA 4G9HA 1G7OA 2IFQB 2GLRA 3FZ9A 5G1KA 2F8FA 1K3LA 1WIKA 2GQMA 3TKSE 4EF0A 3LGCA 6GSTA 4OD7A 3DRNA 1ERWA 3ZVJA 2VCZA 2XC2A 2H1DA 3ZMKA 4IQ1A 2PWJA 4KE3A 1U6TA 2CAIA 2H73A 1S3DA 4GLTA 2DJ2A 2HSYA 1K0NA 2CZ2A 5GAND 4EC0A 5B6NA 5IMCA 2O85A 1HNAA 5DCGA 3WGEA 1JZRA 1KTEA 3VK9A 3OR5A 4TRXA 3C8EA 4Q5FA 4O5RA 3A3TA 4P3YB 3G7YA 2M72A 3VPTA 3TKRA 2IIYA 2IMDA 2G0FA 3BJ5A 4KGIA 1BG5A 5G30A 4NMUA 2DBCA 3GH9A 4HI7A 1EGRA 1YKCA 2F9SA 1QQ2A 4O7HA 3MYDA 3EC3A 2PMTA 2VL2A 3NOFA 1T4ZA 3IBHA 2KLXA 1YDKA 2QC7A 1XW5A 2GSQA 1AC1A 3EYTA 1XBSA 3GV1A 20GSA 2JZTA 3LORA 3EVIA 2LQOA 5D9XA 2HSMA 1SJIA 3IAM2 2A4VA 4ULXA 4PQIA 4KCAA 2IJYA 2HZEB 5G2ZA 2EC4A 4LL1B 3PR8A 2GGTA 1ZCPA 4ILFA 5AGYA 3UAPA 1VF2A 2WCIA 3UVHA 1GUHA 4RUVA 1U87A 2C8UA 2HE3A 4MF5A 2NBSA 1FO5A 6GSWA 1RW1A 4XS1A 5B8BA 2A4HA 4KW6A 1FG4A 5D93A 4CY8A 5LCZA 3ZITA 2B5XA 3L0HA 1IYIA 3KZQA 1EWXA 5AIXA 3IHGA 4OO4A 4OWYA 2XBQA 3W8SA 4KDUA 1X5DA 2WFCA 5HQPA 1Z6NA 1YF0A 1H4OA 1V57A 3DD3A 2LTKA 3UVTA 3QDNA 2DSAA 3F4TA 4ZL7A 2WS2A 4QL9A 2GVPA 4XIHA 1CQGA 2R2JA 4WEYA 4I2UA 3U6VA 3KJYA 1DUGA 3KP8A 3A2WA 2HSHA 5DJMA 3VFIA 1SKWB 4ZB9A 1UN2A 4WXTA 2I3YA 4KAEA 5IMAA 3IE3A 3LYKA 2X64A 4KSOA 2R4VA 4K0NA 2H6ZA 4O32A 1TI3A 2E2MA 5B6MA 2M46A 5J3RA 4IELA 4DEJA 3IA1A 4POLA 4XTSA 3F63A 4TN8A 1XW9A 1TK8B 3APOA 4PURA 1A24A 3QOUA 2ZUPA 2LS5A 4G0LA 3S9FA 4ZIJA 1MD3A 5G31A 2LRNA 2LKUA 5GAPD 1GNEA 3C1SA 3LXZA 4EVMA 2X49A 5ECSA 1PL1A 1Z6MA 2GSSA 5ECKB 2R6KA 1A8LA 2LQQA 2FD3A 2GZPA 3L9SA 5IMVA 1SD9A 5ECLB 5HFIA 13GSA 2IL3A 1XCCA 3CRTA 3EU3A 4XHMA 4Z2UA 5IPGA 2GZYA 2GSTA 2VLVA 5FHIA 4EO3A 5CAXA 2CX4A 4YQUA 1XWAA 3ERFA 3H79A 1SJ6A 4K8MA 1YQ1A 4PGTA 2OE1A 3CMIA 4HOJA 2I4AA 5L71A 3ZIJA 2VL9A 4J2FA 3TJKA 3VURA 3I69A 3RHCA 2A2RA 1BJXA 5IO2A 5IOWA 3BOAA 3DIEA 2ZCTA 3TOTA 3CXGA 4XS4A 3FR3A 3KGKA 4G0KA 2LJAA 1PRXA 3MIXA 5LNKe 6GSVA 1PGTA 4EUYA 5F0GA 1B9YC 1M7TA 1TTZA 5CRDA 3HXSA 2H0IA 2AUVA 4JBBA 3R2QA 4TR4A 3ME7A 4YAPA 4I2TA 5DALA 2HYXA 1TDIA 3H1NA 3UEMA 4K7NA 2KP2A 1A2LA 1PA3A 3IR4A 1TRWA 1SKSB 1F3AA 4IP6A 2QKEA 4RQXA 2RUFA 4MLYA 4EE0A 2ON5A 1NW2A 4J56E 2Z9SA 1TJDA 4PXOA 4KUNA 4J57E 3TKPA 1JZOA 4IBPA 4MZBA 3F8UA 4K1FA 3VWUA 1PL2A 5IPHA 4IW9A 1Y6EA 2FA8A 2YN1A 4NXIA 2DMMA 3W8JA 3CSJA 1XWBA 2HLSA 4ZBAA 3HVXA 2PERA 4MJBA 1GSFA 2H0GA 3BBYA 5DQSA 5J41A 2FHEA 4WBJA 4TR0A 4OFNA 2PPTA 1GTBA 1GH2A 2P5QA 2GT5A 4EL1A 2L6DA 4GQCA 3HJPA 4F0CA 2YZUA 5G1LA 5A4VA 5AIVA 4G10A 1PX6A 3FKFA 3M8NA 2X8GA 3CYNA 1VGLA 5EPFA 1X9WB 3MNGA 1O73A 4MA9A 1WP0A 2K8SA 4PNGA 4L0UA 4FYCA 1ZL9A 2DJKA 2J23A 3MAKA 2WULA 4F03A 5B8AA 4G2EA 2L4QA 3FR9A 3KCMA 5ECOB 1GSYA 3LXTA 1Z7PA 3W6GA 3ZL5A 4Q5NA 1EOGA 1WMJA 4QL7A 10GSA 5KN1A 5ECIB 9GSSA 5J5NA 5LD0A 3D0ZA 1ILOA 2AB6A 1TRUA 2VCVA 5B7CA 1KNGA 2BTOT 1BEDA 3APSA 3GIXA 4BWSA 1M0UA 5H5SA 1EZKA 1O6JA 4V2NA 1A2MA 3TKSA 4ML1A 3GURA 1WE0A 2XPDA 4WR4A 5JCGA 3VWXA 4ISDA 1FAAA 3TKSC 2NTOA 2OA7A 5A5KA 5EL8A 1ERVA 4F0BA 2HZFA 2F3MA 4HJMA 3F3QA 1OC9A 3QCPA 4GWRA 1SK2A 3C73A 1WRYA 2GS3A 1QFNA 2HRKA 4MK3A 4AJ8A 1VF3A 2KHPA 3N9JA 1SU9A 4HZ2A 2YNXA 2YV9A 1O85A 4O5QA 2AV4A 2BMXA 5E59A 3FRCA 1XWGA 2VLTA 4RQRA 4BL7A 2MBTA 3CSHA 1C72A 5G5EA 3QR6A 4BVYA 1F9MA 1B4PA 1DE1A 1GWCA 4ZXGA 1XZOA 1PD21 1B4QA 3L9UA 3WGXA 1TU8A 4LLRA 2KOKA 3LJRA 4OFTA 4ZB6A 5CREA 4YAVA 3TCOA 3D22A 4K6XA 5IO0A 2DC5A 1U3AA 4ZILA 3ZZXA 2L6CA 1GUMA 2DIZA 7GSSA 1EV9A 3DEXA 2CA8A 3G7IA 3FYGA 4USSA 2B1KA 5AISA 1ZYQB 5ECHB 2H71A 4POMA 3F4RA 1AUCA 2QGVA 3UBKA 3WGDA 4JU5A 3HVSA 2PN8A 3FEUA 3WYWA 1O7UA 5F05A 1YJ6A 2EIOA 1A2JA 2TIRA 2VCWA 3GH6A 3KMOA 3QD9A 4GTUA 4L5OA 1EEJA 3FZ5A 1T7PB 1S3AA 2HFDA 18GSA 3DVWA 17GSA 4MCUA 2L59A 2HRAA 5ECNB 2DJ0A 1GULA 1G6YA 1VF4A 4POBA 3GL5A 5GSSA 4JZQA 1X9MB 1CQHA 2FA4A 5ID2A 1BYEA 4GCIA 4F2IA 2H01A 5H5QA 5DAKA 4ACSA 4ECIA 3EMPA 4POKA 4NHWA 2H1BA 1MDIA 3EE2A 3DMLA 11GSA 2RM5A 4K7IA 14GSA 2R0PA 4XS4B 1XOAA 1KBNA 1XWKA 1EP7A 4CHSA 2GT6A 1ERUA 4ML6A 1V9WA 3M9JA 3IK9A 1NSWA 4E8HA 3LEFA 3FHKA 2ZNMA 4MPFA 5DALB 1XVWA 2RM6A 4IKHA 4KDYA 3HY2A 2TRCP 1SYXA 2YJ7A 5ENUA 4TOPA 1QK8A 2MMAA 5KEJA 4TXOA 3TGZA 1UC7A 2C3TA 3UOMA 3O76A 4DSSA 4EDYA 2CVKA 2L57A 3I9V2 4YKFA 4GSTA 2IPAA 2NPBA 1LU4A 2V2GA 1F6MC 3MDKA 2DJ1A 1X5CA 3KIJA 2VIMA 3KTBA 3KMNA 4BPYA 4PUFC 3DVXA 2VM2A 4OFMA 3TJGA 1QXHA 3ZYWA 2E0QA 1PN9A 3RDWA 2H74A 3IOSA 4MF7A 3KD0A 4IS0A 2C3QA 3M1GA 4BA7A 2OADA 2AAWA 4HQZA 1N8JA 2VCTA 3RBTA 2MMOA 2CT6A 4XCSA 4EKZA 4PQHA 3P8WA 1K3YA 2KUCA 1PSQA 2RUEA 3M9KA 4WR5A 2DMLA 5COHA 4F82A 2L4CA 1GSSA 2DJ3A 1B9XC 2YOIA 2P0GA 2OE0A 3GSTA 4MJEA 3TB2A 1R5PA 2MMZA 3WT1A 3GKXA 1M2DA 2XHFA 4LA1A 5EVOA 1X9SB 1ACVA 3N5OA 1U88A 1T00A 2AHEA 4TR3A 1OKDA 5JWRB 3A5WA 1TP9A 4MZWA 3GUSA 3KM6A 1EV4A 3AY8A 1WOUA 4Z7XA 4D73A 12GSA 4NWYA 4ZL9A 4JR4A 19GSA 1O8XA 4OCFA 1BQ7A 1R4WA 1Z3EA 2B6MA 2B7KA 2JZSA 1TOFA 1Z9HA 3ZLPA 4GF0A 4OMVA 2F8AA 3U5RE 4HU7A 4ECBA 4FIWA 3GYKA 2YWOA 3GFKA 1GSDA 5HR0A 3WT2A 1ON4A 2VUPA 5H5RA 2PUKC 3QPMA 1ZYNA 3O3TA 1WJKA 3GKMA 2OACA 1GSUA 4QQ7A 4I8BA 3CBUA 1AW9A 2EIQA 1FOVA 3TOUA 4K9ZA 1MEKA 4NHZA 1A23A 1LJRA 3IC8A 1RQMA 4GSSA 4G19A 1O8WA 2O89A 1OC9B 2HRFA 2G2QA 4CDOA 3FR6A 1URMA 5IIZA 1T8EB 3IXRA 4EIQA 3L9VA 3KH9A 2R3XA 1EEMA 3RPNA 3JCML 4GQFA 1KEBA 2P31A 4N10A 4BL7B 6GSXA 4BVYB 1OC8A 4K7OA 1YZXA 3ZFBA 1SL2B 2XBIA 2H0HA 1GTAA 2PVQA 1LBKA 5ECPB 2LSTA 3CSIA 1MDKA 4GSNA 3VPQA 1TW9A 5AN1A 2CQ9A 2N5BA 3GMFA 3VI7A 2F51A 3IRAA 3FY7A 4AJ7A 4OCEA 2REMA 3IPZA 3Q6OA 3QAWA 4AGSA 3UL3A 2OBIA 1AQXA 3NIVA 3IDVA 3D4MA 4K2DA 2DKIA 1GLPA 4ZBDA 3V1WA 3L78A 3C7MA 2LRTA 3MWHA 3RAZA 2HNLA 1FOHA 4MNNA 5D9VA 4L8EA 1OYJA 3C1RA 1X0RA 4YKGA 5ECRB 4IP1A 4NV5A 4DSRA 5ID2B 5J9CA 4K5RA 4KX4A 1N2AA 2I9HA 3TJBA 5DAKB 1ZOFA 1MTCA 4NPBA 3J7Yb 3EPTA 2GQLA 2C80A 2HXKA 1BAYA 1TRVA 2H6XA 2CVDA 3US3A 4MP4A 1K0OA 4HJ2A 1GRXA 1BX9A 2D2ZA 1TRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YQM A;  2C0G A;  3P7X A;  5ELG A;  1SL0 B;  2GSR A;  4MH2 A;  3I43 A;  4AJ6 A;  3FZ4 A;  5ECQ B;  1HD2 A;  2C1Y A;  5CNW A;  5CYY A;  3EUR A;  3KXO A;  4EDZ A;  1O81 A;  4TXO B;  3NZN A;  4DSS B;  1FVK A;  5C00 A;  4KND A;  1ABA A;  2K6V A;  5HR3 A;  2O8V B;  5HR1 A;  4NV2 A;  2NDO A;  3KH7 A;  3UMA A;  2I81 A;  2VLU A;  2WB9 A;  1G6W A;  4FH8 A;  2B1L A;  2J9H A;  4HDE A;  1FW1 A;  3GL3 A;  2B5E A;  1TKD B;  2O87 A;  1SYR A;  2H6Y A;  2PBJ A;  3VWW A;  4IJ3 A;  3ME8 A;  5FT3 A;  1G0T A;  2IMK A;  6GSS A;  2PVO C;  2X8C A;  4TR1 A;  4JED A;  1UA5 A;  1USB A;  1ZZY A;  4KDX A;  2V6K A;  3GKK A;  3KTL A;  2MZC A;  5F8B A;  3GTU A;  2YWM A;  2P5R A;  3HZ4 A;  1Q4J A;  2VM1 A;  1YEP A;  2FY6 A;  3EWL A;  4N0V A;  2RLI A;  4RI7 A;  2DIY A;  3O6T A;  1DBY A;  2IWT A;  3CTG A;  3H8Q A;  5IMF A;  4GXZ A;  1SJZ A;  1V58 A;  3HA9 A;  5DBQ A;  3QFA C;  1M99 A;  3TUE A;  1DE2 A;  3UIW A;  3LQ7 A;  1OC3 A;  4HEA 2;  1OAZ A;  1OVN A;  3E9J B;  3IC4 A;  2CZ3 A;  4KCE A;  2LEG A;  3HJO A;  6GSY A;  2HI7 A;  5IMZ A;  2V41 A;  2N5A A;  1ML6 A;  1OKT A;  4D73 B;  2JAC A;  3F4S A;  1W89 A;  4BVX A;  5ELA A;  3GX8 A;  2FUG 2;  2JSZ A;  1K0A A;  1E6B A;  2LJK A;  4X1U A;  3VI5 A;  3ERG A;  1V2A A;  5HR2 A;  2CVB A;  2X99 A;  3EIN A;  4F9Z A;  2GTU A;  2HT9 A;  2GZZ A;  2FGX A;  3SWL A;  3ZTL A;  1PX7 A;  1ZMA A;  1QUW A;  4Q5Q A;  2H1A A;  4PUA A;  3LSZ A;  1GLQ A;  3QFB C;  4IQA A;  1PQN A;  3GA4 A;  2CX3 A;  4PNF A;  3LG6 A;  3WD6 A;  5CRG A;  4MJC A;  2V6O A;  5CRH A;  1WPI A;  2DJJ A;  1XWC A;  4FYU A;  4N30 A;  5FWG A;  1XVQ A;  1MDJ A;  4KA0 A;  2M80 A;  1ST9 A;  1V40 A;  2R37 A;  2YAN A;  2B7J A;  2PU9 C;  1A8Y A;  2MMN A;  1F37 A;  3SBC A;  1FHE A;  3UJ1 A;  4X0X A;  4PQ1 A;  4WKW A;  2C0D A;  1FVJ A;  1F2E A;  4JRR A;  2MBS A;  4MDC A;  4ECC A;  4FO5 A;  1I5G A;  4XS6 A;  1K0B A;  3HHV A;  5C04 A;  3LFL A;  1K0D A;  4MZC A;  2VL2 C;  5IOX A;  3IHQ A;  4IVF A;  3F0I A;  3K8N A;  1HYU A;  1EGO A;  3ZRE A;  1AXD A;  2AJQ B;  1SD8 A;  3P2A A;  1M9A A;  3Q74 A;  3HZ8 A;  1HNB A;  1AQW A;  4HU9 A;  1GSE A;  3FW2 A;  5DVB A;  4L0W A;  4I5Q A;  1PKZ A;  1FB0 A;  3A2V A;  3PIN A;  1ERT A;  3GHA A;  1GTI A;  3QAV A;  5IMD A;  4JE1 A;  2XPE A;  3P90 A;  4HUA A;  3LWA A;  2LRC A;  4I97 A;  1A0F A;  1K3O A;  2JSY A;  2LJR A;  4TXV A;  2B3S A;  1WWJ A;  4HS1 A;  2RII A;  2BJX A;  4V1A p;  1G7E A;  5JWQ B;  1GP1 A;  6GSU A;  4HZ4 A;  3E0U A;  1R5A A;  1FB6 A;  3KP9 A;  3VWV A;  3GN3 A;  3TRP A;  1ZGN A;  5CO3 A;  1E2Y A;  1MD4 A;  1HQO A;  4N0Z A;  4TW5 A;  2VD1 A;  3RHB A;  4PX1 A;  2GQK A;  3HYP A;  1OE7 A;  5IQY A;  2H72 A;  1Z7R A;  2A2S A;  4WET A;  3C71 A;  5GZZ B;  4WF5 A;  1T3B A;  2DLX A;  1VRS D;  1JLV A;  4MPG A;  1ZYE A;  3FK8 A;  3ZVJ D;  4KSM A;  2YV7 A;  1M9B A;  2C0E A;  2C0F A;  1M2A A;  4ZB8 A;  1SK1 A;  2FLS A;  3LYP A;  4YH2 A;  1Q98 A;  1R26 A;  1JZD A;  3TDG A;  5D8I A;  1QMV A;  2QSI A;  5D9W A;  1NHO A;  1EOH A;  2FNO A;  2LNT A;  4V1A g;  2IN3 A;  3QMX A;  5E4W A;  5F06 A;  1JZW A;  3QAG A;  3F6D A;  3TRQ A;  4TR1 B;  4JR6 A;  3BD2 A;  3KEB A;  3MSZ A;  2VOC A;  2FCH A;  3DKS A;  5J9B A;  1NM3 A;  2OE3 A;  3Q19 A;  2IFQ A;  1SEN A;  2KP1 A;  3GTU B;  3H93 A;  3IK7 A;  1J9B A;  3UAR A;  2N5F A;  2VO4 A;  3G7J A;  1JLW A;  2C3N A;  3CRU A;  2YZH A;  5GST A;  2B5Y A;  2WRT A;  4V2M A;  1SKR B;  5DDL A;  3TJJ A;  2MYG A;  2O7K A;  1YF1 A;  2AYT A;  1Z5Y E;  3DWV A;  3Q18 A;  4ID0 A;  3DXB A;  4HQS A;  2WGR A;  5D96 A;  4IHU A;  1TI1 A;  4OO5 A;  4TKY A;  2VCQ A;  4NAX A;  4EXJ A;  1XIY A;  5G5F A;  2V1M A;  4BWQ A;  3HCZ A;  2IME A;  2E2G A;  2ON7 A;  2VL3 A;  2H30 A;  4MAB A;  5D73 A;  5JWO B;  2TRX A;  3J7Y k;  5KN3 A;  2YJH A;  1W4V A;  3PH9 A;  1GUK A;  3BCI A;  1AIU A;  3CTF A;  5CP1 A;  3ED3 A;  2WZ9 A;  3DYR A;  5ECM B;  2L5O A;  1HNC A;  4H86 A;  1SK0 A;  8GSS A;  2FWH A;  4N11 A;  3IV4 A;  4WF4 A;  2OJL A;  5INY A;  2H66 A;  1GSQ A;  4GRF A;  2VD0 A;  4I6X A;  5D9T A;  1GL8 A;  4LMW A;  1NHY A;  2V32 A;  5IM9 A;  4L5L A;  4ECJ A;  2GDR A;  1PMT A;  1M2B A;  2HZE A;  1XW6 A;  2NVL A;  3D6I A;  4KH7 A;  4V2L A;  4CW9 A;  1THX A;  3TKQ A;  1J0F A;  3ERW A;  2LUS A;  2JL4 A;  3DGQ A;  4ZL8 A;  5KN0 A;  2R5G A;  5A4U A;  3D4T A;  4DVC A;  1SL1 B;  5DJL A;  2JAD A;  4IN0 A;  4MH3 A;  4WBR D;  4E8E A;  3E3E A;  3VLN A;  1TU7 A;  4FYB A;  1VF1 A;  3TJF A;  1Y25 A;  2C4J A;  2H75 A;  4YQV A;  1K0C A;  2ES7 A;  3PGT A;  2OBK A;  2K18 A;  1V98 A;  5F07 A;  1B48 A;  1JHB A;  1K0M A;  3APQ A;  3A2X A;  2IMI A;  4K0G A;  1JFU A;  2YPM A;  2FWF A;  5HFK A;  3F3R A;  2E7P A;  3M0F A;  2H1G A;  1XXU A;  1TK5 B;  3HKR A;  1T4Y A;  1I9D A;  3FZA A;  4MF6 A;  3HVV A;  3GRX A;  4ZBB A;  4MMM A;  4AF2 A;  3EU4 A;  2CAQ A;  5EY6 A;  5ABR A;  1R7H A;  2LNS A;  2YWN A;  2H19 A;  4KB3 A;  1X5E A;  3ZIV A;  1XPV A;  1XOB A;  1PKW A;  1T1V A;  2WJU A;  1AAZ A;  4O92 A;  1TK0 B;  1A0R P;  2OKA A;  4XRA A;  2X8H A;  2PGT A;  2LV3 A;  2JU5 A;  1RK4 A;  1S3C A;  2YCD A;  1B8X A;  3TRX A;  1J08 A;  5J4U A;  1DSB A;  22GS A;  3F9U A;  5HFG A;  1YEX A;  3ISO A;  3UBL A;  4IJI A;  2K9F A;  1YKA A;  2H8L A;  4IGJ A;  2K8V A;  3L4N A;  3H4K A;  2EIR A;  2H70 A;  2JZR A;  3HDC A;  2I1U A;  2ALB A;  3ZFL A;  1H75 A;  3F6F A;  4LL4 B;  4Q5R A;  4DSQ A;  2IMF A;  3EMX A;  2YP6 A;  3IAS 2;  1IYH A;  3D21 A;  5DQY A;  5DCH A;  2FWE A;  2VAF A;  5CRW A;  2CV4 A;  1GTU A;  4XRD A;  1OE8 A;  2YWI A;  1XFL A;  4MJA A;  3GNJ A;  2WDU A;  3HJM A;  2HRN A;  3ZML A;  4TVE A;  3I6A A;  3GX0 A;  3M3M A;  1GNW A;  3GKN A;  1EP8 A;  4RI6 A;  1AQV A;  5JCW A;  3RPP A;  2VCX A;  1U3I A;  5A4W A;  5KN2 A;  3D5J A;  2FWG A;  3ZRD A;  5JCU A;  3G9B A;  1UVZ A;  2L5L A;  1YY7 A;  1TXX A;  3GSS A;  3HD5 A;  4LMV A;  1QGV A;  1THO A;  4X43 A;  2H76 A;  3BCK A;  1F3B A;  16GS A;  4G9H A;  1G7O A;  2IFQ B;  2GLR A;  3FZ9 A;  5G1K A;  2F8F A;  1K3L A;  1WIK A;  2GQM A;  3TKS E;  4EF0 A;  3LGC A;  6GST A;  4OD7 A;  3DRN A;  1ERW A;  3ZVJ A;  2VCZ A;  2XC2 A;  2H1D A;  3ZMK A;  4IQ1 A;  2PWJ A;  4KE3 A;  1U6T A;  2CAI A;  2H73 A;  1S3D A;  4GLT A;  2DJ2 A;  2HSY A;  1K0N A;  2CZ2 A;  5GAN D;  4EC0 A;  5B6N A;  5IMC A;  2O85 A;  1HNA A;  5DCG A;  3WGE A;  1JZR A;  1KTE A;  3VK9 A;  3OR5 A;  4TRX A;  3C8E A;  4Q5F A;  4O5R A;  3A3T A;  4P3Y B;  3G7Y A;  2M72 A;  3VPT A;  3TKR A;  2IIY A;  2IMD A;  2G0F A;  3BJ5 A;  4KGI A;  1BG5 A;  5G30 A;  4NMU A;  2DBC A;  3GH9 A;  4HI7 A;  1EGR A;  1YKC A;  2F9S A;  1QQ2 A;  4O7H A;  3EC3 A;  2PMT A;  2VL2 A;  3NOF A;  1T4Z A;  3IBH A;  2KLX A;  1YDK A;  2QC7 A;  1XW5 A;  2GSQ A;  1AC1 A;  3EYT A;  1XBS A;  3GV1 A;  20GS A;  2JZT A;  3LOR A;  3EVI A;  2LQO A;  5D9X A;  1SJI A;  3IAM 2;  2A4V A;  4ULX A;  4PQI A;  4KCA A;  2IJY A;  2HZE B;  5G2Z A;  2EC4 A;  4LL1 B;  3PR8 A;  2GGT A;  1ZCP A;  4ILF A;  5AGY A;  3UAP A;  1VF2 A;  2WCI A;  3UVH A;  1GUH A;  4RUV A;  1U87 A;  2C8U A;  2HE3 A;  4MF5 A;  2NBS A;  1FO5 A;  6GSW A;  1RW1 A;  4XS1 A;  5B8B A;  4KW6 A;  1FG4 A;  5D93 A;  5LCZ A;  3ZIT A;  2B5X A;  3L0H A;  1IYI A;  3KZQ A;  1EWX A;  5AIX A;  4OO4 A;  4OWY A;  2XBQ A;  3W8S A;  4KDU A;  1X5D A;  2WFC A;  5HQP A;  1Z6N A;  1YF0 A;  1H4O A;  1V57 A;  3DD3 A;  2LTK A;  3UVT A;  3QDN A;  2DSA A;  3F4T A;  4ZL7 A;  2WS2 A;  4QL9 A;  2GVP A;  4XIH A;  1CQG A;  2R2J A;  4WEY A;  4I2U A;  3U6V A;  3KJY A;  1DUG A;  3KP8 A;  3A2W A;  2HSH A;  5DJM A;  3VFI A;  1SKW B;  4ZB9 A;  1UN2 A;  4WXT A;  2I3Y A;  4KAE A;  5IMA A;  3IE3 A;  3LYK A;  2X64 A;  4KSO A;  2R4V A;  4K0N A;  2H6Z A;  4O32 A;  1TI3 A;  2E2M A;  5B6M A;  2M46 A;  5J3R A;  4IEL A;  4DEJ A;  3IA1 A;  4POL A;  4XTS A;  3F63 A;  4TN8 A;  1XW9 A;  1TK8 B;  3APO A;  4PUR A;  1A24 A;  3QOU A;  2ZUP A;  2LS5 A;  3S9F A;  4ZIJ A;  1MD3 A;  5G31 A;  2LRN A;  2LKU A;  5GAP D;  1GNE A;  3C1S A;  3LXZ A;  4EVM A;  5ECS A;  1PL1 A;  1Z6M A;  2GSS A;  5ECK B;  2R6K A;  1A8L A;  2LQQ A;  2FD3 A;  2GZP A;  3L9S A;  5IMV A;  1SD9 A;  5ECL B;  5HFI A;  13GS A;  2IL3 A;  1XCC A;  3CRT A;  3EU3 A;  4XHM A;  5IPG A;  2GZY A;  2GST A;  2VLV A;  5FHI A;  4EO3 A;  5CAX A;  2CX4 A;  4YQU A;  1XWA A;  3ERF A;  3H79 A;  1SJ6 A;  4K8M A;  1YQ1 A;  4PGT A;  2OE1 A;  3CMI A;  4HOJ A;  2I4A A;  5L71 A;  3ZIJ A;  2VL9 A;  4J2F A;  3TJK A;  3VUR A;  3I69 A;  3RHC A;  2A2R A;  1BJX A;  5IO2 A;  5IOW A;  3BOA A;  3DIE A;  2ZCT A;  3TOT A;  3CXG A;  4XS4 A;  3FR3 A;  3KGK A;  2LJA A;  1PRX A;  5LNK e;  6GSV A;  1PGT A;  4EUY A;  5F0G A;  1B9Y C;  1M7T A;  1TTZ A;  5CRD A;  3HXS A;  2H0I A;  2AUV A;  4JBB A;  3R2Q A;  4TR4 A;  3ME7 A;  4YAP A;  4I2T A;  5DAL A;  2HYX A;  1TDI A;  3H1N A;  3UEM A;  4K7N A;  2KP2 A;  1A2L A;  1PA3 A;  3IR4 A;  1TRW A;  1SKS B;  1F3A A;  4IP6 A;  2QKE A;  4RQX A;  2RUF A;  4MLY A;  4EE0 A;  2ON5 A;  1NW2 A;  4J56 E;  2Z9S A;  1TJD A;  4PXO A;  4KUN A;  4J57 E;  3TKP A;  1JZO A;  4IBP A;  4MZB A;  3F8U A;  4K1F A;  3VWU A;  1PL2 A;  5IPH A;  4IW9 A;  1Y6E A;  2FA8 A;  2YN1 A;  4NXI A;  2DMM A;  3W8J A;  3CSJ A;  1XWB A;  2HLS A;  4ZBA A;  3HVX A;  2PER A;  4MJB A;  1GSF A;  2H0G A;  3BBY A;  5DQS A;  5J41 A;  2FHE A;  4WBJ A;  4TR0 A;  4OFN A;  2PPT A;  1GTB A;  1GH2 A;  2P5Q A;  2GT5 A;  4EL1 A;  2L6D A;  4GQC A;  3HJP A;  4F0C A;  2YZU A;  5G1L A;  5A4V A;  5AIV A;  4G10 A;  1PX6 A;  3FKF A;  3M8N A;  2X8G A;  3CYN A;  1VGL A;  5EPF A;  1X9W B;  3MNG A;  1O73 A;  4MA9 A;  1WP0 A;  2K8S A;  4PNG A;  4L0U A;  4FYC A;  1ZL9 A;  2DJK A;  2J23 A;  3MAK A;  2WUL A;  4F03 A;  5B8A A;  4G2E A;  2L4Q A;  3FR9 A;  3KCM A;  5ECO B;  1GSY A;  3LXT A;  1Z7P A;  3W6G A;  3ZL5 A;  4Q5N A;  1EOG A;  1WMJ A;  4QL7 A;  10GS A;  5KN1 A;  5ECI B;  9GSS A;  5J5N A;  5LD0 A;  3D0Z A;  1ILO A;  2AB6 A;  1TRU A;  2VCV A;  5B7C A;  1KNG A;  2BTO T;  1BED A;  3APS A;  3GIX A;  4BWS A;  1M0U A;  5H5S A;  1EZK A;  1O6J A;  4V2N A;  1A2M A;  3TKS A;  4ML1 A;  3GUR A;  1WE0 A;  2XPD A;  4WR4 A;  5JCG A;  3VWX A;  4ISD A;  1FAA A;  3TKS C;  2NTO A;  2OA7 A;  5A5K A;  5EL8 A;  1ERV A;  4F0B A;  2HZF A;  2F3M A;  4HJM A;  3F3Q A;  1OC9 A;  3QCP A;  4GWR A;  1SK2 A;  3C73 A;  1WRY A;  2GS3 A;  1QFN A;  4MK3 A;  4AJ8 A;  1VF3 A;  2KHP A;  3N9J A;  1SU9 A;  4HZ2 A;  2YNX A;  2YV9 A;  1O85 A;  2AV4 A;  2BMX A;  5E59 A;  3FRC A;  1XWG A;  2VLT A;  4RQR A;  4BL7 A;  2MBT A;  3CSH A;  1C72 A;  5G5E A;  3QR6 A;  4BVY A;  1F9M A;  1B4P A;  1DE1 A;  1GWC A;  4ZXG A;  1XZO A;  1PD2 1;  1B4Q A;  3L9U A;  3WGX A;  1TU8 A;  4LLR A;  2KOK A;  3LJR A;  4OFT A;  4ZB6 A;  5CRE A;  4YAV A;  3TCO A;  3D22 A;  4K6X A;  5IO0 A;  2DC5 A;  1U3A A;  4ZIL A;  3ZZX A;  2L6C A;  1GUM A;  2DIZ A;  7GSS A;  1EV9 A;  3DEX A;  2CA8 A;  3G7I A;  3FYG A;  2B1K A;  5AIS A;  1ZYQ B;  5ECH B;  2H71 A;  4POM A;  3F4R A;  1AUC A;  2QGV A;  3UBK A;  3WGD A;  4JU5 A;  3HVS A;  2PN8 A;  3FEU A;  3WYW A;  1O7U A;  5F05 A;  1YJ6 A;  2EIO A;  1A2J A;  2TIR A;  2VCW A;  3GH6 A;  3KMO A;  3QD9 A;  4GTU A;  4L5O A;  1EEJ A;  3FZ5 A;  1T7P B;  1S3A A;  2HFD A;  18GS A;  3DVW A;  17GS A;  4MCU A;  2L59 A;  5ECN B;  2DJ0 A;  1GUL A;  1G6Y A;  1VF4 A;  4POB A;  3GL5 A;  5GSS A;  4JZQ A;  1X9M B;  1CQH A;  2FA4 A;  5ID2 A;  1BYE A;  4GCI A;  4F2I A;  2H01 A;  5H5Q A;  5DAK A;  4ACS A;  4ECI A;  3EMP A;  4POK A;  4NHW A;  2H1B A;  1MDI A;  3EE2 A;  3DML A;  11GS A;  2RM5 A;  4K7I A;  14GS A;  4XS4 B;  1XOA A;  1KBN A;  1XWK A;  1EP7 A;  4CHS A;  2GT6 A;  1ERU A;  4ML6 A;  1V9W A;  3M9J A;  3IK9 A;  1NSW A;  4E8H A;  3LEF A;  3FHK A;  2ZNM A;  4MPF A;  5DAL B;  1XVW A;  2RM6 A;  4IKH A;  4KDY A;  3HY2 A;  2TRC P;  1SYX A;  2YJ7 A;  5ENU A;  4TOP A;  1QK8 A;  2MMA A;  5KEJ A;  4TXO A;  3TGZ A;  1UC7 A;  2C3T A;  3UOM A;  3O76 A;  4DSS A;  4EDY A;  2CVK A;  2L57 A;  3I9V 2;  4GST A;  2IPA A;  2NPB A;  1LU4 A;  2V2G A;  1F6M C;  3MDK A;  2DJ1 A;  1X5C A;  3KIJ A;  2VIM A;  3KTB A;  3KMN A;  4BPY A;  4PUF C;  3DVX A;  2VM2 A;  4OFM A;  3TJG A;  1QXH A;  3ZYW A;  2E0Q A;  1PN9 A;  3RDW A;  2H74 A;  3IOS A;  4MF7 A;  3KD0 A;  4IS0 A;  2C3Q A;  3M1G A;  4BA7 A;  2OAD A;  2AAW A;  4HQZ A;  1N8J A;  2VCT A;  3RBT A;  2MMO A;  2CT6 A;  4XCS A;  4EKZ A;  4PQH A;  3P8W A;  1K3Y A;  2KUC A;  1PSQ A;  2RUE A;  3M9K A;  4WR5 A;  2DML A;  5COH A;  4F82 A;  2L4C A;  1GSS A;  2DJ3 A;  1B9X C;  2YOI A;  2P0G A;  2OE0 A;  3GST A;  4MJE A;  3TB2 A;  1R5P A;  2MMZ A;  3WT1 A;  3GKX A;  1M2D A;  2XHF A;  4LA1 A;  5EVO A;  1X9S B;  1ACV A;  3N5O A;  1U88 A;  1T00 A;  2AHE A;  4TR3 A;  1OKD A;  5JWR B;  3A5W A;  1TP9 A;  4MZW A;  3GUS A;  3KM6 A;  1EV4 A;  3AY8 A;  1WOU A;  4Z7X A;  4D73 A;  12GS A;  4NWY A;  4ZL9 A;  4JR4 A;  19GS A;  1O8X A;  4OCF A;  1BQ7 A;  1R4W A;  1Z3E A;  2B6M A;  2B7K A;  2JZS A;  1TOF A;  1Z9H A;  3ZLP A;  4GF0 A;  4OMV A;  2F8A A;  3U5R E;  4HU7 A;  4ECB A;  4FIW A;  3GYK A;  2YWO A;  3GFK A;  1GSD A;  5HR0 A;  3WT2 A;  1ON4 A;  2VUP A;  5H5R A;  2PUK C;  3QPM A;  3O3T A;  1WJK A;  3GKM A;  2OAC A;  1GSU A;  4QQ7 A;  4I8B A;  3CBU A;  1AW9 A;  2EIQ A;  1FOV A;  3TOU A;  4K9Z A;  1MEK A;  4NHZ A;  1A23 A;  1LJR A;  1RQM A;  4GSS A;  4G19 A;  1O8W A;  2O89 A;  1OC9 B;  2HRF A;  2G2Q A;  4CDO A;  3FR6 A;  1URM A;  5IIZ A;  1T8E B;  3IXR A;  3L9V A;  3KH9 A;  2R3X A;  1EEM A;  3RPN A;  3JCM L;  4GQF A;  1KEB A;  2P31 A;  4N10 A;  6GSX A;  1OC8 A;  4K7O A;  1YZX A;  3ZFB A;  1SL2 B;  2XBI A;  2H0H A;  1GTA A;  2PVQ A;  1LBK A;  5ECP B;  2LST A;  3CSI A;  1MDK A;  4GSN A;  3VPQ A;  1TW9 A;  5AN1 A;  2CQ9 A;  2N5B A;  3GMF A;  3VI7 A;  2F51 A;  3IRA A;  3FY7 A;  4AJ7 A;  4OCE A;  2REM A;  3IPZ A;  3Q6O A;  3QAW A;  4AGS A;  3UL3 A;  2OBI A;  1AQX A;  3NIV A;  3IDV A;  3D4M A;  4K2D A;  1GLP A;  4ZBD A;  3V1W A;  3L78 A;  3C7M A;  2LRT A;  3MWH A;  3RAZ A;  2HNL A;  5D9V A;  4L8E A;  1OYJ A;  3C1R A;  1X0R A;  5ECR B;  4IP1 A;  4NV5 A;  4DSR A;  5ID2 B;  5J9C A;  4KX4 A;  1N2A A;  2I9H A;  3TJB A;  5DAK B;  1ZOF A;  1MTC A;  4NPB A;  3J7Y b;  2GQL A;  2C80 A;  2HXK A;  1BAY A;  1TRV A;  2H6X A;  2CVD A;  3US3 A;  4MP4 A;  1K0O A;  4HJ2 A;  1GRX A;  1BX9 A;  2D2Z A;  1TRS A; 
#chains in the Genus database with same CATH topology
 4YQM A;  2C0G A;  3P7X A;  5ELG A;  1SL0 B;  2GSR A;  4MH2 A;  3I43 A;  4AJ6 A;  3FZ4 A;  5ECQ B;  1HD2 A;  4A5P A;  2C1Y A;  5CNW A;  5CYY A;  3EUR A;  3KXO A;  4EDZ A;  1O81 A;  4TXO B;  3NZN A;  4DSS B;  1FVK A;  5C00 A;  4KND A;  1ABA A;  2K6V A;  5HR3 A;  2O8V B;  5HR1 A;  4NV2 A;  2NDO A;  3KH7 A;  3UMA A;  2I81 A;  2VLU A;  2WB9 A;  1G6W A;  4FH8 A;  2B1L A;  2J9H A;  4HDE A;  1FW1 A;  3GL3 A;  2B5E A;  1TKD B;  2O87 A;  1SYR A;  2H6Y A;  2PBJ A;  3VWW A;  4IJ3 A;  3ME8 A;  5FT3 A;  1G0T A;  2IMK A;  6GSS A;  2PVO C;  2X8C A;  4TR1 A;  4JED A;  1UA5 A;  1USB A;  1ZZY A;  4KDX A;  2V6K A;  3GKK A;  3KTL A;  1XG8 A;  2MZC A;  5F8B A;  3GTU A;  2YWM A;  2P5R A;  3HZ4 A;  1Q4J A;  2VM1 A;  1YEP A;  2FY6 A;  3EWL A;  4N0V A;  2RLI A;  4RI7 A;  2DIY A;  1S3R A;  3O6T A;  1DBY A;  2IWT A;  3CTG A;  3H8Q A;  5IMF A;  4GXZ A;  1SJZ A;  1V58 A;  3HA9 A;  5DBQ A;  3QFA C;  1M99 A;  3TUE A;  1DE2 A;  3UIW A;  3LQ7 A;  1OC3 A;  4HEA 2;  1OAZ A;  1OVN A;  3E9J B;  3IC4 A;  2CZ3 A;  4KCE A;  2LEG A;  3HJO A;  6GSY A;  2HI7 A;  5IMZ A;  2V41 A;  5KOX A;  2N5A A;  1ML6 A;  1OKT A;  4D73 B;  2JAC A;  3F4S A;  1W89 A;  4BVX A;  5ELA A;  3GX8 A;  2FUG 2;  2JSZ A;  1K0A A;  1E6B A;  2LJK A;  3PPU A;  4X1U A;  3VI5 A;  3ERG A;  1V2A A;  5HR2 A;  2CVB A;  2X99 A;  3EIN A;  4F9Z A;  2GTU A;  2HT9 A;  2GZZ A;  2FGX A;  3SWL A;  3ZTL A;  4Z2T A;  1PX7 A;  1ZMA A;  1QUW A;  4Q5Q A;  2H1A A;  4PUA A;  3LSZ A;  1GLQ A;  3QFB C;  4IQA A;  1PQN A;  3GA4 A;  2CX3 A;  4PNF A;  3LG6 A;  3WD6 A;  5CRG A;  4MJC A;  2V6O A;  5CRH A;  1WPI A;  2DJJ A;  1XWC A;  4FYU A;  4N30 A;  5FWG A;  4K2X A;  1XVQ A;  1MDJ A;  4KA0 A;  2M80 A;  1ST9 A;  1V40 A;  2R37 A;  2YAN A;  2B7J A;  4KF9 A;  2PU9 C;  1A8Y A;  2MMN A;  1F37 A;  3SBC A;  1FHE A;  3UJ1 A;  4X0X A;  4PQ1 A;  4WKW A;  2C0D A;  1FVJ A;  1F2E A;  4JRR A;  2MBS A;  4MDC A;  4ECC A;  4FO5 A;  1I5G A;  4XS6 A;  1K0B A;  3HHV A;  5C04 A;  3LFL A;  1K0D A;  3FMW A;  4MZC A;  2VL2 C;  5IOX A;  3IHQ A;  4IVF A;  3F0I A;  3K8N A;  1HYU A;  1EGO A;  3ZRE A;  1AXD A;  2AJQ B;  1SD8 A;  3P2A A;  1M9A A;  3Q74 A;  3HZ8 A;  1HNB A;  1AQW A;  4HU9 A;  1GSE A;  3FW2 A;  5DVB A;  4L0W A;  4I5Q A;  1PKZ A;  1FB0 A;  3A2V A;  3PIN A;  1ERT A;  3GHA A;  1GTI A;  3QAV A;  1ZYP A;  5IMD A;  4JE1 A;  2XPE A;  3P90 A;  4HUA A;  3LWA A;  2LRC A;  4I97 A;  1A0F A;  1K3O A;  2JSY A;  2LJR A;  4TXV A;  2B3S A;  1WWJ A;  4G0I A;  4HS1 A;  2RII A;  2BJX A;  4V1A p;  1G7E A;  5JWQ B;  1GP1 A;  6GSU A;  4HZ4 A;  4O5U A;  3E0U A;  1R5A A;  1FB6 A;  3KP9 A;  3VWV A;  3GN3 A;  3TRP A;  1ZGN A;  5CO3 A;  1E2Y A;  1MD4 A;  1HQO A;  4N0Z A;  4TW5 A;  2VD1 A;  3RHB A;  4PX1 A;  2GQK A;  3HYP A;  1OE7 A;  5BMU A;  5IQY A;  2H72 A;  1Z7R A;  2A2S A;  4WET A;  3C71 A;  5GZZ B;  4WF5 A;  1T3B A;  2DLX A;  1VRS D;  1JLV A;  4MPG A;  1ZYE A;  3FK8 A;  3ZVJ D;  4KSM A;  2YV7 A;  1M9B A;  2C0E A;  2C0F A;  1M2A A;  4ZB8 A;  1SK1 A;  2FLS A;  3LYP A;  4YH2 A;  1Q98 A;  1R26 A;  4X4J A;  1JZD A;  3TDG A;  5D8I A;  1QMV A;  2QSI A;  5D9W A;  2R0C A;  1NHO A;  3HVN A;  1EOH A;  2FNO A;  2LNT A;  4V1A g;  2IN3 A;  3QMX A;  5E4W A;  5F06 A;  1JZW A;  3QAG A;  3F6D A;  3TRQ A;  2QA2 A;  4TR1 B;  4JR6 A;  3BD2 A;  3KEB A;  3MSZ A;  2VOC A;  2FCH A;  3DKS A;  5J9B A;  1NM3 A;  2OE3 A;  3Q19 A;  2IFQ A;  1SEN A;  2KP1 A;  3GTU B;  3H93 A;  3IK7 A;  1J9B A;  3UAR A;  2N5F A;  2VO4 A;  3G7J A;  1JLW A;  2C3N A;  3A5I A;  2YZH A;  3CRU A;  5GST A;  2B5Y A;  2WRT A;  4V2M A;  1SKR B;  3LW9 A;  5DDL A;  3TJJ A;  2MYG A;  2O7K A;  1YF1 A;  2AYT A;  1Z5Y E;  3DWV A;  2X4A A;  3Q18 A;  4ID0 A;  3DXB A;  4HQS A;  2WGR A;  5D96 A;  4IHU A;  4CY6 A;  1TI1 A;  4OO5 A;  4TKY A;  2VCQ A;  4NAX A;  4EXJ A;  1XIY A;  5G5F A;  2V1M A;  4BWQ A;  3HCZ A;  2IME A;  5BRT A;  2E2G A;  2ON7 A;  2VL3 A;  2H30 A;  4MAB A;  5D73 A;  5JWO B;  2TRX A;  3J7Y k;  5KN3 A;  2YJH A;  1W4V A;  3PH9 A;  1GUK A;  3BCI A;  1AIU A;  3CTF A;  5CP1 A;  3ED3 A;  2WZ9 A;  3DYR A;  5ECM B;  2L5O A;  1HNC A;  4H86 A;  1SK0 A;  8GSS A;  2FWH A;  4N11 A;  4BVX B;  3IV4 A;  4WF4 A;  2OJL A;  5INY A;  2H66 A;  1GSQ A;  4GRF A;  2VD0 A;  4I6X A;  5D9T A;  1GL8 A;  4LMW A;  1NHY A;  2V32 A;  5IM9 A;  4L5L A;  2QA1 A;  4ECJ A;  2GDR A;  1PMT A;  2DKH A;  4ICY A;  1M2B A;  2HZE A;  1XW6 A;  2NVL A;  3D6I A;  4KH7 A;  4V2L A;  4CW9 A;  1THX A;  3TKQ A;  1J0F A;  3ERW A;  2LUS A;  2JL4 A;  3DGQ A;  4ZL8 A;  5KN0 A;  2R5G A;  5A4U A;  3D4T A;  4DVC A;  1SL1 B;  5DJL A;  2JAD A;  4IN0 A;  3R3E A;  4MH3 A;  4WBR D;  4E8E A;  3E3E A;  3VLN A;  1TU7 A;  4FYB A;  1VF1 A;  3TJF A;  1Y25 A;  2C4J A;  2H75 A;  4YQV A;  1K0C A;  2ES7 A;  3PGT A;  2OBK A;  2K18 A;  1V98 A;  4EIP A;  5F07 A;  1B48 A;  1JHB A;  1K0M A;  3APQ A;  3A2X A;  4K5S A;  2IMI A;  5KOW A;  4K0G A;  1JFU A;  2YPM A;  2FWF A;  5HFK A;  3F3R A;  2UZ8 A;  2E7P A;  3M0F A;  2H1G A;  1XXU A;  1TK5 B;  3HKR A;  1T4Y A;  1I9D A;  3FZA A;  4MF6 A;  3HVV A;  3GRX A;  4ZBB A;  4MMM A;  4AF2 A;  3EU4 A;  2CAQ A;  5EY6 A;  5ABR A;  1R7H A;  2LNS A;  2YWN A;  2H19 A;  4KB3 A;  1X5E A;  3ZIV A;  1XPV A;  1XOB A;  1PKW A;  1T1V A;  2WJU A;  1AAZ A;  4O92 A;  1TK0 B;  1A0R P;  2OKA A;  4XRA A;  2X8H A;  2PGT A;  2LV3 A;  2JU5 A;  1RK4 A;  1S3C A;  2YCD A;  1B8X A;  3TRX A;  1J08 A;  5J4U A;  1DSB A;  22GS A;  3F9U A;  5HFG A;  1YEX A;  3ISO A;  4FQU A;  3UBL A;  4IJI A;  2K9F A;  1YKA A;  2H8L A;  4IGJ A;  2K8V A;  3L4N A;  3H4K A;  2EIR A;  2H70 A;  2JZR A;  3HDC A;  2I1U A;  4Z2R A;  2ALB A;  3ZFL A;  1H75 A;  3F6F A;  4LL4 B;  4Q5R A;  4DSQ A;  2IMF A;  3EMX A;  2YP6 A;  3IAS 2;  1IYH A;  3D21 A;  5DQY A;  5DCH A;  2FWE A;  2VAF A;  5CRW A;  2CV4 A;  1GTU A;  4XRD A;  1OE8 A;  2YWI A;  1XFL A;  4MJA A;  3GNJ A;  2WDU A;  3HJM A;  2HRN A;  3ZML A;  4TVE A;  3I6A A;  3GX0 A;  3M3M A;  1PN0 A;  1GNW A;  3GKN A;  1EP8 A;  4RI6 A;  1AQV A;  5JCW A;  3RPP A;  2VCX A;  1U3I A;  5A4W A;  5KN2 A;  3D5J A;  2FWG A;  3ZRD A;  5JCU A;  4PTS A;  3G9B A;  1UVZ A;  2L5L A;  1YY7 A;  2R0G A;  1TXX A;  3GSS A;  3HD5 A;  4LMV A;  1QGV A;  1THO A;  4X43 A;  2H76 A;  3BCK A;  2A2P A;  1F3B A;  16GS A;  4G9H A;  1G7O A;  2IFQ B;  2GLR A;  3FZ9 A;  5G1K A;  2F8F A;  1K3L A;  1WIK A;  2GQM A;  3TKS E;  4EF0 A;  3LGC A;  6GST A;  4OD7 A;  3DRN A;  1ERW A;  3ZVJ A;  2VCZ A;  2XC2 A;  2H1D A;  3ZMK A;  4IQ1 A;  2PWJ A;  4KE3 A;  1U6T A;  2CAI A;  2H73 A;  1S3D A;  4GLT A;  2DJ2 A;  2HSY A;  1K0N A;  2CZ2 A;  5GAN D;  4EC0 A;  5B6N A;  5IMC A;  2O85 A;  1HNA A;  5DCG A;  3WGE A;  1JZR A;  1KTE A;  3VK9 A;  3OR5 A;  4TRX A;  4Q5F A;  3C8E A;  4O5R A;  1PFO A;  3A3T A;  4P3Y B;  3G7Y A;  2M72 A;  3VPT A;  3TKR A;  2IIY A;  2IMD A;  2G0F A;  3BJ5 A;  4KGI A;  1BG5 A;  5G30 A;  4NMU A;  2DBC A;  3GH9 A;  4HI7 A;  1EGR A;  1YKC A;  2F9S A;  1QQ2 A;  4O7H A;  3MYD A;  3EC3 A;  2PMT A;  2VL2 A;  3NOF A;  1T4Z A;  3IBH A;  2KLX A;  1YDK A;  2QC7 A;  1XW5 A;  2GSQ A;  1AC1 A;  3EYT A;  1XBS A;  3GV1 A;  20GS A;  2JZT A;  3LOR A;  3EVI A;  2LQO A;  5D9X A;  2HSM A;  1SJI A;  3IAM 2;  2A4V A;  4ULX A;  4PQI A;  4KCA A;  2IJY A;  2HZE B;  5G2Z A;  2EC4 A;  4LL1 B;  3PR8 A;  2GGT A;  1ZCP A;  4ILF A;  5AGY A;  3UAP A;  1VF2 A;  2WCI A;  3UVH A;  1GUH A;  4RUV A;  1U87 A;  2C8U A;  2HE3 A;  4MF5 A;  2NBS A;  1FO5 A;  6GSW A;  1RW1 A;  4XS1 A;  5B8B A;  2A4H A;  4KW6 A;  1FG4 A;  5D93 A;  4CY8 A;  5LCZ A;  3ZIT A;  2B5X A;  3L0H A;  1IYI A;  3KZQ A;  1EWX A;  5AIX A;  3IHG A;  4OO4 A;  4OWY A;  2XBQ A;  3W8S A;  4KDU A;  1X5D A;  2WFC A;  5HQP A;  1Z6N A;  1YF0 A;  1H4O A;  1V57 A;  3DD3 A;  2LTK A;  3UVT A;  3QDN A;  2DSA A;  3F4T A;  4ZL7 A;  2WS2 A;  4QL9 A;  2GVP A;  4XIH A;  1CQG A;  2R2J A;  4WEY A;  4I2U A;  3U6V A;  3KJY A;  1DUG A;  3KP8 A;  3A2W A;  2HSH A;  5DJM A;  3VFI A;  1SKW B;  4ZB9 A;  1UN2 A;  4WXT A;  2I3Y A;  4KAE A;  5IMA A;  3IE3 A;  3LYK A;  2X64 A;  4KSO A;  2R4V A;  4K0N A;  2H6Z A;  4O32 A;  1TI3 A;  2E2M A;  5B6M A;  2M46 A;  5J3R A;  4IEL A;  4DEJ A;  3IA1 A;  4POL A;  4XTS A;  3F63 A;  4TN8 A;  1XW9 A;  1TK8 B;  3APO A;  4PUR A;  1A24 A;  3QOU A;  2ZUP A;  2LS5 A;  4G0L A;  3S9F A;  4ZIJ A;  1MD3 A;  5G31 A;  2LRN A;  2LKU A;  5GAP D;  1GNE A;  3C1S A;  3LXZ A;  4EVM A;  2X49 A;  5ECS A;  1PL1 A;  1Z6M A;  2GSS A;  5ECK B;  2R6K A;  1A8L A;  2LQQ A;  2FD3 A;  2GZP A;  3L9S A;  5IMV A;  1SD9 A;  5ECL B;  5HFI A;  13GS A;  2IL3 A;  1XCC A;  3CRT A;  3EU3 A;  4XHM A;  4Z2U A;  5IPG A;  2GZY A;  2GST A;  2VLV A;  5FHI A;  4EO3 A;  5CAX A;  2CX4 A;  4YQU A;  1XWA A;  3ERF A;  3H79 A;  1SJ6 A;  4K8M A;  1YQ1 A;  4PGT A;  2OE1 A;  3CMI A;  4HOJ A;  2I4A A;  5L71 A;  3ZIJ A;  2VL9 A;  4J2F A;  1M3J A;  3TJK A;  3VUR A;  3I69 A;  3RHC A;  2A2R A;  1BJX A;  5IO2 A;  5IOW A;  3CQF A;  3BOA A;  3DIE A;  2ZCT A;  3TOT A;  3CXG A;  4XS4 A;  3FR3 A;  3KGK A;  4G0K A;  2LJA A;  1PRX A;  3MIX A;  5LNK e;  6GSV A;  1PGT A;  4EUY A;  5F0G A;  1B9Y C;  1M7T A;  1TTZ A;  5CRD A;  3HXS A;  2H0I A;  2AUV A;  4JBB A;  3R2Q A;  4TR4 A;  3ME7 A;  4YAP A;  4I2T A;  5DAL A;  2HYX A;  1TDI A;  3H1N A;  3UEM A;  4K7N A;  2KP2 A;  1A2L A;  1PA3 A;  3IR4 A;  1TRW A;  1SKS B;  1F3A A;  4IP6 A;  2QKE A;  4RQX A;  2RUF A;  4MLY A;  4EE0 A;  2ON5 A;  1NW2 A;  4J56 E;  2Z9S A;  1TJD A;  4PXO A;  4KUN A;  4J57 E;  3TKP A;  1JZO A;  4IBP A;  4MZB A;  3F8U A;  4K1F A;  3VWU A;  1PL2 A;  5IPH A;  4IW9 A;  1Y6E A;  2FA8 A;  2YN1 A;  4NXI A;  2DMM A;  3W8J A;  3CSJ A;  1XWB A;  2HLS A;  4ZBA A;  3HVX A;  2PER A;  4MJB A;  1GSF A;  2H0G A;  3BBY A;  5DQS A;  5J41 A;  2FHE A;  4WBJ A;  4TR0 A;  4OFN A;  2PPT A;  1GTB A;  1GH2 A;  2P5Q A;  2GT5 A;  4EL1 A;  2L6D A;  4GQC A;  3HJP A;  4F0C A;  2YZU A;  5G1L A;  5A4V A;  5AIV A;  4G10 A;  1PX6 A;  3FKF A;  3M8N A;  2X8G A;  3CYN A;  1VGL A;  5EPF A;  1X9W B;  3MNG A;  1O73 A;  4MA9 A;  1WP0 A;  2K8S A;  4PNG A;  4L0U A;  4FYC A;  1ZL9 A;  2DJK A;  2J23 A;  3MAK A;  2WUL A;  4F03 A;  5B8A A;  4G2E A;  2L4Q A;  3FR9 A;  3KCM A;  5ECO B;  1GSY A;  3LXT A;  1Z7P A;  4HSC X;  3W6G A;  3ZL5 A;  4Q5N A;  1EOG A;  1WMJ A;  4QL7 A;  10GS A;  5KN1 A;  5ECI B;  9GSS A;  5J5N A;  5LD0 A;  3D0Z A;  1ILO A;  2AB6 A;  1TRU A;  2VCV A;  5B7C A;  1KNG A;  2BTO T;  1BED A;  3APS A;  3GIX A;  4BWS A;  1M0U A;  5H5S A;  1EZK A;  1O6J A;  4V2N A;  1A2M A;  3TKS A;  4ML1 A;  3GUR A;  1WE0 A;  2XPD A;  4WR4 A;  5JCG A;  3VWX A;  4ISD A;  1FAA A;  3TKS C;  2NTO A;  2OA7 A;  5A5K A;  5EL8 A;  1ERV A;  4F0B A;  2HZF A;  2F3M A;  4HJM A;  3F3Q A;  1OC9 A;  3QCP A;  4GWR A;  1SK2 A;  3C73 A;  1WRY A;  2GS3 A;  1QFN A;  2HRK A;  4MK3 A;  4AJ8 A;  1VF3 A;  2KHP A;  3N9J A;  1SU9 A;  4HZ2 A;  2YNX A;  2YV9 A;  1O85 A;  4O5Q A;  2AV4 A;  2BMX A;  5E59 A;  3FRC A;  1XWG A;  1M3I A;  2VLT A;  4RQR A;  4BL7 A;  2MBT A;  3CSH A;  1C72 A;  5G5E A;  3QR6 A;  4BVY A;  1F9M A;  1B4P A;  1DE1 A;  1GWC A;  4ZXG A;  1XZO A;  1PD2 1;  1B4Q A;  3L9U A;  3WGX A;  1TU8 A;  4LLR A;  2KOK A;  3LJR A;  4OFT A;  4ZB6 A;  5CRE A;  4YAV A;  3TCO A;  3D22 A;  4K6X A;  5IO0 A;  2DC5 A;  1U3A A;  4ZIL A;  3ZZX A;  2L6C A;  1GUM A;  2DIZ A;  7GSS A;  1EV9 A;  3DEX A;  2CA8 A;  3G7I A;  3FYG A;  4USS A;  2B1K A;  5AIS A;  1ZYQ B;  5ECH B;  2H71 A;  4POM A;  3F4R A;  1AUC A;  2QGV A;  3UBK A;  3WGD A;  4JU5 A;  3HVS A;  2PN8 A;  3FEU A;  3WYW A;  1O7U A;  5F05 A;  1YJ6 A;  2EIO A;  1A2J A;  2TIR A;  2VCW A;  3GH6 A;  3KMO A;  3QD9 A;  4GTU A;  4L5O A;  1EEJ A;  3FZ5 A;  1T7P B;  1S3A A;  2HFD A;  18GS A;  3DVW A;  17GS A;  4MCU A;  2L59 A;  2HRA A;  5ECN B;  2DJ0 A;  1GUL A;  1G6Y A;  1VF4 A;  4POB A;  3GL5 A;  5GSS A;  4JZQ A;  1X9M B;  1CQH A;  2FA4 A;  5ID2 A;  1BYE A;  4GCI A;  4F2I A;  2H01 A;  5H5Q A;  5DAK A;  4ACS A;  4ECI A;  3EMP A;  4POK A;  4NHW A;  2H1B A;  1MDI A;  3EE2 A;  3DML A;  11GS A;  2RM5 A;  4K7I A;  14GS A;  2R0P A;  4XS4 B;  1XOA A;  1KBN A;  1XWK A;  1EP7 A;  4CHS A;  2GT6 A;  1ERU A;  4ML6 A;  1V9W A;  3M9J A;  3IK9 A;  1NSW A;  4E8H A;  3LEF A;  3FHK A;  2ZNM A;  4MPF A;  5DAL B;  1XVW A;  2RM6 A;  4IKH A;  4KDY A;  3HY2 A;  2TRC P;  1SYX A;  2YJ7 A;  5ENU A;  4TOP A;  1QK8 A;  2MMA A;  5KEJ A;  4TXO A;  3TGZ A;  1UC7 A;  2C3T A;  3UOM A;  3O76 A;  4DSS A;  4EDY A;  2CVK A;  2L57 A;  3I9V 2;  4YKF A;  4GST A;  2IPA A;  2NPB A;  1LU4 A;  2V2G A;  1F6M C;  3MDK A;  2DJ1 A;  1X5C A;  3KIJ A;  2VIM A;  3KTB A;  3KMN A;  4BPY A;  4PUF C;  3DVX A;  2VM2 A;  4OFM A;  3TJG A;  1QXH A;  3ZYW A;  2E0Q A;  1PN9 A;  3RDW A;  2H74 A;  3IOS A;  4MF7 A;  3KD0 A;  4IS0 A;  2C3Q A;  3M1G A;  4BA7 A;  2OAD A;  2AAW A;  4HQZ A;  1N8J A;  2VCT A;  3RBT A;  2MMO A;  2CT6 A;  4XCS A;  4EKZ A;  4PQH A;  3P8W A;  1K3Y A;  2KUC A;  1PSQ A;  2RUE A;  3M9K A;  4WR5 A;  2DML A;  5COH A;  4F82 A;  2L4C A;  1GSS A;  2DJ3 A;  1B9X C;  2YOI A;  2P0G A;  2OE0 A;  3GST A;  4MJE A;  3TB2 A;  1R5P A;  2MMZ A;  3WT1 A;  3GKX A;  1M2D A;  2XHF A;  4LA1 A;  5EVO A;  1X9S B;  1ACV A;  3N5O A;  1U88 A;  1T00 A;  2AHE A;  4TR3 A;  1OKD A;  5JWR B;  3A5W A;  1TP9 A;  4MZW A;  3GUS A;  3KM6 A;  1EV4 A;  3AY8 A;  1WOU A;  4Z7X A;  4D73 A;  12GS A;  4NWY A;  4ZL9 A;  4JR4 A;  19GS A;  1O8X A;  4OCF A;  1BQ7 A;  1R4W A;  1Z3E A;  2B6M A;  2B7K A;  2JZS A;  1TOF A;  1Z9H A;  3ZLP A;  4GF0 A;  4OMV A;  2F8A A;  3U5R E;  4HU7 A;  4ECB A;  4FIW A;  3GYK A;  2YWO A;  3GFK A;  1GSD A;  5HR0 A;  3WT2 A;  1ON4 A;  2VUP A;  5H5R A;  2PUK C;  3QPM A;  1ZYN A;  3O3T A;  1WJK A;  3GKM A;  2OAC A;  1GSU A;  4QQ7 A;  4I8B A;  3CBU A;  1AW9 A;  2EIQ A;  1FOV A;  3TOU A;  4K9Z A;  1MEK A;  4NHZ A;  1A23 A;  1LJR A;  3IC8 A;  1RQM A;  4GSS A;  4G19 A;  1O8W A;  2O89 A;  1OC9 B;  2HRF A;  2G2Q A;  4CDO A;  3FR6 A;  1URM A;  5IIZ A;  1T8E B;  3IXR A;  4EIQ A;  3L9V A;  3KH9 A;  2R3X A;  1EEM A;  3RPN A;  3JCM L;  4GQF A;  1KEB A;  2P31 A;  4N10 A;  4BL7 B;  6GSX A;  4BVY B;  1OC8 A;  4K7O A;  1YZX A;  3ZFB A;  1SL2 B;  2XBI A;  2H0H A;  1GTA A;  2PVQ A;  1LBK A;  5ECP B;  2LST A;  3CSI A;  1MDK A;  4GSN A;  3VPQ A;  1TW9 A;  5AN1 A;  4BIK A;  2CQ9 A;  2N5B A;  3GMF A;  3VI7 A;  2F51 A;  3IRA A;  3FY7 A;  4AJ7 A;  4OCE A;  2REM A;  3IPZ A;  3Q6O A;  3QAW A;  4AGS A;  3UL3 A;  2OBI A;  1AQX A;  3NIV A;  3IDV A;  3D4M A;  4K2D A;  2DKI A;  1GLP A;  4ZBD A;  3V1W A;  3L78 A;  3C7M A;  2LRT A;  3MWH A;  3RAZ A;  2HNL A;  1FOH A;  4MNN A;  5D9V A;  4L8E A;  1OYJ A;  3C1R A;  1X0R A;  4YKG A;  5ECR B;  4IP1 A;  4NV5 A;  4DSR A;  5ID2 B;  5J9C A;  4K5R A;  4KX4 A;  1N2A A;  2I9H A;  3TJB A;  5DAK B;  1ZOF A;  1MTC A;  4NPB A;  3J7Y b;  3EPT A;  2GQL A;  2C80 A;  2HXK A;  1BAY A;  1TRV A;  2H6X A;  2CVD A;  3US3 A;  4MP4 A;  1K0O A;  4HJ2 A;  1GRX A;  1BX9 A;  2D2Z A;  1TRS A; 
#chains in the Genus database with same CATH homology
 4YQM A;  2C0G A;  3P7X A;  5ELG A;  1SL0 B;  2GSR A;  4MH2 A;  3I43 A;  4AJ6 A;  3FZ4 A;  5ECQ B;  1HD2 A;  4A5P A;  2C1Y A;  5CNW A;  5CYY A;  3EUR A;  3KXO A;  4EDZ A;  1O81 A;  4TXO B;  3NZN A;  4DSS B;  1FVK A;  5C00 A;  4KND A;  1ABA A;  2K6V A;  5HR3 A;  2O8V B;  5HR1 A;  4NV2 A;  2NDO A;  3KH7 A;  3UMA A;  2I81 A;  2VLU A;  2WB9 A;  1G6W A;  4FH8 A;  2B1L A;  2J9H A;  4HDE A;  1FW1 A;  3GL3 A;  2B5E A;  1TKD B;  2O87 A;  1SYR A;  2H6Y A;  2PBJ A;  3VWW A;  4IJ3 A;  3ME8 A;  5FT3 A;  1G0T A;  2IMK A;  6GSS A;  2PVO C;  2X8C A;  4TR1 A;  4JED A;  1UA5 A;  1USB A;  1ZZY A;  4KDX A;  2V6K A;  3GKK A;  3KTL A;  2MZC A;  5F8B A;  3GTU A;  2YWM A;  2P5R A;  3HZ4 A;  1Q4J A;  2VM1 A;  1YEP A;  2FY6 A;  3EWL A;  4N0V A;  2RLI A;  4RI7 A;  2DIY A;  3O6T A;  1DBY A;  2IWT A;  3CTG A;  3H8Q A;  5IMF A;  4GXZ A;  1SJZ A;  1V58 A;  3HA9 A;  5DBQ A;  3QFA C;  1M99 A;  3TUE A;  1DE2 A;  3UIW A;  3LQ7 A;  1OC3 A;  4HEA 2;  1OAZ A;  1OVN A;  3E9J B;  3IC4 A;  2CZ3 A;  4KCE A;  2LEG A;  3HJO A;  6GSY A;  2HI7 A;  5IMZ A;  2V41 A;  5KOX A;  2N5A A;  1ML6 A;  1OKT A;  4D73 B;  2JAC A;  3F4S A;  1W89 A;  4BVX A;  5ELA A;  3GX8 A;  2FUG 2;  2JSZ A;  1K0A A;  1E6B A;  2LJK A;  3PPU A;  4X1U A;  3VI5 A;  3ERG A;  1V2A A;  5HR2 A;  2CVB A;  2X99 A;  3EIN A;  4F9Z A;  2GTU A;  2HT9 A;  2GZZ A;  2FGX A;  3SWL A;  3ZTL A;  4Z2T A;  1PX7 A;  1ZMA A;  1QUW A;  4Q5Q A;  2H1A A;  4PUA A;  3LSZ A;  1GLQ A;  3QFB C;  4IQA A;  1PQN A;  3GA4 A;  2CX3 A;  4PNF A;  3LG6 A;  3WD6 A;  5CRG A;  4MJC A;  2V6O A;  5CRH A;  1WPI A;  2DJJ A;  1XWC A;  4FYU A;  4N30 A;  5FWG A;  4K2X A;  1XVQ A;  1MDJ A;  4KA0 A;  2M80 A;  1ST9 A;  1V40 A;  2R37 A;  2YAN A;  2B7J A;  4KF9 A;  2PU9 C;  1A8Y A;  2MMN A;  1F37 A;  3SBC A;  1FHE A;  3UJ1 A;  4X0X A;  4PQ1 A;  4WKW A;  2C0D A;  1FVJ A;  1F2E A;  4JRR A;  2MBS A;  4MDC A;  4ECC A;  4FO5 A;  1I5G A;  4XS6 A;  1K0B A;  3HHV A;  5C04 A;  3LFL A;  1K0D A;  3FMW A;  4MZC A;  2VL2 C;  5IOX A;  3IHQ A;  4IVF A;  3F0I A;  3K8N A;  1HYU A;  1EGO A;  3ZRE A;  1AXD A;  2AJQ B;  1SD8 A;  3P2A A;  1M9A A;  3Q74 A;  3HZ8 A;  1HNB A;  1AQW A;  4HU9 A;  1GSE A;  3FW2 A;  5DVB A;  4L0W A;  4I5Q A;  1PKZ A;  1FB0 A;  3A2V A;  3PIN A;  1ERT A;  3GHA A;  1GTI A;  3QAV A;  1ZYP A;  5IMD A;  4JE1 A;  2XPE A;  3P90 A;  4HUA A;  3LWA A;  2LRC A;  4I97 A;  1A0F A;  1K3O A;  2JSY A;  2LJR A;  4TXV A;  2B3S A;  1WWJ A;  4G0I A;  4HS1 A;  2RII A;  2BJX A;  4V1A p;  1G7E A;  5JWQ B;  1GP1 A;  6GSU A;  4HZ4 A;  4O5U A;  3E0U A;  1R5A A;  1FB6 A;  3KP9 A;  3VWV A;  3GN3 A;  3TRP A;  1ZGN A;  5CO3 A;  1E2Y A;  1MD4 A;  1HQO A;  4N0Z A;  4TW5 A;  2VD1 A;  3RHB A;  4PX1 A;  2GQK A;  3HYP A;  1OE7 A;  5BMU A;  5IQY A;  2H72 A;  1Z7R A;  2A2S A;  4WET A;  3C71 A;  5GZZ B;  4WF5 A;  1T3B A;  2DLX A;  1VRS D;  1JLV A;  4MPG A;  1ZYE A;  3FK8 A;  3ZVJ D;  4KSM A;  2YV7 A;  1M9B A;  2C0E A;  2C0F A;  1M2A A;  4ZB8 A;  1SK1 A;  2FLS A;  3LYP A;  4YH2 A;  1Q98 A;  1R26 A;  4X4J A;  1JZD A;  3TDG A;  5D8I A;  1QMV A;  2QSI A;  5D9W A;  2R0C A;  1NHO A;  1EOH A;  2FNO A;  2LNT A;  4V1A g;  2IN3 A;  3QMX A;  5E4W A;  5F06 A;  1JZW A;  3QAG A;  3F6D A;  3TRQ A;  2QA2 A;  4TR1 B;  4JR6 A;  3BD2 A;  3KEB A;  3MSZ A;  2VOC A;  2FCH A;  3DKS A;  5J9B A;  1NM3 A;  2OE3 A;  3Q19 A;  2IFQ A;  1SEN A;  2KP1 A;  3GTU B;  3H93 A;  3IK7 A;  1J9B A;  3UAR A;  2N5F A;  2VO4 A;  3G7J A;  1JLW A;  2C3N A;  3A5I A;  2YZH A;  3CRU A;  5GST A;  2B5Y A;  2WRT A;  4V2M A;  1SKR B;  3LW9 A;  5DDL A;  3TJJ A;  2MYG A;  2O7K A;  1YF1 A;  2AYT A;  1Z5Y E;  3DWV A;  2X4A A;  3Q18 A;  4ID0 A;  3DXB A;  4HQS A;  2WGR A;  5D96 A;  4IHU A;  4CY6 A;  1TI1 A;  4OO5 A;  4TKY A;  2VCQ A;  4NAX A;  4EXJ A;  1XIY A;  5G5F A;  2V1M A;  4BWQ A;  3HCZ A;  2IME A;  5BRT A;  2E2G A;  2ON7 A;  2VL3 A;  2H30 A;  4MAB A;  5D73 A;  5JWO B;  2TRX A;  3J7Y k;  5KN3 A;  2YJH A;  1W4V A;  3PH9 A;  1GUK A;  3BCI A;  1AIU A;  3CTF A;  5CP1 A;  3ED3 A;  2WZ9 A;  3DYR A;  5ECM B;  2L5O A;  1HNC A;  4H86 A;  1SK0 A;  8GSS A;  2FWH A;  4N11 A;  4BVX B;  3IV4 A;  4WF4 A;  2OJL A;  5INY A;  2H66 A;  1GSQ A;  4GRF A;  2VD0 A;  4I6X A;  5D9T A;  1GL8 A;  4LMW A;  1NHY A;  2V32 A;  5IM9 A;  4L5L A;  2QA1 A;  4ECJ A;  2GDR A;  1PMT A;  2DKH A;  4ICY A;  1M2B A;  2HZE A;  1XW6 A;  2NVL A;  3D6I A;  4KH7 A;  4V2L A;  4CW9 A;  1THX A;  3TKQ A;  1J0F A;  3ERW A;  2LUS A;  2JL4 A;  3DGQ A;  4ZL8 A;  5KN0 A;  2R5G A;  5A4U A;  3D4T A;  4DVC A;  1SL1 B;  5DJL A;  2JAD A;  4IN0 A;  3R3E A;  4MH3 A;  4WBR D;  4E8E A;  3E3E A;  3VLN A;  1TU7 A;  4FYB A;  1VF1 A;  3TJF A;  1Y25 A;  2C4J A;  2H75 A;  4YQV A;  1K0C A;  2ES7 A;  3PGT A;  2OBK A;  2K18 A;  1V98 A;  4EIP A;  5F07 A;  1B48 A;  1JHB A;  1K0M A;  3APQ A;  3A2X A;  4K5S A;  2IMI A;  5KOW A;  4K0G A;  1JFU A;  2YPM A;  2FWF A;  5HFK A;  3F3R A;  2UZ8 A;  2E7P A;  3M0F A;  2H1G A;  1XXU A;  1TK5 B;  3HKR A;  1T4Y A;  1I9D A;  3FZA A;  4MF6 A;  3HVV A;  3GRX A;  4ZBB A;  4MMM A;  4AF2 A;  3EU4 A;  2CAQ A;  5EY6 A;  5ABR A;  1R7H A;  2LNS A;  2YWN A;  2H19 A;  4KB3 A;  1X5E A;  3ZIV A;  1XPV A;  1XOB A;  1PKW A;  1T1V A;  2WJU A;  1AAZ A;  4O92 A;  1TK0 B;  1A0R P;  2OKA A;  4XRA A;  2X8H A;  2PGT A;  2LV3 A;  2JU5 A;  1RK4 A;  1S3C A;  2YCD A;  1B8X A;  3TRX A;  1J08 A;  5J4U A;  1DSB A;  22GS A;  3F9U A;  5HFG A;  1YEX A;  3ISO A;  4FQU A;  3UBL A;  4IJI A;  2K9F A;  1YKA A;  2H8L A;  4IGJ A;  2K8V A;  3L4N A;  3H4K A;  2EIR A;  2H70 A;  2JZR A;  3HDC A;  2I1U A;  4Z2R A;  2ALB A;  3ZFL A;  1H75 A;  3F6F A;  4LL4 B;  4Q5R A;  4DSQ A;  2IMF A;  3EMX A;  2YP6 A;  3IAS 2;  1IYH A;  3D21 A;  5DQY A;  5DCH A;  2FWE A;  2VAF A;  5CRW A;  2CV4 A;  1GTU A;  4XRD A;  1OE8 A;  2YWI A;  1XFL A;  4MJA A;  3GNJ A;  2WDU A;  3HJM A;  2HRN A;  3ZML A;  4TVE A;  3I6A A;  3GX0 A;  3M3M A;  1PN0 A;  1GNW A;  3GKN A;  1EP8 A;  4RI6 A;  1AQV A;  5JCW A;  3RPP A;  2VCX A;  1U3I A;  5A4W A;  5KN2 A;  3D5J A;  2FWG A;  3ZRD A;  5JCU A;  4PTS A;  3G9B A;  1UVZ A;  2L5L A;  1YY7 A;  2R0G A;  1TXX A;  3GSS A;  3HD5 A;  4LMV A;  1QGV A;  1THO A;  4X43 A;  2H76 A;  3BCK A;  2A2P A;  1F3B A;  16GS A;  4G9H A;  1G7O A;  2IFQ B;  2GLR A;  3FZ9 A;  5G1K A;  2F8F A;  1K3L A;  1WIK A;  2GQM A;  3TKS E;  4EF0 A;  3LGC A;  6GST A;  4OD7 A;  3DRN A;  1ERW A;  3ZVJ A;  2VCZ A;  2XC2 A;  2H1D A;  3ZMK A;  4IQ1 A;  2PWJ A;  4KE3 A;  1U6T A;  2CAI A;  2H73 A;  1S3D A;  4GLT A;  2DJ2 A;  2HSY A;  1K0N A;  2CZ2 A;  5GAN D;  4EC0 A;  5B6N A;  5IMC A;  2O85 A;  1HNA A;  5DCG A;  3WGE A;  1JZR A;  1KTE A;  3VK9 A;  3OR5 A;  4TRX A;  3C8E A;  4Q5F A;  4O5R A;  3A3T A;  4P3Y B;  3G7Y A;  2M72 A;  3VPT A;  3TKR A;  2IIY A;  2IMD A;  2G0F A;  3BJ5 A;  4KGI A;  1BG5 A;  5G30 A;  4NMU A;  2DBC A;  3GH9 A;  4HI7 A;  1EGR A;  1YKC A;  2F9S A;  1QQ2 A;  4O7H A;  3MYD A;  3EC3 A;  2PMT A;  2VL2 A;  3NOF A;  1T4Z A;  3IBH A;  2KLX A;  1YDK A;  2QC7 A;  1XW5 A;  2GSQ A;  1AC1 A;  3EYT A;  1XBS A;  3GV1 A;  20GS A;  2JZT A;  3LOR A;  3EVI A;  2LQO A;  5D9X A;  2HSM A;  1SJI A;  3IAM 2;  2A4V A;  4ULX A;  4PQI A;  4KCA A;  2IJY A;  2HZE B;  5G2Z A;  2EC4 A;  4LL1 B;  3PR8 A;  2GGT A;  1ZCP A;  4ILF A;  5AGY A;  3UAP A;  1VF2 A;  2WCI A;  3UVH A;  1GUH A;  4RUV A;  1U87 A;  2C8U A;  2HE3 A;  4MF5 A;  2NBS A;  1FO5 A;  6GSW A;  1RW1 A;  4XS1 A;  5B8B A;  2A4H A;  4KW6 A;  1FG4 A;  5D93 A;  4CY8 A;  5LCZ A;  3ZIT A;  2B5X A;  3L0H A;  1IYI A;  3KZQ A;  1EWX A;  5AIX A;  3IHG A;  4OO4 A;  4OWY A;  2XBQ A;  3W8S A;  4KDU A;  1X5D A;  2WFC A;  5HQP A;  1Z6N A;  1YF0 A;  1H4O A;  1V57 A;  3DD3 A;  2LTK A;  3UVT A;  3QDN A;  2DSA A;  3F4T A;  4ZL7 A;  2WS2 A;  4QL9 A;  2GVP A;  4XIH A;  1CQG A;  2R2J A;  4WEY A;  4I2U A;  3U6V A;  3KJY A;  1DUG A;  3KP8 A;  3A2W A;  2HSH A;  5DJM A;  3VFI A;  1SKW B;  4ZB9 A;  1UN2 A;  4WXT A;  2I3Y A;  4KAE A;  5IMA A;  3IE3 A;  3LYK A;  2X64 A;  4KSO A;  2R4V A;  4K0N A;  2H6Z A;  4O32 A;  1TI3 A;  2E2M A;  5B6M A;  2M46 A;  5J3R A;  4IEL A;  4DEJ A;  3IA1 A;  4POL A;  4XTS A;  3F63 A;  4TN8 A;  1XW9 A;  1TK8 B;  3APO A;  4PUR A;  1A24 A;  3QOU A;  2ZUP A;  2LS5 A;  4G0L A;  3S9F A;  4ZIJ A;  1MD3 A;  5G31 A;  2LRN A;  2LKU A;  5GAP D;  1GNE A;  3C1S A;  3LXZ A;  4EVM A;  2X49 A;  5ECS A;  1PL1 A;  1Z6M A;  2GSS A;  5ECK B;  2R6K A;  1A8L A;  2LQQ A;  2FD3 A;  2GZP A;  3L9S A;  5IMV A;  1SD9 A;  5ECL B;  5HFI A;  13GS A;  2IL3 A;  1XCC A;  3CRT A;  3EU3 A;  4XHM A;  4Z2U A;  5IPG A;  2GZY A;  2GST A;  2VLV A;  5FHI A;  4EO3 A;  5CAX A;  2CX4 A;  4YQU A;  1XWA A;  3ERF A;  3H79 A;  1SJ6 A;  4K8M A;  1YQ1 A;  4PGT A;  2OE1 A;  3CMI A;  4HOJ A;  2I4A A;  5L71 A;  3ZIJ A;  2VL9 A;  4J2F A;  3TJK A;  3VUR A;  3I69 A;  3RHC A;  2A2R A;  1BJX A;  5IO2 A;  5IOW A;  3BOA A;  3DIE A;  2ZCT A;  3TOT A;  3CXG A;  4XS4 A;  3FR3 A;  3KGK A;  4G0K A;  2LJA A;  1PRX A;  3MIX A;  5LNK e;  6GSV A;  1PGT A;  4EUY A;  5F0G A;  1B9Y C;  1M7T A;  1TTZ A;  5CRD A;  3HXS A;  2H0I A;  2AUV A;  4JBB A;  3R2Q A;  4TR4 A;  3ME7 A;  4YAP A;  4I2T A;  5DAL A;  2HYX A;  1TDI A;  3H1N A;  3UEM A;  4K7N A;  2KP2 A;  1A2L A;  1PA3 A;  3IR4 A;  1TRW A;  1SKS B;  1F3A A;  4IP6 A;  2QKE A;  4RQX A;  2RUF A;  4MLY A;  4EE0 A;  2ON5 A;  1NW2 A;  4J56 E;  2Z9S A;  1TJD A;  4PXO A;  4KUN A;  4J57 E;  3TKP A;  1JZO A;  4IBP A;  4MZB A;  3F8U A;  4K1F A;  3VWU A;  1PL2 A;  5IPH A;  4IW9 A;  1Y6E A;  2FA8 A;  2YN1 A;  4NXI A;  2DMM A;  3W8J A;  3CSJ A;  1XWB A;  2HLS A;  4ZBA A;  3HVX A;  2PER A;  4MJB A;  1GSF A;  2H0G A;  3BBY A;  5DQS A;  5J41 A;  2FHE A;  4WBJ A;  4TR0 A;  4OFN A;  2PPT A;  1GTB A;  1GH2 A;  2P5Q A;  2GT5 A;  4EL1 A;  2L6D A;  4GQC A;  3HJP A;  4F0C A;  2YZU A;  5G1L A;  5A4V A;  5AIV A;  4G10 A;  1PX6 A;  3FKF A;  3M8N A;  2X8G A;  3CYN A;  1VGL A;  5EPF A;  1X9W B;  3MNG A;  1O73 A;  4MA9 A;  1WP0 A;  2K8S A;  4PNG A;  4L0U A;  4FYC A;  1ZL9 A;  2DJK A;  2J23 A;  3MAK A;  2WUL A;  4F03 A;  5B8A A;  4G2E A;  2L4Q A;  3FR9 A;  3KCM A;  5ECO B;  1GSY A;  3LXT A;  1Z7P A;  3W6G A;  3ZL5 A;  4Q5N A;  1EOG A;  1WMJ A;  4QL7 A;  10GS A;  5KN1 A;  5ECI B;  9GSS A;  5J5N A;  5LD0 A;  3D0Z A;  1ILO A;  2AB6 A;  1TRU A;  2VCV A;  5B7C A;  1KNG A;  2BTO T;  1BED A;  3APS A;  3GIX A;  4BWS A;  1M0U A;  5H5S A;  1EZK A;  1O6J A;  4V2N A;  1A2M A;  3TKS A;  4ML1 A;  3GUR A;  1WE0 A;  2XPD A;  4WR4 A;  5JCG A;  3VWX A;  4ISD A;  1FAA A;  3TKS C;  2NTO A;  2OA7 A;  5A5K A;  5EL8 A;  1ERV A;  4F0B A;  2HZF A;  2F3M A;  4HJM A;  3F3Q A;  1OC9 A;  3QCP A;  4GWR A;  1SK2 A;  3C73 A;  1WRY A;  2GS3 A;  1QFN A;  2HRK A;  4MK3 A;  4AJ8 A;  1VF3 A;  2KHP A;  3N9J A;  1SU9 A;  4HZ2 A;  2YNX A;  2YV9 A;  1O85 A;  4O5Q A;  2AV4 A;  2BMX A;  5E59 A;  3FRC A;  1XWG A;  2VLT A;  4RQR A;  4BL7 A;  2MBT A;  3CSH A;  1C72 A;  5G5E A;  3QR6 A;  4BVY A;  1F9M A;  1B4P A;  1DE1 A;  1GWC A;  4ZXG A;  1XZO A;  1PD2 1;  1B4Q A;  3L9U A;  3WGX A;  1TU8 A;  4LLR A;  2KOK A;  3LJR A;  4OFT A;  4ZB6 A;  5CRE A;  4YAV A;  3TCO A;  3D22 A;  4K6X A;  5IO0 A;  2DC5 A;  1U3A A;  4ZIL A;  3ZZX A;  2L6C A;  1GUM A;  2DIZ A;  7GSS A;  1EV9 A;  3DEX A;  2CA8 A;  3G7I A;  3FYG A;  4USS A;  2B1K A;  5AIS A;  1ZYQ B;  5ECH B;  2H71 A;  4POM A;  3F4R A;  1AUC A;  2QGV A;  3UBK A;  3WGD A;  4JU5 A;  3HVS A;  2PN8 A;  3FEU A;  3WYW A;  1O7U A;  5F05 A;  1YJ6 A;  2EIO A;  1A2J A;  2TIR A;  2VCW A;  3GH6 A;  3KMO A;  3QD9 A;  4GTU A;  4L5O A;  1EEJ A;  3FZ5 A;  1T7P B;  1S3A A;  2HFD A;  18GS A;  3DVW A;  17GS A;  4MCU A;  2L59 A;  2HRA A;  5ECN B;  2DJ0 A;  1GUL A;  1G6Y A;  1VF4 A;  4POB A;  3GL5 A;  5GSS A;  4JZQ A;  1X9M B;  1CQH A;  2FA4 A;  5ID2 A;  1BYE A;  4GCI A;  4F2I A;  2H01 A;  5H5Q A;  5DAK A;  4ACS A;  4ECI A;  3EMP A;  4POK A;  4NHW A;  2H1B A;  1MDI A;  3EE2 A;  3DML A;  11GS A;  2RM5 A;  4K7I A;  14GS A;  2R0P A;  4XS4 B;  1XOA A;  1KBN A;  1XWK A;  1EP7 A;  4CHS A;  2GT6 A;  1ERU A;  4ML6 A;  1V9W A;  3M9J A;  3IK9 A;  1NSW A;  4E8H A;  3LEF A;  3FHK A;  2ZNM A;  4MPF A;  5DAL B;  1XVW A;  2RM6 A;  4IKH A;  4KDY A;  3HY2 A;  2TRC P;  1SYX A;  2YJ7 A;  5ENU A;  4TOP A;  1QK8 A;  2MMA A;  5KEJ A;  4TXO A;  3TGZ A;  1UC7 A;  2C3T A;  3UOM A;  3O76 A;  4DSS A;  4EDY A;  2CVK A;  2L57 A;  3I9V 2;  4YKF A;  4GST A;  2IPA A;  2NPB A;  1LU4 A;  2V2G A;  1F6M C;  3MDK A;  2DJ1 A;  1X5C A;  3KIJ A;  2VIM A;  3KTB A;  3KMN A;  4BPY A;  4PUF C;  3DVX A;  2VM2 A;  4OFM A;  3TJG A;  1QXH A;  3ZYW A;  2E0Q A;  1PN9 A;  3RDW A;  2H74 A;  3IOS A;  4MF7 A;  3KD0 A;  4IS0 A;  2C3Q A;  3M1G A;  4BA7 A;  2OAD A;  2AAW A;  4HQZ A;  1N8J A;  2VCT A;  3RBT A;  2MMO A;  2CT6 A;  4XCS A;  4EKZ A;  4PQH A;  3P8W A;  1K3Y A;  2KUC A;  1PSQ A;  2RUE A;  3M9K A;  4WR5 A;  2DML A;  5COH A;  4F82 A;  2L4C A;  1GSS A;  2DJ3 A;  1B9X C;  2YOI A;  2P0G A;  2OE0 A;  3GST A;  4MJE A;  3TB2 A;  1R5P A;  2MMZ A;  3WT1 A;  3GKX A;  1M2D A;  2XHF A;  4LA1 A;  5EVO A;  1X9S B;  1ACV A;  3N5O A;  1U88 A;  1T00 A;  2AHE A;  4TR3 A;  1OKD A;  5JWR B;  3A5W A;  1TP9 A;  4MZW A;  3GUS A;  3KM6 A;  1EV4 A;  3AY8 A;  1WOU A;  4Z7X A;  4D73 A;  12GS A;  4NWY A;  4ZL9 A;  4JR4 A;  19GS A;  1O8X A;  4OCF A;  1BQ7 A;  1R4W A;  1Z3E A;  2B6M A;  2B7K A;  2JZS A;  1TOF A;  1Z9H A;  3ZLP A;  4GF0 A;  4OMV A;  2F8A A;  3U5R E;  4HU7 A;  4ECB A;  4FIW A;  3GYK A;  2YWO A;  3GFK A;  1GSD A;  5HR0 A;  3WT2 A;  1ON4 A;  2VUP A;  5H5R A;  2PUK C;  3QPM A;  1ZYN A;  3O3T A;  1WJK A;  3GKM A;  2OAC A;  1GSU A;  4QQ7 A;  4I8B A;  3CBU A;  1AW9 A;  2EIQ A;  1FOV A;  3TOU A;  4K9Z A;  1MEK A;  4NHZ A;  1A23 A;  1LJR A;  3IC8 A;  1RQM A;  4GSS A;  4G19 A;  1O8W A;  2O89 A;  1OC9 B;  2HRF A;  2G2Q A;  4CDO A;  3FR6 A;  1URM A;  5IIZ A;  1T8E B;  3IXR A;  4EIQ A;  3L9V A;  3KH9 A;  2R3X A;  1EEM A;  3RPN A;  3JCM L;  4GQF A;  1KEB A;  2P31 A;  4N10 A;  4BL7 B;  6GSX A;  4BVY B;  1OC8 A;  4K7O A;  1YZX A;  3ZFB A;  1SL2 B;  2XBI A;  2H0H A;  1GTA A;  2PVQ A;  1LBK A;  5ECP B;  2LST A;  3CSI A;  1MDK A;  4GSN A;  3VPQ A;  1TW9 A;  5AN1 A;  2CQ9 A;  2N5B A;  3GMF A;  3VI7 A;  2F51 A;  3IRA A;  3FY7 A;  4AJ7 A;  4OCE A;  2REM A;  3IPZ A;  3Q6O A;  3QAW A;  4AGS A;  3UL3 A;  2OBI A;  1AQX A;  3NIV A;  3IDV A;  3D4M A;  4K2D A;  2DKI A;  1GLP A;  4ZBD A;  3V1W A;  3L78 A;  3C7M A;  2LRT A;  3MWH A;  3RAZ A;  2HNL A;  1FOH A;  4MNN A;  5D9V A;  4L8E A;  1OYJ A;  3C1R A;  1X0R A;  4YKG A;  5ECR B;  4IP1 A;  4NV5 A;  4DSR A;  5ID2 B;  5J9C A;  4K5R A;  4KX4 A;  1N2A A;  2I9H A;  3TJB A;  5DAK B;  1ZOF A;  1MTC A;  4NPB A;  3J7Y b;  3EPT A;  2GQL A;  2C80 A;  2HXK A;  1BAY A;  1TRV A;  2H6X A;  2CVD A;  3US3 A;  4MP4 A;  1K0O A;  4HJ2 A;  1GRX A;  1BX9 A;  2D2Z A;  1TRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...