1R26A

Crystal structure of thioredoxin from trypanosoma brucei brucei
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
113
structure length
113
Chain Sequence
IRMRARYPSVVDVYSVEQFRNIMSEDILTVAWFTAVWCGPCKTIERPMEKIAYEFPTVKFAKVDADNNSEIVSKCRVLQLPTFIIARSGKMLGHVIGANPGMLRQKLRDIIKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Thioredoxin
publication title Structure of thioredoxin from Trypanosoma brucei brucei
pubmed doi rcsb
source organism Trypanosoma
total genus 32
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2003-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1r26A00
2PUKC 1TU7A 1Z9HA 1B8XA 2BTOT 2ON5A 3VURA 1XWBA 5A4WA 2XPDA 2GZYA 4YQUA 5KEJA 1SJIA 1JZDA 9GSSA 3H1NA 5LNKe 1PKZA 2HLSA 3TJFA 3MDKA 4PUAA 3D4TA 1GRXA 3MAKA 1GP1A 1V9WA 7GSSA 5ABRA 3GYKA 1OYJA 2GT6A 5JWQB 2OE0A 5HFKA 4WR5A 1JHBA 3UBKA 3F3QA 4NV5A 2OKAA 2AV4A 2X8CA 4ULXA 2X99A 4ZB9A 5ECLB 4IP1A 4FYCA 1F3BA 4MJEA 1ZGNA 2L6DA 4L5OA 1O73A 3GKKA 3IHQA 2C0DA 2JZTA 2REMA 4HUAA 2FHEA 3F6FA 2C3QA 3F3RA 2X64A 3GX8A 3E0UA 2RUFA 6GSTA 2NVLA 2FA4A 1ZYQB 1B48A 2VCZA 4KSOA 4IW9A 4OFNA 6GSWA 1TRWA 4EE0A 2V1MA 4GRFA 14GSA 4MJBA 1QUWA 1EGOA 2I81A 2YP6A 8GSSA 4JR6A 2FWEA 3C1SA 1UA5A 1EEMA 1WWJA 2OADA 4YQMA 3KJYA 4RUVA 4IJIA 4OFMA 4N10A 1M2AA 3HKRA 2C0GA 1VF3A 4ISDA 4AGSA 2Z9SA 4BWSA 1TRSA 3L9VA 4G9HA 1AXDA 3UEMA 4WBRD 6GSUA 1R4WA 1YY7A 2CZ3A 2FWFA 4GQCA 4XS4B 5KN1A 3KZQA 4NV2A 2MMNA 3J7Yk 2O85A 5B6MA 1B4PA 3KMOA 1U3IA 4NAXA 4F0CA 4WF5A 2L57A 4P3YB 2NTOA 1Z6NA 1DBYA 3EMXA 3GKNA 3EURA 4V2NA 1RQMA 5C00A 1VF4A 2WULA 1XVWA 1O7UA 3A2WA 3ZFBA 1HNCA 4D73A 1GTAA 2H1DA 3QDNA 2DIYA 2DSAA 4I8BA 3W8JA 4RI7A 3Q6OA 3M9KA 2ES7A 4HZ4A 1GULA 1A8LA 3EC3A 4K0NA 4MZWA 2C3NA 1OE7A 2MMAA 2XC2A 3C7MA 3QFBC 4TR4A 4EF0A 3ZZXA 1GTIA 5ID2A 3GMFA 2YWNA 1KTEA 2X8GA 5J9CA 2VLUA 3I69A 2YNXA 3IRAA 1UN2A 3FK8A 3LXZA 3KTLA 3E3EA 2P5QA 1YF0A 3L78A 4ECBA 1THOA 3EU3A 4L0WA 5CYYA 2VL2A 5LD0A 2VM2A 3HZ8A 3GTUB 1B9YC 3ZTLA 2FCHA 5G1KA 3WYWA 2CAQA 4MF6A 4ZBBA 4WF4A 1T4YA 2JZSA 3FR9A 2QC7A 4IP6A 1V2AA 2K6VA 3PINA 2HFDA 2QSIA 3M3MA 1KBNA 4KCAA 17GSA 2I9HA 1WIKA 4KE3A 5CP1A 4XTSA 6GSSA 1XFLA 4MPGA 2RLIA 1T8EB 1ZYEA 1LJRA 3FR3A 3WD6A 6GSVA 1USBA 2L59A 2LQOA 4LMWA 2R4VA 2H76A 1SJ6A 1TDIA 3IXRA 4X43A 1TI3A 4H86A 1JLVA 2X8HA 3TGZA 1A24A 1TOFA 2R6KA 5JCUA 4QQ7A 4DSRA 1K0AA 4JBBA 3ZIVA 2AUVA 3AY8A 1K0CA 3GA4A 5ELGA 3UJ1A 2YJ7A 2TIRA 1PRXA 4HJMA 4K2DA 3UARA 1FAAA 2M80A 4Q5QA 4GXZA 4HQZA 1A2MA 5GSTA 5IMZA 2HRNA 4IQ1A 5IMAA 4PNGA 1TRVA 4ZILA 1V40A 1EV4A 2C8UA 3VI5A 3HY2A 3CSJA 3EU4A 3VPTA 1OVNA 5F0GA 2IN3A 2H73A 2V6OA 4MMMA 4JRRA 1G6YA 3GFKA 4HU7A 5ECNB 3VWUA 1AIUA 5DJLA 1S3AA 1XOBA 1TK0B 5CRWA 2HZEB 2HSYA 2KP1A 3ME8A 1K3YA 3QAWA 1SD9A 2GSRA 4OD7A 2B3SA 4BVYA 3LSZA 3KP9A 1A0RP 5FWGA 1SKSB 1SK2A 4PURA 2NPBA 1GSUA 4RQRA 1ZOFA 2GSQA 3CSHA 4MJCA 3P8WA 2GLRA 5G2ZA 1ST9A 3OR5A 3HVSA 2C80A 4TR1A 1F9MA 3M0FA 4Q5NA 4ZBDA 2H66A 3D21A 3MNGA 4TW5A 3CXGA 1BAYA 2I3YA 3A5WA 3LEFA 2TRXA 1EZKA 2HYXA 2GT5A 2H0IA 5INYA 5AIXA 3ZFLA 1QMVA 1XCCA 2A2RA 2ZUPA 2PN8A 1SU9A 1PMTA 1J08A 2HE3A 5KN3A 2VIMA 3KCMA 2DC5A 2F51A 3ME7A 5KN2A 2B5EA 2B5XA 4PUFC 4V2MA 1YEPA 4HS1A 1S3CA 3Q18A 2FA8A 4J56E 2YWMA 2EIQA 2C0EA 1GUHA 2R37A 4KGIA 1B9XC 3TKRA 3P7XA 1AAZA 3KP8A 3LG6A 1U87A 2FD3A 3GV1A 2PPTA 2YWIA 1PN9A 2JSYA 2C4JA 4L8EA 1VF1A 2LJKA 1X9WB 3H93A 3TRXA 4HOJA 3IV4A 4PXOA 4GSTA 1DSBA 3HA9A 2OBIA 1EV9A 1O85A 1QXHA 2O7KA 4K0GA 4K8MA 3TRQA 2E2GA 3IC4A 2B7KA 2OJLA 3RHBA 2IL3A 4WBJA 2EIRA 4V1Ap 2OACA 3UBLA 2VLTA 1MD3A 2N5AA 3GRXA 3D4MA 1SK1A 5IPGA 4YAPA 2QKEA 1K0BA 5JCWA 1KNGA 2TRCP 2R5GA 3ED3A 1OC9B 1ZL9A 5IQYA 1BJXA 1WJKA 3APQA 2PWJA 5D96A 3RAZA 5A4VA 1ZZYA 1TI1A 2I4AA 3CRTA 3FW2A 2G2QA 4EVMA 1ERVA 4PQ1A 4L5LA 4ZBAA 2LSTA 1WPIA 2K8SA 3ZREA 3EYTA 5IPHA 1R5AA 2B5YA 4MPFA 2L6CA 1K3LA 2GGTA 2QGVA 12GSA 2RUEA 4POBA 4TR0A 4O92A 4FYBA 2C0FA 4BVXA 4GTUA 3I9V2 1GUKA 1TRUA 2GS3A 3FHKA 4V2LA 2LNSA 2LS5A 3DRNA 5CREA 2L5LA 2VL2C 3IR4A 4KCEA 1UC7A 3H8QA 1J9BA 1T4ZA 3HDCA 4HQSA 2C1YA 4JEDA 1HYUA 4MZCA 4DSQA 2GDRA 5ECRB 2IMIA 3G7JA 3HJOA 4YQVA 5ECKB 5ENUA 2A4VA 4EDZA 2H19A 2P0GA 5IMFA 3APOA 4ZL7A 5EY6A 5DCGA 2EIOA 2H71A 1MTCA 4IGJA 1YKCA 4F2IA 4ACSA 3DMLA 3F9UA 2WFCA 3RBTA 4MH3A 1M2BA 1SK0A 2P5RA 2J9HA 3A2XA 2VOCA 4MF7A 4DEJA 1PQNA 3UL3A 3IE3A 1V98A 3DVWA 3DXBA 1QK8A 2IFQA 4Q5RA 4NHWA 3CTFA 3GKXA 4KDUA 2H30A 2HRFA 3QPMA 1M9AA 5J4UA 2PBJA 4ILFA 1NHOA 2LRCA 2CQ9A 1QGVA 2DJ2A 3TKQA 4K6XA 4E8HA 5AN1A 4QL9A 4MJAA 1TJDA 5J41A 4OFTA 3I6AA 1Z6MA 2H8LA 1GTBA 1Z3EA 4PNFA 4F0BA 1V58A 3R2QA 4N0VA 1FB6A 4MA9A 5D9WA 1T1VA 5IOXA 3IBHA 5H5SA 2GQLA 3F0IA 1TTZA 3TJKA 4GSSA 5CNWA 3ISOA 1SKWB 1SL0B 2P31A 1HQOA 3HXSA 4GQFA 1RW1A 3GL3A 4TN8A 3HYPA 3U6VA 1F6MC 2E0QA 3KXOA 2CA8A 3HJMA 4DSSA 5A5KA 3KH7A 3KEBA 3C73A 1ERUA 2DJ3A 2YOIA 2E2MA 2VUPA 3FR6A 2YANA 5HR1A 3PH9A 2FWHA 2K9FA 1FVJA 3TUEA 3VWXA 2LJAA 2VCQA 1XWAA 3LYPA 4QL7A 1TW9A 3TCOA 4BPYA 1FVKA 20GSA 3EE2A 1PL1A 5DALA 2K8VA 4TXOA 4AJ8A 5D8IA 2VCWA 4F82A 2ON7A 4POMA 4WR4A 2H74A 2YN1A 4O32A 1M2DA 2PERA 5F05A 1R7HA 2F8AA 2VLVA 4N11A 2GVPA 4XCSA 2VCVA 4YAVA 16GSA 3VFIA 1Y6EA 1YEXA 3KM6A 3LYKA 2YWOA 3VWVA 2CZ2A 2VCXA 1XW6A 4EO3A 1THXA 3LQ7A 1XXUA 4PX1A 3IDVA 3WGDA 4AJ7A 4EUYA 2VAFA 4F9ZA 3ZMLA 3CTGA 1ERTA 2L4QA 1YKAA 1M7TA 3RHCA 1E2YA 3F8UA 2YV9A 5DJMA 3FZ5A 3IAS2 1PL2A 1PX7A 4LA1A 3C1RA 2AHEA 3EVIA 5DQYA 2RM5A 2L5OA 4XS1A 4IQAA 3H79A 3ZL5A 5IIZA 4G10A 1GLPA 5G31A 2CX3A 5CAXA 3ZVJD 5B6NA 1GSDA 4KH7A 1N2AA 1U6TA 1O8XA 3O76A 3DVXA 1A0FA 4LL1B 1XWCA 5H5QA 4MABA 4V1Ag 1XVQA 4OCEA 1GWCA 1A23A 3DIEA 2OA7A 1KEBA 3RPPA 4OMVA 3DEXA 1MEKA 1O6JA 3M8NA 2N5BA 3GX0A 5IMVA 4XIHA 3TJGA 3FKFA 4KA0A 4FIWA 2H1AA 3FRCA 5CRGA 1TU8A 3EMPA 1GSSA 2PVQA 3DWVA 4O7HA 4EKZA 3BBYA 4CDOA 4TR3A 4OWYA 5B8BA 2AJQB 1EWXA 1CQHA 2B1KA 4MF5A 3W8SA 1ZCPA 2CAIA 5AGYA 4L0UA 1EOGA 2H01A 5C04A 5L71A 1I9DA 2H6YA 1PKWA 2LKUA 5F07A 3N5OA 5E4WA 1ACVA 5DBQA 3HVXA 3GL5A 3D6IA 3L4NA 3VLNA 3ZITA 4GLTA 1GSQA 3QR6A 5ECSA 2VD0A 3GIXA 2V6KA 2H6ZA 3WGEA 3ZLPA 3APSA 5CRHA 1WOUA 4XS4A 2HT9A 2HNLA 2IMDA 19GSA 4BA7A 1HNBA 1FO5A 3IPZA 5IOWA 3TKSA 1VRSD 3KTBA 4N30A 3ZMKA 1S3DA 1Y25A 1SENA 3RDWA 5IM9A 3GNJA 5FHIA 1YF1A 3LWAA 3GKMA 3L9SA 4TVEA 2H75A 4ML1A 1MDIA 5DQSA 4PGTA 1EGRA 2L4CA 2YCDA 1G7EA 1SJZA 2VL9A 4K7NA 2H0GA 1TXXA 3LFLA 2DMMA 4I6XA 3TOTA 4EC0A 4MLYA 1JZRA 6GSXA 3G7YA 4JR4A 3O3TA 2KP2A 1R26A 1XWGA 1BQ7A 4D73B 4NWYA 1H4OA 4ECJA 3KGKA 4Q5FA 1GSEA 4CW9A 4X1UA 5ECOB 2WGRA 3D5JA 2HI7A 1XW5A 1NW2A 2YV7A 3W6GA 2KLXA 2WRTA 3WGXA 1YZXA 2XPEA 2LNTA 5DAKA 1G0TA 2YJHA 3U5RE 1XZOA 1PD21 2GZPA 4JE1A 3TJJA 4LL4B 4ZB8A 2FY6A 4KNDA 5ID2B 2XBIA 3RPNA 4ZB6A 1M9BA 2CVDA 3GTUA 5ECMB 1SL2B 2IMEA 2OE3A 1TP9A 3IK7A 5G30A 2O8VB 2RIIA 1EOHA 3DKSA 3QCPA 4MZBA 3QAVA 4J2FA 2VO4A 3KIJA 3P90A 4KDYA 3GSTA 3K8NA 2ZNMA 1HD2A 4GSNA 2OE1A 1GTUA 4F03A 4K7OA 2YPMA 1NHYA 4ZL9A 1AQVA 3NIVA 5D9TA 2LRNA 3ZRDA 1PX6A 5DDLA 4IS0A 18GSA 4GWRA 3J7Yb 2IIYA 3KH9A 1SD8A 3LORA 4JZQA 3N9JA 1GNEA 3UVTA 2YZHA 2V41A 4EL1A 5KN0A 2WB9A 3S9FA 1TK5B 3TOUA 1M99A 1R5PA 1J0FA 4Z7XA 4POKA 4EDYA 4POLA 1NM3A 3BJ5A 2RM6A 1GH2A 2H6XA 3UVHA 2CX4A 4I2UA 2AAWA 2B7JA 4I2TA 3DD3A 4XRAA 3QD9A 4IELA 2GTUA 4ZL8A 3ZIJA 3ERWA 4FYUA 2MYGA 2LQQA 2PU9C 3D22A 3BD2A 5D9XA 5JWOB 1N8JA 1M0UA 2OBKA 2XHFA 3A3TA 2B6MA 4HEA2 3H4KA 4NXIA 2VD1A 4IHUA 5B7CA 2IJYA 2FNOA 3TB2A 3G7IA 3IOSA 5HFGA 1A8YA 2I1UA 5HFIA 2D2ZA 1W4VA 2DMLA 2HZFA 1JFUA 3IK9A 1XIYA 2VCTA 4G2EA 1Z5YE 2HZEA 1AQXA 4OO5A 2R3XA 3E9JB 3LGCA 1X9MB 4MDCA 2FLSA 5EVOA 4BL7A 1TKDB 4HU9A 2F3MA 1OKTA 2NBSA 3QAGA 1RK4A 2IMFA 4I97A 4RI6A 5DCHA 3SBCA 3CBUA 4NMUA 1X5CA 4WKWA 2DLXA 5GAND 5EL8A 3P2AA 2MMOA 3VWWA 5HQPA 2WS2A 4FO5A 4CHSA 1FB0A 2M72A 4J57E 2B1LA 2MZCA 5IMCA 1XWKA 1BEDA 4EXJA 5GZZB 1I5GA 5GSSA 3GHAA 5AIVA 3UAPA 1GUMA 1DE2A 1XW9A 2FGXA 1A2LA 1IYHA 4IJ3A 4IBPA 4TR1B 2KOKA 2WDUA 2VL3A 3BCIA 2IPAA 4N0ZA 5AISA 1TK8B 4IKHA 1X0RA 5A4UA 4AF2A 22GSA 4TXVA 1XPVA 5LCZA 3TKSE 1XOAA 2DJJA 1W89A 1H75A 2MMZA 3IA1A 4TRXA 5D9VA 2DJ0A 2WJUA 1ON4A 5IO0A 4XS6A 4BWQA 1FHEA 3WT2A 2YZUA 2R2JA 13GSA 4XHMA 1EP8A 3ZVJA 2DBCA 3GURA 5CO3A 3TDGA 5J9BA 1PGTA 4HDEA 3Q74A 1GSYA 3PGTA 2PGTA 5F06A 4MP4A 3FZ9A 3PR8A 4NHZA 1O8WA 3BCKA 4G19A 5HR3A 2F8FA 5D93A 4K7IA 2CVBA 2CV4A 3F4RA 3QMXA 3TKPA 1AQWA 4DVCA 4KB3A 3TKSC 2PVOC 1G6WA 2H1BA 2GQKA 4LMVA 3HJPA 1PA3A 4WEYA 2O87A 3ZYWA 1F3AA 4LLRA 2LV3A 1DUGA 2KUCA 3VPQA 3GH6A 1WP0A 4XRDA 1ML6A 1X5DA 2WCIA 3V1WA 2GZZA 1E6BA 1O81A 1VGLA 3UMAA 2LJRA 1OC9A 4HZ2A 3EINA 4ECIA 5DAKB 1T00A 2LEGA 1F37A 1ERWA 3CRUA 1JZWA 4NPBA 1MD4A 4ZIJA 2CT6A 2F9SA 4HI7A 5GAPD 4K9ZA 1B4QA 3M1GA 1LU4A 5D73A 1WE0A 3QFAC 1DE1A 1GLQA 5ELAA 1BYEA 2IMKA 1FW1A 3G9BA 3QOUA 3UIWA 3EWLA 4IN0A 4ID0A 4AJ6A 2MBTA 1OAZA 1AW9A 3MWHA 1MDJA 1JLWA 1K0NA 3FEUA 5G1LA 4KUNA 1MDKA 4OCFA 2A2SA 4KX4A 1YQ1A 1SKRB 1FOVA 1AUCA 3LJRA 10GSA 4FH8A 2LTKA 2JSZA 5ECHB 3FZ4A 1Z7PA 1SL1B 2V32A 2JU5A 3VI7A 3F4SA 3DYRA 1OKDA 3M9JA 2GSSA 5IO2A 1K0OA 5ECQB 2G0FA 2JZRA 5FT3A 2LUSA 5HR2A 3HCZA 1U88A 4IVFA 2DJKA 1EP7A 1YJ6A 2PMTA 1U3AA 1YDKA 4WETA 1G7OA 2KHPA 3D0ZA 2J23A 5H5RA 5ECIB 3HVVA 2GQMA 3TRPA 1LBKA 3KD0A 5IMDA 4PQHA 1XBSA 2H0HA 4TOPA 4PQIA 1HNAA 3GUSA 4JU5A 3C8EA 3BOAA 1X5EA 1EEJA 3VK9A 1OE8A 1ZMAA 3WT1A 2JADA 3Q19A 1FG4A 2JL4A 1K3OA 2AB6A 1QQ2A 2LRTA 4WXTA 2XBQA 3JCML 3HZ4A 2IFQB 1F2EA 4RQXA 3KMNA 1ABAA 2GSTA 2CVKA 2O89A 5G5EA 3FY7A 3MSZA 11GSA 2HSHA 4GCIA 1K0DA 1V57A 3GSSA 3UOMA 4YH2A 3CSIA 1C72A 2JACA 1T7PB 4TKYA 3CYNA 4I5QA 3IAM2 2VM1A 4KAEA 2C3TA 2H70A 2H1GA 2NDOA 1X9SB 2EC4A 2DJ1A 3TJBA 2MBSA 5HR0A 5F8BA 4E8EA 4ML6A 2FWGA 2BJXA 3A2VA 2H72A 3I43A 4MH2A 1GNWA 2AYTA 3ERGA 1CQGA 5COHA 1Z7RA 3C71A 3L9UA 2ALBA 3DGQA 5JWRB 1A2JA 1OC3A 2E7PA 1SYXA 3NOFA 3NZNA 1BX9A 3HHVA 1PSQA 3F4TA 3L0HA 3CMIA 1IYIA 2BMXA 2HXKA 2K18A 4KSMA 4DSSB 2V2GA 5CRDA 3US3A 1WRYA 4GF0A 4MCUA 1JZOA 1VF2A 4O5RA 5B8AA 2FUG2 1WMJA 5G5FA 3SWLA 5J3RA 2M46A 2ZCTA 1Q98A 1UVZA 4HJ2A 1BG5A 5EPFA 1GL8A 1ILOA 1GSFA 5JCGA 6GSYA 1T3BA 5DALB 3FYGA 4TXOB 3LXTA 1AC1A 2IWTA 2DIZA 1QFNA 5DVBA 3F63A 1K0MA 4ZXGA 5ECPB 4OO4A 1URMA 1Q4JA 4K1FA 3O6TA 4KDXA 5E59A 3ERFA 2N5FA 3GH9A 1OC8A 4X0XA 3FZAA 4ECCA 1NSWA 4KW6A 3F6DA 4MK3A 5J5NA 1SYRA 3HD5A 3GN3A 2WZ9A
chains in the Genus database with same CATH superfamily
2PUKC 1TU7A 1Z9HA 1B8XA 2BTOT 2ON5A 3VURA 1XWBA 5A4WA 2XPDA 2GZYA 4YQUA 5KEJA 1SJIA 1JZDA 9GSSA 3H1NA 5LNKe 1PKZA 2HLSA 3A5IA 3TJFA 3MDKA 4PUAA 3D4TA 1GRXA 3MAKA 1GP1A 1V9WA 7GSSA 5ABRA 3GYKA 1OYJA 2GT6A 5JWQB 2OE0A 5HFKA 4WR5A 1JHBA 3UBKA 3F3QA 4NV5A 2OKAA 2AV4A 2X8CA 4ULXA 2X99A 4ZB9A 5ECLB 4IP1A 4FYCA 1F3BA 4MJEA 1ZGNA 2L6DA 4L5OA 1O73A 3GKKA 3IHQA 2C0DA 2JZTA 2REMA 4HUAA 2FHEA 3F6FA 2C3QA 3F3RA 2X64A 3GX8A 3E0UA 2RUFA 6GSTA 2NVLA 2FA4A 1ZYQB 1B48A 2VCZA 4KSOA 4IW9A 4OFNA 6GSWA 1TRWA 4EE0A 2V1MA 4GRFA 14GSA 4MJBA 1QUWA 1EGOA 2I81A 2YP6A 8GSSA 4JR6A 2FWEA 3C1SA 1UA5A 1EEMA 1WWJA 2OADA 4YQMA 3KJYA 4RUVA 4IJIA 4OFMA 4N10A 1M2AA 3HKRA 2C0GA 1VF3A 4ISDA 4AGSA 2Z9SA 4BWSA 1TRSA 3L9VA 4G9HA 1AXDA 3UEMA 4WBRD 6GSUA 1R4WA 1YY7A 2CZ3A 2FWFA 4GQCA 4XS4B 5KN1A 3KZQA 4NV2A 2MMNA 3J7Yk 2O85A 5B6MA 1B4PA 3KMOA 1U3IA 4NAXA 4F0CA 4WF5A 2L57A 4P3YB 2NTOA 1Z6NA 1DBYA 3EMXA 3GKNA 3EURA 3R3EA 4V2NA 1RQMA 5C00A 1VF4A 2WULA 1XVWA 1O7UA 3A2WA 3ZFBA 1HNCA 4D73A 1GTAA 2H1DA 3QDNA 2DIYA 2DSAA 4I8BA 3W8JA 5BMUA 4RI7A 3Q6OA 3M9KA 2ES7A 4HZ4A 1GULA 1A8LA 3EC3A 4K0NA 4MZWA 2C3NA 1OE7A 2MMAA 2XC2A 3C7MA 3QFBC 4TR4A 4EF0A 3ZZXA 1GTIA 5ID2A 3GMFA 2YWNA 4Z2TA 1KTEA 2X8GA 5J9CA 2VLUA 3I69A 2YNXA 3IRAA 1UN2A 3FK8A 3LXZA 3KTLA 3E3EA 2P5QA 1YF0A 3L78A 4ECBA 1THOA 3EU3A 4L0WA 5CYYA 2VL2A 5LD0A 2VM2A 3HZ8A 3GTUB 1B9YC 3ZTLA 3MYDA 2FCHA 5G1KA 3WYWA 2CAQA 4MF6A 4ZBBA 4WF4A 1T4YA 2JZSA 3FR9A 2QC7A 4IP6A 1V2AA 2K6VA 3PINA 2HFDA 2QSIA 3M3MA 1KBNA 4KCAA 17GSA 2I9HA 1M3JA 1WIKA 4KE3A 5CP1A 4XTSA 6GSSA 1XFLA 4MPGA 2RLIA 1T8EB 1ZYEA 1LJRA 3FR3A 3WD6A 6GSVA 1USBA 2L59A 2LQOA 4LMWA 2R4VA 2H76A 1SJ6A 1TDIA 3IXRA 4X43A 4K5SA 1TI3A 4H86A 1JLVA 2X8HA 3TGZA 2UZ8A 1A24A 1TOFA 2R6KA 5JCUA 4QQ7A 4DSRA 1K0AA 4JBBA 3ZIVA 2AUVA 3AY8A 1K0CA 3GA4A 5ELGA 3UJ1A 2YJ7A 3HVNA 2TIRA 1PRXA 4HJMA 4K2DA 3UARA 1FAAA 2M80A 4Q5QA 4GXZA 4HQZA 1A2MA 5GSTA 5IMZA 2HRNA 4IQ1A 5IMAA 4PNGA 1TRVA 4ZILA 1V40A 1EV4A 2C8UA 3VI5A 3HY2A 3CSJA 3IHGA 4O5QA 3EU4A 3VPTA 1OVNA 5F0GA 2IN3A 2H73A 2V6OA 1ZYPA 4MMMA 4JRRA 4CY6A 1G6YA 3GFKA 4HU7A 5ECNB 3VWUA 1AIUA 5DJLA 1S3AA 1XOBA 1TK0B 4KF9A 5CRWA 2HZEB 2HSYA 2KP1A 3ME8A 1K3YA 3QAWA 1SD9A 2GSRA 4OD7A 2B3SA 4BVYA 3LSZA 3KP9A 1A0RP 5FWGA 4BL7B 1SKSB 1SK2A 4PURA 2NPBA 1GSUA 4RQRA 1ZOFA 2GSQA 3CSHA 4MJCA 3P8WA 2GLRA 4K2XA 5G2ZA 1ST9A 3OR5A 3HVSA 2C80A 4TR1A 2QA2A 1F9MA 3M0FA 4Q5NA 4ZBDA 2H66A 3D21A 3MNGA 4TW5A 3CXGA 1BAYA 2I3YA 3A5WA 3LEFA 2TRXA 1EZKA 2HYXA 2GT5A 2H0IA 5INYA 5AIXA 3ZFLA 1QMVA 1XCCA 2A2RA 2ZUPA 2PN8A 1SU9A 1PMTA 4CY8A 1J08A 2HE3A 5KN3A 2VIMA 3KCMA 2DC5A 2F51A 3ME7A 5KN2A 4O5UA 2B5EA 2B5XA 4PUFC 4V2MA 1YEPA 4HS1A 3LW9A 1S3CA 3Q18A 2FA8A 4J56E 2YWMA 2EIQA 2C0EA 1GUHA 2R37A 4KGIA 1B9XC 3TKRA 2HRKA 3P7XA 1AAZA 3KP8A 3LG6A 1U87A 2FD3A 3GV1A 2PPTA 2YWIA 1PN9A 2JSYA 4YKFA 2C4JA 4L8EA 1VF1A 2LJKA 1X9WB 1XG8A 3H93A 3TRXA 4HOJA 3IV4A 4PXOA 4GSTA 1DSBA 3HA9A 2OBIA 1EV9A 1O85A 3IC8A 1QXHA 2O7KA 4K0GA 4K8MA 3TRQA 2E2GA 3IC4A 2B7KA 2OJLA 3RHBA 2IL3A 4WBJA 2EIRA 4V1Ap 2OACA 3UBLA 2VLTA 1MD3A 2N5AA 3GRXA 3D4MA 1SK1A 5IPGA 4YAPA 2QKEA 1K0BA 5JCWA 1PFOA 1KNGA 2TRCP 2R5GA 3ED3A 1OC9B 1ZL9A 5IQYA 1BJXA 1WJKA 3APQA 2PWJA 3PPUA 5D96A 3RAZA 5A4VA 1ZZYA 1TI1A 2I4AA 3CRTA 3FW2A 2G2QA 4EVMA 1ERVA 4PQ1A 4L5LA 4ZBAA 2LSTA 1WPIA 2K8SA 3ZREA 3EYTA 5IPHA 1R5AA 2B5YA 4MPFA 2L6CA 1K3LA 2GGTA 2QGVA 12GSA 2RUEA 4POBA 4TR0A 4O92A 4FYBA 2C0FA 4BVXA 4GTUA 3I9V2 1GUKA 1TRUA 2GS3A 3FHKA 4V2LA 2LNSA 2LS5A 3DRNA 5CREA 2L5LA 2VL2C 3IR4A 4KCEA 1UC7A 3H8QA 1J9BA 4FQUA 1T4ZA 3HDCA 4HQSA 2C1YA 4JEDA 1HYUA 4MZCA 4DSQA 2GDRA 5ECRB 2IMIA 1FOHA 3G7JA 3HJOA 4YQVA 2DKIA 5ECKB 5ENUA 2A4VA 4EDZA 2H19A 2P0GA 5IMFA 3APOA 4ZL7A 5EY6A 5DCGA 4G0IA 2EIOA 2H71A 2R0CA 1MTCA 4IGJA 1YKCA 4F2IA 4ACSA 3DMLA 3F9UA 2WFCA 3RBTA 4MH3A 1M2BA 1SK0A 2P5RA 2J9HA 3A2XA 2VOCA 4MF7A 4DEJA 1PQNA 3UL3A 3IE3A 1V98A 3DVWA 3DXBA 1QK8A 2IFQA 4Q5RA 4NHWA 3CTFA 3GKXA 4KDUA 2H30A 2HRFA 3QPMA 1M9AA 5J4UA 2PBJA 4ILFA 1NHOA 2LRCA 2CQ9A 1QGVA 2DJ2A 3TKQA 2R0PA 4K6XA 4E8HA 5AN1A 4EIPA 4QL9A 4MJAA 1TJDA 5J41A 4OFTA 3I6AA 1Z6MA 2H8LA 1GTBA 1Z3EA 4PNFA 4F0BA 1V58A 3R2QA 4N0VA 1FB6A 4MA9A 5D9WA 1T1VA 5IOXA 3IBHA 5H5SA 2GQLA 3F0IA 1TTZA 3TJKA 4GSSA 5CNWA 3ISOA 1SKWB 1SL0B 2P31A 1HQOA 3HXSA 1PN0A 4GQFA 1RW1A 3GL3A 4TN8A 3HYPA 3U6VA 1F6MC 2E0QA 4YKGA 3KXOA 2CA8A 3HJMA 4DSSA 5A5KA 3KH7A 3KEBA 3C73A 1ERUA 2DJ3A 2YOIA 2E2MA 2VUPA 3FR6A 2X4AA 2YANA 5HR1A 3PH9A 2HSMA 2QA1A 2FWHA 2K9FA 1FVJA 3TUEA 3VWXA 2LJAA 2VCQA 1XWAA 3LYPA 4QL7A 1TW9A 3TCOA 4BPYA 4K5RA 1FVKA 20GSA 3EE2A 1PL1A 5DALA 2K8VA 4TXOA 4AJ8A 4EIQA 5D8IA 2VCWA 4F82A 2ON7A 4POMA 4WR4A 2H74A 2YN1A 4MNNA 4O32A 1M2DA 2PERA 5F05A 1R7HA 2F8AA 2VLVA 4N11A 2GVPA 4XCSA 2VCVA 4YAVA 16GSA 3VFIA 1Y6EA 1YEXA 3KM6A 3LYKA 2YWOA 3VWVA 2CZ2A 2VCXA 1XW6A 4EO3A 1THXA 3LQ7A 1XXUA 4PX1A 3IDVA 3WGDA 4AJ7A 4EUYA 2VAFA 4F9ZA 3ZMLA 3CTGA 1ERTA 2L4QA 1YKAA 1M7TA 3RHCA 1E2YA 3F8UA 2YV9A 5DJMA 3FZ5A 3IAS2 1PL2A 1PX7A 4LA1A 3C1RA 2AHEA 5BRTA 3EVIA 5DQYA 2RM5A 2L5OA 4XS1A 4G0KA 4IQAA 3H79A 3ZL5A 5IIZA 4G10A 1GLPA 5G31A 2CX3A 5CAXA 3ZVJD 5B6NA 1GSDA 4KH7A 1N2AA 1U6TA 1O8XA 3O76A 3DVXA 1A0FA 4LL1B 1XWCA 5H5QA 4MABA 4V1Ag 1XVQA 4OCEA 1GWCA 1A23A 3DIEA 2OA7A 1KEBA 3RPPA 4OMVA 3DEXA 1MEKA 1O6JA 3M8NA 2N5BA 3GX0A 5IMVA 4XIHA 3TJGA 3FKFA 4KA0A 4FIWA 2H1AA 3FRCA 5CRGA 1TU8A 3EMPA 1GSSA 2PVQA 3DWVA 4O7HA 4EKZA 3BBYA 4CDOA 4TR3A 4OWYA 5B8BA 2AJQB 1EWXA 1CQHA 2B1KA 4MF5A 3W8SA 1ZCPA 2CAIA 5AGYA 4L0UA 1EOGA 2H01A 5C04A 5L71A 1I9DA 2H6YA 1PKWA 2LKUA 5F07A 3N5OA 5E4WA 1ACVA 5DBQA 3HVXA 3GL5A 3D6IA 3L4NA 3VLNA 3ZITA 4GLTA 1GSQA 3QR6A 5ECSA 2VD0A 3GIXA 2V6KA 2H6ZA 3WGEA 3ZLPA 3APSA 5CRHA 1WOUA 5KOXA 4XS4A 2HT9A 2HNLA 4G0LA 2IMDA 19GSA 4BA7A 1HNBA 1FO5A 3IPZA 5IOWA 3TKSA 1VRSD 3KTBA 4N30A 3ZMKA 1S3DA 1Y25A 1SENA 3RDWA 5IM9A 3GNJA 5FHIA 1YF1A 3LWAA 3GKMA 3L9SA 4TVEA 2H75A 4ML1A 1MDIA 5DQSA 4PGTA 1EGRA 2L4CA 2YCDA 1G7EA 1SJZA 2VL9A 4K7NA 2H0GA 1TXXA 3LFLA 2DMMA 4I6XA 3TOTA 4EC0A 4MLYA 1JZRA 6GSXA 3G7YA 4JR4A 3O3TA 2KP2A 1R26A 1XWGA 1BQ7A 4D73B 4NWYA 1H4OA 4ECJA 3KGKA 4Q5FA 1GSEA 4CW9A 4X1UA 5ECOB 2WGRA 3D5JA 2HI7A 1XW5A 1NW2A 2YV7A 3W6GA 2KLXA 2WRTA 3WGXA 1YZXA 2XPEA 2LNTA 5DAKA 1G0TA 2YJHA 3U5RE 1XZOA 1PD21 2GZPA 4JE1A 3TJJA 4LL4B 4ZB8A 4Z2RA 2FY6A 4KNDA 5ID2B 2XBIA 3RPNA 4ZB6A 1M9BA 1S3RA 2CVDA 3GTUA 5ECMB 1SL2B 2IMEA 2OE3A 1TP9A 3IK7A 5G30A 2O8VB 2RIIA 1EOHA 3DKSA 3QCPA 2HRAA 4MZBA 3QAVA 4J2FA 2VO4A 3KIJA 3P90A 4KDYA 3GSTA 3K8NA 1M3IA 2ZNMA 1HD2A 4GSNA 2OE1A 1GTUA 4F03A 4K7OA 2YPMA 1NHYA 4ZL9A 1AQVA 3NIVA 5D9TA 2LRNA 3ZRDA 1PX6A 5DDLA 4IS0A 18GSA 4GWRA 3J7Yb 2IIYA 3KH9A 1SD8A 3LORA 4JZQA 3N9JA 1GNEA 3UVTA 2YZHA 2V41A 4EL1A 4ICYA 5KN0A 2WB9A 3S9FA 1TK5B 3TOUA 1M99A 1R5PA 1J0FA 4Z7XA 4POKA 4EDYA 4POLA 1NM3A 3BJ5A 2RM6A 1GH2A 2H6XA 3UVHA 2CX4A 5KOWA 4I2UA 2AAWA 2B7JA 4I2TA 3DD3A 4XRAA 3QD9A 4IELA 3MIXA 2GTUA 4ZL8A 3ZIJA 3ERWA 4FYUA 2MYGA 2LQQA 2PU9C 3D22A 3BD2A 5D9XA 5JWOB 1N8JA 1M0UA 2OBKA 2XHFA 3A3TA 2B6MA 4HEA2 3H4KA 4NXIA 2VD1A 4IHUA 5B7CA 2IJYA 2FNOA 3TB2A 3G7IA 3IOSA 5HFGA 1A8YA 2I1UA 5HFIA 2D2ZA 1W4VA 2DMLA 2HZFA 3IK9A 1JFUA 1XIYA 2VCTA 4G2EA 1Z5YE 2HZEA 1AQXA 4OO5A 2R3XA 3E9JB 3LGCA 1X9MB 4MDCA 2FLSA 5EVOA 4BL7A 1TKDB 4HU9A 2F3MA 1OKTA 2NBSA 3QAGA 1RK4A 2IMFA 4I97A 4RI6A 5DCHA 3SBCA 3CBUA 4NMUA 1X5CA 4WKWA 2DLXA 5GAND 5EL8A 3P2AA 2MMOA 3VWWA 5HQPA 2WS2A 4FO5A 4CHSA 1FB0A 2M72A 4J57E 2B1LA 2MZCA 5IMCA 1XWKA 1BEDA 4BVYB 4EXJA 5GZZB 1I5GA 5GSSA 3GHAA 5AIVA 3UAPA 1GUMA 1DE2A 1XW9A 2FGXA 1A2LA 1IYHA 4IJ3A 4IBPA 4TR1B 2KOKA 2WDUA 2VL3A 3BCIA 2IPAA 4N0ZA 5AISA 1TK8B 4IKHA 1X0RA 5A4UA 4AF2A 22GSA 4TXVA 1XPVA 5LCZA 3TKSE 1XOAA 2DJJA 1W89A 1H75A 2MMZA 3IA1A 4TRXA 5D9VA 2DJ0A 2WJUA 1ON4A 5IO0A 4XS6A 4BWQA 1FHEA 3WT2A 2A2PA 2YZUA 2R2JA 13GSA 4XHMA 1EP8A 3ZVJA 2DBCA 3GURA 5CO3A 3TDGA 5J9BA 1PGTA 4HDEA 3Q74A 1GSYA 3PGTA 2PGTA 5F06A 4MP4A 3FZ9A 3PR8A 4NHZA 1O8WA 3BCKA 4G19A 5HR3A 2F8FA 5D93A 4K7IA 2DKHA 2CVBA 2CV4A 3F4RA 3QMXA 3TKPA 1AQWA 4DVCA 4KB3A 3TKSC 2PVOC 1G6WA 2H1BA 2GQKA 4LMVA 3HJPA 4A5PA 1PA3A 4WEYA 2O87A 3ZYWA 1F3AA 4LLRA 2LV3A 1DUGA 2KUCA 3VPQA 3GH6A 1WP0A 4XRDA 1ML6A 1X5DA 2WCIA 3V1WA 3EPTA 2GZZA 1E6BA 1O81A 1VGLA 3UMAA 2LJRA 1OC9A 4HZ2A 3EINA 4ECIA 5DAKB 1T00A 2LEGA 1F37A 1ERWA 3CRUA 1JZWA 4NPBA 1MD4A 4ZIJA 2R0GA 2CT6A 2F9SA 4HI7A 5GAPD 4K9ZA 1B4QA 4USSA 3M1GA 1LU4A 5D73A 1WE0A 3QFAC 1DE1A 1GLQA 5ELAA 1BYEA 2IMKA 1FW1A 3G9BA 3QOUA 3UIWA 3EWLA 4IN0A 4ID0A 4AJ6A 2MBTA 1OAZA 1AW9A 3MWHA 1MDJA 1JLWA 1K0NA 3FEUA 5G1LA 4KUNA 1MDKA 4OCFA 2A2SA 4KX4A 1YQ1A 1SKRB 1FOVA 1AUCA 3LJRA 10GSA 4FH8A 2LTKA 2JSZA 4X4JA 5ECHB 4BVXB 3FZ4A 1Z7PA 1SL1B 2V32A 2JU5A 3VI7A 3F4SA 3DYRA 1OKDA 3M9JA 2GSSA 5IO2A 1K0OA 5ECQB 2G0FA 2JZRA 5FT3A 2LUSA 5HR2A 3HCZA 1U88A 4IVFA 2DJKA 1EP7A 1YJ6A 2PMTA 1U3AA 1YDKA 3FMWA 4WETA 1G7OA 2KHPA 4HSCX 3D0ZA 2J23A 5H5RA 5ECIB 3HVVA 2GQMA 3TRPA 1LBKA 3KD0A 5IMDA 4PQHA 1XBSA 2H0HA 4TOPA 4PQIA 1HNAA 3GUSA 4JU5A 3C8EA 3BOAA 1X5EA 1EEJA 3VK9A 1OE8A 1ZMAA 3WT1A 2JADA 3Q19A 1FG4A 2JL4A 1K3OA 2AB6A 1QQ2A 2A4HA 2LRTA 4WXTA 2XBQA 3JCML 3HZ4A 2IFQB 1F2EA 4RQXA 4Z2UA 3KMNA 1ABAA 2GSTA 2CVKA 2O89A 5G5EA 3FY7A 3MSZA 11GSA 2HSHA 4GCIA 1K0DA 1V57A 3GSSA 3UOMA 4YH2A 3CSIA 1C72A 2JACA 1T7PB 4TKYA 3CYNA 4I5QA 3IAM2 2VM1A 4KAEA 2C3TA 2H70A 2H1GA 2NDOA 1X9SB 2EC4A 2DJ1A 3TJBA 2MBSA 5HR0A 5F8BA 4E8EA 4ML6A 2FWGA 2BJXA 3A2VA 2H72A 3I43A 4MH2A 1GNWA 2AYTA 3CQFA 3ERGA 1CQGA 5COHA 1Z7RA 3C71A 3L9UA 2ALBA 3DGQA 5JWRB 1A2JA 1OC3A 2E7PA 1SYXA 3NOFA 3NZNA 1BX9A 3HHVA 1PSQA 3F4TA 3L0HA 3CMIA 1IYIA 2BMXA 2HXKA 2K18A 4KSMA 4DSSB 2V2GA 5CRDA 3US3A 1WRYA 4GF0A 4MCUA 1JZOA 1VF2A 4O5RA 5B8AA 2FUG2 1WMJA 5G5FA 3SWLA 5J3RA 2M46A 2ZCTA 1Q98A 1UVZA 4HJ2A 1BG5A 5EPFA 1GL8A 1ILOA 1GSFA 5JCGA 6GSYA 1ZYNA 1T3BA 5DALB 3FYGA 4TXOB 3LXTA 1AC1A 2X49A 2IWTA 2DIZA 1QFNA 5DVBA 3F63A 1K0MA 4ZXGA 5ECPB 4OO4A 1URMA 1Q4JA 4K1FA 3O6TA 4KDXA 5E59A 3ERFA 2N5FA 3GH9A 1OC8A 4X0XA 3FZAA 4PTSA 4ECCA 1NSWA 4KW6A 4BIKA 3F6DA 4MK3A 5J5NA 1SYRA 3HD5A 3GN3A 2WZ9A
chains in the Genus database with same CATH topology
2PUKC 1TU7A 1Z9HA 1B8XA 2BTOT 2ON5A 3VURA 1XWBA 5A4WA 2XPDA 2GZYA 4YQUA 5KEJA 1SJIA 1JZDA 9GSSA 3H1NA 5LNKe 1PKZA 2HLSA 3A5IA 3TJFA 3MDKA 4PUAA 3D4TA 1GRXA 3MAKA 1GP1A 1V9WA 7GSSA 5ABRA 3GYKA 1OYJA 2GT6A 5JWQB 2OE0A 5HFKA 4WR5A 1JHBA 3UBKA 3F3QA 4NV5A 2OKAA 2AV4A 2X8CA 4ULXA 2X99A 4ZB9A 5ECLB 4IP1A 4FYCA 1F3BA 4MJEA 1ZGNA 2L6DA 4L5OA 1O73A 3GKKA 3IHQA 2C0DA 2JZTA 2REMA 4HUAA 2FHEA 3F6FA 2C3QA 3F3RA 2X64A 3GX8A 3E0UA 2RUFA 6GSTA 2NVLA 2FA4A 1ZYQB 1B48A 2VCZA 4KSOA 4IW9A 4OFNA 6GSWA 1TRWA 4EE0A 2V1MA 4GRFA 14GSA 4MJBA 1QUWA 1EGOA 2I81A 2YP6A 8GSSA 4JR6A 2FWEA 3C1SA 1UA5A 1EEMA 1WWJA 2OADA 4YQMA 3KJYA 4RUVA 4IJIA 4OFMA 4N10A 1M2AA 3HKRA 2C0GA 1VF3A 4ISDA 4AGSA 2Z9SA 4BWSA 1TRSA 3L9VA 4G9HA 1AXDA 3UEMA 4WBRD 6GSUA 1R4WA 1YY7A 2CZ3A 2FWFA 4GQCA 4XS4B 5KN1A 3KZQA 4NV2A 2MMNA 3J7Yk 2O85A 5B6MA 1B4PA 3KMOA 1U3IA 4NAXA 4F0CA 4WF5A 2L57A 4P3YB 2NTOA 1Z6NA 1DBYA 3EMXA 3GKNA 3EURA 3R3EA 4V2NA 1RQMA 5C00A 1VF4A 2WULA 1XVWA 1O7UA 3A2WA 3ZFBA 1HNCA 4D73A 1GTAA 2H1DA 3QDNA 2DIYA 2DSAA 4I8BA 3W8JA 5BMUA 4RI7A 3Q6OA 3M9KA 2ES7A 4HZ4A 1GULA 1A8LA 3EC3A 4K0NA 4MZWA 2C3NA 1OE7A 2MMAA 2XC2A 3C7MA 3QFBC 4TR4A 4EF0A 3ZZXA 1GTIA 5ID2A 3GMFA 2YWNA 4Z2TA 1KTEA 2X8GA 5J9CA 2VLUA 3I69A 2YNXA 3IRAA 1UN2A 3FK8A 3LXZA 3KTLA 3E3EA 2P5QA 1YF0A 3L78A 4ECBA 1THOA 3EU3A 4L0WA 5CYYA 2VL2A 5LD0A 2VM2A 3HZ8A 3GTUB 1B9YC 3ZTLA 3MYDA 2FCHA 5G1KA 3WYWA 2CAQA 4MF6A 4ZBBA 4WF4A 1T4YA 2JZSA 3FR9A 2QC7A 4IP6A 1V2AA 2K6VA 3PINA 2HFDA 2QSIA 3M3MA 1KBNA 4KCAA 17GSA 2I9HA 1WIKA 4KE3A 5CP1A 4XTSA 6GSSA 1XFLA 4MPGA 2RLIA 1T8EB 1ZYEA 1LJRA 3FR3A 3WD6A 6GSVA 1USBA 2L59A 2LQOA 4LMWA 2R4VA 2H76A 1SJ6A 1TDIA 3IXRA 4X43A 4K5SA 1TI3A 4H86A 1JLVA 2X8HA 3TGZA 2UZ8A 1A24A 1TOFA 2R6KA 5JCUA 4QQ7A 4DSRA 1K0AA 4JBBA 3ZIVA 2AUVA 3AY8A 1K0CA 3GA4A 5ELGA 3UJ1A 2YJ7A 2TIRA 1PRXA 4HJMA 4K2DA 3UARA 1FAAA 2M80A 4Q5QA 4GXZA 4HQZA 1A2MA 5GSTA 5IMZA 2HRNA 4IQ1A 5IMAA 4PNGA 1TRVA 4ZILA 1V40A 1EV4A 2C8UA 3VI5A 3HY2A 3CSJA 3IHGA 4O5QA 3EU4A 3VPTA 1OVNA 5F0GA 2IN3A 2H73A 2V6OA 1ZYPA 4MMMA 4JRRA 4CY6A 1G6YA 3GFKA 4HU7A 5ECNB 3VWUA 1AIUA 5DJLA 1S3AA 1XOBA 1TK0B 4KF9A 5CRWA 2HZEB 2HSYA 2KP1A 3ME8A 1K3YA 3QAWA 1SD9A 2GSRA 4OD7A 2B3SA 4BVYA 3LSZA 3KP9A 1A0RP 5FWGA 4BL7B 1SKSB 1SK2A 4PURA 2NPBA 1GSUA 4RQRA 1ZOFA 2GSQA 3CSHA 4MJCA 3P8WA 2GLRA 4K2XA 5G2ZA 1ST9A 3OR5A 3HVSA 2C80A 4TR1A 2QA2A 1F9MA 3M0FA 4Q5NA 4ZBDA 2H66A 3D21A 3MNGA 4TW5A 3CXGA 1BAYA 2I3YA 3A5WA 3LEFA 2TRXA 1EZKA 2HYXA 2GT5A 2H0IA 5INYA 5AIXA 3ZFLA 1QMVA 1XCCA 2A2RA 2ZUPA 2PN8A 1SU9A 1PMTA 4CY8A 1J08A 2HE3A 5KN3A 2VIMA 3KCMA 2DC5A 2F51A 3ME7A 5KN2A 4O5UA 2B5EA 2B5XA 4PUFC 4V2MA 1YEPA 4HS1A 3LW9A 1S3CA 3Q18A 2FA8A 4J56E 2YWMA 2EIQA 2C0EA 1GUHA 2R37A 4KGIA 1B9XC 3TKRA 2HRKA 3P7XA 1AAZA 3KP8A 3LG6A 1U87A 2FD3A 3GV1A 2PPTA 2YWIA 1PN9A 2JSYA 4YKFA 2C4JA 4L8EA 1VF1A 2LJKA 1X9WB 3H93A 3TRXA 4HOJA 3IV4A 4PXOA 4GSTA 1DSBA 3HA9A 2OBIA 1EV9A 1O85A 3IC8A 1QXHA 2O7KA 4K0GA 4K8MA 3TRQA 2E2GA 3IC4A 2B7KA 2OJLA 3RHBA 2IL3A 4WBJA 2EIRA 4V1Ap 2OACA 3UBLA 2VLTA 1MD3A 2N5AA 3GRXA 3D4MA 1SK1A 5IPGA 4YAPA 2QKEA 1K0BA 5JCWA 1KNGA 2TRCP 2R5GA 3ED3A 1OC9B 1ZL9A 5IQYA 1BJXA 1WJKA 3APQA 2PWJA 3PPUA 5D96A 3RAZA 5A4VA 1ZZYA 1TI1A 2I4AA 3CRTA 3FW2A 2G2QA 4EVMA 1ERVA 4PQ1A 4L5LA 4ZBAA 2LSTA 1WPIA 2K8SA 3ZREA 3EYTA 5IPHA 1R5AA 2B5YA 4MPFA 2L6CA 1K3LA 2GGTA 2QGVA 12GSA 2RUEA 4POBA 4TR0A 4O92A 4FYBA 2C0FA 4BVXA 4GTUA 3I9V2 1GUKA 1TRUA 2GS3A 3FHKA 4V2LA 2LNSA 2LS5A 3DRNA 5CREA 2L5LA 2VL2C 3IR4A 4KCEA 1UC7A 3H8QA 1J9BA 4FQUA 1T4ZA 3HDCA 4HQSA 2C1YA 4JEDA 1HYUA 4MZCA 4DSQA 2GDRA 5ECRB 2IMIA 1FOHA 3G7JA 3HJOA 4YQVA 2DKIA 5ECKB 5ENUA 2A4VA 4EDZA 2H19A 2P0GA 5IMFA 3APOA 4ZL7A 5EY6A 5DCGA 4G0IA 2EIOA 2H71A 2R0CA 1MTCA 4IGJA 1YKCA 4F2IA 4ACSA 3DMLA 3F9UA 2WFCA 3RBTA 4MH3A 1M2BA 1SK0A 2P5RA 2J9HA 3A2XA 2VOCA 4MF7A 4DEJA 1PQNA 3UL3A 3IE3A 1V98A 3DVWA 3DXBA 1QK8A 2IFQA 4Q5RA 4NHWA 3CTFA 3GKXA 4KDUA 2H30A 2HRFA 3QPMA 1M9AA 5J4UA 2PBJA 4ILFA 1NHOA 2LRCA 2CQ9A 1QGVA 2DJ2A 3TKQA 2R0PA 4K6XA 4E8HA 5AN1A 4EIPA 4QL9A 4MJAA 1TJDA 5J41A 4OFTA 3I6AA 1Z6MA 2H8LA 1GTBA 1Z3EA 4PNFA 4F0BA 1V58A 3R2QA 4N0VA 1FB6A 4MA9A 5D9WA 1T1VA 5IOXA 3IBHA 5H5SA 2GQLA 3F0IA 1TTZA 3TJKA 4GSSA 5CNWA 3ISOA 1SKWB 1SL0B 2P31A 1HQOA 3HXSA 1PN0A 4GQFA 1RW1A 3GL3A 4TN8A 3HYPA 3U6VA 1F6MC 2E0QA 4YKGA 3KXOA 2CA8A 3HJMA 4DSSA 5A5KA 3KH7A 3KEBA 3C73A 1ERUA 2DJ3A 2YOIA 2E2MA 2VUPA 3FR6A 2X4AA 2YANA 5HR1A 3PH9A 2HSMA 2QA1A 2FWHA 2K9FA 1FVJA 3TUEA 3VWXA 2LJAA 2VCQA 1XWAA 3LYPA 4QL7A 1TW9A 3TCOA 4BPYA 4K5RA 1FVKA 20GSA 3EE2A 1PL1A 5DALA 2K8VA 4TXOA 4AJ8A 4EIQA 5D8IA 2VCWA 4F82A 2ON7A 4POMA 4WR4A 2H74A 2YN1A 4MNNA 4O32A 1M2DA 2PERA 5F05A 1R7HA 2F8AA 2VLVA 4N11A 2GVPA 4XCSA 2VCVA 4YAVA 16GSA 3VFIA 1Y6EA 1YEXA 3KM6A 3LYKA 2YWOA 3VWVA 2CZ2A 2VCXA 1XW6A 4EO3A 1THXA 3LQ7A 1XXUA 4PX1A 3IDVA 3WGDA 4AJ7A 4EUYA 2VAFA 4F9ZA 3ZMLA 3CTGA 1ERTA 2L4QA 1YKAA 1M7TA 3RHCA 1E2YA 3F8UA 2YV9A 5DJMA 3FZ5A 3IAS2 1PL2A 1PX7A 4LA1A 3C1RA 2AHEA 5BRTA 3EVIA 5DQYA 2RM5A 2L5OA 4XS1A 4G0KA 4IQAA 3H79A 3ZL5A 5IIZA 4G10A 1GLPA 5G31A 2CX3A 5CAXA 3ZVJD 5B6NA 1GSDA 4KH7A 1N2AA 1U6TA 1O8XA 3O76A 3DVXA 1A0FA 4LL1B 1XWCA 5H5QA 4MABA 4V1Ag 1XVQA 4OCEA 1GWCA 1A23A 3DIEA 2OA7A 1KEBA 3RPPA 4OMVA 3DEXA 1MEKA 1O6JA 3M8NA 2N5BA 3GX0A 5IMVA 4XIHA 3TJGA 3FKFA 4KA0A 4FIWA 2H1AA 3FRCA 5CRGA 1TU8A 3EMPA 1GSSA 2PVQA 3DWVA 4O7HA 4EKZA 3BBYA 4CDOA 4TR3A 4OWYA 5B8BA 2AJQB 1EWXA 1CQHA 2B1KA 4MF5A 3W8SA 1ZCPA 2CAIA 5AGYA 4L0UA 1EOGA 2H01A 5C04A 5L71A 1I9DA 2H6YA 1PKWA 2LKUA 5F07A 3N5OA 5E4WA 1ACVA 5DBQA 3HVXA 3GL5A 3D6IA 3L4NA 3VLNA 3ZITA 4GLTA 1GSQA 3QR6A 5ECSA 2VD0A 3GIXA 2V6KA 2H6ZA 3WGEA 3ZLPA 3APSA 5CRHA 1WOUA 5KOXA 4XS4A 2HT9A 2HNLA 4G0LA 2IMDA 19GSA 4BA7A 1HNBA 1FO5A 3IPZA 5IOWA 3TKSA 1VRSD 3KTBA 4N30A 3ZMKA 1S3DA 1Y25A 1SENA 3RDWA 5IM9A 3GNJA 5FHIA 1YF1A 3LWAA 3GKMA 3L9SA 4TVEA 2H75A 4ML1A 1MDIA 5DQSA 4PGTA 1EGRA 2L4CA 2YCDA 1G7EA 1SJZA 2VL9A 4K7NA 2H0GA 1TXXA 3LFLA 2DMMA 4I6XA 3TOTA 4EC0A 4MLYA 1JZRA 6GSXA 3G7YA 4JR4A 3O3TA 2KP2A 1R26A 1XWGA 1BQ7A 4D73B 4NWYA 1H4OA 4ECJA 3KGKA 4Q5FA 1GSEA 4CW9A 4X1UA 5ECOB 2WGRA 3D5JA 2HI7A 1XW5A 1NW2A 2YV7A 3W6GA 2KLXA 2WRTA 3WGXA 1YZXA 2XPEA 2LNTA 5DAKA 1G0TA 2YJHA 3U5RE 1XZOA 1PD21 2GZPA 4JE1A 3TJJA 4LL4B 4ZB8A 4Z2RA 2FY6A 4KNDA 5ID2B 2XBIA 3RPNA 4ZB6A 1M9BA 2CVDA 3GTUA 5ECMB 1SL2B 2IMEA 2OE3A 1TP9A 3IK7A 5G30A 2O8VB 2RIIA 1EOHA 3DKSA 3QCPA 2HRAA 4MZBA 3QAVA 4J2FA 2VO4A 3KIJA 3P90A 4KDYA 3GSTA 3K8NA 2ZNMA 1HD2A 4GSNA 2OE1A 1GTUA 4F03A 4K7OA 2YPMA 1NHYA 4ZL9A 1AQVA 3NIVA 5D9TA 2LRNA 3ZRDA 1PX6A 5DDLA 4IS0A 18GSA 4GWRA 3J7Yb 2IIYA 3KH9A 1SD8A 3LORA 4JZQA 3N9JA 1GNEA 3UVTA 2YZHA 2V41A 4EL1A 4ICYA 5KN0A 2WB9A 3S9FA 1TK5B 3TOUA 1M99A 1R5PA 1J0FA 4Z7XA 4POKA 4EDYA 4POLA 1NM3A 3BJ5A 2RM6A 1GH2A 2H6XA 3UVHA 2CX4A 5KOWA 4I2UA 2AAWA 2B7JA 4I2TA 3DD3A 4XRAA 3QD9A 4IELA 3MIXA 2GTUA 4ZL8A 3ZIJA 3ERWA 4FYUA 2MYGA 2LQQA 2PU9C 3D22A 3BD2A 5D9XA 5JWOB 1N8JA 1M0UA 2OBKA 2XHFA 3A3TA 2B6MA 4HEA2 3H4KA 4NXIA 2VD1A 4IHUA 5B7CA 2IJYA 2FNOA 3TB2A 3G7IA 3IOSA 5HFGA 1A8YA 2I1UA 5HFIA 2D2ZA 1W4VA 2DMLA 2HZFA 3IK9A 1JFUA 1XIYA 2VCTA 4G2EA 1Z5YE 2HZEA 1AQXA 4OO5A 2R3XA 3E9JB 3LGCA 1X9MB 4MDCA 2FLSA 5EVOA 4BL7A 1TKDB 4HU9A 2F3MA 1OKTA 2NBSA 3QAGA 1RK4A 2IMFA 4I97A 4RI6A 5DCHA 3SBCA 3CBUA 4NMUA 1X5CA 4WKWA 2DLXA 5GAND 5EL8A 3P2AA 2MMOA 3VWWA 5HQPA 2WS2A 4FO5A 4CHSA 1FB0A 2M72A 4J57E 2B1LA 2MZCA 5IMCA 1XWKA 1BEDA 4BVYB 4EXJA 5GZZB 1I5GA 5GSSA 3GHAA 5AIVA 3UAPA 1GUMA 1DE2A 1XW9A 2FGXA 1A2LA 1IYHA 4IJ3A 4IBPA 4TR1B 2KOKA 2WDUA 2VL3A 3BCIA 2IPAA 4N0ZA 5AISA 1TK8B 4IKHA 1X0RA 5A4UA 4AF2A 22GSA 4TXVA 1XPVA 5LCZA 3TKSE 1XOAA 2DJJA 1W89A 1H75A 2MMZA 3IA1A 4TRXA 5D9VA 2DJ0A 2WJUA 1ON4A 5IO0A 4XS6A 4BWQA 1FHEA 3WT2A 2A2PA 2YZUA 2R2JA 13GSA 4XHMA 1EP8A 3ZVJA 2DBCA 3GURA 5CO3A 3TDGA 5J9BA 1PGTA 4HDEA 3Q74A 1GSYA 3PGTA 2PGTA 5F06A 4MP4A 3FZ9A 3PR8A 4NHZA 1O8WA 3BCKA 4G19A 5HR3A 2F8FA 5D93A 4K7IA 2DKHA 2CVBA 2CV4A 3F4RA 3QMXA 3TKPA 1AQWA 4DVCA 4KB3A 3TKSC 2PVOC 1G6WA 2H1BA 2GQKA 4LMVA 3HJPA 4A5PA 1PA3A 4WEYA 2O87A 3ZYWA 1F3AA 4LLRA 2LV3A 1DUGA 2KUCA 3VPQA 3GH6A 1WP0A 4XRDA 1ML6A 1X5DA 2WCIA 3V1WA 3EPTA 2GZZA 1E6BA 1O81A 1VGLA 3UMAA 2LJRA 1OC9A 4HZ2A 3EINA 4ECIA 5DAKB 1T00A 2LEGA 1F37A 1ERWA 3CRUA 1JZWA 4NPBA 1MD4A 4ZIJA 2R0GA 2CT6A 2F9SA 4HI7A 5GAPD 4K9ZA 1B4QA 4USSA 3M1GA 1LU4A 5D73A 1WE0A 3QFAC 1DE1A 1GLQA 5ELAA 1BYEA 2IMKA 1FW1A 3G9BA 3QOUA 3UIWA 3EWLA 4IN0A 4ID0A 4AJ6A 2MBTA 1OAZA 1AW9A 3MWHA 1MDJA 1JLWA 1K0NA 3FEUA 5G1LA 4KUNA 1MDKA 4OCFA 2A2SA 4KX4A 1YQ1A 1SKRB 1FOVA 1AUCA 3LJRA 10GSA 4FH8A 2LTKA 2JSZA 4X4JA 5ECHB 4BVXB 3FZ4A 1Z7PA 1SL1B 2V32A 2JU5A 3VI7A 3F4SA 3DYRA 1OKDA 3M9JA 2GSSA 5IO2A 1K0OA 5ECQB 2G0FA 2JZRA 5FT3A 2LUSA 5HR2A 3HCZA 1U88A 4IVFA 2DJKA 1EP7A 1YJ6A 2PMTA 1U3AA 1YDKA 3FMWA 4WETA 1G7OA 2KHPA 3D0ZA 2J23A 5H5RA 5ECIB 3HVVA 2GQMA 3TRPA 1LBKA 3KD0A 5IMDA 4PQHA 1XBSA 2H0HA 4TOPA 4PQIA 1HNAA 3GUSA 4JU5A 3C8EA 3BOAA 1X5EA 1EEJA 3VK9A 1OE8A 1ZMAA 3WT1A 2JADA 3Q19A 1FG4A 2JL4A 1K3OA 2AB6A 1QQ2A 2A4HA 2LRTA 4WXTA 2XBQA 3JCML 3HZ4A 2IFQB 1F2EA 4RQXA 4Z2UA 3KMNA 1ABAA 2GSTA 2CVKA 2O89A 5G5EA 3FY7A 3MSZA 11GSA 2HSHA 4GCIA 1K0DA 1V57A 3GSSA 3UOMA 4YH2A 3CSIA 1C72A 2JACA 1T7PB 4TKYA 3CYNA 4I5QA 3IAM2 2VM1A 4KAEA 2C3TA 2H70A 2H1GA 2NDOA 1X9SB 2EC4A 2DJ1A 3TJBA 2MBSA 5HR0A 5F8BA 4E8EA 4ML6A 2FWGA 2BJXA 3A2VA 2H72A 3I43A 4MH2A 1GNWA 2AYTA 3ERGA 1CQGA 5COHA 1Z7RA 3C71A 3L9UA 2ALBA 3DGQA 5JWRB 1A2JA 1OC3A 2E7PA 1SYXA 3NOFA 3NZNA 1BX9A 3HHVA 1PSQA 3F4TA 3L0HA 3CMIA 1IYIA 2BMXA 2HXKA 2K18A 4KSMA 4DSSB 2V2GA 5CRDA 3US3A 1WRYA 4GF0A 4MCUA 1JZOA 1VF2A 4O5RA 5B8AA 2FUG2 1WMJA 5G5FA 3SWLA 5J3RA 2M46A 2ZCTA 1Q98A 1UVZA 4HJ2A 1BG5A 5EPFA 1GL8A 1ILOA 1GSFA 5JCGA 6GSYA 1ZYNA 1T3BA 5DALB 3FYGA 4TXOB 3LXTA 1AC1A 2X49A 2IWTA 2DIZA 1QFNA 5DVBA 3F63A 1K0MA 4ZXGA 5ECPB 4OO4A 1URMA 1Q4JA 4K1FA 3O6TA 4KDXA 5E59A 3ERFA 2N5FA 3GH9A 1OC8A 4X0XA 3FZAA 4PTSA 4ECCA 1NSWA 4KW6A 3F6DA 4MK3A 5J5NA 1SYRA 3HD5A 3GN3A 2WZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PUK C;  1TU7 A;  1Z9H A;  1B8X A;  2BTO T;  2ON5 A;  3VUR A;  1XWB A;  5A4W A;  2XPD A;  2GZY A;  4YQU A;  5KEJ A;  1SJI A;  1JZD A;  9GSS A;  3H1N A;  5LNK e;  1PKZ A;  2HLS A;  3TJF A;  3MDK A;  4PUA A;  3D4T A;  1GRX A;  3MAK A;  1GP1 A;  1V9W A;  7GSS A;  5ABR A;  3GYK A;  1OYJ A;  2GT6 A;  5JWQ B;  2OE0 A;  5HFK A;  4WR5 A;  1JHB A;  3UBK A;  3F3Q A;  4NV5 A;  2OKA A;  2AV4 A;  2X8C A;  4ULX A;  2X99 A;  4ZB9 A;  5ECL B;  4IP1 A;  4FYC A;  1F3B A;  4MJE A;  1ZGN A;  2L6D A;  4L5O A;  1O73 A;  3GKK A;  3IHQ A;  2C0D A;  2JZT A;  2REM A;  4HUA A;  2FHE A;  3F6F A;  2C3Q A;  3F3R A;  2X64 A;  3GX8 A;  3E0U A;  2RUF A;  6GST A;  2NVL A;  2FA4 A;  1ZYQ B;  1B48 A;  2VCZ A;  4KSO A;  4IW9 A;  4OFN A;  6GSW A;  1TRW A;  4EE0 A;  2V1M A;  4GRF A;  14GS A;  4MJB A;  1QUW A;  1EGO A;  2I81 A;  2YP6 A;  8GSS A;  4JR6 A;  2FWE A;  3C1S A;  1UA5 A;  1EEM A;  1WWJ A;  2OAD A;  4YQM A;  3KJY A;  4RUV A;  4IJI A;  4OFM A;  4N10 A;  1M2A A;  3HKR A;  2C0G A;  1VF3 A;  4ISD A;  4AGS A;  2Z9S A;  4BWS A;  1TRS A;  3L9V A;  4G9H A;  1AXD A;  3UEM A;  4WBR D;  6GSU A;  1R4W A;  1YY7 A;  2CZ3 A;  2FWF A;  4GQC A;  4XS4 B;  5KN1 A;  3KZQ A;  4NV2 A;  2MMN A;  3J7Y k;  2O85 A;  5B6M A;  1B4P A;  3KMO A;  1U3I A;  4NAX A;  4F0C A;  4WF5 A;  2L57 A;  4P3Y B;  2NTO A;  1Z6N A;  1DBY A;  3EMX A;  3GKN A;  3EUR A;  4V2N A;  1RQM A;  5C00 A;  1VF4 A;  2WUL A;  1XVW A;  1O7U A;  3A2W A;  3ZFB A;  1HNC A;  4D73 A;  1GTA A;  2H1D A;  3QDN A;  2DIY A;  2DSA A;  4I8B A;  3W8J A;  4RI7 A;  3Q6O A;  3M9K A;  2ES7 A;  4HZ4 A;  1GUL A;  1A8L A;  3EC3 A;  4K0N A;  4MZW A;  2C3N A;  1OE7 A;  2MMA A;  2XC2 A;  3C7M A;  3QFB C;  4TR4 A;  4EF0 A;  3ZZX A;  1GTI A;  5ID2 A;  3GMF A;  2YWN A;  1KTE A;  2X8G A;  5J9C A;  2VLU A;  3I69 A;  2YNX A;  3IRA A;  1UN2 A;  3FK8 A;  3LXZ A;  3KTL A;  3E3E A;  2P5Q A;  1YF0 A;  3L78 A;  4ECB A;  1THO A;  3EU3 A;  4L0W A;  5CYY A;  2VL2 A;  5LD0 A;  2VM2 A;  3HZ8 A;  3GTU B;  1B9Y C;  3ZTL A;  2FCH A;  5G1K A;  3WYW A;  2CAQ A;  4MF6 A;  4ZBB A;  4WF4 A;  1T4Y A;  2JZS A;  3FR9 A;  2QC7 A;  4IP6 A;  1V2A A;  2K6V A;  3PIN A;  2HFD A;  2QSI A;  3M3M A;  1KBN A;  4KCA A;  17GS A;  2I9H A;  1WIK A;  4KE3 A;  5CP1 A;  4XTS A;  6GSS A;  1XFL A;  4MPG A;  2RLI A;  1T8E B;  1ZYE A;  1LJR A;  3FR3 A;  3WD6 A;  6GSV A;  1USB A;  2L59 A;  2LQO A;  4LMW A;  2R4V A;  2H76 A;  1SJ6 A;  1TDI A;  3IXR A;  4X43 A;  1TI3 A;  4H86 A;  1JLV A;  2X8H A;  3TGZ A;  1A24 A;  1TOF A;  2R6K A;  5JCU A;  4QQ7 A;  4DSR A;  1K0A A;  4JBB A;  3ZIV A;  2AUV A;  3AY8 A;  1K0C A;  3GA4 A;  5ELG A;  3UJ1 A;  2YJ7 A;  2TIR A;  1PRX A;  4HJM A;  4K2D A;  3UAR A;  1FAA A;  2M80 A;  4Q5Q A;  4GXZ A;  4HQZ A;  1A2M A;  5GST A;  5IMZ A;  2HRN A;  4IQ1 A;  5IMA A;  4PNG A;  1TRV A;  4ZIL A;  1V40 A;  1EV4 A;  2C8U A;  3VI5 A;  3HY2 A;  3CSJ A;  3EU4 A;  3VPT A;  1OVN A;  5F0G A;  2IN3 A;  2H73 A;  2V6O A;  4MMM A;  4JRR A;  1G6Y A;  3GFK A;  4HU7 A;  5ECN B;  3VWU A;  1AIU A;  5DJL A;  1S3A A;  1XOB A;  1TK0 B;  5CRW A;  2HZE B;  2HSY A;  2KP1 A;  3ME8 A;  1K3Y A;  3QAW A;  1SD9 A;  2GSR A;  4OD7 A;  2B3S A;  4BVY A;  3LSZ A;  3KP9 A;  1A0R P;  5FWG A;  1SKS B;  1SK2 A;  4PUR A;  2NPB A;  1GSU A;  4RQR A;  1ZOF A;  2GSQ A;  3CSH A;  4MJC A;  3P8W A;  2GLR A;  5G2Z A;  1ST9 A;  3OR5 A;  3HVS A;  2C80 A;  4TR1 A;  1F9M A;  3M0F A;  4Q5N A;  4ZBD A;  2H66 A;  3D21 A;  3MNG A;  4TW5 A;  3CXG A;  1BAY A;  2I3Y A;  3A5W A;  3LEF A;  2TRX A;  1EZK A;  2HYX A;  2GT5 A;  2H0I A;  5INY A;  5AIX A;  3ZFL A;  1QMV A;  1XCC A;  2A2R A;  2ZUP A;  2PN8 A;  1SU9 A;  1PMT A;  1J08 A;  2HE3 A;  5KN3 A;  2VIM A;  3KCM A;  2DC5 A;  2F51 A;  3ME7 A;  5KN2 A;  2B5E A;  2B5X A;  4PUF C;  4V2M A;  1YEP A;  4HS1 A;  1S3C A;  3Q18 A;  2FA8 A;  4J56 E;  2YWM A;  2EIQ A;  2C0E A;  1GUH A;  2R37 A;  4KGI A;  1B9X C;  3TKR A;  3P7X A;  1AAZ A;  3KP8 A;  3LG6 A;  1U87 A;  2FD3 A;  3GV1 A;  2PPT A;  2YWI A;  1PN9 A;  2JSY A;  2C4J A;  4L8E A;  1VF1 A;  2LJK A;  1X9W B;  3H93 A;  3TRX A;  4HOJ A;  3IV4 A;  4PXO A;  4GST A;  1DSB A;  3HA9 A;  2OBI A;  1EV9 A;  1O85 A;  1QXH A;  2O7K A;  4K0G A;  4K8M A;  3TRQ A;  2E2G A;  3IC4 A;  2B7K A;  2OJL A;  3RHB A;  2IL3 A;  4WBJ A;  2EIR A;  4V1A p;  2OAC A;  3UBL A;  2VLT A;  1MD3 A;  2N5A A;  3GRX A;  3D4M A;  1SK1 A;  5IPG A;  4YAP A;  2QKE A;  1K0B A;  5JCW A;  1KNG A;  2TRC P;  2R5G A;  3ED3 A;  1OC9 B;  1ZL9 A;  5IQY A;  1BJX A;  1WJK A;  3APQ A;  2PWJ A;  5D96 A;  3RAZ A;  5A4V A;  1ZZY A;  1TI1 A;  2I4A A;  3CRT A;  3FW2 A;  2G2Q A;  4EVM A;  1ERV A;  4PQ1 A;  4L5L A;  4ZBA A;  2LST A;  1WPI A;  2K8S A;  3ZRE A;  3EYT A;  5IPH A;  1R5A A;  2B5Y A;  4MPF A;  2L6C A;  1K3L A;  2GGT A;  2QGV A;  12GS A;  2RUE A;  4POB A;  4TR0 A;  4O92 A;  4FYB A;  2C0F A;  4BVX A;  4GTU A;  3I9V 2;  1GUK A;  1TRU A;  2GS3 A;  3FHK A;  4V2L A;  2LNS A;  2LS5 A;  3DRN A;  5CRE A;  2L5L A;  2VL2 C;  3IR4 A;  4KCE A;  1UC7 A;  3H8Q A;  1J9B A;  1T4Z A;  3HDC A;  4HQS A;  2C1Y A;  4JED A;  1HYU A;  4MZC A;  4DSQ A;  2GDR A;  5ECR B;  2IMI A;  3G7J A;  3HJO A;  4YQV A;  5ECK B;  5ENU A;  2A4V A;  4EDZ A;  2H19 A;  2P0G A;  5IMF A;  3APO A;  4ZL7 A;  5EY6 A;  5DCG A;  2EIO A;  2H71 A;  1MTC A;  4IGJ A;  1YKC A;  4F2I A;  4ACS A;  3DML A;  3F9U A;  2WFC A;  3RBT A;  4MH3 A;  1M2B A;  1SK0 A;  2P5R A;  2J9H A;  3A2X A;  2VOC A;  4MF7 A;  4DEJ A;  1PQN A;  3UL3 A;  3IE3 A;  1V98 A;  3DVW A;  3DXB A;  1QK8 A;  2IFQ A;  4Q5R A;  4NHW A;  3CTF A;  3GKX A;  4KDU A;  2H30 A;  2HRF A;  3QPM A;  1M9A A;  5J4U A;  2PBJ A;  4ILF A;  1NHO A;  2LRC A;  2CQ9 A;  1QGV A;  2DJ2 A;  3TKQ A;  4K6X A;  4E8H A;  5AN1 A;  4QL9 A;  4MJA A;  1TJD A;  5J41 A;  4OFT A;  3I6A A;  1Z6M A;  2H8L A;  1GTB A;  1Z3E A;  4PNF A;  4F0B A;  1V58 A;  3R2Q A;  4N0V A;  1FB6 A;  4MA9 A;  5D9W A;  1T1V A;  5IOX A;  3IBH A;  5H5S A;  2GQL A;  3F0I A;  1TTZ A;  3TJK A;  4GSS A;  5CNW A;  3ISO A;  1SKW B;  1SL0 B;  2P31 A;  1HQO A;  3HXS A;  4GQF A;  1RW1 A;  3GL3 A;  4TN8 A;  3HYP A;  3U6V A;  1F6M C;  2E0Q A;  3KXO A;  2CA8 A;  3HJM A;  4DSS A;  5A5K A;  3KH7 A;  3KEB A;  3C73 A;  1ERU A;  2DJ3 A;  2YOI A;  2E2M A;  2VUP A;  3FR6 A;  2YAN A;  5HR1 A;  3PH9 A;  2FWH A;  2K9F A;  1FVJ A;  3TUE A;  3VWX A;  2LJA A;  2VCQ A;  1XWA A;  3LYP A;  4QL7 A;  1TW9 A;  3TCO A;  4BPY A;  1FVK A;  20GS A;  3EE2 A;  1PL1 A;  5DAL A;  2K8V A;  4TXO A;  4AJ8 A;  5D8I A;  2VCW A;  4F82 A;  2ON7 A;  4POM A;  4WR4 A;  2H74 A;  2YN1 A;  4O32 A;  1M2D A;  2PER A;  5F05 A;  1R7H A;  2F8A A;  2VLV A;  4N11 A;  2GVP A;  4XCS A;  2VCV A;  4YAV A;  16GS A;  3VFI A;  1Y6E A;  1YEX A;  3KM6 A;  3LYK A;  2YWO A;  3VWV A;  2CZ2 A;  2VCX A;  1XW6 A;  4EO3 A;  1THX A;  3LQ7 A;  1XXU A;  4PX1 A;  3IDV A;  3WGD A;  4AJ7 A;  4EUY A;  2VAF A;  4F9Z A;  3ZML A;  3CTG A;  1ERT A;  2L4Q A;  1YKA A;  1M7T A;  3RHC A;  1E2Y A;  3F8U A;  2YV9 A;  5DJM A;  3FZ5 A;  3IAS 2;  1PL2 A;  1PX7 A;  4LA1 A;  3C1R A;  2AHE A;  3EVI A;  5DQY A;  2RM5 A;  2L5O A;  4XS1 A;  4IQA A;  3H79 A;  3ZL5 A;  5IIZ A;  4G10 A;  1GLP A;  5G31 A;  2CX3 A;  5CAX A;  3ZVJ D;  5B6N A;  1GSD A;  4KH7 A;  1N2A A;  1U6T A;  1O8X A;  3O76 A;  3DVX A;  1A0F A;  4LL1 B;  1XWC A;  5H5Q A;  4MAB A;  4V1A g;  1XVQ A;  4OCE A;  1GWC A;  1A23 A;  3DIE A;  2OA7 A;  1KEB A;  3RPP A;  4OMV A;  3DEX A;  1MEK A;  1O6J A;  3M8N A;  2N5B A;  3GX0 A;  5IMV A;  4XIH A;  3TJG A;  3FKF A;  4KA0 A;  4FIW A;  2H1A A;  3FRC A;  5CRG A;  1TU8 A;  3EMP A;  1GSS A;  2PVQ A;  3DWV A;  4O7H A;  4EKZ A;  3BBY A;  4CDO A;  4TR3 A;  4OWY A;  5B8B A;  2AJQ B;  1EWX A;  1CQH A;  2B1K A;  4MF5 A;  3W8S A;  1ZCP A;  2CAI A;  5AGY A;  4L0U A;  1EOG A;  2H01 A;  5C04 A;  5L71 A;  1I9D A;  2H6Y A;  1PKW A;  2LKU A;  5F07 A;  3N5O A;  5E4W A;  1ACV A;  5DBQ A;  3HVX A;  3GL5 A;  3D6I A;  3L4N A;  3VLN A;  3ZIT A;  4GLT A;  1GSQ A;  3QR6 A;  5ECS A;  2VD0 A;  3GIX A;  2V6K A;  2H6Z A;  3WGE A;  3ZLP A;  3APS A;  5CRH A;  1WOU A;  4XS4 A;  2HT9 A;  2HNL A;  2IMD A;  19GS A;  4BA7 A;  1HNB A;  1FO5 A;  3IPZ A;  5IOW A;  3TKS A;  1VRS D;  3KTB A;  4N30 A;  3ZMK A;  1S3D A;  1Y25 A;  1SEN A;  3RDW A;  5IM9 A;  3GNJ A;  5FHI A;  1YF1 A;  3LWA A;  3GKM A;  3L9S A;  4TVE A;  2H75 A;  4ML1 A;  1MDI A;  5DQS A;  4PGT A;  1EGR A;  2L4C A;  2YCD A;  1G7E A;  1SJZ A;  2VL9 A;  4K7N A;  2H0G A;  1TXX A;  3LFL A;  2DMM A;  4I6X A;  3TOT A;  4EC0 A;  4MLY A;  1JZR A;  6GSX A;  3G7Y A;  4JR4 A;  3O3T A;  2KP2 A;  1R26 A;  1XWG A;  1BQ7 A;  4D73 B;  4NWY A;  1H4O A;  4ECJ A;  3KGK A;  4Q5F A;  1GSE A;  4CW9 A;  4X1U A;  5ECO B;  2WGR A;  3D5J A;  2HI7 A;  1XW5 A;  1NW2 A;  2YV7 A;  3W6G A;  2KLX A;  2WRT A;  3WGX A;  1YZX A;  2XPE A;  2LNT A;  5DAK A;  1G0T A;  2YJH A;  3U5R E;  1XZO A;  1PD2 1;  2GZP A;  4JE1 A;  3TJJ A;  4LL4 B;  4ZB8 A;  2FY6 A;  4KND A;  5ID2 B;  2XBI A;  3RPN A;  4ZB6 A;  1M9B A;  2CVD A;  3GTU A;  5ECM B;  1SL2 B;  2IME A;  2OE3 A;  1TP9 A;  3IK7 A;  5G30 A;  2O8V B;  2RII A;  1EOH A;  3DKS A;  3QCP A;  4MZB A;  3QAV A;  4J2F A;  2VO4 A;  3KIJ A;  3P90 A;  4KDY A;  3GST A;  3K8N A;  2ZNM A;  1HD2 A;  4GSN A;  2OE1 A;  1GTU A;  4F03 A;  4K7O A;  2YPM A;  1NHY A;  4ZL9 A;  1AQV A;  3NIV A;  5D9T A;  2LRN A;  3ZRD A;  1PX6 A;  5DDL A;  4IS0 A;  18GS A;  4GWR A;  3J7Y b;  2IIY A;  3KH9 A;  1SD8 A;  3LOR A;  4JZQ A;  3N9J A;  1GNE A;  3UVT A;  2YZH A;  2V41 A;  4EL1 A;  5KN0 A;  2WB9 A;  3S9F A;  1TK5 B;  3TOU A;  1M99 A;  1R5P A;  1J0F A;  4Z7X A;  4POK A;  4EDY A;  4POL A;  1NM3 A;  3BJ5 A;  2RM6 A;  1GH2 A;  2H6X A;  3UVH A;  2CX4 A;  4I2U A;  2AAW A;  2B7J A;  4I2T A;  3DD3 A;  4XRA A;  3QD9 A;  4IEL A;  2GTU A;  4ZL8 A;  3ZIJ A;  3ERW A;  4FYU A;  2MYG A;  2LQQ A;  2PU9 C;  3D22 A;  3BD2 A;  5D9X A;  5JWO B;  1N8J A;  1M0U A;  2OBK A;  2XHF A;  3A3T A;  2B6M A;  4HEA 2;  3H4K A;  4NXI A;  2VD1 A;  4IHU A;  5B7C A;  2IJY A;  2FNO A;  3TB2 A;  3G7I A;  3IOS A;  5HFG A;  1A8Y A;  2I1U A;  5HFI A;  2D2Z A;  1W4V A;  2DML A;  2HZF A;  1JFU A;  3IK9 A;  1XIY A;  2VCT A;  4G2E A;  1Z5Y E;  2HZE A;  1AQX A;  4OO5 A;  2R3X A;  3E9J B;  3LGC A;  1X9M B;  4MDC A;  2FLS A;  5EVO A;  4BL7 A;  1TKD B;  4HU9 A;  2F3M A;  1OKT A;  2NBS A;  3QAG A;  1RK4 A;  2IMF A;  4I97 A;  4RI6 A;  5DCH A;  3SBC A;  3CBU A;  4NMU A;  1X5C A;  4WKW A;  2DLX A;  5GAN D;  5EL8 A;  3P2A A;  2MMO A;  3VWW A;  5HQP A;  2WS2 A;  4FO5 A;  4CHS A;  1FB0 A;  2M72 A;  4J57 E;  2B1L A;  2MZC A;  5IMC A;  1XWK A;  1BED A;  4EXJ A;  5GZZ B;  1I5G A;  5GSS A;  3GHA A;  5AIV A;  3UAP A;  1GUM A;  1DE2 A;  1XW9 A;  2FGX A;  1A2L A;  1IYH A;  4IJ3 A;  4IBP A;  4TR1 B;  2KOK A;  2WDU A;  2VL3 A;  3BCI A;  2IPA A;  4N0Z A;  5AIS A;  1TK8 B;  4IKH A;  1X0R A;  5A4U A;  4AF2 A;  22GS A;  4TXV A;  1XPV A;  5LCZ A;  3TKS E;  1XOA A;  2DJJ A;  1W89 A;  1H75 A;  2MMZ A;  3IA1 A;  4TRX A;  5D9V A;  2DJ0 A;  2WJU A;  1ON4 A;  5IO0 A;  4XS6 A;  4BWQ A;  1FHE A;  3WT2 A;  2YZU A;  2R2J A;  13GS A;  4XHM A;  1EP8 A;  3ZVJ A;  2DBC A;  3GUR A;  5CO3 A;  3TDG A;  5J9B A;  1PGT A;  4HDE A;  3Q74 A;  1GSY A;  3PGT A;  2PGT A;  5F06 A;  4MP4 A;  3FZ9 A;  3PR8 A;  4NHZ A;  1O8W A;  3BCK A;  4G19 A;  5HR3 A;  2F8F A;  5D93 A;  4K7I A;  2CVB A;  2CV4 A;  3F4R A;  3QMX A;  3TKP A;  1AQW A;  4DVC A;  4KB3 A;  3TKS C;  2PVO C;  1G6W A;  2H1B A;  2GQK A;  4LMV A;  3HJP A;  1PA3 A;  4WEY A;  2O87 A;  3ZYW A;  1F3A A;  4LLR A;  2LV3 A;  1DUG A;  2KUC A;  3VPQ A;  3GH6 A;  1WP0 A;  4XRD A;  1ML6 A;  1X5D A;  2WCI A;  3V1W A;  2GZZ A;  1E6B A;  1O81 A;  1VGL A;  3UMA A;  2LJR A;  1OC9 A;  4HZ2 A;  3EIN A;  4ECI A;  5DAK B;  1T00 A;  2LEG A;  1F37 A;  1ERW A;  3CRU A;  1JZW A;  4NPB A;  1MD4 A;  4ZIJ A;  2CT6 A;  2F9S A;  4HI7 A;  5GAP D;  4K9Z A;  1B4Q A;  3M1G A;  1LU4 A;  5D73 A;  1WE0 A;  3QFA C;  1DE1 A;  1GLQ A;  5ELA A;  1BYE A;  2IMK A;  1FW1 A;  3G9B A;  3QOU A;  3UIW A;  3EWL A;  4IN0 A;  4ID0 A;  4AJ6 A;  2MBT A;  1OAZ A;  1AW9 A;  3MWH A;  1MDJ A;  1JLW A;  1K0N A;  3FEU A;  5G1L A;  4KUN A;  1MDK A;  4OCF A;  2A2S A;  4KX4 A;  1YQ1 A;  1SKR B;  1FOV A;  1AUC A;  3LJR A;  10GS A;  4FH8 A;  2LTK A;  2JSZ A;  5ECH B;  3FZ4 A;  1Z7P A;  1SL1 B;  2V32 A;  2JU5 A;  3VI7 A;  3F4S A;  3DYR A;  1OKD A;  3M9J A;  2GSS A;  5IO2 A;  1K0O A;  5ECQ B;  2G0F A;  2JZR A;  5FT3 A;  2LUS A;  5HR2 A;  3HCZ A;  1U88 A;  4IVF A;  2DJK A;  1EP7 A;  1YJ6 A;  2PMT A;  1U3A A;  1YDK A;  4WET A;  1G7O A;  2KHP A;  3D0Z A;  2J23 A;  5H5R A;  5ECI B;  3HVV A;  2GQM A;  3TRP A;  1LBK A;  3KD0 A;  5IMD A;  4PQH A;  1XBS A;  2H0H A;  4TOP A;  4PQI A;  1HNA A;  3GUS A;  4JU5 A;  3C8E A;  3BOA A;  1X5E A;  1EEJ A;  3VK9 A;  1OE8 A;  1ZMA A;  3WT1 A;  2JAD A;  3Q19 A;  1FG4 A;  2JL4 A;  1K3O A;  2AB6 A;  1QQ2 A;  2LRT A;  4WXT A;  2XBQ A;  3JCM L;  3HZ4 A;  2IFQ B;  1F2E A;  4RQX A;  3KMN A;  1ABA A;  2GST A;  2CVK A;  2O89 A;  5G5E A;  3FY7 A;  3MSZ A;  11GS A;  2HSH A;  4GCI A;  1K0D A;  1V57 A;  3GSS A;  3UOM A;  4YH2 A;  3CSI A;  1C72 A;  2JAC A;  1T7P B;  4TKY A;  3CYN A;  4I5Q A;  3IAM 2;  2VM1 A;  4KAE A;  2C3T A;  2H70 A;  2H1G A;  2NDO A;  1X9S B;  2EC4 A;  2DJ1 A;  3TJB A;  2MBS A;  5HR0 A;  5F8B A;  4E8E A;  4ML6 A;  2FWG A;  2BJX A;  3A2V A;  2H72 A;  3I43 A;  4MH2 A;  1GNW A;  2AYT A;  3ERG A;  1CQG A;  5COH A;  1Z7R A;  3C71 A;  3L9U A;  2ALB A;  3DGQ A;  5JWR B;  1A2J A;  1OC3 A;  2E7P A;  1SYX A;  3NOF A;  3NZN A;  1BX9 A;  3HHV A;  1PSQ A;  3F4T A;  3L0H A;  3CMI A;  1IYI A;  2BMX A;  2HXK A;  2K18 A;  4KSM A;  4DSS B;  2V2G A;  5CRD A;  3US3 A;  1WRY A;  4GF0 A;  4MCU A;  1JZO A;  1VF2 A;  4O5R A;  5B8A A;  2FUG 2;  1WMJ A;  5G5F A;  3SWL A;  5J3R A;  2M46 A;  2ZCT A;  1Q98 A;  1UVZ A;  4HJ2 A;  1BG5 A;  5EPF A;  1GL8 A;  1ILO A;  1GSF A;  5JCG A;  6GSY A;  1T3B A;  5DAL B;  3FYG A;  4TXO B;  3LXT A;  1AC1 A;  2IWT A;  2DIZ A;  1QFN A;  5DVB A;  3F63 A;  1K0M A;  4ZXG A;  5ECP B;  4OO4 A;  1URM A;  1Q4J A;  4K1F A;  3O6T A;  4KDX A;  5E59 A;  3ERF A;  2N5F A;  3GH9 A;  1OC8 A;  4X0X A;  3FZA A;  4ECC A;  1NSW A;  4KW6 A;  3F6D A;  4MK3 A;  5J5N A;  1SYR A;  3HD5 A;  3GN3 A;  2WZ9 A; 
#chains in the Genus database with same CATH topology
 2PUK C;  1TU7 A;  1Z9H A;  1B8X A;  2BTO T;  2ON5 A;  3VUR A;  1XWB A;  5A4W A;  2XPD A;  2GZY A;  4YQU A;  5KEJ A;  1SJI A;  1JZD A;  9GSS A;  3H1N A;  5LNK e;  1PKZ A;  2HLS A;  3A5I A;  3TJF A;  3MDK A;  4PUA A;  3D4T A;  1GRX A;  3MAK A;  1GP1 A;  1V9W A;  7GSS A;  5ABR A;  3GYK A;  1OYJ A;  2GT6 A;  5JWQ B;  2OE0 A;  5HFK A;  4WR5 A;  1JHB A;  3UBK A;  3F3Q A;  4NV5 A;  2OKA A;  2AV4 A;  2X8C A;  4ULX A;  2X99 A;  4ZB9 A;  5ECL B;  4IP1 A;  4FYC A;  1F3B A;  4MJE A;  1ZGN A;  2L6D A;  4L5O A;  1O73 A;  3GKK A;  3IHQ A;  2C0D A;  2JZT A;  2REM A;  4HUA A;  2FHE A;  3F6F A;  2C3Q A;  3F3R A;  2X64 A;  3GX8 A;  3E0U A;  2RUF A;  6GST A;  2NVL A;  2FA4 A;  1ZYQ B;  1B48 A;  2VCZ A;  4KSO A;  4IW9 A;  4OFN A;  6GSW A;  1TRW A;  4EE0 A;  2V1M A;  4GRF A;  14GS A;  4MJB A;  1QUW A;  1EGO A;  2I81 A;  2YP6 A;  8GSS A;  4JR6 A;  2FWE A;  3C1S A;  1UA5 A;  1EEM A;  1WWJ A;  2OAD A;  4YQM A;  3KJY A;  4RUV A;  4IJI A;  4OFM A;  4N10 A;  1M2A A;  3HKR A;  2C0G A;  1VF3 A;  4ISD A;  4AGS A;  2Z9S A;  4BWS A;  1TRS A;  3L9V A;  4G9H A;  1AXD A;  3UEM A;  4WBR D;  6GSU A;  1R4W A;  1YY7 A;  2CZ3 A;  2FWF A;  4GQC A;  4XS4 B;  5KN1 A;  3KZQ A;  4NV2 A;  2MMN A;  3J7Y k;  2O85 A;  5B6M A;  1B4P A;  3KMO A;  1U3I A;  4NAX A;  4F0C A;  4WF5 A;  2L57 A;  4P3Y B;  2NTO A;  1Z6N A;  1DBY A;  3EMX A;  3GKN A;  3EUR A;  3R3E A;  4V2N A;  1RQM A;  5C00 A;  1VF4 A;  2WUL A;  1XVW A;  1O7U A;  3A2W A;  3ZFB A;  1HNC A;  4D73 A;  1GTA A;  2H1D A;  3QDN A;  2DIY A;  2DSA A;  4I8B A;  3W8J A;  5BMU A;  4RI7 A;  3Q6O A;  3M9K A;  2ES7 A;  4HZ4 A;  1GUL A;  1A8L A;  3EC3 A;  4K0N A;  4MZW A;  2C3N A;  1OE7 A;  2MMA A;  2XC2 A;  3C7M A;  3QFB C;  4TR4 A;  4EF0 A;  3ZZX A;  1GTI A;  5ID2 A;  3GMF A;  2YWN A;  4Z2T A;  1KTE A;  2X8G A;  5J9C A;  2VLU A;  3I69 A;  2YNX A;  3IRA A;  1UN2 A;  3FK8 A;  3LXZ A;  3KTL A;  3E3E A;  2P5Q A;  1YF0 A;  3L78 A;  4ECB A;  1THO A;  3EU3 A;  4L0W A;  5CYY A;  2VL2 A;  5LD0 A;  2VM2 A;  3HZ8 A;  3GTU B;  1B9Y C;  3ZTL A;  3MYD A;  2FCH A;  5G1K A;  3WYW A;  2CAQ A;  4MF6 A;  4ZBB A;  4WF4 A;  1T4Y A;  2JZS A;  3FR9 A;  2QC7 A;  4IP6 A;  1V2A A;  2K6V A;  3PIN A;  2HFD A;  2QSI A;  3M3M A;  1KBN A;  4KCA A;  17GS A;  2I9H A;  1M3J A;  1WIK A;  4KE3 A;  5CP1 A;  4XTS A;  6GSS A;  1XFL A;  4MPG A;  2RLI A;  1T8E B;  1ZYE A;  1LJR A;  3FR3 A;  3WD6 A;  6GSV A;  1USB A;  2L59 A;  2LQO A;  4LMW A;  2R4V A;  2H76 A;  1SJ6 A;  1TDI A;  3IXR A;  4X43 A;  4K5S A;  1TI3 A;  4H86 A;  1JLV A;  2X8H A;  3TGZ A;  2UZ8 A;  1A24 A;  1TOF A;  2R6K A;  5JCU A;  4QQ7 A;  4DSR A;  1K0A A;  4JBB A;  3ZIV A;  2AUV A;  3AY8 A;  1K0C A;  3GA4 A;  5ELG A;  3UJ1 A;  2YJ7 A;  3HVN A;  2TIR A;  1PRX A;  4HJM A;  4K2D A;  3UAR A;  1FAA A;  2M80 A;  4Q5Q A;  4GXZ A;  4HQZ A;  1A2M A;  5GST A;  5IMZ A;  2HRN A;  4IQ1 A;  5IMA A;  4PNG A;  1TRV A;  4ZIL A;  1V40 A;  1EV4 A;  2C8U A;  3VI5 A;  3HY2 A;  3CSJ A;  3IHG A;  4O5Q A;  3EU4 A;  3VPT A;  1OVN A;  5F0G A;  2IN3 A;  2H73 A;  2V6O A;  1ZYP A;  4MMM A;  4JRR A;  4CY6 A;  1G6Y A;  3GFK A;  4HU7 A;  5ECN B;  3VWU A;  1AIU A;  5DJL A;  1S3A A;  1XOB A;  1TK0 B;  4KF9 A;  5CRW A;  2HZE B;  2HSY A;  2KP1 A;  3ME8 A;  1K3Y A;  3QAW A;  1SD9 A;  2GSR A;  4OD7 A;  2B3S A;  4BVY A;  3LSZ A;  3KP9 A;  1A0R P;  5FWG A;  4BL7 B;  1SKS B;  1SK2 A;  4PUR A;  2NPB A;  1GSU A;  4RQR A;  1ZOF A;  2GSQ A;  3CSH A;  4MJC A;  3P8W A;  2GLR A;  4K2X A;  5G2Z A;  1ST9 A;  3OR5 A;  3HVS A;  2C80 A;  4TR1 A;  2QA2 A;  1F9M A;  3M0F A;  4Q5N A;  4ZBD A;  2H66 A;  3D21 A;  3MNG A;  4TW5 A;  3CXG A;  1BAY A;  2I3Y A;  3A5W A;  3LEF A;  2TRX A;  1EZK A;  2HYX A;  2GT5 A;  2H0I A;  5INY A;  5AIX A;  3ZFL A;  1QMV A;  1XCC A;  2A2R A;  2ZUP A;  2PN8 A;  1SU9 A;  1PMT A;  4CY8 A;  1J08 A;  2HE3 A;  5KN3 A;  2VIM A;  3KCM A;  2DC5 A;  2F51 A;  3ME7 A;  5KN2 A;  4O5U A;  2B5E A;  2B5X A;  4PUF C;  4V2M A;  1YEP A;  4HS1 A;  3LW9 A;  1S3C A;  3Q18 A;  2FA8 A;  4J56 E;  2YWM A;  2EIQ A;  2C0E A;  1GUH A;  2R37 A;  4KGI A;  1B9X C;  3TKR A;  2HRK A;  3P7X A;  1AAZ A;  3KP8 A;  3LG6 A;  1U87 A;  2FD3 A;  3GV1 A;  2PPT A;  2YWI A;  1PN9 A;  2JSY A;  4YKF A;  2C4J A;  4L8E A;  1VF1 A;  2LJK A;  1X9W B;  1XG8 A;  3H93 A;  3TRX A;  4HOJ A;  3IV4 A;  4PXO A;  4GST A;  1DSB A;  3HA9 A;  2OBI A;  1EV9 A;  1O85 A;  3IC8 A;  1QXH A;  2O7K A;  4K0G A;  4K8M A;  3TRQ A;  2E2G A;  3IC4 A;  2B7K A;  2OJL A;  3RHB A;  2IL3 A;  4WBJ A;  2EIR A;  4V1A p;  2OAC A;  3UBL A;  2VLT A;  1MD3 A;  2N5A A;  3GRX A;  3D4M A;  1SK1 A;  5IPG A;  4YAP A;  2QKE A;  1K0B A;  5JCW A;  1PFO A;  1KNG A;  2TRC P;  2R5G A;  3ED3 A;  1OC9 B;  1ZL9 A;  5IQY A;  1BJX A;  1WJK A;  3APQ A;  2PWJ A;  3PPU A;  5D96 A;  3RAZ A;  5A4V A;  1ZZY A;  1TI1 A;  2I4A A;  3CRT A;  3FW2 A;  2G2Q A;  4EVM A;  1ERV A;  4PQ1 A;  4L5L A;  4ZBA A;  2LST A;  1WPI A;  2K8S A;  3ZRE A;  3EYT A;  5IPH A;  1R5A A;  2B5Y A;  4MPF A;  2L6C A;  1K3L A;  2GGT A;  2QGV A;  12GS A;  2RUE A;  4POB A;  4TR0 A;  4O92 A;  4FYB A;  2C0F A;  4BVX A;  4GTU A;  3I9V 2;  1GUK A;  1TRU A;  2GS3 A;  3FHK A;  4V2L A;  2LNS A;  2LS5 A;  3DRN A;  5CRE A;  2L5L A;  2VL2 C;  3IR4 A;  4KCE A;  1UC7 A;  3H8Q A;  1J9B A;  4FQU A;  1T4Z A;  3HDC A;  4HQS A;  2C1Y A;  4JED A;  1HYU A;  4MZC A;  4DSQ A;  2GDR A;  5ECR B;  2IMI A;  1FOH A;  3G7J A;  3HJO A;  4YQV A;  2DKI A;  5ECK B;  5ENU A;  2A4V A;  4EDZ A;  2H19 A;  2P0G A;  5IMF A;  3APO A;  4ZL7 A;  5EY6 A;  5DCG A;  4G0I A;  2EIO A;  2H71 A;  2R0C A;  1MTC A;  4IGJ A;  1YKC A;  4F2I A;  4ACS A;  3DML A;  3F9U A;  2WFC A;  3RBT A;  4MH3 A;  1M2B A;  1SK0 A;  2P5R A;  2J9H A;  3A2X A;  2VOC A;  4MF7 A;  4DEJ A;  1PQN A;  3UL3 A;  3IE3 A;  1V98 A;  3DVW A;  3DXB A;  1QK8 A;  2IFQ A;  4Q5R A;  4NHW A;  3CTF A;  3GKX A;  4KDU A;  2H30 A;  2HRF A;  3QPM A;  1M9A A;  5J4U A;  2PBJ A;  4ILF A;  1NHO A;  2LRC A;  2CQ9 A;  1QGV A;  2DJ2 A;  3TKQ A;  2R0P A;  4K6X A;  4E8H A;  5AN1 A;  4EIP A;  4QL9 A;  4MJA A;  1TJD A;  5J41 A;  4OFT A;  3I6A A;  1Z6M A;  2H8L A;  1GTB A;  1Z3E A;  4PNF A;  4F0B A;  1V58 A;  3R2Q A;  4N0V A;  1FB6 A;  4MA9 A;  5D9W A;  1T1V A;  5IOX A;  3IBH A;  5H5S A;  2GQL A;  3F0I A;  1TTZ A;  3TJK A;  4GSS A;  5CNW A;  3ISO A;  1SKW B;  1SL0 B;  2P31 A;  1HQO A;  3HXS A;  1PN0 A;  4GQF A;  1RW1 A;  3GL3 A;  4TN8 A;  3HYP A;  3U6V A;  1F6M C;  2E0Q A;  4YKG A;  3KXO A;  2CA8 A;  3HJM A;  4DSS A;  5A5K A;  3KH7 A;  3KEB A;  3C73 A;  1ERU A;  2DJ3 A;  2YOI A;  2E2M A;  2VUP A;  3FR6 A;  2X4A A;  2YAN A;  5HR1 A;  3PH9 A;  2HSM A;  2QA1 A;  2FWH A;  2K9F A;  1FVJ A;  3TUE A;  3VWX A;  2LJA A;  2VCQ A;  1XWA A;  3LYP A;  4QL7 A;  1TW9 A;  3TCO A;  4BPY A;  4K5R A;  1FVK A;  20GS A;  3EE2 A;  1PL1 A;  5DAL A;  2K8V A;  4TXO A;  4AJ8 A;  4EIQ A;  5D8I A;  2VCW A;  4F82 A;  2ON7 A;  4POM A;  4WR4 A;  2H74 A;  2YN1 A;  4MNN A;  4O32 A;  1M2D A;  2PER A;  5F05 A;  1R7H A;  2F8A A;  2VLV A;  4N11 A;  2GVP A;  4XCS A;  2VCV A;  4YAV A;  16GS A;  3VFI A;  1Y6E A;  1YEX A;  3KM6 A;  3LYK A;  2YWO A;  3VWV A;  2CZ2 A;  2VCX A;  1XW6 A;  4EO3 A;  1THX A;  3LQ7 A;  1XXU A;  4PX1 A;  3IDV A;  3WGD A;  4AJ7 A;  4EUY A;  2VAF A;  4F9Z A;  3ZML A;  3CTG A;  1ERT A;  2L4Q A;  1YKA A;  1M7T A;  3RHC A;  1E2Y A;  3F8U A;  2YV9 A;  5DJM A;  3FZ5 A;  3IAS 2;  1PL2 A;  1PX7 A;  4LA1 A;  3C1R A;  2AHE A;  5BRT A;  3EVI A;  5DQY A;  2RM5 A;  2L5O A;  4XS1 A;  4G0K A;  4IQA A;  3H79 A;  3ZL5 A;  5IIZ A;  4G10 A;  1GLP A;  5G31 A;  2CX3 A;  5CAX A;  3ZVJ D;  5B6N A;  1GSD A;  4KH7 A;  1N2A A;  1U6T A;  1O8X A;  3O76 A;  3DVX A;  1A0F A;  4LL1 B;  1XWC A;  5H5Q A;  4MAB A;  4V1A g;  1XVQ A;  4OCE A;  1GWC A;  1A23 A;  3DIE A;  2OA7 A;  1KEB A;  3RPP A;  4OMV A;  3DEX A;  1MEK A;  1O6J A;  3M8N A;  2N5B A;  3GX0 A;  5IMV A;  4XIH A;  3TJG A;  3FKF A;  4KA0 A;  4FIW A;  2H1A A;  3FRC A;  5CRG A;  1TU8 A;  3EMP A;  1GSS A;  2PVQ A;  3DWV A;  4O7H A;  4EKZ A;  3BBY A;  4CDO A;  4TR3 A;  4OWY A;  5B8B A;  2AJQ B;  1EWX A;  1CQH A;  2B1K A;  4MF5 A;  3W8S A;  1ZCP A;  2CAI A;  5AGY A;  4L0U A;  1EOG A;  2H01 A;  5C04 A;  5L71 A;  1I9D A;  2H6Y A;  1PKW A;  2LKU A;  5F07 A;  3N5O A;  5E4W A;  1ACV A;  5DBQ A;  3HVX A;  3GL5 A;  3D6I A;  3L4N A;  3VLN A;  3ZIT A;  4GLT A;  1GSQ A;  3QR6 A;  5ECS A;  2VD0 A;  3GIX A;  2V6K A;  2H6Z A;  3WGE A;  3ZLP A;  3APS A;  5CRH A;  1WOU A;  5KOX A;  4XS4 A;  2HT9 A;  2HNL A;  4G0L A;  2IMD A;  19GS A;  4BA7 A;  1HNB A;  1FO5 A;  3IPZ A;  5IOW A;  3TKS A;  1VRS D;  3KTB A;  4N30 A;  3ZMK A;  1S3D A;  1Y25 A;  1SEN A;  3RDW A;  5IM9 A;  3GNJ A;  5FHI A;  1YF1 A;  3LWA A;  3GKM A;  3L9S A;  4TVE A;  2H75 A;  4ML1 A;  1MDI A;  5DQS A;  4PGT A;  1EGR A;  2L4C A;  2YCD A;  1G7E A;  1SJZ A;  2VL9 A;  4K7N A;  2H0G A;  1TXX A;  3LFL A;  2DMM A;  4I6X A;  3TOT A;  4EC0 A;  4MLY A;  1JZR A;  6GSX A;  3G7Y A;  4JR4 A;  3O3T A;  2KP2 A;  1R26 A;  1XWG A;  1BQ7 A;  4D73 B;  4NWY A;  1H4O A;  4ECJ A;  3KGK A;  4Q5F A;  1GSE A;  4CW9 A;  4X1U A;  5ECO B;  2WGR A;  3D5J A;  2HI7 A;  1XW5 A;  1NW2 A;  2YV7 A;  3W6G A;  2KLX A;  2WRT A;  3WGX A;  1YZX A;  2XPE A;  2LNT A;  5DAK A;  1G0T A;  2YJH A;  3U5R E;  1XZO A;  1PD2 1;  2GZP A;  4JE1 A;  3TJJ A;  4LL4 B;  4ZB8 A;  4Z2R A;  2FY6 A;  4KND A;  5ID2 B;  2XBI A;  3RPN A;  4ZB6 A;  1M9B A;  1S3R A;  2CVD A;  3GTU A;  5ECM B;  1SL2 B;  2IME A;  2OE3 A;  1TP9 A;  3IK7 A;  5G30 A;  2O8V B;  2RII A;  1EOH A;  3DKS A;  3QCP A;  2HRA A;  4MZB A;  3QAV A;  4J2F A;  2VO4 A;  3KIJ A;  3P90 A;  4KDY A;  3GST A;  3K8N A;  1M3I A;  2ZNM A;  1HD2 A;  4GSN A;  2OE1 A;  1GTU A;  4F03 A;  4K7O A;  2YPM A;  1NHY A;  4ZL9 A;  1AQV A;  3NIV A;  5D9T A;  2LRN A;  3ZRD A;  1PX6 A;  5DDL A;  4IS0 A;  18GS A;  4GWR A;  3J7Y b;  2IIY A;  3KH9 A;  1SD8 A;  3LOR A;  4JZQ A;  3N9J A;  1GNE A;  3UVT A;  2YZH A;  2V41 A;  4EL1 A;  4ICY A;  5KN0 A;  2WB9 A;  3S9F A;  1TK5 B;  3TOU A;  1M99 A;  1R5P A;  1J0F A;  4Z7X A;  4POK A;  4EDY A;  4POL A;  1NM3 A;  3BJ5 A;  2RM6 A;  1GH2 A;  2H6X A;  3UVH A;  2CX4 A;  5KOW A;  4I2U A;  2AAW A;  2B7J A;  4I2T A;  3DD3 A;  4XRA A;  3QD9 A;  4IEL A;  3MIX A;  2GTU A;  4ZL8 A;  3ZIJ A;  3ERW A;  4FYU A;  2MYG A;  2LQQ A;  2PU9 C;  3D22 A;  3BD2 A;  5D9X A;  5JWO B;  1N8J A;  1M0U A;  2OBK A;  2XHF A;  3A3T A;  2B6M A;  4HEA 2;  3H4K A;  4NXI A;  2VD1 A;  4IHU A;  5B7C A;  2IJY A;  2FNO A;  3TB2 A;  3G7I A;  3IOS A;  5HFG A;  1A8Y A;  2I1U A;  5HFI A;  2D2Z A;  1W4V A;  2DML A;  2HZF A;  3IK9 A;  1JFU A;  1XIY A;  2VCT A;  4G2E A;  1Z5Y E;  2HZE A;  1AQX A;  4OO5 A;  2R3X A;  3E9J B;  3LGC A;  1X9M B;  4MDC A;  2FLS A;  5EVO A;  4BL7 A;  1TKD B;  4HU9 A;  2F3M A;  1OKT A;  2NBS A;  3QAG A;  1RK4 A;  2IMF A;  4I97 A;  4RI6 A;  5DCH A;  3SBC A;  3CBU A;  4NMU A;  1X5C A;  4WKW A;  2DLX A;  5GAN D;  5EL8 A;  3P2A A;  2MMO A;  3VWW A;  5HQP A;  2WS2 A;  4FO5 A;  4CHS A;  1FB0 A;  2M72 A;  4J57 E;  2B1L A;  2MZC A;  5IMC A;  1XWK A;  1BED A;  4BVY B;  4EXJ A;  5GZZ B;  1I5G A;  5GSS A;  3GHA A;  5AIV A;  3UAP A;  1GUM A;  1DE2 A;  1XW9 A;  2FGX A;  1A2L A;  1IYH A;  4IJ3 A;  4IBP A;  4TR1 B;  2KOK A;  2WDU A;  2VL3 A;  3BCI A;  2IPA A;  4N0Z A;  5AIS A;  1TK8 B;  4IKH A;  1X0R A;  5A4U A;  4AF2 A;  22GS A;  4TXV A;  1XPV A;  5LCZ A;  3TKS E;  1XOA A;  2DJJ A;  1W89 A;  1H75 A;  2MMZ A;  3IA1 A;  4TRX A;  5D9V A;  2DJ0 A;  2WJU A;  1ON4 A;  5IO0 A;  4XS6 A;  4BWQ A;  1FHE A;  3WT2 A;  2A2P A;  2YZU A;  2R2J A;  13GS A;  4XHM A;  1EP8 A;  3ZVJ A;  2DBC A;  3GUR A;  5CO3 A;  3TDG A;  5J9B A;  1PGT A;  4HDE A;  3Q74 A;  1GSY A;  3PGT A;  2PGT A;  5F06 A;  4MP4 A;  3FZ9 A;  3PR8 A;  4NHZ A;  1O8W A;  3BCK A;  4G19 A;  5HR3 A;  2F8F A;  5D93 A;  4K7I A;  2DKH A;  2CVB A;  2CV4 A;  3F4R A;  3QMX A;  3TKP A;  1AQW A;  4DVC A;  4KB3 A;  3TKS C;  2PVO C;  1G6W A;  2H1B A;  2GQK A;  4LMV A;  3HJP A;  4A5P A;  1PA3 A;  4WEY A;  2O87 A;  3ZYW A;  1F3A A;  4LLR A;  2LV3 A;  1DUG A;  2KUC A;  3VPQ A;  3GH6 A;  1WP0 A;  4XRD A;  1ML6 A;  1X5D A;  2WCI A;  3V1W A;  3EPT A;  2GZZ A;  1E6B A;  1O81 A;  1VGL A;  3UMA A;  2LJR A;  1OC9 A;  4HZ2 A;  3EIN A;  4ECI A;  5DAK B;  1T00 A;  2LEG A;  1F37 A;  1ERW A;  3CRU A;  1JZW A;  4NPB A;  1MD4 A;  4ZIJ A;  2R0G A;  2CT6 A;  2F9S A;  4HI7 A;  5GAP D;  4K9Z A;  1B4Q A;  4USS A;  3M1G A;  1LU4 A;  5D73 A;  1WE0 A;  3QFA C;  1DE1 A;  1GLQ A;  5ELA A;  1BYE A;  2IMK A;  1FW1 A;  3G9B A;  3QOU A;  3UIW A;  3EWL A;  4IN0 A;  4ID0 A;  4AJ6 A;  2MBT A;  1OAZ A;  1AW9 A;  3MWH A;  1MDJ A;  1JLW A;  1K0N A;  3FEU A;  5G1L A;  4KUN A;  1MDK A;  4OCF A;  2A2S A;  4KX4 A;  1YQ1 A;  1SKR B;  1FOV A;  1AUC A;  3LJR A;  10GS A;  4FH8 A;  2LTK A;  2JSZ A;  4X4J A;  5ECH B;  4BVX B;  3FZ4 A;  1Z7P A;  1SL1 B;  2V32 A;  2JU5 A;  3VI7 A;  3F4S A;  3DYR A;  1OKD A;  3M9J A;  2GSS A;  5IO2 A;  1K0O A;  5ECQ B;  2G0F A;  2JZR A;  5FT3 A;  2LUS A;  5HR2 A;  3HCZ A;  1U88 A;  4IVF A;  2DJK A;  1EP7 A;  1YJ6 A;  2PMT A;  1U3A A;  1YDK A;  3FMW A;  4WET A;  1G7O A;  2KHP A;  4HSC X;  3D0Z A;  2J23 A;  5H5R A;  5ECI B;  3HVV A;  2GQM A;  3TRP A;  1LBK A;  3KD0 A;  5IMD A;  4PQH A;  1XBS A;  2H0H A;  4TOP A;  4PQI A;  1HNA A;  3GUS A;  4JU5 A;  3C8E A;  3BOA A;  1X5E A;  1EEJ A;  3VK9 A;  1OE8 A;  1ZMA A;  3WT1 A;  2JAD A;  3Q19 A;  1FG4 A;  2JL4 A;  1K3O A;  2AB6 A;  1QQ2 A;  2A4H A;  2LRT A;  4WXT A;  2XBQ A;  3JCM L;  3HZ4 A;  2IFQ B;  1F2E A;  4RQX A;  4Z2U A;  3KMN A;  1ABA A;  2GST A;  2CVK A;  2O89 A;  5G5E A;  3FY7 A;  3MSZ A;  11GS A;  2HSH A;  4GCI A;  1K0D A;  1V57 A;  3GSS A;  3UOM A;  4YH2 A;  3CSI A;  1C72 A;  2JAC A;  1T7P B;  4TKY A;  3CYN A;  4I5Q A;  3IAM 2;  2VM1 A;  4KAE A;  2C3T A;  2H70 A;  2H1G A;  2NDO A;  1X9S B;  2EC4 A;  2DJ1 A;  3TJB A;  2MBS A;  5HR0 A;  5F8B A;  4E8E A;  4ML6 A;  2FWG A;  2BJX A;  3A2V A;  2H72 A;  3I43 A;  4MH2 A;  1GNW A;  2AYT A;  3CQF A;  3ERG A;  1CQG A;  5COH A;  1Z7R A;  3C71 A;  3L9U A;  2ALB A;  3DGQ A;  5JWR B;  1A2J A;  1OC3 A;  2E7P A;  1SYX A;  3NOF A;  3NZN A;  1BX9 A;  3HHV A;  1PSQ A;  3F4T A;  3L0H A;  3CMI A;  1IYI A;  2BMX A;  2HXK A;  2K18 A;  4KSM A;  4DSS B;  2V2G A;  5CRD A;  3US3 A;  1WRY A;  4GF0 A;  4MCU A;  1JZO A;  1VF2 A;  4O5R A;  5B8A A;  2FUG 2;  1WMJ A;  5G5F A;  3SWL A;  5J3R A;  2M46 A;  2ZCT A;  1Q98 A;  1UVZ A;  4HJ2 A;  1BG5 A;  5EPF A;  1GL8 A;  1ILO A;  1GSF A;  5JCG A;  6GSY A;  1ZYN A;  1T3B A;  5DAL B;  3FYG A;  4TXO B;  3LXT A;  1AC1 A;  2X49 A;  2IWT A;  2DIZ A;  1QFN A;  5DVB A;  3F63 A;  1K0M A;  4ZXG A;  5ECP B;  4OO4 A;  1URM A;  1Q4J A;  4K1F A;  3O6T A;  4KDX A;  5E59 A;  3ERF A;  2N5F A;  3GH9 A;  1OC8 A;  4X0X A;  3FZA A;  4PTS A;  4ECC A;  1NSW A;  4KW6 A;  4BIK A;  3F6D A;  4MK3 A;  5J5N A;  1SYR A;  3HD5 A;  3GN3 A;  2WZ9 A; 
#chains in the Genus database with same CATH homology
 2PUK C;  1TU7 A;  1Z9H A;  1B8X A;  2BTO T;  2ON5 A;  3VUR A;  1XWB A;  5A4W A;  2XPD A;  2GZY A;  4YQU A;  5KEJ A;  1SJI A;  1JZD A;  9GSS A;  3H1N A;  5LNK e;  1PKZ A;  2HLS A;  3A5I A;  3TJF A;  3MDK A;  4PUA A;  3D4T A;  1GRX A;  3MAK A;  1GP1 A;  1V9W A;  7GSS A;  5ABR A;  3GYK A;  1OYJ A;  2GT6 A;  5JWQ B;  2OE0 A;  5HFK A;  4WR5 A;  1JHB A;  3UBK A;  3F3Q A;  4NV5 A;  2OKA A;  2AV4 A;  2X8C A;  4ULX A;  2X99 A;  4ZB9 A;  5ECL B;  4IP1 A;  4FYC A;  1F3B A;  4MJE A;  1ZGN A;  2L6D A;  4L5O A;  1O73 A;  3GKK A;  3IHQ A;  2C0D A;  2JZT A;  2REM A;  4HUA A;  2FHE A;  3F6F A;  2C3Q A;  3F3R A;  2X64 A;  3GX8 A;  3E0U A;  2RUF A;  6GST A;  2NVL A;  2FA4 A;  1ZYQ B;  1B48 A;  2VCZ A;  4KSO A;  4IW9 A;  4OFN A;  6GSW A;  1TRW A;  4EE0 A;  2V1M A;  4GRF A;  14GS A;  4MJB A;  1QUW A;  1EGO A;  2I81 A;  2YP6 A;  8GSS A;  4JR6 A;  2FWE A;  3C1S A;  1UA5 A;  1EEM A;  1WWJ A;  2OAD A;  4YQM A;  3KJY A;  4RUV A;  4IJI A;  4OFM A;  4N10 A;  1M2A A;  3HKR A;  2C0G A;  1VF3 A;  4ISD A;  4AGS A;  2Z9S A;  4BWS A;  1TRS A;  3L9V A;  4G9H A;  1AXD A;  3UEM A;  4WBR D;  6GSU A;  1R4W A;  1YY7 A;  2CZ3 A;  2FWF A;  4GQC A;  4XS4 B;  5KN1 A;  3KZQ A;  4NV2 A;  2MMN A;  3J7Y k;  2O85 A;  5B6M A;  1B4P A;  3KMO A;  1U3I A;  4NAX A;  4F0C A;  4WF5 A;  2L57 A;  4P3Y B;  2NTO A;  1Z6N A;  1DBY A;  3EMX A;  3GKN A;  3EUR A;  3R3E A;  4V2N A;  1RQM A;  5C00 A;  1VF4 A;  2WUL A;  1XVW A;  1O7U A;  3A2W A;  3ZFB A;  1HNC A;  4D73 A;  1GTA A;  2H1D A;  3QDN A;  2DIY A;  2DSA A;  4I8B A;  3W8J A;  5BMU A;  4RI7 A;  3Q6O A;  3M9K A;  2ES7 A;  4HZ4 A;  1GUL A;  1A8L A;  3EC3 A;  4K0N A;  4MZW A;  2C3N A;  1OE7 A;  2MMA A;  2XC2 A;  3C7M A;  3QFB C;  4TR4 A;  4EF0 A;  3ZZX A;  1GTI A;  5ID2 A;  3GMF A;  2YWN A;  4Z2T A;  1KTE A;  2X8G A;  5J9C A;  2VLU A;  3I69 A;  2YNX A;  3IRA A;  1UN2 A;  3FK8 A;  3LXZ A;  3KTL A;  3E3E A;  2P5Q A;  1YF0 A;  3L78 A;  4ECB A;  1THO A;  3EU3 A;  4L0W A;  5CYY A;  2VL2 A;  5LD0 A;  2VM2 A;  3HZ8 A;  3GTU B;  1B9Y C;  3ZTL A;  3MYD A;  2FCH A;  5G1K A;  3WYW A;  2CAQ A;  4MF6 A;  4ZBB A;  4WF4 A;  1T4Y A;  2JZS A;  3FR9 A;  2QC7 A;  4IP6 A;  1V2A A;  2K6V A;  3PIN A;  2HFD A;  2QSI A;  3M3M A;  1KBN A;  4KCA A;  17GS A;  2I9H A;  1WIK A;  4KE3 A;  5CP1 A;  4XTS A;  6GSS A;  1XFL A;  4MPG A;  2RLI A;  1T8E B;  1ZYE A;  1LJR A;  3FR3 A;  3WD6 A;  6GSV A;  1USB A;  2L59 A;  2LQO A;  4LMW A;  2R4V A;  2H76 A;  1SJ6 A;  1TDI A;  3IXR A;  4X43 A;  4K5S A;  1TI3 A;  4H86 A;  1JLV A;  2X8H A;  3TGZ A;  2UZ8 A;  1A24 A;  1TOF A;  2R6K A;  5JCU A;  4QQ7 A;  4DSR A;  1K0A A;  4JBB A;  3ZIV A;  2AUV A;  3AY8 A;  1K0C A;  3GA4 A;  5ELG A;  3UJ1 A;  2YJ7 A;  2TIR A;  1PRX A;  4HJM A;  4K2D A;  3UAR A;  1FAA A;  2M80 A;  4Q5Q A;  4GXZ A;  4HQZ A;  1A2M A;  5GST A;  5IMZ A;  2HRN A;  4IQ1 A;  5IMA A;  4PNG A;  1TRV A;  4ZIL A;  1V40 A;  1EV4 A;  2C8U A;  3VI5 A;  3HY2 A;  3CSJ A;  3IHG A;  4O5Q A;  3EU4 A;  3VPT A;  1OVN A;  5F0G A;  2IN3 A;  2H73 A;  2V6O A;  1ZYP A;  4MMM A;  4JRR A;  4CY6 A;  1G6Y A;  3GFK A;  4HU7 A;  5ECN B;  3VWU A;  1AIU A;  5DJL A;  1S3A A;  1XOB A;  1TK0 B;  4KF9 A;  5CRW A;  2HZE B;  2HSY A;  2KP1 A;  3ME8 A;  1K3Y A;  3QAW A;  1SD9 A;  2GSR A;  4OD7 A;  2B3S A;  4BVY A;  3LSZ A;  3KP9 A;  1A0R P;  5FWG A;  4BL7 B;  1SKS B;  1SK2 A;  4PUR A;  2NPB A;  1GSU A;  4RQR A;  1ZOF A;  2GSQ A;  3CSH A;  4MJC A;  3P8W A;  2GLR A;  4K2X A;  5G2Z A;  1ST9 A;  3OR5 A;  3HVS A;  2C80 A;  4TR1 A;  2QA2 A;  1F9M A;  3M0F A;  4Q5N A;  4ZBD A;  2H66 A;  3D21 A;  3MNG A;  4TW5 A;  3CXG A;  1BAY A;  2I3Y A;  3A5W A;  3LEF A;  2TRX A;  1EZK A;  2HYX A;  2GT5 A;  2H0I A;  5INY A;  5AIX A;  3ZFL A;  1QMV A;  1XCC A;  2A2R A;  2ZUP A;  2PN8 A;  1SU9 A;  1PMT A;  4CY8 A;  1J08 A;  2HE3 A;  5KN3 A;  2VIM A;  3KCM A;  2DC5 A;  2F51 A;  3ME7 A;  5KN2 A;  4O5U A;  2B5E A;  2B5X A;  4PUF C;  4V2M A;  1YEP A;  4HS1 A;  3LW9 A;  1S3C A;  3Q18 A;  2FA8 A;  4J56 E;  2YWM A;  2EIQ A;  2C0E A;  1GUH A;  2R37 A;  4KGI A;  1B9X C;  3TKR A;  2HRK A;  3P7X A;  1AAZ A;  3KP8 A;  3LG6 A;  1U87 A;  2FD3 A;  3GV1 A;  2PPT A;  2YWI A;  1PN9 A;  2JSY A;  4YKF A;  2C4J A;  4L8E A;  1VF1 A;  2LJK A;  1X9W B;  3H93 A;  3TRX A;  4HOJ A;  3IV4 A;  4PXO A;  4GST A;  1DSB A;  3HA9 A;  2OBI A;  1EV9 A;  1O85 A;  3IC8 A;  1QXH A;  2O7K A;  4K0G A;  4K8M A;  3TRQ A;  2E2G A;  3IC4 A;  2B7K A;  2OJL A;  3RHB A;  2IL3 A;  4WBJ A;  2EIR A;  4V1A p;  2OAC A;  3UBL A;  2VLT A;  1MD3 A;  2N5A A;  3GRX A;  3D4M A;  1SK1 A;  5IPG A;  4YAP A;  2QKE A;  1K0B A;  5JCW A;  1KNG A;  2TRC P;  2R5G A;  3ED3 A;  1OC9 B;  1ZL9 A;  5IQY A;  1BJX A;  1WJK A;  3APQ A;  2PWJ A;  3PPU A;  5D96 A;  3RAZ A;  5A4V A;  1ZZY A;  1TI1 A;  2I4A A;  3CRT A;  3FW2 A;  2G2Q A;  4EVM A;  1ERV A;  4PQ1 A;  4L5L A;  4ZBA A;  2LST A;  1WPI A;  2K8S A;  3ZRE A;  3EYT A;  5IPH A;  1R5A A;  2B5Y A;  4MPF A;  2L6C A;  1K3L A;  2GGT A;  2QGV A;  12GS A;  2RUE A;  4POB A;  4TR0 A;  4O92 A;  4FYB A;  2C0F A;  4BVX A;  4GTU A;  3I9V 2;  1GUK A;  1TRU A;  2GS3 A;  3FHK A;  4V2L A;  2LNS A;  2LS5 A;  3DRN A;  5CRE A;  2L5L A;  2VL2 C;  3IR4 A;  4KCE A;  1UC7 A;  3H8Q A;  1J9B A;  4FQU A;  1T4Z A;  3HDC A;  4HQS A;  2C1Y A;  4JED A;  1HYU A;  4MZC A;  4DSQ A;  2GDR A;  5ECR B;  2IMI A;  1FOH A;  3G7J A;  3HJO A;  4YQV A;  2DKI A;  5ECK B;  5ENU A;  2A4V A;  4EDZ A;  2H19 A;  2P0G A;  5IMF A;  3APO A;  4ZL7 A;  5EY6 A;  5DCG A;  4G0I A;  2EIO A;  2H71 A;  2R0C A;  1MTC A;  4IGJ A;  1YKC A;  4F2I A;  4ACS A;  3DML A;  3F9U A;  2WFC A;  3RBT A;  4MH3 A;  1M2B A;  1SK0 A;  2P5R A;  2J9H A;  3A2X A;  2VOC A;  4MF7 A;  4DEJ A;  1PQN A;  3UL3 A;  3IE3 A;  1V98 A;  3DVW A;  3DXB A;  1QK8 A;  2IFQ A;  4Q5R A;  4NHW A;  3CTF A;  3GKX A;  4KDU A;  2H30 A;  2HRF A;  3QPM A;  1M9A A;  5J4U A;  2PBJ A;  4ILF A;  1NHO A;  2LRC A;  2CQ9 A;  1QGV A;  2DJ2 A;  3TKQ A;  2R0P A;  4K6X A;  4E8H A;  5AN1 A;  4EIP A;  4QL9 A;  4MJA A;  1TJD A;  5J41 A;  4OFT A;  3I6A A;  1Z6M A;  2H8L A;  1GTB A;  1Z3E A;  4PNF A;  4F0B A;  1V58 A;  3R2Q A;  4N0V A;  1FB6 A;  4MA9 A;  5D9W A;  1T1V A;  5IOX A;  3IBH A;  5H5S A;  2GQL A;  3F0I A;  1TTZ A;  3TJK A;  4GSS A;  5CNW A;  3ISO A;  1SKW B;  1SL0 B;  2P31 A;  1HQO A;  3HXS A;  1PN0 A;  4GQF A;  1RW1 A;  3GL3 A;  4TN8 A;  3HYP A;  3U6V A;  1F6M C;  2E0Q A;  4YKG A;  3KXO A;  2CA8 A;  3HJM A;  4DSS A;  5A5K A;  3KH7 A;  3KEB A;  3C73 A;  1ERU A;  2DJ3 A;  2YOI A;  2E2M A;  2VUP A;  3FR6 A;  2X4A A;  2YAN A;  5HR1 A;  3PH9 A;  2HSM A;  2QA1 A;  2FWH A;  2K9F A;  1FVJ A;  3TUE A;  3VWX A;  2LJA A;  2VCQ A;  1XWA A;  3LYP A;  4QL7 A;  1TW9 A;  3TCO A;  4BPY A;  4K5R A;  1FVK A;  20GS A;  3EE2 A;  1PL1 A;  5DAL A;  2K8V A;  4TXO A;  4AJ8 A;  4EIQ A;  5D8I A;  2VCW A;  4F82 A;  2ON7 A;  4POM A;  4WR4 A;  2H74 A;  2YN1 A;  4MNN A;  4O32 A;  1M2D A;  2PER A;  5F05 A;  1R7H A;  2F8A A;  2VLV A;  4N11 A;  2GVP A;  4XCS A;  2VCV A;  4YAV A;  16GS A;  3VFI A;  1Y6E A;  1YEX A;  3KM6 A;  3LYK A;  2YWO A;  3VWV A;  2CZ2 A;  2VCX A;  1XW6 A;  4EO3 A;  1THX A;  3LQ7 A;  1XXU A;  4PX1 A;  3IDV A;  3WGD A;  4AJ7 A;  4EUY A;  2VAF A;  4F9Z A;  3ZML A;  3CTG A;  1ERT A;  2L4Q A;  1YKA A;  1M7T A;  3RHC A;  1E2Y A;  3F8U A;  2YV9 A;  5DJM A;  3FZ5 A;  3IAS 2;  1PL2 A;  1PX7 A;  4LA1 A;  3C1R A;  2AHE A;  5BRT A;  3EVI A;  5DQY A;  2RM5 A;  2L5O A;  4XS1 A;  4G0K A;  4IQA A;  3H79 A;  3ZL5 A;  5IIZ A;  4G10 A;  1GLP A;  5G31 A;  2CX3 A;  5CAX A;  3ZVJ D;  5B6N A;  1GSD A;  4KH7 A;  1N2A A;  1U6T A;  1O8X A;  3O76 A;  3DVX A;  1A0F A;  4LL1 B;  1XWC A;  5H5Q A;  4MAB A;  4V1A g;  1XVQ A;  4OCE A;  1GWC A;  1A23 A;  3DIE A;  2OA7 A;  1KEB A;  3RPP A;  4OMV A;  3DEX A;  1MEK A;  1O6J A;  3M8N A;  2N5B A;  3GX0 A;  5IMV A;  4XIH A;  3TJG A;  3FKF A;  4KA0 A;  4FIW A;  2H1A A;  3FRC A;  5CRG A;  1TU8 A;  3EMP A;  1GSS A;  2PVQ A;  3DWV A;  4O7H A;  4EKZ A;  3BBY A;  4CDO A;  4TR3 A;  4OWY A;  5B8B A;  2AJQ B;  1EWX A;  1CQH A;  2B1K A;  4MF5 A;  3W8S A;  1ZCP A;  2CAI A;  5AGY A;  4L0U A;  1EOG A;  2H01 A;  5C04 A;  5L71 A;  1I9D A;  2H6Y A;  1PKW A;  2LKU A;  5F07 A;  3N5O A;  5E4W A;  1ACV A;  5DBQ A;  3HVX A;  3GL5 A;  3D6I A;  3L4N A;  3VLN A;  3ZIT A;  4GLT A;  1GSQ A;  3QR6 A;  5ECS A;  2VD0 A;  3GIX A;  2V6K A;  2H6Z A;  3WGE A;  3ZLP A;  3APS A;  5CRH A;  1WOU A;  5KOX A;  4XS4 A;  2HT9 A;  2HNL A;  4G0L A;  2IMD A;  19GS A;  4BA7 A;  1HNB A;  1FO5 A;  3IPZ A;  5IOW A;  3TKS A;  1VRS D;  3KTB A;  4N30 A;  3ZMK A;  1S3D A;  1Y25 A;  1SEN A;  3RDW A;  5IM9 A;  3GNJ A;  5FHI A;  1YF1 A;  3LWA A;  3GKM A;  3L9S A;  4TVE A;  2H75 A;  4ML1 A;  1MDI A;  5DQS A;  4PGT A;  1EGR A;  2L4C A;  2YCD A;  1G7E A;  1SJZ A;  2VL9 A;  4K7N A;  2H0G A;  1TXX A;  3LFL A;  2DMM A;  4I6X A;  3TOT A;  4EC0 A;  4MLY A;  1JZR A;  6GSX A;  3G7Y A;  4JR4 A;  3O3T A;  2KP2 A;  1R26 A;  1XWG A;  1BQ7 A;  4D73 B;  4NWY A;  1H4O A;  4ECJ A;  3KGK A;  4Q5F A;  1GSE A;  4CW9 A;  4X1U A;  5ECO B;  2WGR A;  3D5J A;  2HI7 A;  1XW5 A;  1NW2 A;  2YV7 A;  3W6G A;  2KLX A;  2WRT A;  3WGX A;  1YZX A;  2XPE A;  2LNT A;  5DAK A;  1G0T A;  2YJH A;  3U5R E;  1XZO A;  1PD2 1;  2GZP A;  4JE1 A;  3TJJ A;  4LL4 B;  4ZB8 A;  4Z2R A;  2FY6 A;  4KND A;  5ID2 B;  2XBI A;  3RPN A;  4ZB6 A;  1M9B A;  2CVD A;  3GTU A;  5ECM B;  1SL2 B;  2IME A;  2OE3 A;  1TP9 A;  3IK7 A;  5G30 A;  2O8V B;  2RII A;  1EOH A;  3DKS A;  3QCP A;  2HRA A;  4MZB A;  3QAV A;  4J2F A;  2VO4 A;  3KIJ A;  3P90 A;  4KDY A;  3GST A;  3K8N A;  2ZNM A;  1HD2 A;  4GSN A;  2OE1 A;  1GTU A;  4F03 A;  4K7O A;  2YPM A;  1NHY A;  4ZL9 A;  1AQV A;  3NIV A;  5D9T A;  2LRN A;  3ZRD A;  1PX6 A;  5DDL A;  4IS0 A;  18GS A;  4GWR A;  3J7Y b;  2IIY A;  3KH9 A;  1SD8 A;  3LOR A;  4JZQ A;  3N9J A;  1GNE A;  3UVT A;  2YZH A;  2V41 A;  4EL1 A;  4ICY A;  5KN0 A;  2WB9 A;  3S9F A;  1TK5 B;  3TOU A;  1M99 A;  1R5P A;  1J0F A;  4Z7X A;  4POK A;  4EDY A;  4POL A;  1NM3 A;  3BJ5 A;  2RM6 A;  1GH2 A;  2H6X A;  3UVH A;  2CX4 A;  5KOW A;  4I2U A;  2AAW A;  2B7J A;  4I2T A;  3DD3 A;  4XRA A;  3QD9 A;  4IEL A;  3MIX A;  2GTU A;  4ZL8 A;  3ZIJ A;  3ERW A;  4FYU A;  2MYG A;  2LQQ A;  2PU9 C;  3D22 A;  3BD2 A;  5D9X A;  5JWO B;  1N8J A;  1M0U A;  2OBK A;  2XHF A;  3A3T A;  2B6M A;  4HEA 2;  3H4K A;  4NXI A;  2VD1 A;  4IHU A;  5B7C A;  2IJY A;  2FNO A;  3TB2 A;  3G7I A;  3IOS A;  5HFG A;  1A8Y A;  2I1U A;  5HFI A;  2D2Z A;  1W4V A;  2DML A;  2HZF A;  3IK9 A;  1JFU A;  1XIY A;  2VCT A;  4G2E A;  1Z5Y E;  2HZE A;  1AQX A;  4OO5 A;  2R3X A;  3E9J B;  3LGC A;  1X9M B;  4MDC A;  2FLS A;  5EVO A;  4BL7 A;  1TKD B;  4HU9 A;  2F3M A;  1OKT A;  2NBS A;  3QAG A;  1RK4 A;  2IMF A;  4I97 A;  4RI6 A;  5DCH A;  3SBC A;  3CBU A;  4NMU A;  1X5C A;  4WKW A;  2DLX A;  5GAN D;  5EL8 A;  3P2A A;  2MMO A;  3VWW A;  5HQP A;  2WS2 A;  4FO5 A;  4CHS A;  1FB0 A;  2M72 A;  4J57 E;  2B1L A;  2MZC A;  5IMC A;  1XWK A;  1BED A;  4BVY B;  4EXJ A;  5GZZ B;  1I5G A;  5GSS A;  3GHA A;  5AIV A;  3UAP A;  1GUM A;  1DE2 A;  1XW9 A;  2FGX A;  1A2L A;  1IYH A;  4IJ3 A;  4IBP A;  4TR1 B;  2KOK A;  2WDU A;  2VL3 A;  3BCI A;  2IPA A;  4N0Z A;  5AIS A;  1TK8 B;  4IKH A;  1X0R A;  5A4U A;  4AF2 A;  22GS A;  4TXV A;  1XPV A;  5LCZ A;  3TKS E;  1XOA A;  2DJJ A;  1W89 A;  1H75 A;  2MMZ A;  3IA1 A;  4TRX A;  5D9V A;  2DJ0 A;  2WJU A;  1ON4 A;  5IO0 A;  4XS6 A;  4BWQ A;  1FHE A;  3WT2 A;  2A2P A;  2YZU A;  2R2J A;  13GS A;  4XHM A;  1EP8 A;  3ZVJ A;  2DBC A;  3GUR A;  5CO3 A;  3TDG A;  5J9B A;  1PGT A;  4HDE A;  3Q74 A;  1GSY A;  3PGT A;  2PGT A;  5F06 A;  4MP4 A;  3FZ9 A;  3PR8 A;  4NHZ A;  1O8W A;  3BCK A;  4G19 A;  5HR3 A;  2F8F A;  5D93 A;  4K7I A;  2DKH A;  2CVB A;  2CV4 A;  3F4R A;  3QMX A;  3TKP A;  1AQW A;  4DVC A;  4KB3 A;  3TKS C;  2PVO C;  1G6W A;  2H1B A;  2GQK A;  4LMV A;  3HJP A;  4A5P A;  1PA3 A;  4WEY A;  2O87 A;  3ZYW A;  1F3A A;  4LLR A;  2LV3 A;  1DUG A;  2KUC A;  3VPQ A;  3GH6 A;  1WP0 A;  4XRD A;  1ML6 A;  1X5D A;  2WCI A;  3V1W A;  3EPT A;  2GZZ A;  1E6B A;  1O81 A;  1VGL A;  3UMA A;  2LJR A;  1OC9 A;  4HZ2 A;  3EIN A;  4ECI A;  5DAK B;  1T00 A;  2LEG A;  1F37 A;  1ERW A;  3CRU A;  1JZW A;  4NPB A;  1MD4 A;  4ZIJ A;  2R0G A;  2CT6 A;  2F9S A;  4HI7 A;  5GAP D;  4K9Z A;  1B4Q A;  4USS A;  3M1G A;  1LU4 A;  5D73 A;  1WE0 A;  3QFA C;  1DE1 A;  1GLQ A;  5ELA A;  1BYE A;  2IMK A;  1FW1 A;  3G9B A;  3QOU A;  3UIW A;  3EWL A;  4IN0 A;  4ID0 A;  4AJ6 A;  2MBT A;  1OAZ A;  1AW9 A;  3MWH A;  1MDJ A;  1JLW A;  1K0N A;  3FEU A;  5G1L A;  4KUN A;  1MDK A;  4OCF A;  2A2S A;  4KX4 A;  1YQ1 A;  1SKR B;  1FOV A;  1AUC A;  3LJR A;  10GS A;  4FH8 A;  2LTK A;  2JSZ A;  4X4J A;  5ECH B;  4BVX B;  3FZ4 A;  1Z7P A;  1SL1 B;  2V32 A;  2JU5 A;  3VI7 A;  3F4S A;  3DYR A;  1OKD A;  3M9J A;  2GSS A;  5IO2 A;  1K0O A;  5ECQ B;  2G0F A;  2JZR A;  5FT3 A;  2LUS A;  5HR2 A;  3HCZ A;  1U88 A;  4IVF A;  2DJK A;  1EP7 A;  1YJ6 A;  2PMT A;  1U3A A;  1YDK A;  3FMW A;  4WET A;  1G7O A;  2KHP A;  3D0Z A;  2J23 A;  5H5R A;  5ECI B;  3HVV A;  2GQM A;  3TRP A;  1LBK A;  3KD0 A;  5IMD A;  4PQH A;  1XBS A;  2H0H A;  4TOP A;  4PQI A;  1HNA A;  3GUS A;  4JU5 A;  3C8E A;  3BOA A;  1X5E A;  1EEJ A;  3VK9 A;  1OE8 A;  1ZMA A;  3WT1 A;  2JAD A;  3Q19 A;  1FG4 A;  2JL4 A;  1K3O A;  2AB6 A;  1QQ2 A;  2A4H A;  2LRT A;  4WXT A;  2XBQ A;  3JCM L;  3HZ4 A;  2IFQ B;  1F2E A;  4RQX A;  4Z2U A;  3KMN A;  1ABA A;  2GST A;  2CVK A;  2O89 A;  5G5E A;  3FY7 A;  3MSZ A;  11GS A;  2HSH A;  4GCI A;  1K0D A;  1V57 A;  3GSS A;  3UOM A;  4YH2 A;  3CSI A;  1C72 A;  2JAC A;  1T7P B;  4TKY A;  3CYN A;  4I5Q A;  3IAM 2;  2VM1 A;  4KAE A;  2C3T A;  2H70 A;  2H1G A;  2NDO A;  1X9S B;  2EC4 A;  2DJ1 A;  3TJB A;  2MBS A;  5HR0 A;  5F8B A;  4E8E A;  4ML6 A;  2FWG A;  2BJX A;  3A2V A;  2H72 A;  3I43 A;  4MH2 A;  1GNW A;  2AYT A;  3ERG A;  1CQG A;  5COH A;  1Z7R A;  3C71 A;  3L9U A;  2ALB A;  3DGQ A;  5JWR B;  1A2J A;  1OC3 A;  2E7P A;  1SYX A;  3NOF A;  3NZN A;  1BX9 A;  3HHV A;  1PSQ A;  3F4T A;  3L0H A;  3CMI A;  1IYI A;  2BMX A;  2HXK A;  2K18 A;  4KSM A;  4DSS B;  2V2G A;  5CRD A;  3US3 A;  1WRY A;  4GF0 A;  4MCU A;  1JZO A;  1VF2 A;  4O5R A;  5B8A A;  2FUG 2;  1WMJ A;  5G5F A;  3SWL A;  5J3R A;  2M46 A;  2ZCT A;  1Q98 A;  1UVZ A;  4HJ2 A;  1BG5 A;  5EPF A;  1GL8 A;  1ILO A;  1GSF A;  5JCG A;  6GSY A;  1ZYN A;  1T3B A;  5DAL B;  3FYG A;  4TXO B;  3LXT A;  1AC1 A;  2X49 A;  2IWT A;  2DIZ A;  1QFN A;  5DVB A;  3F63 A;  1K0M A;  4ZXG A;  5ECP B;  4OO4 A;  1URM A;  1Q4J A;  4K1F A;  3O6T A;  4KDX A;  5E59 A;  3ERF A;  2N5F A;  3GH9 A;  1OC8 A;  4X0X A;  3FZA A;  4PTS A;  4ECC A;  1NSW A;  4KW6 A;  3F6D A;  4MK3 A;  5J5N A;  1SYR A;  3HD5 A;  3GN3 A;  2WZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...