5ID2A

Asymmetry in the active site of mycobacterium tuberculosis ahpe upon exposure to mycothiol
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
154
structure length
153
Chain Sequence
VMLNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGIQGELDQLRDHLPEFENDDSAALAISVGPPPTHKIWATQSGFTFPLLSDFWPHGAVSQAYGVFNEQAGIANRGTFVVDRSGIIRFAEMKQPGEVRDQRLWTDALAALTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative peroxiredoxin Rv2238c
publication title Redox chemistry of Mycobacterium tuberculosis alkylhydroperoxide reductase E (AhpE): Structural and mechanistic insight into a mycoredoxin-1 independent reductive pathway of AhpE via mycothiol
pubmed doi rcsb
source organism Mycobacterium tuberculosis h37rv
total genus 49
structure length 153
sequence length 154
chains with identical sequence D
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2016-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5id2A00
1SKRB 1XXUA 2DJJA 3W8SA 2P31A 4EO3A 1EEMA 1BJXA 3KZQA 3DIEA 3IK7A 1RW1A 4KDXA 4K9ZA 3QAVA 2YWIA 3RPPA 4ZBDA 2HYXA 1TRUA 2XC2A 1OE8A 3ERWA 1EV9A 1T4YA 1BEDA 3HHVA 4HUAA 2KUCA 2L5OA 2GSTA 5DVBA 1O81A 2NTOA 3QFAC 1S3AA 1XCCA 1B9XC 3FZ4A 1EOGA 2LV3A 3LFLA 1DUGA 3GSTA 1T3BA 5ECHB 2FY6A 1AW9A 3IBHA 1K3LA 4ACSA 3PINA 3CSIA 5HR2A 3P90A 2KHPA 1E2YA 2H66A 4AJ8A 2H0IA 5B8AA 4XCSA 1Y25A 1KEBA 2DBCA 5B6MA 3DXBA 1OC9A 2L4QA 1W4VA 3LG6A 3HD5A 2GQMA 4NHZA 2YN1A 1TW9A 2N5FA 3F3QA 4LMWA 1GTAA 3CTGA 3L78A 2X8GA 3BBYA 6GSTA 4ML6A 2L6DA 4F0BA 2VL9A 3OR5A 5DAKA 4MZCA 1PX7A 1JHBA 1DSBA 4FIWA 5IO0A 3M9KA 2YCDA 3O76A 4EE0A 3KIJA 3CRTA 2JZSA 2R4VA 5HFIA 5HQPA 3H1NA 2C3QA 1U87A 4MCUA 4RUVA 2V6KA 6GSXA 4JE1A 5DQYA 3PH9A 3MAKA 4WETA 2WB9A 4NXIA 4EXJA 5G5EA 1AQVA 2C0GA 1F37A 3VWXA 5HR1A 1GULA 2B5EA 4MMMA 1GTUA 4ZXGA 4ZB9A 1X9WB 4PQIA 5F8BA 3EC3A 2PGTA 3GRXA 3HY2A 1EGOA 3WGEA 3CSHA 4KE3A 4F2IA 2CZ2A 4KSOA 3FEUA 5GAND 5CRDA 2RLIA 3VURA 1YY7A 1E6BA 2VAFA 3GL3A 2XHFA 4OO5A 4KCEA 3GA4A 4G2EA 1VF1A 4GTUA 2VIMA 2FWEA 4AGSA 1TK5B 4LL4B 1YKCA 5CAXA 18GSA 3RAZA 4KDUA 1A23A 2DC5A 1XOAA 5CRGA 4XS6A 3CYNA 1CQGA 3ZTLA 4TOPA 2R37A 2H6ZA 5FHIA 3EU3A 3LSZA 5ECPB 1K0AA 3IRAA 3I9V2 3D22A 4KAEA 2YP6A 3KP9A 2GT5A 1KNGA 2CVDA 1GSUA 2YPMA 1VF2A 3FKFA 1GTIA 16GSA 2XPEA 4TR1A 2HZEB 3TJFA 4E8HA 3ZVJD 4FH8A 1URMA 4POBA 5DDLA 4MZWA 5G5FA 5G31A 1ML6A 3GN3A 2HLSA 4ZBAA 2FGXA 2LRTA 2OADA 1A0FA 2X8CA 5H5RA 2GTUA 2K8SA 2N5AA 3G7YA 4CW9A 4G9HA 2AUVA 4V2NA 4TRXA 3DRNA 1O8WA 4HU9A 3KD0A 4OCEA 1M7TA 3ZVJA 1JZWA 2IJYA 3FW2A 2J23A 4K2DA 3IHQA 3EMPA 5KN3A 1XIYA 2DIZA 1VGLA 3FR9A 1B8XA 4QQ7A 1V57A 1F3AA 2H72A 2EIRA 1OKDA 4NPBA 2GSQA 1LJRA 4K7OA 2GZYA 4WR5A 1V98A 2OACA 1SKSB 5JWRB 5G1LA 3GNJA 5AGYA 1B9YC 4ML1A 3A2WA 4EDZA 3WT1A 1AQWA 1R26A 3DGQA 2HXKA 3HZ8A 3HYPA 1F6MC 3VWVA 4MABA 4IQAA 3ZIJA 1M2AA 4PGTA 3FZ5A 2N5BA 2V2GA 4TR0A 2G2QA 1QMVA 4V2MA 3BD2A 2WJUA 2TRXA 2KOKA 3KEBA 4JBBA 3HJMA 3KTBA 4V1Ag 2MMNA 4LLRA 3H8QA 3D6IA 1GSSA 2E2GA 3CBUA 4L5LA 1ZCPA 2QKEA 4N11A 3US3A 1RQMA 1PN9A 3IAS2 3C7MA 4GXZA 2K9FA 5F05A 7GSSA 1WE0A 1OC3A 3L9VA 2LUSA 1T4ZA 4NWYA 4Q5NA 1YZXA 1M2DA 1ZYEA 1K0CA 1FAAA 4HS1A 4MA9A 1JZOA 5IPHA 6GSYA 2VCTA 3KH9A 2LJKA 4NMUA 1HQOA 2YV9A 3A2VA 2F8FA 1GUMA 5D8IA 5E59A 3IDVA 2F51A 1O6JA 5AISA 1TU7A 2PVQA 2K8VA 5IOXA 2WFCA 2A2SA 3KMNA 2R6KA 4KNDA 2O87A 4GQCA 3Q6OA 2BTOT 5D73A 4Q5RA 1X5DA 3TJJA 3L4NA 2IIYA 1WP0A 2DJ0A 3HVSA 4O32A 2Z9SA 2PERA 2YWMA 4N0VA 4IKHA 2I81A 1AIUA 1PA3A 2LQOA 5C04A 4KGIA 3P8WA 5GSSA 3LWAA 2WZ9A 4HJMA 2H74A 4GSSA 1G6YA 4MH3A 3QOUA 3GHAA 3LGCA 2VCVA 3P2AA 2HI7A 2B5XA 3DVXA 3R2QA 2C0DA 2C4JA 4I6XA 2YZUA 3AY8A 4D73A 3LYPA 2MBTA 4CDOA 5DJLA 3VI7A 4I5QA 3TGZA 4F9ZA 4HU7A 1A8YA 3QMXA 5IMVA 5D9XA 2C80A 3D4MA 3TKSA 4WKWA 2ZUPA 4GWRA 3LORA 1XWGA 3NZNA 5ECKB 1QUWA 3ZLPA 2H8LA 3FY7A 3IAM2 3V1WA 2AHEA 1SJIA 1K0MA 3F6FA 5G2ZA 1TXXA 2VD1A 4YQVA 1SJZA 5IO2A 4CHSA 4DSQA 2X99A 2CX3A 2KP2A 2P0GA 4N0ZA 5ENUA 2NPBA 3EU4A 5COHA 1A2JA 3M1GA 5AN1A 1A8LA 4HOJA 2ON5A 1AAZA 1TRVA 2LJAA 1SL1B 2FA8A 3TCOA 1SYRA 3TJGA 1YF0A 3K8NA 1PX6A 1TP9A 1XWCA 3GTUA 2X8HA 2CA8A 3GKKA 5G1KA 5JWQB 3S9FA 5ECNB 3MWHA 2YANA 5ELAA 3TRXA 3GYKA 2MYGA 2OE3A 3N5OA 4EKZA 1ZL9A 1QFNA 3CXGA 4MP4A 2LS5A 5HR0A 3I69A 3UIWA 1O8XA 4PXOA 2DIYA 2H01A 1YEPA 2MZCA 1PL1A 3TJKA 2VL2A 1XWKA 3FHKA 3HA9A 1VF4A 1FVKA 1G6WA 4AJ7A 5INYA 5D9WA 2H75A 1C72A 4JRRA 4YQUA 5IMFA 3U6VA 4TN8A 4NV5A 4J56E 2WRTA 1OKTA 1WIKA 2REMA 4RI6A 2E2MA 2YZHA 3WGDA 4JR4A 5IIZA 4WR4A 4PQ1A 4MJAA 3F4RA 2AYTA 1Q98A 1ERWA 1XOBA 1U3IA 2B1LA 2LRNA 3LQ7A 2FWHA 1PMTA 2NVLA 4I97A 4MF7A 5FT3A 3ME7A 3EURA 1LU4A 4MK3A 2VLTA 2PMTA 2DJ2A 2PUKC 3CTFA 3GL5A 2O7KA 1SKWB 1NSWA 4HZ4A 2O89A 2O8VB 4G19A 4PX1A 3F0IA 2CAIA 2DLXA 4OMVA 1AC1A 2B3SA 2VCWA 4FYUA 1GSQA 4KCAA 3A5WA 4WBRD 3GH9A 3QCPA 1MDIA 4L8EA 1GP1A 1FOVA 2H70A 2XBIA 3M9JA 1HNBA 5KN1A 2HNLA 1M0UA 2FLSA 3TKSC 3O6TA 5L71A 1EP8A 1OYJA 1TU8A 4IHUA 1THXA 4ID0A 3UAPA 1A2LA 1ACVA 2AAWA 2HRNA 1ERVA 1SL2B 3IOSA 4I2UA 2J9HA 5J5NA 3EE2A 2IPAA 3IE3A 3O3TA 3QD9A 5DQSA 1BQ7A 3IXRA 1Y6EA 2GSSA 5DALB 2LTKA 4LL1B 4PNFA 3DEXA 2I4AA 1XBSA 1X5EA 1FB0A 3D5JA 4IJ3A 1EV4A 3MSZA 2B7KA 1H4OA 3VK9A 3UBLA 1UVZA 1XPVA 2VCQA 3FZAA 3FYGA 3TUEA 5GZZB 5J3RA 5IQYA 1FVJA 1F3BA 4J57E 2R3XA 1A2MA 2AV4A 1EZKA 5ECLB 2VL3A 2P5QA 2K6VA 1NM3A 2BJXA 14GSA 1LBKA 1GLPA 3RDWA 3CSJA 4GSTA 1V9WA 2QC7A 1TRSA 2HE3A 2B7JA 2VL2C 1YDKA 1U6TA 4GLTA 4JR6A 1U88A 3UARA 1Z6NA 4KH7A 2XBQA 5ECSA 5FWGA 5GSTA 6GSUA 3ISOA 4BWSA 1MEKA 3GFKA 2LRCA 4XS4B 5ECOB 2IL3A 1RK4A 1G0TA 1HNAA 3ERGA 4PNGA 2FCHA 5JCUA 3W6GA 5H5QA 4RI7A 2IFQB 4WF4A 3HVXA 1V40A 1FG4A 4O92A 2PBJA 4DSSA 1PQNA 4EDYA 1ON4A 4L0UA 8GSSA 3M3MA 3TOUA 1NHOA 2VOCA 1J0FA 2L4CA 1TKDB 2OBKA 4LMVA 4QL9A 1PRXA 4F0CA 4Z7XA 1GNEA 2LEGA 3GH6A 2PVOC 2F9SA 4IP1A 2IWTA 2GLRA 1XVWA 1GLQA 19GSA 3TKRA 4DEJA 5ID2B 2WGRA 1XW5A 2GDRA 4TXOA 4BPYA 2CVBA 3EINA 3LXTA 1MD4A 3HVVA 2D2ZA 2FHEA 3ERFA 1SK1A 4I2TA 2LJRA 4MPFA 4K0GA 13GSA 2IMEA 4QL7A 4EC0A 2XPDA 1K0OA 5H5SA 2L57A 1GTBA 1TTZA 2DMMA 2G0FA 4HDEA 4XIHA 3GKNA 1THOA 5B6NA 4HI7A 1Z5YE 1R5AA 5DBQA 3D0ZA 1XWBA 2WCIA 1T1VA 5LD0A 4GSNA 1R7HA 4GRFA 4MPGA 4RQRA 3DVWA 4IELA 3WYWA 2TIRA 3UL3A 1M9BA 5ABRA 4HQSA 1OC9B 2YV7A 3G7JA 2LNTA 3QAGA 3ZFLA 1PGTA 3DWVA 6GSVA 4L0WA 3CRUA 4ECBA 5CYYA 1M9AA 1WPIA 4X0XA 2OE1A 4MH2A 5DAKB 2DJ1A 2V6OA 1QK8A 3A3TA 2YWNA 4XRDA 3ZIVA 1EEJA 3E0UA 1ERUA 4YQMA 1GNWA 2CX4A 2OJLA 3SBCA 5A4UA 4E8EA 2DSAA 3NIVA 4OO4A 1GL8A 1F9MA 4IN0A 4ULXA 2PN8A 11GSA 1BYEA 2DMLA 6GSWA 1UA5A 2GGTA 3HJOA 2MMAA 5D93A 3KP8A 4KUNA 4J2FA 5F0GA 2JZTA 2OA7A 4MZBA 2GSRA 2RUEA 2H76A 1O73A 2F3MA 1GSDA 1GWCA 3G9BA 2H6XA 3ZL5A 4XRAA 5D9VA 3U5RE 1A24A 2IMFA 4V2LA 1SENA 1PSQA 2OBIA 1JFUA 3DYRA 5ECMB 1T7PB 2VUPA 2JU5A 2JSYA 2DJKA 4KDYA 1XVQA 3QR6A 3QDNA 4TW5A 1MDJA 3QFBC 1K0NA 2H0GA 1TI1A 5EPFA 3HJPA 2EIQA 2AJQB 2C8UA 3IK9A 3ZRDA 2WS2A 1ZZYA 1DE2A 1F2EA 3H93A 4PQHA 22GSA 2FWFA 5CP1A 1BG5A 2C0EA 4TR1B 4KW6A 4TR4A 1EP7A 1K0BA 4MJEA 2RIIA 5DCHA 1QQ2A 5A4VA 5IPGA 3EWLA 4BVXA 4DVCA 2CV4A 2M80A 4NHWA 2CAQA 1O85A 2HZEA 3PGTA 1ST9A 1SU9A 3ZMKA 4P3YB 2E7PA 4PUAA 2GVPA 1GUKA 3HKRA 5ECRB 4IVFA 2HSYA 1Z3EA 2YNXA 4XS1A 4ZL8A 3KXOA 3VWUA 1OC8A 4JEDA 5ELGA 1SYXA 1NHYA 2QSIA 1SK2A 1ILOA 2IN3A 1WJKA 4WEYA 3TJBA 3BJ5A 4KX4A 4GCIA 3WD6A 5JWOB 4F03A 3TB2A 1X5CA 1PD21 3HZ4A 3Q74A 3E3EA 4NV2A 1ABAA 2H30A 3A2XA 4I8BA 4POKA 1AXDA 2O85A 2RUFA 3RPNA 2YJ7A 2B5YA 5B7CA 1H75A 4K8MA 2ALBA 3GX0A 3VPTA 2GS3A 2I3YA 4DSRA 2NDOA 2F8AA 2V32A 3F6DA 5C00A 2MMZA 2JADA 1A0RP 1U3AA 3IR4A 2ZNMA 3CMIA 4K0NA 2H1GA 4RQXA 2H1DA 3DD3A 1YJ6A 2NBSA 1CQHA 4ZB8A 2M72A 1BX9A 1WWJA 3TKQA 1XZOA 1Z6MA 3GKXA 4AJ6A 4ZILA 2VCZA 20GSA 2HT9A 4BWQA 3FK8A 4HZ2A 3J7Yb 1XWAA 1YQ1A 1YF1A 4N30A 4OD7A 1FW1A 2I9HA 4GF0A 4HEA2 5EL8A 1YEXA 4XHMA 3ME8A 2MMOA 3F4SA 1XW6A 2OE0A 3C8EA 3J7Yk 2GZZA 1ZGNA 2H73A 4V1Ap 1S3CA 2GZPA 2HRFA 4O7HA 1K3OA 3TOTA 2MBSA 3APOA 1JLVA 2R5GA 1WMJA 2HSHA 3TDGA 3UBKA 3I43A 2L5LA 1S3DA 4EF0A 3Q18A 2FUG2 2VLVA 1IYHA 4H86A 4MJCA 2IMIA 1PL2A 1T8EB 1JLWA 2VD0A 3IC4A 4JZQA 1YKAA 3IV4A 1GH2A 1Z7RA 5DJMA 3IA1A 3RHBA 1MDKA 3N9JA 5CO3A 1Q4JA 3L9UA 4ZL7A 4GQFA 1W89A 1HYUA 5IMZA 3EMXA 4TKYA 4WF5A 1V2AA 3RHCA 4MJBA 2LNSA 1HD2A 1T00A 4D73B 2LSTA 2H0HA 2KP1A 1J9BA 1FB6A 2H6YA 1ZYQB 4OCFA 3LJRA 2ZCTA 1JZDA 4ECIA 4LA1A 4OFMA 2VM2A 5J9BA 3GKMA 1B48A 1XW9A 1K3YA 1I5GA 4OFTA 2IMKA 5IMAA 4N10A 2PU9C 3G7IA 3ZMLA 1FHEA 1XFLA 2FD3A 3GSSA 3VPQA 3KCMA 5GAPD 1VRSD 2VCXA 5JCGA 17GSA 3APSA 1QGVA 5CRWA 3LXZA 4IS0A 5HFKA 5CRHA 2HFDA 4BVYA 4KB3A 1X9SB 2WDUA 2E0QA 3E9JB 4IBPA 1SL0B 4TVEA 4K7NA 4EVMA 2FA4A 3KM6A 2LQQA 4TR3A 5AIXA 3VWWA 3GTUB 1JZRA 1M99A 3UOMA 4HJ2A 1Z9HA 5IMCA 1VF3A 3H79A 3MNGA 4K1FA 1TJDA 3QPMA 2FNOA 1TRWA 5HFGA 4MLYA 4FO5A 1BAYA 2I1UA 2B6MA 1SD9A 4K6XA 3EYTA 2H1BA 1PKZA 12GSA 1UN2A 3EVIA 3FRCA 2RM5A 4Q5FA 4ECJA 1GUHA 5IMDA 3GV1A 2VLUA 1N8JA 2GT6A 3D4TA 3TRPA 1IYIA 4OWYA 4YAPA 5IM9A 3C1RA 3D21A 2V41A 3DMLA 4X1UA 1EOHA 3C71A 3BCKA 5CNWA 1ZOFA 3W8JA 5DCGA 2L59A 1R4WA 4NAXA 1K0DA 3JCML 3TKSE 1GSYA 4ILFA 3IPZA 3H4KA 3GX8A 3PR8A 3KMOA 4KSMA 3WGXA 3C1SA 3P7XA 2CVKA 2HZFA 5F06A 1MTCA 3TKPA 3MDKA 3VI5A 5LNKe 3L0HA 4MF5A 5LCZA 3C73A 2GQKA 3F9UA 5HR3A 1G7EA 3FR6A 5J41A 5B8BA 2BMXA 4FYBA 5CREA 4BL7A 1GRXA 4MF6A 3FZ9A 1DBYA 1KTEA 1J08A 4ZB6A 3UVTA 3ZZXA 2V1MA 1WOUA 2YWOA 3NOFA 1SK0A 3F4TA 2KLXA 2ON7A 2JACA 2P5RA 1OE7A 3UVHA 3VFIA 2IMDA 3F63A 4EL1A 4BA7A 4MDCA 5G30A 2LKUA 2RM6A 5A5KA 5ECQB 3ZFBA 4IQ1A 2CQ9A 4F82A 2PPTA 1TOFA 4AF2A 2A4VA 1R5PA 3L9SA 5J9CA 2JZRA 2L6CA 4G10A 2X64A 4IJIA 3GIXA 3WT2A 5IOWA 3TRQA 1V58A 2B1KA 4XTSA 2M46A 3QAWA 1B4QA 5J4UA 3ED3A 2GQLA 3HXSA 3KGKA 4WXTA 4O5RA 3I6AA 5D96A 3HDCA 3ZITA 4POLA 3BOAA 2VO4A 4FYCA 5A4WA 5EVOA 2C3TA 2CT6A 3APQA 2A2RA 1QXHA 4Q5QA 2JSZA 4IP6A 1SD8A 1O7UA 3VLNA 2H19A 1N2AA 3UJ1A 1GSEA 2VM1A 3LYKA 5E4WA 1TDIA 5DALA 3GUSA 2FWGA 1G7OA 4POMA 3GMFA 4YH2A 1FO5A 5KEJA 3BCIA 4HQZA 5F07A 3UMAA 4ZBBA 2PWJA 1I9DA 10GSA 1AUCA 1OVNA 1WRYA 3ZREA 2JL4A 3M0FA 4EUYA 1B4PA 3RBTA 2EIOA 4PURA 5AIVA 1ZMAA 1X0RA 1AQXA 4L5OA 1GSFA 1X9MB 1TK8B 4YAVA 2C3NA 3M8NA 1TI3A 2EC4A 2K18A 5D9TA 4JU5A 2QGVA 1ERTA 9GSSA 3LEFA 1Z7PA 1M2BA 4TXVA 1TK0B 4ISDA 2DJ3A 2YJHA 1USBA 4XS4A 3HCZA 4K7IA 1UC7A 5EY6A 3KTLA 2ES7A 3F8UA 4DSSB 2C0FA 3GURA 2R2JA 5JCWA 3SWLA 2H1AA 1NW2A 2IFQA 3F3RA 1SJ6A 3ZYWA 1DE1A 2YOIA 4OFNA 1EGRA 2AB6A 5KN2A 5ECIB 4ZIJA 1OAZA 2CZ3A 2TRCP 4X43A 1EWXA 2WULA 4WBJA 3Q19A 3FR3A 2C1YA 3DKSA 4KA0A 4TXOB 4IGJA 1KBNA 6GSSA 3KJYA 1HNCA 3KH7A 1MD3A 2H71A 4IW9A 4PUFC 3UEMA 2OKAA 1PKWA 4ECCA 4ZL9A 5KN0A 5ID2A
chains in the Genus database with same CATH superfamily
1SKRB 1XXUA 2DJJA 3W8SA 2P31A 4EO3A 2DKIA 1EEMA 1BJXA 3KZQA 3DIEA 3IK7A 1RW1A 4KDXA 4K9ZA 3QAVA 2YWIA 3RPPA 4EIPA 4ZBDA 2HYXA 1TRUA 2XC2A 1OE8A 3ERWA 1EV9A 1T4YA 1BEDA 3HHVA 4HUAA 2KUCA 2L5OA 2GSTA 5DVBA 1O81A 2NTOA 3QFAC 1S3AA 1XCCA 1B9XC 3FZ4A 1EOGA 2LV3A 3LFLA 1DUGA 3GSTA 1T3BA 5ECHB 2FY6A 1AW9A 3IBHA 3MYDA 1K3LA 4ACSA 3PINA 3CSIA 5HR2A 3P90A 2KHPA 1E2YA 2H66A 4AJ8A 2H0IA 5B8AA 4XCSA 1Y25A 1KEBA 2DBCA 5B6MA 3DXBA 1OC9A 2L4QA 1W4VA 3LG6A 3HD5A 2GQMA 4NHZA 2YN1A 1TW9A 2N5FA 3F3QA 4LMWA 1GTAA 3CTGA 3L78A 2X8GA 3BBYA 6GSTA 4ML6A 2L6DA 4F0BA 2VL9A 3OR5A 5DAKA 4MZCA 1PX7A 1JHBA 1DSBA 4FIWA 5IO0A 3M9KA 2YCDA 3O76A 4EE0A 3KIJA 3CRTA 4X4JA 2JZSA 2R4VA 5HFIA 5HQPA 3H1NA 2C3QA 1U87A 4MCUA 4RUVA 2V6KA 6GSXA 4JE1A 5DQYA 3PH9A 3MAKA 4WETA 2WB9A 4NXIA 4EXJA 5G5EA 1AQVA 2C0GA 1F37A 3VWXA 5HR1A 1GULA 2B5EA 4MMMA 1GTUA 4ZXGA 4ZB9A 1X9WB 4PQIA 5F8BA 3EC3A 2PGTA 3GRXA 3HY2A 1EGOA 3WGEA 3CSHA 4KE3A 4F2IA 2CZ2A 4KSOA 3FEUA 5GAND 5CRDA 2RLIA 3VURA 1YY7A 1E6BA 2VAFA 3GL3A 2XHFA 4OO5A 4KCEA 3GA4A 4G2EA 1VF1A 4GTUA 2VIMA 2FWEA 4AGSA 1TK5B 4LL4B 1YKCA 5CAXA 18GSA 3RAZA 4KDUA 1A23A 2DC5A 4EIQA 1XOAA 5CRGA 4XS6A 3CYNA 1CQGA 3ZTLA 4TOPA 2R37A 2H6ZA 5FHIA 3EU3A 3LSZA 5ECPB 1K0AA 3IRAA 3I9V2 3D22A 4KAEA 2YP6A 3KP9A 2GT5A 1KNGA 4BVXB 2CVDA 1GSUA 2YPMA 1VF2A 3FKFA 1GTIA 16GSA 2XPEA 4TR1A 2HZEB 3TJFA 4E8HA 3ZVJD 4K5RA 4FH8A 1URMA 4POBA 5DDLA 4MZWA 5G5FA 5G31A 1ML6A 3GN3A 2HLSA 4ZBAA 2FGXA 2LRTA 2OADA 1A0FA 2X8CA 5H5RA 2GTUA 2K8SA 2N5AA 3G7YA 4CW9A 4G9HA 2AUVA 4V2NA 4TRXA 3DRNA 1O8WA 4HU9A 3KD0A 4OCEA 1M7TA 3ZVJA 1JZWA 2IJYA 3FW2A 2J23A 4K2DA 3IHQA 3EMPA 5KN3A 1XIYA 2DIZA 1VGLA 3FR9A 1B8XA 4QQ7A 1V57A 1F3AA 2H72A 2EIRA 1OKDA 4NPBA 2GSQA 1LJRA 4K7OA 2GZYA 4WR5A 1V98A 2OACA 1SKSB 5JWRB 5G1LA 3GNJA 5AGYA 1B9YC 4ML1A 3A2WA 4EDZA 3WT1A 4YKFA 1AQWA 1R26A 3DGQA 2HXKA 3HZ8A 3HYPA 1F6MC 3VWVA 4MABA 4IQAA 3ZIJA 1M2AA 4PGTA 3FZ5A 2N5BA 2V2GA 4TR0A 2G2QA 1QMVA 4V2MA 3BD2A 2WJUA 2TRXA 2X49A 2KOKA 3KEBA 4JBBA 3HJMA 3KTBA 4V1Ag 2MMNA 4LLRA 3H8QA 3D6IA 1GSSA 2E2GA 3CBUA 4L5LA 1ZCPA 2QKEA 4N11A 3US3A 4FQUA 1RQMA 1PN9A 3IAS2 3C7MA 4GXZA 2K9FA 5F05A 7GSSA 1WE0A 1OC3A 3L9VA 2LUSA 3LW9A 1T4ZA 4NWYA 4Q5NA 1YZXA 1M2DA 1ZYEA 1K0CA 1FAAA 4HS1A 4MA9A 1JZOA 5IPHA 6GSYA 2VCTA 3KH9A 2LJKA 4NMUA 1HQOA 2YV9A 3A2VA 2F8FA 1GUMA 5D8IA 5E59A 3IDVA 2F51A 1O6JA 5AISA 1TU7A 2PVQA 2K8VA 5IOXA 2WFCA 2A2SA 3KMNA 2R6KA 4KNDA 2O87A 4GQCA 3Q6OA 2BTOT 5D73A 4Q5RA 1X5DA 3TJJA 3L4NA 2IIYA 1WP0A 2DJ0A 3HVSA 4O32A 2Z9SA 2PERA 2YWMA 4N0VA 4IKHA 2I81A 1AIUA 1PA3A 2LQOA 5C04A 4KGIA 3P8WA 5GSSA 3LWAA 2WZ9A 4HJMA 2H74A 2X4AA 4GSSA 1G6YA 4MH3A 3QOUA 3GHAA 3HVNA 3LGCA 2VCVA 3P2AA 2HI7A 2UZ8A 2B5XA 4BIKA 3DVXA 2HRKA 3R2QA 2C0DA 2C4JA 4I6XA 2YZUA 3AY8A 4D73A 3LYPA 2MBTA 4CDOA 5DJLA 3VI7A 4I5QA 3TGZA 4F9ZA 4HU7A 1A8YA 3QMXA 5IMVA 5D9XA 2C80A 3D4MA 3TKSA 4WKWA 2ZUPA 4GWRA 3LORA 1XWGA 3NZNA 5ECKB 1QUWA 3ZLPA 2H8LA 3FY7A 3IAM2 3V1WA 2AHEA 1SJIA 1K0MA 3F6FA 4BVYB 5G2ZA 1TXXA 2VD1A 4YQVA 1SJZA 5IO2A 4CHSA 4DSQA 2X99A 2CX3A 2KP2A 2P0GA 4N0ZA 5ENUA 2NPBA 3EU4A 5COHA 1A2JA 3M1GA 5AN1A 1A8LA 4HOJA 2ON5A 1AAZA 1TRVA 2LJAA 1SL1B 2FA8A 3TCOA 1SYRA 3TJGA 4K5SA 1YF0A 3K8NA 1PX6A 1TP9A 1XWCA 3GTUA 2X8HA 2CA8A 3GKKA 5G1KA 5JWQB 3S9FA 3PPUA 5ECNB 3MWHA 2YANA 5ELAA 3TRXA 3GYKA 2MYGA 2OE3A 3N5OA 4EKZA 1ZL9A 1QFNA 3CXGA 4MP4A 2LS5A 5HR0A 3I69A 3UIWA 1O8XA 4PXOA 2DIYA 2H01A 1YEPA 2MZCA 4HSCX 1PL1A 3TJKA 2VL2A 1XWKA 3FHKA 3HA9A 1VF4A 1FVKA 1G6WA 4AJ7A 5INYA 5D9WA 2H75A 1C72A 4JRRA 4YQUA 5IMFA 3U6VA 4TN8A 4NV5A 4J56E 2WRTA 1OKTA 1WIKA 2REMA 4RI6A 2E2MA 2YZHA 3WGDA 4JR4A 5IIZA 4WR4A 4PQ1A 4MJAA 3F4RA 2AYTA 1Q98A 1ERWA 1XOBA 1U3IA 2B1LA 2LRNA 4BL7B 3LQ7A 2FWHA 1PMTA 2NVLA 4USSA 4I97A 4MF7A 5FT3A 3ME7A 3EURA 1LU4A 4Z2TA 4MK3A 2VLTA 2PMTA 2DJ2A 2PUKC 1M3IA 3CTFA 3GL5A 2O7KA 1SKWB 1NSWA 4HZ4A 2O89A 2O8VB 4G19A 4PX1A 3F0IA 2CAIA 5BMUA 2DLXA 4OMVA 1AC1A 2B3SA 2VCWA 4FYUA 1GSQA 4KCAA 3A5WA 4WBRD 3GH9A 3QCPA 1MDIA 4L8EA 1GP1A 1FOVA 2H70A 2XBIA 3M9JA 1HNBA 5KN1A 2HNLA 1M0UA 2FLSA 3TKSC 3O6TA 4MNNA 5L71A 1EP8A 1OYJA 1TU8A 1M3JA 4IHUA 1THXA 4ID0A 3UAPA 1A2LA 1ACVA 2AAWA 2HRNA 1ERVA 1SL2B 3IOSA 4I2UA 2J9HA 5J5NA 3EE2A 2IPAA 3IE3A 3O3TA 3QD9A 5DQSA 1BQ7A 3IXRA 1Y6EA 2GSSA 5DALB 2LTKA 4LL1B 4PNFA 3DEXA 2I4AA 1XBSA 1X5EA 1FB0A 3D5JA 4IJ3A 1EV4A 3MSZA 2B7KA 1H4OA 3IC8A 3VK9A 3UBLA 1UVZA 1XPVA 2VCQA 3FZAA 3FYGA 3TUEA 5GZZB 5J3RA 5IQYA 1FVJA 1F3BA 4J57E 2R3XA 1A2MA 2AV4A 1EZKA 2VL3A 5ECLB 2P5QA 2K6VA 1NM3A 2BJXA 14GSA 1LBKA 1GLPA 3RDWA 3CSJA 4GSTA 1V9WA 2QC7A 1TRSA 2HE3A 2B7JA 3CQFA 2VL2C 1YDKA 1U6TA 4GLTA 4CY6A 4JR6A 1U88A 3UARA 1Z6NA 4KH7A 2XBQA 5ECSA 5FWGA 5GSTA 6GSUA 3ISOA 4BWSA 1MEKA 3GFKA 2LRCA 4XS4B 5ECOB 2IL3A 1RK4A 1G0TA 1HNAA 3ERGA 4PNGA 2FCHA 5JCUA 1PN0A 3W6GA 5H5QA 4RI7A 2IFQB 4WF4A 3HVXA 1V40A 2QA2A 1FG4A 4O92A 2PBJA 4DSSA 1PQNA 4EDYA 1ON4A 4L0UA 8GSSA 3M3MA 3TOUA 1NHOA 2VOCA 1J0FA 2L4CA 1TKDB 2OBKA 4LMVA 4QL9A 1ZYPA 1PRXA 4F0CA 4Z7XA 1GNEA 2LEGA 3GH6A 2PVOC 2F9SA 4IP1A 2IWTA 2GLRA 1XVWA 1GLQA 19GSA 3TKRA 4DEJA 5ID2B 2WGRA 1XW5A 2GDRA 4TXOA 4BPYA 2CVBA 3EINA 3LXTA 1MD4A 3HVVA 2D2ZA 2FHEA 3ERFA 1SK1A 4I2TA 2LJRA 4MPFA 4K0GA 13GSA 2IMEA 4QL7A 4EC0A 2XPDA 1K0OA 5H5SA 2L57A 1GTBA 1TTZA 2DMMA 2G0FA 4HDEA 4XIHA 3GKNA 1THOA 5B6NA 4HI7A 1Z5YE 1R5AA 5DBQA 3D0ZA 1XWBA 2WCIA 1T1VA 5LD0A 4GSNA 1R7HA 4GRFA 4MPGA 4RQRA 3DVWA 3FMWA 4IELA 3WYWA 2TIRA 3UL3A 1M9BA 5ABRA 4HQSA 1OC9B 2YV7A 3G7JA 2LNTA 3QAGA 3ZFLA 1PGTA 3DWVA 6GSVA 4L0WA 3CRUA 4ECBA 5CYYA 1M9AA 1WPIA 4X0XA 2OE1A 4MH2A 5DAKB 2DJ1A 2V6OA 1QK8A 3A3TA 2YWNA 4XRDA 1XG8A 3ZIVA 1EEJA 3E0UA 1ERUA 4YQMA 1GNWA 2CX4A 2OJLA 3SBCA 5A4UA 4E8EA 2DSAA 3NIVA 4OO4A 1GL8A 1F9MA 4IN0A 4ULXA 2PN8A 11GSA 1BYEA 2DMLA 6GSWA 1UA5A 2GGTA 3HJOA 2MMAA 5D93A 3KP8A 4KUNA 1FOHA 4J2FA 5F0GA 2JZTA 2OA7A 4MZBA 2GSRA 2RUEA 2H76A 1O73A 2F3MA 1GSDA 1GWCA 3G9BA 2H6XA 3ZL5A 4XRAA 5D9VA 3U5RE 2HRAA 1A24A 2IMFA 4V2LA 1SENA 1PSQA 2OBIA 1JFUA 3DYRA 5ECMB 1T7PB 2VUPA 2JU5A 2JSYA 2DJKA 4KDYA 1XVQA 3QR6A 3QDNA 4TW5A 1MDJA 3QFBC 1K0NA 2H0GA 1TI1A 5KOWA 5EPFA 3HJPA 2EIQA 2AJQB 2C8UA 3IK9A 3ZRDA 2WS2A 2A2PA 1ZZYA 1DE2A 1F2EA 3H93A 4PQHA 22GSA 2FWFA 5CP1A 1BG5A 2C0EA 4TR1B 4KW6A 4TR4A 1EP7A 1K0BA 4MJEA 2RIIA 5DCHA 1QQ2A 5A4VA 5IPGA 3EWLA 4BVXA 4DVCA 2CV4A 2M80A 4NHWA 2CAQA 1O85A 2HZEA 3PGTA 1ST9A 1SU9A 3ZMKA 4KF9A 4P3YB 2E7PA 4PUAA 2GVPA 1GUKA 3HKRA 5ECRB 4IVFA 2HSYA 1Z3EA 2YNXA 4XS1A 4ZL8A 3KXOA 3VWUA 1OC8A 4JEDA 5ELGA 1SYXA 1NHYA 2QSIA 2A4HA 1SK2A 1ILOA 2IN3A 1WJKA 4WEYA 3TJBA 3BJ5A 4KX4A 4GCIA 3WD6A 5JWOB 4F03A 3TB2A 1X5CA 4PTSA 1PD21 3HZ4A 3Q74A 3E3EA 4NV2A 1ABAA 2H30A 3A2XA 4I8BA 4POKA 1AXDA 2O85A 2RUFA 3IHGA 3RPNA 2YJ7A 2B5YA 5B7CA 1H75A 4K8MA 2ALBA 3GX0A 3VPTA 2GS3A 2I3YA 4DSRA 2NDOA 2F8AA 2V32A 3F6DA 5C00A 2MMZA 2JADA 1A0RP 1U3AA 3IR4A 2ZNMA 3CMIA 4K0NA 2H1GA 4RQXA 2H1DA 3DD3A 1YJ6A 2NBSA 1CQHA 4ZB8A 2M72A 1BX9A 1WWJA 3TKQA 1XZOA 1Z6MA 3GKXA 4AJ6A 4ZILA 2VCZA 20GSA 2HT9A 4BWQA 3FK8A 4HZ2A 3J7Yb 1XWAA 1YQ1A 1YF1A 4N30A 4OD7A 1FW1A 2I9HA 4GF0A 4HEA2 5EL8A 1YEXA 4XHMA 3ME8A 2MMOA 3F4SA 1XW6A 2OE0A 3C8EA 3J7Yk 2GZZA 1ZGNA 2H73A 4V1Ap 1S3CA 2GZPA 2HRFA 4O7HA 1K3OA 3TOTA 2MBSA 3APOA 1JLVA 2R5GA 1WMJA 2HSHA 3TDGA 3UBKA 3I43A 2L5LA 3A5IA 1S3DA 4EF0A 3Q18A 2FUG2 2VLVA 1IYHA 4CY8A 4H86A 4MJCA 2IMIA 1PL2A 1T8EB 1JLWA 2VD0A 3IC4A 4JZQA 1YKAA 3IV4A 1GH2A 1Z7RA 5DJMA 3IA1A 3RHBA 4Z2RA 1MDKA 2HSMA 3N9JA 5CO3A 1Q4JA 3L9UA 4ZL7A 4GQFA 1W89A 1HYUA 5IMZA 3EMXA 4TKYA 4WF5A 1V2AA 3RHCA 1S3RA 4Z2UA 4MJBA 2LNSA 1HD2A 1T00A 4D73B 2LSTA 2H0HA 2KP1A 1J9BA 1FB6A 2H6YA 2QA1A 1ZYQB 4OCFA 3LJRA 2ZCTA 1JZDA 4ECIA 4LA1A 4OFMA 2VM2A 5J9BA 3GKMA 1B48A 1XW9A 1K3YA 1I5GA 4OFTA 2IMKA 5IMAA 4N10A 2PU9C 3G7IA 3ZMLA 1FHEA 1XFLA 2FD3A 3GSSA 3VPQA 3KCMA 5GAPD 1VRSD 2VCXA 5JCGA 17GSA 3APSA 1QGVA 5CRWA 3LXZA 4IS0A 5HFKA 5CRHA 3R3EA 2HFDA 4BVYA 4KB3A 1X9SB 2WDUA 2E0QA 3E9JB 4IBPA 1SL0B 4TVEA 4K7NA 4EVMA 2FA4A 3KM6A 2LQQA 4TR3A 5AIXA 3VWWA 3GTUB 1JZRA 1M99A 3UOMA 4HJ2A 1Z9HA 5IMCA 1VF3A 3H79A 3MNGA 4K1FA 4A5PA 1TJDA 3QPMA 2FNOA 1TRWA 5HFGA 4G0IA 2R0CA 4MLYA 4FO5A 1BAYA 2I1UA 2B6MA 1SD9A 4K6XA 3EYTA 1PFOA 2H1BA 1PKZA 12GSA 1UN2A 3EVIA 3FRCA 2RM5A 4Q5FA 4ECJA 1GUHA 4O5UA 5IMDA 3GV1A 2VLUA 1N8JA 2GT6A 3D4TA 3TRPA 1IYIA 4OWYA 4YAPA 5IM9A 3C1RA 3D21A 2V41A 3DMLA 4X1UA 1EOHA 3C71A 3BCKA 3EPTA 5CNWA 1ZOFA 3W8JA 5DCGA 2L59A 1R4WA 4NAXA 1K0DA 3JCML 3TKSE 1GSYA 4ILFA 3IPZA 4ICYA 5BRTA 3H4KA 3GX8A 3PR8A 3KMOA 4KSMA 3WGXA 3C1SA 3P7XA 2CVKA 2HZFA 5F06A 1MTCA 3TKPA 3MDKA 3VI5A 5LNKe 3L0HA 4MF5A 5LCZA 3C73A 2GQKA 3F9UA 5HR3A 1G7EA 3FR6A 5J41A 5B8BA 2BMXA 4FYBA 5CREA 4BL7A 1GRXA 4MF6A 3FZ9A 1DBYA 1KTEA 1J08A 4ZB6A 3UVTA 3ZZXA 2V1MA 1WOUA 2YWOA 3NOFA 1SK0A 3F4TA 2KLXA 2ON7A 2JACA 2P5RA 1OE7A 3UVHA 4K2XA 3VFIA 2IMDA 3F63A 4EL1A 4BA7A 4MDCA 5G30A 2LKUA 2RM6A 5A5KA 5ECQB 3ZFBA 4IQ1A 2CQ9A 4F82A 2PPTA 1TOFA 4AF2A 2A4VA 2R0GA 1R5PA 3L9SA 5J9CA 2JZRA 2L6CA 4G10A 2X64A 4IJIA 3MIXA 3GIXA 3WT2A 5IOWA 3TRQA 1V58A 2B1KA 4XTSA 2M46A 3QAWA 1B4QA 5J4UA 3ED3A 2GQLA 3HXSA 3KGKA 4WXTA 4O5RA 3I6AA 5D96A 3HDCA 3ZITA 4POLA 3BOAA 2VO4A 4FYCA 5A4WA 5EVOA 2C3TA 2CT6A 3APQA 4O5QA 2A2RA 1QXHA 4Q5QA 2JSZA 4IP6A 1SD8A 1O7UA 3VLNA 4YKGA 2H19A 1N2AA 3UJ1A 1GSEA 2VM1A 3LYKA 5E4WA 1TDIA 5DALA 3GUSA 2FWGA 1G7OA 4POMA 3GMFA 4YH2A 1FO5A 5KEJA 3BCIA 4HQZA 5F07A 3UMAA 4ZBBA 2PWJA 1I9DA 10GSA 1AUCA 1OVNA 1WRYA 3ZREA 2JL4A 3M0FA 4EUYA 1B4PA 3RBTA 2EIOA 4PURA 5AIVA 1ZMAA 1X0RA 1AQXA 4L5OA 1GSFA 1X9MB 1TK8B 4YAVA 2C3NA 3M8NA 1TI3A 2EC4A 2K18A 5D9TA 4JU5A 2QGVA 1ERTA 4G0LA 9GSSA 3LEFA 1Z7PA 1M2BA 4TXVA 1TK0B 4ISDA 2DJ3A 1ZYNA 2YJHA 1USBA 5KOXA 4XS4A 3HCZA 4K7IA 1UC7A 5EY6A 3KTLA 2ES7A 3F8UA 4DSSB 2C0FA 3GURA 2R2JA 5JCWA 3SWLA 2H1AA 1NW2A 2IFQA 3F3RA 1SJ6A 3ZYWA 1DE1A 2YOIA 4OFNA 1EGRA 2AB6A 5KN2A 5ECIB 4ZIJA 1OAZA 2CZ3A 2TRCP 4X43A 1EWXA 2WULA 4WBJA 3Q19A 3FR3A 2C1YA 3DKSA 2R0PA 4KA0A 4TXOB 4IGJA 1KBNA 2DKHA 6GSSA 3KJYA 1HNCA 3KH7A 1MD3A 2H71A 4IW9A 4PUFC 3UEMA 4G0KA 2OKAA 1PKWA 4ECCA 4ZL9A 5KN0A 5ID2A
chains in the Genus database with same CATH topology
1SKRB 1XXUA 2DJJA 3W8SA 2P31A 4EO3A 2DKIA 1EEMA 1BJXA 3KZQA 3DIEA 3IK7A 1RW1A 4KDXA 4K9ZA 3QAVA 2YWIA 3RPPA 4EIPA 4ZBDA 2HYXA 1TRUA 2XC2A 1OE8A 3ERWA 1EV9A 1T4YA 1BEDA 3HHVA 4HUAA 2KUCA 2L5OA 2GSTA 5DVBA 1O81A 2NTOA 3QFAC 1S3AA 1XCCA 1B9XC 3FZ4A 1EOGA 2LV3A 3LFLA 1DUGA 3GSTA 1T3BA 5ECHB 2FY6A 1AW9A 3IBHA 3MYDA 1K3LA 4ACSA 3PINA 3CSIA 5HR2A 3P90A 2KHPA 1E2YA 2H66A 4AJ8A 2H0IA 5B8AA 4XCSA 1Y25A 1KEBA 2DBCA 5B6MA 3DXBA 1OC9A 2L4QA 1W4VA 3LG6A 3HD5A 2GQMA 4NHZA 2YN1A 1TW9A 2N5FA 3F3QA 4LMWA 1GTAA 3CTGA 3L78A 2X8GA 3BBYA 6GSTA 4ML6A 2L6DA 4F0BA 2VL9A 3OR5A 5DAKA 4MZCA 1PX7A 1JHBA 1DSBA 4FIWA 5IO0A 3M9KA 2YCDA 3O76A 4EE0A 3KIJA 3CRTA 4X4JA 2JZSA 2R4VA 5HFIA 5HQPA 3H1NA 2C3QA 1U87A 4MCUA 4RUVA 2V6KA 6GSXA 4JE1A 5DQYA 3PH9A 3MAKA 4WETA 2WB9A 4NXIA 4EXJA 5G5EA 1AQVA 2C0GA 1F37A 3VWXA 5HR1A 1GULA 2B5EA 4MMMA 1GTUA 4ZXGA 4ZB9A 1X9WB 4PQIA 5F8BA 3EC3A 2PGTA 3GRXA 3HY2A 1EGOA 3WGEA 3CSHA 4KE3A 4F2IA 2CZ2A 4KSOA 3FEUA 5GAND 5CRDA 2RLIA 3VURA 1YY7A 1E6BA 2VAFA 3GL3A 2XHFA 4OO5A 4KCEA 3GA4A 4G2EA 1VF1A 4GTUA 2VIMA 2FWEA 4AGSA 1TK5B 4LL4B 1YKCA 5CAXA 18GSA 3RAZA 4KDUA 1A23A 2DC5A 4EIQA 1XOAA 5CRGA 4XS6A 3CYNA 1CQGA 3ZTLA 4TOPA 2R37A 2H6ZA 5FHIA 3EU3A 3LSZA 5ECPB 1K0AA 3IRAA 3I9V2 3D22A 4KAEA 2YP6A 3KP9A 2GT5A 1KNGA 4BVXB 2CVDA 1GSUA 2YPMA 1VF2A 3FKFA 1GTIA 16GSA 2XPEA 4TR1A 2HZEB 3TJFA 4E8HA 3ZVJD 4K5RA 4FH8A 1URMA 4POBA 5DDLA 4MZWA 5G5FA 5G31A 1ML6A 3GN3A 2HLSA 4ZBAA 2FGXA 2LRTA 2OADA 1A0FA 2X8CA 5H5RA 2GTUA 2K8SA 2N5AA 3G7YA 4CW9A 4G9HA 2AUVA 4V2NA 4TRXA 3DRNA 1O8WA 4HU9A 3KD0A 4OCEA 1M7TA 3ZVJA 1JZWA 2IJYA 3FW2A 2J23A 4K2DA 3IHQA 3EMPA 5KN3A 1XIYA 2DIZA 1VGLA 3FR9A 1B8XA 4QQ7A 1V57A 1F3AA 2H72A 2EIRA 1OKDA 4NPBA 2GSQA 1LJRA 4K7OA 2GZYA 4WR5A 1V98A 2OACA 1SKSB 5JWRB 5G1LA 3GNJA 5AGYA 1B9YC 4ML1A 3A2WA 4EDZA 3WT1A 4YKFA 1AQWA 1R26A 3DGQA 2HXKA 3HZ8A 3HYPA 1F6MC 3VWVA 4MABA 4IQAA 3ZIJA 1M2AA 4PGTA 3FZ5A 2N5BA 2V2GA 4TR0A 2G2QA 1QMVA 4V2MA 3BD2A 2WJUA 2TRXA 2X49A 2KOKA 3KEBA 4JBBA 3HJMA 3KTBA 4V1Ag 2MMNA 4LLRA 3H8QA 3D6IA 1GSSA 2E2GA 3CBUA 4L5LA 1ZCPA 2QKEA 4N11A 3US3A 4FQUA 1RQMA 1PN9A 3IAS2 3C7MA 4GXZA 2K9FA 5F05A 7GSSA 1WE0A 1OC3A 3L9VA 2LUSA 3LW9A 1T4ZA 4NWYA 4Q5NA 1YZXA 1M2DA 1ZYEA 1K0CA 1FAAA 4HS1A 4MA9A 1JZOA 5IPHA 6GSYA 2VCTA 3KH9A 2LJKA 4NMUA 1HQOA 2YV9A 3A2VA 2F8FA 1GUMA 5D8IA 5E59A 3IDVA 2F51A 1O6JA 5AISA 1TU7A 2PVQA 2K8VA 5IOXA 2WFCA 2A2SA 3KMNA 2R6KA 4KNDA 2O87A 4GQCA 3Q6OA 2BTOT 5D73A 4Q5RA 1X5DA 3TJJA 3L4NA 2IIYA 1WP0A 2DJ0A 3HVSA 4O32A 2Z9SA 2PERA 2YWMA 4N0VA 4IKHA 2I81A 1AIUA 1PA3A 2LQOA 5C04A 4KGIA 3P8WA 5GSSA 3LWAA 2WZ9A 4HJMA 2H74A 2X4AA 4GSSA 1G6YA 4MH3A 3QOUA 3GHAA 3LGCA 2VCVA 3P2AA 2HI7A 2UZ8A 2B5XA 3DVXA 2HRKA 3R2QA 2C0DA 2C4JA 4I6XA 2YZUA 3AY8A 4D73A 3LYPA 2MBTA 4CDOA 5DJLA 3VI7A 4I5QA 3TGZA 4F9ZA 4HU7A 1A8YA 3QMXA 5IMVA 5D9XA 2C80A 3D4MA 3TKSA 4WKWA 2ZUPA 4GWRA 3LORA 1XWGA 3NZNA 5ECKB 1QUWA 3ZLPA 2H8LA 3FY7A 3IAM2 3V1WA 2AHEA 1SJIA 1K0MA 3F6FA 4BVYB 5G2ZA 1TXXA 2VD1A 4YQVA 1SJZA 5IO2A 4CHSA 4DSQA 2X99A 2CX3A 2KP2A 2P0GA 4N0ZA 5ENUA 2NPBA 3EU4A 5COHA 1A2JA 3M1GA 5AN1A 1A8LA 4HOJA 2ON5A 1AAZA 1TRVA 2LJAA 1SL1B 2FA8A 3TCOA 1SYRA 3TJGA 4K5SA 1YF0A 3K8NA 1PX6A 1TP9A 1XWCA 3GTUA 2X8HA 2CA8A 3GKKA 5G1KA 5JWQB 3S9FA 3PPUA 5ECNB 3MWHA 2YANA 5ELAA 3TRXA 3GYKA 2MYGA 2OE3A 3N5OA 4EKZA 1ZL9A 1QFNA 3CXGA 4MP4A 2LS5A 5HR0A 3I69A 3UIWA 1O8XA 4PXOA 2DIYA 2H01A 1YEPA 2MZCA 1PL1A 3TJKA 2VL2A 1XWKA 3FHKA 3HA9A 1VF4A 1FVKA 1G6WA 4AJ7A 5INYA 5D9WA 2H75A 1C72A 4JRRA 4YQUA 5IMFA 3U6VA 4TN8A 4NV5A 4J56E 2WRTA 1OKTA 1WIKA 2REMA 4RI6A 2E2MA 2YZHA 3WGDA 4JR4A 5IIZA 4WR4A 4PQ1A 4MJAA 3F4RA 2AYTA 1Q98A 1ERWA 1XOBA 1U3IA 2B1LA 2LRNA 4BL7B 3LQ7A 2FWHA 1PMTA 2NVLA 4USSA 4I97A 4MF7A 5FT3A 3ME7A 3EURA 1LU4A 4Z2TA 4MK3A 2VLTA 2PMTA 2DJ2A 2PUKC 3CTFA 3GL5A 2O7KA 1SKWB 1NSWA 4HZ4A 2O89A 2O8VB 4G19A 4PX1A 3F0IA 2CAIA 5BMUA 2DLXA 4OMVA 1AC1A 2B3SA 2VCWA 4FYUA 1GSQA 4KCAA 3A5WA 4WBRD 3GH9A 3QCPA 1MDIA 4L8EA 1GP1A 1FOVA 2H70A 2XBIA 3M9JA 1HNBA 5KN1A 2HNLA 1M0UA 2FLSA 3TKSC 3O6TA 4MNNA 5L71A 1EP8A 1OYJA 1TU8A 4IHUA 1THXA 4ID0A 3UAPA 1A2LA 1ACVA 2AAWA 2HRNA 1ERVA 1SL2B 3IOSA 4I2UA 2J9HA 5J5NA 3EE2A 2IPAA 3IE3A 3O3TA 3QD9A 5DQSA 1BQ7A 3IXRA 1Y6EA 2GSSA 5DALB 2LTKA 4LL1B 4PNFA 3DEXA 2I4AA 1XBSA 1X5EA 1FB0A 3D5JA 4IJ3A 1EV4A 3MSZA 2B7KA 1H4OA 3IC8A 3VK9A 3UBLA 1UVZA 1XPVA 2VCQA 3FZAA 3FYGA 3TUEA 5GZZB 5J3RA 5IQYA 1FVJA 1F3BA 4J57E 2R3XA 1A2MA 2AV4A 1EZKA 2VL3A 5ECLB 2P5QA 2K6VA 1NM3A 2BJXA 14GSA 1LBKA 1GLPA 3RDWA 3CSJA 4GSTA 1V9WA 2QC7A 1TRSA 2HE3A 2B7JA 2VL2C 1YDKA 1U6TA 4GLTA 4CY6A 4JR6A 1U88A 3UARA 1Z6NA 4KH7A 2XBQA 5ECSA 5FWGA 5GSTA 6GSUA 3ISOA 4BWSA 1MEKA 3GFKA 2LRCA 4XS4B 5ECOB 2IL3A 1RK4A 1G0TA 1HNAA 3ERGA 4PNGA 2FCHA 5JCUA 1PN0A 3W6GA 5H5QA 4RI7A 2IFQB 4WF4A 3HVXA 1V40A 2QA2A 1FG4A 4O92A 2PBJA 4DSSA 1PQNA 4EDYA 1ON4A 4L0UA 8GSSA 3M3MA 3TOUA 1NHOA 2VOCA 1J0FA 2L4CA 1TKDB 2OBKA 4LMVA 4QL9A 1ZYPA 1PRXA 4F0CA 4Z7XA 1GNEA 2LEGA 3GH6A 2PVOC 2F9SA 4IP1A 2IWTA 2GLRA 1XVWA 1GLQA 19GSA 3TKRA 4DEJA 5ID2B 2WGRA 1XW5A 2GDRA 4TXOA 4BPYA 2CVBA 3EINA 3LXTA 1MD4A 3HVVA 2D2ZA 2FHEA 3ERFA 1SK1A 4I2TA 2LJRA 4MPFA 4K0GA 13GSA 2IMEA 4QL7A 4EC0A 2XPDA 1K0OA 5H5SA 2L57A 1GTBA 1TTZA 2DMMA 2G0FA 4HDEA 4XIHA 3GKNA 1THOA 5B6NA 4HI7A 1Z5YE 1R5AA 5DBQA 3D0ZA 1XWBA 2WCIA 1T1VA 5LD0A 4GSNA 1R7HA 4GRFA 4MPGA 4RQRA 3DVWA 3FMWA 4IELA 3WYWA 2TIRA 3UL3A 1M9BA 5ABRA 4HQSA 1OC9B 2YV7A 3G7JA 2LNTA 3QAGA 3ZFLA 1PGTA 3DWVA 6GSVA 4L0WA 3CRUA 4ECBA 5CYYA 1M9AA 1WPIA 4X0XA 2OE1A 4MH2A 5DAKB 2DJ1A 2V6OA 1QK8A 3A3TA 2YWNA 4XRDA 3ZIVA 1EEJA 3E0UA 1ERUA 4YQMA 1GNWA 2CX4A 2OJLA 3SBCA 5A4UA 4E8EA 2DSAA 3NIVA 4OO4A 1GL8A 1F9MA 4IN0A 4ULXA 2PN8A 11GSA 1BYEA 2DMLA 6GSWA 1UA5A 2GGTA 3HJOA 2MMAA 5D93A 3KP8A 4KUNA 1FOHA 4J2FA 5F0GA 2JZTA 2OA7A 4MZBA 2GSRA 2RUEA 2H76A 1O73A 2F3MA 1GSDA 1GWCA 3G9BA 2H6XA 3ZL5A 4XRAA 5D9VA 3U5RE 2HRAA 1A24A 2IMFA 4V2LA 1SENA 1PSQA 2OBIA 1JFUA 3DYRA 5ECMB 1T7PB 2VUPA 2JU5A 2JSYA 2DJKA 4KDYA 1XVQA 3QR6A 3QDNA 4TW5A 1MDJA 3QFBC 1K0NA 2H0GA 1TI1A 5KOWA 5EPFA 3HJPA 2EIQA 2AJQB 2C8UA 3IK9A 3ZRDA 2WS2A 2A2PA 1ZZYA 1DE2A 1F2EA 3H93A 4PQHA 22GSA 2FWFA 5CP1A 1BG5A 2C0EA 4TR1B 4KW6A 4TR4A 1EP7A 1K0BA 4MJEA 2RIIA 5DCHA 1QQ2A 5A4VA 5IPGA 3EWLA 4BVXA 4DVCA 2CV4A 2M80A 4NHWA 2CAQA 1O85A 2HZEA 3PGTA 1ST9A 1SU9A 3ZMKA 4KF9A 4P3YB 2E7PA 4PUAA 2GVPA 1GUKA 3HKRA 5ECRB 4IVFA 2HSYA 1Z3EA 2YNXA 4XS1A 4ZL8A 3KXOA 3VWUA 1OC8A 4JEDA 5ELGA 1SYXA 1NHYA 2QSIA 2A4HA 1SK2A 1ILOA 2IN3A 1WJKA 4WEYA 3TJBA 3BJ5A 4KX4A 4GCIA 3WD6A 5JWOB 4F03A 3TB2A 1X5CA 4PTSA 1PD21 3HZ4A 3Q74A 3E3EA 4NV2A 1ABAA 2H30A 3A2XA 4I8BA 4POKA 1AXDA 2O85A 2RUFA 3IHGA 3RPNA 2YJ7A 2B5YA 5B7CA 1H75A 4K8MA 2ALBA 3GX0A 3VPTA 2GS3A 2I3YA 4DSRA 2NDOA 2F8AA 2V32A 3F6DA 5C00A 2MMZA 2JADA 1A0RP 1U3AA 3IR4A 2ZNMA 3CMIA 4K0NA 2H1GA 4RQXA 2H1DA 3DD3A 1YJ6A 2NBSA 1CQHA 4ZB8A 2M72A 1BX9A 1WWJA 3TKQA 1XZOA 1Z6MA 3GKXA 4AJ6A 4ZILA 2VCZA 20GSA 2HT9A 4BWQA 3FK8A 4HZ2A 3J7Yb 1XWAA 1YQ1A 1YF1A 4N30A 4OD7A 1FW1A 2I9HA 4GF0A 4HEA2 5EL8A 1YEXA 4XHMA 3ME8A 2MMOA 3F4SA 1XW6A 2OE0A 3C8EA 3J7Yk 2GZZA 1ZGNA 2H73A 4V1Ap 1S3CA 2GZPA 2HRFA 4O7HA 1K3OA 3TOTA 2MBSA 3APOA 1JLVA 2R5GA 1WMJA 2HSHA 3TDGA 3UBKA 3I43A 2L5LA 3A5IA 1S3DA 4EF0A 3Q18A 2FUG2 2VLVA 1IYHA 4CY8A 4H86A 4MJCA 2IMIA 1PL2A 1T8EB 1JLWA 2VD0A 3IC4A 4JZQA 1YKAA 3IV4A 1GH2A 1Z7RA 5DJMA 3IA1A 3RHBA 4Z2RA 1MDKA 2HSMA 3N9JA 5CO3A 1Q4JA 3L9UA 4ZL7A 4GQFA 1W89A 1HYUA 5IMZA 3EMXA 4TKYA 4WF5A 1V2AA 3RHCA 4Z2UA 4MJBA 2LNSA 1HD2A 1T00A 4D73B 2LSTA 2H0HA 2KP1A 1J9BA 1FB6A 2H6YA 2QA1A 1ZYQB 4OCFA 3LJRA 2ZCTA 1JZDA 4ECIA 4LA1A 4OFMA 2VM2A 5J9BA 3GKMA 1B48A 1XW9A 1K3YA 1I5GA 4OFTA 2IMKA 5IMAA 4N10A 2PU9C 3G7IA 3ZMLA 1FHEA 1XFLA 2FD3A 3GSSA 3VPQA 3KCMA 5GAPD 1VRSD 2VCXA 5JCGA 17GSA 3APSA 1QGVA 5CRWA 3LXZA 4IS0A 5HFKA 5CRHA 3R3EA 2HFDA 4BVYA 4KB3A 1X9SB 2WDUA 2E0QA 3E9JB 4IBPA 1SL0B 4TVEA 4K7NA 4EVMA 2FA4A 3KM6A 2LQQA 4TR3A 5AIXA 3VWWA 3GTUB 1JZRA 1M99A 3UOMA 4HJ2A 1Z9HA 5IMCA 1VF3A 3H79A 3MNGA 4K1FA 4A5PA 1TJDA 3QPMA 2FNOA 1TRWA 5HFGA 4G0IA 2R0CA 4MLYA 4FO5A 1BAYA 2I1UA 2B6MA 1SD9A 4K6XA 3EYTA 2H1BA 1PKZA 12GSA 1UN2A 3EVIA 3FRCA 2RM5A 4Q5FA 4ECJA 1GUHA 4O5UA 5IMDA 3GV1A 2VLUA 1N8JA 2GT6A 3D4TA 3TRPA 1IYIA 4OWYA 4YAPA 5IM9A 3C1RA 3D21A 2V41A 3DMLA 4X1UA 1EOHA 3C71A 3BCKA 3EPTA 5CNWA 1ZOFA 3W8JA 5DCGA 2L59A 1R4WA 4NAXA 1K0DA 3JCML 3TKSE 1GSYA 4ILFA 3IPZA 4ICYA 5BRTA 3H4KA 3GX8A 3PR8A 3KMOA 4KSMA 3WGXA 3C1SA 3P7XA 2CVKA 2HZFA 5F06A 1MTCA 3TKPA 3MDKA 3VI5A 5LNKe 3L0HA 4MF5A 5LCZA 3C73A 2GQKA 3F9UA 5HR3A 1G7EA 3FR6A 5J41A 5B8BA 2BMXA 4FYBA 5CREA 4BL7A 1GRXA 4MF6A 3FZ9A 1DBYA 1KTEA 1J08A 4ZB6A 3UVTA 3ZZXA 2V1MA 1WOUA 2YWOA 3NOFA 1SK0A 3F4TA 2KLXA 2ON7A 2JACA 2P5RA 1OE7A 3UVHA 4K2XA 3VFIA 2IMDA 3F63A 4EL1A 4BA7A 4MDCA 5G30A 2LKUA 2RM6A 5A5KA 5ECQB 3ZFBA 4IQ1A 2CQ9A 4F82A 2PPTA 1TOFA 4AF2A 2A4VA 2R0GA 1R5PA 3L9SA 5J9CA 2JZRA 2L6CA 4G10A 2X64A 4IJIA 3MIXA 3GIXA 3WT2A 5IOWA 3TRQA 1V58A 2B1KA 4XTSA 2M46A 3QAWA 1B4QA 5J4UA 3ED3A 2GQLA 3HXSA 3KGKA 4WXTA 4O5RA 3I6AA 5D96A 3HDCA 3ZITA 4POLA 3BOAA 2VO4A 4FYCA 5A4WA 5EVOA 2C3TA 2CT6A 3APQA 4O5QA 2A2RA 1QXHA 4Q5QA 2JSZA 4IP6A 1SD8A 1O7UA 3VLNA 4YKGA 2H19A 1N2AA 3UJ1A 1GSEA 2VM1A 3LYKA 5E4WA 1TDIA 5DALA 3GUSA 2FWGA 1G7OA 4POMA 3GMFA 4YH2A 1FO5A 5KEJA 3BCIA 4HQZA 5F07A 3UMAA 4ZBBA 2PWJA 1I9DA 10GSA 1AUCA 1OVNA 1WRYA 3ZREA 2JL4A 3M0FA 4EUYA 1B4PA 3RBTA 2EIOA 4PURA 5AIVA 1ZMAA 1X0RA 1AQXA 4L5OA 1GSFA 1X9MB 1TK8B 4YAVA 2C3NA 3M8NA 1TI3A 2EC4A 2K18A 5D9TA 4JU5A 2QGVA 1ERTA 4G0LA 9GSSA 3LEFA 1Z7PA 1M2BA 4TXVA 1TK0B 4ISDA 2DJ3A 1ZYNA 2YJHA 1USBA 5KOXA 4XS4A 3HCZA 4K7IA 1UC7A 5EY6A 3KTLA 2ES7A 3F8UA 4DSSB 2C0FA 3GURA 2R2JA 5JCWA 3SWLA 2H1AA 1NW2A 2IFQA 3F3RA 1SJ6A 3ZYWA 1DE1A 2YOIA 4OFNA 1EGRA 2AB6A 5KN2A 5ECIB 4ZIJA 1OAZA 2CZ3A 2TRCP 4X43A 1EWXA 2WULA 4WBJA 3Q19A 3FR3A 2C1YA 3DKSA 2R0PA 4KA0A 4TXOB 4IGJA 1KBNA 2DKHA 6GSSA 3KJYA 1HNCA 3KH7A 1MD3A 2H71A 4IW9A 4PUFC 3UEMA 4G0KA 2OKAA 1PKWA 4ECCA 4ZL9A 5KN0A 5ID2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SKR B;  1XXU A;  2DJJ A;  3W8S A;  2P31 A;  4EO3 A;  1EEM A;  1BJX A;  3KZQ A;  3DIE A;  3IK7 A;  1RW1 A;  4KDX A;  4K9Z A;  3QAV A;  2YWI A;  3RPP A;  4ZBD A;  2HYX A;  1TRU A;  2XC2 A;  1OE8 A;  3ERW A;  1EV9 A;  1T4Y A;  1BED A;  3HHV A;  4HUA A;  2KUC A;  2L5O A;  2GST A;  5DVB A;  1O81 A;  2NTO A;  3QFA C;  1S3A A;  1XCC A;  1B9X C;  3FZ4 A;  1EOG A;  2LV3 A;  3LFL A;  1DUG A;  3GST A;  1T3B A;  5ECH B;  2FY6 A;  1AW9 A;  3IBH A;  1K3L A;  4ACS A;  3PIN A;  3CSI A;  5HR2 A;  3P90 A;  2KHP A;  1E2Y A;  2H66 A;  4AJ8 A;  2H0I A;  5B8A A;  4XCS A;  1Y25 A;  1KEB A;  2DBC A;  5B6M A;  3DXB A;  1OC9 A;  2L4Q A;  1W4V A;  3LG6 A;  3HD5 A;  2GQM A;  4NHZ A;  2YN1 A;  1TW9 A;  2N5F A;  3F3Q A;  4LMW A;  1GTA A;  3CTG A;  3L78 A;  2X8G A;  3BBY A;  6GST A;  4ML6 A;  2L6D A;  4F0B A;  2VL9 A;  3OR5 A;  5DAK A;  4MZC A;  1PX7 A;  1JHB A;  1DSB A;  4FIW A;  5IO0 A;  3M9K A;  2YCD A;  3O76 A;  4EE0 A;  3KIJ A;  3CRT A;  2JZS A;  2R4V A;  5HFI A;  5HQP A;  3H1N A;  2C3Q A;  1U87 A;  4MCU A;  4RUV A;  2V6K A;  6GSX A;  4JE1 A;  5DQY A;  3PH9 A;  3MAK A;  4WET A;  2WB9 A;  4NXI A;  4EXJ A;  5G5E A;  1AQV A;  2C0G A;  1F37 A;  3VWX A;  5HR1 A;  1GUL A;  2B5E A;  4MMM A;  1GTU A;  4ZXG A;  4ZB9 A;  1X9W B;  4PQI A;  5F8B A;  3EC3 A;  2PGT A;  3GRX A;  3HY2 A;  1EGO A;  3WGE A;  3CSH A;  4KE3 A;  4F2I A;  2CZ2 A;  4KSO A;  3FEU A;  5GAN D;  5CRD A;  2RLI A;  3VUR A;  1YY7 A;  1E6B A;  2VAF A;  3GL3 A;  2XHF A;  4OO5 A;  4KCE A;  3GA4 A;  4G2E A;  1VF1 A;  4GTU A;  2VIM A;  2FWE A;  4AGS A;  1TK5 B;  4LL4 B;  1YKC A;  5CAX A;  18GS A;  3RAZ A;  4KDU A;  1A23 A;  2DC5 A;  1XOA A;  5CRG A;  4XS6 A;  3CYN A;  1CQG A;  3ZTL A;  4TOP A;  2R37 A;  2H6Z A;  5FHI A;  3EU3 A;  3LSZ A;  5ECP B;  1K0A A;  3IRA A;  3I9V 2;  3D22 A;  4KAE A;  2YP6 A;  3KP9 A;  2GT5 A;  1KNG A;  2CVD A;  1GSU A;  2YPM A;  1VF2 A;  3FKF A;  1GTI A;  16GS A;  2XPE A;  4TR1 A;  2HZE B;  3TJF A;  4E8H A;  3ZVJ D;  4FH8 A;  1URM A;  4POB A;  5DDL A;  4MZW A;  5G5F A;  5G31 A;  1ML6 A;  3GN3 A;  2HLS A;  4ZBA A;  2FGX A;  2LRT A;  2OAD A;  1A0F A;  2X8C A;  5H5R A;  2GTU A;  2K8S A;  2N5A A;  3G7Y A;  4CW9 A;  4G9H A;  2AUV A;  4V2N A;  4TRX A;  3DRN A;  1O8W A;  4HU9 A;  3KD0 A;  4OCE A;  1M7T A;  3ZVJ A;  1JZW A;  2IJY A;  3FW2 A;  2J23 A;  4K2D A;  3IHQ A;  3EMP A;  5KN3 A;  1XIY A;  2DIZ A;  1VGL A;  3FR9 A;  1B8X A;  4QQ7 A;  1V57 A;  1F3A A;  2H72 A;  2EIR A;  1OKD A;  4NPB A;  2GSQ A;  1LJR A;  4K7O A;  2GZY A;  4WR5 A;  1V98 A;  2OAC A;  1SKS B;  5JWR B;  5G1L A;  3GNJ A;  5AGY A;  1B9Y C;  4ML1 A;  3A2W A;  4EDZ A;  3WT1 A;  1AQW A;  1R26 A;  3DGQ A;  2HXK A;  3HZ8 A;  3HYP A;  1F6M C;  3VWV A;  4MAB A;  4IQA A;  3ZIJ A;  1M2A A;  4PGT A;  3FZ5 A;  2N5B A;  2V2G A;  4TR0 A;  2G2Q A;  1QMV A;  4V2M A;  3BD2 A;  2WJU A;  2TRX A;  2KOK A;  3KEB A;  4JBB A;  3HJM A;  3KTB A;  4V1A g;  2MMN A;  4LLR A;  3H8Q A;  3D6I A;  1GSS A;  2E2G A;  3CBU A;  4L5L A;  1ZCP A;  2QKE A;  4N11 A;  3US3 A;  1RQM A;  1PN9 A;  3IAS 2;  3C7M A;  4GXZ A;  2K9F A;  5F05 A;  7GSS A;  1WE0 A;  1OC3 A;  3L9V A;  2LUS A;  1T4Z A;  4NWY A;  4Q5N A;  1YZX A;  1M2D A;  1ZYE A;  1K0C A;  1FAA A;  4HS1 A;  4MA9 A;  1JZO A;  5IPH A;  6GSY A;  2VCT A;  3KH9 A;  2LJK A;  4NMU A;  1HQO A;  2YV9 A;  3A2V A;  2F8F A;  1GUM A;  5D8I A;  5E59 A;  3IDV A;  2F51 A;  1O6J A;  5AIS A;  1TU7 A;  2PVQ A;  2K8V A;  5IOX A;  2WFC A;  2A2S A;  3KMN A;  2R6K A;  4KND A;  2O87 A;  4GQC A;  3Q6O A;  2BTO T;  5D73 A;  4Q5R A;  1X5D A;  3TJJ A;  3L4N A;  2IIY A;  1WP0 A;  2DJ0 A;  3HVS A;  4O32 A;  2Z9S A;  2PER A;  2YWM A;  4N0V A;  4IKH A;  2I81 A;  1AIU A;  1PA3 A;  2LQO A;  5C04 A;  4KGI A;  3P8W A;  5GSS A;  3LWA A;  2WZ9 A;  4HJM A;  2H74 A;  4GSS A;  1G6Y A;  4MH3 A;  3QOU A;  3GHA A;  3LGC A;  2VCV A;  3P2A A;  2HI7 A;  2B5X A;  3DVX A;  3R2Q A;  2C0D A;  2C4J A;  4I6X A;  2YZU A;  3AY8 A;  4D73 A;  3LYP A;  2MBT A;  4CDO A;  5DJL A;  3VI7 A;  4I5Q A;  3TGZ A;  4F9Z A;  4HU7 A;  1A8Y A;  3QMX A;  5IMV A;  5D9X A;  2C80 A;  3D4M A;  3TKS A;  4WKW A;  2ZUP A;  4GWR A;  3LOR A;  1XWG A;  3NZN A;  5ECK B;  1QUW A;  3ZLP A;  2H8L A;  3FY7 A;  3IAM 2;  3V1W A;  2AHE A;  1SJI A;  1K0M A;  3F6F A;  5G2Z A;  1TXX A;  2VD1 A;  4YQV A;  1SJZ A;  5IO2 A;  4CHS A;  4DSQ A;  2X99 A;  2CX3 A;  2KP2 A;  2P0G A;  4N0Z A;  5ENU A;  2NPB A;  3EU4 A;  5COH A;  1A2J A;  3M1G A;  5AN1 A;  1A8L A;  4HOJ A;  2ON5 A;  1AAZ A;  1TRV A;  2LJA A;  1SL1 B;  2FA8 A;  3TCO A;  1SYR A;  3TJG A;  1YF0 A;  3K8N A;  1PX6 A;  1TP9 A;  1XWC A;  3GTU A;  2X8H A;  2CA8 A;  3GKK A;  5G1K A;  5JWQ B;  3S9F A;  5ECN B;  3MWH A;  2YAN A;  5ELA A;  3TRX A;  3GYK A;  2MYG A;  2OE3 A;  3N5O A;  4EKZ A;  1ZL9 A;  1QFN A;  3CXG A;  4MP4 A;  2LS5 A;  5HR0 A;  3I69 A;  3UIW A;  1O8X A;  4PXO A;  2DIY A;  2H01 A;  1YEP A;  2MZC A;  1PL1 A;  3TJK A;  2VL2 A;  1XWK A;  3FHK A;  3HA9 A;  1VF4 A;  1FVK A;  1G6W A;  4AJ7 A;  5INY A;  5D9W A;  2H75 A;  1C72 A;  4JRR A;  4YQU A;  5IMF A;  3U6V A;  4TN8 A;  4NV5 A;  4J56 E;  2WRT A;  1OKT A;  1WIK A;  2REM A;  4RI6 A;  2E2M A;  2YZH A;  3WGD A;  4JR4 A;  5IIZ A;  4WR4 A;  4PQ1 A;  4MJA A;  3F4R A;  2AYT A;  1Q98 A;  1ERW A;  1XOB A;  1U3I A;  2B1L A;  2LRN A;  3LQ7 A;  2FWH A;  1PMT A;  2NVL A;  4I97 A;  4MF7 A;  5FT3 A;  3ME7 A;  3EUR A;  1LU4 A;  4MK3 A;  2VLT A;  2PMT A;  2DJ2 A;  2PUK C;  3CTF A;  3GL5 A;  2O7K A;  1SKW B;  1NSW A;  4HZ4 A;  2O89 A;  2O8V B;  4G19 A;  4PX1 A;  3F0I A;  2CAI A;  2DLX A;  4OMV A;  1AC1 A;  2B3S A;  2VCW A;  4FYU A;  1GSQ A;  4KCA A;  3A5W A;  4WBR D;  3GH9 A;  3QCP A;  1MDI A;  4L8E A;  1GP1 A;  1FOV A;  2H70 A;  2XBI A;  3M9J A;  1HNB A;  5KN1 A;  2HNL A;  1M0U A;  2FLS A;  3TKS C;  3O6T A;  5L71 A;  1EP8 A;  1OYJ A;  1TU8 A;  4IHU A;  1THX A;  4ID0 A;  3UAP A;  1A2L A;  1ACV A;  2AAW A;  2HRN A;  1ERV A;  1SL2 B;  3IOS A;  4I2U A;  2J9H A;  5J5N A;  3EE2 A;  2IPA A;  3IE3 A;  3O3T A;  3QD9 A;  5DQS A;  1BQ7 A;  3IXR A;  1Y6E A;  2GSS A;  5DAL B;  2LTK A;  4LL1 B;  4PNF A;  3DEX A;  2I4A A;  1XBS A;  1X5E A;  1FB0 A;  3D5J A;  4IJ3 A;  1EV4 A;  3MSZ A;  2B7K A;  1H4O A;  3VK9 A;  3UBL A;  1UVZ A;  1XPV A;  2VCQ A;  3FZA A;  3FYG A;  3TUE A;  5GZZ B;  5J3R A;  5IQY A;  1FVJ A;  1F3B A;  4J57 E;  2R3X A;  1A2M A;  2AV4 A;  1EZK A;  5ECL B;  2VL3 A;  2P5Q A;  2K6V A;  1NM3 A;  2BJX A;  14GS A;  1LBK A;  1GLP A;  3RDW A;  3CSJ A;  4GST A;  1V9W A;  2QC7 A;  1TRS A;  2HE3 A;  2B7J A;  2VL2 C;  1YDK A;  1U6T A;  4GLT A;  4JR6 A;  1U88 A;  3UAR A;  1Z6N A;  4KH7 A;  2XBQ A;  5ECS A;  5FWG A;  5GST A;  6GSU A;  3ISO A;  4BWS A;  1MEK A;  3GFK A;  2LRC A;  4XS4 B;  5ECO B;  2IL3 A;  1RK4 A;  1G0T A;  1HNA A;  3ERG A;  4PNG A;  2FCH A;  5JCU A;  3W6G A;  5H5Q A;  4RI7 A;  2IFQ B;  4WF4 A;  3HVX A;  1V40 A;  1FG4 A;  4O92 A;  2PBJ A;  4DSS A;  1PQN A;  4EDY A;  1ON4 A;  4L0U A;  8GSS A;  3M3M A;  3TOU A;  1NHO A;  2VOC A;  1J0F A;  2L4C A;  1TKD B;  2OBK A;  4LMV A;  4QL9 A;  1PRX A;  4F0C A;  4Z7X A;  1GNE A;  2LEG A;  3GH6 A;  2PVO C;  2F9S A;  4IP1 A;  2IWT A;  2GLR A;  1XVW A;  1GLQ A;  19GS A;  3TKR A;  4DEJ A;  5ID2 B;  2WGR A;  1XW5 A;  2GDR A;  4TXO A;  4BPY A;  2CVB A;  3EIN A;  3LXT A;  1MD4 A;  3HVV A;  2D2Z A;  2FHE A;  3ERF A;  1SK1 A;  4I2T A;  2LJR A;  4MPF A;  4K0G A;  13GS A;  2IME A;  4QL7 A;  4EC0 A;  2XPD A;  1K0O A;  5H5S A;  2L57 A;  1GTB A;  1TTZ A;  2DMM A;  2G0F A;  4HDE A;  4XIH A;  3GKN A;  1THO A;  5B6N A;  4HI7 A;  1Z5Y E;  1R5A A;  5DBQ A;  3D0Z A;  1XWB A;  2WCI A;  1T1V A;  5LD0 A;  4GSN A;  1R7H A;  4GRF A;  4MPG A;  4RQR A;  3DVW A;  4IEL A;  3WYW A;  2TIR A;  3UL3 A;  1M9B A;  5ABR A;  4HQS A;  1OC9 B;  2YV7 A;  3G7J A;  2LNT A;  3QAG A;  3ZFL A;  1PGT A;  3DWV A;  6GSV A;  4L0W A;  3CRU A;  4ECB A;  5CYY A;  1M9A A;  1WPI A;  4X0X A;  2OE1 A;  4MH2 A;  5DAK B;  2DJ1 A;  2V6O A;  1QK8 A;  3A3T A;  2YWN A;  4XRD A;  3ZIV A;  1EEJ A;  3E0U A;  1ERU A;  4YQM A;  1GNW A;  2CX4 A;  2OJL A;  3SBC A;  5A4U A;  4E8E A;  2DSA A;  3NIV A;  4OO4 A;  1GL8 A;  1F9M A;  4IN0 A;  4ULX A;  2PN8 A;  11GS A;  1BYE A;  2DML A;  6GSW A;  1UA5 A;  2GGT A;  3HJO A;  2MMA A;  5D93 A;  3KP8 A;  4KUN A;  4J2F A;  5F0G A;  2JZT A;  2OA7 A;  4MZB A;  2GSR A;  2RUE A;  2H76 A;  1O73 A;  2F3M A;  1GSD A;  1GWC A;  3G9B A;  2H6X A;  3ZL5 A;  4XRA A;  5D9V A;  3U5R E;  1A24 A;  2IMF A;  4V2L A;  1SEN A;  1PSQ A;  2OBI A;  1JFU A;  3DYR A;  5ECM B;  1T7P B;  2VUP A;  2JU5 A;  2JSY A;  2DJK A;  4KDY A;  1XVQ A;  3QR6 A;  3QDN A;  4TW5 A;  1MDJ A;  3QFB C;  1K0N A;  2H0G A;  1TI1 A;  5EPF A;  3HJP A;  2EIQ A;  2AJQ B;  2C8U A;  3IK9 A;  3ZRD A;  2WS2 A;  1ZZY A;  1DE2 A;  1F2E A;  3H93 A;  4PQH A;  22GS A;  2FWF A;  5CP1 A;  1BG5 A;  2C0E A;  4TR1 B;  4KW6 A;  4TR4 A;  1EP7 A;  1K0B A;  4MJE A;  2RII A;  5DCH A;  1QQ2 A;  5A4V A;  5IPG A;  3EWL A;  4BVX A;  4DVC A;  2CV4 A;  2M80 A;  4NHW A;  2CAQ A;  1O85 A;  2HZE A;  3PGT A;  1ST9 A;  1SU9 A;  3ZMK A;  4P3Y B;  2E7P A;  4PUA A;  2GVP A;  1GUK A;  3HKR A;  5ECR B;  4IVF A;  2HSY A;  1Z3E A;  2YNX A;  4XS1 A;  4ZL8 A;  3KXO A;  3VWU A;  1OC8 A;  4JED A;  5ELG A;  1SYX A;  1NHY A;  2QSI A;  1SK2 A;  1ILO A;  2IN3 A;  1WJK A;  4WEY A;  3TJB A;  3BJ5 A;  4KX4 A;  4GCI A;  3WD6 A;  5JWO B;  4F03 A;  3TB2 A;  1X5C A;  1PD2 1;  3HZ4 A;  3Q74 A;  3E3E A;  4NV2 A;  1ABA A;  2H30 A;  3A2X A;  4I8B A;  4POK A;  1AXD A;  2O85 A;  2RUF A;  3RPN A;  2YJ7 A;  2B5Y A;  5B7C A;  1H75 A;  4K8M A;  2ALB A;  3GX0 A;  3VPT A;  2GS3 A;  2I3Y A;  4DSR A;  2NDO A;  2F8A A;  2V32 A;  3F6D A;  5C00 A;  2MMZ A;  2JAD A;  1A0R P;  1U3A A;  3IR4 A;  2ZNM A;  3CMI A;  4K0N A;  2H1G A;  4RQX A;  2H1D A;  3DD3 A;  1YJ6 A;  2NBS A;  1CQH A;  4ZB8 A;  2M72 A;  1BX9 A;  1WWJ A;  3TKQ A;  1XZO A;  1Z6M A;  3GKX A;  4AJ6 A;  4ZIL A;  2VCZ A;  20GS A;  2HT9 A;  4BWQ A;  3FK8 A;  4HZ2 A;  3J7Y b;  1XWA A;  1YQ1 A;  1YF1 A;  4N30 A;  4OD7 A;  1FW1 A;  2I9H A;  4GF0 A;  4HEA 2;  5EL8 A;  1YEX A;  4XHM A;  3ME8 A;  2MMO A;  3F4S A;  1XW6 A;  2OE0 A;  3C8E A;  3J7Y k;  2GZZ A;  1ZGN A;  2H73 A;  4V1A p;  1S3C A;  2GZP A;  2HRF A;  4O7H A;  1K3O A;  3TOT A;  2MBS A;  3APO A;  1JLV A;  2R5G A;  1WMJ A;  2HSH A;  3TDG A;  3UBK A;  3I43 A;  2L5L A;  1S3D A;  4EF0 A;  3Q18 A;  2FUG 2;  2VLV A;  1IYH A;  4H86 A;  4MJC A;  2IMI A;  1PL2 A;  1T8E B;  1JLW A;  2VD0 A;  3IC4 A;  4JZQ A;  1YKA A;  3IV4 A;  1GH2 A;  1Z7R A;  5DJM A;  3IA1 A;  3RHB A;  1MDK A;  3N9J A;  5CO3 A;  1Q4J A;  3L9U A;  4ZL7 A;  4GQF A;  1W89 A;  1HYU A;  5IMZ A;  3EMX A;  4TKY A;  4WF5 A;  1V2A A;  3RHC A;  4MJB A;  2LNS A;  1HD2 A;  1T00 A;  4D73 B;  2LST A;  2H0H A;  2KP1 A;  1J9B A;  1FB6 A;  2H6Y A;  1ZYQ B;  4OCF A;  3LJR A;  2ZCT A;  1JZD A;  4ECI A;  4LA1 A;  4OFM A;  2VM2 A;  5J9B A;  3GKM A;  1B48 A;  1XW9 A;  1K3Y A;  1I5G A;  4OFT A;  2IMK A;  5IMA A;  4N10 A;  2PU9 C;  3G7I A;  3ZML A;  1FHE A;  1XFL A;  2FD3 A;  3GSS A;  3VPQ A;  3KCM A;  5GAP D;  1VRS D;  2VCX A;  5JCG A;  17GS A;  3APS A;  1QGV A;  5CRW A;  3LXZ A;  4IS0 A;  5HFK A;  5CRH A;  2HFD A;  4BVY A;  4KB3 A;  1X9S B;  2WDU A;  2E0Q A;  3E9J B;  4IBP A;  1SL0 B;  4TVE A;  4K7N A;  4EVM A;  2FA4 A;  3KM6 A;  2LQQ A;  4TR3 A;  5AIX A;  3VWW A;  3GTU B;  1JZR A;  1M99 A;  3UOM A;  4HJ2 A;  1Z9H A;  5IMC A;  1VF3 A;  3H79 A;  3MNG A;  4K1F A;  1TJD A;  3QPM A;  2FNO A;  1TRW A;  5HFG A;  4MLY A;  4FO5 A;  1BAY A;  2I1U A;  2B6M A;  1SD9 A;  4K6X A;  3EYT A;  2H1B A;  1PKZ A;  12GS A;  1UN2 A;  3EVI A;  3FRC A;  2RM5 A;  4Q5F A;  4ECJ A;  1GUH A;  5IMD A;  3GV1 A;  2VLU A;  1N8J A;  2GT6 A;  3D4T A;  3TRP A;  1IYI A;  4OWY A;  4YAP A;  5IM9 A;  3C1R A;  3D21 A;  2V41 A;  3DML A;  4X1U A;  1EOH A;  3C71 A;  3BCK A;  5CNW A;  1ZOF A;  3W8J A;  5DCG A;  2L59 A;  1R4W A;  4NAX A;  1K0D A;  3JCM L;  3TKS E;  1GSY A;  4ILF A;  3IPZ A;  3H4K A;  3GX8 A;  3PR8 A;  3KMO A;  4KSM A;  3WGX A;  3C1S A;  3P7X A;  2CVK A;  2HZF A;  5F06 A;  1MTC A;  3TKP A;  3MDK A;  3VI5 A;  5LNK e;  3L0H A;  4MF5 A;  5LCZ A;  3C73 A;  2GQK A;  3F9U A;  5HR3 A;  1G7E A;  3FR6 A;  5J41 A;  5B8B A;  2BMX A;  4FYB A;  5CRE A;  4BL7 A;  1GRX A;  4MF6 A;  3FZ9 A;  1DBY A;  1KTE A;  1J08 A;  4ZB6 A;  3UVT A;  3ZZX A;  2V1M A;  1WOU A;  2YWO A;  3NOF A;  1SK0 A;  3F4T A;  2KLX A;  2ON7 A;  2JAC A;  2P5R A;  1OE7 A;  3UVH A;  3VFI A;  2IMD A;  3F63 A;  4EL1 A;  4BA7 A;  4MDC A;  5G30 A;  2LKU A;  2RM6 A;  5A5K A;  5ECQ B;  3ZFB A;  4IQ1 A;  2CQ9 A;  4F82 A;  2PPT A;  1TOF A;  4AF2 A;  2A4V A;  1R5P A;  3L9S A;  5J9C A;  2JZR A;  2L6C A;  4G10 A;  2X64 A;  4IJI A;  3GIX A;  3WT2 A;  5IOW A;  3TRQ A;  1V58 A;  2B1K A;  4XTS A;  2M46 A;  3QAW A;  1B4Q A;  5J4U A;  3ED3 A;  2GQL A;  3HXS A;  3KGK A;  4WXT A;  4O5R A;  3I6A A;  5D96 A;  3HDC A;  3ZIT A;  4POL A;  3BOA A;  2VO4 A;  4FYC A;  5A4W A;  5EVO A;  2C3T A;  2CT6 A;  3APQ A;  2A2R A;  1QXH A;  4Q5Q A;  2JSZ A;  4IP6 A;  1SD8 A;  1O7U A;  3VLN A;  2H19 A;  1N2A A;  3UJ1 A;  1GSE A;  2VM1 A;  3LYK A;  5E4W A;  1TDI A;  5DAL A;  3GUS A;  2FWG A;  1G7O A;  4POM A;  3GMF A;  4YH2 A;  1FO5 A;  5KEJ A;  3BCI A;  4HQZ A;  5F07 A;  3UMA A;  4ZBB A;  2PWJ A;  1I9D A;  10GS A;  1AUC A;  1OVN A;  1WRY A;  3ZRE A;  2JL4 A;  3M0F A;  4EUY A;  1B4P A;  3RBT A;  2EIO A;  4PUR A;  5AIV A;  1ZMA A;  1X0R A;  1AQX A;  4L5O A;  1GSF A;  1X9M B;  1TK8 B;  4YAV A;  2C3N A;  3M8N A;  1TI3 A;  2EC4 A;  2K18 A;  5D9T A;  4JU5 A;  2QGV A;  1ERT A;  9GSS A;  3LEF A;  1Z7P A;  1M2B A;  4TXV A;  1TK0 B;  4ISD A;  2DJ3 A;  2YJH A;  1USB A;  4XS4 A;  3HCZ A;  4K7I A;  1UC7 A;  5EY6 A;  3KTL A;  2ES7 A;  3F8U A;  4DSS B;  2C0F A;  3GUR A;  2R2J A;  5JCW A;  3SWL A;  2H1A A;  1NW2 A;  2IFQ A;  3F3R A;  1SJ6 A;  3ZYW A;  1DE1 A;  2YOI A;  4OFN A;  1EGR A;  2AB6 A;  5KN2 A;  5ECI B;  4ZIJ A;  1OAZ A;  2CZ3 A;  2TRC P;  4X43 A;  1EWX A;  2WUL A;  4WBJ A;  3Q19 A;  3FR3 A;  2C1Y A;  3DKS A;  4KA0 A;  4TXO B;  4IGJ A;  1KBN A;  6GSS A;  3KJY A;  1HNC A;  3KH7 A;  1MD3 A;  2H71 A;  4IW9 A;  4PUF C;  3UEM A;  2OKA A;  1PKW A;  4ECC A;  4ZL9 A;  5KN0 A;  5ID2 A; 
#chains in the Genus database with same CATH topology
 1SKR B;  1XXU A;  2DJJ A;  3W8S A;  2P31 A;  4EO3 A;  2DKI A;  1EEM A;  1BJX A;  3KZQ A;  3DIE A;  3IK7 A;  1RW1 A;  4KDX A;  4K9Z A;  3QAV A;  2YWI A;  3RPP A;  4EIP A;  4ZBD A;  2HYX A;  1TRU A;  2XC2 A;  1OE8 A;  3ERW A;  1EV9 A;  1T4Y A;  1BED A;  3HHV A;  4HUA A;  2KUC A;  2L5O A;  2GST A;  5DVB A;  1O81 A;  2NTO A;  3QFA C;  1S3A A;  1XCC A;  1B9X C;  3FZ4 A;  1EOG A;  2LV3 A;  3LFL A;  1DUG A;  3GST A;  1T3B A;  5ECH B;  2FY6 A;  1AW9 A;  3IBH A;  3MYD A;  1K3L A;  4ACS A;  3PIN A;  3CSI A;  5HR2 A;  3P90 A;  2KHP A;  1E2Y A;  2H66 A;  4AJ8 A;  2H0I A;  5B8A A;  4XCS A;  1Y25 A;  1KEB A;  2DBC A;  5B6M A;  3DXB A;  1OC9 A;  2L4Q A;  1W4V A;  3LG6 A;  3HD5 A;  2GQM A;  4NHZ A;  2YN1 A;  1TW9 A;  2N5F A;  3F3Q A;  4LMW A;  1GTA A;  3CTG A;  3L78 A;  2X8G A;  3BBY A;  6GST A;  4ML6 A;  2L6D A;  4F0B A;  2VL9 A;  3OR5 A;  5DAK A;  4MZC A;  1PX7 A;  1JHB A;  1DSB A;  4FIW A;  5IO0 A;  3M9K A;  2YCD A;  3O76 A;  4EE0 A;  3KIJ A;  3CRT A;  4X4J A;  2JZS A;  2R4V A;  5HFI A;  5HQP A;  3H1N A;  2C3Q A;  1U87 A;  4MCU A;  4RUV A;  2V6K A;  6GSX A;  4JE1 A;  5DQY A;  3PH9 A;  3MAK A;  4WET A;  2WB9 A;  4NXI A;  4EXJ A;  5G5E A;  1AQV A;  2C0G A;  1F37 A;  3VWX A;  5HR1 A;  1GUL A;  2B5E A;  4MMM A;  1GTU A;  4ZXG A;  4ZB9 A;  1X9W B;  4PQI A;  5F8B A;  3EC3 A;  2PGT A;  3GRX A;  3HY2 A;  1EGO A;  3WGE A;  3CSH A;  4KE3 A;  4F2I A;  2CZ2 A;  4KSO A;  3FEU A;  5GAN D;  5CRD A;  2RLI A;  3VUR A;  1YY7 A;  1E6B A;  2VAF A;  3GL3 A;  2XHF A;  4OO5 A;  4KCE A;  3GA4 A;  4G2E A;  1VF1 A;  4GTU A;  2VIM A;  2FWE A;  4AGS A;  1TK5 B;  4LL4 B;  1YKC A;  5CAX A;  18GS A;  3RAZ A;  4KDU A;  1A23 A;  2DC5 A;  4EIQ A;  1XOA A;  5CRG A;  4XS6 A;  3CYN A;  1CQG A;  3ZTL A;  4TOP A;  2R37 A;  2H6Z A;  5FHI A;  3EU3 A;  3LSZ A;  5ECP B;  1K0A A;  3IRA A;  3I9V 2;  3D22 A;  4KAE A;  2YP6 A;  3KP9 A;  2GT5 A;  1KNG A;  4BVX B;  2CVD A;  1GSU A;  2YPM A;  1VF2 A;  3FKF A;  1GTI A;  16GS A;  2XPE A;  4TR1 A;  2HZE B;  3TJF A;  4E8H A;  3ZVJ D;  4K5R A;  4FH8 A;  1URM A;  4POB A;  5DDL A;  4MZW A;  5G5F A;  5G31 A;  1ML6 A;  3GN3 A;  2HLS A;  4ZBA A;  2FGX A;  2LRT A;  2OAD A;  1A0F A;  2X8C A;  5H5R A;  2GTU A;  2K8S A;  2N5A A;  3G7Y A;  4CW9 A;  4G9H A;  2AUV A;  4V2N A;  4TRX A;  3DRN A;  1O8W A;  4HU9 A;  3KD0 A;  4OCE A;  1M7T A;  3ZVJ A;  1JZW A;  2IJY A;  3FW2 A;  2J23 A;  4K2D A;  3IHQ A;  3EMP A;  5KN3 A;  1XIY A;  2DIZ A;  1VGL A;  3FR9 A;  1B8X A;  4QQ7 A;  1V57 A;  1F3A A;  2H72 A;  2EIR A;  1OKD A;  4NPB A;  2GSQ A;  1LJR A;  4K7O A;  2GZY A;  4WR5 A;  1V98 A;  2OAC A;  1SKS B;  5JWR B;  5G1L A;  3GNJ A;  5AGY A;  1B9Y C;  4ML1 A;  3A2W A;  4EDZ A;  3WT1 A;  4YKF A;  1AQW A;  1R26 A;  3DGQ A;  2HXK A;  3HZ8 A;  3HYP A;  1F6M C;  3VWV A;  4MAB A;  4IQA A;  3ZIJ A;  1M2A A;  4PGT A;  3FZ5 A;  2N5B A;  2V2G A;  4TR0 A;  2G2Q A;  1QMV A;  4V2M A;  3BD2 A;  2WJU A;  2TRX A;  2X49 A;  2KOK A;  3KEB A;  4JBB A;  3HJM A;  3KTB A;  4V1A g;  2MMN A;  4LLR A;  3H8Q A;  3D6I A;  1GSS A;  2E2G A;  3CBU A;  4L5L A;  1ZCP A;  2QKE A;  4N11 A;  3US3 A;  4FQU A;  1RQM A;  1PN9 A;  3IAS 2;  3C7M A;  4GXZ A;  2K9F A;  5F05 A;  7GSS A;  1WE0 A;  1OC3 A;  3L9V A;  2LUS A;  3LW9 A;  1T4Z A;  4NWY A;  4Q5N A;  1YZX A;  1M2D A;  1ZYE A;  1K0C A;  1FAA A;  4HS1 A;  4MA9 A;  1JZO A;  5IPH A;  6GSY A;  2VCT A;  3KH9 A;  2LJK A;  4NMU A;  1HQO A;  2YV9 A;  3A2V A;  2F8F A;  1GUM A;  5D8I A;  5E59 A;  3IDV A;  2F51 A;  1O6J A;  5AIS A;  1TU7 A;  2PVQ A;  2K8V A;  5IOX A;  2WFC A;  2A2S A;  3KMN A;  2R6K A;  4KND A;  2O87 A;  4GQC A;  3Q6O A;  2BTO T;  5D73 A;  4Q5R A;  1X5D A;  3TJJ A;  3L4N A;  2IIY A;  1WP0 A;  2DJ0 A;  3HVS A;  4O32 A;  2Z9S A;  2PER A;  2YWM A;  4N0V A;  4IKH A;  2I81 A;  1AIU A;  1PA3 A;  2LQO A;  5C04 A;  4KGI A;  3P8W A;  5GSS A;  3LWA A;  2WZ9 A;  4HJM A;  2H74 A;  2X4A A;  4GSS A;  1G6Y A;  4MH3 A;  3QOU A;  3GHA A;  3HVN A;  3LGC A;  2VCV A;  3P2A A;  2HI7 A;  2UZ8 A;  2B5X A;  4BIK A;  3DVX A;  2HRK A;  3R2Q A;  2C0D A;  2C4J A;  4I6X A;  2YZU A;  3AY8 A;  4D73 A;  3LYP A;  2MBT A;  4CDO A;  5DJL A;  3VI7 A;  4I5Q A;  3TGZ A;  4F9Z A;  4HU7 A;  1A8Y A;  3QMX A;  5IMV A;  5D9X A;  2C80 A;  3D4M A;  3TKS A;  4WKW A;  2ZUP A;  4GWR A;  3LOR A;  1XWG A;  3NZN A;  5ECK B;  1QUW A;  3ZLP A;  2H8L A;  3FY7 A;  3IAM 2;  3V1W A;  2AHE A;  1SJI A;  1K0M A;  3F6F A;  4BVY B;  5G2Z A;  1TXX A;  2VD1 A;  4YQV A;  1SJZ A;  5IO2 A;  4CHS A;  4DSQ A;  2X99 A;  2CX3 A;  2KP2 A;  2P0G A;  4N0Z A;  5ENU A;  2NPB A;  3EU4 A;  5COH A;  1A2J A;  3M1G A;  5AN1 A;  1A8L A;  4HOJ A;  2ON5 A;  1AAZ A;  1TRV A;  2LJA A;  1SL1 B;  2FA8 A;  3TCO A;  1SYR A;  3TJG A;  4K5S A;  1YF0 A;  3K8N A;  1PX6 A;  1TP9 A;  1XWC A;  3GTU A;  2X8H A;  2CA8 A;  3GKK A;  5G1K A;  5JWQ B;  3S9F A;  3PPU A;  5ECN B;  3MWH A;  2YAN A;  5ELA A;  3TRX A;  3GYK A;  2MYG A;  2OE3 A;  3N5O A;  4EKZ A;  1ZL9 A;  1QFN A;  3CXG A;  4MP4 A;  2LS5 A;  5HR0 A;  3I69 A;  3UIW A;  1O8X A;  4PXO A;  2DIY A;  2H01 A;  1YEP A;  2MZC A;  4HSC X;  1PL1 A;  3TJK A;  2VL2 A;  1XWK A;  3FHK A;  3HA9 A;  1VF4 A;  1FVK A;  1G6W A;  4AJ7 A;  5INY A;  5D9W A;  2H75 A;  1C72 A;  4JRR A;  4YQU A;  5IMF A;  3U6V A;  4TN8 A;  4NV5 A;  4J56 E;  2WRT A;  1OKT A;  1WIK A;  2REM A;  4RI6 A;  2E2M A;  2YZH A;  3WGD A;  4JR4 A;  5IIZ A;  4WR4 A;  4PQ1 A;  4MJA A;  3F4R A;  2AYT A;  1Q98 A;  1ERW A;  1XOB A;  1U3I A;  2B1L A;  2LRN A;  4BL7 B;  3LQ7 A;  2FWH A;  1PMT A;  2NVL A;  4USS A;  4I97 A;  4MF7 A;  5FT3 A;  3ME7 A;  3EUR A;  1LU4 A;  4Z2T A;  4MK3 A;  2VLT A;  2PMT A;  2DJ2 A;  2PUK C;  1M3I A;  3CTF A;  3GL5 A;  2O7K A;  1SKW B;  1NSW A;  4HZ4 A;  2O89 A;  2O8V B;  4G19 A;  4PX1 A;  3F0I A;  2CAI A;  5BMU A;  2DLX A;  4OMV A;  1AC1 A;  2B3S A;  2VCW A;  4FYU A;  1GSQ A;  4KCA A;  3A5W A;  4WBR D;  3GH9 A;  3QCP A;  1MDI A;  4L8E A;  1GP1 A;  1FOV A;  2H70 A;  2XBI A;  3M9J A;  1HNB A;  5KN1 A;  2HNL A;  1M0U A;  2FLS A;  3TKS C;  3O6T A;  4MNN A;  5L71 A;  1EP8 A;  1OYJ A;  1TU8 A;  1M3J A;  4IHU A;  1THX A;  4ID0 A;  3UAP A;  1A2L A;  1ACV A;  2AAW A;  2HRN A;  1ERV A;  1SL2 B;  3IOS A;  4I2U A;  2J9H A;  5J5N A;  3EE2 A;  2IPA A;  3IE3 A;  3O3T A;  3QD9 A;  5DQS A;  1BQ7 A;  3IXR A;  1Y6E A;  2GSS A;  5DAL B;  2LTK A;  4LL1 B;  4PNF A;  3DEX A;  2I4A A;  1XBS A;  1X5E A;  1FB0 A;  3D5J A;  4IJ3 A;  1EV4 A;  3MSZ A;  2B7K A;  1H4O A;  3IC8 A;  3VK9 A;  3UBL A;  1UVZ A;  1XPV A;  2VCQ A;  3FZA A;  3FYG A;  3TUE A;  5GZZ B;  5J3R A;  5IQY A;  1FVJ A;  1F3B A;  4J57 E;  2R3X A;  1A2M A;  2AV4 A;  1EZK A;  2VL3 A;  5ECL B;  2P5Q A;  2K6V A;  1NM3 A;  2BJX A;  14GS A;  1LBK A;  1GLP A;  3RDW A;  3CSJ A;  4GST A;  1V9W A;  2QC7 A;  1TRS A;  2HE3 A;  2B7J A;  3CQF A;  2VL2 C;  1YDK A;  1U6T A;  4GLT A;  4CY6 A;  4JR6 A;  1U88 A;  3UAR A;  1Z6N A;  4KH7 A;  2XBQ A;  5ECS A;  5FWG A;  5GST A;  6GSU A;  3ISO A;  4BWS A;  1MEK A;  3GFK A;  2LRC A;  4XS4 B;  5ECO B;  2IL3 A;  1RK4 A;  1G0T A;  1HNA A;  3ERG A;  4PNG A;  2FCH A;  5JCU A;  1PN0 A;  3W6G A;  5H5Q A;  4RI7 A;  2IFQ B;  4WF4 A;  3HVX A;  1V40 A;  2QA2 A;  1FG4 A;  4O92 A;  2PBJ A;  4DSS A;  1PQN A;  4EDY A;  1ON4 A;  4L0U A;  8GSS A;  3M3M A;  3TOU A;  1NHO A;  2VOC A;  1J0F A;  2L4C A;  1TKD B;  2OBK A;  4LMV A;  4QL9 A;  1ZYP A;  1PRX A;  4F0C A;  4Z7X A;  1GNE A;  2LEG A;  3GH6 A;  2PVO C;  2F9S A;  4IP1 A;  2IWT A;  2GLR A;  1XVW A;  1GLQ A;  19GS A;  3TKR A;  4DEJ A;  5ID2 B;  2WGR A;  1XW5 A;  2GDR A;  4TXO A;  4BPY A;  2CVB A;  3EIN A;  3LXT A;  1MD4 A;  3HVV A;  2D2Z A;  2FHE A;  3ERF A;  1SK1 A;  4I2T A;  2LJR A;  4MPF A;  4K0G A;  13GS A;  2IME A;  4QL7 A;  4EC0 A;  2XPD A;  1K0O A;  5H5S A;  2L57 A;  1GTB A;  1TTZ A;  2DMM A;  2G0F A;  4HDE A;  4XIH A;  3GKN A;  1THO A;  5B6N A;  4HI7 A;  1Z5Y E;  1R5A A;  5DBQ A;  3D0Z A;  1XWB A;  2WCI A;  1T1V A;  5LD0 A;  4GSN A;  1R7H A;  4GRF A;  4MPG A;  4RQR A;  3DVW A;  3FMW A;  4IEL A;  3WYW A;  2TIR A;  3UL3 A;  1M9B A;  5ABR A;  4HQS A;  1OC9 B;  2YV7 A;  3G7J A;  2LNT A;  3QAG A;  3ZFL A;  1PGT A;  3DWV A;  6GSV A;  4L0W A;  3CRU A;  4ECB A;  5CYY A;  1M9A A;  1WPI A;  4X0X A;  2OE1 A;  4MH2 A;  5DAK B;  2DJ1 A;  2V6O A;  1QK8 A;  3A3T A;  2YWN A;  4XRD A;  1XG8 A;  3ZIV A;  1EEJ A;  3E0U A;  1ERU A;  4YQM A;  1GNW A;  2CX4 A;  2OJL A;  3SBC A;  5A4U A;  4E8E A;  2DSA A;  3NIV A;  4OO4 A;  1GL8 A;  1F9M A;  4IN0 A;  4ULX A;  2PN8 A;  11GS A;  1BYE A;  2DML A;  6GSW A;  1UA5 A;  2GGT A;  3HJO A;  2MMA A;  5D93 A;  3KP8 A;  4KUN A;  1FOH A;  4J2F A;  5F0G A;  2JZT A;  2OA7 A;  4MZB A;  2GSR A;  2RUE A;  2H76 A;  1O73 A;  2F3M A;  1GSD A;  1GWC A;  3G9B A;  2H6X A;  3ZL5 A;  4XRA A;  5D9V A;  3U5R E;  2HRA A;  1A24 A;  2IMF A;  4V2L A;  1SEN A;  1PSQ A;  2OBI A;  1JFU A;  3DYR A;  5ECM B;  1T7P B;  2VUP A;  2JU5 A;  2JSY A;  2DJK A;  4KDY A;  1XVQ A;  3QR6 A;  3QDN A;  4TW5 A;  1MDJ A;  3QFB C;  1K0N A;  2H0G A;  1TI1 A;  5KOW A;  5EPF A;  3HJP A;  2EIQ A;  2AJQ B;  2C8U A;  3IK9 A;  3ZRD A;  2WS2 A;  2A2P A;  1ZZY A;  1DE2 A;  1F2E A;  3H93 A;  4PQH A;  22GS A;  2FWF A;  5CP1 A;  1BG5 A;  2C0E A;  4TR1 B;  4KW6 A;  4TR4 A;  1EP7 A;  1K0B A;  4MJE A;  2RII A;  5DCH A;  1QQ2 A;  5A4V A;  5IPG A;  3EWL A;  4BVX A;  4DVC A;  2CV4 A;  2M80 A;  4NHW A;  2CAQ A;  1O85 A;  2HZE A;  3PGT A;  1ST9 A;  1SU9 A;  3ZMK A;  4KF9 A;  4P3Y B;  2E7P A;  4PUA A;  2GVP A;  1GUK A;  3HKR A;  5ECR B;  4IVF A;  2HSY A;  1Z3E A;  2YNX A;  4XS1 A;  4ZL8 A;  3KXO A;  3VWU A;  1OC8 A;  4JED A;  5ELG A;  1SYX A;  1NHY A;  2QSI A;  2A4H A;  1SK2 A;  1ILO A;  2IN3 A;  1WJK A;  4WEY A;  3TJB A;  3BJ5 A;  4KX4 A;  4GCI A;  3WD6 A;  5JWO B;  4F03 A;  3TB2 A;  1X5C A;  4PTS A;  1PD2 1;  3HZ4 A;  3Q74 A;  3E3E A;  4NV2 A;  1ABA A;  2H30 A;  3A2X A;  4I8B A;  4POK A;  1AXD A;  2O85 A;  2RUF A;  3IHG A;  3RPN A;  2YJ7 A;  2B5Y A;  5B7C A;  1H75 A;  4K8M A;  2ALB A;  3GX0 A;  3VPT A;  2GS3 A;  2I3Y A;  4DSR A;  2NDO A;  2F8A A;  2V32 A;  3F6D A;  5C00 A;  2MMZ A;  2JAD A;  1A0R P;  1U3A A;  3IR4 A;  2ZNM A;  3CMI A;  4K0N A;  2H1G A;  4RQX A;  2H1D A;  3DD3 A;  1YJ6 A;  2NBS A;  1CQH A;  4ZB8 A;  2M72 A;  1BX9 A;  1WWJ A;  3TKQ A;  1XZO A;  1Z6M A;  3GKX A;  4AJ6 A;  4ZIL A;  2VCZ A;  20GS A;  2HT9 A;  4BWQ A;  3FK8 A;  4HZ2 A;  3J7Y b;  1XWA A;  1YQ1 A;  1YF1 A;  4N30 A;  4OD7 A;  1FW1 A;  2I9H A;  4GF0 A;  4HEA 2;  5EL8 A;  1YEX A;  4XHM A;  3ME8 A;  2MMO A;  3F4S A;  1XW6 A;  2OE0 A;  3C8E A;  3J7Y k;  2GZZ A;  1ZGN A;  2H73 A;  4V1A p;  1S3C A;  2GZP A;  2HRF A;  4O7H A;  1K3O A;  3TOT A;  2MBS A;  3APO A;  1JLV A;  2R5G A;  1WMJ A;  2HSH A;  3TDG A;  3UBK A;  3I43 A;  2L5L A;  3A5I A;  1S3D A;  4EF0 A;  3Q18 A;  2FUG 2;  2VLV A;  1IYH A;  4CY8 A;  4H86 A;  4MJC A;  2IMI A;  1PL2 A;  1T8E B;  1JLW A;  2VD0 A;  3IC4 A;  4JZQ A;  1YKA A;  3IV4 A;  1GH2 A;  1Z7R A;  5DJM A;  3IA1 A;  3RHB A;  4Z2R A;  1MDK A;  2HSM A;  3N9J A;  5CO3 A;  1Q4J A;  3L9U A;  4ZL7 A;  4GQF A;  1W89 A;  1HYU A;  5IMZ A;  3EMX A;  4TKY A;  4WF5 A;  1V2A A;  3RHC A;  1S3R A;  4Z2U A;  4MJB A;  2LNS A;  1HD2 A;  1T00 A;  4D73 B;  2LST A;  2H0H A;  2KP1 A;  1J9B A;  1FB6 A;  2H6Y A;  2QA1 A;  1ZYQ B;  4OCF A;  3LJR A;  2ZCT A;  1JZD A;  4ECI A;  4LA1 A;  4OFM A;  2VM2 A;  5J9B A;  3GKM A;  1B48 A;  1XW9 A;  1K3Y A;  1I5G A;  4OFT A;  2IMK A;  5IMA A;  4N10 A;  2PU9 C;  3G7I A;  3ZML A;  1FHE A;  1XFL A;  2FD3 A;  3GSS A;  3VPQ A;  3KCM A;  5GAP D;  1VRS D;  2VCX A;  5JCG A;  17GS A;  3APS A;  1QGV A;  5CRW A;  3LXZ A;  4IS0 A;  5HFK A;  5CRH A;  3R3E A;  2HFD A;  4BVY A;  4KB3 A;  1X9S B;  2WDU A;  2E0Q A;  3E9J B;  4IBP A;  1SL0 B;  4TVE A;  4K7N A;  4EVM A;  2FA4 A;  3KM6 A;  2LQQ A;  4TR3 A;  5AIX A;  3VWW A;  3GTU B;  1JZR A;  1M99 A;  3UOM A;  4HJ2 A;  1Z9H A;  5IMC A;  1VF3 A;  3H79 A;  3MNG A;  4K1F A;  4A5P A;  1TJD A;  3QPM A;  2FNO A;  1TRW A;  5HFG A;  4G0I A;  2R0C A;  4MLY A;  4FO5 A;  1BAY A;  2I1U A;  2B6M A;  1SD9 A;  4K6X A;  3EYT A;  1PFO A;  2H1B A;  1PKZ A;  12GS A;  1UN2 A;  3EVI A;  3FRC A;  2RM5 A;  4Q5F A;  4ECJ A;  1GUH A;  4O5U A;  5IMD A;  3GV1 A;  2VLU A;  1N8J A;  2GT6 A;  3D4T A;  3TRP A;  1IYI A;  4OWY A;  4YAP A;  5IM9 A;  3C1R A;  3D21 A;  2V41 A;  3DML A;  4X1U A;  1EOH A;  3C71 A;  3BCK A;  3EPT A;  5CNW A;  1ZOF A;  3W8J A;  5DCG A;  2L59 A;  1R4W A;  4NAX A;  1K0D A;  3JCM L;  3TKS E;  1GSY A;  4ILF A;  3IPZ A;  4ICY A;  5BRT A;  3H4K A;  3GX8 A;  3PR8 A;  3KMO A;  4KSM A;  3WGX A;  3C1S A;  3P7X A;  2CVK A;  2HZF A;  5F06 A;  1MTC A;  3TKP A;  3MDK A;  3VI5 A;  5LNK e;  3L0H A;  4MF5 A;  5LCZ A;  3C73 A;  2GQK A;  3F9U A;  5HR3 A;  1G7E A;  3FR6 A;  5J41 A;  5B8B A;  2BMX A;  4FYB A;  5CRE A;  4BL7 A;  1GRX A;  4MF6 A;  3FZ9 A;  1DBY A;  1KTE A;  1J08 A;  4ZB6 A;  3UVT A;  3ZZX A;  2V1M A;  1WOU A;  2YWO A;  3NOF A;  1SK0 A;  3F4T A;  2KLX A;  2ON7 A;  2JAC A;  2P5R A;  1OE7 A;  3UVH A;  4K2X A;  3VFI A;  2IMD A;  3F63 A;  4EL1 A;  4BA7 A;  4MDC A;  5G30 A;  2LKU A;  2RM6 A;  5A5K A;  5ECQ B;  3ZFB A;  4IQ1 A;  2CQ9 A;  4F82 A;  2PPT A;  1TOF A;  4AF2 A;  2A4V A;  2R0G A;  1R5P A;  3L9S A;  5J9C A;  2JZR A;  2L6C A;  4G10 A;  2X64 A;  4IJI A;  3MIX A;  3GIX A;  3WT2 A;  5IOW A;  3TRQ A;  1V58 A;  2B1K A;  4XTS A;  2M46 A;  3QAW A;  1B4Q A;  5J4U A;  3ED3 A;  2GQL A;  3HXS A;  3KGK A;  4WXT A;  4O5R A;  3I6A A;  5D96 A;  3HDC A;  3ZIT A;  4POL A;  3BOA A;  2VO4 A;  4FYC A;  5A4W A;  5EVO A;  2C3T A;  2CT6 A;  3APQ A;  4O5Q A;  2A2R A;  1QXH A;  4Q5Q A;  2JSZ A;  4IP6 A;  1SD8 A;  1O7U A;  3VLN A;  4YKG A;  2H19 A;  1N2A A;  3UJ1 A;  1GSE A;  2VM1 A;  3LYK A;  5E4W A;  1TDI A;  5DAL A;  3GUS A;  2FWG A;  1G7O A;  4POM A;  3GMF A;  4YH2 A;  1FO5 A;  5KEJ A;  3BCI A;  4HQZ A;  5F07 A;  3UMA A;  4ZBB A;  2PWJ A;  1I9D A;  10GS A;  1AUC A;  1OVN A;  1WRY A;  3ZRE A;  2JL4 A;  3M0F A;  4EUY A;  1B4P A;  3RBT A;  2EIO A;  4PUR A;  5AIV A;  1ZMA A;  1X0R A;  1AQX A;  4L5O A;  1GSF A;  1X9M B;  1TK8 B;  4YAV A;  2C3N A;  3M8N A;  1TI3 A;  2EC4 A;  2K18 A;  5D9T A;  4JU5 A;  2QGV A;  1ERT A;  4G0L A;  9GSS A;  3LEF A;  1Z7P A;  1M2B A;  4TXV A;  1TK0 B;  4ISD A;  2DJ3 A;  1ZYN A;  2YJH A;  1USB A;  5KOX A;  4XS4 A;  3HCZ A;  4K7I A;  1UC7 A;  5EY6 A;  3KTL A;  2ES7 A;  3F8U A;  4DSS B;  2C0F A;  3GUR A;  2R2J A;  5JCW A;  3SWL A;  2H1A A;  1NW2 A;  2IFQ A;  3F3R A;  1SJ6 A;  3ZYW A;  1DE1 A;  2YOI A;  4OFN A;  1EGR A;  2AB6 A;  5KN2 A;  5ECI B;  4ZIJ A;  1OAZ A;  2CZ3 A;  2TRC P;  4X43 A;  1EWX A;  2WUL A;  4WBJ A;  3Q19 A;  3FR3 A;  2C1Y A;  3DKS A;  2R0P A;  4KA0 A;  4TXO B;  4IGJ A;  1KBN A;  2DKH A;  6GSS A;  3KJY A;  1HNC A;  3KH7 A;  1MD3 A;  2H71 A;  4IW9 A;  4PUF C;  3UEM A;  4G0K A;  2OKA A;  1PKW A;  4ECC A;  4ZL9 A;  5KN0 A;  5ID2 A; 
#chains in the Genus database with same CATH homology
 1SKR B;  1XXU A;  2DJJ A;  3W8S A;  2P31 A;  4EO3 A;  2DKI A;  1EEM A;  1BJX A;  3KZQ A;  3DIE A;  3IK7 A;  1RW1 A;  4KDX A;  4K9Z A;  3QAV A;  2YWI A;  3RPP A;  4EIP A;  4ZBD A;  2HYX A;  1TRU A;  2XC2 A;  1OE8 A;  3ERW A;  1EV9 A;  1T4Y A;  1BED A;  3HHV A;  4HUA A;  2KUC A;  2L5O A;  2GST A;  5DVB A;  1O81 A;  2NTO A;  3QFA C;  1S3A A;  1XCC A;  1B9X C;  3FZ4 A;  1EOG A;  2LV3 A;  3LFL A;  1DUG A;  3GST A;  1T3B A;  5ECH B;  2FY6 A;  1AW9 A;  3IBH A;  3MYD A;  1K3L A;  4ACS A;  3PIN A;  3CSI A;  5HR2 A;  3P90 A;  2KHP A;  1E2Y A;  2H66 A;  4AJ8 A;  2H0I A;  5B8A A;  4XCS A;  1Y25 A;  1KEB A;  2DBC A;  5B6M A;  3DXB A;  1OC9 A;  2L4Q A;  1W4V A;  3LG6 A;  3HD5 A;  2GQM A;  4NHZ A;  2YN1 A;  1TW9 A;  2N5F A;  3F3Q A;  4LMW A;  1GTA A;  3CTG A;  3L78 A;  2X8G A;  3BBY A;  6GST A;  4ML6 A;  2L6D A;  4F0B A;  2VL9 A;  3OR5 A;  5DAK A;  4MZC A;  1PX7 A;  1JHB A;  1DSB A;  4FIW A;  5IO0 A;  3M9K A;  2YCD A;  3O76 A;  4EE0 A;  3KIJ A;  3CRT A;  4X4J A;  2JZS A;  2R4V A;  5HFI A;  5HQP A;  3H1N A;  2C3Q A;  1U87 A;  4MCU A;  4RUV A;  2V6K A;  6GSX A;  4JE1 A;  5DQY A;  3PH9 A;  3MAK A;  4WET A;  2WB9 A;  4NXI A;  4EXJ A;  5G5E A;  1AQV A;  2C0G A;  1F37 A;  3VWX A;  5HR1 A;  1GUL A;  2B5E A;  4MMM A;  1GTU A;  4ZXG A;  4ZB9 A;  1X9W B;  4PQI A;  5F8B A;  3EC3 A;  2PGT A;  3GRX A;  3HY2 A;  1EGO A;  3WGE A;  3CSH A;  4KE3 A;  4F2I A;  2CZ2 A;  4KSO A;  3FEU A;  5GAN D;  5CRD A;  2RLI A;  3VUR A;  1YY7 A;  1E6B A;  2VAF A;  3GL3 A;  2XHF A;  4OO5 A;  4KCE A;  3GA4 A;  4G2E A;  1VF1 A;  4GTU A;  2VIM A;  2FWE A;  4AGS A;  1TK5 B;  4LL4 B;  1YKC A;  5CAX A;  18GS A;  3RAZ A;  4KDU A;  1A23 A;  2DC5 A;  4EIQ A;  1XOA A;  5CRG A;  4XS6 A;  3CYN A;  1CQG A;  3ZTL A;  4TOP A;  2R37 A;  2H6Z A;  5FHI A;  3EU3 A;  3LSZ A;  5ECP B;  1K0A A;  3IRA A;  3I9V 2;  3D22 A;  4KAE A;  2YP6 A;  3KP9 A;  2GT5 A;  1KNG A;  4BVX B;  2CVD A;  1GSU A;  2YPM A;  1VF2 A;  3FKF A;  1GTI A;  16GS A;  2XPE A;  4TR1 A;  2HZE B;  3TJF A;  4E8H A;  3ZVJ D;  4K5R A;  4FH8 A;  1URM A;  4POB A;  5DDL A;  4MZW A;  5G5F A;  5G31 A;  1ML6 A;  3GN3 A;  2HLS A;  4ZBA A;  2FGX A;  2LRT A;  2OAD A;  1A0F A;  2X8C A;  5H5R A;  2GTU A;  2K8S A;  2N5A A;  3G7Y A;  4CW9 A;  4G9H A;  2AUV A;  4V2N A;  4TRX A;  3DRN A;  1O8W A;  4HU9 A;  3KD0 A;  4OCE A;  1M7T A;  3ZVJ A;  1JZW A;  2IJY A;  3FW2 A;  2J23 A;  4K2D A;  3IHQ A;  3EMP A;  5KN3 A;  1XIY A;  2DIZ A;  1VGL A;  3FR9 A;  1B8X A;  4QQ7 A;  1V57 A;  1F3A A;  2H72 A;  2EIR A;  1OKD A;  4NPB A;  2GSQ A;  1LJR A;  4K7O A;  2GZY A;  4WR5 A;  1V98 A;  2OAC A;  1SKS B;  5JWR B;  5G1L A;  3GNJ A;  5AGY A;  1B9Y C;  4ML1 A;  3A2W A;  4EDZ A;  3WT1 A;  4YKF A;  1AQW A;  1R26 A;  3DGQ A;  2HXK A;  3HZ8 A;  3HYP A;  1F6M C;  3VWV A;  4MAB A;  4IQA A;  3ZIJ A;  1M2A A;  4PGT A;  3FZ5 A;  2N5B A;  2V2G A;  4TR0 A;  2G2Q A;  1QMV A;  4V2M A;  3BD2 A;  2WJU A;  2TRX A;  2X49 A;  2KOK A;  3KEB A;  4JBB A;  3HJM A;  3KTB A;  4V1A g;  2MMN A;  4LLR A;  3H8Q A;  3D6I A;  1GSS A;  2E2G A;  3CBU A;  4L5L A;  1ZCP A;  2QKE A;  4N11 A;  3US3 A;  4FQU A;  1RQM A;  1PN9 A;  3IAS 2;  3C7M A;  4GXZ A;  2K9F A;  5F05 A;  7GSS A;  1WE0 A;  1OC3 A;  3L9V A;  2LUS A;  3LW9 A;  1T4Z A;  4NWY A;  4Q5N A;  1YZX A;  1M2D A;  1ZYE A;  1K0C A;  1FAA A;  4HS1 A;  4MA9 A;  1JZO A;  5IPH A;  6GSY A;  2VCT A;  3KH9 A;  2LJK A;  4NMU A;  1HQO A;  2YV9 A;  3A2V A;  2F8F A;  1GUM A;  5D8I A;  5E59 A;  3IDV A;  2F51 A;  1O6J A;  5AIS A;  1TU7 A;  2PVQ A;  2K8V A;  5IOX A;  2WFC A;  2A2S A;  3KMN A;  2R6K A;  4KND A;  2O87 A;  4GQC A;  3Q6O A;  2BTO T;  5D73 A;  4Q5R A;  1X5D A;  3TJJ A;  3L4N A;  2IIY A;  1WP0 A;  2DJ0 A;  3HVS A;  4O32 A;  2Z9S A;  2PER A;  2YWM A;  4N0V A;  4IKH A;  2I81 A;  1AIU A;  1PA3 A;  2LQO A;  5C04 A;  4KGI A;  3P8W A;  5GSS A;  3LWA A;  2WZ9 A;  4HJM A;  2H74 A;  2X4A A;  4GSS A;  1G6Y A;  4MH3 A;  3QOU A;  3GHA A;  3LGC A;  2VCV A;  3P2A A;  2HI7 A;  2UZ8 A;  2B5X A;  3DVX A;  2HRK A;  3R2Q A;  2C0D A;  2C4J A;  4I6X A;  2YZU A;  3AY8 A;  4D73 A;  3LYP A;  2MBT A;  4CDO A;  5DJL A;  3VI7 A;  4I5Q A;  3TGZ A;  4F9Z A;  4HU7 A;  1A8Y A;  3QMX A;  5IMV A;  5D9X A;  2C80 A;  3D4M A;  3TKS A;  4WKW A;  2ZUP A;  4GWR A;  3LOR A;  1XWG A;  3NZN A;  5ECK B;  1QUW A;  3ZLP A;  2H8L A;  3FY7 A;  3IAM 2;  3V1W A;  2AHE A;  1SJI A;  1K0M A;  3F6F A;  4BVY B;  5G2Z A;  1TXX A;  2VD1 A;  4YQV A;  1SJZ A;  5IO2 A;  4CHS A;  4DSQ A;  2X99 A;  2CX3 A;  2KP2 A;  2P0G A;  4N0Z A;  5ENU A;  2NPB A;  3EU4 A;  5COH A;  1A2J A;  3M1G A;  5AN1 A;  1A8L A;  4HOJ A;  2ON5 A;  1AAZ A;  1TRV A;  2LJA A;  1SL1 B;  2FA8 A;  3TCO A;  1SYR A;  3TJG A;  4K5S A;  1YF0 A;  3K8N A;  1PX6 A;  1TP9 A;  1XWC A;  3GTU A;  2X8H A;  2CA8 A;  3GKK A;  5G1K A;  5JWQ B;  3S9F A;  3PPU A;  5ECN B;  3MWH A;  2YAN A;  5ELA A;  3TRX A;  3GYK A;  2MYG A;  2OE3 A;  3N5O A;  4EKZ A;  1ZL9 A;  1QFN A;  3CXG A;  4MP4 A;  2LS5 A;  5HR0 A;  3I69 A;  3UIW A;  1O8X A;  4PXO A;  2DIY A;  2H01 A;  1YEP A;  2MZC A;  1PL1 A;  3TJK A;  2VL2 A;  1XWK A;  3FHK A;  3HA9 A;  1VF4 A;  1FVK A;  1G6W A;  4AJ7 A;  5INY A;  5D9W A;  2H75 A;  1C72 A;  4JRR A;  4YQU A;  5IMF A;  3U6V A;  4TN8 A;  4NV5 A;  4J56 E;  2WRT A;  1OKT A;  1WIK A;  2REM A;  4RI6 A;  2E2M A;  2YZH A;  3WGD A;  4JR4 A;  5IIZ A;  4WR4 A;  4PQ1 A;  4MJA A;  3F4R A;  2AYT A;  1Q98 A;  1ERW A;  1XOB A;  1U3I A;  2B1L A;  2LRN A;  4BL7 B;  3LQ7 A;  2FWH A;  1PMT A;  2NVL A;  4USS A;  4I97 A;  4MF7 A;  5FT3 A;  3ME7 A;  3EUR A;  1LU4 A;  4Z2T A;  4MK3 A;  2VLT A;  2PMT A;  2DJ2 A;  2PUK C;  3CTF A;  3GL5 A;  2O7K A;  1SKW B;  1NSW A;  4HZ4 A;  2O89 A;  2O8V B;  4G19 A;  4PX1 A;  3F0I A;  2CAI A;  5BMU A;  2DLX A;  4OMV A;  1AC1 A;  2B3S A;  2VCW A;  4FYU A;  1GSQ A;  4KCA A;  3A5W A;  4WBR D;  3GH9 A;  3QCP A;  1MDI A;  4L8E A;  1GP1 A;  1FOV A;  2H70 A;  2XBI A;  3M9J A;  1HNB A;  5KN1 A;  2HNL A;  1M0U A;  2FLS A;  3TKS C;  3O6T A;  4MNN A;  5L71 A;  1EP8 A;  1OYJ A;  1TU8 A;  4IHU A;  1THX A;  4ID0 A;  3UAP A;  1A2L A;  1ACV A;  2AAW A;  2HRN A;  1ERV A;  1SL2 B;  3IOS A;  4I2U A;  2J9H A;  5J5N A;  3EE2 A;  2IPA A;  3IE3 A;  3O3T A;  3QD9 A;  5DQS A;  1BQ7 A;  3IXR A;  1Y6E A;  2GSS A;  5DAL B;  2LTK A;  4LL1 B;  4PNF A;  3DEX A;  2I4A A;  1XBS A;  1X5E A;  1FB0 A;  3D5J A;  4IJ3 A;  1EV4 A;  3MSZ A;  2B7K A;  1H4O A;  3IC8 A;  3VK9 A;  3UBL A;  1UVZ A;  1XPV A;  2VCQ A;  3FZA A;  3FYG A;  3TUE A;  5GZZ B;  5J3R A;  5IQY A;  1FVJ A;  1F3B A;  4J57 E;  2R3X A;  1A2M A;  2AV4 A;  1EZK A;  2VL3 A;  5ECL B;  2P5Q A;  2K6V A;  1NM3 A;  2BJX A;  14GS A;  1LBK A;  1GLP A;  3RDW A;  3CSJ A;  4GST A;  1V9W A;  2QC7 A;  1TRS A;  2HE3 A;  2B7J A;  2VL2 C;  1YDK A;  1U6T A;  4GLT A;  4CY6 A;  4JR6 A;  1U88 A;  3UAR A;  1Z6N A;  4KH7 A;  2XBQ A;  5ECS A;  5FWG A;  5GST A;  6GSU A;  3ISO A;  4BWS A;  1MEK A;  3GFK A;  2LRC A;  4XS4 B;  5ECO B;  2IL3 A;  1RK4 A;  1G0T A;  1HNA A;  3ERG A;  4PNG A;  2FCH A;  5JCU A;  1PN0 A;  3W6G A;  5H5Q A;  4RI7 A;  2IFQ B;  4WF4 A;  3HVX A;  1V40 A;  2QA2 A;  1FG4 A;  4O92 A;  2PBJ A;  4DSS A;  1PQN A;  4EDY A;  1ON4 A;  4L0U A;  8GSS A;  3M3M A;  3TOU A;  1NHO A;  2VOC A;  1J0F A;  2L4C A;  1TKD B;  2OBK A;  4LMV A;  4QL9 A;  1ZYP A;  1PRX A;  4F0C A;  4Z7X A;  1GNE A;  2LEG A;  3GH6 A;  2PVO C;  2F9S A;  4IP1 A;  2IWT A;  2GLR A;  1XVW A;  1GLQ A;  19GS A;  3TKR A;  4DEJ A;  5ID2 B;  2WGR A;  1XW5 A;  2GDR A;  4TXO A;  4BPY A;  2CVB A;  3EIN A;  3LXT A;  1MD4 A;  3HVV A;  2D2Z A;  2FHE A;  3ERF A;  1SK1 A;  4I2T A;  2LJR A;  4MPF A;  4K0G A;  13GS A;  2IME A;  4QL7 A;  4EC0 A;  2XPD A;  1K0O A;  5H5S A;  2L57 A;  1GTB A;  1TTZ A;  2DMM A;  2G0F A;  4HDE A;  4XIH A;  3GKN A;  1THO A;  5B6N A;  4HI7 A;  1Z5Y E;  1R5A A;  5DBQ A;  3D0Z A;  1XWB A;  2WCI A;  1T1V A;  5LD0 A;  4GSN A;  1R7H A;  4GRF A;  4MPG A;  4RQR A;  3DVW A;  3FMW A;  4IEL A;  3WYW A;  2TIR A;  3UL3 A;  1M9B A;  5ABR A;  4HQS A;  1OC9 B;  2YV7 A;  3G7J A;  2LNT A;  3QAG A;  3ZFL A;  1PGT A;  3DWV A;  6GSV A;  4L0W A;  3CRU A;  4ECB A;  5CYY A;  1M9A A;  1WPI A;  4X0X A;  2OE1 A;  4MH2 A;  5DAK B;  2DJ1 A;  2V6O A;  1QK8 A;  3A3T A;  2YWN A;  4XRD A;  3ZIV A;  1EEJ A;  3E0U A;  1ERU A;  4YQM A;  1GNW A;  2CX4 A;  2OJL A;  3SBC A;  5A4U A;  4E8E A;  2DSA A;  3NIV A;  4OO4 A;  1GL8 A;  1F9M A;  4IN0 A;  4ULX A;  2PN8 A;  11GS A;  1BYE A;  2DML A;  6GSW A;  1UA5 A;  2GGT A;  3HJO A;  2MMA A;  5D93 A;  3KP8 A;  4KUN A;  1FOH A;  4J2F A;  5F0G A;  2JZT A;  2OA7 A;  4MZB A;  2GSR A;  2RUE A;  2H76 A;  1O73 A;  2F3M A;  1GSD A;  1GWC A;  3G9B A;  2H6X A;  3ZL5 A;  4XRA A;  5D9V A;  3U5R E;  2HRA A;  1A24 A;  2IMF A;  4V2L A;  1SEN A;  1PSQ A;  2OBI A;  1JFU A;  3DYR A;  5ECM B;  1T7P B;  2VUP A;  2JU5 A;  2JSY A;  2DJK A;  4KDY A;  1XVQ A;  3QR6 A;  3QDN A;  4TW5 A;  1MDJ A;  3QFB C;  1K0N A;  2H0G A;  1TI1 A;  5KOW A;  5EPF A;  3HJP A;  2EIQ A;  2AJQ B;  2C8U A;  3IK9 A;  3ZRD A;  2WS2 A;  2A2P A;  1ZZY A;  1DE2 A;  1F2E A;  3H93 A;  4PQH A;  22GS A;  2FWF A;  5CP1 A;  1BG5 A;  2C0E A;  4TR1 B;  4KW6 A;  4TR4 A;  1EP7 A;  1K0B A;  4MJE A;  2RII A;  5DCH A;  1QQ2 A;  5A4V A;  5IPG A;  3EWL A;  4BVX A;  4DVC A;  2CV4 A;  2M80 A;  4NHW A;  2CAQ A;  1O85 A;  2HZE A;  3PGT A;  1ST9 A;  1SU9 A;  3ZMK A;  4KF9 A;  4P3Y B;  2E7P A;  4PUA A;  2GVP A;  1GUK A;  3HKR A;  5ECR B;  4IVF A;  2HSY A;  1Z3E A;  2YNX A;  4XS1 A;  4ZL8 A;  3KXO A;  3VWU A;  1OC8 A;  4JED A;  5ELG A;  1SYX A;  1NHY A;  2QSI A;  2A4H A;  1SK2 A;  1ILO A;  2IN3 A;  1WJK A;  4WEY A;  3TJB A;  3BJ5 A;  4KX4 A;  4GCI A;  3WD6 A;  5JWO B;  4F03 A;  3TB2 A;  1X5C A;  4PTS A;  1PD2 1;  3HZ4 A;  3Q74 A;  3E3E A;  4NV2 A;  1ABA A;  2H30 A;  3A2X A;  4I8B A;  4POK A;  1AXD A;  2O85 A;  2RUF A;  3IHG A;  3RPN A;  2YJ7 A;  2B5Y A;  5B7C A;  1H75 A;  4K8M A;  2ALB A;  3GX0 A;  3VPT A;  2GS3 A;  2I3Y A;  4DSR A;  2NDO A;  2F8A A;  2V32 A;  3F6D A;  5C00 A;  2MMZ A;  2JAD A;  1A0R P;  1U3A A;  3IR4 A;  2ZNM A;  3CMI A;  4K0N A;  2H1G A;  4RQX A;  2H1D A;  3DD3 A;  1YJ6 A;  2NBS A;  1CQH A;  4ZB8 A;  2M72 A;  1BX9 A;  1WWJ A;  3TKQ A;  1XZO A;  1Z6M A;  3GKX A;  4AJ6 A;  4ZIL A;  2VCZ A;  20GS A;  2HT9 A;  4BWQ A;  3FK8 A;  4HZ2 A;  3J7Y b;  1XWA A;  1YQ1 A;  1YF1 A;  4N30 A;  4OD7 A;  1FW1 A;  2I9H A;  4GF0 A;  4HEA 2;  5EL8 A;  1YEX A;  4XHM A;  3ME8 A;  2MMO A;  3F4S A;  1XW6 A;  2OE0 A;  3C8E A;  3J7Y k;  2GZZ A;  1ZGN A;  2H73 A;  4V1A p;  1S3C A;  2GZP A;  2HRF A;  4O7H A;  1K3O A;  3TOT A;  2MBS A;  3APO A;  1JLV A;  2R5G A;  1WMJ A;  2HSH A;  3TDG A;  3UBK A;  3I43 A;  2L5L A;  3A5I A;  1S3D A;  4EF0 A;  3Q18 A;  2FUG 2;  2VLV A;  1IYH A;  4CY8 A;  4H86 A;  4MJC A;  2IMI A;  1PL2 A;  1T8E B;  1JLW A;  2VD0 A;  3IC4 A;  4JZQ A;  1YKA A;  3IV4 A;  1GH2 A;  1Z7R A;  5DJM A;  3IA1 A;  3RHB A;  4Z2R A;  1MDK A;  2HSM A;  3N9J A;  5CO3 A;  1Q4J A;  3L9U A;  4ZL7 A;  4GQF A;  1W89 A;  1HYU A;  5IMZ A;  3EMX A;  4TKY A;  4WF5 A;  1V2A A;  3RHC A;  4Z2U A;  4MJB A;  2LNS A;  1HD2 A;  1T00 A;  4D73 B;  2LST A;  2H0H A;  2KP1 A;  1J9B A;  1FB6 A;  2H6Y A;  2QA1 A;  1ZYQ B;  4OCF A;  3LJR A;  2ZCT A;  1JZD A;  4ECI A;  4LA1 A;  4OFM A;  2VM2 A;  5J9B A;  3GKM A;  1B48 A;  1XW9 A;  1K3Y A;  1I5G A;  4OFT A;  2IMK A;  5IMA A;  4N10 A;  2PU9 C;  3G7I A;  3ZML A;  1FHE A;  1XFL A;  2FD3 A;  3GSS A;  3VPQ A;  3KCM A;  5GAP D;  1VRS D;  2VCX A;  5JCG A;  17GS A;  3APS A;  1QGV A;  5CRW A;  3LXZ A;  4IS0 A;  5HFK A;  5CRH A;  3R3E A;  2HFD A;  4BVY A;  4KB3 A;  1X9S B;  2WDU A;  2E0Q A;  3E9J B;  4IBP A;  1SL0 B;  4TVE A;  4K7N A;  4EVM A;  2FA4 A;  3KM6 A;  2LQQ A;  4TR3 A;  5AIX A;  3VWW A;  3GTU B;  1JZR A;  1M99 A;  3UOM A;  4HJ2 A;  1Z9H A;  5IMC A;  1VF3 A;  3H79 A;  3MNG A;  4K1F A;  4A5P A;  1TJD A;  3QPM A;  2FNO A;  1TRW A;  5HFG A;  4G0I A;  2R0C A;  4MLY A;  4FO5 A;  1BAY A;  2I1U A;  2B6M A;  1SD9 A;  4K6X A;  3EYT A;  2H1B A;  1PKZ A;  12GS A;  1UN2 A;  3EVI A;  3FRC A;  2RM5 A;  4Q5F A;  4ECJ A;  1GUH A;  4O5U A;  5IMD A;  3GV1 A;  2VLU A;  1N8J A;  2GT6 A;  3D4T A;  3TRP A;  1IYI A;  4OWY A;  4YAP A;  5IM9 A;  3C1R A;  3D21 A;  2V41 A;  3DML A;  4X1U A;  1EOH A;  3C71 A;  3BCK A;  3EPT A;  5CNW A;  1ZOF A;  3W8J A;  5DCG A;  2L59 A;  1R4W A;  4NAX A;  1K0D A;  3JCM L;  3TKS E;  1GSY A;  4ILF A;  3IPZ A;  4ICY A;  5BRT A;  3H4K A;  3GX8 A;  3PR8 A;  3KMO A;  4KSM A;  3WGX A;  3C1S A;  3P7X A;  2CVK A;  2HZF A;  5F06 A;  1MTC A;  3TKP A;  3MDK A;  3VI5 A;  5LNK e;  3L0H A;  4MF5 A;  5LCZ A;  3C73 A;  2GQK A;  3F9U A;  5HR3 A;  1G7E A;  3FR6 A;  5J41 A;  5B8B A;  2BMX A;  4FYB A;  5CRE A;  4BL7 A;  1GRX A;  4MF6 A;  3FZ9 A;  1DBY A;  1KTE A;  1J08 A;  4ZB6 A;  3UVT A;  3ZZX A;  2V1M A;  1WOU A;  2YWO A;  3NOF A;  1SK0 A;  3F4T A;  2KLX A;  2ON7 A;  2JAC A;  2P5R A;  1OE7 A;  3UVH A;  4K2X A;  3VFI A;  2IMD A;  3F63 A;  4EL1 A;  4BA7 A;  4MDC A;  5G30 A;  2LKU A;  2RM6 A;  5A5K A;  5ECQ B;  3ZFB A;  4IQ1 A;  2CQ9 A;  4F82 A;  2PPT A;  1TOF A;  4AF2 A;  2A4V A;  2R0G A;  1R5P A;  3L9S A;  5J9C A;  2JZR A;  2L6C A;  4G10 A;  2X64 A;  4IJI A;  3MIX A;  3GIX A;  3WT2 A;  5IOW A;  3TRQ A;  1V58 A;  2B1K A;  4XTS A;  2M46 A;  3QAW A;  1B4Q A;  5J4U A;  3ED3 A;  2GQL A;  3HXS A;  3KGK A;  4WXT A;  4O5R A;  3I6A A;  5D96 A;  3HDC A;  3ZIT A;  4POL A;  3BOA A;  2VO4 A;  4FYC A;  5A4W A;  5EVO A;  2C3T A;  2CT6 A;  3APQ A;  4O5Q A;  2A2R A;  1QXH A;  4Q5Q A;  2JSZ A;  4IP6 A;  1SD8 A;  1O7U A;  3VLN A;  4YKG A;  2H19 A;  1N2A A;  3UJ1 A;  1GSE A;  2VM1 A;  3LYK A;  5E4W A;  1TDI A;  5DAL A;  3GUS A;  2FWG A;  1G7O A;  4POM A;  3GMF A;  4YH2 A;  1FO5 A;  5KEJ A;  3BCI A;  4HQZ A;  5F07 A;  3UMA A;  4ZBB A;  2PWJ A;  1I9D A;  10GS A;  1AUC A;  1OVN A;  1WRY A;  3ZRE A;  2JL4 A;  3M0F A;  4EUY A;  1B4P A;  3RBT A;  2EIO A;  4PUR A;  5AIV A;  1ZMA A;  1X0R A;  1AQX A;  4L5O A;  1GSF A;  1X9M B;  1TK8 B;  4YAV A;  2C3N A;  3M8N A;  1TI3 A;  2EC4 A;  2K18 A;  5D9T A;  4JU5 A;  2QGV A;  1ERT A;  4G0L A;  9GSS A;  3LEF A;  1Z7P A;  1M2B A;  4TXV A;  1TK0 B;  4ISD A;  2DJ3 A;  1ZYN A;  2YJH A;  1USB A;  5KOX A;  4XS4 A;  3HCZ A;  4K7I A;  1UC7 A;  5EY6 A;  3KTL A;  2ES7 A;  3F8U A;  4DSS B;  2C0F A;  3GUR A;  2R2J A;  5JCW A;  3SWL A;  2H1A A;  1NW2 A;  2IFQ A;  3F3R A;  1SJ6 A;  3ZYW A;  1DE1 A;  2YOI A;  4OFN A;  1EGR A;  2AB6 A;  5KN2 A;  5ECI B;  4ZIJ A;  1OAZ A;  2CZ3 A;  2TRC P;  4X43 A;  1EWX A;  2WUL A;  4WBJ A;  3Q19 A;  3FR3 A;  2C1Y A;  3DKS A;  2R0P A;  4KA0 A;  4TXO B;  4IGJ A;  1KBN A;  2DKH A;  6GSS A;  3KJY A;  1HNC A;  3KH7 A;  1MD3 A;  2H71 A;  4IW9 A;  4PUF C;  3UEM A;  4G0K A;  2OKA A;  1PKW A;  4ECC A;  4ZL9 A;  5KN0 A;  5ID2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...