2VM2A

Crystal structure of barley thioredoxin h isoform 1 crystallized using peg as precipitant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
109
Chain Sequence
GAVIACHTKQEFDTHMANGKDTGKLVIIDFTASWCGPCRVIAPVFAEYAKKFPGAIFLKVDVDELKDVAEAYNVEAMPTFLFIKDGEKVDSVVGGRKDDIHTKIVALMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN H ISOFORM 1.
publication title Crystal Structures of Barley Thioredoxin H Isoforms Hvtrxh1 and Hvtrxh2 Reveal Features Involved in Protein Recognition and Possibly in Discriminating the Isoform Specificity.
pubmed doi rcsb
source organism Hordeum vulgare var. distichum
total genus 30
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2008-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vm2A01
1ST9A 5C00A 4XRAA 4BPYA 1O85A 1WWJA 2WDUA 1TRWA 3KM6A 4RQRA 2X8CA 2HSYA 10GSA 2PMTA 4TN8A 1BG5A 3W8SA 3V1WA 4F03A 1GRXA 2OE0A 1GWCA 1BEDA 2I3YA 5IMAA 1Q4JA 4YH2A 5IMFA 3H8QA 3IOSA 1GNWA 2QKEA 3TRPA 4Q5QA 4EDZA 3TCOA 2DIZA 1WPIA 1MD3A 3KP8A 5AGYA 2AB6A 1M2AA 4V1Ag 3P8WA 4KA0A 2G2QA 2YWOA 3UVTA 3W6GA 4IGJA 2AAWA 6GSUA 3G7YA 1O73A 1K0OA 3FR9A 5F8BA 2X99A 2H19A 3ZVJD 3EURA 5CP1A 2HZEB 1K0CA 4XS4A 3TB2A 1GL8A 2VLUA 1BAYA 3CRUA 4K6XA 1MDIA 4WBJA 3GTUB 1NHOA 3HKRA 4KAEA 2ZNMA 1AQWA 2E0QA 3ZITA 4TR4A 4GCIA 4IS0A 2CVKA 3EVIA 1EGOA 2DMMA 5GAPD 4JU5A 2CX4A 4F82A 1VF3A 3FZ5A 3ZYWA 4E8EA 3U6VA 2GLRA 4IVFA 4PQ1A 2FY6A 3C71A 4QL9A 4WF4A 4V2NA 4BA7A 2FGXA 4ML1A 4D73A 3CYNA 1G0TA 3DRNA 3RDWA 2HSHA 3ZIVA 2RIIA 1Z3EA 5J41A 2A2SA 3S9FA 3TJBA 1I9DA 2REMA 5E59A 3H4KA 3IDVA 1TK5B 4ECJA 4KB3A 4PURA 1G6WA 2C0FA 1X0RA 3TKQA 4AJ7A 1VF4A 1SJZA 5GSTA 1R4WA 1M9AA 2CVDA 3TGZA 1OC9B 2GVPA 3VI5A 5A4VA 3DD3A 5ID2A 4PNFA 1XWKA 2TIRA 3KH9A 4HDEA 4IW9A 5G1LA 3FK8A 5D93A 3WT2A 1XFLA 1HD2A 3SBCA 3F63A 1T4ZA 4FYBA 2XPDA 1W89A 4RQXA 4Q5FA 4V2LA 3WGDA 4IP6A 1F3AA 2GGTA 1AIUA 2AJQB 3EU3A 3GH9A 3LYPA 2DMLA 2RLIA 2ON5A 5DBQA 3DIEA 1JLWA 2LJAA 9GSSA 5D73A 4V1Ap 5IMZA 4DEJA 3GSTA 4EKZA 2FUG2 1VF1A 1GSDA 3TOTA 3I43A 4L8EA 2R5GA 3QFBC 2N5FA 1R26A 2MMAA 3F0IA 3D22A 1O8WA 4FIWA 3KMOA 4GSTA 1K0DA 1V9WA 1PA3A 2H74A 1EP7A 3ED3A 1LU4A 4YQMA 2PU9C 3WGEA 2ALBA 3DVWA 1A0RP 4EVMA 1YF0A 1T7PB 2QC7A 1JHBA 3LYKA 4HJ2A 4HU7A 2E2GA 4JBBA 5CRWA 2MYGA 2H75A 4LL4B 1YEPA 3KJYA 5CYYA 5F06A 1T8EB 4EE0A 1WOUA 6GSTA 1HYUA 2CZ2A 2HE3A 1X9SB 4ZILA 3US3A 4GRFA 4IKHA 3MNGA 4GLTA 4NAXA 3TJJA 3WD6A 4IP1A 3HHVA 1A2LA 3FHKA 3H1NA 1UC7A 1G7OA 1VRSD 3WGXA 4TKYA 5JWOB 2DJ0A 2VCTA 3VPQA 1LJRA 3GKXA 11GSA 2GZYA 2B5EA 4J56E 1BQ7A 4ML6A 2LRNA 3W8JA 5IO2A 2WJUA 1GH2A 1G7EA 1J9BA 5LD0A 2VM2A 2PGTA 5D9TA 4LL1B 3FZAA 2LJRA 2H76A 1XW9A 1YQ1A 1T4YA 3GX8A 2JACA 5DJMA 2FWGA 5G30A 3TKRA 4KUNA 1O7UA 6GSVA 3LQ7A 3ERWA 3GA4A 2DLXA 4G2EA 4J2FA 1TU8A 2FLSA 3N5OA 1FO5A 1PSQA 2RUFA 2H6ZA 4Q5RA 20GSA 2R6KA 4NHZA 2O87A 4N30A 2DIYA 14GSA 3I9V2 1GTBA 4WR4A 3PR8A 3D4TA 5COHA 5ELGA 1Z7RA 5JCWA 1OAZA 3VLNA 2JSYA 4GTUA 3M9KA 1XVQA 1U87A 4JR4A 2M72A 2RM5A 3F6DA 3HJOA 3FEUA 4JRRA 5HQPA 1K3YA 1EWXA 1E2YA 2NPBA 5JCUA 4NMUA 4MF7A 2R2JA 2YANA 5AIVA 3APQA 5B6NA 4PUFC 5CREA 3L9SA 5D9VA 4HU9A 18GSA 4DVCA 4DSSB 4TR1A 3FR6A 2X64A 4K0NA 1RQMA 1AC1A 1YZXA 3HVXA 2IPAA 4WKWA 3DVXA 1A0FA 4EL1A 5J5NA 2C3NA 1SD8A 2LNTA 5G2ZA 2H0HA 1G6YA 2OA7A 2F8AA 3ZVJA 4FYCA 3ZIJA 1PN9A 2NTOA 4OFNA 3IK9A 2C4JA 3GKKA 2CT6A 2QGVA 5J4UA 5ECQB 4PX1A 2CX3A 1A24A 5H5RA 1TJDA 4ZL8A 4MZBA 1SKSB 3GHAA 2CZ3A 2K9FA 1QXHA 1XWBA 4NHWA 4J57E 5HR3A 2O8VB 1A8LA 4HQZA 3F4SA 4O7HA 2R37A 1B8XA 3GURA 3F6FA 1NSWA 4XTSA 4PNGA 1SK1A 4KE3A 1Y6EA 3C7MA 4ULXA 2GS3A 2DSAA 5HFIA 2A4VA 2H73A 1Z9HA 3GRXA 13GSA 5L71A 1GSFA 3IV4A 4OO4A 2B1KA 3TRQA 3O76A 4N0ZA 2DJ3A 4MJAA 1SD9A 1FB0A 4I2UA 1T3BA 3FKFA 1I5GA 2DJJA 3MWHA 1FVJA 4KNDA 1NHYA 5AIXA 2PERA 4OD7A 2JZSA 2GQKA 2GSQA 1A2MA 1JZDA 1SKWB 3F3QA 4OCEA 1IYIA 4O92A 4MMMA 2XBIA 4NPBA 1YEXA 2KOKA 5AN1A 5F0GA 3LSZA 1EEJA 5GZZB 3ME7A 4MH2A 1FB6A 4PGTA 4F0BA 3QR6A 4TXVA 1BYEA 1XWGA 2G0FA 4XS6A 2BTOT 3L9VA 3GL5A 4N10A 2N5BA 1ACVA 2JZTA 4IHUA 1SJIA 4POKA 2IMFA 1JFUA 3P2AA 1GSUA 2LSTA 2PVQA 1URMA 5IPGA 2PWJA 1GSYA 3CSJA 3GX0A 3KCMA 4ZB9A 4I5QA 3IRAA 4LLRA 2MMZA 4AGSA 2PVOC 2TRXA 3UEMA 1PX6A 5C04A 3WYWA 1MDJA 3IE3A 3KTBA 1WRYA 2FNOA 1V58A 1OC8A 2M46A 4AJ8A 4IBPA 2YJHA 4IJ3A 4G19A 1BJXA 4MPGA 4POBA 1Z6MA 1QK8A 3VFIA 3M0FA 1GSEA 3E0UA 1PL2A 3DKSA 3O6TA 3UVHA 1ZYQB 1ON4A 2XC2A 1HNAA 2H1AA 4EUYA 2RM6A 5DALA 2L6CA 4ZXGA 2VUPA 3IXRA 4RI6A 5IO0A 5B8AA 4ZBAA 4BL7A 5CO3A 4X0XA 2KP2A 1XOAA 22GSA 1DUGA 4DSRA 3ZMLA 2VD0A 1PX7A 5D9WA 1LBKA 4MA9A 5ELAA 3KZQA 2H1DA 2C3TA 5CRGA 1GP1A 4GXZA 1F6MC 1M7TA 3L0HA 2EIOA 2HFDA 3CBUA 1EGRA 3UOMA 4G9HA 4HZ2A 3LFLA 4KH7A 5EVOA 2JSZA 1UA5A 1XOBA 1CQHA 3J7Yb 2B5XA 2N5AA 2LUSA 4HJMA 4IN0A 1V2AA 1DSBA 4TVEA 4RI7A 3TKSA 4K7OA 3VURA 5HR2A 3K8NA 1KTEA 2B1LA 1B48A 1PKWA 1JZWA 3F3RA 4PXOA 3UJ1A 2C8UA 3RHCA 2LQQA 4MABA 4POMA 2OBKA 1SENA 4F9ZA 4X1UA 3UIWA 1TXXA 1ZCPA 2KHPA 5FT3A 3QFAC 1ML6A 3DWVA 2KUCA 2H6XA 4DSQA 3KD0A 4MF5A 3KEBA 4BVXA 2P5RA 3FZ4A 2F3MA 3L4NA 3HDCA 1BX9A 4IJIA 1V98A 1O8XA 4ZIJA 2OBIA 2YNXA 1M2DA 5ECLB 2YPMA 3QMXA 2VL2C 3TKSE 3LEFA 2K18A 1U3AA 3SWLA 5IOXA 4HI7A 4L0WA 5FHIA 3UAPA 5DJLA 4ZL9A 2LV3A 3DYRA 2YWMA 4MJEA 2ES7A 1XBSA 2VLTA 1MD4A 5LCZA 5HFKA 4F2IA 3LJRA 3HCZA 2YZUA 2IFQA 1K0AA 3GMFA 1HNCA 4OMVA 4CDOA 2VCWA 12GSA 3FY7A 3EC3A 2B5YA 3PINA 1FHEA 1GNEA 2VO4A 2V1MA 4TOPA 3JCML 2AUVA 2VOCA 1O6JA 1MDKA 1DBYA 4GQFA 1SL2B 1ILOA 1QMVA 4HQSA 2TRCP 3EYTA 3WT1A 4KCEA 4OCFA 4K2DA 3FZ9A 2IIYA 2CAIA 5DAKA 2KP1A 4JEDA 1UN2A 1K3OA 2FA8A 4MLYA 2YP6A 6GSWA 2H1BA 4IELA 2LEGA 4LMWA 2RUEA 1TI3A 5ABRA 3TKPA 2LRCA 2GTUA 1SYRA 2LRTA 1EV4A 5A4UA 3F4TA 3LXTA 1ERTA 2HXKA 3RPNA 2HNLA 2VM1A 1GTAA 1Y25A 2DJ2A 3RHBA 1JZRA 4XS4B 5KN3A 2GSRA 1GULA 2BMXA 1N8JA 1B9YC 2YCDA 3ZZXA 1PD21 1F3BA 3TKSC 19GSA 3LG6A 3ZL5A 3VI7A 3NOFA 3VWUA 3C8EA 1SK2A 1O81A 4KDXA 2P31A 5G1KA 1S3CA 2LS5A 4HOJA 2E2MA 4K7IA 3C73A 2HZFA 2PPTA 3CSIA 5ECOB 2BJXA 3ZFLA 4D73B 1TW9A 1JZOA 2EIQA 5IIZA 3GL3A 3QAGA 3N9JA 2EIRA 4YQUA 3FYGA 1ZOFA 2JU5A 1U3IA 1EZKA 1AQVA 4HEA2 5A4WA 2I4AA 1A8YA 1PRXA 4G10A 3ISOA 1FG4A 4EO3A 2FWFA 1X9WB 4BVYA 1TU7A 2OJLA 2WZ9A 2H1GA 3GNJA 3VPTA 4ZBDA 3NIVA 1U6TA 1WMJA 2K8SA 2E7PA 1RW1A 2YZHA 3G7JA 4RUVA 1NM3A 5FWGA 4YAPA 3TOUA 1S3DA 2ZUPA 3U5RE 2MMNA 3M3MA 1ZZYA 1OVNA 3NZNA 5ID2B 1XZOA 1TRUA 3BBYA 1V57A 3PH9A 5EPFA 2VL9A 3Q6OA 4XRDA 2ZCTA 2OADA 2IL3A 1AAZA 4GF0A 3ZRDA 3TRXA 1OC3A 2QSIA 4LA1A 3BJ5A 1PL1A 2OKAA 3TDGA 3D0ZA 1MTCA 2VCZA 3ERGA 3GFKA 2FA4A 3MDKA 3HVVA 1B4PA 1Z6NA 1UVZA 1USBA 3EINA 1GUMA 3KXOA 2WS2A 4MPFA 2WULA 1OC9A 4N0VA 3VWVA 4FH8A 1ZL9A 5E4WA 2F9SA 3D21A 1XW5A 4BWSA 1M9BA 3L9UA 2A2RA 2C1YA 1X9MB 5H5SA 2I9HA 3EWLA 4O32A 1XW6A 3TJKA 4ECBA 1PMTA 1V40A 2YWIA 4HS1A 2IFQB 5EY6A 4MJCA 2VIMA 5ECHB 1PQNA 1ZGNA 1YJ6A 4Q5NA 1GSSA 1AUCA 2WCIA 5HR0A 3RBTA 5CRHA 4POLA 4MDCA 1QQ2A 4K7NA 4KDUA 3C1RA 3RPPA 3GV1A 3J7Yk 1K0NA 1TK8B 3M9JA 1OYJA 3UMAA 2VCVA 4KSOA 1TP9A 2YJ7A 3IC4A 2DBCA 2DJ1A 5D8IA 2LTKA 2FWHA 2HT9A 3F8UA 2CV4A 1EOGA 3RAZA 4K0GA 1TDIA 3DMLA 1TRVA 2GDRA 3A3TA 4KX4A 2AYTA 3IR4A 2AHEA 5CNWA 1B9XC 5CAXA 3AY8A 5A5KA 4TR0A 3KP9A 2GQLA 2WFCA 2XPEA 1K0BA 1HQOA 3FRCA 1HNBA 1SL0B 3ZTLA 3IAS2 1YDKA 3ME8A 2LKUA 3HVSA 4K9ZA 2JL4A 4KCAA 2VL2A 4I6XA 1EOHA 4KGIA 5INYA 4MF6A 2XHFA 1ABAA 2H71A 3DXBA 1TRSA 2V41A 4ZB8A 1C72A 4K8MA 1TI1A 2NVLA 2IMEA 4MP4A 1Q98A 3BD2A 4NWYA 1XXUA 5JWRB 5CRDA 1S3AA 2YN1A 1MEKA 3GSSA 3IHQA 1ERWA 3GN3A 2PUKC 2L4CA 2ON7A 5ECMB 2VCQA 3IPZA 4TXOA 5KEJA 2V6OA 1RK4A 1R5AA 3F4RA 3IK7A 17GSA 3VWWA 3PGTA 1WJKA 3APOA 5ECNB 4OWYA 2PN8A 2CQ9A 4GQCA 3D4MA 1XWCA 3TJGA 1KEBA 3L78A 2WRTA 3HZ8A 3GUSA 1K3LA 3A2XA 4ZB6A 4WR5A 2C0EA 1F37A 1F2EA 1K0MA 3QDNA 1SJ6A 3HJMA 2B6MA 3P7XA 2MZCA 3ZFBA 3Q74A 3DGQA 2OE1A 3EU4A 4TR1B 4L5OA 1YKCA 5IMDA 3CSHA 5KN0A 3QOUA 4PQHA 4L0UA 3BCIA 3CTGA 3ZLPA 4GSNA 4HZ4A 5IMCA 1NW2A 4XCSA 4GSSA 2I1UA 4YAVA 5G31A 3LXZA 3Q19A 6GSSA 2DC5A 3VK9A 16GSA 5KN2A 5JCGA 4OFMA 3QPMA 3Q18A 2C0DA 2HRNA 2V2GA 2KLXA 4X43A 1ZYEA 2B7KA 4PUAA 6GSYA 5B6MA 1OE7A 4JE1A 1GLQA 4YQVA 4FYUA 4DSSA 1FW1A 3GKMA 4CHSA 2GT5A 3A2VA 2V6KA 5DQYA 5IOWA 1SKRB 2GT6A 2L4QA 4V2MA 1VF2A 4WF5A 1EP8A 3C1SA 5GSSA 1XIYA 1TKDB 2VL3A 2B7JA 2HYXA 1M0UA 3GIXA 2CAQA 3EE2A 5ECKB 1GLPA 3LGCA 3UBLA 3UL3A 2FHEA 5ECSA 1Z7PA 2HRFA 5HR1A 2JZRA 2D2ZA 4TRXA 1OKTA 4ID0A 2B3SA 1SYXA 3D5JA 2HI7A 5IPHA 4JR6A 2X8HA 4E8HA 2F8FA 3OR5A 3MAKA 3G9BA 3HD5A 2H6YA 2NBSA 2V32A 4NXIA 4K1FA 1PKZA 2H0IA 5LNKe 5F07A 2FCHA 3H79A 4AF2A 3A5WA 2H66A 2LNSA 4WETA 2J9HA 5G5FA 4OFTA 2H01A 2GSSA 1OKDA 4IQ1A 5ECRB 5ECIB 3E9JB 4WEYA 4ISDA 3GKNA 1AW9A 3GYKA 5J9BA 1TTZA 3HZ4A 2L5LA 5D9XA 1T00A 2L57A 2H70A 5IM9A 1WP0A 3I6AA 2O85A 5B7CA 1WE0A 2WGRA 3MSZA 2GZPA 1F9MA 3KMNA 2JADA 3R2QA 2H72A 1YF1A 1WIKA 3TJFA 3APSA 5F05A 2VD1A 5ENUA 2VAFA 3GH6A 3M1GA 3EMPA 1EEMA 3G7IA 4FO5A 4TXOB 1XVWA 3ZMKA 3QAVA 1YKAA 1E6BA 2IN3A 4IQAA 3VWXA 2XBQA 3HXSA 1KBNA 1VGLA 1CQGA 1TOFA 1H4OA 3IBHA 3H93A 4MJBA 5DALB 2HLSA 2L6DA 2EC4A 4KW6A 5G5EA 4L5LA 4QQ7A 3DEXA 5IQYA 2CVBA 2IMDA 3O3TA 2R3XA 2GSTA 2LQOA 3KTLA 1GUHA 3HJPA 4NV2A 4XIHA 1FOVA 5J3RA 4WBRD 3CTFA 1THOA 4XHMA 3QCPA 3D6IA 2HZEA 2OACA 3HYPA 4ACSA 2VLVA 2C3QA 3KIJA 4TW5A 1GSQA 4HUAA 4O5RA 2NDOA 3GTUA 3A2WA 4MZCA 3FW2A 4MZWA 2FWEA 1AQXA 5JWQB 1SU9A 3E3EA 2YV7A 2AV4A 4EC0A 1X5CA 1U88A 4OO5A 2CA8A 5IMVA 3QAWA 2H30A 5DCGA 2X8GA 2J23A 4PQIA 4KDYA 1KNGA 1XPVA 4AJ6A 4BWQA 2C80A 2IJYA 2MMOA 2YWNA 1XWAA 3M8NA 7GSSA 4N11A 2I81A 5DVBA 3LORA 5GAND 4JZQA 3QD9A 2Z9SA 1FAAA 1W4VA 5AISA 2IMKA 4CW9A 3CMIA 4EXJA 2WB9A 4ECIA 2DJKA 1EV9A 2P5QA 5EL8A 4I8BA 2L59A 1GTIA 1DE2A 5HFGA 1XCCA 1JLVA 5DCHA 1ZMAA 5DQSA 5DDLA 1A2JA 1J0FA 1GUKA 3CXGA 6GSXA 4TR3A 1OE8A 3KH7A 1GTUA 3LWAA 2P0GA 4I2TA 5B8BA 4ILFA 4H86A 1YY7A 2YV9A 1SL1B 1SK0A 2GZZA 1H75A 2H0GA 5J9CA 2YOIA 4EDYA 1AXDA 3FR3A 3ERFA 3BCKA 4MK3A 2MBSA 2IWTA 3TUEA 2K6VA 4LMVA 1X5EA 3EMXA 3UBKA 5KN1A 1T1VA 2O89A 2FD3A 1PGTA 1ERVA 1TK0B 1X5DA 3HY2A 1N2AA 2R4VA 4I97A 4EF0A 4QL7A 4MH3A 1FVKA 2GQMA 1M2BA 1ERUA 1M99A 4KSMA 1QFNA 2F51A 5D96A 2L5OA 4WXTA 3HA9A 2O7KA 1R5PA 2PBJA 2C0GA 2VCXA 8GSSA 4F0CA 3ZREA 1THXA 3UARA 4ECCA 1R7HA 4NV5A 2OE3A 2IMIA 5DAKB 1B4QA 4GWRA 5ECPB 2LJKA 4MCUA 3CRTA 1J08A 3BOAA 2K8VA 4XS1A 5H5QA 1QUWA 2M80A 3I69A 2MBTA 4P3YB 3P90A 1QGVA 3IAM2 3F9UA 1IYHA 4Z7XA 1A23A 2H8LA 3KGKA 4ZBBA 1Z5YE 1DE1A 4ZL7A 3IA1A
chains in the Genus database with same CATH superfamily
1ST9A 5C00A 4XRAA 4BPYA 1O85A 1WWJA 2WDUA 1TRWA 3KM6A 4RQRA 2X8CA 2HSYA 10GSA 2PMTA 4TN8A 1BG5A 3W8SA 3V1WA 4F03A 1GRXA 2OE0A 1GWCA 1BEDA 2I3YA 5IMAA 1Q4JA 4YH2A 5IMFA 3H8QA 3IOSA 1GNWA 1XG8A 2QKEA 3TRPA 4Q5QA 4EDZA 3TCOA 2DIZA 1FOHA 1WPIA 1MD3A 3KP8A 5AGYA 2AB6A 1M2AA 2HRAA 4V1Ag 3P8WA 4KA0A 2G2QA 2YWOA 3UVTA 3W6GA 4IGJA 2AAWA 6GSUA 3G7YA 1O73A 1K0OA 3FR9A 5F8BA 2X99A 2H19A 3ZVJD 3EURA 5CP1A 2HZEB 1K0CA 4XS4A 3TB2A 1GL8A 2VLUA 1BAYA 3CRUA 4K6XA 1MDIA 4WBJA 3GTUB 1NHOA 3HKRA 4KAEA 2ZNMA 1AQWA 2E0QA 3ZITA 4TR4A 4BVYB 4GCIA 4IS0A 2CVKA 3EVIA 1EGOA 2DMMA 5GAPD 4JU5A 2CX4A 4F82A 1VF3A 3FZ5A 3ZYWA 4E8EA 3U6VA 2GLRA 4IVFA 4PQ1A 2FY6A 3C71A 4QL9A 4WF4A 4V2NA 4BA7A 2FGXA 4ML1A 4D73A 3CYNA 1G0TA 3DRNA 3RDWA 2HSHA 3ZIVA 1PFOA 2RIIA 1Z3EA 5J41A 2A2SA 3S9FA 3TJBA 1I9DA 2REMA 5E59A 3H4KA 3IDVA 4G0IA 1TK5B 4ECJA 4KB3A 4PURA 1G6WA 2C0FA 1X0RA 3TKQA 4AJ7A 1VF4A 1SJZA 5GSTA 1R4WA 1M9AA 2CVDA 3TGZA 1OC9B 2GVPA 3VI5A 5A4VA 3DD3A 5ID2A 4PNFA 1XWKA 2TIRA 3KH9A 4HDEA 4IW9A 5G1LA 3FK8A 5D93A 3WT2A 1XFLA 1HD2A 3SBCA 3F63A 1T4ZA 4FYBA 2X49A 2XPDA 1W89A 4RQXA 4Q5FA 4V2LA 3WGDA 4IP6A 1F3AA 2GGTA 1AIUA 2AJQB 3EU3A 3GH9A 3LYPA 2DMLA 2RLIA 2ON5A 5DBQA 3DIEA 1JLWA 2LJAA 9GSSA 4HSCX 5D73A 4V1Ap 5IMZA 4DEJA 3GSTA 4EKZA 1M3IA 2FUG2 1VF1A 1GSDA 3TOTA 3I43A 4L8EA 2R5GA 3QFBC 2N5FA 1R26A 2MMAA 3F0IA 3D22A 1O8WA 4FIWA 3KMOA 4GSTA 1K0DA 1V9WA 1PA3A 2H74A 1EP7A 3ED3A 1LU4A 4YQMA 2PU9C 3WGEA 2ALBA 3DVWA 1A0RP 4EVMA 1YF0A 1T7PB 2QC7A 1JHBA 3LYKA 4HJ2A 4HU7A 2E2GA 4JBBA 5CRWA 2MYGA 3A5IA 2H75A 4LL4B 1YEPA 3KJYA 5CYYA 5F06A 1T8EB 4EE0A 1WOUA 6GSTA 1HYUA 2CZ2A 2HE3A 1X9SB 4ZILA 3US3A 4GRFA 4EIQA 4IKHA 3MNGA 4GLTA 4NAXA 3TJJA 3WD6A 4IP1A 3HHVA 1A2LA 3FHKA 3H1NA 1UC7A 1G7OA 1VRSD 3WGXA 4TKYA 5JWOB 2DJ0A 2VCTA 3VPQA 1LJRA 3MIXA 3GKXA 11GSA 2GZYA 2B5EA 4J56E 1BQ7A 4ML6A 2LRNA 3W8JA 5IO2A 2WJUA 1GH2A 1G7EA 1J9BA 5LD0A 2VM2A 2PGTA 5D9TA 4LL1B 3FZAA 2LJRA 2H76A 1XW9A 1YQ1A 1T4YA 3GX8A 2JACA 5DJMA 2FWGA 5G30A 3TKRA 4KUNA 1O7UA 6GSVA 3LQ7A 3ERWA 3GA4A 2DLXA 4G2EA 4J2FA 1TU8A 2FLSA 3N5OA 1FO5A 1PSQA 2RUFA 2H6ZA 4Q5RA 20GSA 2R6KA 4NHZA 2O87A 4N30A 2DIYA 14GSA 3I9V2 1GTBA 4WR4A 3PR8A 3D4TA 5COHA 5ELGA 1Z7RA 5JCWA 1OAZA 3VLNA 2JSYA 4GTUA 3M9KA 1XVQA 1U87A 4JR4A 2M72A 3CQFA 2RM5A 3F6DA 3HJOA 3FEUA 4JRRA 5HQPA 1K3YA 1EWXA 1E2YA 2NPBA 5JCUA 4NMUA 4MF7A 2R2JA 2YANA 5AIVA 3APQA 5B6NA 4PUFC 5CREA 3L9SA 4HU9A 5D9VA 18GSA 4DVCA 4DSSB 4TR1A 3FR6A 2X64A 4K0NA 1RQMA 1AC1A 1YZXA 3HVXA 2IPAA 4O5UA 4WKWA 3DVXA 1A0FA 4EL1A 5J5NA 2C3NA 1SD8A 2LNTA 5G2ZA 2H0HA 1G6YA 2OA7A 2F8AA 3ZVJA 4FYCA 3ZIJA 1PN9A 2NTOA 2R0GA 5BMUA 4OFNA 3IK9A 2C4JA 3GKKA 2CT6A 2QGVA 5J4UA 5ECQB 4PX1A 2CX3A 1A24A 4A5PA 5H5RA 1TJDA 4ZL8A 4MZBA 1SKSB 3GHAA 2CZ3A 2K9FA 1QXHA 1XWBA 4NHWA 4J57E 5HR3A 2O8VB 1A8LA 4HQZA 3F4SA 4O7HA 2R37A 1B8XA 3GURA 3F6FA 1NSWA 4XTSA 4PNGA 1SK1A 4KE3A 1Y6EA 3C7MA 4ULXA 2GS3A 2DSAA 5HFIA 2A4VA 2H73A 1Z9HA 3GRXA 13GSA 5L71A 1GSFA 3IV4A 4OO4A 2B1KA 3TRQA 3O76A 4Z2UA 4N0ZA 2DJ3A 4MJAA 1SD9A 1FB0A 4I2UA 1T3BA 3FKFA 1I5GA 2DJJA 4Z2RA 3MWHA 1FVJA 4KNDA 1NHYA 5AIXA 2PERA 4OD7A 2JZSA 2GQKA 2GSQA 1A2MA 1JZDA 1SKWB 3F3QA 4OCEA 1IYIA 4O92A 4MMMA 2XBIA 4NPBA 1YEXA 2KOKA 5AN1A 5F0GA 3LSZA 1EEJA 5GZZB 3ME7A 4MH2A 1FB6A 4PGTA 4F0BA 3QR6A 4TXVA 1BYEA 1XWGA 2G0FA 4XS6A 2BTOT 3L9VA 3GL5A 4N10A 2N5BA 1ACVA 2JZTA 4IHUA 1SJIA 4POKA 2IMFA 1JFUA 3P2AA 1GSUA 2LSTA 2PVQA 1URMA 5IPGA 2PWJA 1GSYA 3CSJA 3GX0A 3KCMA 4ZB9A 4I5QA 3IRAA 4LLRA 2MMZA 4AGSA 2PVOC 2TRXA 3UEMA 3HVNA 1PX6A 5C04A 3WYWA 1MDJA 3IE3A 3KTBA 1WRYA 2FNOA 1V58A 1OC8A 2M46A 4AJ8A 4IBPA 2YJHA 4IJ3A 4G19A 1BJXA 4MPGA 4POBA 1Z6MA 1QK8A 3VFIA 3M0FA 1GSEA 3E0UA 1PL2A 3DKSA 3O6TA 3UVHA 1ZYQB 1ON4A 2XC2A 1HNAA 2H1AA 4EUYA 2RM6A 5DALA 2L6CA 4ZXGA 2VUPA 3IXRA 4RI6A 5IO0A 5B8AA 4ZBAA 4BL7A 5CO3A 4X0XA 2KP2A 1XOAA 22GSA 1DUGA 4DSRA 3ZMLA 2VD0A 1PX7A 2UZ8A 5D9WA 1LBKA 4MA9A 5ELAA 3KZQA 2H1DA 2C3TA 5CRGA 1GP1A 4GXZA 1F6MC 1M7TA 3L0HA 2EIOA 2HFDA 3CBUA 1EGRA 3UOMA 4G9HA 4HZ2A 3LFLA 4KH7A 5EVOA 2JSZA 1UA5A 1XOBA 1CQHA 3J7Yb 2B5XA 2N5AA 2LUSA 4HJMA 4IN0A 1V2AA 1DSBA 4TVEA 4CY6A 4RI7A 3TKSA 4K7OA 3VURA 5HR2A 3K8NA 1KTEA 2B1LA 1B48A 1PKWA 1JZWA 3F3RA 4PXOA 3UJ1A 4CY8A 2C8UA 3RHCA 2LQQA 4MABA 4POMA 2OBKA 1SENA 4F9ZA 4X1UA 3UIWA 1TXXA 1ZCPA 3MYDA 2KHPA 3QFAC 5FT3A 1ML6A 3DWVA 2KUCA 2H6XA 4DSQA 3KD0A 4MF5A 3KEBA 3IHGA 4BVXA 2P5RA 3FZ4A 2F3MA 3L4NA 3HDCA 1BX9A 4IJIA 1V98A 4K5SA 1O8XA 4ZIJA 2DKIA 2OBIA 2YNXA 1M2DA 5ECLB 2YPMA 3QMXA 2VL2C 3TKSE 3LEFA 2K18A 1U3AA 5BRTA 2R0CA 3SWLA 5IOXA 4HI7A 4L0WA 5FHIA 3UAPA 5DJLA 4ZL9A 4FQUA 2LV3A 3DYRA 2YWMA 4MJEA 2ES7A 1XBSA 2VLTA 1MD4A 5LCZA 5HFKA 4F2IA 5KOXA 3LJRA 3HCZA 2YZUA 2IFQA 1K0AA 3GMFA 1HNCA 4OMVA 4CDOA 2VCWA 12GSA 3FY7A 3EC3A 2B5YA 3PINA 1FHEA 1GNEA 2VO4A 2V1MA 4TOPA 3JCML 2AUVA 2VOCA 1PN0A 1O6JA 1MDKA 1DBYA 4GQFA 1SL2B 1ILOA 1QMVA 4HQSA 2TRCP 3EYTA 3WT1A 4KCEA 4OCFA 4K2DA 3FZ9A 2IIYA 2CAIA 5DAKA 2KP1A 4JEDA 1UN2A 1K3OA 2FA8A 4MLYA 1S3RA 2YP6A 6GSWA 2H1BA 4IELA 1M3JA 2LEGA 4LMWA 2RUEA 1TI3A 5ABRA 3TKPA 2LRCA 2GTUA 1SYRA 2LRTA 1EV4A 5A4UA 3F4TA 3LXTA 1ERTA 2HXKA 3RPNA 2HNLA 2VM1A 1GTAA 1Y25A 2DJ2A 3RHBA 1JZRA 4XS4B 5KN3A 2GSRA 1GULA 2BMXA 1N8JA 1B9YC 2YCDA 3ZZXA 1PD21 1F3BA 3TKSC 19GSA 3LG6A 3ZL5A 3VI7A 3NOFA 3VWUA 3C8EA 1SK2A 1O81A 4KDXA 4BL7B 2P31A 5G1KA 1S3CA 2LS5A 4HOJA 2E2MA 4K7IA 3C73A 2HZFA 2DKHA 2PPTA 3R3EA 3CSIA 5ECOB 2BJXA 3ZFLA 3IC8A 4D73B 1TW9A 1JZOA 2EIQA 2X4AA 5IIZA 3GL3A 3QAGA 3N9JA 2EIRA 4YQUA 3FYGA 1ZOFA 2JU5A 1U3IA 1EZKA 1AQVA 4HEA2 5A4WA 2I4AA 1A8YA 1PRXA 4G10A 3ISOA 1FG4A 2QA2A 4EO3A 2FWFA 1X9WB 4BVYA 1TU7A 2OJLA 2WZ9A 2H1GA 3GNJA 3VPTA 4ZBDA 3NIVA 1U6TA 1WMJA 2K8SA 2E7PA 1RW1A 4PTSA 2YZHA 3G7JA 4RUVA 1NM3A 5FWGA 4YAPA 3TOUA 1S3DA 2ZUPA 3U5RE 2MMNA 3M3MA 1ZZYA 1OVNA 3NZNA 5ID2B 1XZOA 1TRUA 3BBYA 1V57A 3PH9A 5EPFA 2VL9A 3Q6OA 4XRDA 4Z2TA 2ZCTA 2OADA 2IL3A 1AAZA 4GF0A 3ZRDA 3TRXA 1OC3A 2QSIA 4LA1A 3BJ5A 1PL1A 2OKAA 3TDGA 3D0ZA 1MTCA 2VCZA 3ERGA 3GFKA 2FA4A 3MDKA 3HVVA 1B4PA 1Z6NA 1UVZA 1USBA 3EINA 1GUMA 3KXOA 2WS2A 4YKGA 4MPFA 2WULA 1OC9A 4N0VA 3VWVA 4FH8A 1ZL9A 5E4WA 2F9SA 3D21A 1XW5A 4BWSA 1M9BA 3L9UA 2A2RA 2C1YA 1X9MB 5H5SA 2I9HA 3EWLA 4O32A 1XW6A 3TJKA 4ECBA 1PMTA 1V40A 2YWIA 4HS1A 2IFQB 5EY6A 4MJCA 2VIMA 5ECHB 1PQNA 1ZGNA 1YJ6A 4Q5NA 1GSSA 1AUCA 2WCIA 5HR0A 3RBTA 5CRHA 4POLA 4MDCA 1QQ2A 4K7NA 4KDUA 3C1RA 3RPPA 3GV1A 4USSA 1ZYNA 3J7Yk 1K0NA 1TK8B 3M9JA 1OYJA 3UMAA 2VCVA 4G0LA 4KSOA 1TP9A 2YJ7A 3IC4A 2DBCA 2DJ1A 5D8IA 2LTKA 2FWHA 2HT9A 3F8UA 2CV4A 1EOGA 3RAZA 4K0GA 1TDIA 3DMLA 1TRVA 2GDRA 3A3TA 4KX4A 2AYTA 3IR4A 2AHEA 5CNWA 1B9XC 5CAXA 3AY8A 5A5KA 4TR0A 3KP9A 2GQLA 2WFCA 2XPEA 1K0BA 1HQOA 3FRCA 1HNBA 1SL0B 3EPTA 3ZTLA 3IAS2 1YDKA 3ME8A 2LKUA 3HVSA 4K9ZA 2JL4A 4KCAA 2VL2A 4I6XA 1EOHA 4KGIA 5INYA 4MF6A 2XHFA 1ABAA 2H71A 3DXBA 1TRSA 2V41A 4ZB8A 1C72A 4G0KA 4K8MA 1TI1A 2NVLA 2IMEA 4MP4A 1Q98A 3BD2A 4NWYA 1XXUA 5JWRB 5CRDA 1S3AA 2YN1A 1MEKA 3GSSA 3IHQA 1ERWA 3GN3A 2PUKC 2L4CA 1ZYPA 2ON7A 5ECMB 2VCQA 3IPZA 4TXOA 5KEJA 2V6OA 1RK4A 1R5AA 3F4RA 3IK7A 17GSA 3VWWA 3PGTA 1WJKA 3APOA 4OWYA 5ECNB 2PN8A 2CQ9A 4GQCA 3D4MA 1XWCA 3TJGA 1KEBA 3L78A 2WRTA 3HZ8A 3GUSA 1K3LA 3A2XA 4ZB6A 4WR5A 2C0EA 1F37A 1F2EA 1K0MA 3QDNA 1SJ6A 3HJMA 2B6MA 3P7XA 2MZCA 3ZFBA 3Q74A 3DGQA 2OE1A 3EU4A 4TR1B 4L5OA 1YKCA 5IMDA 3CSHA 5KN0A 3QOUA 4PQHA 4YKFA 4L0UA 3BCIA 3CTGA 3ZLPA 4GSNA 4HZ4A 5IMCA 1NW2A 3FMWA 4XCSA 4GSSA 2I1UA 4YAVA 5G31A 3LXZA 3Q19A 6GSSA 2DC5A 3VK9A 16GSA 5KN2A 5JCGA 4OFMA 3QPMA 3Q18A 2C0DA 2HRNA 2V2GA 2KLXA 4X43A 1ZYEA 2B7KA 4PUAA 6GSYA 5B6MA 1OE7A 4JE1A 1GLQA 4YQVA 4FYUA 4DSSA 1FW1A 3GKMA 4CHSA 2GT5A 3A2VA 2V6KA 5DQYA 5IOWA 1SKRB 2GT6A 2L4QA 4V2MA 1VF2A 4WF5A 1EP8A 3C1SA 5GSSA 1XIYA 1TKDB 2VL3A 2B7JA 2HYXA 1M0UA 3GIXA 2CAQA 3EE2A 5ECKB 1GLPA 3LGCA 3UBLA 3UL3A 4O5QA 2FHEA 5ECSA 1Z7PA 2HRFA 4X4JA 5HR1A 2JZRA 2D2ZA 4TRXA 1OKTA 4ID0A 2B3SA 1SYXA 3D5JA 2HI7A 5IPHA 4JR6A 2X8HA 4E8HA 2F8FA 3OR5A 3MAKA 3G9BA 3HD5A 2H6YA 2NBSA 2V32A 4NXIA 4K1FA 1PKZA 2H0IA 5LNKe 5F07A 2FCHA 3H79A 4AF2A 3A5WA 2H66A 2LNSA 4WETA 2J9HA 5G5FA 4OFTA 2H01A 2GSSA 1OKDA 4IQ1A 2R0PA 5ECRB 5ECIB 3E9JB 4WEYA 4ISDA 3GKNA 1AW9A 3GYKA 5J9BA 1TTZA 3HZ4A 2L5LA 5D9XA 1T00A 2L57A 2H70A 5IM9A 1WP0A 3I6AA 2O85A 5B7CA 1WE0A 2WGRA 3MSZA 5KOWA 2GZPA 1F9MA 3KMNA 2JADA 3R2QA 2H72A 1YF1A 1WIKA 4MNNA 3TJFA 3APSA 5F05A 2VD1A 5ENUA 2VAFA 3GH6A 4K2XA 3M1GA 3EMPA 1EEMA 3G7IA 4FO5A 4TXOB 1XVWA 3ZMKA 3QAVA 1YKAA 1E6BA 2IN3A 4IQAA 3VWXA 2XBQA 3HXSA 1KBNA 1VGLA 1CQGA 1TOFA 1H4OA 3IBHA 3H93A 4MJBA 5DALB 2HLSA 2L6DA 2EC4A 4KW6A 5G5EA 4L5LA 4QQ7A 3DEXA 5IQYA 3O3TA 2CVBA 2A4HA 2HSMA 2IMDA 2R3XA 4EIPA 2GSTA 2LQOA 3KTLA 1GUHA 3HJPA 4NV2A 4XIHA 1FOVA 5J3RA 4WBRD 3CTFA 3LW9A 1THOA 4XHMA 4K5RA 3QCPA 3D6IA 2HZEA 2OACA 3HYPA 4ACSA 2VLVA 2C3QA 3KIJA 4TW5A 1GSQA 4HUAA 4O5RA 2NDOA 3GTUA 3A2WA 4MZCA 3FW2A 4MZWA 2FWEA 2A2PA 1AQXA 5JWQB 1SU9A 3E3EA 2YV7A 2AV4A 4EC0A 1X5CA 1U88A 4OO5A 2CA8A 5IMVA 3QAWA 2H30A 5DCGA 2X8GA 2J23A 4PQIA 4KDYA 1KNGA 1XPVA 4AJ6A 4BWQA 2C80A 2IJYA 2MMOA 4KF9A 2YWNA 1XWAA 3M8NA 3PPUA 7GSSA 4N11A 2I81A 5DVBA 3LORA 5GAND 4JZQA 3QD9A 2Z9SA 1FAAA 1W4VA 5AISA 2IMKA 4CW9A 3CMIA 4EXJA 2WB9A 4ECIA 2DJKA 1EV9A 2P5QA 5EL8A 4I8BA 2L59A 1GTIA 1DE2A 5HFGA 1XCCA 4BVXB 1JLVA 5DCHA 1ZMAA 4ICYA 5DQSA 5DDLA 1A2JA 1J0FA 1GUKA 3CXGA 6GSXA 4TR3A 1OE8A 3KH7A 1GTUA 3LWAA 2P0GA 4I2TA 5B8BA 4ILFA 4H86A 1YY7A 2YV9A 1SL1B 1SK0A 2GZZA 1H75A 2H0GA 5J9CA 2YOIA 4EDYA 4BIKA 1AXDA 3FR3A 3ERFA 3BCKA 4MK3A 2MBSA 2IWTA 3TUEA 2K6VA 4LMVA 1X5EA 2QA1A 3EMXA 3UBKA 5KN1A 1T1VA 2O89A 2FD3A 1PGTA 1ERVA 1TK0B 1X5DA 3HY2A 1N2AA 2R4VA 4I97A 4EF0A 4QL7A 4MH3A 1FVKA 2GQMA 1M2BA 1ERUA 2HRKA 1M99A 4KSMA 1QFNA 2F51A 5D96A 2L5OA 4WXTA 3HA9A 2O7KA 1R5PA 2PBJA 2C0GA 2VCXA 8GSSA 4F0CA 3ZREA 1THXA 3UARA 4ECCA 1R7HA 4NV5A 2OE3A 2IMIA 5DAKB 1B4QA 4GWRA 5ECPB 2LJKA 4MCUA 3CRTA 1J08A 3BOAA 2K8VA 4XS1A 5H5QA 1QUWA 2M80A 3I69A 2MBTA 4P3YB 3P90A 1QGVA 3IAM2 3F9UA 1IYHA 4Z7XA 1A23A 2H8LA 3KGKA 4ZBBA 1Z5YE 1DE1A 4ZL7A 3IA1A
chains in the Genus database with same CATH topology
1ST9A 5C00A 4XRAA 4BPYA 1O85A 1WWJA 2WDUA 1TRWA 3KM6A 4RQRA 2X8CA 2HSYA 10GSA 2PMTA 4TN8A 1BG5A 3W8SA 3V1WA 4F03A 1GRXA 2OE0A 1GWCA 1BEDA 2I3YA 5IMAA 1Q4JA 4YH2A 5IMFA 3H8QA 3IOSA 1GNWA 2QKEA 3TRPA 4Q5QA 4EDZA 3TCOA 2DIZA 1FOHA 1WPIA 1MD3A 3KP8A 5AGYA 2AB6A 1M2AA 2HRAA 4V1Ag 3P8WA 4KA0A 2G2QA 2YWOA 3UVTA 3W6GA 4IGJA 2AAWA 6GSUA 3G7YA 1O73A 1K0OA 3FR9A 5F8BA 2X99A 2H19A 3ZVJD 3EURA 5CP1A 2HZEB 1K0CA 4XS4A 3TB2A 1GL8A 2VLUA 1BAYA 3CRUA 4K6XA 1MDIA 4WBJA 3GTUB 1NHOA 3HKRA 4KAEA 2ZNMA 1AQWA 2E0QA 3ZITA 4TR4A 4BVYB 4GCIA 4IS0A 2CVKA 3EVIA 1EGOA 2DMMA 5GAPD 4JU5A 2CX4A 4F82A 1VF3A 3FZ5A 3ZYWA 4E8EA 3U6VA 2GLRA 4IVFA 4PQ1A 2FY6A 3C71A 4QL9A 4WF4A 4V2NA 4BA7A 2FGXA 4ML1A 4D73A 3CYNA 1G0TA 3DRNA 3RDWA 2HSHA 3ZIVA 2RIIA 1Z3EA 5J41A 2A2SA 3S9FA 3TJBA 1I9DA 2REMA 5E59A 3H4KA 3IDVA 4G0IA 1TK5B 4ECJA 4KB3A 4PURA 1G6WA 2C0FA 1X0RA 3TKQA 4AJ7A 1VF4A 1SJZA 5GSTA 1R4WA 1M9AA 2CVDA 3TGZA 1OC9B 2GVPA 3VI5A 5A4VA 3DD3A 5ID2A 4PNFA 1XWKA 2TIRA 3KH9A 4HDEA 4IW9A 5G1LA 3FK8A 5D93A 3WT2A 1XFLA 1HD2A 3SBCA 3F63A 1T4ZA 4FYBA 2X49A 2XPDA 1W89A 4RQXA 4Q5FA 4V2LA 3WGDA 4IP6A 1F3AA 2GGTA 1AIUA 2AJQB 3EU3A 3GH9A 3LYPA 2DMLA 2RLIA 2ON5A 5DBQA 3DIEA 1JLWA 2LJAA 9GSSA 5D73A 4V1Ap 5IMZA 4DEJA 3GSTA 4EKZA 2FUG2 1VF1A 1GSDA 3TOTA 3I43A 4L8EA 2R5GA 3QFBC 2N5FA 1R26A 2MMAA 3F0IA 3D22A 1O8WA 4FIWA 3KMOA 4GSTA 1K0DA 1V9WA 1PA3A 2H74A 1EP7A 3ED3A 1LU4A 4YQMA 2PU9C 3WGEA 2ALBA 3DVWA 1A0RP 4EVMA 1YF0A 1T7PB 2QC7A 1JHBA 3LYKA 4HJ2A 4HU7A 2E2GA 4JBBA 5CRWA 2MYGA 3A5IA 2H75A 4LL4B 1YEPA 3KJYA 5CYYA 5F06A 1T8EB 4EE0A 1WOUA 6GSTA 1HYUA 2CZ2A 2HE3A 1X9SB 4ZILA 3US3A 4GRFA 4EIQA 4IKHA 3MNGA 4GLTA 4NAXA 3TJJA 3WD6A 4IP1A 3HHVA 1A2LA 3FHKA 3H1NA 1UC7A 1G7OA 1VRSD 3WGXA 4TKYA 5JWOB 2DJ0A 2VCTA 3VPQA 1LJRA 3MIXA 3GKXA 11GSA 2GZYA 2B5EA 4J56E 1BQ7A 4ML6A 2LRNA 3W8JA 5IO2A 2WJUA 1GH2A 1G7EA 1J9BA 5LD0A 2VM2A 2PGTA 5D9TA 4LL1B 3FZAA 2LJRA 2H76A 1XW9A 1YQ1A 1T4YA 3GX8A 2JACA 5DJMA 2FWGA 5G30A 3TKRA 4KUNA 1O7UA 6GSVA 3LQ7A 3ERWA 3GA4A 2DLXA 4G2EA 4J2FA 1TU8A 2FLSA 3N5OA 1FO5A 1PSQA 2RUFA 2H6ZA 4Q5RA 20GSA 2R6KA 4NHZA 2O87A 4N30A 2DIYA 14GSA 3I9V2 1GTBA 4WR4A 3PR8A 3D4TA 5COHA 5ELGA 1Z7RA 5JCWA 1OAZA 3VLNA 2JSYA 4GTUA 3M9KA 1XVQA 1U87A 4JR4A 2M72A 2RM5A 3F6DA 3HJOA 3FEUA 4JRRA 5HQPA 1K3YA 1EWXA 1E2YA 2NPBA 5JCUA 4NMUA 4MF7A 2R2JA 2YANA 5AIVA 3APQA 5B6NA 4PUFC 5CREA 3L9SA 4HU9A 5D9VA 18GSA 4DVCA 4DSSB 4TR1A 3FR6A 2X64A 4K0NA 1RQMA 1AC1A 1YZXA 3HVXA 2IPAA 4O5UA 4WKWA 3DVXA 1A0FA 4EL1A 5J5NA 2C3NA 1SD8A 2LNTA 5G2ZA 2H0HA 1G6YA 2OA7A 2F8AA 3ZVJA 4FYCA 3ZIJA 1PN9A 2NTOA 2R0GA 5BMUA 4OFNA 3IK9A 2C4JA 3GKKA 2CT6A 2QGVA 5J4UA 5ECQB 4PX1A 2CX3A 1A24A 4A5PA 5H5RA 1TJDA 4ZL8A 4MZBA 1SKSB 3GHAA 2CZ3A 2K9FA 1QXHA 1XWBA 4NHWA 4J57E 5HR3A 2O8VB 1A8LA 4HQZA 3F4SA 4O7HA 2R37A 1B8XA 3GURA 3F6FA 1NSWA 4XTSA 4PNGA 1SK1A 4KE3A 1Y6EA 3C7MA 4ULXA 2GS3A 2DSAA 5HFIA 2A4VA 2H73A 1Z9HA 3GRXA 13GSA 5L71A 1GSFA 3IV4A 4OO4A 2B1KA 3TRQA 3O76A 4Z2UA 4N0ZA 2DJ3A 4MJAA 1SD9A 1FB0A 4I2UA 1T3BA 3FKFA 1I5GA 2DJJA 4Z2RA 3MWHA 1FVJA 4KNDA 1NHYA 5AIXA 2PERA 4OD7A 2JZSA 2GQKA 2GSQA 1A2MA 1JZDA 1SKWB 3F3QA 4OCEA 1IYIA 4O92A 4MMMA 2XBIA 4NPBA 1YEXA 2KOKA 5AN1A 5F0GA 3LSZA 1EEJA 5GZZB 3ME7A 4MH2A 1FB6A 4PGTA 4F0BA 3QR6A 4TXVA 1BYEA 1XWGA 2G0FA 4XS6A 2BTOT 3L9VA 3GL5A 4N10A 2N5BA 1ACVA 2JZTA 4IHUA 1SJIA 4POKA 2IMFA 1JFUA 3P2AA 1GSUA 2LSTA 2PVQA 1URMA 5IPGA 2PWJA 1GSYA 3CSJA 3GX0A 3KCMA 4ZB9A 4I5QA 3IRAA 4LLRA 2MMZA 4AGSA 2PVOC 2TRXA 3UEMA 1PX6A 5C04A 3WYWA 1MDJA 3IE3A 3KTBA 1WRYA 2FNOA 1V58A 1OC8A 2M46A 4AJ8A 4IBPA 2YJHA 4IJ3A 4G19A 1BJXA 4MPGA 4POBA 1Z6MA 1QK8A 3VFIA 3M0FA 1GSEA 3E0UA 1PL2A 3DKSA 3O6TA 3UVHA 1ZYQB 1ON4A 2XC2A 1HNAA 2H1AA 4EUYA 2RM6A 5DALA 2L6CA 4ZXGA 2VUPA 3IXRA 4RI6A 5IO0A 5B8AA 4ZBAA 4BL7A 5CO3A 4X0XA 2KP2A 1XOAA 22GSA 1DUGA 4DSRA 3ZMLA 2VD0A 1PX7A 2UZ8A 5D9WA 1LBKA 4MA9A 5ELAA 3KZQA 2H1DA 2C3TA 5CRGA 1GP1A 4GXZA 1F6MC 1M7TA 3L0HA 2EIOA 2HFDA 3CBUA 1EGRA 3UOMA 4G9HA 4HZ2A 3LFLA 4KH7A 5EVOA 2JSZA 1UA5A 1XOBA 1CQHA 3J7Yb 2B5XA 2N5AA 2LUSA 4HJMA 4IN0A 1V2AA 1DSBA 4TVEA 4CY6A 4RI7A 3TKSA 4K7OA 3VURA 5HR2A 3K8NA 1KTEA 2B1LA 1B48A 1PKWA 1JZWA 3F3RA 4PXOA 3UJ1A 4CY8A 2C8UA 3RHCA 2LQQA 4MABA 4POMA 2OBKA 1SENA 4F9ZA 4X1UA 3UIWA 1TXXA 1ZCPA 3MYDA 2KHPA 3QFAC 5FT3A 1ML6A 3DWVA 2KUCA 2H6XA 4DSQA 3KD0A 4MF5A 3KEBA 3IHGA 4BVXA 2P5RA 3FZ4A 2F3MA 3L4NA 3HDCA 1BX9A 4IJIA 1V98A 4K5SA 1O8XA 4ZIJA 2DKIA 2OBIA 2YNXA 1M2DA 5ECLB 2YPMA 3QMXA 2VL2C 3TKSE 3LEFA 2K18A 1U3AA 5BRTA 2R0CA 3SWLA 5IOXA 4HI7A 4L0WA 5FHIA 3UAPA 5DJLA 4ZL9A 4FQUA 2LV3A 3DYRA 2YWMA 4MJEA 2ES7A 1XBSA 2VLTA 1MD4A 5LCZA 5HFKA 4F2IA 5KOXA 3LJRA 3HCZA 2YZUA 2IFQA 1K0AA 3GMFA 1HNCA 4OMVA 4CDOA 2VCWA 12GSA 3FY7A 3EC3A 2B5YA 3PINA 1FHEA 1GNEA 2VO4A 2V1MA 4TOPA 3JCML 2AUVA 2VOCA 1PN0A 1O6JA 1MDKA 1DBYA 4GQFA 1SL2B 1ILOA 1QMVA 4HQSA 2TRCP 3EYTA 3WT1A 4KCEA 4OCFA 4K2DA 3FZ9A 2IIYA 2CAIA 5DAKA 2KP1A 4JEDA 1UN2A 1K3OA 2FA8A 4MLYA 2YP6A 6GSWA 2H1BA 4IELA 2LEGA 4LMWA 2RUEA 1TI3A 5ABRA 3TKPA 2LRCA 2GTUA 1SYRA 2LRTA 1EV4A 5A4UA 3F4TA 3LXTA 1ERTA 2HXKA 3RPNA 2HNLA 2VM1A 1GTAA 1Y25A 2DJ2A 3RHBA 1JZRA 4XS4B 5KN3A 2GSRA 1GULA 2BMXA 1N8JA 1B9YC 2YCDA 3ZZXA 1PD21 1F3BA 3TKSC 19GSA 3LG6A 3ZL5A 3VI7A 3NOFA 3VWUA 3C8EA 1SK2A 1O81A 4KDXA 4BL7B 2P31A 5G1KA 1S3CA 2LS5A 4HOJA 2E2MA 4K7IA 3C73A 2HZFA 2DKHA 2PPTA 3R3EA 3CSIA 5ECOB 2BJXA 3ZFLA 3IC8A 4D73B 1TW9A 1JZOA 2EIQA 2X4AA 5IIZA 3GL3A 3QAGA 3N9JA 2EIRA 4YQUA 3FYGA 1ZOFA 2JU5A 1U3IA 1EZKA 1AQVA 4HEA2 5A4WA 2I4AA 1A8YA 1PRXA 4G10A 3ISOA 1FG4A 2QA2A 4EO3A 2FWFA 1X9WB 4BVYA 1TU7A 2OJLA 2WZ9A 2H1GA 3GNJA 3VPTA 4ZBDA 3NIVA 1U6TA 1WMJA 2K8SA 2E7PA 1RW1A 4PTSA 2YZHA 3G7JA 4RUVA 1NM3A 5FWGA 4YAPA 3TOUA 1S3DA 2ZUPA 3U5RE 2MMNA 3M3MA 1ZZYA 1OVNA 3NZNA 5ID2B 1XZOA 1TRUA 3BBYA 1V57A 3PH9A 5EPFA 2VL9A 3Q6OA 4XRDA 4Z2TA 2ZCTA 2OADA 2IL3A 1AAZA 4GF0A 3ZRDA 3TRXA 1OC3A 2QSIA 4LA1A 3BJ5A 1PL1A 2OKAA 3TDGA 3D0ZA 1MTCA 2VCZA 3ERGA 3GFKA 2FA4A 3MDKA 3HVVA 1B4PA 1Z6NA 1UVZA 1USBA 3EINA 1GUMA 3KXOA 2WS2A 4YKGA 4MPFA 2WULA 1OC9A 4N0VA 3VWVA 4FH8A 1ZL9A 5E4WA 2F9SA 3D21A 1XW5A 4BWSA 1M9BA 3L9UA 2A2RA 2C1YA 1X9MB 5H5SA 2I9HA 3EWLA 4O32A 1XW6A 3TJKA 4ECBA 1PMTA 1V40A 2YWIA 4HS1A 2IFQB 5EY6A 4MJCA 2VIMA 5ECHB 1PQNA 1ZGNA 1YJ6A 4Q5NA 1GSSA 1AUCA 2WCIA 5HR0A 3RBTA 5CRHA 4POLA 4MDCA 1QQ2A 4K7NA 4KDUA 3C1RA 3RPPA 3GV1A 4USSA 1ZYNA 3J7Yk 1K0NA 1TK8B 3M9JA 1OYJA 3UMAA 2VCVA 4G0LA 4KSOA 1TP9A 2YJ7A 3IC4A 2DBCA 2DJ1A 5D8IA 2LTKA 2FWHA 2HT9A 3F8UA 2CV4A 1EOGA 3RAZA 4K0GA 1TDIA 3DMLA 1TRVA 2GDRA 3A3TA 4KX4A 2AYTA 3IR4A 2AHEA 5CNWA 1B9XC 5CAXA 3AY8A 5A5KA 4TR0A 3KP9A 2GQLA 2WFCA 2XPEA 1K0BA 1HQOA 3FRCA 1HNBA 1SL0B 3EPTA 3ZTLA 3IAS2 1YDKA 3ME8A 2LKUA 3HVSA 4K9ZA 2JL4A 4KCAA 2VL2A 4I6XA 1EOHA 4KGIA 5INYA 4MF6A 2XHFA 1ABAA 2H71A 3DXBA 1TRSA 2V41A 4ZB8A 1C72A 4G0KA 4K8MA 1TI1A 2NVLA 2IMEA 4MP4A 1Q98A 3BD2A 4NWYA 1XXUA 5JWRB 5CRDA 1S3AA 2YN1A 1MEKA 3GSSA 3IHQA 1ERWA 3GN3A 2PUKC 2L4CA 1ZYPA 2ON7A 5ECMB 2VCQA 3IPZA 4TXOA 5KEJA 2V6OA 1RK4A 1R5AA 3F4RA 3IK7A 17GSA 3VWWA 3PGTA 1WJKA 3APOA 4OWYA 5ECNB 2PN8A 2CQ9A 4GQCA 3D4MA 1XWCA 3TJGA 1KEBA 3L78A 2WRTA 3HZ8A 3GUSA 1K3LA 3A2XA 4ZB6A 4WR5A 2C0EA 1F37A 1F2EA 1K0MA 3QDNA 1SJ6A 3HJMA 2B6MA 3P7XA 2MZCA 3ZFBA 3Q74A 3DGQA 2OE1A 3EU4A 4TR1B 4L5OA 1YKCA 5IMDA 3CSHA 5KN0A 3QOUA 4PQHA 4YKFA 4L0UA 3BCIA 3CTGA 3ZLPA 4GSNA 4HZ4A 5IMCA 1NW2A 3FMWA 4XCSA 4GSSA 2I1UA 4YAVA 5G31A 3LXZA 3Q19A 6GSSA 2DC5A 3VK9A 16GSA 5KN2A 5JCGA 4OFMA 3QPMA 3Q18A 2C0DA 2HRNA 2V2GA 2KLXA 4X43A 1ZYEA 2B7KA 4PUAA 6GSYA 5B6MA 1OE7A 4JE1A 1GLQA 4YQVA 4FYUA 4DSSA 1FW1A 3GKMA 4CHSA 2GT5A 3A2VA 2V6KA 5DQYA 5IOWA 1SKRB 2GT6A 2L4QA 4V2MA 1VF2A 4WF5A 1EP8A 3C1SA 5GSSA 1XIYA 1TKDB 2VL3A 2B7JA 2HYXA 1M0UA 3GIXA 2CAQA 3EE2A 5ECKB 1GLPA 3LGCA 3UBLA 3UL3A 4O5QA 2FHEA 5ECSA 1Z7PA 2HRFA 4X4JA 5HR1A 2JZRA 2D2ZA 4TRXA 1OKTA 4ID0A 2B3SA 1SYXA 3D5JA 2HI7A 5IPHA 4JR6A 2X8HA 4E8HA 2F8FA 3OR5A 3MAKA 3G9BA 3HD5A 2H6YA 2NBSA 2V32A 4NXIA 4K1FA 1PKZA 2H0IA 5LNKe 5F07A 2FCHA 3H79A 4AF2A 3A5WA 2H66A 2LNSA 4WETA 2J9HA 5G5FA 4OFTA 2H01A 2GSSA 1OKDA 4IQ1A 2R0PA 5ECRB 5ECIB 3E9JB 4WEYA 4ISDA 3GKNA 1AW9A 3GYKA 5J9BA 1TTZA 3HZ4A 2L5LA 5D9XA 1T00A 2L57A 2H70A 5IM9A 1WP0A 3I6AA 2O85A 5B7CA 1WE0A 2WGRA 3MSZA 5KOWA 2GZPA 1F9MA 3KMNA 2JADA 3R2QA 2H72A 1YF1A 1WIKA 4MNNA 3TJFA 3APSA 5F05A 2VD1A 5ENUA 2VAFA 3GH6A 4K2XA 3M1GA 3EMPA 1EEMA 3G7IA 4FO5A 4TXOB 1XVWA 3ZMKA 3QAVA 1YKAA 1E6BA 2IN3A 4IQAA 3VWXA 2XBQA 3HXSA 1KBNA 1VGLA 1CQGA 1TOFA 1H4OA 3IBHA 3H93A 4MJBA 5DALB 2HLSA 2L6DA 2EC4A 4KW6A 5G5EA 4L5LA 4QQ7A 3DEXA 5IQYA 3O3TA 2CVBA 2A4HA 2HSMA 2IMDA 2R3XA 4EIPA 2GSTA 2LQOA 3KTLA 1GUHA 3HJPA 4NV2A 4XIHA 1FOVA 5J3RA 4WBRD 3CTFA 3LW9A 1THOA 4XHMA 4K5RA 3QCPA 3D6IA 2HZEA 2OACA 3HYPA 4ACSA 2VLVA 2C3QA 3KIJA 4TW5A 1GSQA 4HUAA 4O5RA 2NDOA 3GTUA 3A2WA 4MZCA 3FW2A 4MZWA 2FWEA 2A2PA 1AQXA 5JWQB 1SU9A 3E3EA 2YV7A 2AV4A 4EC0A 1X5CA 1U88A 4OO5A 2CA8A 5IMVA 3QAWA 2H30A 5DCGA 2X8GA 2J23A 4PQIA 4KDYA 1KNGA 1XPVA 4AJ6A 4BWQA 2C80A 2IJYA 2MMOA 4KF9A 2YWNA 1XWAA 3M8NA 3PPUA 7GSSA 4N11A 2I81A 5DVBA 3LORA 5GAND 4JZQA 3QD9A 2Z9SA 1FAAA 1W4VA 5AISA 2IMKA 4CW9A 3CMIA 4EXJA 2WB9A 4ECIA 2DJKA 1EV9A 2P5QA 5EL8A 4I8BA 2L59A 1GTIA 1DE2A 5HFGA 1XCCA 4BVXB 1JLVA 5DCHA 1ZMAA 4ICYA 5DQSA 5DDLA 1A2JA 1J0FA 1GUKA 3CXGA 6GSXA 4TR3A 1OE8A 3KH7A 1GTUA 3LWAA 2P0GA 4I2TA 5B8BA 4ILFA 4H86A 1YY7A 2YV9A 1SL1B 1SK0A 2GZZA 1H75A 2H0GA 5J9CA 2YOIA 4EDYA 1AXDA 3FR3A 3ERFA 3BCKA 4MK3A 2MBSA 2IWTA 3TUEA 2K6VA 4LMVA 1X5EA 2QA1A 3EMXA 3UBKA 5KN1A 1T1VA 2O89A 2FD3A 1PGTA 1ERVA 1TK0B 1X5DA 3HY2A 1N2AA 2R4VA 4I97A 4EF0A 4QL7A 4MH3A 1FVKA 2GQMA 1M2BA 1ERUA 2HRKA 1M99A 4KSMA 1QFNA 2F51A 5D96A 2L5OA 4WXTA 3HA9A 2O7KA 1R5PA 2PBJA 2C0GA 2VCXA 8GSSA 4F0CA 3ZREA 1THXA 3UARA 4ECCA 1R7HA 4NV5A 2OE3A 2IMIA 5DAKB 1B4QA 4GWRA 5ECPB 2LJKA 4MCUA 3CRTA 1J08A 3BOAA 2K8VA 4XS1A 5H5QA 1QUWA 2M80A 3I69A 2MBTA 4P3YB 3P90A 1QGVA 3IAM2 3F9UA 1IYHA 4Z7XA 1A23A 2H8LA 3KGKA 4ZBBA 1Z5YE 1DE1A 4ZL7A 3IA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ST9 A;  5C00 A;  4XRA A;  4BPY A;  1O85 A;  1WWJ A;  2WDU A;  1TRW A;  3KM6 A;  4RQR A;  2X8C A;  2HSY A;  10GS A;  2PMT A;  4TN8 A;  1BG5 A;  3W8S A;  3V1W A;  4F03 A;  1GRX A;  2OE0 A;  1GWC A;  1BED A;  2I3Y A;  5IMA A;  1Q4J A;  4YH2 A;  5IMF A;  3H8Q A;  3IOS A;  1GNW A;  2QKE A;  3TRP A;  4Q5Q A;  4EDZ A;  3TCO A;  2DIZ A;  1WPI A;  1MD3 A;  3KP8 A;  5AGY A;  2AB6 A;  1M2A A;  4V1A g;  3P8W A;  4KA0 A;  2G2Q A;  2YWO A;  3UVT A;  3W6G A;  4IGJ A;  2AAW A;  6GSU A;  3G7Y A;  1O73 A;  1K0O A;  3FR9 A;  5F8B A;  2X99 A;  2H19 A;  3ZVJ D;  3EUR A;  5CP1 A;  2HZE B;  1K0C A;  4XS4 A;  3TB2 A;  1GL8 A;  2VLU A;  1BAY A;  3CRU A;  4K6X A;  1MDI A;  4WBJ A;  3GTU B;  1NHO A;  3HKR A;  4KAE A;  2ZNM A;  1AQW A;  2E0Q A;  3ZIT A;  4TR4 A;  4GCI A;  4IS0 A;  2CVK A;  3EVI A;  1EGO A;  2DMM A;  5GAP D;  4JU5 A;  2CX4 A;  4F82 A;  1VF3 A;  3FZ5 A;  3ZYW A;  4E8E A;  3U6V A;  2GLR A;  4IVF A;  4PQ1 A;  2FY6 A;  3C71 A;  4QL9 A;  4WF4 A;  4V2N A;  4BA7 A;  2FGX A;  4ML1 A;  4D73 A;  3CYN A;  1G0T A;  3DRN A;  3RDW A;  2HSH A;  3ZIV A;  2RII A;  1Z3E A;  5J41 A;  2A2S A;  3S9F A;  3TJB A;  1I9D A;  2REM A;  5E59 A;  3H4K A;  3IDV A;  1TK5 B;  4ECJ A;  4KB3 A;  4PUR A;  1G6W A;  2C0F A;  1X0R A;  3TKQ A;  4AJ7 A;  1VF4 A;  1SJZ A;  5GST A;  1R4W A;  1M9A A;  2CVD A;  3TGZ A;  1OC9 B;  2GVP A;  3VI5 A;  5A4V A;  3DD3 A;  5ID2 A;  4PNF A;  1XWK A;  2TIR A;  3KH9 A;  4HDE A;  4IW9 A;  5G1L A;  3FK8 A;  5D93 A;  3WT2 A;  1XFL A;  1HD2 A;  3SBC A;  3F63 A;  1T4Z A;  4FYB A;  2XPD A;  1W89 A;  4RQX A;  4Q5F A;  4V2L A;  3WGD A;  4IP6 A;  1F3A A;  2GGT A;  1AIU A;  2AJQ B;  3EU3 A;  3GH9 A;  3LYP A;  2DML A;  2RLI A;  2ON5 A;  5DBQ A;  3DIE A;  1JLW A;  2LJA A;  9GSS A;  5D73 A;  4V1A p;  5IMZ A;  4DEJ A;  3GST A;  4EKZ A;  2FUG 2;  1VF1 A;  1GSD A;  3TOT A;  3I43 A;  4L8E A;  2R5G A;  3QFB C;  2N5F A;  1R26 A;  2MMA A;  3F0I A;  3D22 A;  1O8W A;  4FIW A;  3KMO A;  4GST A;  1K0D A;  1V9W A;  1PA3 A;  2H74 A;  1EP7 A;  3ED3 A;  1LU4 A;  4YQM A;  2PU9 C;  3WGE A;  2ALB A;  3DVW A;  1A0R P;  4EVM A;  1YF0 A;  1T7P B;  2QC7 A;  1JHB A;  3LYK A;  4HJ2 A;  4HU7 A;  2E2G A;  4JBB A;  5CRW A;  2MYG A;  2H75 A;  4LL4 B;  1YEP A;  3KJY A;  5CYY A;  5F06 A;  1T8E B;  4EE0 A;  1WOU A;  6GST A;  1HYU A;  2CZ2 A;  2HE3 A;  1X9S B;  4ZIL A;  3US3 A;  4GRF A;  4IKH A;  3MNG A;  4GLT A;  4NAX A;  3TJJ A;  3WD6 A;  4IP1 A;  3HHV A;  1A2L A;  3FHK A;  3H1N A;  1UC7 A;  1G7O A;  1VRS D;  3WGX A;  4TKY A;  5JWO B;  2DJ0 A;  2VCT A;  3VPQ A;  1LJR A;  3GKX A;  11GS A;  2GZY A;  2B5E A;  4J56 E;  1BQ7 A;  4ML6 A;  2LRN A;  3W8J A;  5IO2 A;  2WJU A;  1GH2 A;  1G7E A;  1J9B A;  5LD0 A;  2VM2 A;  2PGT A;  5D9T A;  4LL1 B;  3FZA A;  2LJR A;  2H76 A;  1XW9 A;  1YQ1 A;  1T4Y A;  3GX8 A;  2JAC A;  5DJM A;  2FWG A;  5G30 A;  3TKR A;  4KUN A;  1O7U A;  6GSV A;  3LQ7 A;  3ERW A;  3GA4 A;  2DLX A;  4G2E A;  4J2F A;  1TU8 A;  2FLS A;  3N5O A;  1FO5 A;  1PSQ A;  2RUF A;  2H6Z A;  4Q5R A;  20GS A;  2R6K A;  4NHZ A;  2O87 A;  4N30 A;  2DIY A;  14GS A;  3I9V 2;  1GTB A;  4WR4 A;  3PR8 A;  3D4T A;  5COH A;  5ELG A;  1Z7R A;  5JCW A;  1OAZ A;  3VLN A;  2JSY A;  4GTU A;  3M9K A;  1XVQ A;  1U87 A;  4JR4 A;  2M72 A;  2RM5 A;  3F6D A;  3HJO A;  3FEU A;  4JRR A;  5HQP A;  1K3Y A;  1EWX A;  1E2Y A;  2NPB A;  5JCU A;  4NMU A;  4MF7 A;  2R2J A;  2YAN A;  5AIV A;  3APQ A;  5B6N A;  4PUF C;  5CRE A;  3L9S A;  5D9V A;  4HU9 A;  18GS A;  4DVC A;  4DSS B;  4TR1 A;  3FR6 A;  2X64 A;  4K0N A;  1RQM A;  1AC1 A;  1YZX A;  3HVX A;  2IPA A;  4WKW A;  3DVX A;  1A0F A;  4EL1 A;  5J5N A;  2C3N A;  1SD8 A;  2LNT A;  5G2Z A;  2H0H A;  1G6Y A;  2OA7 A;  2F8A A;  3ZVJ A;  4FYC A;  3ZIJ A;  1PN9 A;  2NTO A;  4OFN A;  3IK9 A;  2C4J A;  3GKK A;  2CT6 A;  2QGV A;  5J4U A;  5ECQ B;  4PX1 A;  2CX3 A;  1A24 A;  5H5R A;  1TJD A;  4ZL8 A;  4MZB A;  1SKS B;  3GHA A;  2CZ3 A;  2K9F A;  1QXH A;  1XWB A;  4NHW A;  4J57 E;  5HR3 A;  2O8V B;  1A8L A;  4HQZ A;  3F4S A;  4O7H A;  2R37 A;  1B8X A;  3GUR A;  3F6F A;  1NSW A;  4XTS A;  4PNG A;  1SK1 A;  4KE3 A;  1Y6E A;  3C7M A;  4ULX A;  2GS3 A;  2DSA A;  5HFI A;  2A4V A;  2H73 A;  1Z9H A;  3GRX A;  13GS A;  5L71 A;  1GSF A;  3IV4 A;  4OO4 A;  2B1K A;  3TRQ A;  3O76 A;  4N0Z A;  2DJ3 A;  4MJA A;  1SD9 A;  1FB0 A;  4I2U A;  1T3B A;  3FKF A;  1I5G A;  2DJJ A;  3MWH A;  1FVJ A;  4KND A;  1NHY A;  5AIX A;  2PER A;  4OD7 A;  2JZS A;  2GQK A;  2GSQ A;  1A2M A;  1JZD A;  1SKW B;  3F3Q A;  4OCE A;  1IYI A;  4O92 A;  4MMM A;  2XBI A;  4NPB A;  1YEX A;  2KOK A;  5AN1 A;  5F0G A;  3LSZ A;  1EEJ A;  5GZZ B;  3ME7 A;  4MH2 A;  1FB6 A;  4PGT A;  4F0B A;  3QR6 A;  4TXV A;  1BYE A;  1XWG A;  2G0F A;  4XS6 A;  2BTO T;  3L9V A;  3GL5 A;  4N10 A;  2N5B A;  1ACV A;  2JZT A;  4IHU A;  1SJI A;  4POK A;  2IMF A;  1JFU A;  3P2A A;  1GSU A;  2LST A;  2PVQ A;  1URM A;  5IPG A;  2PWJ A;  1GSY A;  3CSJ A;  3GX0 A;  3KCM A;  4ZB9 A;  4I5Q A;  3IRA A;  4LLR A;  2MMZ A;  4AGS A;  2PVO C;  2TRX A;  3UEM A;  1PX6 A;  5C04 A;  3WYW A;  1MDJ A;  3IE3 A;  3KTB A;  1WRY A;  2FNO A;  1V58 A;  1OC8 A;  2M46 A;  4AJ8 A;  4IBP A;  2YJH A;  4IJ3 A;  4G19 A;  1BJX A;  4MPG A;  4POB A;  1Z6M A;  1QK8 A;  3VFI A;  3M0F A;  1GSE A;  3E0U A;  1PL2 A;  3DKS A;  3O6T A;  3UVH A;  1ZYQ B;  1ON4 A;  2XC2 A;  1HNA A;  2H1A A;  4EUY A;  2RM6 A;  5DAL A;  2L6C A;  4ZXG A;  2VUP A;  3IXR A;  4RI6 A;  5IO0 A;  5B8A A;  4ZBA A;  4BL7 A;  5CO3 A;  4X0X A;  2KP2 A;  1XOA A;  22GS A;  1DUG A;  4DSR A;  3ZML A;  2VD0 A;  1PX7 A;  5D9W A;  1LBK A;  4MA9 A;  5ELA A;  3KZQ A;  2H1D A;  2C3T A;  5CRG A;  1GP1 A;  4GXZ A;  1F6M C;  1M7T A;  3L0H A;  2EIO A;  2HFD A;  3CBU A;  1EGR A;  3UOM A;  4G9H A;  4HZ2 A;  3LFL A;  4KH7 A;  5EVO A;  2JSZ A;  1UA5 A;  1XOB A;  1CQH A;  3J7Y b;  2B5X A;  2N5A A;  2LUS A;  4HJM A;  4IN0 A;  1V2A A;  1DSB A;  4TVE A;  4RI7 A;  3TKS A;  4K7O A;  3VUR A;  5HR2 A;  3K8N A;  1KTE A;  2B1L A;  1B48 A;  1PKW A;  1JZW A;  3F3R A;  4PXO A;  3UJ1 A;  2C8U A;  3RHC A;  2LQQ A;  4MAB A;  4POM A;  2OBK A;  1SEN A;  4F9Z A;  4X1U A;  3UIW A;  1TXX A;  1ZCP A;  2KHP A;  5FT3 A;  3QFA C;  1ML6 A;  3DWV A;  2KUC A;  2H6X A;  4DSQ A;  3KD0 A;  4MF5 A;  3KEB A;  4BVX A;  2P5R A;  3FZ4 A;  2F3M A;  3L4N A;  3HDC A;  1BX9 A;  4IJI A;  1V98 A;  1O8X A;  4ZIJ A;  2OBI A;  2YNX A;  1M2D A;  5ECL B;  2YPM A;  3QMX A;  2VL2 C;  3TKS E;  3LEF A;  2K18 A;  1U3A A;  3SWL A;  5IOX A;  4HI7 A;  4L0W A;  5FHI A;  3UAP A;  5DJL A;  4ZL9 A;  2LV3 A;  3DYR A;  2YWM A;  4MJE A;  2ES7 A;  1XBS A;  2VLT A;  1MD4 A;  5LCZ A;  5HFK A;  4F2I A;  3LJR A;  3HCZ A;  2YZU A;  2IFQ A;  1K0A A;  3GMF A;  1HNC A;  4OMV A;  4CDO A;  2VCW A;  12GS A;  3FY7 A;  3EC3 A;  2B5Y A;  3PIN A;  1FHE A;  1GNE A;  2VO4 A;  2V1M A;  4TOP A;  3JCM L;  2AUV A;  2VOC A;  1O6J A;  1MDK A;  1DBY A;  4GQF A;  1SL2 B;  1ILO A;  1QMV A;  4HQS A;  2TRC P;  3EYT A;  3WT1 A;  4KCE A;  4OCF A;  4K2D A;  3FZ9 A;  2IIY A;  2CAI A;  5DAK A;  2KP1 A;  4JED A;  1UN2 A;  1K3O A;  2FA8 A;  4MLY A;  2YP6 A;  6GSW A;  2H1B A;  4IEL A;  2LEG A;  4LMW A;  2RUE A;  1TI3 A;  5ABR A;  3TKP A;  2LRC A;  2GTU A;  1SYR A;  2LRT A;  1EV4 A;  5A4U A;  3F4T A;  3LXT A;  1ERT A;  2HXK A;  3RPN A;  2HNL A;  2VM1 A;  1GTA A;  1Y25 A;  2DJ2 A;  3RHB A;  1JZR A;  4XS4 B;  5KN3 A;  2GSR A;  1GUL A;  2BMX A;  1N8J A;  1B9Y C;  2YCD A;  3ZZX A;  1PD2 1;  1F3B A;  3TKS C;  19GS A;  3LG6 A;  3ZL5 A;  3VI7 A;  3NOF A;  3VWU A;  3C8E A;  1SK2 A;  1O81 A;  4KDX A;  2P31 A;  5G1K A;  1S3C A;  2LS5 A;  4HOJ A;  2E2M A;  4K7I A;  3C73 A;  2HZF A;  2PPT A;  3CSI A;  5ECO B;  2BJX A;  3ZFL A;  4D73 B;  1TW9 A;  1JZO A;  2EIQ A;  5IIZ A;  3GL3 A;  3QAG A;  3N9J A;  2EIR A;  4YQU A;  3FYG A;  1ZOF A;  2JU5 A;  1U3I A;  1EZK A;  1AQV A;  4HEA 2;  5A4W A;  2I4A A;  1A8Y A;  1PRX A;  4G10 A;  3ISO A;  1FG4 A;  4EO3 A;  2FWF A;  1X9W B;  4BVY A;  1TU7 A;  2OJL A;  2WZ9 A;  2H1G A;  3GNJ A;  3VPT A;  4ZBD A;  3NIV A;  1U6T A;  1WMJ A;  2K8S A;  2E7P A;  1RW1 A;  2YZH A;  3G7J A;  4RUV A;  1NM3 A;  5FWG A;  4YAP A;  3TOU A;  1S3D A;  2ZUP A;  3U5R E;  2MMN A;  3M3M A;  1ZZY A;  1OVN A;  3NZN A;  5ID2 B;  1XZO A;  1TRU A;  3BBY A;  1V57 A;  3PH9 A;  5EPF A;  2VL9 A;  3Q6O A;  4XRD A;  2ZCT A;  2OAD A;  2IL3 A;  1AAZ A;  4GF0 A;  3ZRD A;  3TRX A;  1OC3 A;  2QSI A;  4LA1 A;  3BJ5 A;  1PL1 A;  2OKA A;  3TDG A;  3D0Z A;  1MTC A;  2VCZ A;  3ERG A;  3GFK A;  2FA4 A;  3MDK A;  3HVV A;  1B4P A;  1Z6N A;  1UVZ A;  1USB A;  3EIN A;  1GUM A;  3KXO A;  2WS2 A;  4MPF A;  2WUL A;  1OC9 A;  4N0V A;  3VWV A;  4FH8 A;  1ZL9 A;  5E4W A;  2F9S A;  3D21 A;  1XW5 A;  4BWS A;  1M9B A;  3L9U A;  2A2R A;  2C1Y A;  1X9M B;  5H5S A;  2I9H A;  3EWL A;  4O32 A;  1XW6 A;  3TJK A;  4ECB A;  1PMT A;  1V40 A;  2YWI A;  4HS1 A;  2IFQ B;  5EY6 A;  4MJC A;  2VIM A;  5ECH B;  1PQN A;  1ZGN A;  1YJ6 A;  4Q5N A;  1GSS A;  1AUC A;  2WCI A;  5HR0 A;  3RBT A;  5CRH A;  4POL A;  4MDC A;  1QQ2 A;  4K7N A;  4KDU A;  3C1R A;  3RPP A;  3GV1 A;  3J7Y k;  1K0N A;  1TK8 B;  3M9J A;  1OYJ A;  3UMA A;  2VCV A;  4KSO A;  1TP9 A;  2YJ7 A;  3IC4 A;  2DBC A;  2DJ1 A;  5D8I A;  2LTK A;  2FWH A;  2HT9 A;  3F8U A;  2CV4 A;  1EOG A;  3RAZ A;  4K0G A;  1TDI A;  3DML A;  1TRV A;  2GDR A;  3A3T A;  4KX4 A;  2AYT A;  3IR4 A;  2AHE A;  5CNW A;  1B9X C;  5CAX A;  3AY8 A;  5A5K A;  4TR0 A;  3KP9 A;  2GQL A;  2WFC A;  2XPE A;  1K0B A;  1HQO A;  3FRC A;  1HNB A;  1SL0 B;  3ZTL A;  3IAS 2;  1YDK A;  3ME8 A;  2LKU A;  3HVS A;  4K9Z A;  2JL4 A;  4KCA A;  2VL2 A;  4I6X A;  1EOH A;  4KGI A;  5INY A;  4MF6 A;  2XHF A;  1ABA A;  2H71 A;  3DXB A;  1TRS A;  2V41 A;  4ZB8 A;  1C72 A;  4K8M A;  1TI1 A;  2NVL A;  2IME A;  4MP4 A;  1Q98 A;  3BD2 A;  4NWY A;  1XXU A;  5JWR B;  5CRD A;  1S3A A;  2YN1 A;  1MEK A;  3GSS A;  3IHQ A;  1ERW A;  3GN3 A;  2PUK C;  2L4C A;  2ON7 A;  5ECM B;  2VCQ A;  3IPZ A;  4TXO A;  5KEJ A;  2V6O A;  1RK4 A;  1R5A A;  3F4R A;  3IK7 A;  17GS A;  3VWW A;  3PGT A;  1WJK A;  3APO A;  5ECN B;  4OWY A;  2PN8 A;  2CQ9 A;  4GQC A;  3D4M A;  1XWC A;  3TJG A;  1KEB A;  3L78 A;  2WRT A;  3HZ8 A;  3GUS A;  1K3L A;  3A2X A;  4ZB6 A;  4WR5 A;  2C0E A;  1F37 A;  1F2E A;  1K0M A;  3QDN A;  1SJ6 A;  3HJM A;  2B6M A;  3P7X A;  2MZC A;  3ZFB A;  3Q74 A;  3DGQ A;  2OE1 A;  3EU4 A;  4TR1 B;  4L5O A;  1YKC A;  5IMD A;  3CSH A;  5KN0 A;  3QOU A;  4PQH A;  4L0U A;  3BCI A;  3CTG A;  3ZLP A;  4GSN A;  4HZ4 A;  5IMC A;  1NW2 A;  4XCS A;  4GSS A;  2I1U A;  4YAV A;  5G31 A;  3LXZ A;  3Q19 A;  6GSS A;  2DC5 A;  3VK9 A;  16GS A;  5KN2 A;  5JCG A;  4OFM A;  3QPM A;  3Q18 A;  2C0D A;  2HRN A;  2V2G A;  2KLX A;  4X43 A;  1ZYE A;  2B7K A;  4PUA A;  6GSY A;  5B6M A;  1OE7 A;  4JE1 A;  1GLQ A;  4YQV A;  4FYU A;  4DSS A;  1FW1 A;  3GKM A;  4CHS A;  2GT5 A;  3A2V A;  2V6K A;  5DQY A;  5IOW A;  1SKR B;  2GT6 A;  2L4Q A;  4V2M A;  1VF2 A;  4WF5 A;  1EP8 A;  3C1S A;  5GSS A;  1XIY A;  1TKD B;  2VL3 A;  2B7J A;  2HYX A;  1M0U A;  3GIX A;  2CAQ A;  3EE2 A;  5ECK B;  1GLP A;  3LGC A;  3UBL A;  3UL3 A;  2FHE A;  5ECS A;  1Z7P A;  2HRF A;  5HR1 A;  2JZR A;  2D2Z A;  4TRX A;  1OKT A;  4ID0 A;  2B3S A;  1SYX A;  3D5J A;  2HI7 A;  5IPH A;  4JR6 A;  2X8H A;  4E8H A;  2F8F A;  3OR5 A;  3MAK A;  3G9B A;  3HD5 A;  2H6Y A;  2NBS A;  2V32 A;  4NXI A;  4K1F A;  1PKZ A;  2H0I A;  5LNK e;  5F07 A;  2FCH A;  3H79 A;  4AF2 A;  3A5W A;  2H66 A;  2LNS A;  4WET A;  2J9H A;  5G5F A;  4OFT A;  2H01 A;  2GSS A;  1OKD A;  4IQ1 A;  5ECR B;  5ECI B;  3E9J B;  4WEY A;  4ISD A;  3GKN A;  1AW9 A;  3GYK A;  5J9B A;  1TTZ A;  3HZ4 A;  2L5L A;  5D9X A;  1T00 A;  2L57 A;  2H70 A;  5IM9 A;  1WP0 A;  3I6A A;  2O85 A;  5B7C A;  1WE0 A;  2WGR A;  3MSZ A;  2GZP A;  1F9M A;  3KMN A;  2JAD A;  3R2Q A;  2H72 A;  1YF1 A;  1WIK A;  3TJF A;  3APS A;  5F05 A;  2VD1 A;  5ENU A;  2VAF A;  3GH6 A;  3M1G A;  3EMP A;  1EEM A;  3G7I A;  4FO5 A;  4TXO B;  1XVW A;  3ZMK A;  3QAV A;  1YKA A;  1E6B A;  2IN3 A;  4IQA A;  3VWX A;  2XBQ A;  3HXS A;  1KBN A;  1VGL A;  1CQG A;  1TOF A;  1H4O A;  3IBH A;  3H93 A;  4MJB A;  5DAL B;  2HLS A;  2L6D A;  2EC4 A;  4KW6 A;  5G5E A;  4L5L A;  4QQ7 A;  3DEX A;  5IQY A;  2CVB A;  2IMD A;  3O3T A;  2R3X A;  2GST A;  2LQO A;  3KTL A;  1GUH A;  3HJP A;  4NV2 A;  4XIH A;  1FOV A;  5J3R A;  4WBR D;  3CTF A;  1THO A;  4XHM A;  3QCP A;  3D6I A;  2HZE A;  2OAC A;  3HYP A;  4ACS A;  2VLV A;  2C3Q A;  3KIJ A;  4TW5 A;  1GSQ A;  4HUA A;  4O5R A;  2NDO A;  3GTU A;  3A2W A;  4MZC A;  3FW2 A;  4MZW A;  2FWE A;  1AQX A;  5JWQ B;  1SU9 A;  3E3E A;  2YV7 A;  2AV4 A;  4EC0 A;  1X5C A;  1U88 A;  4OO5 A;  2CA8 A;  5IMV A;  3QAW A;  2H30 A;  5DCG A;  2X8G A;  2J23 A;  4PQI A;  4KDY A;  1KNG A;  1XPV A;  4AJ6 A;  4BWQ A;  2C80 A;  2IJY A;  2MMO A;  2YWN A;  1XWA A;  3M8N A;  7GSS A;  4N11 A;  2I81 A;  5DVB A;  3LOR A;  5GAN D;  4JZQ A;  3QD9 A;  2Z9S A;  1FAA A;  1W4V A;  5AIS A;  2IMK A;  4CW9 A;  3CMI A;  4EXJ A;  2WB9 A;  4ECI A;  2DJK A;  1EV9 A;  2P5Q A;  5EL8 A;  4I8B A;  2L59 A;  1GTI A;  1DE2 A;  5HFG A;  1XCC A;  1JLV A;  5DCH A;  1ZMA A;  5DQS A;  5DDL A;  1A2J A;  1J0F A;  1GUK A;  3CXG A;  6GSX A;  4TR3 A;  1OE8 A;  3KH7 A;  1GTU A;  3LWA A;  2P0G A;  4I2T A;  5B8B A;  4ILF A;  4H86 A;  1YY7 A;  2YV9 A;  1SL1 B;  1SK0 A;  2GZZ A;  1H75 A;  2H0G A;  5J9C A;  2YOI A;  4EDY A;  1AXD A;  3FR3 A;  3ERF A;  3BCK A;  4MK3 A;  2MBS A;  2IWT A;  3TUE A;  2K6V A;  4LMV A;  1X5E A;  3EMX A;  3UBK A;  5KN1 A;  1T1V A;  2O89 A;  2FD3 A;  1PGT A;  1ERV A;  1TK0 B;  1X5D A;  3HY2 A;  1N2A A;  2R4V A;  4I97 A;  4EF0 A;  4QL7 A;  4MH3 A;  1FVK A;  2GQM A;  1M2B A;  1ERU A;  1M99 A;  4KSM A;  1QFN A;  2F51 A;  5D96 A;  2L5O A;  4WXT A;  3HA9 A;  2O7K A;  1R5P A;  2PBJ A;  2C0G A;  2VCX A;  8GSS A;  4F0C A;  3ZRE A;  1THX A;  3UAR A;  4ECC A;  1R7H A;  4NV5 A;  2OE3 A;  2IMI A;  5DAK B;  1B4Q A;  4GWR A;  5ECP B;  2LJK A;  4MCU A;  3CRT A;  1J08 A;  3BOA A;  2K8V A;  4XS1 A;  5H5Q A;  1QUW A;  2M80 A;  3I69 A;  2MBT A;  4P3Y B;  3P90 A;  1QGV A;  3IAM 2;  3F9U A;  1IYH A;  4Z7X A;  1A23 A;  2H8L A;  3KGK A;  4ZBB A;  1Z5Y E;  1DE1 A;  4ZL7 A;  3IA1 A; 
#chains in the Genus database with same CATH topology
 1ST9 A;  5C00 A;  4XRA A;  4BPY A;  1O85 A;  1WWJ A;  2WDU A;  1TRW A;  3KM6 A;  4RQR A;  2X8C A;  2HSY A;  10GS A;  2PMT A;  4TN8 A;  1BG5 A;  3W8S A;  3V1W A;  4F03 A;  1GRX A;  2OE0 A;  1GWC A;  1BED A;  2I3Y A;  5IMA A;  1Q4J A;  4YH2 A;  5IMF A;  3H8Q A;  3IOS A;  1GNW A;  1XG8 A;  2QKE A;  3TRP A;  4Q5Q A;  4EDZ A;  3TCO A;  2DIZ A;  1FOH A;  1WPI A;  1MD3 A;  3KP8 A;  5AGY A;  2AB6 A;  1M2A A;  2HRA A;  4V1A g;  3P8W A;  4KA0 A;  2G2Q A;  2YWO A;  3UVT A;  3W6G A;  4IGJ A;  2AAW A;  6GSU A;  3G7Y A;  1O73 A;  1K0O A;  3FR9 A;  5F8B A;  2X99 A;  2H19 A;  3ZVJ D;  3EUR A;  5CP1 A;  2HZE B;  1K0C A;  4XS4 A;  3TB2 A;  1GL8 A;  2VLU A;  1BAY A;  3CRU A;  4K6X A;  1MDI A;  4WBJ A;  3GTU B;  1NHO A;  3HKR A;  4KAE A;  2ZNM A;  1AQW A;  2E0Q A;  3ZIT A;  4TR4 A;  4BVY B;  4GCI A;  4IS0 A;  2CVK A;  3EVI A;  1EGO A;  2DMM A;  5GAP D;  4JU5 A;  2CX4 A;  4F82 A;  1VF3 A;  3FZ5 A;  3ZYW A;  4E8E A;  3U6V A;  2GLR A;  4IVF A;  4PQ1 A;  2FY6 A;  3C71 A;  4QL9 A;  4WF4 A;  4V2N A;  4BA7 A;  2FGX A;  4ML1 A;  4D73 A;  3CYN A;  1G0T A;  3DRN A;  3RDW A;  2HSH A;  3ZIV A;  1PFO A;  2RII A;  1Z3E A;  5J41 A;  2A2S A;  3S9F A;  3TJB A;  1I9D A;  2REM A;  5E59 A;  3H4K A;  3IDV A;  4G0I A;  1TK5 B;  4ECJ A;  4KB3 A;  4PUR A;  1G6W A;  2C0F A;  1X0R A;  3TKQ A;  4AJ7 A;  1VF4 A;  1SJZ A;  5GST A;  1R4W A;  1M9A A;  2CVD A;  3TGZ A;  1OC9 B;  2GVP A;  3VI5 A;  5A4V A;  3DD3 A;  5ID2 A;  4PNF A;  1XWK A;  2TIR A;  3KH9 A;  4HDE A;  4IW9 A;  5G1L A;  3FK8 A;  5D93 A;  3WT2 A;  1XFL A;  1HD2 A;  3SBC A;  3F63 A;  1T4Z A;  4FYB A;  2X49 A;  2XPD A;  1W89 A;  4RQX A;  4Q5F A;  4V2L A;  3WGD A;  4IP6 A;  1F3A A;  2GGT A;  1AIU A;  2AJQ B;  3EU3 A;  3GH9 A;  3LYP A;  2DML A;  2RLI A;  2ON5 A;  5DBQ A;  3DIE A;  1JLW A;  2LJA A;  9GSS A;  4HSC X;  5D73 A;  4V1A p;  5IMZ A;  4DEJ A;  3GST A;  4EKZ A;  1M3I A;  2FUG 2;  1VF1 A;  1GSD A;  3TOT A;  3I43 A;  4L8E A;  2R5G A;  3QFB C;  2N5F A;  1R26 A;  2MMA A;  3F0I A;  3D22 A;  1O8W A;  4FIW A;  3KMO A;  4GST A;  1K0D A;  1V9W A;  1PA3 A;  2H74 A;  1EP7 A;  3ED3 A;  1LU4 A;  4YQM A;  2PU9 C;  3WGE A;  2ALB A;  3DVW A;  1A0R P;  4EVM A;  1YF0 A;  1T7P B;  2QC7 A;  1JHB A;  3LYK A;  4HJ2 A;  4HU7 A;  2E2G A;  4JBB A;  5CRW A;  2MYG A;  3A5I A;  2H75 A;  4LL4 B;  1YEP A;  3KJY A;  5CYY A;  5F06 A;  1T8E B;  4EE0 A;  1WOU A;  6GST A;  1HYU A;  2CZ2 A;  2HE3 A;  1X9S B;  4ZIL A;  3US3 A;  4GRF A;  4EIQ A;  4IKH A;  3MNG A;  4GLT A;  4NAX A;  3TJJ A;  3WD6 A;  4IP1 A;  3HHV A;  1A2L A;  3FHK A;  3H1N A;  1UC7 A;  1G7O A;  1VRS D;  3WGX A;  4TKY A;  5JWO B;  2DJ0 A;  2VCT A;  3VPQ A;  1LJR A;  3MIX A;  3GKX A;  11GS A;  2GZY A;  2B5E A;  4J56 E;  1BQ7 A;  4ML6 A;  2LRN A;  3W8J A;  5IO2 A;  2WJU A;  1GH2 A;  1G7E A;  1J9B A;  5LD0 A;  2VM2 A;  2PGT A;  5D9T A;  4LL1 B;  3FZA A;  2LJR A;  2H76 A;  1XW9 A;  1YQ1 A;  1T4Y A;  3GX8 A;  2JAC A;  5DJM A;  2FWG A;  5G30 A;  3TKR A;  4KUN A;  1O7U A;  6GSV A;  3LQ7 A;  3ERW A;  3GA4 A;  2DLX A;  4G2E A;  4J2F A;  1TU8 A;  2FLS A;  3N5O A;  1FO5 A;  1PSQ A;  2RUF A;  2H6Z A;  4Q5R A;  20GS A;  2R6K A;  4NHZ A;  2O87 A;  4N30 A;  2DIY A;  14GS A;  3I9V 2;  1GTB A;  4WR4 A;  3PR8 A;  3D4T A;  5COH A;  5ELG A;  1Z7R A;  5JCW A;  1OAZ A;  3VLN A;  2JSY A;  4GTU A;  3M9K A;  1XVQ A;  1U87 A;  4JR4 A;  2M72 A;  3CQF A;  2RM5 A;  3F6D A;  3HJO A;  3FEU A;  4JRR A;  5HQP A;  1K3Y A;  1EWX A;  1E2Y A;  2NPB A;  5JCU A;  4NMU A;  4MF7 A;  2R2J A;  2YAN A;  5AIV A;  3APQ A;  5B6N A;  4PUF C;  5CRE A;  3L9S A;  4HU9 A;  5D9V A;  18GS A;  4DVC A;  4DSS B;  4TR1 A;  3FR6 A;  2X64 A;  4K0N A;  1RQM A;  1AC1 A;  1YZX A;  3HVX A;  2IPA A;  4O5U A;  4WKW A;  3DVX A;  1A0F A;  4EL1 A;  5J5N A;  2C3N A;  1SD8 A;  2LNT A;  5G2Z A;  2H0H A;  1G6Y A;  2OA7 A;  2F8A A;  3ZVJ A;  4FYC A;  3ZIJ A;  1PN9 A;  2NTO A;  2R0G A;  5BMU A;  4OFN A;  3IK9 A;  2C4J A;  3GKK A;  2CT6 A;  2QGV A;  5J4U A;  5ECQ B;  4PX1 A;  2CX3 A;  1A24 A;  4A5P A;  5H5R A;  1TJD A;  4ZL8 A;  4MZB A;  1SKS B;  3GHA A;  2CZ3 A;  2K9F A;  1QXH A;  1XWB A;  4NHW A;  4J57 E;  5HR3 A;  2O8V B;  1A8L A;  4HQZ A;  3F4S A;  4O7H A;  2R37 A;  1B8X A;  3GUR A;  3F6F A;  1NSW A;  4XTS A;  4PNG A;  1SK1 A;  4KE3 A;  1Y6E A;  3C7M A;  4ULX A;  2GS3 A;  2DSA A;  5HFI A;  2A4V A;  2H73 A;  1Z9H A;  3GRX A;  13GS A;  5L71 A;  1GSF A;  3IV4 A;  4OO4 A;  2B1K A;  3TRQ A;  3O76 A;  4Z2U A;  4N0Z A;  2DJ3 A;  4MJA A;  1SD9 A;  1FB0 A;  4I2U A;  1T3B A;  3FKF A;  1I5G A;  2DJJ A;  4Z2R A;  3MWH A;  1FVJ A;  4KND A;  1NHY A;  5AIX A;  2PER A;  4OD7 A;  2JZS A;  2GQK A;  2GSQ A;  1A2M A;  1JZD A;  1SKW B;  3F3Q A;  4OCE A;  1IYI A;  4O92 A;  4MMM A;  2XBI A;  4NPB A;  1YEX A;  2KOK A;  5AN1 A;  5F0G A;  3LSZ A;  1EEJ A;  5GZZ B;  3ME7 A;  4MH2 A;  1FB6 A;  4PGT A;  4F0B A;  3QR6 A;  4TXV A;  1BYE A;  1XWG A;  2G0F A;  4XS6 A;  2BTO T;  3L9V A;  3GL5 A;  4N10 A;  2N5B A;  1ACV A;  2JZT A;  4IHU A;  1SJI A;  4POK A;  2IMF A;  1JFU A;  3P2A A;  1GSU A;  2LST A;  2PVQ A;  1URM A;  5IPG A;  2PWJ A;  1GSY A;  3CSJ A;  3GX0 A;  3KCM A;  4ZB9 A;  4I5Q A;  3IRA A;  4LLR A;  2MMZ A;  4AGS A;  2PVO C;  2TRX A;  3UEM A;  3HVN A;  1PX6 A;  5C04 A;  3WYW A;  1MDJ A;  3IE3 A;  3KTB A;  1WRY A;  2FNO A;  1V58 A;  1OC8 A;  2M46 A;  4AJ8 A;  4IBP A;  2YJH A;  4IJ3 A;  4G19 A;  1BJX A;  4MPG A;  4POB A;  1Z6M A;  1QK8 A;  3VFI A;  3M0F A;  1GSE A;  3E0U A;  1PL2 A;  3DKS A;  3O6T A;  3UVH A;  1ZYQ B;  1ON4 A;  2XC2 A;  1HNA A;  2H1A A;  4EUY A;  2RM6 A;  5DAL A;  2L6C A;  4ZXG A;  2VUP A;  3IXR A;  4RI6 A;  5IO0 A;  5B8A A;  4ZBA A;  4BL7 A;  5CO3 A;  4X0X A;  2KP2 A;  1XOA A;  22GS A;  1DUG A;  4DSR A;  3ZML A;  2VD0 A;  1PX7 A;  2UZ8 A;  5D9W A;  1LBK A;  4MA9 A;  5ELA A;  3KZQ A;  2H1D A;  2C3T A;  5CRG A;  1GP1 A;  4GXZ A;  1F6M C;  1M7T A;  3L0H A;  2EIO A;  2HFD A;  3CBU A;  1EGR A;  3UOM A;  4G9H A;  4HZ2 A;  3LFL A;  4KH7 A;  5EVO A;  2JSZ A;  1UA5 A;  1XOB A;  1CQH A;  3J7Y b;  2B5X A;  2N5A A;  2LUS A;  4HJM A;  4IN0 A;  1V2A A;  1DSB A;  4TVE A;  4CY6 A;  4RI7 A;  3TKS A;  4K7O A;  3VUR A;  5HR2 A;  3K8N A;  1KTE A;  2B1L A;  1B48 A;  1PKW A;  1JZW A;  3F3R A;  4PXO A;  3UJ1 A;  4CY8 A;  2C8U A;  3RHC A;  2LQQ A;  4MAB A;  4POM A;  2OBK A;  1SEN A;  4F9Z A;  4X1U A;  3UIW A;  1TXX A;  1ZCP A;  3MYD A;  2KHP A;  3QFA C;  5FT3 A;  1ML6 A;  3DWV A;  2KUC A;  2H6X A;  4DSQ A;  3KD0 A;  4MF5 A;  3KEB A;  3IHG A;  4BVX A;  2P5R A;  3FZ4 A;  2F3M A;  3L4N A;  3HDC A;  1BX9 A;  4IJI A;  1V98 A;  4K5S A;  1O8X A;  4ZIJ A;  2DKI A;  2OBI A;  2YNX A;  1M2D A;  5ECL B;  2YPM A;  3QMX A;  2VL2 C;  3TKS E;  3LEF A;  2K18 A;  1U3A A;  5BRT A;  2R0C A;  3SWL A;  5IOX A;  4HI7 A;  4L0W A;  5FHI A;  3UAP A;  5DJL A;  4ZL9 A;  4FQU A;  2LV3 A;  3DYR A;  2YWM A;  4MJE A;  2ES7 A;  1XBS A;  2VLT A;  1MD4 A;  5LCZ A;  5HFK A;  4F2I A;  5KOX A;  3LJR A;  3HCZ A;  2YZU A;  2IFQ A;  1K0A A;  3GMF A;  1HNC A;  4OMV A;  4CDO A;  2VCW A;  12GS A;  3FY7 A;  3EC3 A;  2B5Y A;  3PIN A;  1FHE A;  1GNE A;  2VO4 A;  2V1M A;  4TOP A;  3JCM L;  2AUV A;  2VOC A;  1PN0 A;  1O6J A;  1MDK A;  1DBY A;  4GQF A;  1SL2 B;  1ILO A;  1QMV A;  4HQS A;  2TRC P;  3EYT A;  3WT1 A;  4KCE A;  4OCF A;  4K2D A;  3FZ9 A;  2IIY A;  2CAI A;  5DAK A;  2KP1 A;  4JED A;  1UN2 A;  1K3O A;  2FA8 A;  4MLY A;  1S3R A;  2YP6 A;  6GSW A;  2H1B A;  4IEL A;  1M3J A;  2LEG A;  4LMW A;  2RUE A;  1TI3 A;  5ABR A;  3TKP A;  2LRC A;  2GTU A;  1SYR A;  2LRT A;  1EV4 A;  5A4U A;  3F4T A;  3LXT A;  1ERT A;  2HXK A;  3RPN A;  2HNL A;  2VM1 A;  1GTA A;  1Y25 A;  2DJ2 A;  3RHB A;  1JZR A;  4XS4 B;  5KN3 A;  2GSR A;  1GUL A;  2BMX A;  1N8J A;  1B9Y C;  2YCD A;  3ZZX A;  1PD2 1;  1F3B A;  3TKS C;  19GS A;  3LG6 A;  3ZL5 A;  3VI7 A;  3NOF A;  3VWU A;  3C8E A;  1SK2 A;  1O81 A;  4KDX A;  4BL7 B;  2P31 A;  5G1K A;  1S3C A;  2LS5 A;  4HOJ A;  2E2M A;  4K7I A;  3C73 A;  2HZF A;  2DKH A;  2PPT A;  3R3E A;  3CSI A;  5ECO B;  2BJX A;  3ZFL A;  3IC8 A;  4D73 B;  1TW9 A;  1JZO A;  2EIQ A;  2X4A A;  5IIZ A;  3GL3 A;  3QAG A;  3N9J A;  2EIR A;  4YQU A;  3FYG A;  1ZOF A;  2JU5 A;  1U3I A;  1EZK A;  1AQV A;  4HEA 2;  5A4W A;  2I4A A;  1A8Y A;  1PRX A;  4G10 A;  3ISO A;  1FG4 A;  2QA2 A;  4EO3 A;  2FWF A;  1X9W B;  4BVY A;  1TU7 A;  2OJL A;  2WZ9 A;  2H1G A;  3GNJ A;  3VPT A;  4ZBD A;  3NIV A;  1U6T A;  1WMJ A;  2K8S A;  2E7P A;  1RW1 A;  4PTS A;  2YZH A;  3G7J A;  4RUV A;  1NM3 A;  5FWG A;  4YAP A;  3TOU A;  1S3D A;  2ZUP A;  3U5R E;  2MMN A;  3M3M A;  1ZZY A;  1OVN A;  3NZN A;  5ID2 B;  1XZO A;  1TRU A;  3BBY A;  1V57 A;  3PH9 A;  5EPF A;  2VL9 A;  3Q6O A;  4XRD A;  4Z2T A;  2ZCT A;  2OAD A;  2IL3 A;  1AAZ A;  4GF0 A;  3ZRD A;  3TRX A;  1OC3 A;  2QSI A;  4LA1 A;  3BJ5 A;  1PL1 A;  2OKA A;  3TDG A;  3D0Z A;  1MTC A;  2VCZ A;  3ERG A;  3GFK A;  2FA4 A;  3MDK A;  3HVV A;  1B4P A;  1Z6N A;  1UVZ A;  1USB A;  3EIN A;  1GUM A;  3KXO A;  2WS2 A;  4YKG A;  4MPF A;  2WUL A;  1OC9 A;  4N0V A;  3VWV A;  4FH8 A;  1ZL9 A;  5E4W A;  2F9S A;  3D21 A;  1XW5 A;  4BWS A;  1M9B A;  3L9U A;  2A2R A;  2C1Y A;  1X9M B;  5H5S A;  2I9H A;  3EWL A;  4O32 A;  1XW6 A;  3TJK A;  4ECB A;  1PMT A;  1V40 A;  2YWI A;  4HS1 A;  2IFQ B;  5EY6 A;  4MJC A;  2VIM A;  5ECH B;  1PQN A;  1ZGN A;  1YJ6 A;  4Q5N A;  1GSS A;  1AUC A;  2WCI A;  5HR0 A;  3RBT A;  5CRH A;  4POL A;  4MDC A;  1QQ2 A;  4K7N A;  4KDU A;  3C1R A;  3RPP A;  3GV1 A;  4USS A;  1ZYN A;  3J7Y k;  1K0N A;  1TK8 B;  3M9J A;  1OYJ A;  3UMA A;  2VCV A;  4G0L A;  4KSO A;  1TP9 A;  2YJ7 A;  3IC4 A;  2DBC A;  2DJ1 A;  5D8I A;  2LTK A;  2FWH A;  2HT9 A;  3F8U A;  2CV4 A;  1EOG A;  3RAZ A;  4K0G A;  1TDI A;  3DML A;  1TRV A;  2GDR A;  3A3T A;  4KX4 A;  2AYT A;  3IR4 A;  2AHE A;  5CNW A;  1B9X C;  5CAX A;  3AY8 A;  5A5K A;  4TR0 A;  3KP9 A;  2GQL A;  2WFC A;  2XPE A;  1K0B A;  1HQO A;  3FRC A;  1HNB A;  1SL0 B;  3EPT A;  3ZTL A;  3IAS 2;  1YDK A;  3ME8 A;  2LKU A;  3HVS A;  4K9Z A;  2JL4 A;  4KCA A;  2VL2 A;  4I6X A;  1EOH A;  4KGI A;  5INY A;  4MF6 A;  2XHF A;  1ABA A;  2H71 A;  3DXB A;  1TRS A;  2V41 A;  4ZB8 A;  1C72 A;  4G0K A;  4K8M A;  1TI1 A;  2NVL A;  2IME A;  4MP4 A;  1Q98 A;  3BD2 A;  4NWY A;  1XXU A;  5JWR B;  5CRD A;  1S3A A;  2YN1 A;  1MEK A;  3GSS A;  3IHQ A;  1ERW A;  3GN3 A;  2PUK C;  2L4C A;  1ZYP A;  2ON7 A;  5ECM B;  2VCQ A;  3IPZ A;  4TXO A;  5KEJ A;  2V6O A;  1RK4 A;  1R5A A;  3F4R A;  3IK7 A;  17GS A;  3VWW A;  3PGT A;  1WJK A;  3APO A;  4OWY A;  5ECN B;  2PN8 A;  2CQ9 A;  4GQC A;  3D4M A;  1XWC A;  3TJG A;  1KEB A;  3L78 A;  2WRT A;  3HZ8 A;  3GUS A;  1K3L A;  3A2X A;  4ZB6 A;  4WR5 A;  2C0E A;  1F37 A;  1F2E A;  1K0M A;  3QDN A;  1SJ6 A;  3HJM A;  2B6M A;  3P7X A;  2MZC A;  3ZFB A;  3Q74 A;  3DGQ A;  2OE1 A;  3EU4 A;  4TR1 B;  4L5O A;  1YKC A;  5IMD A;  3CSH A;  5KN0 A;  3QOU A;  4PQH A;  4YKF A;  4L0U A;  3BCI A;  3CTG A;  3ZLP A;  4GSN A;  4HZ4 A;  5IMC A;  1NW2 A;  3FMW A;  4XCS A;  4GSS A;  2I1U A;  4YAV A;  5G31 A;  3LXZ A;  3Q19 A;  6GSS A;  2DC5 A;  3VK9 A;  16GS A;  5KN2 A;  5JCG A;  4OFM A;  3QPM A;  3Q18 A;  2C0D A;  2HRN A;  2V2G A;  2KLX A;  4X43 A;  1ZYE A;  2B7K A;  4PUA A;  6GSY A;  5B6M A;  1OE7 A;  4JE1 A;  1GLQ A;  4YQV A;  4FYU A;  4DSS A;  1FW1 A;  3GKM A;  4CHS A;  2GT5 A;  3A2V A;  2V6K A;  5DQY A;  5IOW A;  1SKR B;  2GT6 A;  2L4Q A;  4V2M A;  1VF2 A;  4WF5 A;  1EP8 A;  3C1S A;  5GSS A;  1XIY A;  1TKD B;  2VL3 A;  2B7J A;  2HYX A;  1M0U A;  3GIX A;  2CAQ A;  3EE2 A;  5ECK B;  1GLP A;  3LGC A;  3UBL A;  3UL3 A;  4O5Q A;  2FHE A;  5ECS A;  1Z7P A;  2HRF A;  4X4J A;  5HR1 A;  2JZR A;  2D2Z A;  4TRX A;  1OKT A;  4ID0 A;  2B3S A;  1SYX A;  3D5J A;  2HI7 A;  5IPH A;  4JR6 A;  2X8H A;  4E8H A;  2F8F A;  3OR5 A;  3MAK A;  3G9B A;  3HD5 A;  2H6Y A;  2NBS A;  2V32 A;  4NXI A;  4K1F A;  1PKZ A;  2H0I A;  5LNK e;  5F07 A;  2FCH A;  3H79 A;  4AF2 A;  3A5W A;  2H66 A;  2LNS A;  4WET A;  2J9H A;  5G5F A;  4OFT A;  2H01 A;  2GSS A;  1OKD A;  4IQ1 A;  2R0P A;  5ECR B;  5ECI B;  3E9J B;  4WEY A;  4ISD A;  3GKN A;  1AW9 A;  3GYK A;  5J9B A;  1TTZ A;  3HZ4 A;  2L5L A;  5D9X A;  1T00 A;  2L57 A;  2H70 A;  5IM9 A;  1WP0 A;  3I6A A;  2O85 A;  5B7C A;  1WE0 A;  2WGR A;  3MSZ A;  5KOW A;  2GZP A;  1F9M A;  3KMN A;  2JAD A;  3R2Q A;  2H72 A;  1YF1 A;  1WIK A;  4MNN A;  3TJF A;  3APS A;  5F05 A;  2VD1 A;  5ENU A;  2VAF A;  3GH6 A;  4K2X A;  3M1G A;  3EMP A;  1EEM A;  3G7I A;  4FO5 A;  4TXO B;  1XVW A;  3ZMK A;  3QAV A;  1YKA A;  1E6B A;  2IN3 A;  4IQA A;  3VWX A;  2XBQ A;  3HXS A;  1KBN A;  1VGL A;  1CQG A;  1TOF A;  1H4O A;  3IBH A;  3H93 A;  4MJB A;  5DAL B;  2HLS A;  2L6D A;  2EC4 A;  4KW6 A;  5G5E A;  4L5L A;  4QQ7 A;  3DEX A;  5IQY A;  3O3T A;  2CVB A;  2A4H A;  2HSM A;  2IMD A;  2R3X A;  4EIP A;  2GST A;  2LQO A;  3KTL A;  1GUH A;  3HJP A;  4NV2 A;  4XIH A;  1FOV A;  5J3R A;  4WBR D;  3CTF A;  3LW9 A;  1THO A;  4XHM A;  4K5R A;  3QCP A;  3D6I A;  2HZE A;  2OAC A;  3HYP A;  4ACS A;  2VLV A;  2C3Q A;  3KIJ A;  4TW5 A;  1GSQ A;  4HUA A;  4O5R A;  2NDO A;  3GTU A;  3A2W A;  4MZC A;  3FW2 A;  4MZW A;  2FWE A;  2A2P A;  1AQX A;  5JWQ B;  1SU9 A;  3E3E A;  2YV7 A;  2AV4 A;  4EC0 A;  1X5C A;  1U88 A;  4OO5 A;  2CA8 A;  5IMV A;  3QAW A;  2H30 A;  5DCG A;  2X8G A;  2J23 A;  4PQI A;  4KDY A;  1KNG A;  1XPV A;  4AJ6 A;  4BWQ A;  2C80 A;  2IJY A;  2MMO A;  4KF9 A;  2YWN A;  1XWA A;  3M8N A;  3PPU A;  7GSS A;  4N11 A;  2I81 A;  5DVB A;  3LOR A;  5GAN D;  4JZQ A;  3QD9 A;  2Z9S A;  1FAA A;  1W4V A;  5AIS A;  2IMK A;  4CW9 A;  3CMI A;  4EXJ A;  2WB9 A;  4ECI A;  2DJK A;  1EV9 A;  2P5Q A;  5EL8 A;  4I8B A;  2L59 A;  1GTI A;  1DE2 A;  5HFG A;  1XCC A;  4BVX B;  1JLV A;  5DCH A;  1ZMA A;  4ICY A;  5DQS A;  5DDL A;  1A2J A;  1J0F A;  1GUK A;  3CXG A;  6GSX A;  4TR3 A;  1OE8 A;  3KH7 A;  1GTU A;  3LWA A;  2P0G A;  4I2T A;  5B8B A;  4ILF A;  4H86 A;  1YY7 A;  2YV9 A;  1SL1 B;  1SK0 A;  2GZZ A;  1H75 A;  2H0G A;  5J9C A;  2YOI A;  4EDY A;  4BIK A;  1AXD A;  3FR3 A;  3ERF A;  3BCK A;  4MK3 A;  2MBS A;  2IWT A;  3TUE A;  2K6V A;  4LMV A;  1X5E A;  2QA1 A;  3EMX A;  3UBK A;  5KN1 A;  1T1V A;  2O89 A;  2FD3 A;  1PGT A;  1ERV A;  1TK0 B;  1X5D A;  3HY2 A;  1N2A A;  2R4V A;  4I97 A;  4EF0 A;  4QL7 A;  4MH3 A;  1FVK A;  2GQM A;  1M2B A;  1ERU A;  2HRK A;  1M99 A;  4KSM A;  1QFN A;  2F51 A;  5D96 A;  2L5O A;  4WXT A;  3HA9 A;  2O7K A;  1R5P A;  2PBJ A;  2C0G A;  2VCX A;  8GSS A;  4F0C A;  3ZRE A;  1THX A;  3UAR A;  4ECC A;  1R7H A;  4NV5 A;  2OE3 A;  2IMI A;  5DAK B;  1B4Q A;  4GWR A;  5ECP B;  2LJK A;  4MCU A;  3CRT A;  1J08 A;  3BOA A;  2K8V A;  4XS1 A;  5H5Q A;  1QUW A;  2M80 A;  3I69 A;  2MBT A;  4P3Y B;  3P90 A;  1QGV A;  3IAM 2;  3F9U A;  1IYH A;  4Z7X A;  1A23 A;  2H8L A;  3KGK A;  4ZBB A;  1Z5Y E;  1DE1 A;  4ZL7 A;  3IA1 A; 
#chains in the Genus database with same CATH homology
 1ST9 A;  5C00 A;  4XRA A;  4BPY A;  1O85 A;  1WWJ A;  2WDU A;  1TRW A;  3KM6 A;  4RQR A;  2X8C A;  2HSY A;  10GS A;  2PMT A;  4TN8 A;  1BG5 A;  3W8S A;  3V1W A;  4F03 A;  1GRX A;  2OE0 A;  1GWC A;  1BED A;  2I3Y A;  5IMA A;  1Q4J A;  4YH2 A;  5IMF A;  3H8Q A;  3IOS A;  1GNW A;  2QKE A;  3TRP A;  4Q5Q A;  4EDZ A;  3TCO A;  2DIZ A;  1FOH A;  1WPI A;  1MD3 A;  3KP8 A;  5AGY A;  2AB6 A;  1M2A A;  2HRA A;  4V1A g;  3P8W A;  4KA0 A;  2G2Q A;  2YWO A;  3UVT A;  3W6G A;  4IGJ A;  2AAW A;  6GSU A;  3G7Y A;  1O73 A;  1K0O A;  3FR9 A;  5F8B A;  2X99 A;  2H19 A;  3ZVJ D;  3EUR A;  5CP1 A;  2HZE B;  1K0C A;  4XS4 A;  3TB2 A;  1GL8 A;  2VLU A;  1BAY A;  3CRU A;  4K6X A;  1MDI A;  4WBJ A;  3GTU B;  1NHO A;  3HKR A;  4KAE A;  2ZNM A;  1AQW A;  2E0Q A;  3ZIT A;  4TR4 A;  4BVY B;  4GCI A;  4IS0 A;  2CVK A;  3EVI A;  1EGO A;  2DMM A;  5GAP D;  4JU5 A;  2CX4 A;  4F82 A;  1VF3 A;  3FZ5 A;  3ZYW A;  4E8E A;  3U6V A;  2GLR A;  4IVF A;  4PQ1 A;  2FY6 A;  3C71 A;  4QL9 A;  4WF4 A;  4V2N A;  4BA7 A;  2FGX A;  4ML1 A;  4D73 A;  3CYN A;  1G0T A;  3DRN A;  3RDW A;  2HSH A;  3ZIV A;  2RII A;  1Z3E A;  5J41 A;  2A2S A;  3S9F A;  3TJB A;  1I9D A;  2REM A;  5E59 A;  3H4K A;  3IDV A;  4G0I A;  1TK5 B;  4ECJ A;  4KB3 A;  4PUR A;  1G6W A;  2C0F A;  1X0R A;  3TKQ A;  4AJ7 A;  1VF4 A;  1SJZ A;  5GST A;  1R4W A;  1M9A A;  2CVD A;  3TGZ A;  1OC9 B;  2GVP A;  3VI5 A;  5A4V A;  3DD3 A;  5ID2 A;  4PNF A;  1XWK A;  2TIR A;  3KH9 A;  4HDE A;  4IW9 A;  5G1L A;  3FK8 A;  5D93 A;  3WT2 A;  1XFL A;  1HD2 A;  3SBC A;  3F63 A;  1T4Z A;  4FYB A;  2X49 A;  2XPD A;  1W89 A;  4RQX A;  4Q5F A;  4V2L A;  3WGD A;  4IP6 A;  1F3A A;  2GGT A;  1AIU A;  2AJQ B;  3EU3 A;  3GH9 A;  3LYP A;  2DML A;  2RLI A;  2ON5 A;  5DBQ A;  3DIE A;  1JLW A;  2LJA A;  9GSS A;  5D73 A;  4V1A p;  5IMZ A;  4DEJ A;  3GST A;  4EKZ A;  2FUG 2;  1VF1 A;  1GSD A;  3TOT A;  3I43 A;  4L8E A;  2R5G A;  3QFB C;  2N5F A;  1R26 A;  2MMA A;  3F0I A;  3D22 A;  1O8W A;  4FIW A;  3KMO A;  4GST A;  1K0D A;  1V9W A;  1PA3 A;  2H74 A;  1EP7 A;  3ED3 A;  1LU4 A;  4YQM A;  2PU9 C;  3WGE A;  2ALB A;  3DVW A;  1A0R P;  4EVM A;  1YF0 A;  1T7P B;  2QC7 A;  1JHB A;  3LYK A;  4HJ2 A;  4HU7 A;  2E2G A;  4JBB A;  5CRW A;  2MYG A;  3A5I A;  2H75 A;  4LL4 B;  1YEP A;  3KJY A;  5CYY A;  5F06 A;  1T8E B;  4EE0 A;  1WOU A;  6GST A;  1HYU A;  2CZ2 A;  2HE3 A;  1X9S B;  4ZIL A;  3US3 A;  4GRF A;  4EIQ A;  4IKH A;  3MNG A;  4GLT A;  4NAX A;  3TJJ A;  3WD6 A;  4IP1 A;  3HHV A;  1A2L A;  3FHK A;  3H1N A;  1UC7 A;  1G7O A;  1VRS D;  3WGX A;  4TKY A;  5JWO B;  2DJ0 A;  2VCT A;  3VPQ A;  1LJR A;  3MIX A;  3GKX A;  11GS A;  2GZY A;  2B5E A;  4J56 E;  1BQ7 A;  4ML6 A;  2LRN A;  3W8J A;  5IO2 A;  2WJU A;  1GH2 A;  1G7E A;  1J9B A;  5LD0 A;  2VM2 A;  2PGT A;  5D9T A;  4LL1 B;  3FZA A;  2LJR A;  2H76 A;  1XW9 A;  1YQ1 A;  1T4Y A;  3GX8 A;  2JAC A;  5DJM A;  2FWG A;  5G30 A;  3TKR A;  4KUN A;  1O7U A;  6GSV A;  3LQ7 A;  3ERW A;  3GA4 A;  2DLX A;  4G2E A;  4J2F A;  1TU8 A;  2FLS A;  3N5O A;  1FO5 A;  1PSQ A;  2RUF A;  2H6Z A;  4Q5R A;  20GS A;  2R6K A;  4NHZ A;  2O87 A;  4N30 A;  2DIY A;  14GS A;  3I9V 2;  1GTB A;  4WR4 A;  3PR8 A;  3D4T A;  5COH A;  5ELG A;  1Z7R A;  5JCW A;  1OAZ A;  3VLN A;  2JSY A;  4GTU A;  3M9K A;  1XVQ A;  1U87 A;  4JR4 A;  2M72 A;  2RM5 A;  3F6D A;  3HJO A;  3FEU A;  4JRR A;  5HQP A;  1K3Y A;  1EWX A;  1E2Y A;  2NPB A;  5JCU A;  4NMU A;  4MF7 A;  2R2J A;  2YAN A;  5AIV A;  3APQ A;  5B6N A;  4PUF C;  5CRE A;  3L9S A;  4HU9 A;  5D9V A;  18GS A;  4DVC A;  4DSS B;  4TR1 A;  3FR6 A;  2X64 A;  4K0N A;  1RQM A;  1AC1 A;  1YZX A;  3HVX A;  2IPA A;  4O5U A;  4WKW A;  3DVX A;  1A0F A;  4EL1 A;  5J5N A;  2C3N A;  1SD8 A;  2LNT A;  5G2Z A;  2H0H A;  1G6Y A;  2OA7 A;  2F8A A;  3ZVJ A;  4FYC A;  3ZIJ A;  1PN9 A;  2NTO A;  2R0G A;  5BMU A;  4OFN A;  3IK9 A;  2C4J A;  3GKK A;  2CT6 A;  2QGV A;  5J4U A;  5ECQ B;  4PX1 A;  2CX3 A;  1A24 A;  4A5P A;  5H5R A;  1TJD A;  4ZL8 A;  4MZB A;  1SKS B;  3GHA A;  2CZ3 A;  2K9F A;  1QXH A;  1XWB A;  4NHW A;  4J57 E;  5HR3 A;  2O8V B;  1A8L A;  4HQZ A;  3F4S A;  4O7H A;  2R37 A;  1B8X A;  3GUR A;  3F6F A;  1NSW A;  4XTS A;  4PNG A;  1SK1 A;  4KE3 A;  1Y6E A;  3C7M A;  4ULX A;  2GS3 A;  2DSA A;  5HFI A;  2A4V A;  2H73 A;  1Z9H A;  3GRX A;  13GS A;  5L71 A;  1GSF A;  3IV4 A;  4OO4 A;  2B1K A;  3TRQ A;  3O76 A;  4Z2U A;  4N0Z A;  2DJ3 A;  4MJA A;  1SD9 A;  1FB0 A;  4I2U A;  1T3B A;  3FKF A;  1I5G A;  2DJJ A;  4Z2R A;  3MWH A;  1FVJ A;  4KND A;  1NHY A;  5AIX A;  2PER A;  4OD7 A;  2JZS A;  2GQK A;  2GSQ A;  1A2M A;  1JZD A;  1SKW B;  3F3Q A;  4OCE A;  1IYI A;  4O92 A;  4MMM A;  2XBI A;  4NPB A;  1YEX A;  2KOK A;  5AN1 A;  5F0G A;  3LSZ A;  1EEJ A;  5GZZ B;  3ME7 A;  4MH2 A;  1FB6 A;  4PGT A;  4F0B A;  3QR6 A;  4TXV A;  1BYE A;  1XWG A;  2G0F A;  4XS6 A;  2BTO T;  3L9V A;  3GL5 A;  4N10 A;  2N5B A;  1ACV A;  2JZT A;  4IHU A;  1SJI A;  4POK A;  2IMF A;  1JFU A;  3P2A A;  1GSU A;  2LST A;  2PVQ A;  1URM A;  5IPG A;  2PWJ A;  1GSY A;  3CSJ A;  3GX0 A;  3KCM A;  4ZB9 A;  4I5Q A;  3IRA A;  4LLR A;  2MMZ A;  4AGS A;  2PVO C;  2TRX A;  3UEM A;  1PX6 A;  5C04 A;  3WYW A;  1MDJ A;  3IE3 A;  3KTB A;  1WRY A;  2FNO A;  1V58 A;  1OC8 A;  2M46 A;  4AJ8 A;  4IBP A;  2YJH A;  4IJ3 A;  4G19 A;  1BJX A;  4MPG A;  4POB A;  1Z6M A;  1QK8 A;  3VFI A;  3M0F A;  1GSE A;  3E0U A;  1PL2 A;  3DKS A;  3O6T A;  3UVH A;  1ZYQ B;  1ON4 A;  2XC2 A;  1HNA A;  2H1A A;  4EUY A;  2RM6 A;  5DAL A;  2L6C A;  4ZXG A;  2VUP A;  3IXR A;  4RI6 A;  5IO0 A;  5B8A A;  4ZBA A;  4BL7 A;  5CO3 A;  4X0X A;  2KP2 A;  1XOA A;  22GS A;  1DUG A;  4DSR A;  3ZML A;  2VD0 A;  1PX7 A;  2UZ8 A;  5D9W A;  1LBK A;  4MA9 A;  5ELA A;  3KZQ A;  2H1D A;  2C3T A;  5CRG A;  1GP1 A;  4GXZ A;  1F6M C;  1M7T A;  3L0H A;  2EIO A;  2HFD A;  3CBU A;  1EGR A;  3UOM A;  4G9H A;  4HZ2 A;  3LFL A;  4KH7 A;  5EVO A;  2JSZ A;  1UA5 A;  1XOB A;  1CQH A;  3J7Y b;  2B5X A;  2N5A A;  2LUS A;  4HJM A;  4IN0 A;  1V2A A;  1DSB A;  4TVE A;  4CY6 A;  4RI7 A;  3TKS A;  4K7O A;  3VUR A;  5HR2 A;  3K8N A;  1KTE A;  2B1L A;  1B48 A;  1PKW A;  1JZW A;  3F3R A;  4PXO A;  3UJ1 A;  4CY8 A;  2C8U A;  3RHC A;  2LQQ A;  4MAB A;  4POM A;  2OBK A;  1SEN A;  4F9Z A;  4X1U A;  3UIW A;  1TXX A;  1ZCP A;  3MYD A;  2KHP A;  3QFA C;  5FT3 A;  1ML6 A;  3DWV A;  2KUC A;  2H6X A;  4DSQ A;  3KD0 A;  4MF5 A;  3KEB A;  3IHG A;  4BVX A;  2P5R A;  3FZ4 A;  2F3M A;  3L4N A;  3HDC A;  1BX9 A;  4IJI A;  1V98 A;  4K5S A;  1O8X A;  4ZIJ A;  2DKI A;  2OBI A;  2YNX A;  1M2D A;  5ECL B;  2YPM A;  3QMX A;  2VL2 C;  3TKS E;  3LEF A;  2K18 A;  1U3A A;  5BRT A;  2R0C A;  3SWL A;  5IOX A;  4HI7 A;  4L0W A;  5FHI A;  3UAP A;  5DJL A;  4ZL9 A;  4FQU A;  2LV3 A;  3DYR A;  2YWM A;  4MJE A;  2ES7 A;  1XBS A;  2VLT A;  1MD4 A;  5LCZ A;  5HFK A;  4F2I A;  5KOX A;  3LJR A;  3HCZ A;  2YZU A;  2IFQ A;  1K0A A;  3GMF A;  1HNC A;  4OMV A;  4CDO A;  2VCW A;  12GS A;  3FY7 A;  3EC3 A;  2B5Y A;  3PIN A;  1FHE A;  1GNE A;  2VO4 A;  2V1M A;  4TOP A;  3JCM L;  2AUV A;  2VOC A;  1PN0 A;  1O6J A;  1MDK A;  1DBY A;  4GQF A;  1SL2 B;  1ILO A;  1QMV A;  4HQS A;  2TRC P;  3EYT A;  3WT1 A;  4KCE A;  4OCF A;  4K2D A;  3FZ9 A;  2IIY A;  2CAI A;  5DAK A;  2KP1 A;  4JED A;  1UN2 A;  1K3O A;  2FA8 A;  4MLY A;  2YP6 A;  6GSW A;  2H1B A;  4IEL A;  2LEG A;  4LMW A;  2RUE A;  1TI3 A;  5ABR A;  3TKP A;  2LRC A;  2GTU A;  1SYR A;  2LRT A;  1EV4 A;  5A4U A;  3F4T A;  3LXT A;  1ERT A;  2HXK A;  3RPN A;  2HNL A;  2VM1 A;  1GTA A;  1Y25 A;  2DJ2 A;  3RHB A;  1JZR A;  4XS4 B;  5KN3 A;  2GSR A;  1GUL A;  2BMX A;  1N8J A;  1B9Y C;  2YCD A;  3ZZX A;  1PD2 1;  1F3B A;  3TKS C;  19GS A;  3LG6 A;  3ZL5 A;  3VI7 A;  3NOF A;  3VWU A;  3C8E A;  1SK2 A;  1O81 A;  4KDX A;  4BL7 B;  2P31 A;  5G1K A;  1S3C A;  2LS5 A;  4HOJ A;  2E2M A;  4K7I A;  3C73 A;  2HZF A;  2DKH A;  2PPT A;  3R3E A;  3CSI A;  5ECO B;  2BJX A;  3ZFL A;  3IC8 A;  4D73 B;  1TW9 A;  1JZO A;  2EIQ A;  2X4A A;  5IIZ A;  3GL3 A;  3QAG A;  3N9J A;  2EIR A;  4YQU A;  3FYG A;  1ZOF A;  2JU5 A;  1U3I A;  1EZK A;  1AQV A;  4HEA 2;  5A4W A;  2I4A A;  1A8Y A;  1PRX A;  4G10 A;  3ISO A;  1FG4 A;  2QA2 A;  4EO3 A;  2FWF A;  1X9W B;  4BVY A;  1TU7 A;  2OJL A;  2WZ9 A;  2H1G A;  3GNJ A;  3VPT A;  4ZBD A;  3NIV A;  1U6T A;  1WMJ A;  2K8S A;  2E7P A;  1RW1 A;  4PTS A;  2YZH A;  3G7J A;  4RUV A;  1NM3 A;  5FWG A;  4YAP A;  3TOU A;  1S3D A;  2ZUP A;  3U5R E;  2MMN A;  3M3M A;  1ZZY A;  1OVN A;  3NZN A;  5ID2 B;  1XZO A;  1TRU A;  3BBY A;  1V57 A;  3PH9 A;  5EPF A;  2VL9 A;  3Q6O A;  4XRD A;  4Z2T A;  2ZCT A;  2OAD A;  2IL3 A;  1AAZ A;  4GF0 A;  3ZRD A;  3TRX A;  1OC3 A;  2QSI A;  4LA1 A;  3BJ5 A;  1PL1 A;  2OKA A;  3TDG A;  3D0Z A;  1MTC A;  2VCZ A;  3ERG A;  3GFK A;  2FA4 A;  3MDK A;  3HVV A;  1B4P A;  1Z6N A;  1UVZ A;  1USB A;  3EIN A;  1GUM A;  3KXO A;  2WS2 A;  4YKG A;  4MPF A;  2WUL A;  1OC9 A;  4N0V A;  3VWV A;  4FH8 A;  1ZL9 A;  5E4W A;  2F9S A;  3D21 A;  1XW5 A;  4BWS A;  1M9B A;  3L9U A;  2A2R A;  2C1Y A;  1X9M B;  5H5S A;  2I9H A;  3EWL A;  4O32 A;  1XW6 A;  3TJK A;  4ECB A;  1PMT A;  1V40 A;  2YWI A;  4HS1 A;  2IFQ B;  5EY6 A;  4MJC A;  2VIM A;  5ECH B;  1PQN A;  1ZGN A;  1YJ6 A;  4Q5N A;  1GSS A;  1AUC A;  2WCI A;  5HR0 A;  3RBT A;  5CRH A;  4POL A;  4MDC A;  1QQ2 A;  4K7N A;  4KDU A;  3C1R A;  3RPP A;  3GV1 A;  4USS A;  1ZYN A;  3J7Y k;  1K0N A;  1TK8 B;  3M9J A;  1OYJ A;  3UMA A;  2VCV A;  4G0L A;  4KSO A;  1TP9 A;  2YJ7 A;  3IC4 A;  2DBC A;  2DJ1 A;  5D8I A;  2LTK A;  2FWH A;  2HT9 A;  3F8U A;  2CV4 A;  1EOG A;  3RAZ A;  4K0G A;  1TDI A;  3DML A;  1TRV A;  2GDR A;  3A3T A;  4KX4 A;  2AYT A;  3IR4 A;  2AHE A;  5CNW A;  1B9X C;  5CAX A;  3AY8 A;  5A5K A;  4TR0 A;  3KP9 A;  2GQL A;  2WFC A;  2XPE A;  1K0B A;  1HQO A;  3FRC A;  1HNB A;  1SL0 B;  3EPT A;  3ZTL A;  3IAS 2;  1YDK A;  3ME8 A;  2LKU A;  3HVS A;  4K9Z A;  2JL4 A;  4KCA A;  2VL2 A;  4I6X A;  1EOH A;  4KGI A;  5INY A;  4MF6 A;  2XHF A;  1ABA A;  2H71 A;  3DXB A;  1TRS A;  2V41 A;  4ZB8 A;  1C72 A;  4G0K A;  4K8M A;  1TI1 A;  2NVL A;  2IME A;  4MP4 A;  1Q98 A;  3BD2 A;  4NWY A;  1XXU A;  5JWR B;  5CRD A;  1S3A A;  2YN1 A;  1MEK A;  3GSS A;  3IHQ A;  1ERW A;  3GN3 A;  2PUK C;  2L4C A;  1ZYP A;  2ON7 A;  5ECM B;  2VCQ A;  3IPZ A;  4TXO A;  5KEJ A;  2V6O A;  1RK4 A;  1R5A A;  3F4R A;  3IK7 A;  17GS A;  3VWW A;  3PGT A;  1WJK A;  3APO A;  4OWY A;  5ECN B;  2PN8 A;  2CQ9 A;  4GQC A;  3D4M A;  1XWC A;  3TJG A;  1KEB A;  3L78 A;  2WRT A;  3HZ8 A;  3GUS A;  1K3L A;  3A2X A;  4ZB6 A;  4WR5 A;  2C0E A;  1F37 A;  1F2E A;  1K0M A;  3QDN A;  1SJ6 A;  3HJM A;  2B6M A;  3P7X A;  2MZC A;  3ZFB A;  3Q74 A;  3DGQ A;  2OE1 A;  3EU4 A;  4TR1 B;  4L5O A;  1YKC A;  5IMD A;  3CSH A;  5KN0 A;  3QOU A;  4PQH A;  4YKF A;  4L0U A;  3BCI A;  3CTG A;  3ZLP A;  4GSN A;  4HZ4 A;  5IMC A;  1NW2 A;  3FMW A;  4XCS A;  4GSS A;  2I1U A;  4YAV A;  5G31 A;  3LXZ A;  3Q19 A;  6GSS A;  2DC5 A;  3VK9 A;  16GS A;  5KN2 A;  5JCG A;  4OFM A;  3QPM A;  3Q18 A;  2C0D A;  2HRN A;  2V2G A;  2KLX A;  4X43 A;  1ZYE A;  2B7K A;  4PUA A;  6GSY A;  5B6M A;  1OE7 A;  4JE1 A;  1GLQ A;  4YQV A;  4FYU A;  4DSS A;  1FW1 A;  3GKM A;  4CHS A;  2GT5 A;  3A2V A;  2V6K A;  5DQY A;  5IOW A;  1SKR B;  2GT6 A;  2L4Q A;  4V2M A;  1VF2 A;  4WF5 A;  1EP8 A;  3C1S A;  5GSS A;  1XIY A;  1TKD B;  2VL3 A;  2B7J A;  2HYX A;  1M0U A;  3GIX A;  2CAQ A;  3EE2 A;  5ECK B;  1GLP A;  3LGC A;  3UBL A;  3UL3 A;  4O5Q A;  2FHE A;  5ECS A;  1Z7P A;  2HRF A;  4X4J A;  5HR1 A;  2JZR A;  2D2Z A;  4TRX A;  1OKT A;  4ID0 A;  2B3S A;  1SYX A;  3D5J A;  2HI7 A;  5IPH A;  4JR6 A;  2X8H A;  4E8H A;  2F8F A;  3OR5 A;  3MAK A;  3G9B A;  3HD5 A;  2H6Y A;  2NBS A;  2V32 A;  4NXI A;  4K1F A;  1PKZ A;  2H0I A;  5LNK e;  5F07 A;  2FCH A;  3H79 A;  4AF2 A;  3A5W A;  2H66 A;  2LNS A;  4WET A;  2J9H A;  5G5F A;  4OFT A;  2H01 A;  2GSS A;  1OKD A;  4IQ1 A;  2R0P A;  5ECR B;  5ECI B;  3E9J B;  4WEY A;  4ISD A;  3GKN A;  1AW9 A;  3GYK A;  5J9B A;  1TTZ A;  3HZ4 A;  2L5L A;  5D9X A;  1T00 A;  2L57 A;  2H70 A;  5IM9 A;  1WP0 A;  3I6A A;  2O85 A;  5B7C A;  1WE0 A;  2WGR A;  3MSZ A;  5KOW A;  2GZP A;  1F9M A;  3KMN A;  2JAD A;  3R2Q A;  2H72 A;  1YF1 A;  1WIK A;  4MNN A;  3TJF A;  3APS A;  5F05 A;  2VD1 A;  5ENU A;  2VAF A;  3GH6 A;  4K2X A;  3M1G A;  3EMP A;  1EEM A;  3G7I A;  4FO5 A;  4TXO B;  1XVW A;  3ZMK A;  3QAV A;  1YKA A;  1E6B A;  2IN3 A;  4IQA A;  3VWX A;  2XBQ A;  3HXS A;  1KBN A;  1VGL A;  1CQG A;  1TOF A;  1H4O A;  3IBH A;  3H93 A;  4MJB A;  5DAL B;  2HLS A;  2L6D A;  2EC4 A;  4KW6 A;  5G5E A;  4L5L A;  4QQ7 A;  3DEX A;  5IQY A;  3O3T A;  2CVB A;  2A4H A;  2HSM A;  2IMD A;  2R3X A;  4EIP A;  2GST A;  2LQO A;  3KTL A;  1GUH A;  3HJP A;  4NV2 A;  4XIH A;  1FOV A;  5J3R A;  4WBR D;  3CTF A;  3LW9 A;  1THO A;  4XHM A;  4K5R A;  3QCP A;  3D6I A;  2HZE A;  2OAC A;  3HYP A;  4ACS A;  2VLV A;  2C3Q A;  3KIJ A;  4TW5 A;  1GSQ A;  4HUA A;  4O5R A;  2NDO A;  3GTU A;  3A2W A;  4MZC A;  3FW2 A;  4MZW A;  2FWE A;  2A2P A;  1AQX A;  5JWQ B;  1SU9 A;  3E3E A;  2YV7 A;  2AV4 A;  4EC0 A;  1X5C A;  1U88 A;  4OO5 A;  2CA8 A;  5IMV A;  3QAW A;  2H30 A;  5DCG A;  2X8G A;  2J23 A;  4PQI A;  4KDY A;  1KNG A;  1XPV A;  4AJ6 A;  4BWQ A;  2C80 A;  2IJY A;  2MMO A;  4KF9 A;  2YWN A;  1XWA A;  3M8N A;  3PPU A;  7GSS A;  4N11 A;  2I81 A;  5DVB A;  3LOR A;  5GAN D;  4JZQ A;  3QD9 A;  2Z9S A;  1FAA A;  1W4V A;  5AIS A;  2IMK A;  4CW9 A;  3CMI A;  4EXJ A;  2WB9 A;  4ECI A;  2DJK A;  1EV9 A;  2P5Q A;  5EL8 A;  4I8B A;  2L59 A;  1GTI A;  1DE2 A;  5HFG A;  1XCC A;  4BVX B;  1JLV A;  5DCH A;  1ZMA A;  4ICY A;  5DQS A;  5DDL A;  1A2J A;  1J0F A;  1GUK A;  3CXG A;  6GSX A;  4TR3 A;  1OE8 A;  3KH7 A;  1GTU A;  3LWA A;  2P0G A;  4I2T A;  5B8B A;  4ILF A;  4H86 A;  1YY7 A;  2YV9 A;  1SL1 B;  1SK0 A;  2GZZ A;  1H75 A;  2H0G A;  5J9C A;  2YOI A;  4EDY A;  1AXD A;  3FR3 A;  3ERF A;  3BCK A;  4MK3 A;  2MBS A;  2IWT A;  3TUE A;  2K6V A;  4LMV A;  1X5E A;  2QA1 A;  3EMX A;  3UBK A;  5KN1 A;  1T1V A;  2O89 A;  2FD3 A;  1PGT A;  1ERV A;  1TK0 B;  1X5D A;  3HY2 A;  1N2A A;  2R4V A;  4I97 A;  4EF0 A;  4QL7 A;  4MH3 A;  1FVK A;  2GQM A;  1M2B A;  1ERU A;  2HRK A;  1M99 A;  4KSM A;  1QFN A;  2F51 A;  5D96 A;  2L5O A;  4WXT A;  3HA9 A;  2O7K A;  1R5P A;  2PBJ A;  2C0G A;  2VCX A;  8GSS A;  4F0C A;  3ZRE A;  1THX A;  3UAR A;  4ECC A;  1R7H A;  4NV5 A;  2OE3 A;  2IMI A;  5DAK B;  1B4Q A;  4GWR A;  5ECP B;  2LJK A;  4MCU A;  3CRT A;  1J08 A;  3BOA A;  2K8V A;  4XS1 A;  5H5Q A;  1QUW A;  2M80 A;  3I69 A;  2MBT A;  4P3Y B;  3P90 A;  1QGV A;  3IAM 2;  3F9U A;  1IYH A;  4Z7X A;  1A23 A;  2H8L A;  3KGK A;  4ZBB A;  1Z5Y E;  1DE1 A;  4ZL7 A;  3IA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...