1R26A

Crystal structure of thioredoxin from trypanosoma brucei brucei
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
113
structure length
113
Chain Sequence
b'IRMRARYPSVVDVYSVEQFRNIMSEDILTVAWFTAVWCGPCKTIERPMEKIAYEFPTVKFAKVDADNNSEIVSKCRVLQLPTFIIARSGKMLGHVIGANPGMLRQKLRDIIKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Structure of thioredoxin from Trypanosoma brucei brucei
pubmed doi rcsb
source organism Trypanosoma
molecule tags Electron transport
total genus 32
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2003-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1r26A00
5ECQB 5CRWA 1G0TA 4BVXA 5GZZB 3PGTA 2AAWA 5KN2A 5DALA 1K0MA 4MZWA 2VLTA 1V58A 1T3BA 2EC4A 3EMPA 1S3AA 4ECIA 1HQOA 1SENA 1ZL9A 3F4SA 2K8VA 3GH6A 2B6MA 2I3YA 1T1VA 4IQAA 1GLPA 4MLYA 1IYIA 2B1LA 3L9UA 4O5RA 4TKYA 5A4VA 4CDOA 4GRFA 4KH7A 3EINA 2AJQB 1T00A 3HHVA 1Z7PA 4WXTA 1MDKA 3Q18A 4O92A 4ULXA 4JEDA 4CHSA 4E8HA 4HU7A 1GUHA 3GA4A 4KUNA 1KEBA 1PD21 4V2LA 2GSRA 1F3AA 2XC2A 1X9WB 2RIIA 4KW6A 2CX4A 2C1YA 4K7OA 3OR5A 4PURA 2GSTA 2HZFA 4IS0A 2VCVA 5F05A 3M0FA 4DSQA 2LS5A 2AB6A 2G2QA 4KDXA 2XBIA 3CRUA 3DWVA 3TRQA 2WJUA 5JWQB 4GQCA 3ZVJA 4TXOB 5G5EA 2GTUA 2BTOT 2CVDA 20GSA 2CVBA 6GSVA 1Q98A 2VD0A 4MJBA 1ILOA 2HI7A 2FA8A 1XWAA 1ERVA 3HYPA 1BEDA 1SK1A 5DDLA 5IMVA 4F82A 1OKTA 1TRWA 4V1Ag 5KN3A 3ZMKA 1K0CA 1K0BA 4KAEA 4K0NA 2YANA 4YH2A 3KEBA 1RK4A 3A2WA 5D8IA 1CQGA 4AGSA 4IKHA 2VIMA 4AJ7A 5H5SA 2NBSA 3VK9A 2VCTA 3DXBA 1MTCA 5ECNB 2V32A 4OFMA 2VCZA 2H1DA 17GSA 1GLQA 3U5RE 5CNWA 2IPAA 1PA3A 5E59A 1MDJA 1GSFA 1PKWA 2I1UA 1JZOA 13GSA 1SKSB 3VI5A 4XS4B 4N0ZA 2RM6A 4G9HA 1EV4A 1THOA 5C00A 6GSYA 1QXHA 4IJ3A 4RI6A 2BMXA 5ECOB 3D21A 3FR6A 2ZCTA 2FCHA 4RQXA 2F8AA 3LJRA 3TDGA 1F6MC 4KSOA 2RM5A 2GQKA 4QL7A 2I81A 3F0IA 2B5XA 4GF0A 4ZBAA 2FA4A 4ID0A 3DYRA 1SJ6A 2VD1A 3I43A 1XBSA 2D2ZA 2VOCA 1DE1A 3HD5A 2PU9C 4BA7A 2H0HA 1XW5A 2ES7A 5B6MA 2B1KA 1TP9A 2DIYA 5A4WA 1JFUA 3L4NA 5IMCA 2OA7A 1B9XC 4DSSB 3I6AA 4WEYA 3GFKA 4KE3A 2CV4A 5CO3A 2JU5A 3VWVA 3DVWA 2VL2A 2YWIA 3ZYWA 1R5PA 5DAKB 5F0GA 3D0ZA 2N5AA 1GSUA 3FW2A 1M2AA 3KIJA 3P2AA 2PVQA 4Q5FA 4AJ8A 4TW5A 3IPZA 5CAXA 3IE3A 1R4WA 1SD9A 2GZYA 1BQ7A 5CRDA 3TKQA 4ZIJA 1XWGA 2DJ0A 5FWGA 3LG6A 1PSQA 4BWQA 1ST9A 5ECRB 3KTBA 3W8SA 4PQIA 2GT5A 5IO2A 2HNLA 5IOXA 3CMIA 1SL0B 2B5YA 3GIXA 2IFQA 4GSTA 3CRTA 5INYA 2TRXA 4TN8A 1YZXA 5H5RA 2Z9SA 1VF3A 1NW2A 1SJZA 5ECMB 4JBBA 2GDRA 2LRNA 2PPTA 4IHUA 1E6BA 1NHOA 1PX6A 2E0QA 2GSSA 3ZREA 3W6GA 5FHIA 4I5QA 1B8XA 2PVOC 5IIZA 12GSA 1WMJA 1T7PB 1RQMA 3SWLA 5DJLA 5HR0A 2WZ9A 1O7UA 1BX9A 1QFNA 2L59A 4OFNA 2DJ2A 3QDNA 4MDCA 3GKMA 3VPTA 2ON7A 3L78A 4MH3A 3SBCA 1M2DA 4NPBA 1EZKA 4HQZA 2LNSA 1YKCA 4WKWA 3BD2A 5C04A 2H8LA 4OD7A 3UL3A 3RBTA 1CQHA 1WWJA 4KNDA 3H1NA 2R37A 3TOUA 4MJCA 4I97A 2PN8A 3GTUA 1F37A 2TIRA 2L4QA 2H76A 5G31A 3HDCA 3ZZXA 4KCEA 3R2QA 4WETA 11GSA 2K8SA 2QSIA 4LMWA 4IGJA 3RHBA 4Q5QA 4HZ4A 1ON4A 3NOFA 2QKEA 1ZYQB 4MPFA 2FGXA 4TR1B 4ECJA 1A2JA 3VI7A 5EVOA 2B5EA 1JZDA 3FHKA 4EO3A 2RLIA 2KLXA 1XIYA 3IR4A 1YF0A 2EIQA 2N5BA 4IP6A 3UIWA 5F07A 3CXGA 3TJFA 1EP7A 5GSSA 3VWWA 4PQ1A 2JSZA 2VUPA 1I9DA 4TRXA 1GNEA 4FYBA 1EOGA 5ECPB 1SJIA 5J3RA 2LJAA 4D73B 3QCPA 4GXZA 2KP2A 2P31A 4K0GA 2JZTA 18GSA 3UVTA 1SK0A 2RUFA 3C7MA 3IAS2 1ACVA 4RUVA 1YQ1A 4G2EA 4QQ7A 4WR4A 3LXTA 1ZOFA 1HYUA 3DMLA 4XS6A 2F51A 3QR6A 2K18A 4KDYA 1GP1A 1Z6NA 2NVLA 5D9XA 3ZRDA 5CP1A 1UA5A 4FO5A 4YAVA 2EIRA 3GYKA 2LTKA 2YOIA 1XWKA 1GTIA 2I9HA 2MMZA 1YY7A 5DALB 1V40A 1U6TA 2OBIA 3DD3A 3GURA 1FB6A 1Y25A 3K8NA 2C0EA 4CW9A 4K8MA 1K3YA 4IELA 3ZIVA 3LXZA 4WF5A 1F3BA 1O6JA 1F2EA 1A24A 2P0GA 4MJEA 3TJJA 1HNBA 1FO5A 1M7TA 4JE1A 5DCHA 3MSZA 3H4KA 4K7IA 2OJLA 2C3TA 2V41A 4OWYA 4TVEA 4DSRA 1AAZA 4FYCA 1TK8B 2M46A 1N2AA 1OE8A 5D96A 5GAND 3CTFA 4PX1A 1U87A 1N8JA 3WGEA 3LQ7A 3DGQA 3QAWA 1O73A 2B3SA 4JZQA 1DBYA 1GRXA 1TK5B 4GLTA 2IN3A 5DQYA 4ZXGA 4J2FA 4Z7XA 3FRCA 3ZVJD 1MDIA 4MK3A 3HCZA 2MMNA 1XWCA 2IL3A 4HI7A 3IAM2 2FY6A 1G7OA 4EVMA 1XW9A 3HJMA 4JR6A 1QGVA 1C72A 3DRNA 2GQMA 5J9BA 2HXKA 4MF5A 2IWTA 4ECCA 4NXIA 4O32A 4LL4B 1Z9HA 2OKAA 2GLRA 6GSUA 5B6NA 1XOBA 4MP4A 4EXJA 1MD4A 1PQNA 2MMOA 1H4OA 1ZCPA 4XIHA 3QOUA 5JWRB 5DQSA 3P90A 4TOPA 2LRCA 4TXVA 2OE3A 3EVIA 1WP0A 3L9SA 2N5FA 1Q4JA 2VLVA 3TGZA 1H75A 4EDYA 2CZ3A 1A2MA 2WRTA 2J23A 3A2VA 1PMTA 2KOKA 2JACA 1M9BA 4XRAA 3GV1A 1KNGA 4KSMA 3ZL5A 2XPEA 3TJBA 2M80A 3LSZA 2VM2A 1WE0A 3HVVA 5HR3A 2HRFA 1GSQA 3BOAA 1GTBA 2H30A 2DJ1A 4ZL9A 4KGIA 4ML1A 1V2AA 4ML6A 1XVQA 4F0BA 3KGKA 2A2SA 1EEMA 3VPQA 3JCML 2YWMA 2JADA 2V6OA 2YWOA 1UC7A 2O7KA 2VM1A 3ZFBA 1Z6MA 1EV9A 2H73A 1AW9A 1UVZA 4KCAA 2AV4A 3F9UA 1A2LA 4O7HA 3CYNA 3O76A 2E2MA 3PH9A 1VGLA 4I8BA 5EPFA 1U3IA 1S3DA 5J41A 4MZCA 4HEA2 2DBCA 3KD0A 5IMZA 2IJYA 3IBHA 1VF2A 4ILFA 1EGRA 6GSWA 3VLNA 2R5GA 2HZEA 3F4RA 4HQSA 4LMVA 2R2JA 1V9WA 4X1UA 2XHFA 4MCUA 1XXUA 5J9CA 2GT6A 4K6XA 5J5NA 4NHZA 2WFCA 1LJRA 19GSA 1GNWA 2X99A 3F4TA 3C71A 3ME8A 4FYUA 2X64A 1X0RA 2P5RA 1WOUA 3FYGA 10GSA 3TKSE 1ZYEA 3KP8A 2REMA 2GZPA 1AIUA 1NSWA 2ZNMA 4IP1A 1QMVA 1EWXA 3RPNA 3ISOA 2K9FA 1DUGA 2VO4A 2M72A 1XZOA 4KA0A 4XS1A 1RW1A 4MMMA 2CA8A 1WJKA 2PERA 4G10A 5J4UA 1HD2A 3F3QA 2C4JA 3TOTA 1ERWA 3FZ9A 2P5QA 4L5LA 1YJ6A 2FHEA 3MAKA 4L5OA 1SL2B 4DVCA 3DKSA 4MPGA 4GQFA 2MYGA 3M3MA 4JR4A 4FIWA 1E2YA 5ELAA 3HXSA 2H75A 2DJKA 2XPDA 5HFKA 2LQOA 3E9JB 2H01A 1TKDB 3TKSA 3O3TA 1GSYA 4OO5A 1K0NA 4G19A 2IFQB 4NV5A 5IM9A 4XS4A 3HVXA 3C73A 1DE2A 2AHEA 1GTAA 2TRCP 3KXOA 5EY6A 1T8EB 1VF4A 2DMMA 2VAFA 5FT3A 3TKRA 4L8EA 3GNJA 3IV4A 3PINA 1X9SB 1WPIA 1W89A 3M9KA 1K0AA 4BL7A 2I4AA 1X5EA 4BWSA 2H6ZA 5EL8A 2CX3A 5AIVA 1K0OA 2KHPA 5HQPA 2FWGA 1OC9A 5AIXA 3FR9A 5DVBA 1TTZA 1SD8A 3QPMA 3FZ4A 1OE7A 3VURA 3MNGA 1JZWA 2HFDA 4WBRD 5COHA 1XVWA 1GSSA 1FB0A 4WF4A 3DEXA 4HS1A 1BYEA 3ZTLA 2PWJA 2LRTA 3TB2A 3GRXA 1K3OA 4E8EA 3S9FA 3KMNA 5DAKA 4MA9A 4EUYA 5ID2A 2PMTA 5F06A 2H72A 3EE2A 2VL3A 1JZRA 1OVNA 3H93A 2R4VA 3NZNA 1IYHA 2JZRA 2DIZA 1SYRA 4RI7A 3E0UA 5KN0A 2CT6A 1PL1A 6GSXA 4ACSA 5JWOB 2O89A 2L6DA 4YQMA 1YKAA 4TR4A 3CSJA 4YQVA 1Z5YE 4J57E 5AN1A 3QFBC 2WS2A 1BJXA 5AGYA 1PGTA 2O8VB 5IO0A 3GX0A 1F9MA 2YZUA 3D5JA 4MF7A 5G1KA 4ZB8A 4KB3A 4F03A 3QMXA 4J56E 4GSSA 1PKZA 3D22A 1M2BA 1FVKA 2LKUA 2RUEA 3APOA 5IPHA 1B48A 2DLXA 5D9VA 3GH9A 5HFGA 3ME7A 3F8UA 5F8BA 3BBYA 4EKZA 4EF0A 3UMAA 4ZILA 2YPMA 3N5OA 3F6FA 5LCZA 5DCGA 2V6KA 2CQ9A 2GVPA 2YV9A 3VWXA 1A8LA 3N9JA 1WIKA 2NTOA 1GUKA 1DSBA 4Q5RA 3LWAA 5JCGA 2GGTA 3C8EA 1WRYA 3GL5A 2PGTA 1ML6A 3KZQA 1VRSD 3PR8A 3GKNA 1JLWA 1VF1A 1O81A 2MMAA 2FWHA 3W8JA 4DEJA 3FEUA 2O87A 3TRXA 1EEJA 3GUSA 4NMUA 22GSA 2G0FA 1R7HA 4OO4A 1SL1B 5ECIB 3L9VA 4PXOA 2L5OA 5G30A 1Y6EA 4TR1A 2YZHA 2R3XA 3QAVA 1KBNA 16GSA 5AISA 3APSA 1X5CA 3IK9A 2VCQA 3EWLA 2PUKC 3GKKA 4POLA 4XRDA 3TKPA 3MWHA 3EU3A 3ERWA 1JHBA 2L4CA 2H0GA 1YEXA 1GULA 4F9ZA 5ECSA 2YJ7A 3WD6A 4L0UA 2JZSA 1YDKA 1QK8A 5ECLB 4LLRA 4D73A 4ZL7A 4WR5A 1PN9A 1R26A 1XOAA 1X9MB 1MEKA 2L5LA 1GTUA 4ZL8A 3L0HA 3UBLA 1TI1A 1XW6A 5CREA 3D4TA 3APQA 3M9JA 3RDWA 1TOFA 1HNCA 2H1BA 2LUSA 1BG5A 4EE0A 1QQ2A 5JCUA 2J9HA 4YQUA 3HJPA 2H6XA 5CRHA 1M9AA 2BJXA 3UARA 1A8YA 4EL1A 5IMDA 3J7Yk 2IMEA 4MF6A 3GSSA 1TXXA 3CSHA 4BVYA 2QC7A 4AJ6A 4LL1B 5G1LA 2HSYA 1NM3A 5IMAA 2HYXA 2YP6A 3TRPA 3KTLA 4I6XA 3UAPA 3A3TA 5HR2A 4NAXA 5LD0A 2C0DA 2HT9A 2CVKA 3GN3A 1B4PA 4GCIA 3IRAA 2YV7A 4OMVA 2L6CA 2F8FA 1T4ZA 3J7Yb 4WBJA 2OADA 1Z3EA 4XCSA 4KDUA 1FVJA 3G7YA 1SKRB 2HRNA 1FW1A 2DC5A 3G7IA 2C0FA 5LNKe 2GSQA 2H70A 14GSA 3GMFA 3QFAC 4XHMA 2YWNA 3G7JA 1ERUA 1USBA 2VLUA 1V98A 2H74A 6GSSA 1OKDA 3ZLPA 1LU4A 3V1WA 2HZEB 5KN1A 3CBUA 2WDUA 1OC3A 2HLSA 1AXDA 2IMFA 1O85A 4ZBDA 3D4MA 3F63A 1JLVA 2FNOA 2LEGA 4HJ2A 1GH2A 3KH9A 3G9BA 1U88A 1T4YA 2HE3A 1GWCA 2OE1A 1LBKA 3KP9A 2YJHA 3ERGA 2OACA 4V1Ap 5IMFA 2OE0A 3DIEA 1TRSA 4OCFA 4IN0A 3HKRA 2A4VA 2LJKA 1Z7RA 3UEMA 3GL3A 1I5GA 3EMXA 3BCKA 2X8GA 2ON5A 2JL4A 5B8AA 3QAGA 1TI3A 2A2RA 3ED3A 4PNGA 1ERTA 2LQQA 4PQHA 4ZB9A 2AYTA 1TW9A 1SKWB 2DMLA 3A5WA 4GSNA 1GSDA 4I2UA 1SU9A 3KM6A 1TDIA 1XWBA 3Q6OA 1G7EA 3NIVA 3WT1A 4OCEA 2LJRA 3TUEA 4TXOA 1O8XA 2NPBA 4OFTA 1J9BA 1TRUA 2LV3A 1J0FA 1KTEA 3LORA 2AUVA 3HZ4A 4BPYA 4N11A 5D9TA 3C1RA 1K0DA 2JSYA 4NWYA 4GWRA 1GUMA 1EGOA 3EC3A 3I69A 2VCXA 5A4UA 3DVXA 2WCIA 4HU9A 2B7JA 5H5QA 1ABAA 4HJMA 3C1SA 4HOJA 2H66A 4HZ2A 3GHAA 1OC9B 1S3CA 3EYTA 2YCDA 3LEFA 5CYYA 5DBQA 1GL8A 2E7PA 2WULA 1AC1A 1YEPA 4MJAA 3ZITA 4Q5NA 3WT2A 2MBTA 3IC4A 2VL9A 3LGCA 3BCIA 3FKFA 4LA1A 2CAQA 1SK2A 4TR0A 2H19A 1OYJA 2QGVA 5ECHB 2FLSA 1FAAA 3CSIA 3D6IA 5A5KA 2NDOA 5ID2B 2IIYA 3P7XA 5IQYA 1BAYA 5JCWA 4XTSA 5E4WA 1TU8A 2H71A 1U3AA 2KUCA 2OBKA 3HY2A 5ABRA 5GSTA 4HDEA 1AQVA 2ALBA 3M8NA 1A23A 2IMKA 5L71A 5KEJA 3LYPA 3HJOA 2R6KA 1NHYA 3VFIA 3TJGA 4IQ1A 4K9ZA 1XFLA 3FK8A 3UJ1A 4N30A 4K7NA 4DSSA 1PL2A 1AQXA 1J08A 4L0WA 2FWFA 2H0IA 2H1GA 4X0XA 1AUCA 1K3LA 3IA1A 2X8CA 1FOVA 1FG4A 1PX7A 3GTUB 3QD9A 1G6YA 3EURA 1ZMAA 3Q74A 4AF2A 3LYKA 2GS3A 5B8BA 1M0UA 2C3NA 3KJYA 1YF1A 3GKXA 3WGXA 3RHCA 3FZ5A 3O6TA 1THXA 1TK0B 1V57A 3FR3A 2FD3A 2PBJA 4POBA 4V2MA 2DJ3A 2L57A 3IHQA 3A2XA 1AQWA 4NV2A 1EP8A 3BJ5A 4IBPA 1URMA 4F2IA 3F6DA 4PUFC 2MBSA 4TR3A 3GSTA 4MZBA 4YAPA 2C0GA 1R5AA 2CAIA 5HFIA 3U6VA 2V2GA 2DSAA 5G2ZA 4HUAA 1EOHA 2H1AA 1XPVA 3IXRA 4MH2A 3LFLA 1OC8A 3F3RA 3TKSC 2GZZA 2YNXA 6GSTA 5IOWA 5GAPD 2VL2C 4PNFA 2C3QA 4I2TA 2LSTA 1GSEA 1ZGNA 3P8WA 3MDKA 2O85A 1B4QA 3TCOA 3KCMA 3FY7A 1QUWA 1A0FA 1TJDA 2WB9A 1M99A 3HVSA 2YN1A 4NHWA 3VWUA 3IK7A 2E2GA 4FH8A 3ZMLA 2GQLA 2MZCA 4X43A 7GSSA 2V1MA 3TJKA 2H6YA 3H79A 3H8QA 3WYWA 3IOSA 4P3YB 2EIOA 5ELGA 2XBQA 3RAZA 2F9SA 2WGRA 2LNTA 1B9YC 3FZAA 4IW9A 3RPPA 4GTUA 1W4VA 5D9WA 4K1FA 8GSSA 3UBKA 1UN2A 4POMA 2CZ2A 2IMIA 4K2DA 2X8HA 4H86A 2B7KA 1X5DA 1OAZA 2C80A 4IJIA 1FHEA 3UVHA 1HNAA 3E3EA 1SYXA 2HSHA 4N0VA 4PGTA 2IMDA 3KH7A 5HR1A 9GSSA 2KP1A 4EC0A 3EU4A 4ECBA 3CTGA 2ZUPA 3US3A 1A0RP 2C8UA 4EDZA 3HA9A 2K6VA 5D93A 1TRVA 4N10A 4V2NA 1PRXA 3HZ8A 4QL9A 3Q19A 4JRRA 2DJJA 4IVFA 3KMOA 5DJMA 5G5FA 4KX4A 4JU5A 1MD3A 1XCCA 1ZZYA 4ISDA 4MABA 3WGDA 4ZB6A 3GX8A 2FUG2 5CRGA 5IPGA 4F0CA 3ERFA 1TU7A 4RQRA 5ECKB 3ZIJA 3AY8A 3IDVA 2VCWA 5ENUA 2F3MA 2FWEA 5B7CA 3M1GA 5D73A 4PUAA 4POKA 3UOMA 3ZFLA 1G6WA 3I9V2 4ZBBA 1O8WA
chains in the Genus database with same CATH superfamily
5ECQB 5CRWA 1G0TA 4BVXA 5GZZB 3PGTA 2AAWA 5KN2A 5DALA 1K0MA 4MZWA 2VLTA 1V58A 1T3BA 2EC4A 3EMPA 1S3AA 4ECIA 1HQOA 1SENA 1ZL9A 3F4SA 2K8VA 3GH6A 2B6MA 2I3YA 1T1VA 4IQAA 1GLPA 4MLYA 1IYIA 2B1LA 3L9UA 4O5RA 4TKYA 5A4VA 4CDOA 4GRFA 4KH7A 3EINA 3R3EA 2AJQB 1T00A 3HHVA 1Z7PA 4WXTA 1MDKA 3Q18A 4O92A 4ULXA 4JEDA 4CHSA 4E8HA 4HU7A 1GUHA 3GA4A 4KUNA 1KEBA 1PD21 4V2LA 2GSRA 1F3AA 2XC2A 1ZYNA 1X9WB 2RIIA 4KW6A 2CX4A 2C1YA 4K7OA 3OR5A 4PURA 2GSTA 2DKHA 2HZFA 4IS0A 2VCVA 5F05A 3M0FA 4DSQA 2LS5A 2AB6A 2G2QA 4KDXA 2XBIA 3CRUA 3DWVA 3TRQA 2WJUA 5JWQB 4GQCA 3ZVJA 4TXOB 5G5EA 2GTUA 2BTOT 2CVDA 20GSA 2CVBA 6GSVA 1Q98A 2VD0A 3PPUA 4MJBA 1ILOA 2HI7A 2FA8A 1XWAA 1ERVA 3HYPA 1BEDA 1SK1A 5DDLA 5IMVA 4F82A 1OKTA 1TRWA 4V1Ag 5KN3A 3ZMKA 1K0CA 1K0BA 4KAEA 4K0NA 2YANA 4YH2A 3KEBA 1RK4A 3A2WA 5D8IA 1CQGA 4AGSA 4IKHA 2VIMA 4AJ7A 5H5SA 2NBSA 3VK9A 2VCTA 3DXBA 1MTCA 3IC8A 3MYDA 5ECNB 2V32A 4OFMA 2VCZA 2H1DA 17GSA 1GLQA 3U5RE 5CNWA 2IPAA 1PA3A 5E59A 1MDJA 1GSFA 1PKWA 2I1UA 1JZOA 13GSA 1SKSB 3VI5A 4XS4B 4N0ZA 2RM6A 4G9HA 1EV4A 1THOA 5C00A 6GSYA 1QXHA 4IJ3A 4RI6A 2BMXA 5ECOB 3D21A 3FR6A 2ZCTA 2FCHA 4RQXA 2F8AA 3LJRA 3TDGA 1F6MC 4KSOA 2RM5A 2GQKA 4QL7A 2I81A 3F0IA 2B5XA 4GF0A 4ZBAA 2FA4A 4ID0A 3DYRA 1SJ6A 4BL7B 2VD1A 3I43A 1XBSA 2D2ZA 2VOCA 1DE1A 3HD5A 2PU9C 4BA7A 2H0HA 1XW5A 2ES7A 5B6MA 2B1KA 1TP9A 2DIYA 5A4WA 1JFUA 3L4NA 4K5RA 5IMCA 2OA7A 1B9XC 4CY8A 4DSSB 3I6AA 4WEYA 4O5QA 3GFKA 4KE3A 2CV4A 5CO3A 2JU5A 3VWVA 3DVWA 2R0GA 2VL2A 2YWIA 3ZYWA 1R5PA 4FQUA 5DAKB 5F0GA 3D0ZA 2N5AA 1GSUA 3FW2A 1M2AA 3KIJA 3P2AA 2PVQA 4Q5FA 4AJ8A 4TW5A 3IPZA 5CAXA 3IE3A 1R4WA 1SD9A 2GZYA 1BQ7A 5CRDA 3TKQA 4ZIJA 1XWGA 2DJ0A 5FWGA 3LG6A 1PSQA 4BWQA 1ST9A 5ECRB 3MIXA 3KTBA 3W8SA 4PQIA 2GT5A 5IO2A 2HNLA 5IOXA 3CMIA 1SL0B 2B5YA 3GIXA 2IFQA 4GSTA 3CRTA 5INYA 2TRXA 4TN8A 1YZXA 5H5RA 2Z9SA 1VF3A 1NW2A 4USSA 1SJZA 5ECMB 4JBBA 2GDRA 1FOHA 4YKGA 2LRNA 2PPTA 5BMUA 4IHUA 1E6BA 4KF9A 1NHOA 1PX6A 2E0QA 2GSSA 1PN0A 2UZ8A 3ZREA 3W6GA 5FHIA 4I5QA 1B8XA 2PVOC 5IIZA 12GSA 1WMJA 1T7PB 1RQMA 3SWLA 5DJLA 5HR0A 2WZ9A 1O7UA 1BX9A 1QFNA 2L59A 4OFNA 2DJ2A 3QDNA 4MDCA 3GKMA 3VPTA 2ON7A 3L78A 4MH3A 3SBCA 3LW9A 1M2DA 4NPBA 1EZKA 4K5SA 4HQZA 2LNSA 1ZYPA 1YKCA 4WKWA 3BD2A 5C04A 2H8LA 4OD7A 3UL3A 3RBTA 1CQHA 1WWJA 4KNDA 3H1NA 2R37A 3TOUA 4MJCA 4I97A 2PN8A 3GTUA 1F37A 2TIRA 2L4QA 2H76A 5G31A 3HDCA 3ZZXA 2A2PA 4KCEA 3R2QA 4WETA 11GSA 2K8SA 2QSIA 4LMWA 4IGJA 3RHBA 4Q5QA 4HZ4A 1ON4A 3NOFA 2QKEA 1ZYQB 4MPFA 2FGXA 4TR1B 4ECJA 1A2JA 3VI7A 5EVOA 2B5EA 1JZDA 3FHKA 4EO3A 2RLIA 2KLXA 1XIYA 3IR4A 1YF0A 2EIQA 2N5BA 4IP6A 3UIWA 5F07A 3CXGA 3TJFA 1EP7A 5GSSA 3VWWA 4PQ1A 2JSZA 2VUPA 1I9DA 4TRXA 1GNEA 4FYBA 1EOGA 5ECPB 1SJIA 5J3RA 2LJAA 4D73B 3QCPA 4GXZA 2KP2A 2P31A 4K0GA 2JZTA 18GSA 3UVTA 1SK0A 2RUFA 3C7MA 4G0LA 3IAS2 1ACVA 4RUVA 1S3RA 1YQ1A 4G2EA 4QQ7A 4WR4A 3LXTA 1ZOFA 1HYUA 3DMLA 4XS6A 2F51A 3QR6A 2K18A 4KDYA 1GP1A 1Z6NA 2NVLA 4EIQA 5D9XA 2R0CA 3ZRDA 5CP1A 1UA5A 4FO5A 4YAVA 2EIRA 3GYKA 2LTKA 2YOIA 1XWKA 1GTIA 2I9HA 2MMZA 1YY7A 5DALB 1V40A 1U6TA 2OBIA 3DD3A 3GURA 1FB6A 1Y25A 3K8NA 2C0EA 4CW9A 4K8MA 1K3YA 4IELA 3ZIVA 3LXZA 4WF5A 1F3BA 1O6JA 1F2EA 1A24A 2P0GA 4MJEA 3TJJA 4X4JA 1HNBA 1FO5A 1M7TA 4JE1A 5DCHA 3MSZA 3H4KA 4K7IA 2OJLA 2C3TA 2V41A 4OWYA 4TVEA 4DSRA 1AAZA 4FYCA 1TK8B 2M46A 1N2AA 1OE8A 5D96A 5GAND 3CTFA 4PX1A 1U87A 1N8JA 3WGEA 3LQ7A 3DGQA 3QAWA 1O73A 2B3SA 4JZQA 1DBYA 1GRXA 1TK5B 4GLTA 2IN3A 1XG8A 5DQYA 4ZXGA 4J2FA 4Z7XA 3FRCA 3ZVJD 1MDIA 4MK3A 3HCZA 2MMNA 1XWCA 2IL3A 4HI7A 3IAM2 2FY6A 1G7OA 4EVMA 1XW9A 3HJMA 4JR6A 1QGVA 1C72A 3DRNA 2GQMA 5J9BA 2HXKA 4MF5A 2IWTA 4ECCA 4NXIA 4O32A 4LL4B 1Z9HA 2OKAA 2GLRA 6GSUA 5B6NA 1XOBA 4MP4A 4EXJA 1MD4A 1PQNA 2MMOA 1H4OA 1ZCPA 4XIHA 3QOUA 5JWRB 5DQSA 3P90A 4TOPA 2LRCA 4TXVA 2OE3A 3EVIA 1WP0A 3L9SA 2N5FA 1Q4JA 2VLVA 3TGZA 1H75A 4EDYA 2CZ3A 1A2MA 2WRTA 2J23A 3A2VA 1PMTA 2KOKA 2JACA 4G0IA 1M9BA 4XRAA 3GV1A 1KNGA 4KSMA 3ZL5A 4EIPA 2XPEA 3TJBA 2M80A 3LSZA 2VM2A 1WE0A 3HVVA 5HR3A 2HRFA 1GSQA 3BOAA 1GTBA 2H30A 2DJ1A 4ZL9A 4KGIA 4ML1A 1V2AA 4ML6A 1XVQA 4F0BA 3KGKA 2A2SA 1EEMA 3VPQA 3JCML 2YWMA 2JADA 2V6OA 2YWOA 1UC7A 2O7KA 2VM1A 3ZFBA 1Z6MA 1EV9A 2H73A 1AW9A 1UVZA 4KCAA 2AV4A 3F9UA 1A2LA 4O7HA 3CYNA 3O76A 2E2MA 3PH9A 1VGLA 4I8BA 5EPFA 1U3IA 1S3DA 5J41A 4MZCA 4HEA2 2DBCA 3KD0A 5IMZA 2IJYA 3IBHA 1VF2A 4ILFA 1EGRA 6GSWA 3VLNA 2R5GA 2HZEA 3F4RA 4HQSA 4LMVA 2R2JA 1V9WA 4X1UA 2XHFA 4MCUA 1XXUA 5J9CA 2GT6A 4K6XA 5J5NA 5KOXA 4NHZA 2WFCA 1LJRA 19GSA 1GNWA 2X99A 3F4TA 3C71A 3ME8A 4FYUA 2X64A 1X0RA 2P5RA 1WOUA 3FYGA 10GSA 3TKSE 1ZYEA 3KP8A 2REMA 2GZPA 1AIUA 1NSWA 2ZNMA 4IP1A 1QMVA 1EWXA 3RPNA 3ISOA 2K9FA 1DUGA 2VO4A 2M72A 1XZOA 4KA0A 4XS1A 1RW1A 4MMMA 2CA8A 1WJKA 2PERA 4G10A 5J4UA 1HD2A 3F3QA 2C4JA 3TOTA 1ERWA 3FZ9A 2P5QA 2R0PA 4L5LA 1YJ6A 2FHEA 3MAKA 4L5OA 1SL2B 4DVCA 3DKSA 4MPGA 4GQFA 2MYGA 3M3MA 4JR4A 4FIWA 1E2YA 5ELAA 3HXSA 2H75A 2DJKA 2XPDA 5HFKA 2LQOA 3E9JB 2H01A 1TKDB 3TKSA 2HRKA 3O3TA 1GSYA 4OO5A 1K0NA 4G19A 2IFQB 4NV5A 5IM9A 4XS4A 3HVXA 4CY6A 3C73A 1DE2A 4YKFA 2AHEA 1GTAA 2TRCP 4BIKA 3KXOA 5EY6A 1T8EB 1VF4A 2DMMA 2VAFA 5FT3A 3TKRA 4Z2TA 4L8EA 3GNJA 3IV4A 3PINA 1X9SB 1WPIA 1W89A 3M9KA 1K0AA 4BL7A 2I4AA 1X5EA 4BWSA 2H6ZA 5EL8A 2CX3A 5AIVA 1K0OA 2KHPA 5HQPA 2FWGA 1OC9A 5AIXA 3FR9A 5DVBA 1TTZA 4PTSA 1SD8A 3QPMA 3FZ4A 1OE7A 3VURA 3MNGA 1JZWA 2HFDA 4WBRD 5COHA 1XVWA 1GSSA 1FB0A 4WF4A 3DEXA 4Z2RA 4HS1A 1BYEA 3ZTLA 2PWJA 2LRTA 3TB2A 3GRXA 1K3OA 4E8EA 3S9FA 3KMNA 5DAKA 4MA9A 5BRTA 4EUYA 5ID2A 2PMTA 5F06A 2H72A 3EE2A 2VL3A 1JZRA 1OVNA 3H93A 2R4VA 3NZNA 1IYHA 2JZRA 2DIZA 1SYRA 4RI7A 3E0UA 5KN0A 2CT6A 1PL1A 6GSXA 4ACSA 5JWOB 2O89A 2L6DA 4YQMA 1YKAA 4TR4A 3CSJA 4YQVA 1Z5YE 4J57E 5AN1A 3QFBC 2WS2A 1BJXA 5AGYA 1PGTA 2O8VB 5IO0A 3GX0A 1F9MA 2YZUA 3D5JA 4MF7A 5G1KA 4ZB8A 4KB3A 1M3JA 4F03A 3QMXA 4J56E 4GSSA 1PKZA 3D22A 1M2BA 1FVKA 2LKUA 2RUEA 3APOA 5IPHA 1B48A 2DLXA 5D9VA 3GH9A 5HFGA 3ME7A 3F8UA 5F8BA 3BBYA 4EKZA 4EF0A 3UMAA 4ZILA 2YPMA 3N5OA 3F6FA 4O5UA 5LCZA 5DCGA 2V6KA 2CQ9A 2GVPA 2YV9A 3VWXA 1A8LA 3FMWA 3N9JA 1WIKA 2NTOA 1GUKA 1DSBA 4Q5RA 3LWAA 5JCGA 2GGTA 3C8EA 1WRYA 3GL5A 2PGTA 1ML6A 3KZQA 1VRSD 3PR8A 3GKNA 4ICYA 1JLWA 1VF1A 1O81A 2MMAA 2FWHA 3W8JA 4DEJA 3FEUA 2O87A 3TRXA 1EEJA 3GUSA 4NMUA 22GSA 2G0FA 1R7HA 4OO4A 1SL1B 5ECIB 3L9VA 4PXOA 2L5OA 5G30A 1Y6EA 4TR1A 2YZHA 2R3XA 3QAVA 1KBNA 4BVXB 4Z2UA 16GSA 5AISA 3APSA 1X5CA 3IK9A 2VCQA 3EWLA 2PUKC 3GKKA 4POLA 4XRDA 3TKPA 3MWHA 3EU3A 3ERWA 1JHBA 2L4CA 2H0GA 1YEXA 1GULA 4F9ZA 5ECSA 2YJ7A 3WD6A 4L0UA 2JZSA 1YDKA 1QK8A 5ECLB 4LLRA 4D73A 4ZL7A 4WR5A 5KOWA 1PN9A 1R26A 1XOAA 1X9MB 1MEKA 2L5LA 1GTUA 4ZL8A 3L0HA 3UBLA 1TI1A 1XW6A 5CREA 3D4TA 3APQA 3M9JA 3RDWA 1TOFA 1HNCA 2H1BA 2LUSA 1BG5A 4EE0A 1QQ2A 5JCUA 2J9HA 4YQUA 3HJPA 2H6XA 5CRHA 1M9AA 2BJXA 3UARA 1A8YA 4EL1A 5IMDA 3J7Yk 2IMEA 4MF6A 3GSSA 1TXXA 3CSHA 3EPTA 4BVYA 2QC7A 4AJ6A 4LL1B 5G1LA 2HSYA 1NM3A 5IMAA 2HYXA 1M3IA 2YP6A 3TRPA 3KTLA 4I6XA 3UAPA 3A3TA 5HR2A 4NAXA 5LD0A 2C0DA 2HT9A 1PFOA 2CVKA 3GN3A 2X49A 1B4PA 4GCIA 3IRAA 2YV7A 4OMVA 2L6CA 2F8FA 1T4ZA 3J7Yb 4WBJA 2OADA 1Z3EA 4XCSA 4KDUA 1FVJA 3G7YA 1SKRB 2HRNA 1FW1A 2DC5A 3G7IA 2C0FA 5LNKe 2GSQA 2H70A 14GSA 3GMFA 3QFAC 4XHMA 4A5PA 2YWNA 3G7JA 1ERUA 1USBA 2VLUA 1V98A 2H74A 6GSSA 1OKDA 3ZLPA 1LU4A 3V1WA 2HZEB 5KN1A 3CBUA 2WDUA 1OC3A 2HLSA 1AXDA 2IMFA 1O85A 4ZBDA 3D4MA 3F63A 1JLVA 2FNOA 2LEGA 4HJ2A 1GH2A 3KH9A 3G9BA 1U88A 1T4YA 2HE3A 3CQFA 1GWCA 2OE1A 1LBKA 3KP9A 2YJHA 3ERGA 2OACA 4V1Ap 5IMFA 2OE0A 3DIEA 1TRSA 4OCFA 4IN0A 3HKRA 2A4VA 2LJKA 1Z7RA 3UEMA 3GL3A 1I5GA 3EMXA 3BCKA 2X8GA 2ON5A 2JL4A 5B8AA 3QAGA 1TI3A 2A2RA 3ED3A 4PNGA 1ERTA 2LQQA 4PQHA 2DKIA 4ZB9A 2AYTA 1TW9A 1SKWB 2DMLA 3A5WA 4GSNA 1GSDA 4I2UA 1SU9A 3KM6A 1TDIA 1XWBA 3Q6OA 1G7EA 3NIVA 3WT1A 4OCEA 2LJRA 3TUEA 4TXOA 1O8XA 2NPBA 4OFTA 1J9BA 1TRUA 2LV3A 1J0FA 1KTEA 3LORA 2AUVA 3HZ4A 4BPYA 4N11A 5D9TA 2A4HA 3A5IA 3C1RA 1K0DA 2JSYA 4NWYA 4GWRA 1GUMA 1EGOA 3EC3A 3I69A 2VCXA 5A4UA 3DVXA 2WCIA 2QA2A 4HU9A 2B7JA 5H5QA 1ABAA 4HJMA 3C1SA 4HOJA 2H66A 4HZ2A 3GHAA 1OC9B 1S3CA 3EYTA 2YCDA 3LEFA 5CYYA 5DBQA 1GL8A 2E7PA 2WULA 1AC1A 1YEPA 4MJAA 3ZITA 4Q5NA 3WT2A 2MBTA 3IC4A 2VL9A 3LGCA 3BCIA 3FKFA 4LA1A 2CAQA 1SK2A 4HSCX 4TR0A 2H19A 1OYJA 2QGVA 5ECHB 2FLSA 2HSMA 1FAAA 3CSIA 3D6IA 5A5KA 2NDOA 5ID2B 2IIYA 3P7XA 3HVNA 5IQYA 1BAYA 5JCWA 4XTSA 5E4WA 1TU8A 2H71A 1U3AA 2KUCA 2OBKA 3HY2A 5ABRA 5GSTA 4HDEA 1AQVA 2ALBA 3M8NA 1A23A 2IMKA 5L71A 5KEJA 3LYPA 3HJOA 2R6KA 1NHYA 3VFIA 3TJGA 4IQ1A 4K9ZA 1XFLA 3FK8A 3UJ1A 4N30A 4K7NA 4DSSA 1PL2A 1AQXA 1J08A 4L0WA 2FWFA 2H0IA 2H1GA 4X0XA 1AUCA 1K3LA 3IA1A 2X8CA 1FOVA 1FG4A 1PX7A 3GTUB 3QD9A 1G6YA 3EURA 1ZMAA 3Q74A 4AF2A 3LYKA 2GS3A 5B8BA 1M0UA 2C3NA 3KJYA 1YF1A 3GKXA 3WGXA 3RHCA 3FZ5A 3O6TA 1THXA 1TK0B 1V57A 3FR3A 2FD3A 2PBJA 4POBA 4V2MA 2DJ3A 2L57A 3IHQA 3A2XA 1AQWA 4NV2A 1EP8A 3BJ5A 4IBPA 1URMA 4F2IA 3F6DA 4PUFC 2HRAA 2MBSA 4TR3A 3GSTA 4MZBA 4YAPA 2C0GA 1R5AA 2CAIA 5HFIA 3U6VA 2V2GA 2X4AA 2DSAA 5G2ZA 4HUAA 1EOHA 2H1AA 1XPVA 3IXRA 4MH2A 3LFLA 1OC8A 3F3RA 3TKSC 2GZZA 2YNXA 6GSTA 5IOWA 5GAPD 2VL2C 4PNFA 2C3QA 4I2TA 2LSTA 1GSEA 1ZGNA 3P8WA 3MDKA 2O85A 1B4QA 3TCOA 3KCMA 3FY7A 1QUWA 1A0FA 1TJDA 2WB9A 1M99A 3HVSA 2YN1A 4NHWA 3VWUA 3IK7A 4MNNA 2E2GA 4FH8A 2QA1A 3ZMLA 2GQLA 2MZCA 4X43A 7GSSA 2V1MA 3TJKA 2H6YA 3H79A 3H8QA 3WYWA 3IOSA 4P3YB 2EIOA 5ELGA 2XBQA 3RAZA 2F9SA 3IHGA 2WGRA 2LNTA 1B9YC 4G0KA 3FZAA 4IW9A 3RPPA 4GTUA 1W4VA 5D9WA 4K1FA 8GSSA 3UBKA 1UN2A 4POMA 2CZ2A 2IMIA 4K2DA 2X8HA 4H86A 2B7KA 1X5DA 1OAZA 2C80A 4IJIA 1FHEA 3UVHA 1HNAA 3E3EA 1SYXA 2HSHA 4N0VA 4PGTA 2IMDA 3KH7A 5HR1A 9GSSA 2KP1A 4EC0A 3EU4A 4ECBA 3CTGA 2ZUPA 3US3A 1A0RP 2C8UA 4EDZA 3HA9A 2K6VA 5D93A 1TRVA 4N10A 4V2NA 1PRXA 3HZ8A 4QL9A 3Q19A 4JRRA 2DJJA 4BVYB 4IVFA 3KMOA 5DJMA 5G5FA 4K2XA 4KX4A 4JU5A 1MD3A 1XCCA 1ZZYA 4ISDA 4MABA 3WGDA 4ZB6A 3GX8A 2FUG2 5CRGA 5IPGA 4F0CA 3ERFA 1TU7A 4RQRA 5ECKB 3ZIJA 3AY8A 3IDVA 2VCWA 5ENUA 2F3MA 2FWEA 5B7CA 3M1GA 5D73A 4PUAA 4POKA 3UOMA 3ZFLA 1G6WA 3I9V2 4ZBBA 1O8WA
chains in the Genus database with same CATH topology
5ECQB 5CRWA 1G0TA 4BVXA 5GZZB 3PGTA 2AAWA 5KN2A 5DALA 1K0MA 4MZWA 2VLTA 1V58A 1T3BA 2EC4A 3EMPA 1S3AA 4ECIA 1HQOA 1SENA 1ZL9A 3F4SA 2K8VA 3GH6A 2B6MA 2I3YA 1T1VA 4IQAA 1GLPA 4MLYA 1IYIA 2B1LA 3L9UA 4O5RA 4TKYA 5A4VA 4CDOA 4GRFA 4KH7A 3EINA 3R3EA 2AJQB 1T00A 3HHVA 1Z7PA 4WXTA 1MDKA 3Q18A 4O92A 4ULXA 4JEDA 4CHSA 4E8HA 4HU7A 1GUHA 3GA4A 4KUNA 1KEBA 1PD21 4V2LA 2GSRA 1F3AA 2XC2A 1ZYNA 1X9WB 2RIIA 4KW6A 2CX4A 2C1YA 4K7OA 3OR5A 4PURA 2GSTA 2DKHA 2HZFA 4IS0A 2VCVA 5F05A 3M0FA 4DSQA 2LS5A 2AB6A 2G2QA 4KDXA 2XBIA 3CRUA 3DWVA 3TRQA 2WJUA 5JWQB 4GQCA 3ZVJA 4TXOB 5G5EA 2GTUA 2BTOT 2CVDA 20GSA 2CVBA 6GSVA 1Q98A 2VD0A 3PPUA 4MJBA 1ILOA 2HI7A 2FA8A 1XWAA 1ERVA 3HYPA 1BEDA 1SK1A 5DDLA 5IMVA 4F82A 1OKTA 1TRWA 4V1Ag 5KN3A 3ZMKA 1K0CA 1K0BA 4KAEA 4K0NA 2YANA 4YH2A 3KEBA 1RK4A 3A2WA 5D8IA 1CQGA 4AGSA 4IKHA 2VIMA 4AJ7A 5H5SA 2NBSA 3VK9A 2VCTA 3DXBA 1MTCA 3IC8A 3MYDA 5ECNB 2V32A 4OFMA 2VCZA 2H1DA 17GSA 1GLQA 3U5RE 5CNWA 2IPAA 1PA3A 5E59A 1MDJA 1GSFA 1PKWA 2I1UA 1JZOA 13GSA 1SKSB 3VI5A 4XS4B 4N0ZA 2RM6A 4G9HA 1EV4A 1THOA 5C00A 6GSYA 1QXHA 4IJ3A 4RI6A 2BMXA 5ECOB 3D21A 3FR6A 2ZCTA 2FCHA 4RQXA 2F8AA 3LJRA 3TDGA 1F6MC 4KSOA 2RM5A 2GQKA 4QL7A 2I81A 3F0IA 2B5XA 4GF0A 4ZBAA 2FA4A 4ID0A 3DYRA 1SJ6A 4BL7B 2VD1A 3I43A 1XBSA 2D2ZA 2VOCA 1DE1A 3HD5A 2PU9C 4BA7A 2H0HA 1XW5A 2ES7A 5B6MA 2B1KA 1TP9A 2DIYA 5A4WA 1JFUA 3L4NA 4K5RA 5IMCA 2OA7A 1B9XC 4CY8A 4DSSB 3I6AA 4WEYA 4O5QA 3GFKA 4KE3A 2CV4A 5CO3A 2JU5A 3VWVA 3DVWA 2R0GA 2VL2A 2YWIA 3ZYWA 1R5PA 4FQUA 5DAKB 5F0GA 3D0ZA 2N5AA 1GSUA 3FW2A 1M2AA 3KIJA 3P2AA 2PVQA 4Q5FA 4AJ8A 4TW5A 3IPZA 5CAXA 3IE3A 1R4WA 1SD9A 2GZYA 1BQ7A 5CRDA 3TKQA 4ZIJA 1XWGA 2DJ0A 5FWGA 3LG6A 1PSQA 4BWQA 1ST9A 5ECRB 3MIXA 3KTBA 3W8SA 4PQIA 2GT5A 5IO2A 2HNLA 5IOXA 3CMIA 1SL0B 2B5YA 3GIXA 2IFQA 4GSTA 3CRTA 5INYA 2TRXA 4TN8A 1YZXA 5H5RA 2Z9SA 1VF3A 1NW2A 4USSA 1SJZA 5ECMB 4JBBA 2GDRA 1FOHA 4YKGA 2LRNA 2PPTA 5BMUA 4IHUA 1E6BA 4KF9A 1NHOA 1PX6A 2E0QA 2GSSA 1PN0A 2UZ8A 3ZREA 3W6GA 5FHIA 4I5QA 1B8XA 2PVOC 5IIZA 12GSA 1WMJA 1T7PB 1RQMA 3SWLA 5DJLA 5HR0A 2WZ9A 1O7UA 1BX9A 1QFNA 2L59A 4OFNA 2DJ2A 3QDNA 4MDCA 3GKMA 3VPTA 2ON7A 3L78A 4MH3A 3SBCA 3LW9A 1M2DA 4NPBA 1EZKA 4K5SA 4HQZA 2LNSA 1ZYPA 1YKCA 4WKWA 3BD2A 5C04A 2H8LA 4OD7A 3UL3A 3RBTA 1CQHA 1WWJA 4KNDA 3H1NA 2R37A 3TOUA 4MJCA 4I97A 2PN8A 3GTUA 1F37A 2TIRA 2L4QA 2H76A 5G31A 3HDCA 3ZZXA 2A2PA 4KCEA 3R2QA 4WETA 11GSA 2K8SA 2QSIA 4LMWA 4IGJA 3RHBA 4Q5QA 4HZ4A 1ON4A 3NOFA 2QKEA 1ZYQB 4MPFA 2FGXA 4TR1B 4ECJA 1A2JA 3VI7A 5EVOA 2B5EA 1JZDA 3FHKA 4EO3A 2RLIA 2KLXA 1XIYA 3IR4A 1YF0A 2EIQA 2N5BA 4IP6A 3UIWA 5F07A 3CXGA 3TJFA 1EP7A 5GSSA 3VWWA 4PQ1A 2JSZA 2VUPA 1I9DA 4TRXA 1GNEA 4FYBA 1EOGA 5ECPB 1SJIA 5J3RA 2LJAA 4D73B 3QCPA 4GXZA 2KP2A 2P31A 4K0GA 2JZTA 18GSA 3UVTA 1SK0A 2RUFA 3C7MA 4G0LA 3IAS2 1ACVA 4RUVA 1YQ1A 4G2EA 4QQ7A 4WR4A 3LXTA 1ZOFA 1HYUA 3DMLA 4XS6A 2F51A 3QR6A 2K18A 4KDYA 1GP1A 1Z6NA 2NVLA 4EIQA 5D9XA 2R0CA 3ZRDA 5CP1A 1UA5A 4FO5A 4YAVA 2EIRA 3GYKA 2LTKA 2YOIA 1XWKA 1GTIA 2I9HA 2MMZA 1YY7A 5DALB 1V40A 1U6TA 2OBIA 3DD3A 3GURA 1FB6A 1Y25A 3K8NA 2C0EA 4CW9A 4K8MA 1K3YA 4IELA 3ZIVA 3LXZA 4WF5A 1F3BA 1O6JA 1F2EA 1A24A 2P0GA 4MJEA 3TJJA 4X4JA 1HNBA 1FO5A 1M7TA 4JE1A 5DCHA 3MSZA 3H4KA 4K7IA 2OJLA 2C3TA 2V41A 4OWYA 4TVEA 4DSRA 1AAZA 4FYCA 1TK8B 2M46A 1N2AA 1OE8A 5D96A 5GAND 3CTFA 4PX1A 1U87A 1N8JA 3WGEA 3LQ7A 3DGQA 3QAWA 1O73A 2B3SA 4JZQA 1DBYA 1GRXA 1TK5B 4GLTA 2IN3A 5DQYA 4ZXGA 4J2FA 4Z7XA 3FRCA 3ZVJD 1MDIA 4MK3A 3HCZA 2MMNA 1XWCA 2IL3A 4HI7A 3IAM2 2FY6A 1G7OA 4EVMA 1XW9A 3HJMA 4JR6A 1QGVA 1C72A 3DRNA 2GQMA 5J9BA 2HXKA 4MF5A 2IWTA 4ECCA 4NXIA 4O32A 4LL4B 1Z9HA 2OKAA 2GLRA 6GSUA 5B6NA 1XOBA 4MP4A 4EXJA 1MD4A 1PQNA 2MMOA 1H4OA 1ZCPA 4XIHA 3QOUA 5JWRB 5DQSA 3P90A 4TOPA 2LRCA 4TXVA 2OE3A 3EVIA 1WP0A 3L9SA 2N5FA 1Q4JA 2VLVA 3TGZA 1H75A 4EDYA 2CZ3A 1A2MA 2WRTA 2J23A 3A2VA 1PMTA 2KOKA 2JACA 4G0IA 1M9BA 4XRAA 3GV1A 1KNGA 4KSMA 3ZL5A 4EIPA 2XPEA 3TJBA 2M80A 3LSZA 2VM2A 1WE0A 3HVVA 5HR3A 2HRFA 1GSQA 3BOAA 1GTBA 2H30A 2DJ1A 4ZL9A 4KGIA 4ML1A 1V2AA 4ML6A 1XVQA 4F0BA 3KGKA 2A2SA 1EEMA 3VPQA 3JCML 2YWMA 2JADA 2V6OA 2YWOA 1UC7A 2O7KA 2VM1A 3ZFBA 1Z6MA 1EV9A 2H73A 1AW9A 1UVZA 4KCAA 2AV4A 3F9UA 1A2LA 4O7HA 3CYNA 3O76A 2E2MA 3PH9A 1VGLA 4I8BA 5EPFA 1U3IA 1S3DA 5J41A 4MZCA 4HEA2 2DBCA 3KD0A 5IMZA 2IJYA 3IBHA 1VF2A 4ILFA 1EGRA 6GSWA 3VLNA 2R5GA 2HZEA 3F4RA 4HQSA 4LMVA 2R2JA 1V9WA 4X1UA 2XHFA 4MCUA 1XXUA 5J9CA 2GT6A 4K6XA 5J5NA 5KOXA 4NHZA 2WFCA 1LJRA 19GSA 1GNWA 2X99A 3F4TA 3C71A 3ME8A 4FYUA 2X64A 1X0RA 2P5RA 1WOUA 3FYGA 10GSA 3TKSE 1ZYEA 3KP8A 2REMA 2GZPA 1AIUA 1NSWA 2ZNMA 4IP1A 1QMVA 1EWXA 3RPNA 3ISOA 2K9FA 1DUGA 2VO4A 2M72A 1XZOA 4KA0A 4XS1A 1RW1A 4MMMA 2CA8A 1WJKA 2PERA 4G10A 5J4UA 1HD2A 3F3QA 2C4JA 3TOTA 1ERWA 3FZ9A 2P5QA 2R0PA 4L5LA 1YJ6A 2FHEA 3MAKA 4L5OA 1SL2B 4DVCA 3DKSA 4MPGA 4GQFA 2MYGA 3M3MA 4JR4A 4FIWA 1E2YA 5ELAA 3HXSA 2H75A 2DJKA 2XPDA 5HFKA 2LQOA 3E9JB 2H01A 1TKDB 3TKSA 2HRKA 3O3TA 1GSYA 4OO5A 1K0NA 4G19A 2IFQB 4NV5A 5IM9A 4XS4A 3HVXA 4CY6A 3C73A 1DE2A 4YKFA 2AHEA 1GTAA 2TRCP 3KXOA 5EY6A 1T8EB 1VF4A 2DMMA 2VAFA 5FT3A 3TKRA 4Z2TA 4L8EA 3GNJA 3IV4A 3PINA 1X9SB 1WPIA 1W89A 3M9KA 1K0AA 4BL7A 2I4AA 1X5EA 4BWSA 2H6ZA 5EL8A 2CX3A 5AIVA 1K0OA 2KHPA 5HQPA 2FWGA 1OC9A 5AIXA 3FR9A 5DVBA 1TTZA 4PTSA 1SD8A 3QPMA 3FZ4A 1OE7A 3VURA 3MNGA 1JZWA 2HFDA 4WBRD 5COHA 1XVWA 1GSSA 1FB0A 4WF4A 3DEXA 4Z2RA 4HS1A 1BYEA 3ZTLA 2PWJA 2LRTA 3TB2A 3GRXA 1K3OA 4E8EA 3S9FA 3KMNA 5DAKA 4MA9A 5BRTA 4EUYA 5ID2A 2PMTA 5F06A 2H72A 3EE2A 2VL3A 1JZRA 1OVNA 3H93A 2R4VA 3NZNA 1IYHA 2JZRA 2DIZA 1SYRA 4RI7A 3E0UA 5KN0A 2CT6A 1PL1A 6GSXA 4ACSA 5JWOB 2O89A 2L6DA 4YQMA 1YKAA 4TR4A 3CSJA 4YQVA 1Z5YE 4J57E 5AN1A 3QFBC 2WS2A 1BJXA 5AGYA 1PGTA 2O8VB 5IO0A 3GX0A 1F9MA 2YZUA 3D5JA 4MF7A 5G1KA 4ZB8A 4KB3A 4F03A 3QMXA 4J56E 4GSSA 1PKZA 3D22A 1M2BA 1FVKA 2LKUA 2RUEA 3APOA 5IPHA 1B48A 2DLXA 5D9VA 3GH9A 5HFGA 3ME7A 3F8UA 5F8BA 3BBYA 4EKZA 4EF0A 3UMAA 4ZILA 2YPMA 3N5OA 3F6FA 4O5UA 5LCZA 5DCGA 2V6KA 2CQ9A 2GVPA 2YV9A 3VWXA 1A8LA 3FMWA 3N9JA 1WIKA 2NTOA 1GUKA 1DSBA 4Q5RA 3LWAA 5JCGA 2GGTA 3C8EA 1WRYA 3GL5A 2PGTA 1ML6A 3KZQA 1VRSD 3PR8A 3GKNA 4ICYA 1JLWA 1VF1A 1O81A 2MMAA 2FWHA 3W8JA 4DEJA 3FEUA 2O87A 3TRXA 1EEJA 3GUSA 4NMUA 22GSA 2G0FA 1R7HA 4OO4A 1SL1B 5ECIB 3L9VA 4PXOA 2L5OA 5G30A 1Y6EA 4TR1A 2YZHA 2R3XA 3QAVA 1KBNA 4BVXB 4Z2UA 16GSA 5AISA 3APSA 1X5CA 3IK9A 2VCQA 3EWLA 2PUKC 3GKKA 4POLA 4XRDA 3TKPA 3MWHA 3EU3A 3ERWA 1JHBA 2L4CA 2H0GA 1YEXA 1GULA 4F9ZA 5ECSA 2YJ7A 3WD6A 4L0UA 2JZSA 1YDKA 1QK8A 5ECLB 4LLRA 4D73A 4ZL7A 4WR5A 5KOWA 1PN9A 1R26A 1XOAA 1X9MB 1MEKA 2L5LA 1GTUA 4ZL8A 3L0HA 3UBLA 1TI1A 1XW6A 5CREA 3D4TA 3APQA 3M9JA 3RDWA 1TOFA 1HNCA 2H1BA 2LUSA 1BG5A 4EE0A 1QQ2A 5JCUA 2J9HA 4YQUA 3HJPA 2H6XA 5CRHA 1M9AA 2BJXA 3UARA 1A8YA 4EL1A 5IMDA 3J7Yk 2IMEA 4MF6A 3GSSA 1TXXA 3CSHA 3EPTA 4BVYA 2QC7A 4AJ6A 4LL1B 5G1LA 2HSYA 1NM3A 5IMAA 2HYXA 2YP6A 3TRPA 3KTLA 4I6XA 3UAPA 3A3TA 5HR2A 4NAXA 5LD0A 2C0DA 2HT9A 2CVKA 3GN3A 2X49A 1B4PA 4GCIA 3IRAA 2YV7A 4OMVA 2L6CA 2F8FA 1T4ZA 3J7Yb 4WBJA 2OADA 1Z3EA 4XCSA 4KDUA 1FVJA 3G7YA 1SKRB 2HRNA 1FW1A 2DC5A 3G7IA 2C0FA 5LNKe 2GSQA 2H70A 14GSA 3GMFA 3QFAC 4XHMA 4A5PA 2YWNA 3G7JA 1ERUA 1USBA 2VLUA 1V98A 2H74A 6GSSA 1OKDA 3ZLPA 1LU4A 3V1WA 2HZEB 5KN1A 3CBUA 2WDUA 1OC3A 2HLSA 1AXDA 2IMFA 1O85A 4ZBDA 3D4MA 3F63A 1JLVA 2FNOA 2LEGA 4HJ2A 1GH2A 3KH9A 3G9BA 1U88A 1T4YA 2HE3A 1GWCA 2OE1A 1LBKA 3KP9A 2YJHA 3ERGA 2OACA 4V1Ap 5IMFA 2OE0A 3DIEA 1TRSA 4OCFA 4IN0A 3HKRA 2A4VA 2LJKA 1Z7RA 3UEMA 3GL3A 1I5GA 3EMXA 3BCKA 2X8GA 2ON5A 2JL4A 5B8AA 3QAGA 1TI3A 2A2RA 3ED3A 4PNGA 1ERTA 2LQQA 4PQHA 2DKIA 4ZB9A 2AYTA 1TW9A 1SKWB 2DMLA 3A5WA 4GSNA 1GSDA 4I2UA 1SU9A 3KM6A 1TDIA 1XWBA 3Q6OA 1G7EA 3NIVA 3WT1A 4OCEA 2LJRA 3TUEA 4TXOA 1O8XA 2NPBA 4OFTA 1J9BA 1TRUA 2LV3A 1J0FA 1KTEA 3LORA 2AUVA 3HZ4A 4BPYA 4N11A 5D9TA 2A4HA 3A5IA 3C1RA 1K0DA 2JSYA 4NWYA 4GWRA 1GUMA 1EGOA 3EC3A 3I69A 2VCXA 5A4UA 3DVXA 2WCIA 2QA2A 4HU9A 2B7JA 5H5QA 1ABAA 4HJMA 3C1SA 4HOJA 2H66A 4HZ2A 3GHAA 1OC9B 1S3CA 3EYTA 2YCDA 3LEFA 5CYYA 5DBQA 1GL8A 2E7PA 2WULA 1AC1A 1YEPA 4MJAA 3ZITA 4Q5NA 3WT2A 2MBTA 3IC4A 2VL9A 3LGCA 3BCIA 3FKFA 4LA1A 2CAQA 1SK2A 4TR0A 2H19A 1OYJA 2QGVA 5ECHB 2FLSA 2HSMA 1FAAA 3CSIA 3D6IA 5A5KA 2NDOA 5ID2B 2IIYA 3P7XA 5IQYA 1BAYA 5JCWA 4XTSA 5E4WA 1TU8A 2H71A 1U3AA 2KUCA 2OBKA 3HY2A 5ABRA 5GSTA 4HDEA 1AQVA 2ALBA 3M8NA 1A23A 2IMKA 5L71A 5KEJA 3LYPA 3HJOA 2R6KA 1NHYA 3VFIA 3TJGA 4IQ1A 4K9ZA 1XFLA 3FK8A 3UJ1A 4N30A 4K7NA 4DSSA 1PL2A 1AQXA 1J08A 4L0WA 2FWFA 2H0IA 2H1GA 4X0XA 1AUCA 1K3LA 3IA1A 2X8CA 1FOVA 1FG4A 1PX7A 3GTUB 3QD9A 1G6YA 3EURA 1ZMAA 3Q74A 4AF2A 3LYKA 2GS3A 5B8BA 1M0UA 2C3NA 3KJYA 1YF1A 3GKXA 3WGXA 3RHCA 3FZ5A 3O6TA 1THXA 1TK0B 1V57A 3FR3A 2FD3A 2PBJA 4POBA 4V2MA 2DJ3A 2L57A 3IHQA 3A2XA 1AQWA 4NV2A 1EP8A 3BJ5A 4IBPA 1URMA 4F2IA 3F6DA 4PUFC 2HRAA 2MBSA 4TR3A 3GSTA 4MZBA 4YAPA 2C0GA 1R5AA 2CAIA 5HFIA 3U6VA 2V2GA 2X4AA 2DSAA 5G2ZA 4HUAA 1EOHA 2H1AA 1XPVA 3IXRA 4MH2A 3LFLA 1OC8A 3F3RA 3TKSC 2GZZA 2YNXA 6GSTA 5IOWA 5GAPD 2VL2C 4PNFA 2C3QA 4I2TA 2LSTA 1GSEA 1ZGNA 3P8WA 3MDKA 2O85A 1B4QA 3TCOA 3KCMA 3FY7A 1QUWA 1A0FA 1TJDA 2WB9A 1M99A 3HVSA 2YN1A 4NHWA 3VWUA 3IK7A 4MNNA 2E2GA 4FH8A 2QA1A 3ZMLA 2GQLA 2MZCA 4X43A 7GSSA 2V1MA 3TJKA 2H6YA 3H79A 3H8QA 3WYWA 3IOSA 4P3YB 2EIOA 5ELGA 2XBQA 3RAZA 2F9SA 3IHGA 2WGRA 2LNTA 1B9YC 4G0KA 3FZAA 4IW9A 3RPPA 4GTUA 1W4VA 5D9WA 4K1FA 8GSSA 3UBKA 1UN2A 4POMA 2CZ2A 2IMIA 4K2DA 2X8HA 4H86A 2B7KA 1X5DA 1OAZA 2C80A 4IJIA 1FHEA 3UVHA 1HNAA 3E3EA 1SYXA 2HSHA 4N0VA 4PGTA 2IMDA 3KH7A 5HR1A 9GSSA 2KP1A 4EC0A 3EU4A 4ECBA 3CTGA 2ZUPA 3US3A 1A0RP 2C8UA 4EDZA 3HA9A 2K6VA 5D93A 1TRVA 4N10A 4V2NA 1PRXA 3HZ8A 4QL9A 3Q19A 4JRRA 2DJJA 4BVYB 4IVFA 3KMOA 5DJMA 5G5FA 4K2XA 4KX4A 4JU5A 1MD3A 1XCCA 1ZZYA 4ISDA 4MABA 3WGDA 4ZB6A 3GX8A 2FUG2 5CRGA 5IPGA 4F0CA 3ERFA 1TU7A 4RQRA 5ECKB 3ZIJA 3AY8A 3IDVA 2VCWA 5ENUA 2F3MA 2FWEA 5B7CA 3M1GA 5D73A 4PUAA 4POKA 3UOMA 3ZFLA 1G6WA 3I9V2 4ZBBA 1O8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ECQ B;  5CRW A;  1G0T A;  4BVX A;  5GZZ B;  3PGT A;  2AAW A;  5KN2 A;  5DAL A;  1K0M A;  4MZW A;  2VLT A;  1V58 A;  1T3B A;  2EC4 A;  3EMP A;  1S3A A;  4ECI A;  1HQO A;  1SEN A;  1ZL9 A;  3F4S A;  2K8V A;  3GH6 A;  2B6M A;  2I3Y A;  1T1V A;  4IQA A;  1GLP A;  4MLY A;  1IYI A;  2B1L A;  3L9U A;  4O5R A;  4TKY A;  5A4V A;  4CDO A;  4GRF A;  4KH7 A;  3EIN A;  2AJQ B;  1T00 A;  3HHV A;  1Z7P A;  4WXT A;  1MDK A;  3Q18 A;  4O92 A;  4ULX A;  4JED A;  4CHS A;  4E8H A;  4HU7 A;  1GUH A;  3GA4 A;  4KUN A;  1KEB A;  1PD2 1;  4V2L A;  2GSR A;  1F3A A;  2XC2 A;  1X9W B;  2RII A;  4KW6 A;  2CX4 A;  2C1Y A;  4K7O A;  3OR5 A;  4PUR A;  2GST A;  2HZF A;  4IS0 A;  2VCV A;  5F05 A;  3M0F A;  4DSQ A;  2LS5 A;  2AB6 A;  2G2Q A;  4KDX A;  2XBI A;  3CRU A;  3DWV A;  3TRQ A;  2WJU A;  5JWQ B;  4GQC A;  3ZVJ A;  4TXO B;  5G5E A;  2GTU A;  2BTO T;  2CVD A;  20GS A;  2CVB A;  6GSV A;  1Q98 A;  2VD0 A;  4MJB A;  1ILO A;  2HI7 A;  2FA8 A;  1XWA A;  1ERV A;  3HYP A;  1BED A;  1SK1 A;  5DDL A;  5IMV A;  4F82 A;  1OKT A;  1TRW A;  4V1A g;  5KN3 A;  3ZMK A;  1K0C A;  1K0B A;  4KAE A;  4K0N A;  2YAN A;  4YH2 A;  3KEB A;  1RK4 A;  3A2W A;  5D8I A;  1CQG A;  4AGS A;  4IKH A;  2VIM A;  4AJ7 A;  5H5S A;  2NBS A;  3VK9 A;  2VCT A;  3DXB A;  1MTC A;  5ECN B;  2V32 A;  4OFM A;  2VCZ A;  2H1D A;  17GS A;  1GLQ A;  3U5R E;  5CNW A;  2IPA A;  1PA3 A;  5E59 A;  1MDJ A;  1GSF A;  1PKW A;  2I1U A;  1JZO A;  13GS A;  1SKS B;  3VI5 A;  4XS4 B;  4N0Z A;  2RM6 A;  4G9H A;  1EV4 A;  1THO A;  5C00 A;  6GSY A;  1QXH A;  4IJ3 A;  4RI6 A;  2BMX A;  5ECO B;  3D21 A;  3FR6 A;  2ZCT A;  2FCH A;  4RQX A;  2F8A A;  3LJR A;  3TDG A;  1F6M C;  4KSO A;  2RM5 A;  2GQK A;  4QL7 A;  2I81 A;  3F0I A;  2B5X A;  4GF0 A;  4ZBA A;  2FA4 A;  4ID0 A;  3DYR A;  1SJ6 A;  2VD1 A;  3I43 A;  1XBS A;  2D2Z A;  2VOC A;  1DE1 A;  3HD5 A;  2PU9 C;  4BA7 A;  2H0H A;  1XW5 A;  2ES7 A;  5B6M A;  2B1K A;  1TP9 A;  2DIY A;  5A4W A;  1JFU A;  3L4N A;  5IMC A;  2OA7 A;  1B9X C;  4DSS B;  3I6A A;  4WEY A;  3GFK A;  4KE3 A;  2CV4 A;  5CO3 A;  2JU5 A;  3VWV A;  3DVW A;  2VL2 A;  2YWI A;  3ZYW A;  1R5P A;  5DAK B;  5F0G A;  3D0Z A;  2N5A A;  1GSU A;  3FW2 A;  1M2A A;  3KIJ A;  3P2A A;  2PVQ A;  4Q5F A;  4AJ8 A;  4TW5 A;  3IPZ A;  5CAX A;  3IE3 A;  1R4W A;  1SD9 A;  2GZY A;  1BQ7 A;  5CRD A;  3TKQ A;  4ZIJ A;  1XWG A;  2DJ0 A;  5FWG A;  3LG6 A;  1PSQ A;  4BWQ A;  1ST9 A;  5ECR B;  3KTB A;  3W8S A;  4PQI A;  2GT5 A;  5IO2 A;  2HNL A;  5IOX A;  3CMI A;  1SL0 B;  2B5Y A;  3GIX A;  2IFQ A;  4GST A;  3CRT A;  5INY A;  2TRX A;  4TN8 A;  1YZX A;  5H5R A;  2Z9S A;  1VF3 A;  1NW2 A;  1SJZ A;  5ECM B;  4JBB A;  2GDR A;  2LRN A;  2PPT A;  4IHU A;  1E6B A;  1NHO A;  1PX6 A;  2E0Q A;  2GSS A;  3ZRE A;  3W6G A;  5FHI A;  4I5Q A;  1B8X A;  2PVO C;  5IIZ A;  12GS A;  1WMJ A;  1T7P B;  1RQM A;  3SWL A;  5DJL A;  5HR0 A;  2WZ9 A;  1O7U A;  1BX9 A;  1QFN A;  2L59 A;  4OFN A;  2DJ2 A;  3QDN A;  4MDC A;  3GKM A;  3VPT A;  2ON7 A;  3L78 A;  4MH3 A;  3SBC A;  1M2D A;  4NPB A;  1EZK A;  4HQZ A;  2LNS A;  1YKC A;  4WKW A;  3BD2 A;  5C04 A;  2H8L A;  4OD7 A;  3UL3 A;  3RBT A;  1CQH A;  1WWJ A;  4KND A;  3H1N A;  2R37 A;  3TOU A;  4MJC A;  4I97 A;  2PN8 A;  3GTU A;  1F37 A;  2TIR A;  2L4Q A;  2H76 A;  5G31 A;  3HDC A;  3ZZX A;  4KCE A;  3R2Q A;  4WET A;  11GS A;  2K8S A;  2QSI A;  4LMW A;  4IGJ A;  3RHB A;  4Q5Q A;  4HZ4 A;  1ON4 A;  3NOF A;  2QKE A;  1ZYQ B;  4MPF A;  2FGX A;  4TR1 B;  4ECJ A;  1A2J A;  3VI7 A;  5EVO A;  2B5E A;  1JZD A;  3FHK A;  4EO3 A;  2RLI A;  2KLX A;  1XIY A;  3IR4 A;  1YF0 A;  2EIQ A;  2N5B A;  4IP6 A;  3UIW A;  5F07 A;  3CXG A;  3TJF A;  1EP7 A;  5GSS A;  3VWW A;  4PQ1 A;  2JSZ A;  2VUP A;  1I9D A;  4TRX A;  1GNE A;  4FYB A;  1EOG A;  5ECP B;  1SJI A;  5J3R A;  2LJA A;  4D73 B;  3QCP A;  4GXZ A;  2KP2 A;  2P31 A;  4K0G A;  2JZT A;  18GS A;  3UVT A;  1SK0 A;  2RUF A;  3C7M A;  3IAS 2;  1ACV A;  4RUV A;  1YQ1 A;  4G2E A;  4QQ7 A;  4WR4 A;  3LXT A;  1ZOF A;  1HYU A;  3DML A;  4XS6 A;  2F51 A;  3QR6 A;  2K18 A;  4KDY A;  1GP1 A;  1Z6N A;  2NVL A;  5D9X A;  3ZRD A;  5CP1 A;  1UA5 A;  4FO5 A;  4YAV A;  2EIR A;  3GYK A;  2LTK A;  2YOI A;  1XWK A;  1GTI A;  2I9H A;  2MMZ A;  1YY7 A;  5DAL B;  1V40 A;  1U6T A;  2OBI A;  3DD3 A;  3GUR A;  1FB6 A;  1Y25 A;  3K8N A;  2C0E A;  4CW9 A;  4K8M A;  1K3Y A;  4IEL A;  3ZIV A;  3LXZ A;  4WF5 A;  1F3B A;  1O6J A;  1F2E A;  1A24 A;  2P0G A;  4MJE A;  3TJJ A;  1HNB A;  1FO5 A;  1M7T A;  4JE1 A;  5DCH A;  3MSZ A;  3H4K A;  4K7I A;  2OJL A;  2C3T A;  2V41 A;  4OWY A;  4TVE A;  4DSR A;  1AAZ A;  4FYC A;  1TK8 B;  2M46 A;  1N2A A;  1OE8 A;  5D96 A;  5GAN D;  3CTF A;  4PX1 A;  1U87 A;  1N8J A;  3WGE A;  3LQ7 A;  3DGQ A;  3QAW A;  1O73 A;  2B3S A;  4JZQ A;  1DBY A;  1GRX A;  1TK5 B;  4GLT A;  2IN3 A;  5DQY A;  4ZXG A;  4J2F A;  4Z7X A;  3FRC A;  3ZVJ D;  1MDI A;  4MK3 A;  3HCZ A;  2MMN A;  1XWC A;  2IL3 A;  4HI7 A;  3IAM 2;  2FY6 A;  1G7O A;  4EVM A;  1XW9 A;  3HJM A;  4JR6 A;  1QGV A;  1C72 A;  3DRN A;  2GQM A;  5J9B A;  2HXK A;  4MF5 A;  2IWT A;  4ECC A;  4NXI A;  4O32 A;  4LL4 B;  1Z9H A;  2OKA A;  2GLR A;  6GSU A;  5B6N A;  1XOB A;  4MP4 A;  4EXJ A;  1MD4 A;  1PQN A;  2MMO A;  1H4O A;  1ZCP A;  4XIH A;  3QOU A;  5JWR B;  5DQS A;  3P90 A;  4TOP A;  2LRC A;  4TXV A;  2OE3 A;  3EVI A;  1WP0 A;  3L9S A;  2N5F A;  1Q4J A;  2VLV A;  3TGZ A;  1H75 A;  4EDY A;  2CZ3 A;  1A2M A;  2WRT A;  2J23 A;  3A2V A;  1PMT A;  2KOK A;  2JAC A;  1M9B A;  4XRA A;  3GV1 A;  1KNG A;  4KSM A;  3ZL5 A;  2XPE A;  3TJB A;  2M80 A;  3LSZ A;  2VM2 A;  1WE0 A;  3HVV A;  5HR3 A;  2HRF A;  1GSQ A;  3BOA A;  1GTB A;  2H30 A;  2DJ1 A;  4ZL9 A;  4KGI A;  4ML1 A;  1V2A A;  4ML6 A;  1XVQ A;  4F0B A;  3KGK A;  2A2S A;  1EEM A;  3VPQ A;  3JCM L;  2YWM A;  2JAD A;  2V6O A;  2YWO A;  1UC7 A;  2O7K A;  2VM1 A;  3ZFB A;  1Z6M A;  1EV9 A;  2H73 A;  1AW9 A;  1UVZ A;  4KCA A;  2AV4 A;  3F9U A;  1A2L A;  4O7H A;  3CYN A;  3O76 A;  2E2M A;  3PH9 A;  1VGL A;  4I8B A;  5EPF A;  1U3I A;  1S3D A;  5J41 A;  4MZC A;  4HEA 2;  2DBC A;  3KD0 A;  5IMZ A;  2IJY A;  3IBH A;  1VF2 A;  4ILF A;  1EGR A;  6GSW A;  3VLN A;  2R5G A;  2HZE A;  3F4R A;  4HQS A;  4LMV A;  2R2J A;  1V9W A;  4X1U A;  2XHF A;  4MCU A;  1XXU A;  5J9C A;  2GT6 A;  4K6X A;  5J5N A;  4NHZ A;  2WFC A;  1LJR A;  19GS A;  1GNW A;  2X99 A;  3F4T A;  3C71 A;  3ME8 A;  4FYU A;  2X64 A;  1X0R A;  2P5R A;  1WOU A;  3FYG A;  10GS A;  3TKS E;  1ZYE A;  3KP8 A;  2REM A;  2GZP A;  1AIU A;  1NSW A;  2ZNM A;  4IP1 A;  1QMV A;  1EWX A;  3RPN A;  3ISO A;  2K9F A;  1DUG A;  2VO4 A;  2M72 A;  1XZO A;  4KA0 A;  4XS1 A;  1RW1 A;  4MMM A;  2CA8 A;  1WJK A;  2PER A;  4G10 A;  5J4U A;  1HD2 A;  3F3Q A;  2C4J A;  3TOT A;  1ERW A;  3FZ9 A;  2P5Q A;  4L5L A;  1YJ6 A;  2FHE A;  3MAK A;  4L5O A;  1SL2 B;  4DVC A;  3DKS A;  4MPG A;  4GQF A;  2MYG A;  3M3M A;  4JR4 A;  4FIW A;  1E2Y A;  5ELA A;  3HXS A;  2H75 A;  2DJK A;  2XPD A;  5HFK A;  2LQO A;  3E9J B;  2H01 A;  1TKD B;  3TKS A;  3O3T A;  1GSY A;  4OO5 A;  1K0N A;  4G19 A;  2IFQ B;  4NV5 A;  5IM9 A;  4XS4 A;  3HVX A;  3C73 A;  1DE2 A;  2AHE A;  1GTA A;  2TRC P;  3KXO A;  5EY6 A;  1T8E B;  1VF4 A;  2DMM A;  2VAF A;  5FT3 A;  3TKR A;  4L8E A;  3GNJ A;  3IV4 A;  3PIN A;  1X9S B;  1WPI A;  1W89 A;  3M9K A;  1K0A A;  4BL7 A;  2I4A A;  1X5E A;  4BWS A;  2H6Z A;  5EL8 A;  2CX3 A;  5AIV A;  1K0O A;  2KHP A;  5HQP A;  2FWG A;  1OC9 A;  5AIX A;  3FR9 A;  5DVB A;  1TTZ A;  1SD8 A;  3QPM A;  3FZ4 A;  1OE7 A;  3VUR A;  3MNG A;  1JZW A;  2HFD A;  4WBR D;  5COH A;  1XVW A;  1GSS A;  1FB0 A;  4WF4 A;  3DEX A;  4HS1 A;  1BYE A;  3ZTL A;  2PWJ A;  2LRT A;  3TB2 A;  3GRX A;  1K3O A;  4E8E A;  3S9F A;  3KMN A;  5DAK A;  4MA9 A;  4EUY A;  5ID2 A;  2PMT A;  5F06 A;  2H72 A;  3EE2 A;  2VL3 A;  1JZR A;  1OVN A;  3H93 A;  2R4V A;  3NZN A;  1IYH A;  2JZR A;  2DIZ A;  1SYR A;  4RI7 A;  3E0U A;  5KN0 A;  2CT6 A;  1PL1 A;  6GSX A;  4ACS A;  5JWO B;  2O89 A;  2L6D A;  4YQM A;  1YKA A;  4TR4 A;  3CSJ A;  4YQV A;  1Z5Y E;  4J57 E;  5AN1 A;  3QFB C;  2WS2 A;  1BJX A;  5AGY A;  1PGT A;  2O8V B;  5IO0 A;  3GX0 A;  1F9M A;  2YZU A;  3D5J A;  4MF7 A;  5G1K A;  4ZB8 A;  4KB3 A;  4F03 A;  3QMX A;  4J56 E;  4GSS A;  1PKZ A;  3D22 A;  1M2B A;  1FVK A;  2LKU A;  2RUE A;  3APO A;  5IPH A;  1B48 A;  2DLX A;  5D9V A;  3GH9 A;  5HFG A;  3ME7 A;  3F8U A;  5F8B A;  3BBY A;  4EKZ A;  4EF0 A;  3UMA A;  4ZIL A;  2YPM A;  3N5O A;  3F6F A;  5LCZ A;  5DCG A;  2V6K A;  2CQ9 A;  2GVP A;  2YV9 A;  3VWX A;  1A8L A;  3N9J A;  1WIK A;  2NTO A;  1GUK A;  1DSB A;  4Q5R A;  3LWA A;  5JCG A;  2GGT A;  3C8E A;  1WRY A;  3GL5 A;  2PGT A;  1ML6 A;  3KZQ A;  1VRS D;  3PR8 A;  3GKN A;  1JLW A;  1VF1 A;  1O81 A;  2MMA A;  2FWH A;  3W8J A;  4DEJ A;  3FEU A;  2O87 A;  3TRX A;  1EEJ A;  3GUS A;  4NMU A;  22GS A;  2G0F A;  1R7H A;  4OO4 A;  1SL1 B;  5ECI B;  3L9V A;  4PXO A;  2L5O A;  5G30 A;  1Y6E A;  4TR1 A;  2YZH A;  2R3X A;  3QAV A;  1KBN A;  16GS A;  5AIS A;  3APS A;  1X5C A;  3IK9 A;  2VCQ A;  3EWL A;  2PUK C;  3GKK A;  4POL A;  4XRD A;  3TKP A;  3MWH A;  3EU3 A;  3ERW A;  1JHB A;  2L4C A;  2H0G A;  1YEX A;  1GUL A;  4F9Z A;  5ECS A;  2YJ7 A;  3WD6 A;  4L0U A;  2JZS A;  1YDK A;  1QK8 A;  5ECL B;  4LLR A;  4D73 A;  4ZL7 A;  4WR5 A;  1PN9 A;  1R26 A;  1XOA A;  1X9M B;  1MEK A;  2L5L A;  1GTU A;  4ZL8 A;  3L0H A;  3UBL A;  1TI1 A;  1XW6 A;  5CRE A;  3D4T A;  3APQ A;  3M9J A;  3RDW A;  1TOF A;  1HNC A;  2H1B A;  2LUS A;  1BG5 A;  4EE0 A;  1QQ2 A;  5JCU A;  2J9H A;  4YQU A;  3HJP A;  2H6X A;  5CRH A;  1M9A A;  2BJX A;  3UAR A;  1A8Y A;  4EL1 A;  5IMD A;  3J7Y k;  2IME A;  4MF6 A;  3GSS A;  1TXX A;  3CSH A;  4BVY A;  2QC7 A;  4AJ6 A;  4LL1 B;  5G1L A;  2HSY A;  1NM3 A;  5IMA A;  2HYX A;  2YP6 A;  3TRP A;  3KTL A;  4I6X A;  3UAP A;  3A3T A;  5HR2 A;  4NAX A;  5LD0 A;  2C0D A;  2HT9 A;  2CVK A;  3GN3 A;  1B4P A;  4GCI A;  3IRA A;  2YV7 A;  4OMV A;  2L6C A;  2F8F A;  1T4Z A;  3J7Y b;  4WBJ A;  2OAD A;  1Z3E A;  4XCS A;  4KDU A;  1FVJ A;  3G7Y A;  1SKR B;  2HRN A;  1FW1 A;  2DC5 A;  3G7I A;  2C0F A;  5LNK e;  2GSQ A;  2H70 A;  14GS A;  3GMF A;  3QFA C;  4XHM A;  2YWN A;  3G7J A;  1ERU A;  1USB A;  2VLU A;  1V98 A;  2H74 A;  6GSS A;  1OKD A;  3ZLP A;  1LU4 A;  3V1W A;  2HZE B;  5KN1 A;  3CBU A;  2WDU A;  1OC3 A;  2HLS A;  1AXD A;  2IMF A;  1O85 A;  4ZBD A;  3D4M A;  3F63 A;  1JLV A;  2FNO A;  2LEG A;  4HJ2 A;  1GH2 A;  3KH9 A;  3G9B A;  1U88 A;  1T4Y A;  2HE3 A;  1GWC A;  2OE1 A;  1LBK A;  3KP9 A;  2YJH A;  3ERG A;  2OAC A;  4V1A p;  5IMF A;  2OE0 A;  3DIE A;  1TRS A;  4OCF A;  4IN0 A;  3HKR A;  2A4V A;  2LJK A;  1Z7R A;  3UEM A;  3GL3 A;  1I5G A;  3EMX A;  3BCK A;  2X8G A;  2ON5 A;  2JL4 A;  5B8A A;  3QAG A;  1TI3 A;  2A2R A;  3ED3 A;  4PNG A;  1ERT A;  2LQQ A;  4PQH A;  4ZB9 A;  2AYT A;  1TW9 A;  1SKW B;  2DML A;  3A5W A;  4GSN A;  1GSD A;  4I2U A;  1SU9 A;  3KM6 A;  1TDI A;  1XWB A;  3Q6O A;  1G7E A;  3NIV A;  3WT1 A;  4OCE A;  2LJR A;  3TUE A;  4TXO A;  1O8X A;  2NPB A;  4OFT A;  1J9B A;  1TRU A;  2LV3 A;  1J0F A;  1KTE A;  3LOR A;  2AUV A;  3HZ4 A;  4BPY A;  4N11 A;  5D9T A;  3C1R A;  1K0D A;  2JSY A;  4NWY A;  4GWR A;  1GUM A;  1EGO A;  3EC3 A;  3I69 A;  2VCX A;  5A4U A;  3DVX A;  2WCI A;  4HU9 A;  2B7J A;  5H5Q A;  1ABA A;  4HJM A;  3C1S A;  4HOJ A;  2H66 A;  4HZ2 A;  3GHA A;  1OC9 B;  1S3C A;  3EYT A;  2YCD A;  3LEF A;  5CYY A;  5DBQ A;  1GL8 A;  2E7P A;  2WUL A;  1AC1 A;  1YEP A;  4MJA A;  3ZIT A;  4Q5N A;  3WT2 A;  2MBT A;  3IC4 A;  2VL9 A;  3LGC A;  3BCI A;  3FKF A;  4LA1 A;  2CAQ A;  1SK2 A;  4TR0 A;  2H19 A;  1OYJ A;  2QGV A;  5ECH B;  2FLS A;  1FAA A;  3CSI A;  3D6I A;  5A5K A;  2NDO A;  5ID2 B;  2IIY A;  3P7X A;  5IQY A;  1BAY A;  5JCW A;  4XTS A;  5E4W A;  1TU8 A;  2H71 A;  1U3A A;  2KUC A;  2OBK A;  3HY2 A;  5ABR A;  5GST A;  4HDE A;  1AQV A;  2ALB A;  3M8N A;  1A23 A;  2IMK A;  5L71 A;  5KEJ A;  3LYP A;  3HJO A;  2R6K A;  1NHY A;  3VFI A;  3TJG A;  4IQ1 A;  4K9Z A;  1XFL A;  3FK8 A;  3UJ1 A;  4N30 A;  4K7N A;  4DSS A;  1PL2 A;  1AQX A;  1J08 A;  4L0W A;  2FWF A;  2H0I A;  2H1G A;  4X0X A;  1AUC A;  1K3L A;  3IA1 A;  2X8C A;  1FOV A;  1FG4 A;  1PX7 A;  3GTU B;  3QD9 A;  1G6Y A;  3EUR A;  1ZMA A;  3Q74 A;  4AF2 A;  3LYK A;  2GS3 A;  5B8B A;  1M0U A;  2C3N A;  3KJY A;  1YF1 A;  3GKX A;  3WGX A;  3RHC A;  3FZ5 A;  3O6T A;  1THX A;  1TK0 B;  1V57 A;  3FR3 A;  2FD3 A;  2PBJ A;  4POB A;  4V2M A;  2DJ3 A;  2L57 A;  3IHQ A;  3A2X A;  1AQW A;  4NV2 A;  1EP8 A;  3BJ5 A;  4IBP A;  1URM A;  4F2I A;  3F6D A;  4PUF C;  2MBS A;  4TR3 A;  3GST A;  4MZB A;  4YAP A;  2C0G A;  1R5A A;  2CAI A;  5HFI A;  3U6V A;  2V2G A;  2DSA A;  5G2Z A;  4HUA A;  1EOH A;  2H1A A;  1XPV A;  3IXR A;  4MH2 A;  3LFL A;  1OC8 A;  3F3R A;  3TKS C;  2GZZ A;  2YNX A;  6GST A;  5IOW A;  5GAP D;  2VL2 C;  4PNF A;  2C3Q A;  4I2T A;  2LST A;  1GSE A;  1ZGN A;  3P8W A;  3MDK A;  2O85 A;  1B4Q A;  3TCO A;  3KCM A;  3FY7 A;  1QUW A;  1A0F A;  1TJD A;  2WB9 A;  1M99 A;  3HVS A;  2YN1 A;  4NHW A;  3VWU A;  3IK7 A;  2E2G A;  4FH8 A;  3ZML A;  2GQL A;  2MZC A;  4X43 A;  7GSS A;  2V1M A;  3TJK A;  2H6Y A;  3H79 A;  3H8Q A;  3WYW A;  3IOS A;  4P3Y B;  2EIO A;  5ELG A;  2XBQ A;  3RAZ A;  2F9S A;  2WGR A;  2LNT A;  1B9Y C;  3FZA A;  4IW9 A;  3RPP A;  4GTU A;  1W4V A;  5D9W A;  4K1F A;  8GSS A;  3UBK A;  1UN2 A;  4POM A;  2CZ2 A;  2IMI A;  4K2D A;  2X8H A;  4H86 A;  2B7K A;  1X5D A;  1OAZ A;  2C80 A;  4IJI A;  1FHE A;  3UVH A;  1HNA A;  3E3E A;  1SYX A;  2HSH A;  4N0V A;  4PGT A;  2IMD A;  3KH7 A;  5HR1 A;  9GSS A;  2KP1 A;  4EC0 A;  3EU4 A;  4ECB A;  3CTG A;  2ZUP A;  3US3 A;  1A0R P;  2C8U A;  4EDZ A;  3HA9 A;  2K6V A;  5D93 A;  1TRV A;  4N10 A;  4V2N A;  1PRX A;  3HZ8 A;  4QL9 A;  3Q19 A;  4JRR A;  2DJJ A;  4IVF A;  3KMO A;  5DJM A;  5G5F A;  4KX4 A;  4JU5 A;  1MD3 A;  1XCC A;  1ZZY A;  4ISD A;  4MAB A;  3WGD A;  4ZB6 A;  3GX8 A;  2FUG 2;  5CRG A;  5IPG A;  4F0C A;  3ERF A;  1TU7 A;  4RQR A;  5ECK B;  3ZIJ A;  3AY8 A;  3IDV A;  2VCW A;  5ENU A;  2F3M A;  2FWE A;  5B7C A;  3M1G A;  5D73 A;  4PUA A;  4POK A;  3UOM A;  3ZFL A;  1G6W A;  3I9V 2;  4ZBB A;  1O8W A; 
#chains in the Genus database with same CATH topology
 5ECQ B;  5CRW A;  1G0T A;  4BVX A;  5GZZ B;  3PGT A;  2AAW A;  5KN2 A;  5DAL A;  1K0M A;  4MZW A;  2VLT A;  1V58 A;  1T3B A;  2EC4 A;  3EMP A;  1S3A A;  4ECI A;  1HQO A;  1SEN A;  1ZL9 A;  3F4S A;  2K8V A;  3GH6 A;  2B6M A;  2I3Y A;  1T1V A;  4IQA A;  1GLP A;  4MLY A;  1IYI A;  2B1L A;  3L9U A;  4O5R A;  4TKY A;  5A4V A;  4CDO A;  4GRF A;  4KH7 A;  3EIN A;  3R3E A;  2AJQ B;  1T00 A;  3HHV A;  1Z7P A;  4WXT A;  1MDK A;  3Q18 A;  4O92 A;  4ULX A;  4JED A;  4CHS A;  4E8H A;  4HU7 A;  1GUH A;  3GA4 A;  4KUN A;  1KEB A;  1PD2 1;  4V2L A;  2GSR A;  1F3A A;  2XC2 A;  1ZYN A;  1X9W B;  2RII A;  4KW6 A;  2CX4 A;  2C1Y A;  4K7O A;  3OR5 A;  4PUR A;  2GST A;  2DKH A;  2HZF A;  4IS0 A;  2VCV A;  5F05 A;  3M0F A;  4DSQ A;  2LS5 A;  2AB6 A;  2G2Q A;  4KDX A;  2XBI A;  3CRU A;  3DWV A;  3TRQ A;  2WJU A;  5JWQ B;  4GQC A;  3ZVJ A;  4TXO B;  5G5E A;  2GTU A;  2BTO T;  2CVD A;  20GS A;  2CVB A;  6GSV A;  1Q98 A;  2VD0 A;  3PPU A;  4MJB A;  1ILO A;  2HI7 A;  2FA8 A;  1XWA A;  1ERV A;  3HYP A;  1BED A;  1SK1 A;  5DDL A;  5IMV A;  4F82 A;  1OKT A;  1TRW A;  4V1A g;  5KN3 A;  3ZMK A;  1K0C A;  1K0B A;  4KAE A;  4K0N A;  2YAN A;  4YH2 A;  3KEB A;  1RK4 A;  3A2W A;  5D8I A;  1CQG A;  4AGS A;  4IKH A;  2VIM A;  4AJ7 A;  5H5S A;  2NBS A;  3VK9 A;  2VCT A;  3DXB A;  1MTC A;  3IC8 A;  3MYD A;  5ECN B;  2V32 A;  4OFM A;  2VCZ A;  2H1D A;  17GS A;  1GLQ A;  3U5R E;  5CNW A;  2IPA A;  1PA3 A;  5E59 A;  1MDJ A;  1GSF A;  1PKW A;  2I1U A;  1JZO A;  13GS A;  1SKS B;  3VI5 A;  4XS4 B;  4N0Z A;  2RM6 A;  4G9H A;  1EV4 A;  1THO A;  5C00 A;  6GSY A;  1QXH A;  4IJ3 A;  4RI6 A;  2BMX A;  5ECO B;  3D21 A;  3FR6 A;  2ZCT A;  2FCH A;  4RQX A;  2F8A A;  3LJR A;  3TDG A;  1F6M C;  4KSO A;  2RM5 A;  2GQK A;  4QL7 A;  2I81 A;  3F0I A;  2B5X A;  4GF0 A;  4ZBA A;  2FA4 A;  4ID0 A;  3DYR A;  1SJ6 A;  4BL7 B;  2VD1 A;  3I43 A;  1XBS A;  2D2Z A;  2VOC A;  1DE1 A;  3HD5 A;  2PU9 C;  4BA7 A;  2H0H A;  1XW5 A;  2ES7 A;  5B6M A;  2B1K A;  1TP9 A;  2DIY A;  5A4W A;  1JFU A;  3L4N A;  4K5R A;  5IMC A;  2OA7 A;  1B9X C;  4CY8 A;  4DSS B;  3I6A A;  4WEY A;  4O5Q A;  3GFK A;  4KE3 A;  2CV4 A;  5CO3 A;  2JU5 A;  3VWV A;  3DVW A;  2R0G A;  2VL2 A;  2YWI A;  3ZYW A;  1R5P A;  4FQU A;  5DAK B;  5F0G A;  3D0Z A;  2N5A A;  1GSU A;  3FW2 A;  1M2A A;  3KIJ A;  3P2A A;  2PVQ A;  4Q5F A;  4AJ8 A;  4TW5 A;  3IPZ A;  5CAX A;  3IE3 A;  1R4W A;  1SD9 A;  2GZY A;  1BQ7 A;  5CRD A;  3TKQ A;  4ZIJ A;  1XWG A;  2DJ0 A;  5FWG A;  3LG6 A;  1PSQ A;  4BWQ A;  1ST9 A;  5ECR B;  3MIX A;  3KTB A;  3W8S A;  4PQI A;  2GT5 A;  5IO2 A;  2HNL A;  5IOX A;  3CMI A;  1SL0 B;  2B5Y A;  3GIX A;  2IFQ A;  4GST A;  3CRT A;  5INY A;  2TRX A;  4TN8 A;  1YZX A;  5H5R A;  2Z9S A;  1VF3 A;  1NW2 A;  4USS A;  1SJZ A;  5ECM B;  4JBB A;  2GDR A;  1FOH A;  4YKG A;  2LRN A;  2PPT A;  5BMU A;  4IHU A;  1E6B A;  4KF9 A;  1NHO A;  1PX6 A;  2E0Q A;  2GSS A;  1PN0 A;  2UZ8 A;  3ZRE A;  3W6G A;  5FHI A;  4I5Q A;  1B8X A;  2PVO C;  5IIZ A;  12GS A;  1WMJ A;  1T7P B;  1RQM A;  3SWL A;  5DJL A;  5HR0 A;  2WZ9 A;  1O7U A;  1BX9 A;  1QFN A;  2L59 A;  4OFN A;  2DJ2 A;  3QDN A;  4MDC A;  3GKM A;  3VPT A;  2ON7 A;  3L78 A;  4MH3 A;  3SBC A;  3LW9 A;  1M2D A;  4NPB A;  1EZK A;  4K5S A;  4HQZ A;  2LNS A;  1ZYP A;  1YKC A;  4WKW A;  3BD2 A;  5C04 A;  2H8L A;  4OD7 A;  3UL3 A;  3RBT A;  1CQH A;  1WWJ A;  4KND A;  3H1N A;  2R37 A;  3TOU A;  4MJC A;  4I97 A;  2PN8 A;  3GTU A;  1F37 A;  2TIR A;  2L4Q A;  2H76 A;  5G31 A;  3HDC A;  3ZZX A;  2A2P A;  4KCE A;  3R2Q A;  4WET A;  11GS A;  2K8S A;  2QSI A;  4LMW A;  4IGJ A;  3RHB A;  4Q5Q A;  4HZ4 A;  1ON4 A;  3NOF A;  2QKE A;  1ZYQ B;  4MPF A;  2FGX A;  4TR1 B;  4ECJ A;  1A2J A;  3VI7 A;  5EVO A;  2B5E A;  1JZD A;  3FHK A;  4EO3 A;  2RLI A;  2KLX A;  1XIY A;  3IR4 A;  1YF0 A;  2EIQ A;  2N5B A;  4IP6 A;  3UIW A;  5F07 A;  3CXG A;  3TJF A;  1EP7 A;  5GSS A;  3VWW A;  4PQ1 A;  2JSZ A;  2VUP A;  1I9D A;  4TRX A;  1GNE A;  4FYB A;  1EOG A;  5ECP B;  1SJI A;  5J3R A;  2LJA A;  4D73 B;  3QCP A;  4GXZ A;  2KP2 A;  2P31 A;  4K0G A;  2JZT A;  18GS A;  3UVT A;  1SK0 A;  2RUF A;  3C7M A;  4G0L A;  3IAS 2;  1ACV A;  4RUV A;  1S3R A;  1YQ1 A;  4G2E A;  4QQ7 A;  4WR4 A;  3LXT A;  1ZOF A;  1HYU A;  3DML A;  4XS6 A;  2F51 A;  3QR6 A;  2K18 A;  4KDY A;  1GP1 A;  1Z6N A;  2NVL A;  4EIQ A;  5D9X A;  2R0C A;  3ZRD A;  5CP1 A;  1UA5 A;  4FO5 A;  4YAV A;  2EIR A;  3GYK A;  2LTK A;  2YOI A;  1XWK A;  1GTI A;  2I9H A;  2MMZ A;  1YY7 A;  5DAL B;  1V40 A;  1U6T A;  2OBI A;  3DD3 A;  3GUR A;  1FB6 A;  1Y25 A;  3K8N A;  2C0E A;  4CW9 A;  4K8M A;  1K3Y A;  4IEL A;  3ZIV A;  3LXZ A;  4WF5 A;  1F3B A;  1O6J A;  1F2E A;  1A24 A;  2P0G A;  4MJE A;  3TJJ A;  4X4J A;  1HNB A;  1FO5 A;  1M7T A;  4JE1 A;  5DCH A;  3MSZ A;  3H4K A;  4K7I A;  2OJL A;  2C3T A;  2V41 A;  4OWY A;  4TVE A;  4DSR A;  1AAZ A;  4FYC A;  1TK8 B;  2M46 A;  1N2A A;  1OE8 A;  5D96 A;  5GAN D;  3CTF A;  4PX1 A;  1U87 A;  1N8J A;  3WGE A;  3LQ7 A;  3DGQ A;  3QAW A;  1O73 A;  2B3S A;  4JZQ A;  1DBY A;  1GRX A;  1TK5 B;  4GLT A;  2IN3 A;  1XG8 A;  5DQY A;  4ZXG A;  4J2F A;  4Z7X A;  3FRC A;  3ZVJ D;  1MDI A;  4MK3 A;  3HCZ A;  2MMN A;  1XWC A;  2IL3 A;  4HI7 A;  3IAM 2;  2FY6 A;  1G7O A;  4EVM A;  1XW9 A;  3HJM A;  4JR6 A;  1QGV A;  1C72 A;  3DRN A;  2GQM A;  5J9B A;  2HXK A;  4MF5 A;  2IWT A;  4ECC A;  4NXI A;  4O32 A;  4LL4 B;  1Z9H A;  2OKA A;  2GLR A;  6GSU A;  5B6N A;  1XOB A;  4MP4 A;  4EXJ A;  1MD4 A;  1PQN A;  2MMO A;  1H4O A;  1ZCP A;  4XIH A;  3QOU A;  5JWR B;  5DQS A;  3P90 A;  4TOP A;  2LRC A;  4TXV A;  2OE3 A;  3EVI A;  1WP0 A;  3L9S A;  2N5F A;  1Q4J A;  2VLV A;  3TGZ A;  1H75 A;  4EDY A;  2CZ3 A;  1A2M A;  2WRT A;  2J23 A;  3A2V A;  1PMT A;  2KOK A;  2JAC A;  4G0I A;  1M9B A;  4XRA A;  3GV1 A;  1KNG A;  4KSM A;  3ZL5 A;  4EIP A;  2XPE A;  3TJB A;  2M80 A;  3LSZ A;  2VM2 A;  1WE0 A;  3HVV A;  5HR3 A;  2HRF A;  1GSQ A;  3BOA A;  1GTB A;  2H30 A;  2DJ1 A;  4ZL9 A;  4KGI A;  4ML1 A;  1V2A A;  4ML6 A;  1XVQ A;  4F0B A;  3KGK A;  2A2S A;  1EEM A;  3VPQ A;  3JCM L;  2YWM A;  2JAD A;  2V6O A;  2YWO A;  1UC7 A;  2O7K A;  2VM1 A;  3ZFB A;  1Z6M A;  1EV9 A;  2H73 A;  1AW9 A;  1UVZ A;  4KCA A;  2AV4 A;  3F9U A;  1A2L A;  4O7H A;  3CYN A;  3O76 A;  2E2M A;  3PH9 A;  1VGL A;  4I8B A;  5EPF A;  1U3I A;  1S3D A;  5J41 A;  4MZC A;  4HEA 2;  2DBC A;  3KD0 A;  5IMZ A;  2IJY A;  3IBH A;  1VF2 A;  4ILF A;  1EGR A;  6GSW A;  3VLN A;  2R5G A;  2HZE A;  3F4R A;  4HQS A;  4LMV A;  2R2J A;  1V9W A;  4X1U A;  2XHF A;  4MCU A;  1XXU A;  5J9C A;  2GT6 A;  4K6X A;  5J5N A;  5KOX A;  4NHZ A;  2WFC A;  1LJR A;  19GS A;  1GNW A;  2X99 A;  3F4T A;  3C71 A;  3ME8 A;  4FYU A;  2X64 A;  1X0R A;  2P5R A;  1WOU A;  3FYG A;  10GS A;  3TKS E;  1ZYE A;  3KP8 A;  2REM A;  2GZP A;  1AIU A;  1NSW A;  2ZNM A;  4IP1 A;  1QMV A;  1EWX A;  3RPN A;  3ISO A;  2K9F A;  1DUG A;  2VO4 A;  2M72 A;  1XZO A;  4KA0 A;  4XS1 A;  1RW1 A;  4MMM A;  2CA8 A;  1WJK A;  2PER A;  4G10 A;  5J4U A;  1HD2 A;  3F3Q A;  2C4J A;  3TOT A;  1ERW A;  3FZ9 A;  2P5Q A;  2R0P A;  4L5L A;  1YJ6 A;  2FHE A;  3MAK A;  4L5O A;  1SL2 B;  4DVC A;  3DKS A;  4MPG A;  4GQF A;  2MYG A;  3M3M A;  4JR4 A;  4FIW A;  1E2Y A;  5ELA A;  3HXS A;  2H75 A;  2DJK A;  2XPD A;  5HFK A;  2LQO A;  3E9J B;  2H01 A;  1TKD B;  3TKS A;  2HRK A;  3O3T A;  1GSY A;  4OO5 A;  1K0N A;  4G19 A;  2IFQ B;  4NV5 A;  5IM9 A;  4XS4 A;  3HVX A;  4CY6 A;  3C73 A;  1DE2 A;  4YKF A;  2AHE A;  1GTA A;  2TRC P;  4BIK A;  3KXO A;  5EY6 A;  1T8E B;  1VF4 A;  2DMM A;  2VAF A;  5FT3 A;  3TKR A;  4Z2T A;  4L8E A;  3GNJ A;  3IV4 A;  3PIN A;  1X9S B;  1WPI A;  1W89 A;  3M9K A;  1K0A A;  4BL7 A;  2I4A A;  1X5E A;  4BWS A;  2H6Z A;  5EL8 A;  2CX3 A;  5AIV A;  1K0O A;  2KHP A;  5HQP A;  2FWG A;  1OC9 A;  5AIX A;  3FR9 A;  5DVB A;  1TTZ A;  4PTS A;  1SD8 A;  3QPM A;  3FZ4 A;  1OE7 A;  3VUR A;  3MNG A;  1JZW A;  2HFD A;  4WBR D;  5COH A;  1XVW A;  1GSS A;  1FB0 A;  4WF4 A;  3DEX A;  4Z2R A;  4HS1 A;  1BYE A;  3ZTL A;  2PWJ A;  2LRT A;  3TB2 A;  3GRX A;  1K3O A;  4E8E A;  3S9F A;  3KMN A;  5DAK A;  4MA9 A;  5BRT A;  4EUY A;  5ID2 A;  2PMT A;  5F06 A;  2H72 A;  3EE2 A;  2VL3 A;  1JZR A;  1OVN A;  3H93 A;  2R4V A;  3NZN A;  1IYH A;  2JZR A;  2DIZ A;  1SYR A;  4RI7 A;  3E0U A;  5KN0 A;  2CT6 A;  1PL1 A;  6GSX A;  4ACS A;  5JWO B;  2O89 A;  2L6D A;  4YQM A;  1YKA A;  4TR4 A;  3CSJ A;  4YQV A;  1Z5Y E;  4J57 E;  5AN1 A;  3QFB C;  2WS2 A;  1BJX A;  5AGY A;  1PGT A;  2O8V B;  5IO0 A;  3GX0 A;  1F9M A;  2YZU A;  3D5J A;  4MF7 A;  5G1K A;  4ZB8 A;  4KB3 A;  1M3J A;  4F03 A;  3QMX A;  4J56 E;  4GSS A;  1PKZ A;  3D22 A;  1M2B A;  1FVK A;  2LKU A;  2RUE A;  3APO A;  5IPH A;  1B48 A;  2DLX A;  5D9V A;  3GH9 A;  5HFG A;  3ME7 A;  3F8U A;  5F8B A;  3BBY A;  4EKZ A;  4EF0 A;  3UMA A;  4ZIL A;  2YPM A;  3N5O A;  3F6F A;  4O5U A;  5LCZ A;  5DCG A;  2V6K A;  2CQ9 A;  2GVP A;  2YV9 A;  3VWX A;  1A8L A;  3FMW A;  3N9J A;  1WIK A;  2NTO A;  1GUK A;  1DSB A;  4Q5R A;  3LWA A;  5JCG A;  2GGT A;  3C8E A;  1WRY A;  3GL5 A;  2PGT A;  1ML6 A;  3KZQ A;  1VRS D;  3PR8 A;  3GKN A;  4ICY A;  1JLW A;  1VF1 A;  1O81 A;  2MMA A;  2FWH A;  3W8J A;  4DEJ A;  3FEU A;  2O87 A;  3TRX A;  1EEJ A;  3GUS A;  4NMU A;  22GS A;  2G0F A;  1R7H A;  4OO4 A;  1SL1 B;  5ECI B;  3L9V A;  4PXO A;  2L5O A;  5G30 A;  1Y6E A;  4TR1 A;  2YZH A;  2R3X A;  3QAV A;  1KBN A;  4BVX B;  4Z2U A;  16GS A;  5AIS A;  3APS A;  1X5C A;  3IK9 A;  2VCQ A;  3EWL A;  2PUK C;  3GKK A;  4POL A;  4XRD A;  3TKP A;  3MWH A;  3EU3 A;  3ERW A;  1JHB A;  2L4C A;  2H0G A;  1YEX A;  1GUL A;  4F9Z A;  5ECS A;  2YJ7 A;  3WD6 A;  4L0U A;  2JZS A;  1YDK A;  1QK8 A;  5ECL B;  4LLR A;  4D73 A;  4ZL7 A;  4WR5 A;  5KOW A;  1PN9 A;  1R26 A;  1XOA A;  1X9M B;  1MEK A;  2L5L A;  1GTU A;  4ZL8 A;  3L0H A;  3UBL A;  1TI1 A;  1XW6 A;  5CRE A;  3D4T A;  3APQ A;  3M9J A;  3RDW A;  1TOF A;  1HNC A;  2H1B A;  2LUS A;  1BG5 A;  4EE0 A;  1QQ2 A;  5JCU A;  2J9H A;  4YQU A;  3HJP A;  2H6X A;  5CRH A;  1M9A A;  2BJX A;  3UAR A;  1A8Y A;  4EL1 A;  5IMD A;  3J7Y k;  2IME A;  4MF6 A;  3GSS A;  1TXX A;  3CSH A;  3EPT A;  4BVY A;  2QC7 A;  4AJ6 A;  4LL1 B;  5G1L A;  2HSY A;  1NM3 A;  5IMA A;  2HYX A;  1M3I A;  2YP6 A;  3TRP A;  3KTL A;  4I6X A;  3UAP A;  3A3T A;  5HR2 A;  4NAX A;  5LD0 A;  2C0D A;  2HT9 A;  1PFO A;  2CVK A;  3GN3 A;  2X49 A;  1B4P A;  4GCI A;  3IRA A;  2YV7 A;  4OMV A;  2L6C A;  2F8F A;  1T4Z A;  3J7Y b;  4WBJ A;  2OAD A;  1Z3E A;  4XCS A;  4KDU A;  1FVJ A;  3G7Y A;  1SKR B;  2HRN A;  1FW1 A;  2DC5 A;  3G7I A;  2C0F A;  5LNK e;  2GSQ A;  2H70 A;  14GS A;  3GMF A;  3QFA C;  4XHM A;  4A5P A;  2YWN A;  3G7J A;  1ERU A;  1USB A;  2VLU A;  1V98 A;  2H74 A;  6GSS A;  1OKD A;  3ZLP A;  1LU4 A;  3V1W A;  2HZE B;  5KN1 A;  3CBU A;  2WDU A;  1OC3 A;  2HLS A;  1AXD A;  2IMF A;  1O85 A;  4ZBD A;  3D4M A;  3F63 A;  1JLV A;  2FNO A;  2LEG A;  4HJ2 A;  1GH2 A;  3KH9 A;  3G9B A;  1U88 A;  1T4Y A;  2HE3 A;  3CQF A;  1GWC A;  2OE1 A;  1LBK A;  3KP9 A;  2YJH A;  3ERG A;  2OAC A;  4V1A p;  5IMF A;  2OE0 A;  3DIE A;  1TRS A;  4OCF A;  4IN0 A;  3HKR A;  2A4V A;  2LJK A;  1Z7R A;  3UEM A;  3GL3 A;  1I5G A;  3EMX A;  3BCK A;  2X8G A;  2ON5 A;  2JL4 A;  5B8A A;  3QAG A;  1TI3 A;  2A2R A;  3ED3 A;  4PNG A;  1ERT A;  2LQQ A;  4PQH A;  2DKI A;  4ZB9 A;  2AYT A;  1TW9 A;  1SKW B;  2DML A;  3A5W A;  4GSN A;  1GSD A;  4I2U A;  1SU9 A;  3KM6 A;  1TDI A;  1XWB A;  3Q6O A;  1G7E A;  3NIV A;  3WT1 A;  4OCE A;  2LJR A;  3TUE A;  4TXO A;  1O8X A;  2NPB A;  4OFT A;  1J9B A;  1TRU A;  2LV3 A;  1J0F A;  1KTE A;  3LOR A;  2AUV A;  3HZ4 A;  4BPY A;  4N11 A;  5D9T A;  2A4H A;  3A5I A;  3C1R A;  1K0D A;  2JSY A;  4NWY A;  4GWR A;  1GUM A;  1EGO A;  3EC3 A;  3I69 A;  2VCX A;  5A4U A;  3DVX A;  2WCI A;  2QA2 A;  4HU9 A;  2B7J A;  5H5Q A;  1ABA A;  4HJM A;  3C1S A;  4HOJ A;  2H66 A;  4HZ2 A;  3GHA A;  1OC9 B;  1S3C A;  3EYT A;  2YCD A;  3LEF A;  5CYY A;  5DBQ A;  1GL8 A;  2E7P A;  2WUL A;  1AC1 A;  1YEP A;  4MJA A;  3ZIT A;  4Q5N A;  3WT2 A;  2MBT A;  3IC4 A;  2VL9 A;  3LGC A;  3BCI A;  3FKF A;  4LA1 A;  2CAQ A;  1SK2 A;  4HSC X;  4TR0 A;  2H19 A;  1OYJ A;  2QGV A;  5ECH B;  2FLS A;  2HSM A;  1FAA A;  3CSI A;  3D6I A;  5A5K A;  2NDO A;  5ID2 B;  2IIY A;  3P7X A;  3HVN A;  5IQY A;  1BAY A;  5JCW A;  4XTS A;  5E4W A;  1TU8 A;  2H71 A;  1U3A A;  2KUC A;  2OBK A;  3HY2 A;  5ABR A;  5GST A;  4HDE A;  1AQV A;  2ALB A;  3M8N A;  1A23 A;  2IMK A;  5L71 A;  5KEJ A;  3LYP A;  3HJO A;  2R6K A;  1NHY A;  3VFI A;  3TJG A;  4IQ1 A;  4K9Z A;  1XFL A;  3FK8 A;  3UJ1 A;  4N30 A;  4K7N A;  4DSS A;  1PL2 A;  1AQX A;  1J08 A;  4L0W A;  2FWF A;  2H0I A;  2H1G A;  4X0X A;  1AUC A;  1K3L A;  3IA1 A;  2X8C A;  1FOV A;  1FG4 A;  1PX7 A;  3GTU B;  3QD9 A;  1G6Y A;  3EUR A;  1ZMA A;  3Q74 A;  4AF2 A;  3LYK A;  2GS3 A;  5B8B A;  1M0U A;  2C3N A;  3KJY A;  1YF1 A;  3GKX A;  3WGX A;  3RHC A;  3FZ5 A;  3O6T A;  1THX A;  1TK0 B;  1V57 A;  3FR3 A;  2FD3 A;  2PBJ A;  4POB A;  4V2M A;  2DJ3 A;  2L57 A;  3IHQ A;  3A2X A;  1AQW A;  4NV2 A;  1EP8 A;  3BJ5 A;  4IBP A;  1URM A;  4F2I A;  3F6D A;  4PUF C;  2HRA A;  2MBS A;  4TR3 A;  3GST A;  4MZB A;  4YAP A;  2C0G A;  1R5A A;  2CAI A;  5HFI A;  3U6V A;  2V2G A;  2X4A A;  2DSA A;  5G2Z A;  4HUA A;  1EOH A;  2H1A A;  1XPV A;  3IXR A;  4MH2 A;  3LFL A;  1OC8 A;  3F3R A;  3TKS C;  2GZZ A;  2YNX A;  6GST A;  5IOW A;  5GAP D;  2VL2 C;  4PNF A;  2C3Q A;  4I2T A;  2LST A;  1GSE A;  1ZGN A;  3P8W A;  3MDK A;  2O85 A;  1B4Q A;  3TCO A;  3KCM A;  3FY7 A;  1QUW A;  1A0F A;  1TJD A;  2WB9 A;  1M99 A;  3HVS A;  2YN1 A;  4NHW A;  3VWU A;  3IK7 A;  4MNN A;  2E2G A;  4FH8 A;  2QA1 A;  3ZML A;  2GQL A;  2MZC A;  4X43 A;  7GSS A;  2V1M A;  3TJK A;  2H6Y A;  3H79 A;  3H8Q A;  3WYW A;  3IOS A;  4P3Y B;  2EIO A;  5ELG A;  2XBQ A;  3RAZ A;  2F9S A;  3IHG A;  2WGR A;  2LNT A;  1B9Y C;  4G0K A;  3FZA A;  4IW9 A;  3RPP A;  4GTU A;  1W4V A;  5D9W A;  4K1F A;  8GSS A;  3UBK A;  1UN2 A;  4POM A;  2CZ2 A;  2IMI A;  4K2D A;  2X8H A;  4H86 A;  2B7K A;  1X5D A;  1OAZ A;  2C80 A;  4IJI A;  1FHE A;  3UVH A;  1HNA A;  3E3E A;  1SYX A;  2HSH A;  4N0V A;  4PGT A;  2IMD A;  3KH7 A;  5HR1 A;  9GSS A;  2KP1 A;  4EC0 A;  3EU4 A;  4ECB A;  3CTG A;  2ZUP A;  3US3 A;  1A0R P;  2C8U A;  4EDZ A;  3HA9 A;  2K6V A;  5D93 A;  1TRV A;  4N10 A;  4V2N A;  1PRX A;  3HZ8 A;  4QL9 A;  3Q19 A;  4JRR A;  2DJJ A;  4BVY B;  4IVF A;  3KMO A;  5DJM A;  5G5F A;  4K2X A;  4KX4 A;  4JU5 A;  1MD3 A;  1XCC A;  1ZZY A;  4ISD A;  4MAB A;  3WGD A;  4ZB6 A;  3GX8 A;  2FUG 2;  5CRG A;  5IPG A;  4F0C A;  3ERF A;  1TU7 A;  4RQR A;  5ECK B;  3ZIJ A;  3AY8 A;  3IDV A;  2VCW A;  5ENU A;  2F3M A;  2FWE A;  5B7C A;  3M1G A;  5D73 A;  4PUA A;  4POK A;  3UOM A;  3ZFL A;  1G6W A;  3I9V 2;  4ZBB A;  1O8W A; 
#chains in the Genus database with same CATH homology
 5ECQ B;  5CRW A;  1G0T A;  4BVX A;  5GZZ B;  3PGT A;  2AAW A;  5KN2 A;  5DAL A;  1K0M A;  4MZW A;  2VLT A;  1V58 A;  1T3B A;  2EC4 A;  3EMP A;  1S3A A;  4ECI A;  1HQO A;  1SEN A;  1ZL9 A;  3F4S A;  2K8V A;  3GH6 A;  2B6M A;  2I3Y A;  1T1V A;  4IQA A;  1GLP A;  4MLY A;  1IYI A;  2B1L A;  3L9U A;  4O5R A;  4TKY A;  5A4V A;  4CDO A;  4GRF A;  4KH7 A;  3EIN A;  3R3E A;  2AJQ B;  1T00 A;  3HHV A;  1Z7P A;  4WXT A;  1MDK A;  3Q18 A;  4O92 A;  4ULX A;  4JED A;  4CHS A;  4E8H A;  4HU7 A;  1GUH A;  3GA4 A;  4KUN A;  1KEB A;  1PD2 1;  4V2L A;  2GSR A;  1F3A A;  2XC2 A;  1ZYN A;  1X9W B;  2RII A;  4KW6 A;  2CX4 A;  2C1Y A;  4K7O A;  3OR5 A;  4PUR A;  2GST A;  2DKH A;  2HZF A;  4IS0 A;  2VCV A;  5F05 A;  3M0F A;  4DSQ A;  2LS5 A;  2AB6 A;  2G2Q A;  4KDX A;  2XBI A;  3CRU A;  3DWV A;  3TRQ A;  2WJU A;  5JWQ B;  4GQC A;  3ZVJ A;  4TXO B;  5G5E A;  2GTU A;  2BTO T;  2CVD A;  20GS A;  2CVB A;  6GSV A;  1Q98 A;  2VD0 A;  3PPU A;  4MJB A;  1ILO A;  2HI7 A;  2FA8 A;  1XWA A;  1ERV A;  3HYP A;  1BED A;  1SK1 A;  5DDL A;  5IMV A;  4F82 A;  1OKT A;  1TRW A;  4V1A g;  5KN3 A;  3ZMK A;  1K0C A;  1K0B A;  4KAE A;  4K0N A;  2YAN A;  4YH2 A;  3KEB A;  1RK4 A;  3A2W A;  5D8I A;  1CQG A;  4AGS A;  4IKH A;  2VIM A;  4AJ7 A;  5H5S A;  2NBS A;  3VK9 A;  2VCT A;  3DXB A;  1MTC A;  3IC8 A;  3MYD A;  5ECN B;  2V32 A;  4OFM A;  2VCZ A;  2H1D A;  17GS A;  1GLQ A;  3U5R E;  5CNW A;  2IPA A;  1PA3 A;  5E59 A;  1MDJ A;  1GSF A;  1PKW A;  2I1U A;  1JZO A;  13GS A;  1SKS B;  3VI5 A;  4XS4 B;  4N0Z A;  2RM6 A;  4G9H A;  1EV4 A;  1THO A;  5C00 A;  6GSY A;  1QXH A;  4IJ3 A;  4RI6 A;  2BMX A;  5ECO B;  3D21 A;  3FR6 A;  2ZCT A;  2FCH A;  4RQX A;  2F8A A;  3LJR A;  3TDG A;  1F6M C;  4KSO A;  2RM5 A;  2GQK A;  4QL7 A;  2I81 A;  3F0I A;  2B5X A;  4GF0 A;  4ZBA A;  2FA4 A;  4ID0 A;  3DYR A;  1SJ6 A;  4BL7 B;  2VD1 A;  3I43 A;  1XBS A;  2D2Z A;  2VOC A;  1DE1 A;  3HD5 A;  2PU9 C;  4BA7 A;  2H0H A;  1XW5 A;  2ES7 A;  5B6M A;  2B1K A;  1TP9 A;  2DIY A;  5A4W A;  1JFU A;  3L4N A;  4K5R A;  5IMC A;  2OA7 A;  1B9X C;  4CY8 A;  4DSS B;  3I6A A;  4WEY A;  4O5Q A;  3GFK A;  4KE3 A;  2CV4 A;  5CO3 A;  2JU5 A;  3VWV A;  3DVW A;  2R0G A;  2VL2 A;  2YWI A;  3ZYW A;  1R5P A;  4FQU A;  5DAK B;  5F0G A;  3D0Z A;  2N5A A;  1GSU A;  3FW2 A;  1M2A A;  3KIJ A;  3P2A A;  2PVQ A;  4Q5F A;  4AJ8 A;  4TW5 A;  3IPZ A;  5CAX A;  3IE3 A;  1R4W A;  1SD9 A;  2GZY A;  1BQ7 A;  5CRD A;  3TKQ A;  4ZIJ A;  1XWG A;  2DJ0 A;  5FWG A;  3LG6 A;  1PSQ A;  4BWQ A;  1ST9 A;  5ECR B;  3MIX A;  3KTB A;  3W8S A;  4PQI A;  2GT5 A;  5IO2 A;  2HNL A;  5IOX A;  3CMI A;  1SL0 B;  2B5Y A;  3GIX A;  2IFQ A;  4GST A;  3CRT A;  5INY A;  2TRX A;  4TN8 A;  1YZX A;  5H5R A;  2Z9S A;  1VF3 A;  1NW2 A;  4USS A;  1SJZ A;  5ECM B;  4JBB A;  2GDR A;  1FOH A;  4YKG A;  2LRN A;  2PPT A;  5BMU A;  4IHU A;  1E6B A;  4KF9 A;  1NHO A;  1PX6 A;  2E0Q A;  2GSS A;  1PN0 A;  2UZ8 A;  3ZRE A;  3W6G A;  5FHI A;  4I5Q A;  1B8X A;  2PVO C;  5IIZ A;  12GS A;  1WMJ A;  1T7P B;  1RQM A;  3SWL A;  5DJL A;  5HR0 A;  2WZ9 A;  1O7U A;  1BX9 A;  1QFN A;  2L59 A;  4OFN A;  2DJ2 A;  3QDN A;  4MDC A;  3GKM A;  3VPT A;  2ON7 A;  3L78 A;  4MH3 A;  3SBC A;  3LW9 A;  1M2D A;  4NPB A;  1EZK A;  4K5S A;  4HQZ A;  2LNS A;  1ZYP A;  1YKC A;  4WKW A;  3BD2 A;  5C04 A;  2H8L A;  4OD7 A;  3UL3 A;  3RBT A;  1CQH A;  1WWJ A;  4KND A;  3H1N A;  2R37 A;  3TOU A;  4MJC A;  4I97 A;  2PN8 A;  3GTU A;  1F37 A;  2TIR A;  2L4Q A;  2H76 A;  5G31 A;  3HDC A;  3ZZX A;  2A2P A;  4KCE A;  3R2Q A;  4WET A;  11GS A;  2K8S A;  2QSI A;  4LMW A;  4IGJ A;  3RHB A;  4Q5Q A;  4HZ4 A;  1ON4 A;  3NOF A;  2QKE A;  1ZYQ B;  4MPF A;  2FGX A;  4TR1 B;  4ECJ A;  1A2J A;  3VI7 A;  5EVO A;  2B5E A;  1JZD A;  3FHK A;  4EO3 A;  2RLI A;  2KLX A;  1XIY A;  3IR4 A;  1YF0 A;  2EIQ A;  2N5B A;  4IP6 A;  3UIW A;  5F07 A;  3CXG A;  3TJF A;  1EP7 A;  5GSS A;  3VWW A;  4PQ1 A;  2JSZ A;  2VUP A;  1I9D A;  4TRX A;  1GNE A;  4FYB A;  1EOG A;  5ECP B;  1SJI A;  5J3R A;  2LJA A;  4D73 B;  3QCP A;  4GXZ A;  2KP2 A;  2P31 A;  4K0G A;  2JZT A;  18GS A;  3UVT A;  1SK0 A;  2RUF A;  3C7M A;  4G0L A;  3IAS 2;  1ACV A;  4RUV A;  1YQ1 A;  4G2E A;  4QQ7 A;  4WR4 A;  3LXT A;  1ZOF A;  1HYU A;  3DML A;  4XS6 A;  2F51 A;  3QR6 A;  2K18 A;  4KDY A;  1GP1 A;  1Z6N A;  2NVL A;  4EIQ A;  5D9X A;  2R0C A;  3ZRD A;  5CP1 A;  1UA5 A;  4FO5 A;  4YAV A;  2EIR A;  3GYK A;  2LTK A;  2YOI A;  1XWK A;  1GTI A;  2I9H A;  2MMZ A;  1YY7 A;  5DAL B;  1V40 A;  1U6T A;  2OBI A;  3DD3 A;  3GUR A;  1FB6 A;  1Y25 A;  3K8N A;  2C0E A;  4CW9 A;  4K8M A;  1K3Y A;  4IEL A;  3ZIV A;  3LXZ A;  4WF5 A;  1F3B A;  1O6J A;  1F2E A;  1A24 A;  2P0G A;  4MJE A;  3TJJ A;  4X4J A;  1HNB A;  1FO5 A;  1M7T A;  4JE1 A;  5DCH A;  3MSZ A;  3H4K A;  4K7I A;  2OJL A;  2C3T A;  2V41 A;  4OWY A;  4TVE A;  4DSR A;  1AAZ A;  4FYC A;  1TK8 B;  2M46 A;  1N2A A;  1OE8 A;  5D96 A;  5GAN D;  3CTF A;  4PX1 A;  1U87 A;  1N8J A;  3WGE A;  3LQ7 A;  3DGQ A;  3QAW A;  1O73 A;  2B3S A;  4JZQ A;  1DBY A;  1GRX A;  1TK5 B;  4GLT A;  2IN3 A;  5DQY A;  4ZXG A;  4J2F A;  4Z7X A;  3FRC A;  3ZVJ D;  1MDI A;  4MK3 A;  3HCZ A;  2MMN A;  1XWC A;  2IL3 A;  4HI7 A;  3IAM 2;  2FY6 A;  1G7O A;  4EVM A;  1XW9 A;  3HJM A;  4JR6 A;  1QGV A;  1C72 A;  3DRN A;  2GQM A;  5J9B A;  2HXK A;  4MF5 A;  2IWT A;  4ECC A;  4NXI A;  4O32 A;  4LL4 B;  1Z9H A;  2OKA A;  2GLR A;  6GSU A;  5B6N A;  1XOB A;  4MP4 A;  4EXJ A;  1MD4 A;  1PQN A;  2MMO A;  1H4O A;  1ZCP A;  4XIH A;  3QOU A;  5JWR B;  5DQS A;  3P90 A;  4TOP A;  2LRC A;  4TXV A;  2OE3 A;  3EVI A;  1WP0 A;  3L9S A;  2N5F A;  1Q4J A;  2VLV A;  3TGZ A;  1H75 A;  4EDY A;  2CZ3 A;  1A2M A;  2WRT A;  2J23 A;  3A2V A;  1PMT A;  2KOK A;  2JAC A;  4G0I A;  1M9B A;  4XRA A;  3GV1 A;  1KNG A;  4KSM A;  3ZL5 A;  4EIP A;  2XPE A;  3TJB A;  2M80 A;  3LSZ A;  2VM2 A;  1WE0 A;  3HVV A;  5HR3 A;  2HRF A;  1GSQ A;  3BOA A;  1GTB A;  2H30 A;  2DJ1 A;  4ZL9 A;  4KGI A;  4ML1 A;  1V2A A;  4ML6 A;  1XVQ A;  4F0B A;  3KGK A;  2A2S A;  1EEM A;  3VPQ A;  3JCM L;  2YWM A;  2JAD A;  2V6O A;  2YWO A;  1UC7 A;  2O7K A;  2VM1 A;  3ZFB A;  1Z6M A;  1EV9 A;  2H73 A;  1AW9 A;  1UVZ A;  4KCA A;  2AV4 A;  3F9U A;  1A2L A;  4O7H A;  3CYN A;  3O76 A;  2E2M A;  3PH9 A;  1VGL A;  4I8B A;  5EPF A;  1U3I A;  1S3D A;  5J41 A;  4MZC A;  4HEA 2;  2DBC A;  3KD0 A;  5IMZ A;  2IJY A;  3IBH A;  1VF2 A;  4ILF A;  1EGR A;  6GSW A;  3VLN A;  2R5G A;  2HZE A;  3F4R A;  4HQS A;  4LMV A;  2R2J A;  1V9W A;  4X1U A;  2XHF A;  4MCU A;  1XXU A;  5J9C A;  2GT6 A;  4K6X A;  5J5N A;  5KOX A;  4NHZ A;  2WFC A;  1LJR A;  19GS A;  1GNW A;  2X99 A;  3F4T A;  3C71 A;  3ME8 A;  4FYU A;  2X64 A;  1X0R A;  2P5R A;  1WOU A;  3FYG A;  10GS A;  3TKS E;  1ZYE A;  3KP8 A;  2REM A;  2GZP A;  1AIU A;  1NSW A;  2ZNM A;  4IP1 A;  1QMV A;  1EWX A;  3RPN A;  3ISO A;  2K9F A;  1DUG A;  2VO4 A;  2M72 A;  1XZO A;  4KA0 A;  4XS1 A;  1RW1 A;  4MMM A;  2CA8 A;  1WJK A;  2PER A;  4G10 A;  5J4U A;  1HD2 A;  3F3Q A;  2C4J A;  3TOT A;  1ERW A;  3FZ9 A;  2P5Q A;  2R0P A;  4L5L A;  1YJ6 A;  2FHE A;  3MAK A;  4L5O A;  1SL2 B;  4DVC A;  3DKS A;  4MPG A;  4GQF A;  2MYG A;  3M3M A;  4JR4 A;  4FIW A;  1E2Y A;  5ELA A;  3HXS A;  2H75 A;  2DJK A;  2XPD A;  5HFK A;  2LQO A;  3E9J B;  2H01 A;  1TKD B;  3TKS A;  2HRK A;  3O3T A;  1GSY A;  4OO5 A;  1K0N A;  4G19 A;  2IFQ B;  4NV5 A;  5IM9 A;  4XS4 A;  3HVX A;  4CY6 A;  3C73 A;  1DE2 A;  4YKF A;  2AHE A;  1GTA A;  2TRC P;  3KXO A;  5EY6 A;  1T8E B;  1VF4 A;  2DMM A;  2VAF A;  5FT3 A;  3TKR A;  4Z2T A;  4L8E A;  3GNJ A;  3IV4 A;  3PIN A;  1X9S B;  1WPI A;  1W89 A;  3M9K A;  1K0A A;  4BL7 A;  2I4A A;  1X5E A;  4BWS A;  2H6Z A;  5EL8 A;  2CX3 A;  5AIV A;  1K0O A;  2KHP A;  5HQP A;  2FWG A;  1OC9 A;  5AIX A;  3FR9 A;  5DVB A;  1TTZ A;  4PTS A;  1SD8 A;  3QPM A;  3FZ4 A;  1OE7 A;  3VUR A;  3MNG A;  1JZW A;  2HFD A;  4WBR D;  5COH A;  1XVW A;  1GSS A;  1FB0 A;  4WF4 A;  3DEX A;  4Z2R A;  4HS1 A;  1BYE A;  3ZTL A;  2PWJ A;  2LRT A;  3TB2 A;  3GRX A;  1K3O A;  4E8E A;  3S9F A;  3KMN A;  5DAK A;  4MA9 A;  5BRT A;  4EUY A;  5ID2 A;  2PMT A;  5F06 A;  2H72 A;  3EE2 A;  2VL3 A;  1JZR A;  1OVN A;  3H93 A;  2R4V A;  3NZN A;  1IYH A;  2JZR A;  2DIZ A;  1SYR A;  4RI7 A;  3E0U A;  5KN0 A;  2CT6 A;  1PL1 A;  6GSX A;  4ACS A;  5JWO B;  2O89 A;  2L6D A;  4YQM A;  1YKA A;  4TR4 A;  3CSJ A;  4YQV A;  1Z5Y E;  4J57 E;  5AN1 A;  3QFB C;  2WS2 A;  1BJX A;  5AGY A;  1PGT A;  2O8V B;  5IO0 A;  3GX0 A;  1F9M A;  2YZU A;  3D5J A;  4MF7 A;  5G1K A;  4ZB8 A;  4KB3 A;  4F03 A;  3QMX A;  4J56 E;  4GSS A;  1PKZ A;  3D22 A;  1M2B A;  1FVK A;  2LKU A;  2RUE A;  3APO A;  5IPH A;  1B48 A;  2DLX A;  5D9V A;  3GH9 A;  5HFG A;  3ME7 A;  3F8U A;  5F8B A;  3BBY A;  4EKZ A;  4EF0 A;  3UMA A;  4ZIL A;  2YPM A;  3N5O A;  3F6F A;  4O5U A;  5LCZ A;  5DCG A;  2V6K A;  2CQ9 A;  2GVP A;  2YV9 A;  3VWX A;  1A8L A;  3FMW A;  3N9J A;  1WIK A;  2NTO A;  1GUK A;  1DSB A;  4Q5R A;  3LWA A;  5JCG A;  2GGT A;  3C8E A;  1WRY A;  3GL5 A;  2PGT A;  1ML6 A;  3KZQ A;  1VRS D;  3PR8 A;  3GKN A;  4ICY A;  1JLW A;  1VF1 A;  1O81 A;  2MMA A;  2FWH A;  3W8J A;  4DEJ A;  3FEU A;  2O87 A;  3TRX A;  1EEJ A;  3GUS A;  4NMU A;  22GS A;  2G0F A;  1R7H A;  4OO4 A;  1SL1 B;  5ECI B;  3L9V A;  4PXO A;  2L5O A;  5G30 A;  1Y6E A;  4TR1 A;  2YZH A;  2R3X A;  3QAV A;  1KBN A;  4BVX B;  4Z2U A;  16GS A;  5AIS A;  3APS A;  1X5C A;  3IK9 A;  2VCQ A;  3EWL A;  2PUK C;  3GKK A;  4POL A;  4XRD A;  3TKP A;  3MWH A;  3EU3 A;  3ERW A;  1JHB A;  2L4C A;  2H0G A;  1YEX A;  1GUL A;  4F9Z A;  5ECS A;  2YJ7 A;  3WD6 A;  4L0U A;  2JZS A;  1YDK A;  1QK8 A;  5ECL B;  4LLR A;  4D73 A;  4ZL7 A;  4WR5 A;  5KOW A;  1PN9 A;  1R26 A;  1XOA A;  1X9M B;  1MEK A;  2L5L A;  1GTU A;  4ZL8 A;  3L0H A;  3UBL A;  1TI1 A;  1XW6 A;  5CRE A;  3D4T A;  3APQ A;  3M9J A;  3RDW A;  1TOF A;  1HNC A;  2H1B A;  2LUS A;  1BG5 A;  4EE0 A;  1QQ2 A;  5JCU A;  2J9H A;  4YQU A;  3HJP A;  2H6X A;  5CRH A;  1M9A A;  2BJX A;  3UAR A;  1A8Y A;  4EL1 A;  5IMD A;  3J7Y k;  2IME A;  4MF6 A;  3GSS A;  1TXX A;  3CSH A;  3EPT A;  4BVY A;  2QC7 A;  4AJ6 A;  4LL1 B;  5G1L A;  2HSY A;  1NM3 A;  5IMA A;  2HYX A;  2YP6 A;  3TRP A;  3KTL A;  4I6X A;  3UAP A;  3A3T A;  5HR2 A;  4NAX A;  5LD0 A;  2C0D A;  2HT9 A;  2CVK A;  3GN3 A;  2X49 A;  1B4P A;  4GCI A;  3IRA A;  2YV7 A;  4OMV A;  2L6C A;  2F8F A;  1T4Z A;  3J7Y b;  4WBJ A;  2OAD A;  1Z3E A;  4XCS A;  4KDU A;  1FVJ A;  3G7Y A;  1SKR B;  2HRN A;  1FW1 A;  2DC5 A;  3G7I A;  2C0F A;  5LNK e;  2GSQ A;  2H70 A;  14GS A;  3GMF A;  3QFA C;  4XHM A;  4A5P A;  2YWN A;  3G7J A;  1ERU A;  1USB A;  2VLU A;  1V98 A;  2H74 A;  6GSS A;  1OKD A;  3ZLP A;  1LU4 A;  3V1W A;  2HZE B;  5KN1 A;  3CBU A;  2WDU A;  1OC3 A;  2HLS A;  1AXD A;  2IMF A;  1O85 A;  4ZBD A;  3D4M A;  3F63 A;  1JLV A;  2FNO A;  2LEG A;  4HJ2 A;  1GH2 A;  3KH9 A;  3G9B A;  1U88 A;  1T4Y A;  2HE3 A;  1GWC A;  2OE1 A;  1LBK A;  3KP9 A;  2YJH A;  3ERG A;  2OAC A;  4V1A p;  5IMF A;  2OE0 A;  3DIE A;  1TRS A;  4OCF A;  4IN0 A;  3HKR A;  2A4V A;  2LJK A;  1Z7R A;  3UEM A;  3GL3 A;  1I5G A;  3EMX A;  3BCK A;  2X8G A;  2ON5 A;  2JL4 A;  5B8A A;  3QAG A;  1TI3 A;  2A2R A;  3ED3 A;  4PNG A;  1ERT A;  2LQQ A;  4PQH A;  2DKI A;  4ZB9 A;  2AYT A;  1TW9 A;  1SKW B;  2DML A;  3A5W A;  4GSN A;  1GSD A;  4I2U A;  1SU9 A;  3KM6 A;  1TDI A;  1XWB A;  3Q6O A;  1G7E A;  3NIV A;  3WT1 A;  4OCE A;  2LJR A;  3TUE A;  4TXO A;  1O8X A;  2NPB A;  4OFT A;  1J9B A;  1TRU A;  2LV3 A;  1J0F A;  1KTE A;  3LOR A;  2AUV A;  3HZ4 A;  4BPY A;  4N11 A;  5D9T A;  2A4H A;  3A5I A;  3C1R A;  1K0D A;  2JSY A;  4NWY A;  4GWR A;  1GUM A;  1EGO A;  3EC3 A;  3I69 A;  2VCX A;  5A4U A;  3DVX A;  2WCI A;  2QA2 A;  4HU9 A;  2B7J A;  5H5Q A;  1ABA A;  4HJM A;  3C1S A;  4HOJ A;  2H66 A;  4HZ2 A;  3GHA A;  1OC9 B;  1S3C A;  3EYT A;  2YCD A;  3LEF A;  5CYY A;  5DBQ A;  1GL8 A;  2E7P A;  2WUL A;  1AC1 A;  1YEP A;  4MJA A;  3ZIT A;  4Q5N A;  3WT2 A;  2MBT A;  3IC4 A;  2VL9 A;  3LGC A;  3BCI A;  3FKF A;  4LA1 A;  2CAQ A;  1SK2 A;  4TR0 A;  2H19 A;  1OYJ A;  2QGV A;  5ECH B;  2FLS A;  2HSM A;  1FAA A;  3CSI A;  3D6I A;  5A5K A;  2NDO A;  5ID2 B;  2IIY A;  3P7X A;  5IQY A;  1BAY A;  5JCW A;  4XTS A;  5E4W A;  1TU8 A;  2H71 A;  1U3A A;  2KUC A;  2OBK A;  3HY2 A;  5ABR A;  5GST A;  4HDE A;  1AQV A;  2ALB A;  3M8N A;  1A23 A;  2IMK A;  5L71 A;  5KEJ A;  3LYP A;  3HJO A;  2R6K A;  1NHY A;  3VFI A;  3TJG A;  4IQ1 A;  4K9Z A;  1XFL A;  3FK8 A;  3UJ1 A;  4N30 A;  4K7N A;  4DSS A;  1PL2 A;  1AQX A;  1J08 A;  4L0W A;  2FWF A;  2H0I A;  2H1G A;  4X0X A;  1AUC A;  1K3L A;  3IA1 A;  2X8C A;  1FOV A;  1FG4 A;  1PX7 A;  3GTU B;  3QD9 A;  1G6Y A;  3EUR A;  1ZMA A;  3Q74 A;  4AF2 A;  3LYK A;  2GS3 A;  5B8B A;  1M0U A;  2C3N A;  3KJY A;  1YF1 A;  3GKX A;  3WGX A;  3RHC A;  3FZ5 A;  3O6T A;  1THX A;  1TK0 B;  1V57 A;  3FR3 A;  2FD3 A;  2PBJ A;  4POB A;  4V2M A;  2DJ3 A;  2L57 A;  3IHQ A;  3A2X A;  1AQW A;  4NV2 A;  1EP8 A;  3BJ5 A;  4IBP A;  1URM A;  4F2I A;  3F6D A;  4PUF C;  2HRA A;  2MBS A;  4TR3 A;  3GST A;  4MZB A;  4YAP A;  2C0G A;  1R5A A;  2CAI A;  5HFI A;  3U6V A;  2V2G A;  2X4A A;  2DSA A;  5G2Z A;  4HUA A;  1EOH A;  2H1A A;  1XPV A;  3IXR A;  4MH2 A;  3LFL A;  1OC8 A;  3F3R A;  3TKS C;  2GZZ A;  2YNX A;  6GST A;  5IOW A;  5GAP D;  2VL2 C;  4PNF A;  2C3Q A;  4I2T A;  2LST A;  1GSE A;  1ZGN A;  3P8W A;  3MDK A;  2O85 A;  1B4Q A;  3TCO A;  3KCM A;  3FY7 A;  1QUW A;  1A0F A;  1TJD A;  2WB9 A;  1M99 A;  3HVS A;  2YN1 A;  4NHW A;  3VWU A;  3IK7 A;  4MNN A;  2E2G A;  4FH8 A;  2QA1 A;  3ZML A;  2GQL A;  2MZC A;  4X43 A;  7GSS A;  2V1M A;  3TJK A;  2H6Y A;  3H79 A;  3H8Q A;  3WYW A;  3IOS A;  4P3Y B;  2EIO A;  5ELG A;  2XBQ A;  3RAZ A;  2F9S A;  3IHG A;  2WGR A;  2LNT A;  1B9Y C;  4G0K A;  3FZA A;  4IW9 A;  3RPP A;  4GTU A;  1W4V A;  5D9W A;  4K1F A;  8GSS A;  3UBK A;  1UN2 A;  4POM A;  2CZ2 A;  2IMI A;  4K2D A;  2X8H A;  4H86 A;  2B7K A;  1X5D A;  1OAZ A;  2C80 A;  4IJI A;  1FHE A;  3UVH A;  1HNA A;  3E3E A;  1SYX A;  2HSH A;  4N0V A;  4PGT A;  2IMD A;  3KH7 A;  5HR1 A;  9GSS A;  2KP1 A;  4EC0 A;  3EU4 A;  4ECB A;  3CTG A;  2ZUP A;  3US3 A;  1A0R P;  2C8U A;  4EDZ A;  3HA9 A;  2K6V A;  5D93 A;  1TRV A;  4N10 A;  4V2N A;  1PRX A;  3HZ8 A;  4QL9 A;  3Q19 A;  4JRR A;  2DJJ A;  4BVY B;  4IVF A;  3KMO A;  5DJM A;  5G5F A;  4K2X A;  4KX4 A;  4JU5 A;  1MD3 A;  1XCC A;  1ZZY A;  4ISD A;  4MAB A;  3WGD A;  4ZB6 A;  3GX8 A;  2FUG 2;  5CRG A;  5IPG A;  4F0C A;  3ERF A;  1TU7 A;  4RQR A;  5ECK B;  3ZIJ A;  3AY8 A;  3IDV A;  2VCW A;  5ENU A;  2F3M A;  2FWE A;  5B7C A;  3M1G A;  5D73 A;  4PUA A;  4POK A;  3UOM A;  3ZFL A;  1G6W A;  3I9V 2;  4ZBB A;  1O8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...