4KSOA

Crystal structure of circadian clock protein kaib from s.elongatus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
ILKLYVAGNTPNSVRALKTLKNILEVEFQGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPLPVRRIIGDLSDREKVLIGLDLLYGELQDSDDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Circadian clock protein
molecule keywords Circadian clock protein KaiB
publication title CryoEM and Molecular Dynamics of the Circadian KaiB-KaiC Complex Indicates KaiB Monomers Interact with KaiC and Block ATP Binding Clefts.
pubmed doi rcsb
source organism Synechococcus elongatus
total genus 20
structure length 95
sequence length 95
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07689 KaiB KaiB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ksoA00
3I9V2 4OFMA 2YP6A 3TKQA 3Q74A 4HI7A 2QC7A 4XRDA 1PL2A 5IPGA 1S3CA 2JZRA 4XCSA 2CVKA 2A2SA 2WCIA 5CYYA 1GRXA 1S3AA 2X8HA 3WT2A 1K0DA 2ES7A 2YCDA 2RIIA 1K0BA 3H79A 4MF7A 2IMFA 1SK1A 1K0AA 4MMMA 4ECCA 2HZEA 3QMXA 1B48A 1Z6MA 1XIYA 5GAND 1PA3A 3WGXA 2MMOA 1SJIA 4OFNA 1C72A 1KTEA 3RDWA 2PBJA 5D9VA 5IQYA 1PX7A 3RHBA 1ERTA 1F3AA 1JZRA 1A23A 3ERGA 3QCPA 2I9HA 1SKWB 3D4TA 2CAIA 2DMMA 2H0GA 2C0EA 3HYPA 2H74A 2TRCP 3R2QA 1BEDA 3GYKA 2OJLA 3EE2A 2VL3A 3EINA 3H8QA 3KXOA 4ZB6A 4ZBDA 2LRNA 1V98A 1U87A 2K8SA 1Y25A 3IA1A 1WMJA 5B8BA 3ZRDA 4TOPA 3G7YA 1HQOA 3HZ8A 4KA0A 4HEA2 3TKPA 2IFQA 12GSA 3EMXA 2ALBA 3P90A 5D73A 1F3BA 4POKA 1VF3A 2ZNMA 3FYGA 4G9HA 2F8AA 2H0IA 1R7HA 4K0GA 4X1UA 2VD1A 2KLXA 4K7IA 2B5EA 5DAKA 3FEUA 2AV4A 3N5OA 5GSSA 5CRWA 2GQMA 4AF2A 4HQSA 3KTBA 2H6XA 3HD5A 1G7OA 5FHIA 2LQOA 2OE1A 2HSHA 1UA5A 5GAPD 2DMLA 4RI7A 2E2GA 5AIVA 2M72A 3IAM2 1GNEA 2L6CA 4N10A 2V6OA 2DLXA 3UVHA 2GZYA 2RM5A 2XPDA 3CSJA 1SL1B 1SD9A 2FD3A 3A2XA 3ZYWA 1K0MA 1UC7A 3F6FA 3HXSA 2H8LA 4KSMA 1A8YA 3FY7A 4MABA 3QFAC 4FYCA 3FZ5A 1O8XA 3NZNA 1XVQA 5G2ZA 1PGTA 2KOKA 3LORA 2HFDA 1TK8B 4L8EA 3D21A 4MPGA 4K2DA 5A5KA 4Q5QA 5ECHB 2MMZA 2H71A 4OWYA 3IBHA 1FW1A 3AY8A 2YV7A 2FLSA 5ELGA 4ZILA 4TR4A 5GSTA 1GL8A 2MMNA 2G2QA 2VCZA 1X5DA 3GMFA 4YAPA 2CV4A 3E0UA 3NOFA 3PH9A 3TB2A 2V2GA 3FR9A 2NPBA 4KDUA 6GSSA 5ID2A 3LEFA 4KX4A 2PPTA 3VI7A 2WGRA 3F3RA 1SL2B 4PX1A 5IMFA 3QAGA 4K1FA 1GTAA 3ZFLA 3VPQA 3C8EA 2LJAA 3EYTA 2P0GA 1V9WA 2QGVA 3GFKA 2WJUA 2WB9A 4MZWA 3IXRA 10GSA 3CMIA 4HQZA 4NWYA 4OFTA 3C71A 4DEJA 2IJYA 5HFIA 1USBA 1BYEA 1HNBA 4I6XA 3IOSA 3DVXA 4IELA 1O6JA 5B6MA 1ILOA 3EU4A 1NHOA 3M0FA 3K8NA 3EWLA 4GRFA 3EU3A 1TRUA 4DSRA 3L9VA 3D0ZA 5JWOB 2DJ2A 4KCEA 1XWAA 4WR4A 5IMZA 4AJ7A 1V57A 3TDGA 1X0RA 1ZOFA 3V1WA 2L4QA 4J57E 1HNAA 2LNTA 4G19A 1J0FA 2YZHA 5C00A 1GNWA 3QOUA 4JE1A 2OBIA 3ISOA 1WIKA 1T00A 1LBKA 3TKRA 1OC9A 2DSAA 1TOFA 1PRXA 3KH7A 4GCIA 3VURA 1GTUA 2K6VA 1SKRB 2A2RA 3EVIA 2VLVA 3MDKA 2JSZA 4OO5A 2DJ3A 4PGTA 2GSQA 4DVCA 2L59A 5CP1A 3GH6A 3BCIA 3HHVA 1TKDB 3LFLA 1VF1A 5KN3A 1DE1A 2FWHA 3HA9A 4L0WA 4MA9A 2VM1A 3F4SA 4IP1A 3QDNA 2O89A 4N0VA 3ERWA 1WWJA 4ZB8A 4ML1A 3D4MA 2O87A 2WULA 2LJKA 2IMEA 1VGLA 19GSA 2GQLA 4V2MA 3RPPA 1F6MC 2C3TA 1SK2A 1DSBA 2DJKA 1FVKA 1OE7A 4Z7XA 2R4VA 5HQPA 4XHMA 4HU7A 2GLRA 4NV5A 4ZBBA 5F06A 5LD0A 2XBQA 4HU9A 2C3QA 1GUMA 3A5WA 4XS4B 4EC0A 5ENUA 1LJRA 3G7IA 2JZTA 3IK7A 3TGZA 1ERUA 2ZCTA 3A3TA 4MF6A 3GTUB 3CXGA 3VFIA 1PQNA 2C0DA 5ECLB 3DD3A 5DJMA 1X9SB 1SU9A 3GX0A 3DYRA 4EL1A 4F03A 2X8CA 4NXIA 1BJXA 1BX9A 3HCZA 4GSNA 3TUEA 1O8WA 4TXOB 1M2BA 5HFKA 5IMAA 1G7EA 4IVFA 1NM3A 3L4NA 2YOIA 2CAQA 1T3BA 4ZXGA 4I5QA 2AJQB 2C0GA 2H75A 5HR0A 2J23A 4QQ7A 3JCML 2TIRA 1S3DA 1JZWA 1RK4A 2C80A 4N11A 2CX4A 3EC3A 4EKZA 2L5LA 2LRCA 1TU7A 1XWBA 2WZ9A 4L5OA 1AQXA 1IYHA 5ECIB 14GSA 2GDRA 1EGOA 2CQ9A 3O6TA 1GTIA 3HKRA 2GGTA 2PVQA 3C1SA 3KD0A 2DJJA 3TOTA 1EOHA 2LRTA 4IJ3A 3ZL5A 3DVWA 3BOAA 1T7PB 4POBA 4IBPA 4F0BA 2VCWA 5DAKB 1TRWA 1DBYA 3TOUA 3BCKA 1XWGA 5CAXA 2HZFA 1XOBA 1WJKA 1XPVA 4K9ZA 2AUVA 6GSYA 3W6GA 1EV4A 5IPHA 2XC2A 5HR1A 3UBLA 2L5OA 2JACA 3TJBA 4V1Ap 1SYRA 1W4VA 1ZCPA 3GKMA 3WD6A 4PQIA 2PGTA 1R26A 1WOUA 2JU5A 4F2IA 3APOA 5ECOB 1XXUA 3IE3A 5J9CA 1TI3A 3UAPA 2KUCA 4Q5FA 1BAYA 4ZB9A 5D93A 3VK9A 2FA8A 3J7Yk 2P5RA 16GSA 2BTOT 4HJMA 5LCZA 4OCFA 3LJRA 2XBIA 3KGKA 1MD4A 2IMIA 2O7KA 3RAZA 2HRNA 1M99A 2EC4A 4WBJA 3ZIJA 5G31A 2CT6A 2MBSA 5J5NA 2E0QA 5IIZA 5G1LA 1A2LA 2CX3A 3F3QA 3TJGA 2NTOA 1GULA 3ZFBA 1XWKA 5IM9A 4CHSA 1GUKA 1GSDA 2E7PA 1B4QA 4EF0A 2LJRA 2E2MA 3KMNA 2C0FA 2CZ2A 2GS3A 3GA4A 3IV4A 2LUSA 1UVZA 1X9MB 4XS6A 1GSQA 4EO3A 2N5FA 2IN3A 2JZSA 1XZOA 5KN0A 1Z3EA 1FB6A 5G30A 2EIRA 4BWSA 2H76A 2VCQA 4E8EA 3QR6A 1K3OA 4KUNA 1F37A 5ECMB 2IMDA 1RW1A 2H73A 4ILFA 5F0GA 1GP1A 1NSWA 2AHEA 5H5SA 1X5CA 1FOVA 4V2LA 3O3TA 1SL0B 1SJZA 4RQXA 1YY7A 4HZ2A 5GZZB 3NIVA 2PU9C 5D9XA 1SK0A 4DSSB 1PN9A 4MPFA 3KIJA 5DDLA 3ME8A 1OKTA 1BG5A 1AUCA 2GQKA 2EIQA 3KMOA 4WXTA 5DALB 4KAEA 4E8HA 2G0FA 1ML6A 2PUKC 1YEPA 2RUEA 5LNKe 3IR4A 4O92A 4ZL7A 3VWWA 2H01A 3U5RE 5CNWA 2HXKA 4TR1B 4WR5A 5F8BA 4D73A 4KH7A 2I81A 1SD8A 3KP9A 4YQMA 4LMVA 5HR2A 3APQA 4YAVA 1B9YC 1TI1A 4ML6A 3VWVA 5G5EA 4HDEA 4KGIA 2MZCA 1V2AA 5IO2A 4WF4A 4EVMA 4NPBA 4MF5A 4QL9A 1B9XC 1O85A 4EDYA 3CRTA 2C4JA 2FWEA 2V32A 4I2TA 1EP7A 3HJMA 5ECRB 4G10A 5EL8A 3W8JA 3FZ9A 5B6NA 3LYPA 2VLTA 2NVLA 3HJPA 4EUYA 4IQ1A 2FGXA 4ACSA 5EVOA 3TKSC 1R5AA 2D2ZA 3A2VA 3SWLA 2C3NA 4H86A 2PVOC 3H93A 4IHUA 4GLTA 4NMUA 5ECKB 2DIYA 4KW6A 3UBKA 1WP0A 2CVDA 1O7UA 1JZDA 1QXHA 3WYWA 2L4CA 4LL4B 1K0CA 5IMDA 4PXOA 3VPTA 2VD0A 4EXJA 2YWNA 2M80A 2I1UA 4I2UA 1J08A 4L5LA 4MK3A 3GH9A 2GZPA 1TJDA 5AIXA 1QQ2A 3PGTA 2R6KA 1ERVA 2VO4A 1MEKA 5JCWA 1GLPA 2N5BA 5DQSA 3TRXA 3GSTA 5B8AA 3CBUA 2VCXA 1SENA 3ZMKA 4GTUA 1A0FA 3KH9A 1GH2A 2N5AA 1Q4JA 2IPAA 5DCHA 2JADA 1PKWA 2YN1A 2WS2A 4WKWA 1U88A 2WDUA 4PNFA 1CQHA 1GSEA 4JZQA 1EV9A 3TCOA 2ON7A 4K6XA 2PMTA 5D9TA 1QK8A 1URMA 3FR6A 1WRYA 1THXA 5A4WA 4XRAA 1JZOA 17GSA 1H4OA 3D6IA 3FRCA 1GSYA 3C73A 2O85A 1EGRA 1XW9A 5D9WA 5KN1A 5H5RA 3GNJA 4TRXA 4KSOA 4TR0A 2M46A 1G0TA 3IPZA 1TP9A 3FZ4A 1AXDA 4JRRA 4J2FA 3LYKA 1F2EA 1X9WB 3HDCA 1Y6EA 3M3MA 4O5RA 2GSTA 2QKEA 4DSQA 5ECSA 2H70A 3RPNA 3QFBC 4MZBA 4LLRA 1KBNA 1NW2A 3P7XA 1PL1A 3DWVA 2OADA 4G2EA 1Z5YE 2YWIA 4GXZA 4HZ4A 2VUPA 5F05A 4HUAA 3S9FA 2AB6A 2B1LA 2H19A 1OE8A 3UEMA 1VF2A 4ZIJA 1OC3A 4Q5NA 3GKNA 4AGSA 1OAZA 3BBYA 3HVVA 4BL7A 2V41A 1ACVA 5CRHA 4O7HA 2V1MA 2RUFA 1THOA 1XCCA 1XWCA 4FYBA 2HI7A 4NAXA 1KEBA 1HYUA 2CVBA 3CSHA 3H4KA 2RM6A 4TN8A 5IO0A 4MCUA 4JBBA 3ZITA 1QUWA 1TK5B 3ED3A 1ZL9A 2MYGA 1WPIA 1QMVA 1TDIA 2YANA 7GSSA 5D96A 5J41A 4OD7A 3EURA 2OACA 2I4AA 4WF5A 4GWRA 5INYA 2CA8A 2P31A 4K8MA 3UMAA 5COHA 2HZEB 5JWQB 1IYIA 3MSZA 1YKCA 20GSA 4ZBAA 3CRUA 2HLSA 2H1DA 2X8GA 2LTKA 1JLVA 3IHQA 6GSXA 3ZMLA 3TKSA 1T4YA 2YPMA 5ECQB 18GSA 8GSSA 1R5PA 1XW6A 3M9KA 4MJCA 2VCVA 2K18A 4ECJA 2YWMA 1Z6NA 1Z7PA 4X43A 2OKAA 1XW5A 1KNGA 5HFGA 3ZLPA 1QGVA 3G7JA 4MP4A 2B6MA 1PSQA 2FWGA 3QAVA 1XBSA 1TTZA 4MDCA 5ELAA 3E9JB 2F3MA 1ZGNA 1DUGA 2F9SA 1M2DA 1MD3A 2OA7A 2X99A 3M8NA 2P5QA 1YF1A 3RHCA 2O8VB 1K0OA 2IFQB 3LXZA 3TJFA 3FHKA 5CRDA 4NHWA 3DXBA 2LKUA 2NDOA 5J9BA 1GSSA 5G5FA 1K3LA 2LNSA 2I3YA 3UVTA 1O73A 3F9UA 1B4PA 2H1AA 3GN3A 1GWCA 6GSUA 2PN8A 3TRPA 3ZZXA 2H1GA 1YKAA 3ZIVA 3BJ5A 2R5GA 3LGCA 4X0XA 5EY6A 4I8BA 3CTFA 3GURA 1HD2A 4LA1A 1N8JA 3QPMA 2MMAA 4GF0A 3LWAA 1JFUA 4FO5A 5A4UA 3P8WA 3ERFA 3TKSE 3J7Yb 4OMVA 2J9HA 1QFNA 4J56E 4CW9A 4FYUA 4AJ8A 1T8EB 1F9MA 5DQYA 2C8UA 3M9JA 4GQFA 2GSSA 4HOJA 1LU4A 1CQGA 2YJHA 3C1RA 3GUSA 3P2AA 3GHAA 1M7TA 3C7MA 1GTBA 1YEXA 5ABRA 4ISDA 3L0HA 1UN2A 4ID0A 3KEBA 4XS4A 4MJEA 3EMPA 3KP8A 2DBCA 2X64A 3F8UA 4XIHA 2YV9A 4GQCA 2H72A 1B8XA 1FB0A 3GTUA 4F9ZA 1K0NA 1OKDA 5IMCA 1SJ6A 4TR3A 2H66A 3I69A 5ID2B 2LV3A 1A8LA 3HVXA 6GSVA 1SKSB 4L0UA 1U3IA 3PINA 4OCEA 3KZQA 2XPEA 4CDOA 1A24A 2BMXA 4MH2A 4TXVA 3IRAA 4TXOA 1MDIA 2EIOA 3DMLA 4LMWA 5HR3A 3GSSA 2MBTA 3UIWA 1TXXA 5IOXA 3DKSA 1VRSD 3TJKA 3FW2A 2WRTA 3WGDA 3OR5A 4FIWA 4EE0A 1G6WA 4IGJA 3ZVJD 5IMVA 2JL4A 6GSWA 2A4VA 1FO5A 3Q6OA 1R4WA 1M9BA 3LSZA 4NHZA 4IJIA 3F63A 4BVXA 5KN2A 2IL3A 3QD9A 3GIXA 3O76A 3F4TA 4BPYA 2PERA 1NHYA 1GUHA 4IW9A 2FNOA 3GKXA 3E3EA 1VF4A 1JLWA 2K8VA 2B5XA 1OC9B 5D8IA 2LEGA 2FY6A 2R2JA 1A2JA 3CYNA 3PR8A 3KCMA 3FZAA 1A2MA 4QL7A 1EEJA 3MWHA 5DJLA 5JWRB 4EDZA 3BD2A 3Q18A 1T1VA 4FH8A 3RBTA 3W8SA 2B1KA 1N2AA 3N9JA 2HRFA 1W89A 3HY2A 4GSTA 2GT5A 1AQVA 2HNLA 5B7CA 5CO3A 4WETA 5J3RA 1M2AA 5C04A 1YQ1A 2HE3A 3QAWA 4XTSA 2VL2C 3GV1A 1EWXA 4IS0A 2B3SA 2LQQA 1M9AA 3TRQA 3F6DA 1ERWA 3ZREA 4ECIA 1AAZA 2VL9A 3GKKA 4PUFC 2DIZA 3US3A 3DRNA 1SYXA 1BQ7A 2VAFA 4ECBA 1AW9A 3ZVJA 2VM2A 4MZCA 1T4ZA 4K7NA 1FAAA 4BVYA 1OVNA 5DVBA 3ME7A 1Q98A 4BA7A 3DGQA 2IMKA 4TW5A 1MDKA 3F0IA 3M1GA 1YJ6A 1YZXA 3DIEA 3L78A 4IN0A 2YZUA 3GX8A 1EEMA 2NBSA 3DEXA 1TRVA 2WFCA 22GSA 2OBKA 4PURA 1XVWA 1EP8A 3D22A 1Z7RA 2F8FA 3CTGA 4TKYA 3U6VA 2REMA 4RQRA 4IKHA 1U6TA 3TJJA 2L57A 1X5EA 3I6AA 1PMTA 4V2NA 5L71A 2AYTA 3I43A 5AGYA 4HJ2A 4JR4A 3UJ1A 1E2YA 2DJ0A 4KDXA 3FR3A 2HT9A 2ZUPA 2R3XA 2DC5A 1YF0A 1FG4A 2VOCA 4HS1A 2AAWA 4I97A 4PUAA 2VIMA 5CRGA 1G6YA 1ABAA 4DSSA 3HVSA 3VI5A 3VLNA 4NV2A 5KEJA 4JU5A 5DALA 3IC4A 1ST9A 3MNGA 5JCGA 2FCHA 4N30A 1JHBA 4RUVA 1XFLA 4KE3A 1FVJA 3Q19A 4O32A 2LS5A 1AQWA 2H0HA 1AIUA 3GL3A 1M0UA 3L9UA 4TR1A 4PQHA 11GSA 1GLQA 1RQMA 3UL3A 1TK0B 4IP6A 4MLYA 3KM6A 5FWGA 5E4WA 1ZZYA 3SBCA 5ECNB 5F07A 2B7KA 4KNDA 1WE0A 2GSRA 2BJXA 1OC8A 4RI6A 2YJ7A 4K7OA 4JEDA 3APSA 4ULXA 2K9FA 4TVEA 3D5JA 5AISA 2LSTA 4XS1A 4PNGA 4K0NA 3A2WA 1V58A 2B7JA 4IQAA 2TRXA 2YWOA 3F4RA 4F0CA 3UARA 1I5GA 3GRXA 3L9SA 2VL2A 3FKFA 3FK8A 2ON5A 2OE3A 5AN1A 2HYXA 5IOWA 2OE0A 2FA4A 3GL5A 4YH2A 4ZL9A 1MDJA 4V1Ag 3KJYA 2KP2A 2CZ3A 1U3AA 2VLUA 2GTUA 4WEYA 1PKZA 4ZL8A 4BWQA 1A0RP 2H30A 2IWTA 2FUG2 1J9BA 5E59A 4POMA 2L6DA 3WT1A 2YNXA 3IAS2 1O81A 2GT6A 1AC1A 4MJAA 2HSYA 2RLIA 2GVPA 2VCTA 1MTCA 1DE2A 4JR6A 3IDVA 2IIYA 3WGEA 2C1YA 3LQ7A 5A4VA 3MAKA 5G1KA 1TW9A 1ZMAA 5FT3A 5EPFA 1PD21 3H1NA 1GSUA 2KP1A 5DBQA 2DJ1A 4POLA 6GSTA 2H1BA 4Q5RA 1H75A 4YQVA 4OO4A 4N0ZA 1XOAA 4KCAA 5J4UA 4P3YB 3HZ4A 4YQUA 5H5QA 4PQ1A 4MJBA 1V40A 9GSSA 1OYJA 2H6ZA 3VWXA 5JCUA 2JSYA 2FWFA 1GSFA 3CSIA 2B5YA 2KHPA 2QSIA 4AJ6A 1ZYEA 3VWUA 1PX6A 3UOMA 2GZZA 1HNCA 1E6BA 4KDYA 4KB3A 2XHFA 3IK9A 2H6YA 1ON4A 1FHEA 2V6KA 4WBRD 2FHEA 4LL1B 3ZTLA 5ECPB 5DCGA 2R37A 1TRSA 1EZKA 4F82A 1K3YA 1YDKA 4GSSA 3HJOA 3G9BA 1EOGA 4D73B 2F51A 3LXTA 1Z9HA 2Z9SA 5CREA 4MH3A 2PWJA 3KTLA 3LG6A 1TU8A 1ZYQB 1I9DA 13GSA
chains in the Genus database with same CATH superfamily
3I9V2 4OFMA 2YP6A 3TKQA 3Q74A 4HI7A 2QC7A 4XRDA 1PL2A 5IPGA 1S3CA 2JZRA 4XCSA 2CVKA 2A2SA 2WCIA 5CYYA 1GRXA 1S3AA 2X8HA 3WT2A 1K0DA 2ES7A 2YCDA 2RIIA 1K0BA 3H79A 4MF7A 2IMFA 1SK1A 1K0AA 4K2XA 4MMMA 4ECCA 2HZEA 3QMXA 1B48A 1Z6MA 1XIYA 5GAND 1PA3A 3WGXA 2MMOA 1SJIA 4OFNA 1C72A 1KTEA 3RDWA 2PBJA 5D9VA 5IQYA 1PX7A 3RHBA 1ERTA 1F3AA 1JZRA 1A23A 3ERGA 3QCPA 2I9HA 1SKWB 3D4TA 2CAIA 2DMMA 2H0GA 2C0EA 3HYPA 2H74A 1PN0A 2TRCP 3R2QA 1BEDA 3GYKA 2OJLA 3EE2A 2HSMA 2VL3A 3EINA 3H8QA 3KXOA 4ZB6A 4ZBDA 2LRNA 1V98A 1U87A 2K8SA 1Y25A 3IA1A 1WMJA 5B8BA 3ZRDA 4TOPA 3G7YA 1HQOA 3HZ8A 4YKGA 5KOWA 4KA0A 4HEA2 3TKPA 2IFQA 12GSA 3EMXA 2ALBA 3P90A 2UZ8A 5D73A 1F3BA 4POKA 1VF3A 2ZNMA 3FYGA 4G9HA 2F8AA 2H0IA 1R7HA 4K0GA 4X1UA 2VD1A 2KLXA 4K7IA 2B5EA 4HSCX 5DAKA 3FEUA 2AV4A 3N5OA 5GSSA 5CRWA 2GQMA 4AF2A 4HQSA 3KTBA 2H6XA 3HD5A 1G7OA 5FHIA 2LQOA 2OE1A 2HSHA 1UA5A 5GAPD 2DMLA 4RI7A 2E2GA 5AIVA 2M72A 3IAM2 1GNEA 2L6CA 4N10A 2V6OA 2DLXA 3UVHA 2GZYA 2RM5A 2XPDA 3CSJA 1SL1B 1SD9A 2FD3A 3A2XA 3ZYWA 1K0MA 1UC7A 3F6FA 3HXSA 2H8LA 4KSMA 1A8YA 3FY7A 4MABA 3QFAC 4FYCA 3FZ5A 1O8XA 3NZNA 1XVQA 5G2ZA 1PGTA 2KOKA 3LORA 2HFDA 1TK8B 4BL7B 4L8EA 3D21A 4MPGA 4K2DA 5A5KA 4Q5QA 5ECHB 2MMZA 2H71A 4OWYA 3IBHA 1FW1A 3AY8A 2YV7A 2FLSA 3IHGA 2X49A 5ELGA 4ZILA 4TR4A 5GSTA 1GL8A 2MMNA 2G2QA 2VCZA 1X5DA 3GMFA 4YAPA 2CV4A 3E0UA 3NOFA 3PH9A 3TB2A 2V2GA 3FR9A 2NPBA 4KDUA 6GSSA 5ID2A 3LEFA 4KX4A 2PPTA 3VI7A 2WGRA 3F3RA 4Z2RA 1SL2B 4PX1A 5IMFA 3QAGA 4K1FA 1GTAA 4ICYA 3ZFLA 3VPQA 3C8EA 2LJAA 3EYTA 2P0GA 1V9WA 2QGVA 3GFKA 2WJUA 2WB9A 4MZWA 3IXRA 10GSA 3CMIA 4HQZA 4NWYA 4OFTA 3C71A 4DEJA 2IJYA 5HFIA 4K5SA 1USBA 1BYEA 1HNBA 4I6XA 3IOSA 3DVXA 4IELA 1O6JA 5B6MA 1ILOA 3EU4A 1NHOA 3M0FA 3K8NA 3EWLA 4GRFA 3EU3A 1TRUA 4DSRA 3L9VA 3D0ZA 5JWOB 2DJ2A 4KCEA 1XWAA 4WR4A 5IMZA 4AJ7A 1V57A 3TDGA 1X0RA 1ZOFA 2DKHA 3V1WA 2L4QA 4J57E 1HNAA 2LNTA 3LW9A 4G19A 1J0FA 2YZHA 5C00A 1GNWA 3QOUA 4JE1A 2OBIA 3ISOA 1WIKA 1T00A 1LBKA 3TKRA 1OC9A 2DSAA 1TOFA 1PRXA 3KH7A 4GCIA 3VURA 1GTUA 2K6VA 1SKRB 2A2RA 3EVIA 2VLVA 3MDKA 2JSZA 4OO5A 2DJ3A 4PGTA 2GSQA 4DVCA 2L59A 5CP1A 3GH6A 3BCIA 3IC8A 3HHVA 1TKDB 3LFLA 1VF1A 5KN3A 1DE1A 2FWHA 3HA9A 4Z2TA 4L0WA 4MA9A 2VM1A 2QA2A 3F4SA 4IP1A 3QDNA 2O89A 4N0VA 5KOXA 3ERWA 1WWJA 4ZB8A 4ML1A 3D4MA 2O87A 2WULA 2LJKA 2IMEA 1VGLA 19GSA 2GQLA 4V2MA 3RPPA 1F6MC 2C3TA 1SK2A 1DSBA 2DJKA 1FVKA 1OE7A 4Z7XA 2R4VA 5HQPA 4XHMA 4HU7A 2GLRA 4NV5A 4ZBBA 5F06A 5LD0A 2XBQA 4HU9A 2C3QA 1GUMA 3A5WA 4XS4B 4EC0A 1LJRA 5ENUA 3G7IA 2JZTA 3IK7A 3TGZA 1ERUA 2ZCTA 3A3TA 4MF6A 3GTUB 3CXGA 3VFIA 1PQNA 2C0DA 5ECLB 3DD3A 5DJMA 1X9SB 1SU9A 3GX0A 3DYRA 4EL1A 4F03A 2X8CA 4NXIA 4PTSA 1BJXA 1BX9A 3HCZA 4GSNA 3TUEA 1O8WA 4TXOB 1M2BA 5HFKA 5IMAA 1G7EA 4IVFA 1NM3A 3L4NA 2YOIA 2CAQA 1T3BA 4ZXGA 4I5QA 2AJQB 2C0GA 2H75A 5HR0A 2J23A 4QQ7A 3JCML 2TIRA 1S3DA 1JZWA 1RK4A 2C80A 4N11A 2CX4A 3EC3A 4EKZA 2L5LA 2LRCA 1TU7A 1XWBA 2WZ9A 4L5OA 1AQXA 1IYHA 5ECIB 14GSA 2GDRA 1EGOA 2CQ9A 4BVXB 3O6TA 1GTIA 3HKRA 2GGTA 4O5QA 2PVQA 3C1SA 3KD0A 2DJJA 2HRAA 3TOTA 1EOHA 2LRTA 4IJ3A 3ZL5A 3DVWA 3BOAA 1T7PB 4POBA 4IBPA 4F0BA 2VCWA 5DAKB 1TRWA 1DBYA 3TOUA 3BCKA 1XWGA 5CAXA 2HZFA 1XOBA 1WJKA 1XPVA 4K9ZA 2AUVA 6GSYA 3W6GA 1EV4A 5IPHA 2XC2A 5HR1A 3UBLA 2L5OA 2JACA 3TJBA 4V1Ap 1SYRA 1W4VA 1ZCPA 3GKMA 3WD6A 4PQIA 2PGTA 1R26A 1WOUA 2JU5A 4F2IA 3APOA 5ECOB 1XXUA 3IE3A 5J9CA 1TI3A 3UAPA 2KUCA 4Q5FA 1BAYA 4ZB9A 5D93A 3VK9A 2FA8A 3J7Yk 2P5RA 16GSA 2BTOT 4HJMA 5LCZA 4OCFA 3LJRA 2XBIA 3KGKA 1MD4A 2X4AA 2IMIA 2O7KA 3RAZA 4EIPA 2HRNA 1M99A 2EC4A 4WBJA 3ZIJA 4BVYB 5G31A 2CT6A 2MBSA 5J5NA 2E0QA 5IIZA 5G1LA 1A2LA 2CX3A 3F3QA 3TJGA 2NTOA 1GULA 3ZFBA 1XWKA 5IM9A 4CHSA 1GUKA 1GSDA 2E7PA 1B4QA 4EF0A 2R0PA 2LJRA 2E2MA 3KMNA 2C0FA 2CZ2A 2GS3A 4USSA 3GA4A 3IV4A 2LUSA 1UVZA 1X9MB 4XS6A 1GSQA 4EO3A 2N5FA 2IN3A 2JZSA 1XZOA 5KN0A 1Z3EA 1FB6A 5G30A 2EIRA 4BWSA 2A2PA 2H76A 2VCQA 3FMWA 4E8EA 3QR6A 1K3OA 4KUNA 1F37A 5ECMB 2IMDA 1RW1A 2H73A 4ILFA 5F0GA 1GP1A 1NSWA 2AHEA 5H5SA 1X5CA 1FOVA 4V2LA 3O3TA 1SL0B 1SJZA 4RQXA 1YY7A 4HZ2A 5GZZB 3NIVA 2PU9C 5D9XA 1SK0A 4DSSB 1PN9A 4MPFA 3KIJA 5DDLA 2R0GA 3ME8A 1OKTA 1BG5A 1AUCA 2GQKA 2EIQA 3KMOA 4WXTA 5DALB 4G0LA 4KAEA 4E8HA 2G0FA 1ML6A 2PUKC 1YEPA 2R0CA 2RUEA 5LNKe 3IR4A 4O92A 4ZL7A 3VWWA 2H01A 3U5RE 5CNWA 2HXKA 4TR1B 4WR5A 5F8BA 4D73A 4KH7A 3HVNA 2I81A 1SD8A 3KP9A 4YQMA 4LMVA 5HR2A 3APQA 4YAVA 1B9YC 1TI1A 4ML6A 3VWVA 5G5EA 4HDEA 4KGIA 2MZCA 1V2AA 5IO2A 4WF4A 4EVMA 4NPBA 4MF5A 4QL9A 1B9XC 1O85A 4EDYA 1PFOA 2C4JA 3CRTA 2FWEA 2V32A 4I2TA 1EP7A 3HJMA 5ECRB 4G10A 5EL8A 3W8JA 3FZ9A 5B6NA 3LYPA 2VLTA 2NVLA 3HJPA 4EUYA 4IQ1A 2FGXA 4ACSA 5EVOA 3TKSC 1R5AA 2D2ZA 3A2VA 3SWLA 2C3NA 4H86A 2PVOC 3H93A 4IHUA 4GLTA 4NMUA 5ECKB 2DIYA 4KW6A 3UBKA 1WP0A 2CVDA 1O7UA 1JZDA 1QXHA 3WYWA 2L4CA 4LL4B 1K0CA 5IMDA 4PXOA 3VPTA 2VD0A 4EXJA 2YWNA 2M80A 2I1UA 4I2UA 1J08A 4L5LA 4MK3A 3GH9A 2GZPA 1TJDA 5AIXA 1QQ2A 3PGTA 2R6KA 3A5IA 1ERVA 2VO4A 1MEKA 5JCWA 1GLPA 2N5BA 5DQSA 3TRXA 3GSTA 5B8AA 3CBUA 2VCXA 1SENA 3ZMKA 4GTUA 1A0FA 3KH9A 1GH2A 2N5AA 1Q4JA 2IPAA 5DCHA 2JADA 1PKWA 2YN1A 2WS2A 4WKWA 1U88A 2WDUA 4PNFA 1CQHA 1GSEA 4JZQA 1EV9A 3TCOA 2ON7A 4K6XA 2PMTA 4K5RA 5D9TA 1QK8A 1URMA 3FR6A 1WRYA 1THXA 5A4WA 4XRAA 1JZOA 17GSA 1H4OA 3D6IA 3FRCA 1GSYA 3C73A 2O85A 1EGRA 1XW9A 5D9WA 5KN1A 5H5RA 3GNJA 4TRXA 4KSOA 4TR0A 2M46A 1G0TA 3IPZA 1TP9A 3FZ4A 1S3RA 3PPUA 1AXDA 4JRRA 4J2FA 3LYKA 1F2EA 1X9WB 3HDCA 1Y6EA 3M3MA 4O5RA 2GSTA 2QKEA 4DSQA 5ECSA 2H70A 3RPNA 3QFBC 4MZBA 4LLRA 1KBNA 1NW2A 3P7XA 1PL1A 3DWVA 2OADA 4G2EA 1Z5YE 2YWIA 4G0IA 4HZ4A 4GXZA 2VUPA 5F05A 4CY8A 4HUAA 3S9FA 2AB6A 2B1LA 2H19A 1OE8A 3UEMA 1VF2A 4ZIJA 1OC3A 4Q5NA 3GKNA 4AGSA 1OAZA 3BBYA 3HVVA 4BL7A 2V41A 1ACVA 5CRHA 4O7HA 2V1MA 2RUFA 1THOA 1XCCA 1XWCA 4FYBA 4Z2UA 2HI7A 4NAXA 1KEBA 1HYUA 2CVBA 3CSHA 3H4KA 2RM6A 4TN8A 5IO0A 4MCUA 4JBBA 3ZITA 1QUWA 1TK5B 3ED3A 1ZL9A 2MYGA 1WPIA 1QMVA 1TDIA 2YANA 7GSSA 5D96A 5J41A 4OD7A 3EURA 2OACA 2I4AA 4WF5A 4GWRA 5INYA 2CA8A 2P31A 4K8MA 3UMAA 5COHA 2HZEB 5JWQB 1IYIA 3MSZA 1YKCA 20GSA 4ZBAA 3CRUA 2HLSA 2H1DA 2X8GA 2LTKA 1JLVA 3IHQA 6GSXA 3ZMLA 3TKSA 1T4YA 2YPMA 5ECQB 18GSA 8GSSA 1R5PA 1XW6A 3M9KA 4MJCA 2DKIA 2VCVA 2K18A 4ECJA 2YWMA 1Z6NA 1Z7PA 4X43A 2OKAA 1XW5A 1KNGA 5HFGA 3ZLPA 1QGVA 3G7JA 4MP4A 2B6MA 1PSQA 2FWGA 3QAVA 1XBSA 1TTZA 4MDCA 5ELAA 3E9JB 3EPTA 2F3MA 1ZGNA 1DUGA 2F9SA 1M2DA 1MD3A 2OA7A 2X99A 3M8NA 2P5QA 1YF1A 3RHCA 2O8VB 1K0OA 2IFQB 3LXZA 3TJFA 3FHKA 5CRDA 4NHWA 3DXBA 2LKUA 2NDOA 5J9BA 1GSSA 5G5FA 1K3LA 2A4HA 2LNSA 2I3YA 3UVTA 1O73A 3F9UA 1B4PA 2H1AA 3GN3A 1GWCA 6GSUA 2PN8A 3TRPA 4MNNA 3ZZXA 2H1GA 1YKAA 3ZIVA 3BJ5A 2R5GA 3LGCA 4X0XA 5EY6A 4I8BA 3CTFA 3GURA 1HD2A 4LA1A 1N8JA 3QPMA 2MMAA 4GF0A 3LWAA 1JFUA 4FO5A 5A4UA 3P8WA 3ERFA 3TKSE 2QA1A 3J7Yb 4OMVA 2J9HA 1QFNA 4J56E 4CW9A 4FYUA 4AJ8A 1T8EB 1F9MA 5DQYA 2C8UA 3M9JA 4GQFA 2GSSA 4HOJA 1LU4A 1CQGA 2YJHA 3C1RA 3GUSA 3P2AA 3GHAA 1M7TA 3C7MA 1GTBA 1YEXA 5ABRA 4ISDA 1M3IA 3L0HA 1UN2A 4ID0A 3KEBA 4XS4A 4MJEA 3EMPA 3KP8A 2DBCA 2X64A 3F8UA 3R3EA 4XIHA 1M3JA 2YV9A 4GQCA 2H72A 1B8XA 1FB0A 3GTUA 4F9ZA 1K0NA 1OKDA 5IMCA 1SJ6A 4TR3A 2H66A 3I69A 5ID2B 2LV3A 1A8LA 3HVXA 6GSVA 1SKSB 4L0UA 1U3IA 3PINA 4OCEA 3KZQA 2XPEA 4CDOA 1A24A 2BMXA 4MH2A 4TXVA 3IRAA 4TXOA 1MDIA 2EIOA 3DMLA 4LMWA 5HR3A 3GSSA 2MBTA 3UIWA 1TXXA 5IOXA 3DKSA 1VRSD 3TJKA 3FW2A 4EIQA 2WRTA 3WGDA 3OR5A 4FIWA 4EE0A 1G6WA 4IGJA 3ZVJD 5IMVA 2JL4A 6GSWA 2A4VA 1FO5A 3Q6OA 1R4WA 1M9BA 3LSZA 4NHZA 4IJIA 3F63A 4BVXA 5KN2A 2IL3A 3QD9A 3GIXA 3O76A 3F4TA 4BPYA 2PERA 1NHYA 1GUHA 4IW9A 2FNOA 3GKXA 3E3EA 1VF4A 1JLWA 2K8VA 2B5XA 1OC9B 5D8IA 2LEGA 2FY6A 2R2JA 1A2JA 3CYNA 3PR8A 3KCMA 3FZAA 1A2MA 4QL7A 1XG8A 1EEJA 3MWHA 5DJLA 5JWRB 4EDZA 5BRTA 3BD2A 3Q18A 1T1VA 4FH8A 3RBTA 3W8SA 2B1KA 1N2AA 3N9JA 2HRFA 1W89A 3HY2A 4GSTA 2GT5A 1AQVA 2HNLA 5B7CA 5CO3A 4WETA 5J3RA 1M2AA 5C04A 1YQ1A 2HE3A 3QAWA 4XTSA 2VL2C 3GV1A 1EWXA 4IS0A 2B3SA 2LQQA 1M9AA 3TRQA 3F6DA 1ERWA 3ZREA 4ECIA 1AAZA 2VL9A 3GKKA 4PUFC 2DIZA 1FOHA 3US3A 3DRNA 1SYXA 1BQ7A 2VAFA 4ECBA 1AW9A 1ZYNA 3ZVJA 2VM2A 4MZCA 1T4ZA 4K7NA 1FAAA 4BVYA 1OVNA 5DVBA 4G0KA 3ME7A 1Q98A 4BA7A 3DGQA 2IMKA 4TW5A 1MDKA 3F0IA 3M1GA 1YJ6A 1YZXA 3DIEA 3L78A 4IN0A 2YZUA 3GX8A 1EEMA 2NBSA 3DEXA 1TRVA 2WFCA 22GSA 2OBKA 4PURA 1XVWA 1EP8A 4BIKA 3D22A 1Z7RA 2F8FA 3CTGA 1ZYPA 3MYDA 4TKYA 3U6VA 2REMA 4RQRA 4IKHA 1U6TA 3TJJA 2L57A 1X5EA 3I6AA 1PMTA 4V2NA 5L71A 2AYTA 3I43A 5AGYA 4HJ2A 4JR4A 3UJ1A 1E2YA 2DJ0A 4KDXA 3FR3A 2HT9A 2ZUPA 2R3XA 2DC5A 1YF0A 1FG4A 2VOCA 4HS1A 2AAWA 4I97A 4PUAA 2VIMA 5CRGA 1G6YA 1ABAA 4DSSA 3HVSA 3VI5A 3VLNA 4NV2A 5KEJA 4JU5A 4CY6A 5DALA 3IC4A 1ST9A 3MNGA 4FQUA 5JCGA 2FCHA 4N30A 1JHBA 4RUVA 1XFLA 4KE3A 1FVJA 3Q19A 4O32A 2LS5A 4KF9A 1AQWA 2H0HA 1AIUA 3GL3A 1M0UA 3L9UA 4TR1A 4PQHA 11GSA 1GLQA 1RQMA 3UL3A 1TK0B 4IP6A 3CQFA 4MLYA 3KM6A 5FWGA 5E4WA 1ZZYA 3SBCA 5ECNB 5F07A 2B7KA 4KNDA 1WE0A 2GSRA 2BJXA 1OC8A 4RI6A 2HRKA 2YJ7A 4K7OA 4JEDA 3APSA 4ULXA 2K9FA 4TVEA 3D5JA 5AISA 2LSTA 4XS1A 5BMUA 4PNGA 4K0NA 3A2WA 1V58A 2B7JA 4IQAA 2TRXA 2YWOA 3F4RA 4F0CA 3UARA 1I5GA 3GRXA 3L9SA 2VL2A 3FKFA 3FK8A 2ON5A 2OE3A 5AN1A 2HYXA 5IOWA 2OE0A 2FA4A 3GL5A 4YH2A 4ZL9A 1MDJA 3MIXA 4V1Ag 3KJYA 2KP2A 2CZ3A 1U3AA 2VLUA 2GTUA 4WEYA 1PKZA 4ZL8A 4BWQA 1A0RP 2H30A 2IWTA 2FUG2 1J9BA 5E59A 4POMA 4X4JA 2L6DA 3WT1A 2YNXA 3IAS2 1O81A 2GT6A 1AC1A 4MJAA 2HSYA 2RLIA 2GVPA 4A5PA 2VCTA 1MTCA 1DE2A 4O5UA 4JR6A 3IDVA 2IIYA 3WGEA 2C1YA 3LQ7A 5A4VA 3MAKA 5G1KA 1TW9A 1ZMAA 5FT3A 5EPFA 1PD21 3H1NA 1GSUA 2KP1A 5DBQA 2DJ1A 4POLA 6GSTA 2H1BA 4Q5RA 1H75A 4YQVA 4OO4A 4N0ZA 1XOAA 4KCAA 5J4UA 4P3YB 3HZ4A 4YQUA 5H5QA 4PQ1A 4MJBA 1V40A 9GSSA 1OYJA 2H6ZA 3VWXA 5JCUA 2JSYA 2FWFA 1GSFA 3CSIA 2B5YA 2KHPA 2QSIA 4AJ6A 1ZYEA 3VWUA 1PX6A 3UOMA 2GZZA 1HNCA 1E6BA 4KDYA 4KB3A 2XHFA 3IK9A 2H6YA 1ON4A 1FHEA 2V6KA 4WBRD 2FHEA 4LL1B 3ZTLA 5ECPB 5DCGA 2R37A 4YKFA 1TRSA 1EZKA 4F82A 1K3YA 1YDKA 4GSSA 3HJOA 3G9BA 1EOGA 4D73B 2F51A 3LXTA 1Z9HA 2Z9SA 5CREA 4MH3A 2PWJA 3KTLA 3LG6A 1TU8A 1ZYQB 1I9DA 13GSA
chains in the Genus database with same CATH topology
3I9V2 4OFMA 2YP6A 3TKQA 3Q74A 4HI7A 2QC7A 4XRDA 1PL2A 5IPGA 1S3CA 2JZRA 4XCSA 2CVKA 2A2SA 2WCIA 5CYYA 1GRXA 1S3AA 2X8HA 3WT2A 1K0DA 2ES7A 2YCDA 2RIIA 1K0BA 3H79A 4MF7A 2IMFA 1SK1A 1K0AA 4K2XA 4MMMA 4ECCA 2HZEA 3QMXA 1B48A 1Z6MA 1XIYA 5GAND 1PA3A 3WGXA 2MMOA 1SJIA 4OFNA 1C72A 1KTEA 3RDWA 2PBJA 5D9VA 5IQYA 1PX7A 3RHBA 1ERTA 1F3AA 1JZRA 1A23A 3ERGA 3QCPA 2I9HA 1SKWB 3D4TA 2CAIA 2DMMA 2H0GA 2C0EA 3HYPA 2H74A 1PN0A 2TRCP 3R2QA 1BEDA 3GYKA 2OJLA 3EE2A 2HSMA 2VL3A 3EINA 3H8QA 3KXOA 4ZB6A 4ZBDA 2LRNA 1V98A 1U87A 2K8SA 1Y25A 3IA1A 1WMJA 5B8BA 3ZRDA 4TOPA 3G7YA 1HQOA 3HZ8A 4YKGA 5KOWA 4KA0A 4HEA2 3TKPA 2IFQA 12GSA 3EMXA 2ALBA 3P90A 2UZ8A 5D73A 1F3BA 4POKA 1VF3A 2ZNMA 3FYGA 4G9HA 2F8AA 2H0IA 1R7HA 4K0GA 4X1UA 2VD1A 2KLXA 4K7IA 2B5EA 5DAKA 3FEUA 2AV4A 3N5OA 5GSSA 5CRWA 2GQMA 4AF2A 4HQSA 3KTBA 2H6XA 3HD5A 1G7OA 5FHIA 2LQOA 2OE1A 2HSHA 1UA5A 5GAPD 2DMLA 4RI7A 2E2GA 5AIVA 2M72A 3IAM2 1GNEA 2L6CA 4N10A 2V6OA 2DLXA 3UVHA 2GZYA 2RM5A 2XPDA 3CSJA 1SL1B 1SD9A 2FD3A 3A2XA 3ZYWA 1K0MA 1UC7A 3F6FA 3HXSA 2H8LA 4KSMA 1A8YA 3FY7A 4MABA 3QFAC 4FYCA 3FZ5A 1O8XA 3NZNA 1XVQA 5G2ZA 1PGTA 2KOKA 3LORA 2HFDA 1TK8B 4BL7B 4L8EA 3D21A 4MPGA 4K2DA 5A5KA 4Q5QA 5ECHB 2MMZA 2H71A 4OWYA 3IBHA 1FW1A 3AY8A 2YV7A 2FLSA 3IHGA 2X49A 5ELGA 4ZILA 4TR4A 5GSTA 1GL8A 2MMNA 2G2QA 2VCZA 1X5DA 3GMFA 4YAPA 2CV4A 3E0UA 3NOFA 3PH9A 3TB2A 2V2GA 3FR9A 2NPBA 4KDUA 6GSSA 5ID2A 3LEFA 4KX4A 2PPTA 3VI7A 2WGRA 3F3RA 4Z2RA 1SL2B 4PX1A 5IMFA 3QAGA 4K1FA 1GTAA 4ICYA 3ZFLA 3VPQA 3C8EA 2LJAA 3EYTA 2P0GA 1V9WA 2QGVA 3GFKA 2WJUA 2WB9A 4MZWA 3IXRA 10GSA 3CMIA 4HQZA 4NWYA 4OFTA 3C71A 4DEJA 2IJYA 5HFIA 4K5SA 1USBA 1BYEA 1HNBA 4I6XA 3IOSA 3DVXA 4IELA 1O6JA 5B6MA 1ILOA 3EU4A 1NHOA 3M0FA 3K8NA 3EWLA 4GRFA 3EU3A 1TRUA 4DSRA 3L9VA 3D0ZA 5JWOB 2DJ2A 4KCEA 1XWAA 4WR4A 5IMZA 4AJ7A 1V57A 3TDGA 1X0RA 1ZOFA 2DKHA 3V1WA 2L4QA 4J57E 1HNAA 2LNTA 3LW9A 4G19A 1J0FA 2YZHA 5C00A 1GNWA 3QOUA 4JE1A 2OBIA 3ISOA 1WIKA 1T00A 1LBKA 3TKRA 1OC9A 2DSAA 1TOFA 1PRXA 3KH7A 4GCIA 3VURA 1GTUA 2K6VA 1SKRB 2A2RA 3EVIA 2VLVA 3MDKA 2JSZA 4OO5A 2DJ3A 4PGTA 2GSQA 4DVCA 2L59A 5CP1A 3GH6A 3BCIA 3IC8A 3HHVA 1TKDB 3LFLA 1VF1A 5KN3A 1DE1A 2FWHA 3HA9A 4Z2TA 4L0WA 4MA9A 2VM1A 2QA2A 3F4SA 4IP1A 3QDNA 2O89A 4N0VA 5KOXA 3ERWA 1WWJA 4ZB8A 4ML1A 3D4MA 2O87A 2WULA 2LJKA 2IMEA 1VGLA 19GSA 2GQLA 4V2MA 3RPPA 1F6MC 2C3TA 1SK2A 1DSBA 2DJKA 1FVKA 1OE7A 4Z7XA 2R4VA 5HQPA 4XHMA 4HU7A 2GLRA 4NV5A 4ZBBA 5F06A 5LD0A 2XBQA 4HU9A 2C3QA 1GUMA 3A5WA 4XS4B 4EC0A 1LJRA 5ENUA 3G7IA 2JZTA 3IK7A 3TGZA 1ERUA 2ZCTA 3A3TA 4MF6A 3GTUB 3CXGA 3VFIA 1PQNA 2C0DA 5ECLB 3DD3A 5DJMA 1X9SB 1SU9A 3GX0A 3DYRA 4EL1A 4F03A 2X8CA 4NXIA 4PTSA 1BJXA 1BX9A 3HCZA 4GSNA 3TUEA 1O8WA 4TXOB 1M2BA 5HFKA 5IMAA 1G7EA 4IVFA 1NM3A 3L4NA 2YOIA 2CAQA 1T3BA 4ZXGA 4I5QA 2AJQB 2C0GA 2H75A 5HR0A 2J23A 4QQ7A 3JCML 2TIRA 1S3DA 1JZWA 1RK4A 2C80A 4N11A 2CX4A 3EC3A 4EKZA 2L5LA 2LRCA 1TU7A 1XWBA 2WZ9A 4L5OA 1AQXA 1IYHA 5ECIB 14GSA 2GDRA 1EGOA 2CQ9A 4BVXB 3O6TA 1GTIA 3HKRA 2GGTA 4O5QA 2PVQA 3C1SA 3KD0A 2DJJA 2HRAA 3TOTA 1EOHA 2LRTA 4IJ3A 3ZL5A 3DVWA 3BOAA 1T7PB 4POBA 4IBPA 4F0BA 2VCWA 5DAKB 1TRWA 1DBYA 3TOUA 3BCKA 1XWGA 5CAXA 2HZFA 1XOBA 1WJKA 1XPVA 4K9ZA 2AUVA 6GSYA 3W6GA 1EV4A 5IPHA 2XC2A 5HR1A 3UBLA 2L5OA 2JACA 3TJBA 4V1Ap 1SYRA 1W4VA 1ZCPA 3GKMA 3WD6A 4PQIA 2PGTA 1R26A 1WOUA 2JU5A 4F2IA 3APOA 5ECOB 1XXUA 3IE3A 5J9CA 1TI3A 3UAPA 2KUCA 4Q5FA 1BAYA 4ZB9A 5D93A 3VK9A 2FA8A 3J7Yk 2P5RA 16GSA 2BTOT 4HJMA 5LCZA 4OCFA 3LJRA 2XBIA 3KGKA 1MD4A 2X4AA 2IMIA 2O7KA 3RAZA 4EIPA 2HRNA 1M99A 2EC4A 4WBJA 3ZIJA 4BVYB 5G31A 2CT6A 2MBSA 5J5NA 2E0QA 5IIZA 5G1LA 1A2LA 2CX3A 3F3QA 3TJGA 2NTOA 1GULA 3ZFBA 1XWKA 5IM9A 4CHSA 1GUKA 1GSDA 2E7PA 1B4QA 4EF0A 2R0PA 2LJRA 2E2MA 3KMNA 2C0FA 2CZ2A 2GS3A 4USSA 3GA4A 3IV4A 2LUSA 1UVZA 1X9MB 4XS6A 1GSQA 4EO3A 2N5FA 2IN3A 2JZSA 1XZOA 5KN0A 1Z3EA 1FB6A 5G30A 2EIRA 4BWSA 2A2PA 2H76A 2VCQA 3FMWA 4E8EA 3QR6A 1K3OA 4KUNA 1F37A 5ECMB 2IMDA 1RW1A 2H73A 4ILFA 5F0GA 1GP1A 1NSWA 2AHEA 5H5SA 1X5CA 1FOVA 4V2LA 3O3TA 1SL0B 1SJZA 4RQXA 1YY7A 4HZ2A 5GZZB 3NIVA 2PU9C 5D9XA 1SK0A 4DSSB 1PN9A 4MPFA 3KIJA 5DDLA 2R0GA 3ME8A 1OKTA 1BG5A 1AUCA 2GQKA 2EIQA 3KMOA 4WXTA 5DALB 4G0LA 4KAEA 4E8HA 2G0FA 1ML6A 2PUKC 1YEPA 2R0CA 2RUEA 5LNKe 3IR4A 4O92A 4ZL7A 3VWWA 2H01A 3U5RE 5CNWA 2HXKA 4TR1B 4WR5A 5F8BA 4D73A 4KH7A 2I81A 1SD8A 3KP9A 4YQMA 4LMVA 5HR2A 3APQA 4YAVA 1B9YC 1TI1A 4ML6A 3VWVA 5G5EA 4HDEA 4KGIA 2MZCA 1V2AA 5IO2A 4WF4A 4EVMA 4NPBA 4MF5A 4QL9A 1B9XC 1O85A 4EDYA 3CRTA 2C4JA 2FWEA 2V32A 4I2TA 1EP7A 3HJMA 5ECRB 4G10A 5EL8A 3W8JA 3FZ9A 5B6NA 3LYPA 2VLTA 2NVLA 3HJPA 4EUYA 4IQ1A 2FGXA 4ACSA 5EVOA 3TKSC 1R5AA 2D2ZA 3A2VA 3SWLA 2C3NA 4H86A 2PVOC 3H93A 4IHUA 4GLTA 4NMUA 5ECKB 2DIYA 4KW6A 3UBKA 1WP0A 2CVDA 1O7UA 1JZDA 1QXHA 3WYWA 2L4CA 4LL4B 1K0CA 5IMDA 4PXOA 3VPTA 2VD0A 4EXJA 2YWNA 2M80A 2I1UA 4I2UA 1J08A 4L5LA 4MK3A 3GH9A 2GZPA 1TJDA 5AIXA 1QQ2A 3PGTA 2R6KA 3A5IA 1ERVA 2VO4A 1MEKA 5JCWA 1GLPA 2N5BA 5DQSA 3TRXA 3GSTA 5B8AA 3CBUA 2VCXA 1SENA 3ZMKA 4GTUA 1A0FA 3KH9A 1GH2A 2N5AA 1Q4JA 2IPAA 5DCHA 2JADA 1PKWA 2YN1A 2WS2A 4WKWA 1U88A 2WDUA 4PNFA 1CQHA 1GSEA 4JZQA 1EV9A 3TCOA 2ON7A 4K6XA 2PMTA 4K5RA 5D9TA 1QK8A 1URMA 3FR6A 1WRYA 1THXA 5A4WA 4XRAA 1JZOA 17GSA 1H4OA 3D6IA 3FRCA 1GSYA 3C73A 2O85A 1EGRA 1XW9A 5D9WA 5KN1A 5H5RA 3GNJA 4TRXA 4KSOA 4TR0A 2M46A 1G0TA 3IPZA 1TP9A 3FZ4A 3PPUA 1AXDA 4JRRA 4J2FA 3LYKA 1F2EA 1X9WB 3HDCA 1Y6EA 3M3MA 4O5RA 2GSTA 2QKEA 4DSQA 5ECSA 2H70A 3RPNA 3QFBC 4MZBA 4LLRA 1KBNA 1NW2A 3P7XA 1PL1A 3DWVA 2OADA 4G2EA 1Z5YE 2YWIA 4G0IA 4HZ4A 4GXZA 2VUPA 5F05A 4CY8A 4HUAA 3S9FA 2AB6A 2B1LA 2H19A 1OE8A 3UEMA 1VF2A 4ZIJA 1OC3A 4Q5NA 3GKNA 4AGSA 1OAZA 3BBYA 3HVVA 4BL7A 2V41A 1ACVA 5CRHA 4O7HA 2V1MA 2RUFA 1THOA 1XCCA 1XWCA 4FYBA 4Z2UA 2HI7A 4NAXA 1KEBA 1HYUA 2CVBA 3CSHA 3H4KA 2RM6A 4TN8A 5IO0A 4MCUA 4JBBA 3ZITA 1QUWA 1TK5B 3ED3A 1ZL9A 2MYGA 1WPIA 1QMVA 1TDIA 2YANA 7GSSA 5D96A 5J41A 4OD7A 3EURA 2OACA 2I4AA 4WF5A 4GWRA 5INYA 2CA8A 2P31A 4K8MA 3UMAA 5COHA 2HZEB 5JWQB 1IYIA 3MSZA 1YKCA 20GSA 4ZBAA 3CRUA 2HLSA 2H1DA 2X8GA 2LTKA 1JLVA 3IHQA 6GSXA 3ZMLA 3TKSA 1T4YA 2YPMA 5ECQB 18GSA 8GSSA 1R5PA 1XW6A 3M9KA 4MJCA 2DKIA 2VCVA 2K18A 4ECJA 2YWMA 1Z6NA 1Z7PA 4X43A 2OKAA 1XW5A 1KNGA 5HFGA 3ZLPA 1QGVA 3G7JA 4MP4A 2B6MA 1PSQA 2FWGA 3QAVA 1XBSA 1TTZA 4MDCA 5ELAA 3E9JB 3EPTA 2F3MA 1ZGNA 1DUGA 2F9SA 1M2DA 1MD3A 2OA7A 2X99A 3M8NA 2P5QA 1YF1A 3RHCA 2O8VB 1K0OA 2IFQB 3LXZA 3TJFA 3FHKA 5CRDA 4NHWA 3DXBA 2LKUA 2NDOA 5J9BA 1GSSA 5G5FA 1K3LA 2A4HA 2LNSA 2I3YA 3UVTA 1O73A 3F9UA 1B4PA 2H1AA 3GN3A 1GWCA 6GSUA 2PN8A 3TRPA 4MNNA 3ZZXA 2H1GA 1YKAA 3ZIVA 3BJ5A 2R5GA 3LGCA 4X0XA 5EY6A 4I8BA 3CTFA 3GURA 1HD2A 4LA1A 1N8JA 3QPMA 2MMAA 4GF0A 3LWAA 1JFUA 4FO5A 5A4UA 3P8WA 3ERFA 3TKSE 2QA1A 3J7Yb 4OMVA 2J9HA 1QFNA 4J56E 4CW9A 4FYUA 4AJ8A 1T8EB 1F9MA 5DQYA 2C8UA 3M9JA 4GQFA 2GSSA 4HOJA 1LU4A 1CQGA 2YJHA 3C1RA 3GUSA 3P2AA 3GHAA 1M7TA 3C7MA 1GTBA 1YEXA 5ABRA 4ISDA 3L0HA 1UN2A 4ID0A 3KEBA 4XS4A 4MJEA 3EMPA 3KP8A 2DBCA 2X64A 3F8UA 3R3EA 4XIHA 2YV9A 4GQCA 2H72A 1B8XA 1FB0A 3GTUA 4F9ZA 1K0NA 1OKDA 5IMCA 1SJ6A 4TR3A 2H66A 3I69A 5ID2B 2LV3A 1A8LA 3HVXA 6GSVA 1SKSB 4L0UA 1U3IA 3PINA 4OCEA 3KZQA 2XPEA 4CDOA 1A24A 2BMXA 4MH2A 4TXVA 3IRAA 4TXOA 1MDIA 2EIOA 3DMLA 4LMWA 5HR3A 3GSSA 2MBTA 3UIWA 1TXXA 5IOXA 3DKSA 1VRSD 3TJKA 3FW2A 4EIQA 2WRTA 3WGDA 3OR5A 4FIWA 4EE0A 1G6WA 4IGJA 3ZVJD 5IMVA 2JL4A 6GSWA 2A4VA 1FO5A 3Q6OA 1R4WA 1M9BA 3LSZA 4NHZA 4IJIA 3F63A 4BVXA 5KN2A 2IL3A 3QD9A 3GIXA 3O76A 3F4TA 4BPYA 2PERA 1NHYA 1GUHA 4IW9A 2FNOA 3GKXA 3E3EA 1VF4A 1JLWA 2K8VA 2B5XA 1OC9B 5D8IA 2LEGA 2FY6A 2R2JA 1A2JA 3CYNA 3PR8A 3KCMA 3FZAA 1A2MA 4QL7A 1EEJA 3MWHA 5DJLA 5JWRB 4EDZA 5BRTA 3BD2A 3Q18A 1T1VA 4FH8A 3RBTA 3W8SA 2B1KA 1N2AA 3N9JA 2HRFA 1W89A 3HY2A 4GSTA 2GT5A 1AQVA 2HNLA 5B7CA 5CO3A 4WETA 5J3RA 1M2AA 5C04A 1YQ1A 2HE3A 3QAWA 4XTSA 2VL2C 3GV1A 1EWXA 4IS0A 2B3SA 2LQQA 1M9AA 3TRQA 3F6DA 1ERWA 3ZREA 4ECIA 1AAZA 2VL9A 3GKKA 4PUFC 2DIZA 1FOHA 3US3A 3DRNA 1SYXA 1BQ7A 2VAFA 4ECBA 1AW9A 1ZYNA 3ZVJA 2VM2A 4MZCA 1T4ZA 4K7NA 1FAAA 4BVYA 1OVNA 5DVBA 4G0KA 3ME7A 1Q98A 4BA7A 3DGQA 2IMKA 4TW5A 1MDKA 3F0IA 3M1GA 1YJ6A 1YZXA 3DIEA 3L78A 4IN0A 2YZUA 3GX8A 1EEMA 2NBSA 3DEXA 1TRVA 2WFCA 22GSA 2OBKA 4PURA 1XVWA 1EP8A 3D22A 1Z7RA 2F8FA 3CTGA 1ZYPA 3MYDA 4TKYA 3U6VA 2REMA 4RQRA 4IKHA 1U6TA 3TJJA 2L57A 1X5EA 3I6AA 1PMTA 4V2NA 5L71A 2AYTA 3I43A 5AGYA 4HJ2A 4JR4A 3UJ1A 1E2YA 2DJ0A 4KDXA 3FR3A 2HT9A 2ZUPA 2R3XA 2DC5A 1YF0A 1FG4A 2VOCA 4HS1A 2AAWA 4I97A 4PUAA 2VIMA 5CRGA 1G6YA 1ABAA 4DSSA 3HVSA 3VI5A 3VLNA 4NV2A 5KEJA 4JU5A 4CY6A 5DALA 3IC4A 1ST9A 3MNGA 4FQUA 5JCGA 2FCHA 4N30A 1JHBA 4RUVA 1XFLA 4KE3A 1FVJA 3Q19A 4O32A 2LS5A 4KF9A 1AQWA 2H0HA 1AIUA 3GL3A 1M0UA 3L9UA 4TR1A 4PQHA 11GSA 1GLQA 1RQMA 3UL3A 1TK0B 4IP6A 4MLYA 3KM6A 5FWGA 5E4WA 1ZZYA 3SBCA 5ECNB 5F07A 2B7KA 4KNDA 1WE0A 2GSRA 2BJXA 1OC8A 4RI6A 2HRKA 2YJ7A 4K7OA 4JEDA 3APSA 4ULXA 2K9FA 4TVEA 3D5JA 5AISA 2LSTA 4XS1A 5BMUA 4PNGA 4K0NA 3A2WA 1V58A 2B7JA 4IQAA 2TRXA 2YWOA 3F4RA 4F0CA 3UARA 1I5GA 3GRXA 3L9SA 2VL2A 3FKFA 3FK8A 2ON5A 2OE3A 5AN1A 2HYXA 5IOWA 2OE0A 2FA4A 3GL5A 4YH2A 4ZL9A 1MDJA 3MIXA 4V1Ag 3KJYA 2KP2A 2CZ3A 1U3AA 2VLUA 2GTUA 4WEYA 1PKZA 4ZL8A 4BWQA 1A0RP 2H30A 2IWTA 2FUG2 1J9BA 5E59A 4POMA 4X4JA 2L6DA 3WT1A 2YNXA 3IAS2 1O81A 2GT6A 1AC1A 4MJAA 2HSYA 2RLIA 2GVPA 4A5PA 2VCTA 1MTCA 1DE2A 4O5UA 4JR6A 3IDVA 2IIYA 3WGEA 2C1YA 3LQ7A 5A4VA 3MAKA 5G1KA 1TW9A 1ZMAA 5FT3A 5EPFA 1PD21 3H1NA 1GSUA 2KP1A 5DBQA 2DJ1A 4POLA 6GSTA 2H1BA 4Q5RA 1H75A 4YQVA 4OO4A 4N0ZA 1XOAA 4KCAA 5J4UA 4P3YB 3HZ4A 4YQUA 5H5QA 4PQ1A 4MJBA 1V40A 9GSSA 1OYJA 2H6ZA 3VWXA 5JCUA 2JSYA 2FWFA 1GSFA 3CSIA 2B5YA 2KHPA 2QSIA 4AJ6A 1ZYEA 3VWUA 1PX6A 3UOMA 2GZZA 1HNCA 1E6BA 4KDYA 4KB3A 2XHFA 3IK9A 2H6YA 1ON4A 1FHEA 2V6KA 4WBRD 2FHEA 4LL1B 3ZTLA 5ECPB 5DCGA 2R37A 4YKFA 1TRSA 1EZKA 4F82A 1K3YA 1YDKA 4GSSA 3HJOA 3G9BA 1EOGA 4D73B 2F51A 3LXTA 1Z9HA 2Z9SA 5CREA 4MH3A 2PWJA 3KTLA 3LG6A 1TU8A 1ZYQB 1I9DA 13GSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I9V 2;  4OFM A;  2YP6 A;  3TKQ A;  3Q74 A;  4HI7 A;  2QC7 A;  4XRD A;  1PL2 A;  5IPG A;  1S3C A;  2JZR A;  4XCS A;  2CVK A;  2A2S A;  2WCI A;  5CYY A;  1GRX A;  1S3A A;  2X8H A;  3WT2 A;  1K0D A;  2ES7 A;  2YCD A;  2RII A;  1K0B A;  3H79 A;  4MF7 A;  2IMF A;  1SK1 A;  1K0A A;  4MMM A;  4ECC A;  2HZE A;  3QMX A;  1B48 A;  1Z6M A;  1XIY A;  5GAN D;  1PA3 A;  3WGX A;  2MMO A;  1SJI A;  4OFN A;  1C72 A;  1KTE A;  3RDW A;  2PBJ A;  5D9V A;  5IQY A;  1PX7 A;  3RHB A;  1ERT A;  1F3A A;  1JZR A;  1A23 A;  3ERG A;  3QCP A;  2I9H A;  1SKW B;  3D4T A;  2CAI A;  2DMM A;  2H0G A;  2C0E A;  3HYP A;  2H74 A;  2TRC P;  3R2Q A;  1BED A;  3GYK A;  2OJL A;  3EE2 A;  2VL3 A;  3EIN A;  3H8Q A;  3KXO A;  4ZB6 A;  4ZBD A;  2LRN A;  1V98 A;  1U87 A;  2K8S A;  1Y25 A;  3IA1 A;  1WMJ A;  5B8B A;  3ZRD A;  4TOP A;  3G7Y A;  1HQO A;  3HZ8 A;  4KA0 A;  4HEA 2;  3TKP A;  2IFQ A;  12GS A;  3EMX A;  2ALB A;  3P90 A;  5D73 A;  1F3B A;  4POK A;  1VF3 A;  2ZNM A;  3FYG A;  4G9H A;  2F8A A;  2H0I A;  1R7H A;  4K0G A;  4X1U A;  2VD1 A;  2KLX A;  4K7I A;  2B5E A;  5DAK A;  3FEU A;  2AV4 A;  3N5O A;  5GSS A;  5CRW A;  2GQM A;  4AF2 A;  4HQS A;  3KTB A;  2H6X A;  3HD5 A;  1G7O A;  5FHI A;  2LQO A;  2OE1 A;  2HSH A;  1UA5 A;  5GAP D;  2DML A;  4RI7 A;  2E2G A;  5AIV A;  2M72 A;  3IAM 2;  1GNE A;  2L6C A;  4N10 A;  2V6O A;  2DLX A;  3UVH A;  2GZY A;  2RM5 A;  2XPD A;  3CSJ A;  1SL1 B;  1SD9 A;  2FD3 A;  3A2X A;  3ZYW A;  1K0M A;  1UC7 A;  3F6F A;  3HXS A;  2H8L A;  4KSM A;  1A8Y A;  3FY7 A;  4MAB A;  3QFA C;  4FYC A;  3FZ5 A;  1O8X A;  3NZN A;  1XVQ A;  5G2Z A;  1PGT A;  2KOK A;  3LOR A;  2HFD A;  1TK8 B;  4L8E A;  3D21 A;  4MPG A;  4K2D A;  5A5K A;  4Q5Q A;  5ECH B;  2MMZ A;  2H71 A;  4OWY A;  3IBH A;  1FW1 A;  3AY8 A;  2YV7 A;  2FLS A;  5ELG A;  4ZIL A;  4TR4 A;  5GST A;  1GL8 A;  2MMN A;  2G2Q A;  2VCZ A;  1X5D A;  3GMF A;  4YAP A;  2CV4 A;  3E0U A;  3NOF A;  3PH9 A;  3TB2 A;  2V2G A;  3FR9 A;  2NPB A;  4KDU A;  6GSS A;  5ID2 A;  3LEF A;  4KX4 A;  2PPT A;  3VI7 A;  2WGR A;  3F3R A;  1SL2 B;  4PX1 A;  5IMF A;  3QAG A;  4K1F A;  1GTA A;  3ZFL A;  3VPQ A;  3C8E A;  2LJA A;  3EYT A;  2P0G A;  1V9W A;  2QGV A;  3GFK A;  2WJU A;  2WB9 A;  4MZW A;  3IXR A;  10GS A;  3CMI A;  4HQZ A;  4NWY A;  4OFT A;  3C71 A;  4DEJ A;  2IJY A;  5HFI A;  1USB A;  1BYE A;  1HNB A;  4I6X A;  3IOS A;  3DVX A;  4IEL A;  1O6J A;  5B6M A;  1ILO A;  3EU4 A;  1NHO A;  3M0F A;  3K8N A;  3EWL A;  4GRF A;  3EU3 A;  1TRU A;  4DSR A;  3L9V A;  3D0Z A;  5JWO B;  2DJ2 A;  4KCE A;  1XWA A;  4WR4 A;  5IMZ A;  4AJ7 A;  1V57 A;  3TDG A;  1X0R A;  1ZOF A;  3V1W A;  2L4Q A;  4J57 E;  1HNA A;  2LNT A;  4G19 A;  1J0F A;  2YZH A;  5C00 A;  1GNW A;  3QOU A;  4JE1 A;  2OBI A;  3ISO A;  1WIK A;  1T00 A;  1LBK A;  3TKR A;  1OC9 A;  2DSA A;  1TOF A;  1PRX A;  3KH7 A;  4GCI A;  3VUR A;  1GTU A;  2K6V A;  1SKR B;  2A2R A;  3EVI A;  2VLV A;  3MDK A;  2JSZ A;  4OO5 A;  2DJ3 A;  4PGT A;  2GSQ A;  4DVC A;  2L59 A;  5CP1 A;  3GH6 A;  3BCI A;  3HHV A;  1TKD B;  3LFL A;  1VF1 A;  5KN3 A;  1DE1 A;  2FWH A;  3HA9 A;  4L0W A;  4MA9 A;  2VM1 A;  3F4S A;  4IP1 A;  3QDN A;  2O89 A;  4N0V A;  3ERW A;  1WWJ A;  4ZB8 A;  4ML1 A;  3D4M A;  2O87 A;  2WUL A;  2LJK A;  2IME A;  1VGL A;  19GS A;  2GQL A;  4V2M A;  3RPP A;  1F6M C;  2C3T A;  1SK2 A;  1DSB A;  2DJK A;  1FVK A;  1OE7 A;  4Z7X A;  2R4V A;  5HQP A;  4XHM A;  4HU7 A;  2GLR A;  4NV5 A;  4ZBB A;  5F06 A;  5LD0 A;  2XBQ A;  4HU9 A;  2C3Q A;  1GUM A;  3A5W A;  4XS4 B;  4EC0 A;  5ENU A;  1LJR A;  3G7I A;  2JZT A;  3IK7 A;  3TGZ A;  1ERU A;  2ZCT A;  3A3T A;  4MF6 A;  3GTU B;  3CXG A;  3VFI A;  1PQN A;  2C0D A;  5ECL B;  3DD3 A;  5DJM A;  1X9S B;  1SU9 A;  3GX0 A;  3DYR A;  4EL1 A;  4F03 A;  2X8C A;  4NXI A;  1BJX A;  1BX9 A;  3HCZ A;  4GSN A;  3TUE A;  1O8W A;  4TXO B;  1M2B A;  5HFK A;  5IMA A;  1G7E A;  4IVF A;  1NM3 A;  3L4N A;  2YOI A;  2CAQ A;  1T3B A;  4ZXG A;  4I5Q A;  2AJQ B;  2C0G A;  2H75 A;  5HR0 A;  2J23 A;  4QQ7 A;  3JCM L;  2TIR A;  1S3D A;  1JZW A;  1RK4 A;  2C80 A;  4N11 A;  2CX4 A;  3EC3 A;  4EKZ A;  2L5L A;  2LRC A;  1TU7 A;  1XWB A;  2WZ9 A;  4L5O A;  1AQX A;  1IYH A;  5ECI B;  14GS A;  2GDR A;  1EGO A;  2CQ9 A;  3O6T A;  1GTI A;  3HKR A;  2GGT A;  2PVQ A;  3C1S A;  3KD0 A;  2DJJ A;  3TOT A;  1EOH A;  2LRT A;  4IJ3 A;  3ZL5 A;  3DVW A;  3BOA A;  1T7P B;  4POB A;  4IBP A;  4F0B A;  2VCW A;  5DAK B;  1TRW A;  1DBY A;  3TOU A;  3BCK A;  1XWG A;  5CAX A;  2HZF A;  1XOB A;  1WJK A;  1XPV A;  4K9Z A;  2AUV A;  6GSY A;  3W6G A;  1EV4 A;  5IPH A;  2XC2 A;  5HR1 A;  3UBL A;  2L5O A;  2JAC A;  3TJB A;  4V1A p;  1SYR A;  1W4V A;  1ZCP A;  3GKM A;  3WD6 A;  4PQI A;  2PGT A;  1R26 A;  1WOU A;  2JU5 A;  4F2I A;  3APO A;  5ECO B;  1XXU A;  3IE3 A;  5J9C A;  1TI3 A;  3UAP A;  2KUC A;  4Q5F A;  1BAY A;  4ZB9 A;  5D93 A;  3VK9 A;  2FA8 A;  3J7Y k;  2P5R A;  16GS A;  2BTO T;  4HJM A;  5LCZ A;  4OCF A;  3LJR A;  2XBI A;  3KGK A;  1MD4 A;  2IMI A;  2O7K A;  3RAZ A;  2HRN A;  1M99 A;  2EC4 A;  4WBJ A;  3ZIJ A;  5G31 A;  2CT6 A;  2MBS A;  5J5N A;  2E0Q A;  5IIZ A;  5G1L A;  1A2L A;  2CX3 A;  3F3Q A;  3TJG A;  2NTO A;  1GUL A;  3ZFB A;  1XWK A;  5IM9 A;  4CHS A;  1GUK A;  1GSD A;  2E7P A;  1B4Q A;  4EF0 A;  2LJR A;  2E2M A;  3KMN A;  2C0F A;  2CZ2 A;  2GS3 A;  3GA4 A;  3IV4 A;  2LUS A;  1UVZ A;  1X9M B;  4XS6 A;  1GSQ A;  4EO3 A;  2N5F A;  2IN3 A;  2JZS A;  1XZO A;  5KN0 A;  1Z3E A;  1FB6 A;  5G30 A;  2EIR A;  4BWS A;  2H76 A;  2VCQ A;  4E8E A;  3QR6 A;  1K3O A;  4KUN A;  1F37 A;  5ECM B;  2IMD A;  1RW1 A;  2H73 A;  4ILF A;  5F0G A;  1GP1 A;  1NSW A;  2AHE A;  5H5S A;  1X5C A;  1FOV A;  4V2L A;  3O3T A;  1SL0 B;  1SJZ A;  4RQX A;  1YY7 A;  4HZ2 A;  5GZZ B;  3NIV A;  2PU9 C;  5D9X A;  1SK0 A;  4DSS B;  1PN9 A;  4MPF A;  3KIJ A;  5DDL A;  3ME8 A;  1OKT A;  1BG5 A;  1AUC A;  2GQK A;  2EIQ A;  3KMO A;  4WXT A;  5DAL B;  4KAE A;  4E8H A;  2G0F A;  1ML6 A;  2PUK C;  1YEP A;  2RUE A;  5LNK e;  3IR4 A;  4O92 A;  4ZL7 A;  3VWW A;  2H01 A;  3U5R E;  5CNW A;  2HXK A;  4TR1 B;  4WR5 A;  5F8B A;  4D73 A;  4KH7 A;  2I81 A;  1SD8 A;  3KP9 A;  4YQM A;  4LMV A;  5HR2 A;  3APQ A;  4YAV A;  1B9Y C;  1TI1 A;  4ML6 A;  3VWV A;  5G5E A;  4HDE A;  4KGI A;  2MZC A;  1V2A A;  5IO2 A;  4WF4 A;  4EVM A;  4NPB A;  4MF5 A;  4QL9 A;  1B9X C;  1O85 A;  4EDY A;  3CRT A;  2C4J A;  2FWE A;  2V32 A;  4I2T A;  1EP7 A;  3HJM A;  5ECR B;  4G10 A;  5EL8 A;  3W8J A;  3FZ9 A;  5B6N A;  3LYP A;  2VLT A;  2NVL A;  3HJP A;  4EUY A;  4IQ1 A;  2FGX A;  4ACS A;  5EVO A;  3TKS C;  1R5A A;  2D2Z A;  3A2V A;  3SWL A;  2C3N A;  4H86 A;  2PVO C;  3H93 A;  4IHU A;  4GLT A;  4NMU A;  5ECK B;  2DIY A;  4KW6 A;  3UBK A;  1WP0 A;  2CVD A;  1O7U A;  1JZD A;  1QXH A;  3WYW A;  2L4C A;  4LL4 B;  1K0C A;  5IMD A;  4PXO A;  3VPT A;  2VD0 A;  4EXJ A;  2YWN A;  2M80 A;  2I1U A;  4I2U A;  1J08 A;  4L5L A;  4MK3 A;  3GH9 A;  2GZP A;  1TJD A;  5AIX A;  1QQ2 A;  3PGT A;  2R6K A;  1ERV A;  2VO4 A;  1MEK A;  5JCW A;  1GLP A;  2N5B A;  5DQS A;  3TRX A;  3GST A;  5B8A A;  3CBU A;  2VCX A;  1SEN A;  3ZMK A;  4GTU A;  1A0F A;  3KH9 A;  1GH2 A;  2N5A A;  1Q4J A;  2IPA A;  5DCH A;  2JAD A;  1PKW A;  2YN1 A;  2WS2 A;  4WKW A;  1U88 A;  2WDU A;  4PNF A;  1CQH A;  1GSE A;  4JZQ A;  1EV9 A;  3TCO A;  2ON7 A;  4K6X A;  2PMT A;  5D9T A;  1QK8 A;  1URM A;  3FR6 A;  1WRY A;  1THX A;  5A4W A;  4XRA A;  1JZO A;  17GS A;  1H4O A;  3D6I A;  3FRC A;  1GSY A;  3C73 A;  2O85 A;  1EGR A;  1XW9 A;  5D9W A;  5KN1 A;  5H5R A;  3GNJ A;  4TRX A;  4KSO A;  4TR0 A;  2M46 A;  1G0T A;  3IPZ A;  1TP9 A;  3FZ4 A;  1AXD A;  4JRR A;  4J2F A;  3LYK A;  1F2E A;  1X9W B;  3HDC A;  1Y6E A;  3M3M A;  4O5R A;  2GST A;  2QKE A;  4DSQ A;  5ECS A;  2H70 A;  3RPN A;  3QFB C;  4MZB A;  4LLR A;  1KBN A;  1NW2 A;  3P7X A;  1PL1 A;  3DWV A;  2OAD A;  4G2E A;  1Z5Y E;  2YWI A;  4GXZ A;  4HZ4 A;  2VUP A;  5F05 A;  4HUA A;  3S9F A;  2AB6 A;  2B1L A;  2H19 A;  1OE8 A;  3UEM A;  1VF2 A;  4ZIJ A;  1OC3 A;  4Q5N A;  3GKN A;  4AGS A;  1OAZ A;  3BBY A;  3HVV A;  4BL7 A;  2V41 A;  1ACV A;  5CRH A;  4O7H A;  2V1M A;  2RUF A;  1THO A;  1XCC A;  1XWC A;  4FYB A;  2HI7 A;  4NAX A;  1KEB A;  1HYU A;  2CVB A;  3CSH A;  3H4K A;  2RM6 A;  4TN8 A;  5IO0 A;  4MCU A;  4JBB A;  3ZIT A;  1QUW A;  1TK5 B;  3ED3 A;  1ZL9 A;  2MYG A;  1WPI A;  1QMV A;  1TDI A;  2YAN A;  7GSS A;  5D96 A;  5J41 A;  4OD7 A;  3EUR A;  2OAC A;  2I4A A;  4WF5 A;  4GWR A;  5INY A;  2CA8 A;  2P31 A;  4K8M A;  3UMA A;  5COH A;  2HZE B;  5JWQ B;  1IYI A;  3MSZ A;  1YKC A;  20GS A;  4ZBA A;  3CRU A;  2HLS A;  2H1D A;  2X8G A;  2LTK A;  1JLV A;  3IHQ A;  6GSX A;  3ZML A;  3TKS A;  1T4Y A;  2YPM A;  5ECQ B;  18GS A;  8GSS A;  1R5P A;  1XW6 A;  3M9K A;  4MJC A;  2VCV A;  2K18 A;  4ECJ A;  2YWM A;  1Z6N A;  1Z7P A;  4X43 A;  2OKA A;  1XW5 A;  1KNG A;  5HFG A;  3ZLP A;  1QGV A;  3G7J A;  4MP4 A;  2B6M A;  1PSQ A;  2FWG A;  3QAV A;  1XBS A;  1TTZ A;  4MDC A;  5ELA A;  3E9J B;  2F3M A;  1ZGN A;  1DUG A;  2F9S A;  1M2D A;  1MD3 A;  2OA7 A;  2X99 A;  3M8N A;  2P5Q A;  1YF1 A;  3RHC A;  2O8V B;  1K0O A;  2IFQ B;  3LXZ A;  3TJF A;  3FHK A;  5CRD A;  4NHW A;  3DXB A;  2LKU A;  2NDO A;  5J9B A;  1GSS A;  5G5F A;  1K3L A;  2LNS A;  2I3Y A;  3UVT A;  1O73 A;  3F9U A;  1B4P A;  2H1A A;  3GN3 A;  1GWC A;  6GSU A;  2PN8 A;  3TRP A;  3ZZX A;  2H1G A;  1YKA A;  3ZIV A;  3BJ5 A;  2R5G A;  3LGC A;  4X0X A;  5EY6 A;  4I8B A;  3CTF A;  3GUR A;  1HD2 A;  4LA1 A;  1N8J A;  3QPM A;  2MMA A;  4GF0 A;  3LWA A;  1JFU A;  4FO5 A;  5A4U A;  3P8W A;  3ERF A;  3TKS E;  3J7Y b;  4OMV A;  2J9H A;  1QFN A;  4J56 E;  4CW9 A;  4FYU A;  4AJ8 A;  1T8E B;  1F9M A;  5DQY A;  2C8U A;  3M9J A;  4GQF A;  2GSS A;  4HOJ A;  1LU4 A;  1CQG A;  2YJH A;  3C1R A;  3GUS A;  3P2A A;  3GHA A;  1M7T A;  3C7M A;  1GTB A;  1YEX A;  5ABR A;  4ISD A;  3L0H A;  1UN2 A;  4ID0 A;  3KEB A;  4XS4 A;  4MJE A;  3EMP A;  3KP8 A;  2DBC A;  2X64 A;  3F8U A;  4XIH A;  2YV9 A;  4GQC A;  2H72 A;  1B8X A;  1FB0 A;  3GTU A;  4F9Z A;  1K0N A;  1OKD A;  5IMC A;  1SJ6 A;  4TR3 A;  2H66 A;  3I69 A;  5ID2 B;  2LV3 A;  1A8L A;  3HVX A;  6GSV A;  1SKS B;  4L0U A;  1U3I A;  3PIN A;  4OCE A;  3KZQ A;  2XPE A;  4CDO A;  1A24 A;  2BMX A;  4MH2 A;  4TXV A;  3IRA A;  4TXO A;  1MDI A;  2EIO A;  3DML A;  4LMW A;  5HR3 A;  3GSS A;  2MBT A;  3UIW A;  1TXX A;  5IOX A;  3DKS A;  1VRS D;  3TJK A;  3FW2 A;  2WRT A;  3WGD A;  3OR5 A;  4FIW A;  4EE0 A;  1G6W A;  4IGJ A;  3ZVJ D;  5IMV A;  2JL4 A;  6GSW A;  2A4V A;  1FO5 A;  3Q6O A;  1R4W A;  1M9B A;  3LSZ A;  4NHZ A;  4IJI A;  3F63 A;  4BVX A;  5KN2 A;  2IL3 A;  3QD9 A;  3GIX A;  3O76 A;  3F4T A;  4BPY A;  2PER A;  1NHY A;  1GUH A;  4IW9 A;  2FNO A;  3GKX A;  3E3E A;  1VF4 A;  1JLW A;  2K8V A;  2B5X A;  1OC9 B;  5D8I A;  2LEG A;  2FY6 A;  2R2J A;  1A2J A;  3CYN A;  3PR8 A;  3KCM A;  3FZA A;  1A2M A;  4QL7 A;  1EEJ A;  3MWH A;  5DJL A;  5JWR B;  4EDZ A;  3BD2 A;  3Q18 A;  1T1V A;  4FH8 A;  3RBT A;  3W8S A;  2B1K A;  1N2A A;  3N9J A;  2HRF A;  1W89 A;  3HY2 A;  4GST A;  2GT5 A;  1AQV A;  2HNL A;  5B7C A;  5CO3 A;  4WET A;  5J3R A;  1M2A A;  5C04 A;  1YQ1 A;  2HE3 A;  3QAW A;  4XTS A;  2VL2 C;  3GV1 A;  1EWX A;  4IS0 A;  2B3S A;  2LQQ A;  1M9A A;  3TRQ A;  3F6D A;  1ERW A;  3ZRE A;  4ECI A;  1AAZ A;  2VL9 A;  3GKK A;  4PUF C;  2DIZ A;  3US3 A;  3DRN A;  1SYX A;  1BQ7 A;  2VAF A;  4ECB A;  1AW9 A;  3ZVJ A;  2VM2 A;  4MZC A;  1T4Z A;  4K7N A;  1FAA A;  4BVY A;  1OVN A;  5DVB A;  3ME7 A;  1Q98 A;  4BA7 A;  3DGQ A;  2IMK A;  4TW5 A;  1MDK A;  3F0I A;  3M1G A;  1YJ6 A;  1YZX A;  3DIE A;  3L78 A;  4IN0 A;  2YZU A;  3GX8 A;  1EEM A;  2NBS A;  3DEX A;  1TRV A;  2WFC A;  22GS A;  2OBK A;  4PUR A;  1XVW A;  1EP8 A;  3D22 A;  1Z7R A;  2F8F A;  3CTG A;  4TKY A;  3U6V A;  2REM A;  4RQR A;  4IKH A;  1U6T A;  3TJJ A;  2L57 A;  1X5E A;  3I6A A;  1PMT A;  4V2N A;  5L71 A;  2AYT A;  3I43 A;  5AGY A;  4HJ2 A;  4JR4 A;  3UJ1 A;  1E2Y A;  2DJ0 A;  4KDX A;  3FR3 A;  2HT9 A;  2ZUP A;  2R3X A;  2DC5 A;  1YF0 A;  1FG4 A;  2VOC A;  4HS1 A;  2AAW A;  4I97 A;  4PUA A;  2VIM A;  5CRG A;  1G6Y A;  1ABA A;  4DSS A;  3HVS A;  3VI5 A;  3VLN A;  4NV2 A;  5KEJ A;  4JU5 A;  5DAL A;  3IC4 A;  1ST9 A;  3MNG A;  5JCG A;  2FCH A;  4N30 A;  1JHB A;  4RUV A;  1XFL A;  4KE3 A;  1FVJ A;  3Q19 A;  4O32 A;  2LS5 A;  1AQW A;  2H0H A;  1AIU A;  3GL3 A;  1M0U A;  3L9U A;  4TR1 A;  4PQH A;  11GS A;  1GLQ A;  1RQM A;  3UL3 A;  1TK0 B;  4IP6 A;  4MLY A;  3KM6 A;  5FWG A;  5E4W A;  1ZZY A;  3SBC A;  5ECN B;  5F07 A;  2B7K A;  4KND A;  1WE0 A;  2GSR A;  2BJX A;  1OC8 A;  4RI6 A;  2YJ7 A;  4K7O A;  4JED A;  3APS A;  4ULX A;  2K9F A;  4TVE A;  3D5J A;  5AIS A;  2LST A;  4XS1 A;  4PNG A;  4K0N A;  3A2W A;  1V58 A;  2B7J A;  4IQA A;  2TRX A;  2YWO A;  3F4R A;  4F0C A;  3UAR A;  1I5G A;  3GRX A;  3L9S A;  2VL2 A;  3FKF A;  3FK8 A;  2ON5 A;  2OE3 A;  5AN1 A;  2HYX A;  5IOW A;  2OE0 A;  2FA4 A;  3GL5 A;  4YH2 A;  4ZL9 A;  1MDJ A;  4V1A g;  3KJY A;  2KP2 A;  2CZ3 A;  1U3A A;  2VLU A;  2GTU A;  4WEY A;  1PKZ A;  4ZL8 A;  4BWQ A;  1A0R P;  2H30 A;  2IWT A;  2FUG 2;  1J9B A;  5E59 A;  4POM A;  2L6D A;  3WT1 A;  2YNX A;  3IAS 2;  1O81 A;  2GT6 A;  1AC1 A;  4MJA A;  2HSY A;  2RLI A;  2GVP A;  2VCT A;  1MTC A;  1DE2 A;  4JR6 A;  3IDV A;  2IIY A;  3WGE A;  2C1Y A;  3LQ7 A;  5A4V A;  3MAK A;  5G1K A;  1TW9 A;  1ZMA A;  5FT3 A;  5EPF A;  1PD2 1;  3H1N A;  1GSU A;  2KP1 A;  5DBQ A;  2DJ1 A;  4POL A;  6GST A;  2H1B A;  4Q5R A;  1H75 A;  4YQV A;  4OO4 A;  4N0Z A;  1XOA A;  4KCA A;  5J4U A;  4P3Y B;  3HZ4 A;  4YQU A;  5H5Q A;  4PQ1 A;  4MJB A;  1V40 A;  9GSS A;  1OYJ A;  2H6Z A;  3VWX A;  5JCU A;  2JSY A;  2FWF A;  1GSF A;  3CSI A;  2B5Y A;  2KHP A;  2QSI A;  4AJ6 A;  1ZYE A;  3VWU A;  1PX6 A;  3UOM A;  2GZZ A;  1HNC A;  1E6B A;  4KDY A;  4KB3 A;  2XHF A;  3IK9 A;  2H6Y A;  1ON4 A;  1FHE A;  2V6K A;  4WBR D;  2FHE A;  4LL1 B;  3ZTL A;  5ECP B;  5DCG A;  2R37 A;  1TRS A;  1EZK A;  4F82 A;  1K3Y A;  1YDK A;  4GSS A;  3HJO A;  3G9B A;  1EOG A;  4D73 B;  2F51 A;  3LXT A;  1Z9H A;  2Z9S A;  5CRE A;  4MH3 A;  2PWJ A;  3KTL A;  3LG6 A;  1TU8 A;  1ZYQ B;  1I9D A;  13GS A; 
#chains in the Genus database with same CATH topology
 3I9V 2;  4OFM A;  2YP6 A;  3TKQ A;  3Q74 A;  4HI7 A;  2QC7 A;  4XRD A;  1PL2 A;  5IPG A;  1S3C A;  2JZR A;  4XCS A;  2CVK A;  2A2S A;  2WCI A;  5CYY A;  1GRX A;  1S3A A;  2X8H A;  3WT2 A;  1K0D A;  2ES7 A;  2YCD A;  2RII A;  1K0B A;  3H79 A;  4MF7 A;  2IMF A;  1SK1 A;  1K0A A;  4K2X A;  4MMM A;  4ECC A;  2HZE A;  3QMX A;  1B48 A;  1Z6M A;  1XIY A;  5GAN D;  1PA3 A;  3WGX A;  2MMO A;  1SJI A;  4OFN A;  1C72 A;  1KTE A;  3RDW A;  2PBJ A;  5D9V A;  5IQY A;  1PX7 A;  3RHB A;  1ERT A;  1F3A A;  1JZR A;  1A23 A;  3ERG A;  3QCP A;  2I9H A;  1SKW B;  3D4T A;  2CAI A;  2DMM A;  2H0G A;  2C0E A;  3HYP A;  2H74 A;  1PN0 A;  2TRC P;  3R2Q A;  1BED A;  3GYK A;  2OJL A;  3EE2 A;  2HSM A;  2VL3 A;  3EIN A;  3H8Q A;  3KXO A;  4ZB6 A;  4ZBD A;  2LRN A;  1V98 A;  1U87 A;  2K8S A;  1Y25 A;  3IA1 A;  1WMJ A;  5B8B A;  3ZRD A;  4TOP A;  3G7Y A;  1HQO A;  3HZ8 A;  4YKG A;  5KOW A;  4KA0 A;  4HEA 2;  3TKP A;  2IFQ A;  12GS A;  3EMX A;  2ALB A;  3P90 A;  2UZ8 A;  5D73 A;  1F3B A;  4POK A;  1VF3 A;  2ZNM A;  3FYG A;  4G9H A;  2F8A A;  2H0I A;  1R7H A;  4K0G A;  4X1U A;  2VD1 A;  2KLX A;  4K7I A;  2B5E A;  4HSC X;  5DAK A;  3FEU A;  2AV4 A;  3N5O A;  5GSS A;  5CRW A;  2GQM A;  4AF2 A;  4HQS A;  3KTB A;  2H6X A;  3HD5 A;  1G7O A;  5FHI A;  2LQO A;  2OE1 A;  2HSH A;  1UA5 A;  5GAP D;  2DML A;  4RI7 A;  2E2G A;  5AIV A;  2M72 A;  3IAM 2;  1GNE A;  2L6C A;  4N10 A;  2V6O A;  2DLX A;  3UVH A;  2GZY A;  2RM5 A;  2XPD A;  3CSJ A;  1SL1 B;  1SD9 A;  2FD3 A;  3A2X A;  3ZYW A;  1K0M A;  1UC7 A;  3F6F A;  3HXS A;  2H8L A;  4KSM A;  1A8Y A;  3FY7 A;  4MAB A;  3QFA C;  4FYC A;  3FZ5 A;  1O8X A;  3NZN A;  1XVQ A;  5G2Z A;  1PGT A;  2KOK A;  3LOR A;  2HFD A;  1TK8 B;  4BL7 B;  4L8E A;  3D21 A;  4MPG A;  4K2D A;  5A5K A;  4Q5Q A;  5ECH B;  2MMZ A;  2H71 A;  4OWY A;  3IBH A;  1FW1 A;  3AY8 A;  2YV7 A;  2FLS A;  3IHG A;  2X49 A;  5ELG A;  4ZIL A;  4TR4 A;  5GST A;  1GL8 A;  2MMN A;  2G2Q A;  2VCZ A;  1X5D A;  3GMF A;  4YAP A;  2CV4 A;  3E0U A;  3NOF A;  3PH9 A;  3TB2 A;  2V2G A;  3FR9 A;  2NPB A;  4KDU A;  6GSS A;  5ID2 A;  3LEF A;  4KX4 A;  2PPT A;  3VI7 A;  2WGR A;  3F3R A;  4Z2R A;  1SL2 B;  4PX1 A;  5IMF A;  3QAG A;  4K1F A;  1GTA A;  4ICY A;  3ZFL A;  3VPQ A;  3C8E A;  2LJA A;  3EYT A;  2P0G A;  1V9W A;  2QGV A;  3GFK A;  2WJU A;  2WB9 A;  4MZW A;  3IXR A;  10GS A;  3CMI A;  4HQZ A;  4NWY A;  4OFT A;  3C71 A;  4DEJ A;  2IJY A;  5HFI A;  4K5S A;  1USB A;  1BYE A;  1HNB A;  4I6X A;  3IOS A;  3DVX A;  4IEL A;  1O6J A;  5B6M A;  1ILO A;  3EU4 A;  1NHO A;  3M0F A;  3K8N A;  3EWL A;  4GRF A;  3EU3 A;  1TRU A;  4DSR A;  3L9V A;  3D0Z A;  5JWO B;  2DJ2 A;  4KCE A;  1XWA A;  4WR4 A;  5IMZ A;  4AJ7 A;  1V57 A;  3TDG A;  1X0R A;  1ZOF A;  2DKH A;  3V1W A;  2L4Q A;  4J57 E;  1HNA A;  2LNT A;  3LW9 A;  4G19 A;  1J0F A;  2YZH A;  5C00 A;  1GNW A;  3QOU A;  4JE1 A;  2OBI A;  3ISO A;  1WIK A;  1T00 A;  1LBK A;  3TKR A;  1OC9 A;  2DSA A;  1TOF A;  1PRX A;  3KH7 A;  4GCI A;  3VUR A;  1GTU A;  2K6V A;  1SKR B;  2A2R A;  3EVI A;  2VLV A;  3MDK A;  2JSZ A;  4OO5 A;  2DJ3 A;  4PGT A;  2GSQ A;  4DVC A;  2L59 A;  5CP1 A;  3GH6 A;  3BCI A;  3IC8 A;  3HHV A;  1TKD B;  3LFL A;  1VF1 A;  5KN3 A;  1DE1 A;  2FWH A;  3HA9 A;  4Z2T A;  4L0W A;  4MA9 A;  2VM1 A;  2QA2 A;  3F4S A;  4IP1 A;  3QDN A;  2O89 A;  4N0V A;  5KOX A;  3ERW A;  1WWJ A;  4ZB8 A;  4ML1 A;  3D4M A;  2O87 A;  2WUL A;  2LJK A;  2IME A;  1VGL A;  19GS A;  2GQL A;  4V2M A;  3RPP A;  1F6M C;  2C3T A;  1SK2 A;  1DSB A;  2DJK A;  1FVK A;  1OE7 A;  4Z7X A;  2R4V A;  5HQP A;  4XHM A;  4HU7 A;  2GLR A;  4NV5 A;  4ZBB A;  5F06 A;  5LD0 A;  2XBQ A;  4HU9 A;  2C3Q A;  1GUM A;  3A5W A;  4XS4 B;  4EC0 A;  1LJR A;  5ENU A;  3G7I A;  2JZT A;  3IK7 A;  3TGZ A;  1ERU A;  2ZCT A;  3A3T A;  4MF6 A;  3GTU B;  3CXG A;  3VFI A;  1PQN A;  2C0D A;  5ECL B;  3DD3 A;  5DJM A;  1X9S B;  1SU9 A;  3GX0 A;  3DYR A;  4EL1 A;  4F03 A;  2X8C A;  4NXI A;  4PTS A;  1BJX A;  1BX9 A;  3HCZ A;  4GSN A;  3TUE A;  1O8W A;  4TXO B;  1M2B A;  5HFK A;  5IMA A;  1G7E A;  4IVF A;  1NM3 A;  3L4N A;  2YOI A;  2CAQ A;  1T3B A;  4ZXG A;  4I5Q A;  2AJQ B;  2C0G A;  2H75 A;  5HR0 A;  2J23 A;  4QQ7 A;  3JCM L;  2TIR A;  1S3D A;  1JZW A;  1RK4 A;  2C80 A;  4N11 A;  2CX4 A;  3EC3 A;  4EKZ A;  2L5L A;  2LRC A;  1TU7 A;  1XWB A;  2WZ9 A;  4L5O A;  1AQX A;  1IYH A;  5ECI B;  14GS A;  2GDR A;  1EGO A;  2CQ9 A;  4BVX B;  3O6T A;  1GTI A;  3HKR A;  2GGT A;  4O5Q A;  2PVQ A;  3C1S A;  3KD0 A;  2DJJ A;  2HRA A;  3TOT A;  1EOH A;  2LRT A;  4IJ3 A;  3ZL5 A;  3DVW A;  3BOA A;  1T7P B;  4POB A;  4IBP A;  4F0B A;  2VCW A;  5DAK B;  1TRW A;  1DBY A;  3TOU A;  3BCK A;  1XWG A;  5CAX A;  2HZF A;  1XOB A;  1WJK A;  1XPV A;  4K9Z A;  2AUV A;  6GSY A;  3W6G A;  1EV4 A;  5IPH A;  2XC2 A;  5HR1 A;  3UBL A;  2L5O A;  2JAC A;  3TJB A;  4V1A p;  1SYR A;  1W4V A;  1ZCP A;  3GKM A;  3WD6 A;  4PQI A;  2PGT A;  1R26 A;  1WOU A;  2JU5 A;  4F2I A;  3APO A;  5ECO B;  1XXU A;  3IE3 A;  5J9C A;  1TI3 A;  3UAP A;  2KUC A;  4Q5F A;  1BAY A;  4ZB9 A;  5D93 A;  3VK9 A;  2FA8 A;  3J7Y k;  2P5R A;  16GS A;  2BTO T;  4HJM A;  5LCZ A;  4OCF A;  3LJR A;  2XBI A;  3KGK A;  1MD4 A;  2X4A A;  2IMI A;  2O7K A;  3RAZ A;  4EIP A;  2HRN A;  1M99 A;  2EC4 A;  4WBJ A;  3ZIJ A;  4BVY B;  5G31 A;  2CT6 A;  2MBS A;  5J5N A;  2E0Q A;  5IIZ A;  5G1L A;  1A2L A;  2CX3 A;  3F3Q A;  3TJG A;  2NTO A;  1GUL A;  3ZFB A;  1XWK A;  5IM9 A;  4CHS A;  1GUK A;  1GSD A;  2E7P A;  1B4Q A;  4EF0 A;  2R0P A;  2LJR A;  2E2M A;  3KMN A;  2C0F A;  2CZ2 A;  2GS3 A;  4USS A;  3GA4 A;  3IV4 A;  2LUS A;  1UVZ A;  1X9M B;  4XS6 A;  1GSQ A;  4EO3 A;  2N5F A;  2IN3 A;  2JZS A;  1XZO A;  5KN0 A;  1Z3E A;  1FB6 A;  5G30 A;  2EIR A;  4BWS A;  2A2P A;  2H76 A;  2VCQ A;  3FMW A;  4E8E A;  3QR6 A;  1K3O A;  4KUN A;  1F37 A;  5ECM B;  2IMD A;  1RW1 A;  2H73 A;  4ILF A;  5F0G A;  1GP1 A;  1NSW A;  2AHE A;  5H5S A;  1X5C A;  1FOV A;  4V2L A;  3O3T A;  1SL0 B;  1SJZ A;  4RQX A;  1YY7 A;  4HZ2 A;  5GZZ B;  3NIV A;  2PU9 C;  5D9X A;  1SK0 A;  4DSS B;  1PN9 A;  4MPF A;  3KIJ A;  5DDL A;  2R0G A;  3ME8 A;  1OKT A;  1BG5 A;  1AUC A;  2GQK A;  2EIQ A;  3KMO A;  4WXT A;  5DAL B;  4G0L A;  4KAE A;  4E8H A;  2G0F A;  1ML6 A;  2PUK C;  1YEP A;  2R0C A;  2RUE A;  5LNK e;  3IR4 A;  4O92 A;  4ZL7 A;  3VWW A;  2H01 A;  3U5R E;  5CNW A;  2HXK A;  4TR1 B;  4WR5 A;  5F8B A;  4D73 A;  4KH7 A;  3HVN A;  2I81 A;  1SD8 A;  3KP9 A;  4YQM A;  4LMV A;  5HR2 A;  3APQ A;  4YAV A;  1B9Y C;  1TI1 A;  4ML6 A;  3VWV A;  5G5E A;  4HDE A;  4KGI A;  2MZC A;  1V2A A;  5IO2 A;  4WF4 A;  4EVM A;  4NPB A;  4MF5 A;  4QL9 A;  1B9X C;  1O85 A;  4EDY A;  1PFO A;  2C4J A;  3CRT A;  2FWE A;  2V32 A;  4I2T A;  1EP7 A;  3HJM A;  5ECR B;  4G10 A;  5EL8 A;  3W8J A;  3FZ9 A;  5B6N A;  3LYP A;  2VLT A;  2NVL A;  3HJP A;  4EUY A;  4IQ1 A;  2FGX A;  4ACS A;  5EVO A;  3TKS C;  1R5A A;  2D2Z A;  3A2V A;  3SWL A;  2C3N A;  4H86 A;  2PVO C;  3H93 A;  4IHU A;  4GLT A;  4NMU A;  5ECK B;  2DIY A;  4KW6 A;  3UBK A;  1WP0 A;  2CVD A;  1O7U A;  1JZD A;  1QXH A;  3WYW A;  2L4C A;  4LL4 B;  1K0C A;  5IMD A;  4PXO A;  3VPT A;  2VD0 A;  4EXJ A;  2YWN A;  2M80 A;  2I1U A;  4I2U A;  1J08 A;  4L5L A;  4MK3 A;  3GH9 A;  2GZP A;  1TJD A;  5AIX A;  1QQ2 A;  3PGT A;  2R6K A;  3A5I A;  1ERV A;  2VO4 A;  1MEK A;  5JCW A;  1GLP A;  2N5B A;  5DQS A;  3TRX A;  3GST A;  5B8A A;  3CBU A;  2VCX A;  1SEN A;  3ZMK A;  4GTU A;  1A0F A;  3KH9 A;  1GH2 A;  2N5A A;  1Q4J A;  2IPA A;  5DCH A;  2JAD A;  1PKW A;  2YN1 A;  2WS2 A;  4WKW A;  1U88 A;  2WDU A;  4PNF A;  1CQH A;  1GSE A;  4JZQ A;  1EV9 A;  3TCO A;  2ON7 A;  4K6X A;  2PMT A;  4K5R A;  5D9T A;  1QK8 A;  1URM A;  3FR6 A;  1WRY A;  1THX A;  5A4W A;  4XRA A;  1JZO A;  17GS A;  1H4O A;  3D6I A;  3FRC A;  1GSY A;  3C73 A;  2O85 A;  1EGR A;  1XW9 A;  5D9W A;  5KN1 A;  5H5R A;  3GNJ A;  4TRX A;  4KSO A;  4TR0 A;  2M46 A;  1G0T A;  3IPZ A;  1TP9 A;  3FZ4 A;  1S3R A;  3PPU A;  1AXD A;  4JRR A;  4J2F A;  3LYK A;  1F2E A;  1X9W B;  3HDC A;  1Y6E A;  3M3M A;  4O5R A;  2GST A;  2QKE A;  4DSQ A;  5ECS A;  2H70 A;  3RPN A;  3QFB C;  4MZB A;  4LLR A;  1KBN A;  1NW2 A;  3P7X A;  1PL1 A;  3DWV A;  2OAD A;  4G2E A;  1Z5Y E;  2YWI A;  4G0I A;  4HZ4 A;  4GXZ A;  2VUP A;  5F05 A;  4CY8 A;  4HUA A;  3S9F A;  2AB6 A;  2B1L A;  2H19 A;  1OE8 A;  3UEM A;  1VF2 A;  4ZIJ A;  1OC3 A;  4Q5N A;  3GKN A;  4AGS A;  1OAZ A;  3BBY A;  3HVV A;  4BL7 A;  2V41 A;  1ACV A;  5CRH A;  4O7H A;  2V1M A;  2RUF A;  1THO A;  1XCC A;  1XWC A;  4FYB A;  4Z2U A;  2HI7 A;  4NAX A;  1KEB A;  1HYU A;  2CVB A;  3CSH A;  3H4K A;  2RM6 A;  4TN8 A;  5IO0 A;  4MCU A;  4JBB A;  3ZIT A;  1QUW A;  1TK5 B;  3ED3 A;  1ZL9 A;  2MYG A;  1WPI A;  1QMV A;  1TDI A;  2YAN A;  7GSS A;  5D96 A;  5J41 A;  4OD7 A;  3EUR A;  2OAC A;  2I4A A;  4WF5 A;  4GWR A;  5INY A;  2CA8 A;  2P31 A;  4K8M A;  3UMA A;  5COH A;  2HZE B;  5JWQ B;  1IYI A;  3MSZ A;  1YKC A;  20GS A;  4ZBA A;  3CRU A;  2HLS A;  2H1D A;  2X8G A;  2LTK A;  1JLV A;  3IHQ A;  6GSX A;  3ZML A;  3TKS A;  1T4Y A;  2YPM A;  5ECQ B;  18GS A;  8GSS A;  1R5P A;  1XW6 A;  3M9K A;  4MJC A;  2DKI A;  2VCV A;  2K18 A;  4ECJ A;  2YWM A;  1Z6N A;  1Z7P A;  4X43 A;  2OKA A;  1XW5 A;  1KNG A;  5HFG A;  3ZLP A;  1QGV A;  3G7J A;  4MP4 A;  2B6M A;  1PSQ A;  2FWG A;  3QAV A;  1XBS A;  1TTZ A;  4MDC A;  5ELA A;  3E9J B;  3EPT A;  2F3M A;  1ZGN A;  1DUG A;  2F9S A;  1M2D A;  1MD3 A;  2OA7 A;  2X99 A;  3M8N A;  2P5Q A;  1YF1 A;  3RHC A;  2O8V B;  1K0O A;  2IFQ B;  3LXZ A;  3TJF A;  3FHK A;  5CRD A;  4NHW A;  3DXB A;  2LKU A;  2NDO A;  5J9B A;  1GSS A;  5G5F A;  1K3L A;  2A4H A;  2LNS A;  2I3Y A;  3UVT A;  1O73 A;  3F9U A;  1B4P A;  2H1A A;  3GN3 A;  1GWC A;  6GSU A;  2PN8 A;  3TRP A;  4MNN A;  3ZZX A;  2H1G A;  1YKA A;  3ZIV A;  3BJ5 A;  2R5G A;  3LGC A;  4X0X A;  5EY6 A;  4I8B A;  3CTF A;  3GUR A;  1HD2 A;  4LA1 A;  1N8J A;  3QPM A;  2MMA A;  4GF0 A;  3LWA A;  1JFU A;  4FO5 A;  5A4U A;  3P8W A;  3ERF A;  3TKS E;  2QA1 A;  3J7Y b;  4OMV A;  2J9H A;  1QFN A;  4J56 E;  4CW9 A;  4FYU A;  4AJ8 A;  1T8E B;  1F9M A;  5DQY A;  2C8U A;  3M9J A;  4GQF A;  2GSS A;  4HOJ A;  1LU4 A;  1CQG A;  2YJH A;  3C1R A;  3GUS A;  3P2A A;  3GHA A;  1M7T A;  3C7M A;  1GTB A;  1YEX A;  5ABR A;  4ISD A;  1M3I A;  3L0H A;  1UN2 A;  4ID0 A;  3KEB A;  4XS4 A;  4MJE A;  3EMP A;  3KP8 A;  2DBC A;  2X64 A;  3F8U A;  3R3E A;  4XIH A;  1M3J A;  2YV9 A;  4GQC A;  2H72 A;  1B8X A;  1FB0 A;  3GTU A;  4F9Z A;  1K0N A;  1OKD A;  5IMC A;  1SJ6 A;  4TR3 A;  2H66 A;  3I69 A;  5ID2 B;  2LV3 A;  1A8L A;  3HVX A;  6GSV A;  1SKS B;  4L0U A;  1U3I A;  3PIN A;  4OCE A;  3KZQ A;  2XPE A;  4CDO A;  1A24 A;  2BMX A;  4MH2 A;  4TXV A;  3IRA A;  4TXO A;  1MDI A;  2EIO A;  3DML A;  4LMW A;  5HR3 A;  3GSS A;  2MBT A;  3UIW A;  1TXX A;  5IOX A;  3DKS A;  1VRS D;  3TJK A;  3FW2 A;  4EIQ A;  2WRT A;  3WGD A;  3OR5 A;  4FIW A;  4EE0 A;  1G6W A;  4IGJ A;  3ZVJ D;  5IMV A;  2JL4 A;  6GSW A;  2A4V A;  1FO5 A;  3Q6O A;  1R4W A;  1M9B A;  3LSZ A;  4NHZ A;  4IJI A;  3F63 A;  4BVX A;  5KN2 A;  2IL3 A;  3QD9 A;  3GIX A;  3O76 A;  3F4T A;  4BPY A;  2PER A;  1NHY A;  1GUH A;  4IW9 A;  2FNO A;  3GKX A;  3E3E A;  1VF4 A;  1JLW A;  2K8V A;  2B5X A;  1OC9 B;  5D8I A;  2LEG A;  2FY6 A;  2R2J A;  1A2J A;  3CYN A;  3PR8 A;  3KCM A;  3FZA A;  1A2M A;  4QL7 A;  1XG8 A;  1EEJ A;  3MWH A;  5DJL A;  5JWR B;  4EDZ A;  5BRT A;  3BD2 A;  3Q18 A;  1T1V A;  4FH8 A;  3RBT A;  3W8S A;  2B1K A;  1N2A A;  3N9J A;  2HRF A;  1W89 A;  3HY2 A;  4GST A;  2GT5 A;  1AQV A;  2HNL A;  5B7C A;  5CO3 A;  4WET A;  5J3R A;  1M2A A;  5C04 A;  1YQ1 A;  2HE3 A;  3QAW A;  4XTS A;  2VL2 C;  3GV1 A;  1EWX A;  4IS0 A;  2B3S A;  2LQQ A;  1M9A A;  3TRQ A;  3F6D A;  1ERW A;  3ZRE A;  4ECI A;  1AAZ A;  2VL9 A;  3GKK A;  4PUF C;  2DIZ A;  1FOH A;  3US3 A;  3DRN A;  1SYX A;  1BQ7 A;  2VAF A;  4ECB A;  1AW9 A;  1ZYN A;  3ZVJ A;  2VM2 A;  4MZC A;  1T4Z A;  4K7N A;  1FAA A;  4BVY A;  1OVN A;  5DVB A;  4G0K A;  3ME7 A;  1Q98 A;  4BA7 A;  3DGQ A;  2IMK A;  4TW5 A;  1MDK A;  3F0I A;  3M1G A;  1YJ6 A;  1YZX A;  3DIE A;  3L78 A;  4IN0 A;  2YZU A;  3GX8 A;  1EEM A;  2NBS A;  3DEX A;  1TRV A;  2WFC A;  22GS A;  2OBK A;  4PUR A;  1XVW A;  1EP8 A;  4BIK A;  3D22 A;  1Z7R A;  2F8F A;  3CTG A;  1ZYP A;  3MYD A;  4TKY A;  3U6V A;  2REM A;  4RQR A;  4IKH A;  1U6T A;  3TJJ A;  2L57 A;  1X5E A;  3I6A A;  1PMT A;  4V2N A;  5L71 A;  2AYT A;  3I43 A;  5AGY A;  4HJ2 A;  4JR4 A;  3UJ1 A;  1E2Y A;  2DJ0 A;  4KDX A;  3FR3 A;  2HT9 A;  2ZUP A;  2R3X A;  2DC5 A;  1YF0 A;  1FG4 A;  2VOC A;  4HS1 A;  2AAW A;  4I97 A;  4PUA A;  2VIM A;  5CRG A;  1G6Y A;  1ABA A;  4DSS A;  3HVS A;  3VI5 A;  3VLN A;  4NV2 A;  5KEJ A;  4JU5 A;  4CY6 A;  5DAL A;  3IC4 A;  1ST9 A;  3MNG A;  4FQU A;  5JCG A;  2FCH A;  4N30 A;  1JHB A;  4RUV A;  1XFL A;  4KE3 A;  1FVJ A;  3Q19 A;  4O32 A;  2LS5 A;  4KF9 A;  1AQW A;  2H0H A;  1AIU A;  3GL3 A;  1M0U A;  3L9U A;  4TR1 A;  4PQH A;  11GS A;  1GLQ A;  1RQM A;  3UL3 A;  1TK0 B;  4IP6 A;  3CQF A;  4MLY A;  3KM6 A;  5FWG A;  5E4W A;  1ZZY A;  3SBC A;  5ECN B;  5F07 A;  2B7K A;  4KND A;  1WE0 A;  2GSR A;  2BJX A;  1OC8 A;  4RI6 A;  2HRK A;  2YJ7 A;  4K7O A;  4JED A;  3APS A;  4ULX A;  2K9F A;  4TVE A;  3D5J A;  5AIS A;  2LST A;  4XS1 A;  5BMU A;  4PNG A;  4K0N A;  3A2W A;  1V58 A;  2B7J A;  4IQA A;  2TRX A;  2YWO A;  3F4R A;  4F0C A;  3UAR A;  1I5G A;  3GRX A;  3L9S A;  2VL2 A;  3FKF A;  3FK8 A;  2ON5 A;  2OE3 A;  5AN1 A;  2HYX A;  5IOW A;  2OE0 A;  2FA4 A;  3GL5 A;  4YH2 A;  4ZL9 A;  1MDJ A;  3MIX A;  4V1A g;  3KJY A;  2KP2 A;  2CZ3 A;  1U3A A;  2VLU A;  2GTU A;  4WEY A;  1PKZ A;  4ZL8 A;  4BWQ A;  1A0R P;  2H30 A;  2IWT A;  2FUG 2;  1J9B A;  5E59 A;  4POM A;  4X4J A;  2L6D A;  3WT1 A;  2YNX A;  3IAS 2;  1O81 A;  2GT6 A;  1AC1 A;  4MJA A;  2HSY A;  2RLI A;  2GVP A;  4A5P A;  2VCT A;  1MTC A;  1DE2 A;  4O5U A;  4JR6 A;  3IDV A;  2IIY A;  3WGE A;  2C1Y A;  3LQ7 A;  5A4V A;  3MAK A;  5G1K A;  1TW9 A;  1ZMA A;  5FT3 A;  5EPF A;  1PD2 1;  3H1N A;  1GSU A;  2KP1 A;  5DBQ A;  2DJ1 A;  4POL A;  6GST A;  2H1B A;  4Q5R A;  1H75 A;  4YQV A;  4OO4 A;  4N0Z A;  1XOA A;  4KCA A;  5J4U A;  4P3Y B;  3HZ4 A;  4YQU A;  5H5Q A;  4PQ1 A;  4MJB A;  1V40 A;  9GSS A;  1OYJ A;  2H6Z A;  3VWX A;  5JCU A;  2JSY A;  2FWF A;  1GSF A;  3CSI A;  2B5Y A;  2KHP A;  2QSI A;  4AJ6 A;  1ZYE A;  3VWU A;  1PX6 A;  3UOM A;  2GZZ A;  1HNC A;  1E6B A;  4KDY A;  4KB3 A;  2XHF A;  3IK9 A;  2H6Y A;  1ON4 A;  1FHE A;  2V6K A;  4WBR D;  2FHE A;  4LL1 B;  3ZTL A;  5ECP B;  5DCG A;  2R37 A;  4YKF A;  1TRS A;  1EZK A;  4F82 A;  1K3Y A;  1YDK A;  4GSS A;  3HJO A;  3G9B A;  1EOG A;  4D73 B;  2F51 A;  3LXT A;  1Z9H A;  2Z9S A;  5CRE A;  4MH3 A;  2PWJ A;  3KTL A;  3LG6 A;  1TU8 A;  1ZYQ B;  1I9D A;  13GS A; 
#chains in the Genus database with same CATH homology
 3I9V 2;  4OFM A;  2YP6 A;  3TKQ A;  3Q74 A;  4HI7 A;  2QC7 A;  4XRD A;  1PL2 A;  5IPG A;  1S3C A;  2JZR A;  4XCS A;  2CVK A;  2A2S A;  2WCI A;  5CYY A;  1GRX A;  1S3A A;  2X8H A;  3WT2 A;  1K0D A;  2ES7 A;  2YCD A;  2RII A;  1K0B A;  3H79 A;  4MF7 A;  2IMF A;  1SK1 A;  1K0A A;  4K2X A;  4MMM A;  4ECC A;  2HZE A;  3QMX A;  1B48 A;  1Z6M A;  1XIY A;  5GAN D;  1PA3 A;  3WGX A;  2MMO A;  1SJI A;  4OFN A;  1C72 A;  1KTE A;  3RDW A;  2PBJ A;  5D9V A;  5IQY A;  1PX7 A;  3RHB A;  1ERT A;  1F3A A;  1JZR A;  1A23 A;  3ERG A;  3QCP A;  2I9H A;  1SKW B;  3D4T A;  2CAI A;  2DMM A;  2H0G A;  2C0E A;  3HYP A;  2H74 A;  1PN0 A;  2TRC P;  3R2Q A;  1BED A;  3GYK A;  2OJL A;  3EE2 A;  2HSM A;  2VL3 A;  3EIN A;  3H8Q A;  3KXO A;  4ZB6 A;  4ZBD A;  2LRN A;  1V98 A;  1U87 A;  2K8S A;  1Y25 A;  3IA1 A;  1WMJ A;  5B8B A;  3ZRD A;  4TOP A;  3G7Y A;  1HQO A;  3HZ8 A;  4YKG A;  5KOW A;  4KA0 A;  4HEA 2;  3TKP A;  2IFQ A;  12GS A;  3EMX A;  2ALB A;  3P90 A;  2UZ8 A;  5D73 A;  1F3B A;  4POK A;  1VF3 A;  2ZNM A;  3FYG A;  4G9H A;  2F8A A;  2H0I A;  1R7H A;  4K0G A;  4X1U A;  2VD1 A;  2KLX A;  4K7I A;  2B5E A;  5DAK A;  3FEU A;  2AV4 A;  3N5O A;  5GSS A;  5CRW A;  2GQM A;  4AF2 A;  4HQS A;  3KTB A;  2H6X A;  3HD5 A;  1G7O A;  5FHI A;  2LQO A;  2OE1 A;  2HSH A;  1UA5 A;  5GAP D;  2DML A;  4RI7 A;  2E2G A;  5AIV A;  2M72 A;  3IAM 2;  1GNE A;  2L6C A;  4N10 A;  2V6O A;  2DLX A;  3UVH A;  2GZY A;  2RM5 A;  2XPD A;  3CSJ A;  1SL1 B;  1SD9 A;  2FD3 A;  3A2X A;  3ZYW A;  1K0M A;  1UC7 A;  3F6F A;  3HXS A;  2H8L A;  4KSM A;  1A8Y A;  3FY7 A;  4MAB A;  3QFA C;  4FYC A;  3FZ5 A;  1O8X A;  3NZN A;  1XVQ A;  5G2Z A;  1PGT A;  2KOK A;  3LOR A;  2HFD A;  1TK8 B;  4BL7 B;  4L8E A;  3D21 A;  4MPG A;  4K2D A;  5A5K A;  4Q5Q A;  5ECH B;  2MMZ A;  2H71 A;  4OWY A;  3IBH A;  1FW1 A;  3AY8 A;  2YV7 A;  2FLS A;  3IHG A;  2X49 A;  5ELG A;  4ZIL A;  4TR4 A;  5GST A;  1GL8 A;  2MMN A;  2G2Q A;  2VCZ A;  1X5D A;  3GMF A;  4YAP A;  2CV4 A;  3E0U A;  3NOF A;  3PH9 A;  3TB2 A;  2V2G A;  3FR9 A;  2NPB A;  4KDU A;  6GSS A;  5ID2 A;  3LEF A;  4KX4 A;  2PPT A;  3VI7 A;  2WGR A;  3F3R A;  4Z2R A;  1SL2 B;  4PX1 A;  5IMF A;  3QAG A;  4K1F A;  1GTA A;  4ICY A;  3ZFL A;  3VPQ A;  3C8E A;  2LJA A;  3EYT A;  2P0G A;  1V9W A;  2QGV A;  3GFK A;  2WJU A;  2WB9 A;  4MZW A;  3IXR A;  10GS A;  3CMI A;  4HQZ A;  4NWY A;  4OFT A;  3C71 A;  4DEJ A;  2IJY A;  5HFI A;  4K5S A;  1USB A;  1BYE A;  1HNB A;  4I6X A;  3IOS A;  3DVX A;  4IEL A;  1O6J A;  5B6M A;  1ILO A;  3EU4 A;  1NHO A;  3M0F A;  3K8N A;  3EWL A;  4GRF A;  3EU3 A;  1TRU A;  4DSR A;  3L9V A;  3D0Z A;  5JWO B;  2DJ2 A;  4KCE A;  1XWA A;  4WR4 A;  5IMZ A;  4AJ7 A;  1V57 A;  3TDG A;  1X0R A;  1ZOF A;  2DKH A;  3V1W A;  2L4Q A;  4J57 E;  1HNA A;  2LNT A;  3LW9 A;  4G19 A;  1J0F A;  2YZH A;  5C00 A;  1GNW A;  3QOU A;  4JE1 A;  2OBI A;  3ISO A;  1WIK A;  1T00 A;  1LBK A;  3TKR A;  1OC9 A;  2DSA A;  1TOF A;  1PRX A;  3KH7 A;  4GCI A;  3VUR A;  1GTU A;  2K6V A;  1SKR B;  2A2R A;  3EVI A;  2VLV A;  3MDK A;  2JSZ A;  4OO5 A;  2DJ3 A;  4PGT A;  2GSQ A;  4DVC A;  2L59 A;  5CP1 A;  3GH6 A;  3BCI A;  3IC8 A;  3HHV A;  1TKD B;  3LFL A;  1VF1 A;  5KN3 A;  1DE1 A;  2FWH A;  3HA9 A;  4Z2T A;  4L0W A;  4MA9 A;  2VM1 A;  2QA2 A;  3F4S A;  4IP1 A;  3QDN A;  2O89 A;  4N0V A;  5KOX A;  3ERW A;  1WWJ A;  4ZB8 A;  4ML1 A;  3D4M A;  2O87 A;  2WUL A;  2LJK A;  2IME A;  1VGL A;  19GS A;  2GQL A;  4V2M A;  3RPP A;  1F6M C;  2C3T A;  1SK2 A;  1DSB A;  2DJK A;  1FVK A;  1OE7 A;  4Z7X A;  2R4V A;  5HQP A;  4XHM A;  4HU7 A;  2GLR A;  4NV5 A;  4ZBB A;  5F06 A;  5LD0 A;  2XBQ A;  4HU9 A;  2C3Q A;  1GUM A;  3A5W A;  4XS4 B;  4EC0 A;  1LJR A;  5ENU A;  3G7I A;  2JZT A;  3IK7 A;  3TGZ A;  1ERU A;  2ZCT A;  3A3T A;  4MF6 A;  3GTU B;  3CXG A;  3VFI A;  1PQN A;  2C0D A;  5ECL B;  3DD3 A;  5DJM A;  1X9S B;  1SU9 A;  3GX0 A;  3DYR A;  4EL1 A;  4F03 A;  2X8C A;  4NXI A;  4PTS A;  1BJX A;  1BX9 A;  3HCZ A;  4GSN A;  3TUE A;  1O8W A;  4TXO B;  1M2B A;  5HFK A;  5IMA A;  1G7E A;  4IVF A;  1NM3 A;  3L4N A;  2YOI A;  2CAQ A;  1T3B A;  4ZXG A;  4I5Q A;  2AJQ B;  2C0G A;  2H75 A;  5HR0 A;  2J23 A;  4QQ7 A;  3JCM L;  2TIR A;  1S3D A;  1JZW A;  1RK4 A;  2C80 A;  4N11 A;  2CX4 A;  3EC3 A;  4EKZ A;  2L5L A;  2LRC A;  1TU7 A;  1XWB A;  2WZ9 A;  4L5O A;  1AQX A;  1IYH A;  5ECI B;  14GS A;  2GDR A;  1EGO A;  2CQ9 A;  4BVX B;  3O6T A;  1GTI A;  3HKR A;  2GGT A;  4O5Q A;  2PVQ A;  3C1S A;  3KD0 A;  2DJJ A;  2HRA A;  3TOT A;  1EOH A;  2LRT A;  4IJ3 A;  3ZL5 A;  3DVW A;  3BOA A;  1T7P B;  4POB A;  4IBP A;  4F0B A;  2VCW A;  5DAK B;  1TRW A;  1DBY A;  3TOU A;  3BCK A;  1XWG A;  5CAX A;  2HZF A;  1XOB A;  1WJK A;  1XPV A;  4K9Z A;  2AUV A;  6GSY A;  3W6G A;  1EV4 A;  5IPH A;  2XC2 A;  5HR1 A;  3UBL A;  2L5O A;  2JAC A;  3TJB A;  4V1A p;  1SYR A;  1W4V A;  1ZCP A;  3GKM A;  3WD6 A;  4PQI A;  2PGT A;  1R26 A;  1WOU A;  2JU5 A;  4F2I A;  3APO A;  5ECO B;  1XXU A;  3IE3 A;  5J9C A;  1TI3 A;  3UAP A;  2KUC A;  4Q5F A;  1BAY A;  4ZB9 A;  5D93 A;  3VK9 A;  2FA8 A;  3J7Y k;  2P5R A;  16GS A;  2BTO T;  4HJM A;  5LCZ A;  4OCF A;  3LJR A;  2XBI A;  3KGK A;  1MD4 A;  2X4A A;  2IMI A;  2O7K A;  3RAZ A;  4EIP A;  2HRN A;  1M99 A;  2EC4 A;  4WBJ A;  3ZIJ A;  4BVY B;  5G31 A;  2CT6 A;  2MBS A;  5J5N A;  2E0Q A;  5IIZ A;  5G1L A;  1A2L A;  2CX3 A;  3F3Q A;  3TJG A;  2NTO A;  1GUL A;  3ZFB A;  1XWK A;  5IM9 A;  4CHS A;  1GUK A;  1GSD A;  2E7P A;  1B4Q A;  4EF0 A;  2R0P A;  2LJR A;  2E2M A;  3KMN A;  2C0F A;  2CZ2 A;  2GS3 A;  4USS A;  3GA4 A;  3IV4 A;  2LUS A;  1UVZ A;  1X9M B;  4XS6 A;  1GSQ A;  4EO3 A;  2N5F A;  2IN3 A;  2JZS A;  1XZO A;  5KN0 A;  1Z3E A;  1FB6 A;  5G30 A;  2EIR A;  4BWS A;  2A2P A;  2H76 A;  2VCQ A;  3FMW A;  4E8E A;  3QR6 A;  1K3O A;  4KUN A;  1F37 A;  5ECM B;  2IMD A;  1RW1 A;  2H73 A;  4ILF A;  5F0G A;  1GP1 A;  1NSW A;  2AHE A;  5H5S A;  1X5C A;  1FOV A;  4V2L A;  3O3T A;  1SL0 B;  1SJZ A;  4RQX A;  1YY7 A;  4HZ2 A;  5GZZ B;  3NIV A;  2PU9 C;  5D9X A;  1SK0 A;  4DSS B;  1PN9 A;  4MPF A;  3KIJ A;  5DDL A;  2R0G A;  3ME8 A;  1OKT A;  1BG5 A;  1AUC A;  2GQK A;  2EIQ A;  3KMO A;  4WXT A;  5DAL B;  4G0L A;  4KAE A;  4E8H A;  2G0F A;  1ML6 A;  2PUK C;  1YEP A;  2R0C A;  2RUE A;  5LNK e;  3IR4 A;  4O92 A;  4ZL7 A;  3VWW A;  2H01 A;  3U5R E;  5CNW A;  2HXK A;  4TR1 B;  4WR5 A;  5F8B A;  4D73 A;  4KH7 A;  2I81 A;  1SD8 A;  3KP9 A;  4YQM A;  4LMV A;  5HR2 A;  3APQ A;  4YAV A;  1B9Y C;  1TI1 A;  4ML6 A;  3VWV A;  5G5E A;  4HDE A;  4KGI A;  2MZC A;  1V2A A;  5IO2 A;  4WF4 A;  4EVM A;  4NPB A;  4MF5 A;  4QL9 A;  1B9X C;  1O85 A;  4EDY A;  3CRT A;  2C4J A;  2FWE A;  2V32 A;  4I2T A;  1EP7 A;  3HJM A;  5ECR B;  4G10 A;  5EL8 A;  3W8J A;  3FZ9 A;  5B6N A;  3LYP A;  2VLT A;  2NVL A;  3HJP A;  4EUY A;  4IQ1 A;  2FGX A;  4ACS A;  5EVO A;  3TKS C;  1R5A A;  2D2Z A;  3A2V A;  3SWL A;  2C3N A;  4H86 A;  2PVO C;  3H93 A;  4IHU A;  4GLT A;  4NMU A;  5ECK B;  2DIY A;  4KW6 A;  3UBK A;  1WP0 A;  2CVD A;  1O7U A;  1JZD A;  1QXH A;  3WYW A;  2L4C A;  4LL4 B;  1K0C A;  5IMD A;  4PXO A;  3VPT A;  2VD0 A;  4EXJ A;  2YWN A;  2M80 A;  2I1U A;  4I2U A;  1J08 A;  4L5L A;  4MK3 A;  3GH9 A;  2GZP A;  1TJD A;  5AIX A;  1QQ2 A;  3PGT A;  2R6K A;  3A5I A;  1ERV A;  2VO4 A;  1MEK A;  5JCW A;  1GLP A;  2N5B A;  5DQS A;  3TRX A;  3GST A;  5B8A A;  3CBU A;  2VCX A;  1SEN A;  3ZMK A;  4GTU A;  1A0F A;  3KH9 A;  1GH2 A;  2N5A A;  1Q4J A;  2IPA A;  5DCH A;  2JAD A;  1PKW A;  2YN1 A;  2WS2 A;  4WKW A;  1U88 A;  2WDU A;  4PNF A;  1CQH A;  1GSE A;  4JZQ A;  1EV9 A;  3TCO A;  2ON7 A;  4K6X A;  2PMT A;  4K5R A;  5D9T A;  1QK8 A;  1URM A;  3FR6 A;  1WRY A;  1THX A;  5A4W A;  4XRA A;  1JZO A;  17GS A;  1H4O A;  3D6I A;  3FRC A;  1GSY A;  3C73 A;  2O85 A;  1EGR A;  1XW9 A;  5D9W A;  5KN1 A;  5H5R A;  3GNJ A;  4TRX A;  4KSO A;  4TR0 A;  2M46 A;  1G0T A;  3IPZ A;  1TP9 A;  3FZ4 A;  3PPU A;  1AXD A;  4JRR A;  4J2F A;  3LYK A;  1F2E A;  1X9W B;  3HDC A;  1Y6E A;  3M3M A;  4O5R A;  2GST A;  2QKE A;  4DSQ A;  5ECS A;  2H70 A;  3RPN A;  3QFB C;  4MZB A;  4LLR A;  1KBN A;  1NW2 A;  3P7X A;  1PL1 A;  3DWV A;  2OAD A;  4G2E A;  1Z5Y E;  2YWI A;  4G0I A;  4HZ4 A;  4GXZ A;  2VUP A;  5F05 A;  4CY8 A;  4HUA A;  3S9F A;  2AB6 A;  2B1L A;  2H19 A;  1OE8 A;  3UEM A;  1VF2 A;  4ZIJ A;  1OC3 A;  4Q5N A;  3GKN A;  4AGS A;  1OAZ A;  3BBY A;  3HVV A;  4BL7 A;  2V41 A;  1ACV A;  5CRH A;  4O7H A;  2V1M A;  2RUF A;  1THO A;  1XCC A;  1XWC A;  4FYB A;  4Z2U A;  2HI7 A;  4NAX A;  1KEB A;  1HYU A;  2CVB A;  3CSH A;  3H4K A;  2RM6 A;  4TN8 A;  5IO0 A;  4MCU A;  4JBB A;  3ZIT A;  1QUW A;  1TK5 B;  3ED3 A;  1ZL9 A;  2MYG A;  1WPI A;  1QMV A;  1TDI A;  2YAN A;  7GSS A;  5D96 A;  5J41 A;  4OD7 A;  3EUR A;  2OAC A;  2I4A A;  4WF5 A;  4GWR A;  5INY A;  2CA8 A;  2P31 A;  4K8M A;  3UMA A;  5COH A;  2HZE B;  5JWQ B;  1IYI A;  3MSZ A;  1YKC A;  20GS A;  4ZBA A;  3CRU A;  2HLS A;  2H1D A;  2X8G A;  2LTK A;  1JLV A;  3IHQ A;  6GSX A;  3ZML A;  3TKS A;  1T4Y A;  2YPM A;  5ECQ B;  18GS A;  8GSS A;  1R5P A;  1XW6 A;  3M9K A;  4MJC A;  2DKI A;  2VCV A;  2K18 A;  4ECJ A;  2YWM A;  1Z6N A;  1Z7P A;  4X43 A;  2OKA A;  1XW5 A;  1KNG A;  5HFG A;  3ZLP A;  1QGV A;  3G7J A;  4MP4 A;  2B6M A;  1PSQ A;  2FWG A;  3QAV A;  1XBS A;  1TTZ A;  4MDC A;  5ELA A;  3E9J B;  3EPT A;  2F3M A;  1ZGN A;  1DUG A;  2F9S A;  1M2D A;  1MD3 A;  2OA7 A;  2X99 A;  3M8N A;  2P5Q A;  1YF1 A;  3RHC A;  2O8V B;  1K0O A;  2IFQ B;  3LXZ A;  3TJF A;  3FHK A;  5CRD A;  4NHW A;  3DXB A;  2LKU A;  2NDO A;  5J9B A;  1GSS A;  5G5F A;  1K3L A;  2A4H A;  2LNS A;  2I3Y A;  3UVT A;  1O73 A;  3F9U A;  1B4P A;  2H1A A;  3GN3 A;  1GWC A;  6GSU A;  2PN8 A;  3TRP A;  4MNN A;  3ZZX A;  2H1G A;  1YKA A;  3ZIV A;  3BJ5 A;  2R5G A;  3LGC A;  4X0X A;  5EY6 A;  4I8B A;  3CTF A;  3GUR A;  1HD2 A;  4LA1 A;  1N8J A;  3QPM A;  2MMA A;  4GF0 A;  3LWA A;  1JFU A;  4FO5 A;  5A4U A;  3P8W A;  3ERF A;  3TKS E;  2QA1 A;  3J7Y b;  4OMV A;  2J9H A;  1QFN A;  4J56 E;  4CW9 A;  4FYU A;  4AJ8 A;  1T8E B;  1F9M A;  5DQY A;  2C8U A;  3M9J A;  4GQF A;  2GSS A;  4HOJ A;  1LU4 A;  1CQG A;  2YJH A;  3C1R A;  3GUS A;  3P2A A;  3GHA A;  1M7T A;  3C7M A;  1GTB A;  1YEX A;  5ABR A;  4ISD A;  3L0H A;  1UN2 A;  4ID0 A;  3KEB A;  4XS4 A;  4MJE A;  3EMP A;  3KP8 A;  2DBC A;  2X64 A;  3F8U A;  3R3E A;  4XIH A;  2YV9 A;  4GQC A;  2H72 A;  1B8X A;  1FB0 A;  3GTU A;  4F9Z A;  1K0N A;  1OKD A;  5IMC A;  1SJ6 A;  4TR3 A;  2H66 A;  3I69 A;  5ID2 B;  2LV3 A;  1A8L A;  3HVX A;  6GSV A;  1SKS B;  4L0U A;  1U3I A;  3PIN A;  4OCE A;  3KZQ A;  2XPE A;  4CDO A;  1A24 A;  2BMX A;  4MH2 A;  4TXV A;  3IRA A;  4TXO A;  1MDI A;  2EIO A;  3DML A;  4LMW A;  5HR3 A;  3GSS A;  2MBT A;  3UIW A;  1TXX A;  5IOX A;  3DKS A;  1VRS D;  3TJK A;  3FW2 A;  4EIQ A;  2WRT A;  3WGD A;  3OR5 A;  4FIW A;  4EE0 A;  1G6W A;  4IGJ A;  3ZVJ D;  5IMV A;  2JL4 A;  6GSW A;  2A4V A;  1FO5 A;  3Q6O A;  1R4W A;  1M9B A;  3LSZ A;  4NHZ A;  4IJI A;  3F63 A;  4BVX A;  5KN2 A;  2IL3 A;  3QD9 A;  3GIX A;  3O76 A;  3F4T A;  4BPY A;  2PER A;  1NHY A;  1GUH A;  4IW9 A;  2FNO A;  3GKX A;  3E3E A;  1VF4 A;  1JLW A;  2K8V A;  2B5X A;  1OC9 B;  5D8I A;  2LEG A;  2FY6 A;  2R2J A;  1A2J A;  3CYN A;  3PR8 A;  3KCM A;  3FZA A;  1A2M A;  4QL7 A;  1EEJ A;  3MWH A;  5DJL A;  5JWR B;  4EDZ A;  5BRT A;  3BD2 A;  3Q18 A;  1T1V A;  4FH8 A;  3RBT A;  3W8S A;  2B1K A;  1N2A A;  3N9J A;  2HRF A;  1W89 A;  3HY2 A;  4GST A;  2GT5 A;  1AQV A;  2HNL A;  5B7C A;  5CO3 A;  4WET A;  5J3R A;  1M2A A;  5C04 A;  1YQ1 A;  2HE3 A;  3QAW A;  4XTS A;  2VL2 C;  3GV1 A;  1EWX A;  4IS0 A;  2B3S A;  2LQQ A;  1M9A A;  3TRQ A;  3F6D A;  1ERW A;  3ZRE A;  4ECI A;  1AAZ A;  2VL9 A;  3GKK A;  4PUF C;  2DIZ A;  1FOH A;  3US3 A;  3DRN A;  1SYX A;  1BQ7 A;  2VAF A;  4ECB A;  1AW9 A;  1ZYN A;  3ZVJ A;  2VM2 A;  4MZC A;  1T4Z A;  4K7N A;  1FAA A;  4BVY A;  1OVN A;  5DVB A;  4G0K A;  3ME7 A;  1Q98 A;  4BA7 A;  3DGQ A;  2IMK A;  4TW5 A;  1MDK A;  3F0I A;  3M1G A;  1YJ6 A;  1YZX A;  3DIE A;  3L78 A;  4IN0 A;  2YZU A;  3GX8 A;  1EEM A;  2NBS A;  3DEX A;  1TRV A;  2WFC A;  22GS A;  2OBK A;  4PUR A;  1XVW A;  1EP8 A;  3D22 A;  1Z7R A;  2F8F A;  3CTG A;  1ZYP A;  3MYD A;  4TKY A;  3U6V A;  2REM A;  4RQR A;  4IKH A;  1U6T A;  3TJJ A;  2L57 A;  1X5E A;  3I6A A;  1PMT A;  4V2N A;  5L71 A;  2AYT A;  3I43 A;  5AGY A;  4HJ2 A;  4JR4 A;  3UJ1 A;  1E2Y A;  2DJ0 A;  4KDX A;  3FR3 A;  2HT9 A;  2ZUP A;  2R3X A;  2DC5 A;  1YF0 A;  1FG4 A;  2VOC A;  4HS1 A;  2AAW A;  4I97 A;  4PUA A;  2VIM A;  5CRG A;  1G6Y A;  1ABA A;  4DSS A;  3HVS A;  3VI5 A;  3VLN A;  4NV2 A;  5KEJ A;  4JU5 A;  4CY6 A;  5DAL A;  3IC4 A;  1ST9 A;  3MNG A;  4FQU A;  5JCG A;  2FCH A;  4N30 A;  1JHB A;  4RUV A;  1XFL A;  4KE3 A;  1FVJ A;  3Q19 A;  4O32 A;  2LS5 A;  4KF9 A;  1AQW A;  2H0H A;  1AIU A;  3GL3 A;  1M0U A;  3L9U A;  4TR1 A;  4PQH A;  11GS A;  1GLQ A;  1RQM A;  3UL3 A;  1TK0 B;  4IP6 A;  4MLY A;  3KM6 A;  5FWG A;  5E4W A;  1ZZY A;  3SBC A;  5ECN B;  5F07 A;  2B7K A;  4KND A;  1WE0 A;  2GSR A;  2BJX A;  1OC8 A;  4RI6 A;  2HRK A;  2YJ7 A;  4K7O A;  4JED A;  3APS A;  4ULX A;  2K9F A;  4TVE A;  3D5J A;  5AIS A;  2LST A;  4XS1 A;  5BMU A;  4PNG A;  4K0N A;  3A2W A;  1V58 A;  2B7J A;  4IQA A;  2TRX A;  2YWO A;  3F4R A;  4F0C A;  3UAR A;  1I5G A;  3GRX A;  3L9S A;  2VL2 A;  3FKF A;  3FK8 A;  2ON5 A;  2OE3 A;  5AN1 A;  2HYX A;  5IOW A;  2OE0 A;  2FA4 A;  3GL5 A;  4YH2 A;  4ZL9 A;  1MDJ A;  3MIX A;  4V1A g;  3KJY A;  2KP2 A;  2CZ3 A;  1U3A A;  2VLU A;  2GTU A;  4WEY A;  1PKZ A;  4ZL8 A;  4BWQ A;  1A0R P;  2H30 A;  2IWT A;  2FUG 2;  1J9B A;  5E59 A;  4POM A;  4X4J A;  2L6D A;  3WT1 A;  2YNX A;  3IAS 2;  1O81 A;  2GT6 A;  1AC1 A;  4MJA A;  2HSY A;  2RLI A;  2GVP A;  4A5P A;  2VCT A;  1MTC A;  1DE2 A;  4O5U A;  4JR6 A;  3IDV A;  2IIY A;  3WGE A;  2C1Y A;  3LQ7 A;  5A4V A;  3MAK A;  5G1K A;  1TW9 A;  1ZMA A;  5FT3 A;  5EPF A;  1PD2 1;  3H1N A;  1GSU A;  2KP1 A;  5DBQ A;  2DJ1 A;  4POL A;  6GST A;  2H1B A;  4Q5R A;  1H75 A;  4YQV A;  4OO4 A;  4N0Z A;  1XOA A;  4KCA A;  5J4U A;  4P3Y B;  3HZ4 A;  4YQU A;  5H5Q A;  4PQ1 A;  4MJB A;  1V40 A;  9GSS A;  1OYJ A;  2H6Z A;  3VWX A;  5JCU A;  2JSY A;  2FWF A;  1GSF A;  3CSI A;  2B5Y A;  2KHP A;  2QSI A;  4AJ6 A;  1ZYE A;  3VWU A;  1PX6 A;  3UOM A;  2GZZ A;  1HNC A;  1E6B A;  4KDY A;  4KB3 A;  2XHF A;  3IK9 A;  2H6Y A;  1ON4 A;  1FHE A;  2V6K A;  4WBR D;  2FHE A;  4LL1 B;  3ZTL A;  5ECP B;  5DCG A;  2R37 A;  4YKF A;  1TRS A;  1EZK A;  4F82 A;  1K3Y A;  1YDK A;  4GSS A;  3HJO A;  3G9B A;  1EOG A;  4D73 B;  2F51 A;  3LXT A;  1Z9H A;  2Z9S A;  5CRE A;  4MH3 A;  2PWJ A;  3KTL A;  3LG6 A;  1TU8 A;  1ZYQ B;  1I9D A;  13GS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...