4KSOA

Crystal structure of circadian clock protein kaib from s.elongatus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
ILKLYVAGNTPNSVRALKTLKNILEVEFQGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPLPVRRIIGDLSDREKVLIGLDLLYGELQDSDDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Circadian clock protein KaiB
publication title CryoEM and Molecular Dynamics of the Circadian KaiB-KaiC Complex Indicates KaiB Monomers Interact with KaiC and Block ATP Binding Clefts.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Circadian clock protein
total genus 20
structure length 95
sequence length 95
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07689 KaiB KaiB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ksoA00
1XWAA 3L9VA 4HZ4A 2FHEA 3RPNA 4OO4A 3QFAC 1W4VA 4PXOA 5H5SA 3HVXA 5D9WA 5G31A 1FO5A 4XS1A 3ZIVA 3HZ4A 1EOHA 1M2AA 2H74A 4ZB6A 3J7Yk 2IL3A 1O8XA 2PVOC 2X8GA 2ON7A 1AQXA 3M9JA 1THOA 5EVOA 3CSJA 1WRYA 1UA5A 4POLA 4NPBA 2VL3A 3VWXA 1TI1A 3I6AA 1B4PA 3GH6A 2YPMA 1SKWB 1G6YA 4TXOB 17GSA 2XHFA 2AUVA 3BCKA 4IN0A 4RUVA 4Q5QA 1GSUA 1EWXA 1A2JA 3ZLPA 2O89A 4CHSA 2I9HA 4J57E 1R4WA 2ALBA 1TDIA 1VRSD 5H5RA 11GSA 4FO5A 3QD9A 1XWBA 4WR5A 3N5OA 3G7JA 4J56E 1QUWA 1X9WB 3ZMLA 2C3TA 2P0GA 3TKPA 1Z7PA 4PUAA 4KX4A 4XCSA 1SJIA 3GRXA 3IXRA 1SKRB 3ERGA 4MDCA 3TRQA 2KHPA 2B7KA 3GHAA 5IMCA 3TKQA 2A2SA 4IVFA 2CA8A 1K0AA 5C00A 2H70A 5J9BA 2VCWA 5J41A 3KJYA 2DJ3A 1GSEA 3IOSA 2H0IA 4NMUA 4XS4B 1LBKA 1ERUA 3RDWA 3LGCA 2V6OA 4MZCA 5DJMA 5CNWA 3ZFLA 3O6TA 2N5BA 1ERVA 2WS2A 2H73A 4DSSB 12GSA 1RQMA 1WJKA 3L78A 2O85A 1LJRA 4I6XA 2YN1A 4EVMA 1PKZA 1JHBA 4N10A 1WIKA 3GIXA 4ULXA 3TOUA 4GQFA 5HQPA 1TK0B 1S3CA 3W8JA 4K8MA 4EDZA 4KE3A 1YZXA 3DMLA 1EGOA 3LFLA 2GZZA 1XBSA 1JZDA 4K2DA 3CSHA 2ZCTA 3D22A 4K7NA 2I81A 4HS1A 2IMKA 3U6VA 1GH2A 2HZEA 3KD0A 4FYUA 2C0DA 3QFBC 2E0QA 3M1GA 3VK9A 1OC8A 5ID2A 3H93A 1B9XC 5KEJA 1TP9A 3KH9A 1A8LA 3HY2A 1XXUA 3HVVA 4G2EA 3M3MA 4MP4A 3GFKA 3LEFA 4JZQA 5ECLB 2LS5A 2E2GA 4O32A 1AW9A 3APQA 3L9UA 5G2ZA 2LNSA 2DIYA 7GSSA 4MA9A 2MBSA 2R3XA 3HJOA 1BG5A 3F6FA 4JU5A 4F0BA 2OE3A 5AN1A 2WULA 2PN8A 2P31A 4KNDA 3FR6A 3F4RA 2B1LA 2L57A 2OADA 4K0GA 2XPEA 2F9SA 5AIXA 5D96A 1MDKA 3TJBA 3I69A 3EINA 1TU8A 5HFGA 1Q4JA 1Z9HA 3ED3A 3GKNA 2BJXA 2FWEA 1GULA 1ZL9A 2HLSA 4GWRA 1SK1A 5ECKB 3VPQA 2YCDA 4Z7XA 2IN3A 4OFMA 2CAIA 2H6XA 1GL8A 3EU3A 2C3QA 5H5QA 2B5YA 3WGDA 4WEYA 2VOCA 2J9HA 5DQSA 1K0NA 3TRXA 3FR9A 2VO4A 4ML1A 2O7KA 2C3NA 5ELGA 4F9ZA 3ME8A 6GSSA 2RLIA 6GSTA 2L4CA 2YV7A 3D0ZA 1A2MA 4O5RA 4F82A 2H19A 3Q19A 4KUNA 1JZWA 1CQHA 1T00A 3KIJA 2VCQA 2MMZA 4Q5NA 4GRFA 3W6GA 1X9MB 2V6KA 1R5PA 1YY7A 3TJKA 3FY7A 1SENA 1R7HA 3LSZA 4NV2A 4CW9A 1QQ2A 1UVZA 4QL9A 1TRVA 3HDCA 4IHUA 2P5RA 5IQYA 4IP1A 3MDKA 1IYHA 2VL9A 4WBRD 3EMPA 4PQIA 1FHEA 4PURA 2XBIA 3DEXA 3MSZA 5E4WA 2I3YA 1EP7A 4V2MA 3RHCA 2M46A 1EEJA 3GN3A 3WT2A 2GLRA 1M99A 1E2YA 2GS3A 2K8SA 4MZBA 1H75A 1M2DA 2WDUA 3D5JA 2HSYA 5A4WA 4YAPA 1M0UA 3HJPA 2AHEA 1TK5B 4FIWA 1O73A 3UMAA 2G2QA 1J08A 6GSUA 5JWQB 4OFNA 2LJAA 1X9SB 3ERFA 3I9V2 1AXDA 2G0FA 1AQWA 1AIUA 4GSSA 2DJ2A 4X1UA 2C0EA 3TJGA 3VWWA 2M80A 5ID2B 3HZ8A 4LMWA 1GSYA 3KZQA 4IW9A 3C1SA 5JWRB 1TW9A 2XBQA 4X43A 3BBYA 2BTOT 1G6WA 1XVQA 3TKSA 1XFLA 1TRSA 1FW1A 3TJJA 4ML6A 1TJDA 22GSA 2FA8A 5ECQB 4YQUA 2F3MA 4LMVA 4N0VA 3VPTA 4MF6A 5CRWA 4DSRA 2XPDA 5J9CA 1I5GA 1PQNA 1WE0A 2YWIA 4KCAA 2VL2C 3IDVA 1VF4A 2QC7A 2QKEA 3CMIA 1KNGA 1N2AA 2FWFA 2CVBA 2H6YA 3APSA 4LL1B 3GKKA 2LSTA 3EYTA 4TOPA 1BQ7A 4ZILA 3A5WA 3FZ4A 3GNJA 3FRCA 5C04A 2A4VA 1PL2A 2WJUA 5J4UA 2ZNMA 4XIHA 2RUFA 3TRPA 3UEMA 4ACSA 2FWHA 2IIYA 2C8UA 2VLVA 3GUSA 3LYPA 1TTZA 2H01A 2H30A 5CREA 3KGKA 1HQOA 4KDXA 4K7OA 4NWYA 3VI7A 1H4OA 4FH8A 3DRNA 5DAKA 2OBKA 1YJ6A 2CX3A 3UIWA 4J2FA 4POKA 3C7MA 4MF7A 3FZAA 5FT3A 3FW2A 3VURA 4WBJA 4GCIA 2H72A 3L4NA 3GX0A 2EIRA 1MDJA 1GNEA 2R37A 3LXTA 5IOXA 2MMOA 4EL1A 2N5FA 1SJ6A 5DJLA 1T4ZA 4DVCA 3DWVA 1I9DA 3DD3A 5G1KA 5KN2A 3IK9A 5ECHB 1TK8B 3CBUA 2WRTA 2JSZA 2IJYA 3KTLA 5J5NA 2K6VA 2YANA 3GKXA 4IQAA 3NZNA 5GZZB 3UBLA 2KUCA 4OCEA 1QFNA 3BCIA 3D6IA 1AUCA 2L59A 3CRUA 4ECCA 1FG4A 3IPZA 2VIMA 4K6XA 1Z7RA 2WZ9A 1FOVA 3HA9A 2CQ9A 2EIOA 5HR2A 3PH9A 4AF2A 1OC9B 3KM6A 5CO3A 4TR0A 2YWOA 5ECRB 3GV1A 5ECPB 4MZWA 1URMA 3P2AA 1GTAA 2DJKA 3QPMA 3GSTA 4ZL9A 1O6JA 2FCHA 1FVKA 2VUPA 1B48A 4MLYA 1BEDA 1KTEA 4MJCA 1X5EA 1TU7A 2WB9A 5DCGA 1ZCPA 5J3RA 3M0FA 3M8NA 4TR3A 5F0GA 2LJRA 3G7IA 3U5RE 1A0RP 1EZKA 1B8XA 2YV9A 4TN8A 1ZYQB 4ZIJA 3ZYWA 4OMVA 4WF5A 3H8QA 3PGTA 1SK2A 2H8LA 3CYNA 2H1BA 2B6MA 2XC2A 2L5LA 3EMXA 2HE3A 4MPGA 3D21A 2OA7A 4BWSA 1PX7A 2V2GA 5HFKA 2QSIA 3Q18A 3V1WA 3WT1A 3IK7A 5LCZA 4HOJA 2V41A 2TRCP 1GSDA 4TR1A 4QQ7A 4XTSA 4KGIA 5DVBA 1T4YA 3HD5A 4K0NA 5GSTA 3HYPA 2PPTA 1M7TA 3F4SA 4ZBAA 4HQZA 3TDGA 4MJBA 1SD8A 2X64A 5F8BA 2H1DA 3MWHA 4ZL7A 1YKCA 4JR4A 4AJ7A 2OKAA 2RUEA 5ECNB 3ISOA 4JR6A 2WGRA 5JCUA 1U88A 5B6NA 2H76A 1YDKA 1XZOA 3SBCA 2LNTA 2LRCA 1RW1A 3O3TA 5FWGA 2B5XA 4H86A 3CTGA 2B5EA 4E8EA 4HZ2A 1ABAA 2JSYA 2H1GA 1DUGA 2IFQB 3F63A 5ECOB 3F4TA 3KMOA 3PR8A 3VI5A 3APOA 4TXVA 3VWVA 3GSSA 4KW6A 5IPGA 4ECIA 1T7PB 3IAM2 3GL5A 3TJFA 2GSTA 3ERWA 2ZUPA 3EWLA 3DVXA 1OVNA 1XPVA 2VCXA 3TUEA 3F8UA 5A5KA 3US3A 1YKAA 2IMIA 1SJZA 2GZPA 4AJ6A 3RBTA 3UOMA 4ZXGA 4QL7A 3P7XA 3DIEA 3IHQA 4D73A 1F37A 1XIYA 4NXIA 3L9SA 1VF1A 1OYJA 2H1AA 2L6DA 5F07A 3LQ7A 4PQHA 5LD0A 3KP8A 4ECBA 2Z9SA 4I8BA 4HU9A 3G9BA 10GSA 1OC3A 2IPAA 1T3BA 2EIQA 4YH2A 1O8WA 3A2WA 4DEJA 1EV4A 4XRDA 4OCFA 3ZIJA 3TB2A 1HNAA 2NPBA 5DBQA 1ZMAA 1M2BA 3QCPA 18GSA 4WF4A 2GZYA 1BAYA 2VCVA 3HXSA 4G19A 4JE1A 3IBHA 2C80A 4ID0A 4Q5FA 2I1UA 4RI7A 1G7OA 1K0BA 3QAWA 2DIZA 2L5OA 4CDOA 2A2RA 2VD0A 3GTUA 5G30A 4F03A 1XOAA 2TIRA 2HFDA 3F3QA 4WKWA 2GQLA 1O81A 4ZBDA 5AGYA 1PRXA 3LWAA 2R4VA 3LJRA 2AJQB 1V40A 4Q5RA 3UVHA 3QR6A 4EC0A 2VM2A 1C72A 3JCML 2HNLA 2PWJA 4WXTA 1SU9A 2KLXA 4BA7A 2DMLA 4YQMA 1ACVA 3SWLA 2MZCA 2AB6A 4I5QA 1X0RA 4IP6A 4LA1A 5EL8A 2TRXA 2LQOA 1K0OA 1Z5YE 5CRHA 2LQQA 5B6MA 4YAVA 3QDNA 3A2XA 1V58A 3GYKA 4GSTA 3LXZA 3BOAA 2JZTA 1DE1A 3ZL5A 2CAQA 3GH9A 2H0HA 5F06A 3N9JA 4BVYA 2GT5A 4IJ3A 1M9AA 2FA4A 2HT9A 1ZOFA 1TRWA 2VL2A 3IR4A 3IE3A 3GA4A 2C1YA 5B7CA 2VLUA 4AGSA 4EO3A 4O7HA 4MF5A 2FWGA 2LV3A 1GLQA 5CYYA 5ENUA 6GSYA 1K3LA 2CZ2A 4JBBA 1LU4A 2JADA 2JL4A 3WGXA 4BVXA 1OE7A 4FYBA 4XHMA 2AYTA 4EF0A 1XW6A 1SK0A 3TCOA 2RIIA 1ILOA 4IELA 4E8HA 5D73A 3FK8A 2YZUA 5IMAA 2LRTA 1WOUA 2OACA 5G1LA 1JLVA 3F6DA 4V1Ag 2R5GA 2X99A 2FLSA 2CVKA 2PERA 2H0GA 1ZYEA 5CAXA 1IYIA 4MABA 1M9BA 2HZEB 2L6CA 1PN9A 2GSQA 3P90A 1CQGA 4LLRA 1K3OA 2HRFA 4OFTA 3VLNA 5ECMB 1N8JA 2FUG2 1BJXA 3UARA 2OJLA 4PX1A 3FZ9A 5ELAA 3EC3A 1GUKA 4D73B 4XS4A 3L0HA 4ZL8A 1PD21 1X5CA 1ON4A 5A4UA 2H66A 1OE8A 2B3SA 5D93A 2NBSA 2LEGA 3IAS2 3C73A 1J9BA 4TRXA 5HR1A 2X8CA 2VCZA 2GSSA 5IMZA 1HNBA 4RI6A 3HKRA 2YJHA 4MJEA 1B4QA 4GLTA 1XW5A 2EC4A 5KN0A 1XWGA 2FY6A 4MH3A 2IMEA 5B8BA 2CX4A 4OD7A 1SD9A 4XS6A 2YWNA 3GTUB 3UAPA 1FAAA 1YF0A 3G7YA 5AISA 4HU7A 4BPYA 3W8SA 2MMAA 5DALA 1TRUA 1F2EA 3KXOA 3IRAA 2AAWA 1PSQA 1VF2A 1G0TA 4EE0A 2K18A 4HUAA 3H1NA 2DLXA 4TKYA 4XRAA 2C0FA 3RAZA 4MH2A 1FVJA 4HJMA 3HHVA 2V32A 3UBKA 4V1Ap 1EOGA 2HRNA 1TXXA 1R5AA 5ECIB 4PNGA 2QGVA 2RM5A 2E2MA 2PGTA 4ILFA 2KP2A 3A3TA 3WYWA 1XWCA 4MJAA 5IM9A 4O92A 5HR0A 4HDEA 1ERWA 4JRRA 4MPFA 4IJIA 3EURA 4RQRA 3TKSC 1GTBA 2VM1A 5GAPD 2B7JA 2X8HA 4IS0A 3I43A 2VD1A 2CVDA 1NHOA 3EE2A 1QGVA 3C1RA 1WPIA 1F3BA 3Q74A 2K9FA 4HJ2A 4BWQA 2V1MA 3DKSA 1NM3A 1K0MA 4MK3A 2OE0A 3Q6OA 3VFIA 1GWCA 4K1FA 3TGZA 1V9WA 1PL1A 5IO0A 2CT6A 3FR3A 3J7Yb 1S3DA 2O87A 2KP1A 5LNKe 2HYXA 5JCWA 4EDYA 3GMFA 3GKMA 3IC4A 5IOWA 4N30A 1Z3EA 5INYA 1TKDB 4KCEA 1F6MC 1TOFA 5IMDA 1ERTA 1QK8A 3UVTA 4L0WA 19GSA 1XW9A 5DCHA 2DJ1A 3CRTA 5COHA 1PMTA 2R2JA 5IO2A 4EUYA 1DE2A 4NAXA 4PQ1A 1R26A 5DQYA 2YZHA 1GUMA 3BD2A 4KH7A 1GRXA 1V57A 3F3RA 4GXZA 3GURA 4GSNA 1U6TA 2GDRA 2F8AA 2O8VB 1YEPA 3S9FA 1PA3A 5ECSA 5IMVA 1E6BA 1EP8A 1ZZYA 2PBJA 2NTOA 1MEKA 4L5LA 2DC5A 5G5FA 2L4QA 4NHZA 5IPHA 1O7UA 1A2LA 2DBCA 2PVQA 2F51A 1YEXA 1GLPA 2GT6A 1XCCA 3FKFA 5D9VA 1UC7A 1GSFA 2H75A 1DSBA 3GX8A 1MTCA 1UN2A 4AJ8A 5KN1A 1X5DA 2WFCA 4WETA 4TVEA 4KDYA 1GP1A 1PKWA 2GTUA 6GSXA 4GF0A 1ST9A 3MAKA 3MNGA 3KP9A 4L8EA 1HYUA 3ZREA 5DAKB 5DDLA 4MMMA 3HCZA 1SL0B 3QOUA 2J23A 5DALB 4EKZA 3QAGA 3O76A 6GSWA 1GSSA 1Z6NA 3WGEA 1F9MA 2D2ZA 2OE1A 3EU4A 5EY6A 2WCIA 3E3EA 2ON5A 4POMA 5F05A 1EV9A 4KA0A 4G10A 4JEDA 2B1KA 4ZB8A 1VGLA 2ES7A 3K8NA 2OBIA 1WWJA 4P3YB 1NSWA 3M9KA 1K0CA 9GSSA 1A23A 2DMMA 1SYXA 4F2IA 1OKTA 2VLTA 2R6KA 3ZVJA 4G9HA 1AC1A 1SL2B 4ZB9A 4EXJA 3QAVA 1HNCA 2E7PA 2C4JA 3QMXA 4HEA2 4IQ1A 5D9XA 1PX6A 3A2VA 4KB3A 1A24A 2F8FA 3IV4A 4LL4B 2CZ3A 2VAFA 2BMXA 2FD3A 3KMNA 5D9TA 3KH7A 3F0IA 1T8EB 3E0UA 4NV5A 5B8AA 1V98A 1AQVA 2GGTA 3AY8A 2PUKC 1QMVA 3LG6A 5CRDA 3H4KA 3H79A 1Y25A 3C8EA 1VF3A 4N0ZA 1TI3A 5CRGA 1Z6MA 2GQMA 3UJ1A 1KEBA 5CP1A 4IKHA 3KEBA 4X0XA 2JU5A 1GSQA 4IBPA 2LRNA 1PGTA 3VWUA 4PUFC 1S3AA 2RM6A 1Y6EA 3ZVJD 1JZOA 3ZFBA 3TOTA 3DVWA 4PNFA 4MCUA 3TKRA 1USBA 1K3YA 13GSA 4BL7A 2VCTA 1O85A 3E9JB 4I2UA 4KAEA 3DXBA 4POBA 1AAZA 1THXA 2H71A 4L0UA 4DSQA 2YWMA 5D8IA 4TR1B 2NDOA 3OR5A 2MMNA 3C71A 1RK4A 4TW5A 2HI7A 1GTIA 6GSVA 3KCMA 4ECJA 5IMFA 1T1VA 1OAZA 3NIVA 4N11A 5ABRA 1JLWA 3FZ5A 2HZFA 5AIVA 5IIZA 1OC9A 3ZITA 2GVPA 4OO5A 1V2AA 5FHIA 4TXOA 2JZRA 2CV4A 3CTFA 1G7EA 1JFUA 4WR4A 5GAND 3PINA 2JACA 1MD3A 1NW2A 4FYCA 8GSSA 4K7IA 3R2QA 1A8YA 2YJ7A 3BJ5A 2JZSA 2C0GA 5G5EA 5HR3A 2FNOA 1FB6A 2IMFA 1GUHA 2I4AA 1K0DA 4KSMA 1XWKA 4KDUA 3DYRA 3RPPA 5GSSA 3HJMA 2DJ0A 4YQVA 2AV4A 3IA1A 4F0CA 1XOBA 1QXHA 4V2NA 3P8WA 2PMTA 2KOKA 4HQSA 4ZBBA 1FB0A 5JWOB 1U3IA 3CSIA 1ZGNA 1U3AA 3TKSE 1Q98A 3CXGA 4RQXA 2REMA 16GSA 1MDIA 3ZTLA 2N5AA 20GSA 3ZMKA 3HVSA 2MBTA 1U87A 1SKSB 2YP6A 3NOFA 2GSRA 4GTUA 3ZRDA 3DGQA 1XVWA 3WD6A 4DSSA 1YQ1A 1SYRA 1BYEA 2DJJA 5L71A 1JZRA 1ML6A 1MD4A 3ME7A 2PU9C 3GL3A 5E59A 1DBYA 3D4TA 4K9ZA 2GQKA 2IWTA 1EGRA 2YOIA 3RHBA 5KN3A 2M72A 3LORA 4ISDA 1HD2A 2H6ZA 2HSHA 3EVIA 5HFIA 1W89A 1YF1A 2DSAA 2YNXA 2NVLA 2MYGA 4OWYA 2K8VA 3D4MA 4NHWA 2IFQA 2LUSA 4I97A 5EPFA 3FEUA 2HXKA 3UL3A 2LJKA 3ZZXA 4TR4A 1WP0A 1GTUA 1GNWA 1OKDA 4IGJA 4V2LA 3FYGA 2IMDA 2FGXA 3LYKA 3F9UA 1J0FA 4L5OA 1BX9A 3KTBA 1B9YC 4GQCA 3FHKA 1A0FA 4PGTA 2LTKA 1KBNA 4HI7A 4KSOA 4I2TA 1NHYA 1WMJA 2LKUA 1EEMA 1F3AA 2P5QA 14GSA 5A4VA 5JCGA 1SL1B
chains in the Genus database with same CATH superfamily
1XWAA 3L9VA 4HZ4A 2FHEA 3RPNA 4OO4A 3QFAC 1W4VA 3FMWA 4PXOA 5H5SA 3HVXA 5D9WA 5G31A 1FO5A 4XS1A 3ZIVA 3HZ4A 1EOHA 1M2AA 2H74A 4ZB6A 3J7Yk 2IL3A 1O8XA 2PVOC 2X8GA 2ON7A 1AQXA 3M9JA 3MIXA 1THOA 5EVOA 3CSJA 1WRYA 1UA5A 4POLA 4NPBA 2VL3A 3VWXA 1TI1A 3I6AA 1B4PA 3GH6A 2YPMA 1SKWB 1G6YA 4BVXB 4TXOB 17GSA 2XHFA 2AUVA 3BCKA 4IN0A 4RUVA 4Q5QA 1GSUA 1EWXA 1A2JA 3ZLPA 2O89A 4CHSA 2I9HA 4J57E 1R4WA 2ALBA 1TDIA 1VRSD 5H5RA 11GSA 4FO5A 3QD9A 1XWBA 4WR5A 3N5OA 3G7JA 4J56E 1QUWA 1X9WB 3ZMLA 2C3TA 2P0GA 3TKPA 1Z7PA 4PUAA 4KX4A 4XCSA 1SJIA 3GRXA 3IXRA 1SKRB 3ERGA 4MDCA 3TRQA 2KHPA 2B7KA 3GHAA 5IMCA 3TKQA 2A2SA 4IVFA 2CA8A 1K0AA 5C00A 2H70A 5J9BA 2VCWA 5J41A 3KJYA 2DJ3A 1GSEA 3IOSA 2H0IA 4NMUA 4XS4B 1LBKA 1ERUA 3RDWA 3LGCA 2V6OA 4MZCA 5DJMA 5CNWA 3ZFLA 3O6TA 2N5BA 1ERVA 2WS2A 2H73A 4DSSB 12GSA 1RQMA 1WJKA 3L78A 2O85A 1LJRA 4I6XA 2YN1A 4EVMA 1PKZA 1JHBA 4N10A 1WIKA 3GIXA 4ULXA 3TOUA 4GQFA 5HQPA 1TK0B 1S3CA 3W8JA 4K8MA 4EDZA 4KE3A 1YZXA 3DMLA 1EGOA 3LFLA 2GZZA 1XBSA 1JZDA 4K2DA 3CSHA 2ZCTA 3D22A 4K7NA 2I81A 2R0CA 2X4AA 4HS1A 2IMKA 3U6VA 1GH2A 2HZEA 3KD0A 4FYUA 2C0DA 3QFBC 4G0IA 2E0QA 3M1GA 3VK9A 1OC8A 5ID2A 3H93A 1B9XC 5KEJA 1TP9A 3KH9A 1A8LA 3HY2A 1XXUA 3HVVA 4G2EA 4ICYA 3M3MA 4O5UA 4MP4A 3GFKA 3LEFA 4JZQA 5ECLB 2LS5A 2E2GA 4G0KA 4O32A 1AW9A 3APQA 3L9UA 5G2ZA 2LNSA 2DIYA 7GSSA 4MA9A 2MBSA 2R3XA 3HJOA 1BG5A 3F6FA 4JU5A 4F0BA 2OE3A 5AN1A 4A5PA 2WULA 2PN8A 2P31A 4KNDA 3FR6A 3F4RA 2B1LA 2L57A 2OADA 4K0GA 2XPEA 2F9SA 5AIXA 5D96A 1MDKA 3TJBA 3I69A 3EINA 1TU8A 4EIPA 5HFGA 1Q4JA 1Z9HA 3ED3A 3GKNA 2BJXA 2FWEA 1GULA 1ZL9A 2HLSA 4GWRA 1SK1A 5ECKB 3VPQA 2YCDA 4Z7XA 2IN3A 4OFMA 2CAIA 2H6XA 1GL8A 3EU3A 2C3QA 5H5QA 2B5YA 3IHGA 3WGDA 4WEYA 2VOCA 2J9HA 5DQSA 1K0NA 3TRXA 3FR9A 2VO4A 3R3EA 4ML1A 2O7KA 2C3NA 5ELGA 4F9ZA 3ME8A 6GSSA 2RLIA 6GSTA 2L4CA 2YV7A 3D0ZA 1A2MA 4O5RA 4F82A 2H19A 3Q19A 4KUNA 2A2PA 1JZWA 1CQHA 1T00A 3KIJA 2VCQA 2MMZA 4Q5NA 4GRFA 3W6GA 1X9MB 2V6KA 1R5PA 1YY7A 3TJKA 3FY7A 1SENA 1R7HA 4O5QA 3LSZA 4NV2A 4CW9A 1QQ2A 1UVZA 4QL9A 1TRVA 3HDCA 4IHUA 2P5RA 5IQYA 4IP1A 3MDKA 1IYHA 2VL9A 4WBRD 4EIQA 3EMPA 4PQIA 1FHEA 4PURA 2XBIA 3DEXA 3MSZA 5E4WA 2I3YA 1EP7A 4V2MA 3RHCA 2M46A 1EEJA 3GN3A 3WT2A 2GLRA 1M99A 1E2YA 2GS3A 2K8SA 4MZBA 1H75A 1M2DA 2WDUA 3D5JA 2UZ8A 2HSYA 5A4WA 4YAPA 1M0UA 3HJPA 2AHEA 1TK5B 4FIWA 1O73A 3UMAA 2G2QA 1J08A 6GSUA 5JWQB 4OFNA 2LJAA 1X9SB 3ERFA 3I9V2 1AXDA 2G0FA 1AQWA 1AIUA 4GSSA 2DJ2A 4X1UA 2C0EA 3TJGA 3VWWA 2M80A 5ID2B 3HZ8A 4LMWA 1GSYA 3KZQA 4IW9A 3C1SA 5JWRB 1TW9A 2XBQA 4X43A 3BBYA 2BTOT 1G6WA 1XVQA 3TKSA 1XFLA 1TRSA 1FW1A 3TJJA 4ML6A 1TJDA 22GSA 2FA8A 5ECQB 4YQUA 2F3MA 4LMVA 4N0VA 3VPTA 4MF6A 5CRWA 4DSRA 2XPDA 5J9CA 1I5GA 1PQNA 1WE0A 2YWIA 4KCAA 2VL2C 3IDVA 1VF4A 2QC7A 2QKEA 3CMIA 1KNGA 1N2AA 2FWFA 2CVBA 2H6YA 3APSA 4LL1B 3GKKA 2LSTA 3EYTA 4TOPA 1BQ7A 4ZILA 3A5WA 3FZ4A 3GNJA 3FRCA 5C04A 2A4VA 1PL2A 2WJUA 5J4UA 2ZNMA 4XIHA 2RUFA 3TRPA 3UEMA 4ACSA 2FWHA 2IIYA 2C8UA 2VLVA 3GUSA 3LYPA 1TTZA 2H01A 2H30A 5CREA 3KGKA 1HQOA 4KDXA 4K7OA 4NWYA 3VI7A 1H4OA 4FH8A 3DRNA 5DAKA 2OBKA 1YJ6A 2CX3A 3UIWA 4J2FA 4POKA 3C7MA 4MF7A 3FZAA 5FT3A 3FW2A 3VURA 4WBJA 4GCIA 2H72A 3L4NA 3GX0A 2EIRA 1MDJA 1GNEA 2R37A 3LXTA 5IOXA 2MMOA 4EL1A 2N5FA 1SJ6A 5DJLA 4BL7B 1T4ZA 4DVCA 3DWVA 1I9DA 3DD3A 5G1KA 5KN2A 3IK9A 5ECHB 1TK8B 3CBUA 4MNNA 2WRTA 2JSZA 2IJYA 3KTLA 5J5NA 2K6VA 2YANA 3GKXA 4IQAA 3NZNA 5GZZB 3UBLA 2KUCA 4OCEA 1QFNA 3BCIA 3D6IA 1AUCA 2L59A 3CRUA 4ECCA 1FG4A 3IPZA 2VIMA 4K6XA 1Z7RA 2WZ9A 1FOVA 3HA9A 2CQ9A 2EIOA 5HR2A 3PH9A 4AF2A 1OC9B 3KM6A 5CO3A 4TR0A 2YWOA 5ECRB 3GV1A 5ECPB 4MZWA 1URMA 3P2AA 5KOWA 1GTAA 2DJKA 3QPMA 3GSTA 4ZL9A 1O6JA 2FCHA 1FVKA 2VUPA 1B48A 4MLYA 1BEDA 1KTEA 4MJCA 1X5EA 1TU7A 2WB9A 5DCGA 1ZCPA 5J3RA 3M0FA 3M8NA 4TR3A 5F0GA 2LJRA 3G7IA 1PN0A 1ZYNA 1A0RP 1EZKA 3U5RE 1B8XA 2YV9A 4TN8A 1ZYQB 4ZIJA 3ZYWA 2HSMA 4OMVA 4WF5A 3H8QA 3PGTA 1SK2A 2H8LA 3CYNA 2H1BA 2B6MA 2XC2A 2L5LA 3EMXA 2HRAA 2HE3A 4MPGA 3D21A 2OA7A 4BWSA 1PX7A 2V2GA 5HFKA 2QSIA 3Q18A 3V1WA 3WT1A 3IK7A 5LCZA 4HOJA 2V41A 2TRCP 1GSDA 4TR1A 4QQ7A 3IC8A 4XTSA 4KGIA 5DVBA 1T4YA 3HD5A 4K0NA 5GSTA 3HYPA 2PPTA 1M7TA 3F4SA 4ZBAA 4CY6A 4HQZA 3TDGA 4MJBA 1SD8A 2X64A 5F8BA 2H1DA 3MWHA 4ZL7A 1YKCA 4JR4A 4AJ7A 2OKAA 2RUEA 2DKHA 5ECNB 3ISOA 2DKIA 4JR6A 2WGRA 5JCUA 1U88A 5B6NA 2H76A 1YDKA 1XZOA 3SBCA 2LNTA 2LRCA 1RW1A 3O3TA 5FWGA 4X4JA 2B5XA 4H86A 3CTGA 2B5EA 4E8EA 4HZ2A 1ABAA 2JSYA 2H1GA 1DUGA 2IFQB 3F63A 5ECOB 3F4TA 3KMOA 3PR8A 3VI5A 3APOA 4TXVA 3VWVA 3GSSA 4KW6A 5IPGA 4ECIA 1T7PB 3IAM2 3GL5A 3TJFA 2GSTA 3ERWA 2ZUPA 4KF9A 3EWLA 3DVXA 1OVNA 1XPVA 2VCXA 3TUEA 3F8UA 5A5KA 3US3A 4CY8A 1YKAA 3MYDA 2IMIA 1SJZA 2GZPA 4AJ6A 3RBTA 3UOMA 4ZXGA 4QL7A 3P7XA 3DIEA 3IHQA 4D73A 1F37A 1XIYA 4NXIA 3L9SA 1VF1A 1OYJA 2H1AA 2L6DA 5F07A 3LQ7A 4PQHA 5LD0A 3KP8A 4ECBA 2Z9SA 4I8BA 4HU9A 3G9BA 10GSA 1OC3A 2IPAA 1T3BA 4Z2UA 2EIQA 4YH2A 1O8WA 3A2WA 4DEJA 1EV4A 4XRDA 4OCFA 3ZIJA 3TB2A 1HNAA 2NPBA 5DBQA 1ZMAA 1M2BA 3QCPA 18GSA 4WF4A 1BAYA 2GZYA 2VCVA 3HXSA 4G19A 4JE1A 3IBHA 2C80A 4ID0A 4Q5FA 2I1UA 4RI7A 1G7OA 1K0BA 3QAWA 2DIZA 2L5OA 4CDOA 2A2RA 2VD0A 3GTUA 5G30A 4F03A 1XOAA 2TIRA 2HFDA 3F3QA 4WKWA 2GQLA 1O81A 4ZBDA 5AGYA 1PRXA 3LWAA 2R4VA 3LJRA 2AJQB 1V40A 4Q5RA 3UVHA 3QR6A 4EC0A 2VM2A 1C72A 3JCML 2HNLA 2PWJA 5BMUA 4WXTA 1SU9A 2KLXA 4BA7A 2DMLA 4YQMA 1ACVA 4FQUA 3SWLA 2MZCA 2AB6A 4I5QA 1X0RA 4IP6A 4LA1A 5EL8A 2TRXA 2LQOA 1K0OA 2HRKA 1Z5YE 5CRHA 2LQQA 5B6MA 4YAVA 3QDNA 3A2XA 1V58A 3GYKA 4GSTA 3LXZA 3BOAA 3CQFA 2JZTA 1DE1A 3ZL5A 2CAQA 3GH9A 2H0HA 5F06A 3N9JA 4BVYA 2GT5A 4IJ3A 1M9AA 2FA4A 2HT9A 1ZOFA 1TRWA 2VL2A 3IR4A 3IE3A 3GA4A 2C1YA 5B7CA 2VLUA 4AGSA 4EO3A 4O7HA 4MF5A 2FWGA 2LV3A 1S3RA 1GLQA 5CYYA 5ENUA 6GSYA 1K3LA 2CZ2A 4JBBA 1LU4A 2JADA 2JL4A 3WGXA 2QA2A 4BVXA 4K5SA 1OE7A 4FYBA 4XHMA 2AYTA 4EF0A 1XW6A 1SK0A 3TCOA 2RIIA 1ILOA 4IELA 4E8HA 5D73A 3FK8A 2YZUA 2QA1A 5IMAA 2LRTA 1WOUA 2OACA 5G1LA 1JLVA 3F6DA 4V1Ag 2R5GA 2X99A 2FLSA 2CVKA 2PERA 2H0GA 4BIKA 1ZYEA 5CAXA 1IYIA 4MABA 4Z2RA 1M9BA 2HZEB 2L6CA 1PN9A 2GSQA 3P90A 1CQGA 4LLRA 1K3OA 2HRFA 4OFTA 3VLNA 5ECMB 1N8JA 2FUG2 1BJXA 3UARA 2OJLA 4PX1A 3FZ9A 5ELAA 3EC3A 1GUKA 4D73B 4XS4A 3L0HA 4ZL8A 1PD21 1X5CA 1ON4A 5A4UA 1FOHA 2H66A 1OE8A 2B3SA 5D93A 2NBSA 2LEGA 3IAS2 3C73A 1J9BA 2A4HA 4TRXA 5HR1A 2X8CA 2VCZA 2GSSA 5IMZA 1HNBA 4RI6A 4USSA 3HKRA 2YJHA 4MJEA 1B4QA 4GLTA 1XW5A 2EC4A 5KN0A 1XWGA 2FY6A 4MH3A 2IMEA 5B8BA 2CX4A 4OD7A 1SD9A 4XS6A 2YWNA 3GTUB 3UAPA 1FAAA 1YF0A 3G7YA 5AISA 4HU7A 4BPYA 3W8SA 2MMAA 5DALA 1TRUA 1F2EA 3KXOA 3IRAA 2AAWA 1PSQA 1VF2A 1G0TA 4EE0A 2K18A 4HUAA 3H1NA 2DLXA 4TKYA 4K5RA 4XRAA 2C0FA 3RAZA 4MH2A 1FVJA 4HJMA 3HHVA 2V32A 3UBKA 4V1Ap 1EOGA 2HRNA 1TXXA 1R5AA 5ECIB 4PNGA 2QGVA 2RM5A 2E2MA 2PGTA 4ILFA 2KP2A 3A3TA 3WYWA 1XWCA 4MJAA 5IM9A 4O92A 5HR0A 4HDEA 1ERWA 4JRRA 4MPFA 4IJIA 3EURA 4RQRA 3TKSC 1GTBA 2VM1A 4BVYB 5GAPD 2B7JA 2X8HA 4IS0A 3I43A 2VD1A 2CVDA 1NHOA 3EE2A 1QGVA 3C1RA 1WPIA 1F3BA 3Q74A 2K9FA 4HJ2A 4BWQA 3HVNA 2V1MA 3DKSA 1NM3A 1K0MA 4MK3A 3A5IA 2OE0A 3Q6OA 3VFIA 1GWCA 4K1FA 3TGZA 1V9WA 1PL1A 5IO0A 2CT6A 3FR3A 3J7Yb 1S3DA 2O87A 2KP1A 5LNKe 2HYXA 5JCWA 4EDYA 3GMFA 3GKMA 3IC4A 5IOWA 4N30A 1Z3EA 5INYA 1TKDB 4KCEA 4HSCX 1F6MC 1TOFA 5IMDA 1ERTA 1QK8A 3UVTA 4L0WA 19GSA 1XW9A 5DCHA 2DJ1A 4K2XA 3CRTA 5COHA 1PMTA 2R2JA 5IO2A 5KOXA 4EUYA 1DE2A 4NAXA 4PQ1A 1R26A 5DQYA 4YKGA 2YZHA 1GUMA 3BD2A 4KH7A 1GRXA 1V57A 3F3RA 4GXZA 3GURA 4GSNA 1U6TA 2GDRA 2F8AA 2O8VB 1YEPA 3S9FA 1M3IA 1PA3A 5ECSA 5IMVA 1E6BA 1EP8A 1ZZYA 2PBJA 2NTOA 1MEKA 4L5LA 2DC5A 5G5FA 2L4QA 4NHZA 5IPHA 1O7UA 1A2LA 2DBCA 2PVQA 2F51A 1YEXA 1GLPA 2GT6A 1XCCA 3FKFA 5D9VA 1UC7A 1GSFA 2H75A 1DSBA 3GX8A 1MTCA 1UN2A 4AJ8A 5KN1A 1X5DA 2WFCA 4WETA 4TVEA 4KDYA 1GP1A 1PKWA 2GTUA 6GSXA 4GF0A 1ST9A 5BRTA 3MAKA 3MNGA 3KP9A 4L8EA 1HYUA 3ZREA 5DAKB 5DDLA 4MMMA 1M3JA 3HCZA 1SL0B 3QOUA 2J23A 5DALB 4EKZA 3QAGA 3O76A 6GSWA 1GSSA 1Z6NA 3WGEA 1F9MA 2D2ZA 2OE1A 3EU4A 5EY6A 2WCIA 3E3EA 2ON5A 3PPUA 4POMA 5F05A 1EV9A 4KA0A 4G10A 4JEDA 2B1KA 4ZB8A 1VGLA 2ES7A 3K8NA 2OBIA 1WWJA 4P3YB 1NSWA 3M9KA 1K0CA 9GSSA 1A23A 2DMMA 1SYXA 4F2IA 1OKTA 2VLTA 2R6KA 3ZVJA 4G9HA 1AC1A 1SL2B 4ZB9A 2R0GA 4EXJA 3QAVA 1HNCA 2E7PA 2C4JA 3QMXA 4HEA2 4IQ1A 5D9XA 1PX6A 3A2VA 4KB3A 1A24A 2F8FA 3IV4A 4LL4B 2CZ3A 2VAFA 2BMXA 2FD3A 3KMNA 5D9TA 3KH7A 3F0IA 1T8EB 3E0UA 4NV5A 5B8AA 1V98A 1AQVA 2GGTA 3AY8A 2PUKC 1QMVA 3LG6A 5CRDA 3H4KA 3H79A 1Y25A 3C8EA 1VF3A 4N0ZA 1TI3A 5CRGA 1Z6MA 2GQMA 3UJ1A 2R0PA 1KEBA 5CP1A 4IKHA 3KEBA 4X0XA 2JU5A 1GSQA 4IBPA 2LRNA 1PGTA 4G0LA 3VWUA 4PUFC 1S3AA 2RM6A 1Y6EA 3ZVJD 1JZOA 3ZFBA 3TOTA 3DVWA 4PNFA 4MCUA 3TKRA 1USBA 1K3YA 13GSA 4BL7A 2VCTA 1O85A 3E9JB 4I2UA 4KAEA 3DXBA 4POBA 1AAZA 1XG8A 1THXA 2H71A 4L0UA 4DSQA 2YWMA 5D8IA 4TR1B 2NDOA 3OR5A 2MMNA 3C71A 3EPTA 1RK4A 4TW5A 2HI7A 1GTIA 6GSVA 3KCMA 4ECJA 5IMFA 1T1VA 1OAZA 3NIVA 4N11A 5ABRA 1JLWA 3FZ5A 2HZFA 5AIVA 5IIZA 1OC9A 3ZITA 2GVPA 4OO5A 1V2AA 5FHIA 4TXOA 2JZRA 2CV4A 3CTFA 1G7EA 1JFUA 4WR4A 5GAND 3PINA 2JACA 1MD3A 1NW2A 4FYCA 8GSSA 4K7IA 3R2QA 1A8YA 2YJ7A 3BJ5A 2JZSA 2C0GA 5G5EA 5HR3A 2FNOA 1FB6A 2IMFA 1GUHA 2I4AA 1K0DA 4KSMA 1XWKA 4KDUA 3DYRA 3RPPA 5GSSA 3HJMA 4YKFA 2DJ0A 4YQVA 2AV4A 3IA1A 4F0CA 1XOBA 1QXHA 4V2NA 3P8WA 2PMTA 2KOKA 4HQSA 4ZBBA 1FB0A 5JWOB 1U3IA 3CSIA 1ZGNA 1U3AA 3TKSE 1Q98A 3CXGA 4RQXA 2REMA 16GSA 1MDIA 3ZTLA 2N5AA 20GSA 3ZMKA 3HVSA 2MBTA 1U87A 1SKSB 2YP6A 3NOFA 2GSRA 4GTUA 3ZRDA 3DGQA 1XVWA 3WD6A 4DSSA 1YQ1A 1SYRA 1BYEA 2DJJA 5L71A 1JZRA 1ML6A 1MD4A 3ME7A 4Z2TA 2PU9C 3GL3A 5E59A 1DBYA 3D4TA 4K9ZA 2GQKA 2IWTA 1EGRA 2YOIA 3RHBA 5KN3A 2X49A 2M72A 3LORA 4ISDA 1HD2A 2H6ZA 2HSHA 3EVIA 5HFIA 1W89A 1YF1A 2DSAA 2YNXA 2NVLA 2MYGA 4OWYA 2K8VA 3D4MA 4NHWA 2IFQA 2LUSA 4I97A 1PFOA 5EPFA 3FEUA 2HXKA 3UL3A 2LJKA 3ZZXA 4TR4A 1WP0A 1GTUA 1GNWA 1OKDA 4IGJA 4V2LA 3LW9A 3FYGA 2IMDA 4PTSA 2FGXA 3LYKA 3F9UA 1J0FA 4L5OA 1BX9A 3KTBA 1B9YC 4GQCA 3FHKA 1ZYPA 4PGTA 1A0FA 2LTKA 1KBNA 4HI7A 4KSOA 4I2TA 1NHYA 1WMJA 2LKUA 1EEMA 1F3AA 2P5QA 14GSA 5A4VA 5JCGA 1SL1B
chains in the Genus database with same CATH topology
1XWAA 3L9VA 4HZ4A 2FHEA 3RPNA 4OO4A 3QFAC 1W4VA 3FMWA 4PXOA 5H5SA 3HVXA 5D9WA 5G31A 1FO5A 4XS1A 3ZIVA 3HZ4A 1EOHA 1M2AA 2H74A 4ZB6A 3J7Yk 2IL3A 1O8XA 2PVOC 2X8GA 2ON7A 1AQXA 3M9JA 3MIXA 1THOA 5EVOA 3CSJA 1WRYA 1UA5A 4POLA 4NPBA 2VL3A 3VWXA 1TI1A 3I6AA 1B4PA 3GH6A 2YPMA 1SKWB 1G6YA 4BVXB 4TXOB 17GSA 2XHFA 2AUVA 3BCKA 4IN0A 4RUVA 4Q5QA 1GSUA 1EWXA 1A2JA 3ZLPA 2O89A 4CHSA 2I9HA 4J57E 1R4WA 2ALBA 1TDIA 1VRSD 5H5RA 11GSA 4FO5A 3QD9A 1XWBA 4WR5A 3N5OA 3G7JA 4J56E 1QUWA 1X9WB 3ZMLA 2C3TA 2P0GA 3TKPA 1Z7PA 4PUAA 4KX4A 4XCSA 1SJIA 3GRXA 3IXRA 1SKRB 3ERGA 4MDCA 3TRQA 2KHPA 2B7KA 3GHAA 5IMCA 3TKQA 2A2SA 4IVFA 2CA8A 1K0AA 5C00A 2H70A 5J9BA 2VCWA 5J41A 3KJYA 2DJ3A 1GSEA 3IOSA 2H0IA 4NMUA 4XS4B 1LBKA 1ERUA 3RDWA 3LGCA 2V6OA 4MZCA 5DJMA 5CNWA 3ZFLA 3O6TA 2N5BA 1ERVA 2WS2A 2H73A 4DSSB 12GSA 1RQMA 1WJKA 3L78A 2O85A 1LJRA 4I6XA 2YN1A 4EVMA 1PKZA 1JHBA 4N10A 1WIKA 3GIXA 4ULXA 3TOUA 4GQFA 5HQPA 1TK0B 1S3CA 3W8JA 4K8MA 4EDZA 4KE3A 1YZXA 3DMLA 1EGOA 3LFLA 2GZZA 1XBSA 1JZDA 4K2DA 3CSHA 2ZCTA 3D22A 4K7NA 2I81A 2R0CA 2X4AA 4HS1A 2IMKA 3U6VA 1GH2A 2HZEA 3KD0A 4FYUA 2C0DA 3QFBC 4G0IA 2E0QA 3M1GA 3VK9A 1OC8A 5ID2A 3H93A 1B9XC 5KEJA 1TP9A 3KH9A 1A8LA 3HY2A 1XXUA 3HVVA 4G2EA 4ICYA 3M3MA 4O5UA 4MP4A 3GFKA 3LEFA 4JZQA 5ECLB 2LS5A 2E2GA 4G0KA 4O32A 1AW9A 3APQA 3L9UA 5G2ZA 2LNSA 2DIYA 7GSSA 4MA9A 2MBSA 2R3XA 3HJOA 1BG5A 3F6FA 4JU5A 4F0BA 2OE3A 5AN1A 4A5PA 2WULA 2PN8A 2P31A 4KNDA 3FR6A 3F4RA 2B1LA 2L57A 2OADA 4K0GA 2XPEA 2F9SA 5AIXA 5D96A 1MDKA 3TJBA 3I69A 3EINA 1TU8A 4EIPA 5HFGA 1Q4JA 1Z9HA 3ED3A 3GKNA 2BJXA 2FWEA 1GULA 1ZL9A 2HLSA 4GWRA 1SK1A 5ECKB 3VPQA 2YCDA 4Z7XA 2IN3A 4OFMA 2CAIA 2H6XA 1GL8A 3EU3A 2C3QA 5H5QA 2B5YA 3IHGA 3WGDA 4WEYA 2VOCA 2J9HA 5DQSA 1K0NA 3TRXA 3FR9A 2VO4A 3R3EA 4ML1A 2O7KA 2C3NA 5ELGA 4F9ZA 3ME8A 6GSSA 2RLIA 6GSTA 2L4CA 2YV7A 3D0ZA 1A2MA 4O5RA 4F82A 2H19A 3Q19A 4KUNA 2A2PA 1JZWA 1CQHA 1T00A 3KIJA 2VCQA 2MMZA 4Q5NA 4GRFA 3W6GA 1X9MB 2V6KA 1R5PA 1YY7A 3TJKA 3FY7A 1SENA 1R7HA 4O5QA 3LSZA 4NV2A 4CW9A 1QQ2A 1UVZA 4QL9A 1TRVA 3HDCA 4IHUA 2P5RA 5IQYA 4IP1A 3MDKA 1IYHA 2VL9A 4WBRD 4EIQA 3EMPA 4PQIA 1FHEA 4PURA 2XBIA 3DEXA 3MSZA 5E4WA 2I3YA 1EP7A 4V2MA 3RHCA 2M46A 1EEJA 3GN3A 3WT2A 2GLRA 1M99A 1E2YA 2GS3A 2K8SA 4MZBA 1H75A 1M2DA 2WDUA 3D5JA 2UZ8A 2HSYA 5A4WA 4YAPA 1M0UA 3HJPA 2AHEA 1TK5B 4FIWA 1O73A 3UMAA 2G2QA 1J08A 6GSUA 5JWQB 4OFNA 2LJAA 1X9SB 3ERFA 3I9V2 1AXDA 2G0FA 1AQWA 1AIUA 4GSSA 2DJ2A 4X1UA 2C0EA 3TJGA 3VWWA 2M80A 5ID2B 3HZ8A 4LMWA 1GSYA 3KZQA 4IW9A 3C1SA 5JWRB 1TW9A 2XBQA 4X43A 3BBYA 2BTOT 1G6WA 1XVQA 3TKSA 1XFLA 1TRSA 1FW1A 3TJJA 4ML6A 1TJDA 22GSA 2FA8A 5ECQB 4YQUA 2F3MA 4LMVA 4N0VA 3VPTA 4MF6A 5CRWA 4DSRA 2XPDA 5J9CA 1I5GA 1PQNA 1WE0A 2YWIA 4KCAA 2VL2C 3IDVA 1VF4A 2QC7A 2QKEA 3CMIA 1KNGA 1N2AA 2FWFA 2CVBA 2H6YA 3APSA 4LL1B 3GKKA 2LSTA 3EYTA 4TOPA 1BQ7A 4ZILA 3A5WA 3FZ4A 3GNJA 3FRCA 5C04A 2A4VA 1PL2A 2WJUA 5J4UA 2ZNMA 4XIHA 2RUFA 3TRPA 3UEMA 4ACSA 2FWHA 2IIYA 2C8UA 2VLVA 3GUSA 3LYPA 1TTZA 2H01A 2H30A 5CREA 3KGKA 1HQOA 4KDXA 4K7OA 4NWYA 3VI7A 1H4OA 4FH8A 3DRNA 5DAKA 2OBKA 1YJ6A 2CX3A 3UIWA 4J2FA 4POKA 3C7MA 4MF7A 3FZAA 5FT3A 3FW2A 3VURA 4WBJA 4GCIA 2H72A 3L4NA 3GX0A 2EIRA 1MDJA 1GNEA 2R37A 3LXTA 5IOXA 2MMOA 4EL1A 2N5FA 1SJ6A 5DJLA 4BL7B 1T4ZA 4DVCA 3DWVA 1I9DA 3DD3A 5G1KA 5KN2A 3IK9A 5ECHB 1TK8B 3CBUA 4MNNA 2WRTA 2JSZA 2IJYA 3KTLA 5J5NA 2K6VA 2YANA 3GKXA 4IQAA 3NZNA 5GZZB 3UBLA 2KUCA 4OCEA 1QFNA 3BCIA 3D6IA 1AUCA 2L59A 3CRUA 4ECCA 1FG4A 3IPZA 2VIMA 4K6XA 1Z7RA 2WZ9A 1FOVA 3HA9A 2CQ9A 2EIOA 5HR2A 3PH9A 4AF2A 1OC9B 3KM6A 5CO3A 4TR0A 2YWOA 5ECRB 3GV1A 5ECPB 4MZWA 1URMA 3P2AA 5KOWA 1GTAA 2DJKA 3QPMA 3GSTA 4ZL9A 1O6JA 2FCHA 1FVKA 2VUPA 1B48A 4MLYA 1BEDA 1KTEA 4MJCA 1X5EA 1TU7A 2WB9A 5DCGA 1ZCPA 5J3RA 3M0FA 3M8NA 4TR3A 5F0GA 2LJRA 3G7IA 1PN0A 1ZYNA 1A0RP 1EZKA 3U5RE 1B8XA 2YV9A 4TN8A 1ZYQB 4ZIJA 3ZYWA 2HSMA 4OMVA 4WF5A 3H8QA 3PGTA 1SK2A 2H8LA 3CYNA 2H1BA 2B6MA 2XC2A 2L5LA 3EMXA 2HRAA 2HE3A 4MPGA 3D21A 2OA7A 4BWSA 1PX7A 2V2GA 5HFKA 2QSIA 3Q18A 3V1WA 3WT1A 3IK7A 5LCZA 4HOJA 2V41A 2TRCP 1GSDA 4TR1A 4QQ7A 3IC8A 4XTSA 4KGIA 5DVBA 1T4YA 3HD5A 4K0NA 5GSTA 3HYPA 2PPTA 1M7TA 3F4SA 4ZBAA 4CY6A 4HQZA 3TDGA 4MJBA 1SD8A 2X64A 5F8BA 2H1DA 3MWHA 4ZL7A 1YKCA 4JR4A 4AJ7A 2OKAA 2RUEA 2DKHA 5ECNB 3ISOA 2DKIA 4JR6A 2WGRA 5JCUA 1U88A 5B6NA 2H76A 1YDKA 1XZOA 3SBCA 2LNTA 2LRCA 1RW1A 3O3TA 5FWGA 4X4JA 2B5XA 4H86A 3CTGA 2B5EA 4E8EA 4HZ2A 1ABAA 2JSYA 2H1GA 1DUGA 2IFQB 3F63A 5ECOB 3F4TA 3KMOA 3PR8A 3VI5A 3APOA 4TXVA 3VWVA 3GSSA 4KW6A 5IPGA 4ECIA 1T7PB 3IAM2 3GL5A 3TJFA 2GSTA 3ERWA 2ZUPA 4KF9A 3EWLA 3DVXA 1OVNA 1XPVA 2VCXA 3TUEA 3F8UA 5A5KA 3US3A 4CY8A 1YKAA 3MYDA 2IMIA 1SJZA 2GZPA 4AJ6A 3RBTA 3UOMA 4ZXGA 4QL7A 3P7XA 3DIEA 3IHQA 4D73A 1F37A 1XIYA 4NXIA 3L9SA 1VF1A 1OYJA 2H1AA 2L6DA 5F07A 3LQ7A 4PQHA 5LD0A 3KP8A 4ECBA 2Z9SA 4I8BA 4HU9A 3G9BA 10GSA 1OC3A 2IPAA 1T3BA 4Z2UA 2EIQA 4YH2A 1O8WA 3A2WA 4DEJA 1EV4A 4XRDA 4OCFA 3ZIJA 3TB2A 1HNAA 2NPBA 5DBQA 1ZMAA 1M2BA 3QCPA 18GSA 4WF4A 1BAYA 2GZYA 2VCVA 3HXSA 4G19A 4JE1A 3IBHA 2C80A 4ID0A 4Q5FA 2I1UA 4RI7A 1G7OA 1K0BA 3QAWA 2DIZA 2L5OA 4CDOA 2A2RA 2VD0A 3GTUA 5G30A 4F03A 1XOAA 2TIRA 2HFDA 3F3QA 4WKWA 2GQLA 1O81A 4ZBDA 5AGYA 1PRXA 3LWAA 2R4VA 3LJRA 2AJQB 1V40A 4Q5RA 3UVHA 3QR6A 4EC0A 2VM2A 1C72A 3JCML 2HNLA 2PWJA 5BMUA 4WXTA 1SU9A 2KLXA 4BA7A 2DMLA 4YQMA 1ACVA 4FQUA 3SWLA 2MZCA 2AB6A 4I5QA 1X0RA 4IP6A 4LA1A 5EL8A 2TRXA 2LQOA 1K0OA 2HRKA 1Z5YE 5CRHA 2LQQA 5B6MA 4YAVA 3QDNA 3A2XA 1V58A 3GYKA 4GSTA 3LXZA 3BOAA 2JZTA 1DE1A 3ZL5A 2CAQA 3GH9A 2H0HA 5F06A 3N9JA 4BVYA 2GT5A 4IJ3A 1M9AA 2FA4A 2HT9A 1ZOFA 1TRWA 2VL2A 3IR4A 3IE3A 3GA4A 2C1YA 5B7CA 2VLUA 4AGSA 4EO3A 4O7HA 4MF5A 2FWGA 2LV3A 1GLQA 5CYYA 5ENUA 6GSYA 1K3LA 2CZ2A 4JBBA 1LU4A 2JADA 2JL4A 3WGXA 2QA2A 4BVXA 4K5SA 1OE7A 4FYBA 4XHMA 2AYTA 4EF0A 1XW6A 1SK0A 3TCOA 2RIIA 1ILOA 4IELA 4E8HA 5D73A 3FK8A 2YZUA 2QA1A 5IMAA 2LRTA 1WOUA 2OACA 5G1LA 1JLVA 3F6DA 4V1Ag 2R5GA 2X99A 2FLSA 2CVKA 2PERA 2H0GA 1ZYEA 5CAXA 1IYIA 4MABA 4Z2RA 1M9BA 2HZEB 2L6CA 1PN9A 2GSQA 3P90A 1CQGA 4LLRA 1K3OA 2HRFA 4OFTA 3VLNA 5ECMB 1N8JA 2FUG2 1BJXA 3UARA 2OJLA 4PX1A 3FZ9A 5ELAA 3EC3A 1GUKA 4D73B 4XS4A 3L0HA 4ZL8A 1PD21 1X5CA 1ON4A 5A4UA 1FOHA 2H66A 1OE8A 2B3SA 5D93A 2NBSA 2LEGA 3IAS2 3C73A 1J9BA 2A4HA 4TRXA 5HR1A 2X8CA 2VCZA 2GSSA 5IMZA 1HNBA 4RI6A 4USSA 3HKRA 2YJHA 4MJEA 1B4QA 4GLTA 1XW5A 2EC4A 5KN0A 1XWGA 2FY6A 4MH3A 2IMEA 5B8BA 2CX4A 4OD7A 1SD9A 4XS6A 2YWNA 3GTUB 3UAPA 1FAAA 1YF0A 3G7YA 5AISA 4HU7A 4BPYA 3W8SA 2MMAA 5DALA 1TRUA 1F2EA 3KXOA 3IRAA 2AAWA 1PSQA 1VF2A 1G0TA 4EE0A 2K18A 4HUAA 3H1NA 2DLXA 4TKYA 4K5RA 4XRAA 2C0FA 3RAZA 4MH2A 1FVJA 4HJMA 3HHVA 2V32A 3UBKA 4V1Ap 1EOGA 2HRNA 1TXXA 1R5AA 5ECIB 4PNGA 2QGVA 2RM5A 2E2MA 2PGTA 4ILFA 2KP2A 3A3TA 3WYWA 1XWCA 4MJAA 5IM9A 4O92A 5HR0A 4HDEA 1ERWA 4JRRA 4MPFA 4IJIA 3EURA 4RQRA 3TKSC 1GTBA 2VM1A 4BVYB 5GAPD 2B7JA 2X8HA 4IS0A 3I43A 2VD1A 2CVDA 1NHOA 3EE2A 1QGVA 3C1RA 1WPIA 1F3BA 3Q74A 2K9FA 4HJ2A 4BWQA 2V1MA 3DKSA 1NM3A 1K0MA 4MK3A 3A5IA 2OE0A 3Q6OA 3VFIA 1GWCA 4K1FA 3TGZA 1V9WA 1PL1A 5IO0A 2CT6A 3FR3A 3J7Yb 1S3DA 2O87A 2KP1A 5LNKe 2HYXA 5JCWA 4EDYA 3GMFA 3GKMA 3IC4A 5IOWA 4N30A 1Z3EA 5INYA 1TKDB 4KCEA 1F6MC 1TOFA 5IMDA 1ERTA 1QK8A 3UVTA 4L0WA 19GSA 1XW9A 5DCHA 2DJ1A 4K2XA 3CRTA 5COHA 1PMTA 2R2JA 5IO2A 5KOXA 4EUYA 1DE2A 4NAXA 4PQ1A 1R26A 5DQYA 4YKGA 2YZHA 1GUMA 3BD2A 4KH7A 1GRXA 1V57A 3F3RA 4GXZA 3GURA 4GSNA 1U6TA 2GDRA 2F8AA 2O8VB 1YEPA 3S9FA 1PA3A 5ECSA 5IMVA 1E6BA 1EP8A 1ZZYA 2PBJA 2NTOA 1MEKA 4L5LA 2DC5A 5G5FA 2L4QA 4NHZA 5IPHA 1O7UA 1A2LA 2DBCA 2PVQA 2F51A 1YEXA 1GLPA 2GT6A 1XCCA 3FKFA 5D9VA 1UC7A 1GSFA 2H75A 1DSBA 3GX8A 1MTCA 1UN2A 4AJ8A 5KN1A 1X5DA 2WFCA 4WETA 4TVEA 4KDYA 1GP1A 1PKWA 2GTUA 6GSXA 4GF0A 1ST9A 5BRTA 3MAKA 3MNGA 3KP9A 4L8EA 1HYUA 3ZREA 5DAKB 5DDLA 4MMMA 3HCZA 1SL0B 3QOUA 2J23A 5DALB 4EKZA 3QAGA 3O76A 6GSWA 1GSSA 1Z6NA 3WGEA 1F9MA 2D2ZA 2OE1A 3EU4A 5EY6A 2WCIA 3E3EA 2ON5A 3PPUA 4POMA 5F05A 1EV9A 4KA0A 4G10A 4JEDA 2B1KA 4ZB8A 1VGLA 2ES7A 3K8NA 2OBIA 1WWJA 4P3YB 1NSWA 3M9KA 1K0CA 9GSSA 1A23A 2DMMA 1SYXA 4F2IA 1OKTA 2VLTA 2R6KA 3ZVJA 4G9HA 1AC1A 1SL2B 4ZB9A 2R0GA 4EXJA 3QAVA 1HNCA 2E7PA 2C4JA 3QMXA 4HEA2 4IQ1A 5D9XA 1PX6A 3A2VA 4KB3A 1A24A 2F8FA 3IV4A 4LL4B 2CZ3A 2VAFA 2BMXA 2FD3A 3KMNA 5D9TA 3KH7A 3F0IA 1T8EB 3E0UA 4NV5A 5B8AA 1V98A 1AQVA 2GGTA 3AY8A 2PUKC 1QMVA 3LG6A 5CRDA 3H4KA 3H79A 1Y25A 3C8EA 1VF3A 4N0ZA 1TI3A 5CRGA 1Z6MA 2GQMA 3UJ1A 2R0PA 1KEBA 5CP1A 4IKHA 3KEBA 4X0XA 2JU5A 1GSQA 4IBPA 2LRNA 1PGTA 4G0LA 3VWUA 4PUFC 1S3AA 2RM6A 1Y6EA 3ZVJD 1JZOA 3ZFBA 3TOTA 3DVWA 4PNFA 4MCUA 3TKRA 1USBA 1K3YA 13GSA 4BL7A 2VCTA 1O85A 3E9JB 4I2UA 4KAEA 3DXBA 4POBA 1AAZA 1THXA 2H71A 4L0UA 4DSQA 2YWMA 5D8IA 4TR1B 2NDOA 3OR5A 2MMNA 3C71A 3EPTA 1RK4A 4TW5A 2HI7A 1GTIA 6GSVA 3KCMA 4ECJA 5IMFA 1T1VA 1OAZA 3NIVA 4N11A 5ABRA 1JLWA 3FZ5A 2HZFA 5AIVA 5IIZA 1OC9A 3ZITA 2GVPA 4OO5A 1V2AA 5FHIA 4TXOA 2JZRA 2CV4A 3CTFA 1G7EA 1JFUA 4WR4A 5GAND 3PINA 2JACA 1MD3A 1NW2A 4FYCA 8GSSA 4K7IA 3R2QA 1A8YA 2YJ7A 3BJ5A 2JZSA 2C0GA 5G5EA 5HR3A 2FNOA 1FB6A 2IMFA 1GUHA 2I4AA 1K0DA 4KSMA 1XWKA 4KDUA 3DYRA 3RPPA 5GSSA 3HJMA 4YKFA 2DJ0A 4YQVA 2AV4A 3IA1A 4F0CA 1XOBA 1QXHA 4V2NA 3P8WA 2PMTA 2KOKA 4HQSA 4ZBBA 1FB0A 5JWOB 1U3IA 3CSIA 1ZGNA 1U3AA 3TKSE 1Q98A 3CXGA 4RQXA 2REMA 16GSA 1MDIA 3ZTLA 2N5AA 20GSA 3ZMKA 3HVSA 2MBTA 1U87A 1SKSB 2YP6A 3NOFA 2GSRA 4GTUA 3ZRDA 3DGQA 1XVWA 3WD6A 4DSSA 1YQ1A 1SYRA 1BYEA 2DJJA 5L71A 1JZRA 1ML6A 1MD4A 3ME7A 4Z2TA 2PU9C 3GL3A 5E59A 1DBYA 3D4TA 4K9ZA 2GQKA 2IWTA 1EGRA 2YOIA 3RHBA 5KN3A 2X49A 2M72A 3LORA 4ISDA 1HD2A 2H6ZA 2HSHA 3EVIA 5HFIA 1W89A 1YF1A 2DSAA 2YNXA 2NVLA 2MYGA 4OWYA 2K8VA 3D4MA 4NHWA 2IFQA 2LUSA 4I97A 5EPFA 3FEUA 2HXKA 3UL3A 2LJKA 3ZZXA 4TR4A 1WP0A 1GTUA 1GNWA 1OKDA 4IGJA 4V2LA 3LW9A 3FYGA 2IMDA 4PTSA 2FGXA 3LYKA 3F9UA 1J0FA 4L5OA 1BX9A 3KTBA 1B9YC 4GQCA 3FHKA 1ZYPA 1A0FA 4PGTA 2LTKA 1KBNA 4HI7A 4KSOA 4I2TA 1NHYA 1WMJA 2LKUA 1EEMA 1F3AA 2P5QA 14GSA 5A4VA 5JCGA 1SL1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XWA A;  3L9V A;  4HZ4 A;  2FHE A;  3RPN A;  4OO4 A;  3QFA C;  1W4V A;  4PXO A;  5H5S A;  3HVX A;  5D9W A;  5G31 A;  1FO5 A;  4XS1 A;  3ZIV A;  3HZ4 A;  1EOH A;  1M2A A;  2H74 A;  4ZB6 A;  3J7Y k;  2IL3 A;  1O8X A;  2PVO C;  2X8G A;  2ON7 A;  1AQX A;  3M9J A;  1THO A;  5EVO A;  3CSJ A;  1WRY A;  1UA5 A;  4POL A;  4NPB A;  2VL3 A;  3VWX A;  1TI1 A;  3I6A A;  1B4P A;  3GH6 A;  2YPM A;  1SKW B;  1G6Y A;  4TXO B;  17GS A;  2XHF A;  2AUV A;  3BCK A;  4IN0 A;  4RUV A;  4Q5Q A;  1GSU A;  1EWX A;  1A2J A;  3ZLP A;  2O89 A;  4CHS A;  2I9H A;  4J57 E;  1R4W A;  2ALB A;  1TDI A;  1VRS D;  5H5R A;  11GS A;  4FO5 A;  3QD9 A;  1XWB A;  4WR5 A;  3N5O A;  3G7J A;  4J56 E;  1QUW A;  1X9W B;  3ZML A;  2C3T A;  2P0G A;  3TKP A;  1Z7P A;  4PUA A;  4KX4 A;  4XCS A;  1SJI A;  3GRX A;  3IXR A;  1SKR B;  3ERG A;  4MDC A;  3TRQ A;  2KHP A;  2B7K A;  3GHA A;  5IMC A;  3TKQ A;  2A2S A;  4IVF A;  2CA8 A;  1K0A A;  5C00 A;  2H70 A;  5J9B A;  2VCW A;  5J41 A;  3KJY A;  2DJ3 A;  1GSE A;  3IOS A;  2H0I A;  4NMU A;  4XS4 B;  1LBK A;  1ERU A;  3RDW A;  3LGC A;  2V6O A;  4MZC A;  5DJM A;  5CNW A;  3ZFL A;  3O6T A;  2N5B A;  1ERV A;  2WS2 A;  2H73 A;  4DSS B;  12GS A;  1RQM A;  1WJK A;  3L78 A;  2O85 A;  1LJR A;  4I6X A;  2YN1 A;  4EVM A;  1PKZ A;  1JHB A;  4N10 A;  1WIK A;  3GIX A;  4ULX A;  3TOU A;  4GQF A;  5HQP A;  1TK0 B;  1S3C A;  3W8J A;  4K8M A;  4EDZ A;  4KE3 A;  1YZX A;  3DML A;  1EGO A;  3LFL A;  2GZZ A;  1XBS A;  1JZD A;  4K2D A;  3CSH A;  2ZCT A;  3D22 A;  4K7N A;  2I81 A;  4HS1 A;  2IMK A;  3U6V A;  1GH2 A;  2HZE A;  3KD0 A;  4FYU A;  2C0D A;  3QFB C;  2E0Q A;  3M1G A;  3VK9 A;  1OC8 A;  5ID2 A;  3H93 A;  1B9X C;  5KEJ A;  1TP9 A;  3KH9 A;  1A8L A;  3HY2 A;  1XXU A;  3HVV A;  4G2E A;  3M3M A;  4MP4 A;  3GFK A;  3LEF A;  4JZQ A;  5ECL B;  2LS5 A;  2E2G A;  4O32 A;  1AW9 A;  3APQ A;  3L9U A;  5G2Z A;  2LNS A;  2DIY A;  7GSS A;  4MA9 A;  2MBS A;  2R3X A;  3HJO A;  1BG5 A;  3F6F A;  4JU5 A;  4F0B A;  2OE3 A;  5AN1 A;  2WUL A;  2PN8 A;  2P31 A;  4KND A;  3FR6 A;  3F4R A;  2B1L A;  2L57 A;  2OAD A;  4K0G A;  2XPE A;  2F9S A;  5AIX A;  5D96 A;  1MDK A;  3TJB A;  3I69 A;  3EIN A;  1TU8 A;  5HFG A;  1Q4J A;  1Z9H A;  3ED3 A;  3GKN A;  2BJX A;  2FWE A;  1GUL A;  1ZL9 A;  2HLS A;  4GWR A;  1SK1 A;  5ECK B;  3VPQ A;  2YCD A;  4Z7X A;  2IN3 A;  4OFM A;  2CAI A;  2H6X A;  1GL8 A;  3EU3 A;  2C3Q A;  5H5Q A;  2B5Y A;  3WGD A;  4WEY A;  2VOC A;  2J9H A;  5DQS A;  1K0N A;  3TRX A;  3FR9 A;  2VO4 A;  4ML1 A;  2O7K A;  2C3N A;  5ELG A;  4F9Z A;  3ME8 A;  6GSS A;  2RLI A;  6GST A;  2L4C A;  2YV7 A;  3D0Z A;  1A2M A;  4O5R A;  4F82 A;  2H19 A;  3Q19 A;  4KUN A;  1JZW A;  1CQH A;  1T00 A;  3KIJ A;  2VCQ A;  2MMZ A;  4Q5N A;  4GRF A;  3W6G A;  1X9M B;  2V6K A;  1R5P A;  1YY7 A;  3TJK A;  3FY7 A;  1SEN A;  1R7H A;  3LSZ A;  4NV2 A;  4CW9 A;  1QQ2 A;  1UVZ A;  4QL9 A;  1TRV A;  3HDC A;  4IHU A;  2P5R A;  5IQY A;  4IP1 A;  3MDK A;  1IYH A;  2VL9 A;  4WBR D;  3EMP A;  4PQI A;  1FHE A;  4PUR A;  2XBI A;  3DEX A;  3MSZ A;  5E4W A;  2I3Y A;  1EP7 A;  4V2M A;  3RHC A;  2M46 A;  1EEJ A;  3GN3 A;  3WT2 A;  2GLR A;  1M99 A;  1E2Y A;  2GS3 A;  2K8S A;  4MZB A;  1H75 A;  1M2D A;  2WDU A;  3D5J A;  2HSY A;  5A4W A;  4YAP A;  1M0U A;  3HJP A;  2AHE A;  1TK5 B;  4FIW A;  1O73 A;  3UMA A;  2G2Q A;  1J08 A;  6GSU A;  5JWQ B;  4OFN A;  2LJA A;  1X9S B;  3ERF A;  3I9V 2;  1AXD A;  2G0F A;  1AQW A;  1AIU A;  4GSS A;  2DJ2 A;  4X1U A;  2C0E A;  3TJG A;  3VWW A;  2M80 A;  5ID2 B;  3HZ8 A;  4LMW A;  1GSY A;  3KZQ A;  4IW9 A;  3C1S A;  5JWR B;  1TW9 A;  2XBQ A;  4X43 A;  3BBY A;  2BTO T;  1G6W A;  1XVQ A;  3TKS A;  1XFL A;  1TRS A;  1FW1 A;  3TJJ A;  4ML6 A;  1TJD A;  22GS A;  2FA8 A;  5ECQ B;  4YQU A;  2F3M A;  4LMV A;  4N0V A;  3VPT A;  4MF6 A;  5CRW A;  4DSR A;  2XPD A;  5J9C A;  1I5G A;  1PQN A;  1WE0 A;  2YWI A;  4KCA A;  2VL2 C;  3IDV A;  1VF4 A;  2QC7 A;  2QKE A;  3CMI A;  1KNG A;  1N2A A;  2FWF A;  2CVB A;  2H6Y A;  3APS A;  4LL1 B;  3GKK A;  2LST A;  3EYT A;  4TOP A;  1BQ7 A;  4ZIL A;  3A5W A;  3FZ4 A;  3GNJ A;  3FRC A;  5C04 A;  2A4V A;  1PL2 A;  2WJU A;  5J4U A;  2ZNM A;  4XIH A;  2RUF A;  3TRP A;  3UEM A;  4ACS A;  2FWH A;  2IIY A;  2C8U A;  2VLV A;  3GUS A;  3LYP A;  1TTZ A;  2H01 A;  2H30 A;  5CRE A;  3KGK A;  1HQO A;  4KDX A;  4K7O A;  4NWY A;  3VI7 A;  1H4O A;  4FH8 A;  3DRN A;  5DAK A;  2OBK A;  1YJ6 A;  2CX3 A;  3UIW A;  4J2F A;  4POK A;  3C7M A;  4MF7 A;  3FZA A;  5FT3 A;  3FW2 A;  3VUR A;  4WBJ A;  4GCI A;  2H72 A;  3L4N A;  3GX0 A;  2EIR A;  1MDJ A;  1GNE A;  2R37 A;  3LXT A;  5IOX A;  2MMO A;  4EL1 A;  2N5F A;  1SJ6 A;  5DJL A;  1T4Z A;  4DVC A;  3DWV A;  1I9D A;  3DD3 A;  5G1K A;  5KN2 A;  3IK9 A;  5ECH B;  1TK8 B;  3CBU A;  2WRT A;  2JSZ A;  2IJY A;  3KTL A;  5J5N A;  2K6V A;  2YAN A;  3GKX A;  4IQA A;  3NZN A;  5GZZ B;  3UBL A;  2KUC A;  4OCE A;  1QFN A;  3BCI A;  3D6I A;  1AUC A;  2L59 A;  3CRU A;  4ECC A;  1FG4 A;  3IPZ A;  2VIM A;  4K6X A;  1Z7R A;  2WZ9 A;  1FOV A;  3HA9 A;  2CQ9 A;  2EIO A;  5HR2 A;  3PH9 A;  4AF2 A;  1OC9 B;  3KM6 A;  5CO3 A;  4TR0 A;  2YWO A;  5ECR B;  3GV1 A;  5ECP B;  4MZW A;  1URM A;  3P2A A;  1GTA A;  2DJK A;  3QPM A;  3GST A;  4ZL9 A;  1O6J A;  2FCH A;  1FVK A;  2VUP A;  1B48 A;  4MLY A;  1BED A;  1KTE A;  4MJC A;  1X5E A;  1TU7 A;  2WB9 A;  5DCG A;  1ZCP A;  5J3R A;  3M0F A;  3M8N A;  4TR3 A;  5F0G A;  2LJR A;  3G7I A;  3U5R E;  1A0R P;  1EZK A;  1B8X A;  2YV9 A;  4TN8 A;  1ZYQ B;  4ZIJ A;  3ZYW A;  4OMV A;  4WF5 A;  3H8Q A;  3PGT A;  1SK2 A;  2H8L A;  3CYN A;  2H1B A;  2B6M A;  2XC2 A;  2L5L A;  3EMX A;  2HE3 A;  4MPG A;  3D21 A;  2OA7 A;  4BWS A;  1PX7 A;  2V2G A;  5HFK A;  2QSI A;  3Q18 A;  3V1W A;  3WT1 A;  3IK7 A;  5LCZ A;  4HOJ A;  2V41 A;  2TRC P;  1GSD A;  4TR1 A;  4QQ7 A;  4XTS A;  4KGI A;  5DVB A;  1T4Y A;  3HD5 A;  4K0N A;  5GST A;  3HYP A;  2PPT A;  1M7T A;  3F4S A;  4ZBA A;  4HQZ A;  3TDG A;  4MJB A;  1SD8 A;  2X64 A;  5F8B A;  2H1D A;  3MWH A;  4ZL7 A;  1YKC A;  4JR4 A;  4AJ7 A;  2OKA A;  2RUE A;  5ECN B;  3ISO A;  4JR6 A;  2WGR A;  5JCU A;  1U88 A;  5B6N A;  2H76 A;  1YDK A;  1XZO A;  3SBC A;  2LNT A;  2LRC A;  1RW1 A;  3O3T A;  5FWG A;  2B5X A;  4H86 A;  3CTG A;  2B5E A;  4E8E A;  4HZ2 A;  1ABA A;  2JSY A;  2H1G A;  1DUG A;  2IFQ B;  3F63 A;  5ECO B;  3F4T A;  3KMO A;  3PR8 A;  3VI5 A;  3APO A;  4TXV A;  3VWV A;  3GSS A;  4KW6 A;  5IPG A;  4ECI A;  1T7P B;  3IAM 2;  3GL5 A;  3TJF A;  2GST A;  3ERW A;  2ZUP A;  3EWL A;  3DVX A;  1OVN A;  1XPV A;  2VCX A;  3TUE A;  3F8U A;  5A5K A;  3US3 A;  1YKA A;  2IMI A;  1SJZ A;  2GZP A;  4AJ6 A;  3RBT A;  3UOM A;  4ZXG A;  4QL7 A;  3P7X A;  3DIE A;  3IHQ A;  4D73 A;  1F37 A;  1XIY A;  4NXI A;  3L9S A;  1VF1 A;  1OYJ A;  2H1A A;  2L6D A;  5F07 A;  3LQ7 A;  4PQH A;  5LD0 A;  3KP8 A;  4ECB A;  2Z9S A;  4I8B A;  4HU9 A;  3G9B A;  10GS A;  1OC3 A;  2IPA A;  1T3B A;  2EIQ A;  4YH2 A;  1O8W A;  3A2W A;  4DEJ A;  1EV4 A;  4XRD A;  4OCF A;  3ZIJ A;  3TB2 A;  1HNA A;  2NPB A;  5DBQ A;  1ZMA A;  1M2B A;  3QCP A;  18GS A;  4WF4 A;  2GZY A;  1BAY A;  2VCV A;  3HXS A;  4G19 A;  4JE1 A;  3IBH A;  2C80 A;  4ID0 A;  4Q5F A;  2I1U A;  4RI7 A;  1G7O A;  1K0B A;  3QAW A;  2DIZ A;  2L5O A;  4CDO A;  2A2R A;  2VD0 A;  3GTU A;  5G30 A;  4F03 A;  1XOA A;  2TIR A;  2HFD A;  3F3Q A;  4WKW A;  2GQL A;  1O81 A;  4ZBD A;  5AGY A;  1PRX A;  3LWA A;  2R4V A;  3LJR A;  2AJQ B;  1V40 A;  4Q5R A;  3UVH A;  3QR6 A;  4EC0 A;  2VM2 A;  1C72 A;  3JCM L;  2HNL A;  2PWJ A;  4WXT A;  1SU9 A;  2KLX A;  4BA7 A;  2DML A;  4YQM A;  1ACV A;  3SWL A;  2MZC A;  2AB6 A;  4I5Q A;  1X0R A;  4IP6 A;  4LA1 A;  5EL8 A;  2TRX A;  2LQO A;  1K0O A;  1Z5Y E;  5CRH A;  2LQQ A;  5B6M A;  4YAV A;  3QDN A;  3A2X A;  1V58 A;  3GYK A;  4GST A;  3LXZ A;  3BOA A;  2JZT A;  1DE1 A;  3ZL5 A;  2CAQ A;  3GH9 A;  2H0H A;  5F06 A;  3N9J A;  4BVY A;  2GT5 A;  4IJ3 A;  1M9A A;  2FA4 A;  2HT9 A;  1ZOF A;  1TRW A;  2VL2 A;  3IR4 A;  3IE3 A;  3GA4 A;  2C1Y A;  5B7C A;  2VLU A;  4AGS A;  4EO3 A;  4O7H A;  4MF5 A;  2FWG A;  2LV3 A;  1GLQ A;  5CYY A;  5ENU A;  6GSY A;  1K3L A;  2CZ2 A;  4JBB A;  1LU4 A;  2JAD A;  2JL4 A;  3WGX A;  4BVX A;  1OE7 A;  4FYB A;  4XHM A;  2AYT A;  4EF0 A;  1XW6 A;  1SK0 A;  3TCO A;  2RII A;  1ILO A;  4IEL A;  4E8H A;  5D73 A;  3FK8 A;  2YZU A;  5IMA A;  2LRT A;  1WOU A;  2OAC A;  5G1L A;  1JLV A;  3F6D A;  4V1A g;  2R5G A;  2X99 A;  2FLS A;  2CVK A;  2PER A;  2H0G A;  1ZYE A;  5CAX A;  1IYI A;  4MAB A;  1M9B A;  2HZE B;  2L6C A;  1PN9 A;  2GSQ A;  3P90 A;  1CQG A;  4LLR A;  1K3O A;  2HRF A;  4OFT A;  3VLN A;  5ECM B;  1N8J A;  2FUG 2;  1BJX A;  3UAR A;  2OJL A;  4PX1 A;  3FZ9 A;  5ELA A;  3EC3 A;  1GUK A;  4D73 B;  4XS4 A;  3L0H A;  4ZL8 A;  1PD2 1;  1X5C A;  1ON4 A;  5A4U A;  2H66 A;  1OE8 A;  2B3S A;  5D93 A;  2NBS A;  2LEG A;  3IAS 2;  3C73 A;  1J9B A;  4TRX A;  5HR1 A;  2X8C A;  2VCZ A;  2GSS A;  5IMZ A;  1HNB A;  4RI6 A;  3HKR A;  2YJH A;  4MJE A;  1B4Q A;  4GLT A;  1XW5 A;  2EC4 A;  5KN0 A;  1XWG A;  2FY6 A;  4MH3 A;  2IME A;  5B8B A;  2CX4 A;  4OD7 A;  1SD9 A;  4XS6 A;  2YWN A;  3GTU B;  3UAP A;  1FAA A;  1YF0 A;  3G7Y A;  5AIS A;  4HU7 A;  4BPY A;  3W8S A;  2MMA A;  5DAL A;  1TRU A;  1F2E A;  3KXO A;  3IRA A;  2AAW A;  1PSQ A;  1VF2 A;  1G0T A;  4EE0 A;  2K18 A;  4HUA A;  3H1N A;  2DLX A;  4TKY A;  4XRA A;  2C0F A;  3RAZ A;  4MH2 A;  1FVJ A;  4HJM A;  3HHV A;  2V32 A;  3UBK A;  4V1A p;  1EOG A;  2HRN A;  1TXX A;  1R5A A;  5ECI B;  4PNG A;  2QGV A;  2RM5 A;  2E2M A;  2PGT A;  4ILF A;  2KP2 A;  3A3T A;  3WYW A;  1XWC A;  4MJA A;  5IM9 A;  4O92 A;  5HR0 A;  4HDE A;  1ERW A;  4JRR A;  4MPF A;  4IJI A;  3EUR A;  4RQR A;  3TKS C;  1GTB A;  2VM1 A;  5GAP D;  2B7J A;  2X8H A;  4IS0 A;  3I43 A;  2VD1 A;  2CVD A;  1NHO A;  3EE2 A;  1QGV A;  3C1R A;  1WPI A;  1F3B A;  3Q74 A;  2K9F A;  4HJ2 A;  4BWQ A;  2V1M A;  3DKS A;  1NM3 A;  1K0M A;  4MK3 A;  2OE0 A;  3Q6O A;  3VFI A;  1GWC A;  4K1F A;  3TGZ A;  1V9W A;  1PL1 A;  5IO0 A;  2CT6 A;  3FR3 A;  3J7Y b;  1S3D A;  2O87 A;  2KP1 A;  5LNK e;  2HYX A;  5JCW A;  4EDY A;  3GMF A;  3GKM A;  3IC4 A;  5IOW A;  4N30 A;  1Z3E A;  5INY A;  1TKD B;  4KCE A;  1F6M C;  1TOF A;  5IMD A;  1ERT A;  1QK8 A;  3UVT A;  4L0W A;  19GS A;  1XW9 A;  5DCH A;  2DJ1 A;  3CRT A;  5COH A;  1PMT A;  2R2J A;  5IO2 A;  4EUY A;  1DE2 A;  4NAX A;  4PQ1 A;  1R26 A;  5DQY A;  2YZH A;  1GUM A;  3BD2 A;  4KH7 A;  1GRX A;  1V57 A;  3F3R A;  4GXZ A;  3GUR A;  4GSN A;  1U6T A;  2GDR A;  2F8A A;  2O8V B;  1YEP A;  3S9F A;  1PA3 A;  5ECS A;  5IMV A;  1E6B A;  1EP8 A;  1ZZY A;  2PBJ A;  2NTO A;  1MEK A;  4L5L A;  2DC5 A;  5G5F A;  2L4Q A;  4NHZ A;  5IPH A;  1O7U A;  1A2L A;  2DBC A;  2PVQ A;  2F51 A;  1YEX A;  1GLP A;  2GT6 A;  1XCC A;  3FKF A;  5D9V A;  1UC7 A;  1GSF A;  2H75 A;  1DSB A;  3GX8 A;  1MTC A;  1UN2 A;  4AJ8 A;  5KN1 A;  1X5D A;  2WFC A;  4WET A;  4TVE A;  4KDY A;  1GP1 A;  1PKW A;  2GTU A;  6GSX A;  4GF0 A;  1ST9 A;  3MAK A;  3MNG A;  3KP9 A;  4L8E A;  1HYU A;  3ZRE A;  5DAK B;  5DDL A;  4MMM A;  3HCZ A;  1SL0 B;  3QOU A;  2J23 A;  5DAL B;  4EKZ A;  3QAG A;  3O76 A;  6GSW A;  1GSS A;  1Z6N A;  3WGE A;  1F9M A;  2D2Z A;  2OE1 A;  3EU4 A;  5EY6 A;  2WCI A;  3E3E A;  2ON5 A;  4POM A;  5F05 A;  1EV9 A;  4KA0 A;  4G10 A;  4JED A;  2B1K A;  4ZB8 A;  1VGL A;  2ES7 A;  3K8N A;  2OBI A;  1WWJ A;  4P3Y B;  1NSW A;  3M9K A;  1K0C A;  9GSS A;  1A23 A;  2DMM A;  1SYX A;  4F2I A;  1OKT A;  2VLT A;  2R6K A;  3ZVJ A;  4G9H A;  1AC1 A;  1SL2 B;  4ZB9 A;  4EXJ A;  3QAV A;  1HNC A;  2E7P A;  2C4J A;  3QMX A;  4HEA 2;  4IQ1 A;  5D9X A;  1PX6 A;  3A2V A;  4KB3 A;  1A24 A;  2F8F A;  3IV4 A;  4LL4 B;  2CZ3 A;  2VAF A;  2BMX A;  2FD3 A;  3KMN A;  5D9T A;  3KH7 A;  3F0I A;  1T8E B;  3E0U A;  4NV5 A;  5B8A A;  1V98 A;  1AQV A;  2GGT A;  3AY8 A;  2PUK C;  1QMV A;  3LG6 A;  5CRD A;  3H4K A;  3H79 A;  1Y25 A;  3C8E A;  1VF3 A;  4N0Z A;  1TI3 A;  5CRG A;  1Z6M A;  2GQM A;  3UJ1 A;  1KEB A;  5CP1 A;  4IKH A;  3KEB A;  4X0X A;  2JU5 A;  1GSQ A;  4IBP A;  2LRN A;  1PGT A;  3VWU A;  4PUF C;  1S3A A;  2RM6 A;  1Y6E A;  3ZVJ D;  1JZO A;  3ZFB A;  3TOT A;  3DVW A;  4PNF A;  4MCU A;  3TKR A;  1USB A;  1K3Y A;  13GS A;  4BL7 A;  2VCT A;  1O85 A;  3E9J B;  4I2U A;  4KAE A;  3DXB A;  4POB A;  1AAZ A;  1THX A;  2H71 A;  4L0U A;  4DSQ A;  2YWM A;  5D8I A;  4TR1 B;  2NDO A;  3OR5 A;  2MMN A;  3C71 A;  1RK4 A;  4TW5 A;  2HI7 A;  1GTI A;  6GSV A;  3KCM A;  4ECJ A;  5IMF A;  1T1V A;  1OAZ A;  3NIV A;  4N11 A;  5ABR A;  1JLW A;  3FZ5 A;  2HZF A;  5AIV A;  5IIZ A;  1OC9 A;  3ZIT A;  2GVP A;  4OO5 A;  1V2A A;  5FHI A;  4TXO A;  2JZR A;  2CV4 A;  3CTF A;  1G7E A;  1JFU A;  4WR4 A;  5GAN D;  3PIN A;  2JAC A;  1MD3 A;  1NW2 A;  4FYC A;  8GSS A;  4K7I A;  3R2Q A;  1A8Y A;  2YJ7 A;  3BJ5 A;  2JZS A;  2C0G A;  5G5E A;  5HR3 A;  2FNO A;  1FB6 A;  2IMF A;  1GUH A;  2I4A A;  1K0D A;  4KSM A;  1XWK A;  4KDU A;  3DYR A;  3RPP A;  5GSS A;  3HJM A;  2DJ0 A;  4YQV A;  2AV4 A;  3IA1 A;  4F0C A;  1XOB A;  1QXH A;  4V2N A;  3P8W A;  2PMT A;  2KOK A;  4HQS A;  4ZBB A;  1FB0 A;  5JWO B;  1U3I A;  3CSI A;  1ZGN A;  1U3A A;  3TKS E;  1Q98 A;  3CXG A;  4RQX A;  2REM A;  16GS A;  1MDI A;  3ZTL A;  2N5A A;  20GS A;  3ZMK A;  3HVS A;  2MBT A;  1U87 A;  1SKS B;  2YP6 A;  3NOF A;  2GSR A;  4GTU A;  3ZRD A;  3DGQ A;  1XVW A;  3WD6 A;  4DSS A;  1YQ1 A;  1SYR A;  1BYE A;  2DJJ A;  5L71 A;  1JZR A;  1ML6 A;  1MD4 A;  3ME7 A;  2PU9 C;  3GL3 A;  5E59 A;  1DBY A;  3D4T A;  4K9Z A;  2GQK A;  2IWT A;  1EGR A;  2YOI A;  3RHB A;  5KN3 A;  2M72 A;  3LOR A;  4ISD A;  1HD2 A;  2H6Z A;  2HSH A;  3EVI A;  5HFI A;  1W89 A;  1YF1 A;  2DSA A;  2YNX A;  2NVL A;  2MYG A;  4OWY A;  2K8V A;  3D4M A;  4NHW A;  2IFQ A;  2LUS A;  4I97 A;  5EPF A;  3FEU A;  2HXK A;  3UL3 A;  2LJK A;  3ZZX A;  4TR4 A;  1WP0 A;  1GTU A;  1GNW A;  1OKD A;  4IGJ A;  4V2L A;  3FYG A;  2IMD A;  2FGX A;  3LYK A;  3F9U A;  1J0F A;  4L5O A;  1BX9 A;  3KTB A;  1B9Y C;  4GQC A;  3FHK A;  1A0F A;  4PGT A;  2LTK A;  1KBN A;  4HI7 A;  4KSO A;  4I2T A;  1NHY A;  1WMJ A;  2LKU A;  1EEM A;  1F3A A;  2P5Q A;  14GS A;  5A4V A;  5JCG A;  1SL1 B; 
#chains in the Genus database with same CATH topology
 1XWA A;  3L9V A;  4HZ4 A;  2FHE A;  3RPN A;  4OO4 A;  3QFA C;  1W4V A;  3FMW A;  4PXO A;  5H5S A;  3HVX A;  5D9W A;  5G31 A;  1FO5 A;  4XS1 A;  3ZIV A;  3HZ4 A;  1EOH A;  1M2A A;  2H74 A;  4ZB6 A;  3J7Y k;  2IL3 A;  1O8X A;  2PVO C;  2X8G A;  2ON7 A;  1AQX A;  3M9J A;  3MIX A;  1THO A;  5EVO A;  3CSJ A;  1WRY A;  1UA5 A;  4POL A;  4NPB A;  2VL3 A;  3VWX A;  1TI1 A;  3I6A A;  1B4P A;  3GH6 A;  2YPM A;  1SKW B;  1G6Y A;  4BVX B;  4TXO B;  17GS A;  2XHF A;  2AUV A;  3BCK A;  4IN0 A;  4RUV A;  4Q5Q A;  1GSU A;  1EWX A;  1A2J A;  3ZLP A;  2O89 A;  4CHS A;  2I9H A;  4J57 E;  1R4W A;  2ALB A;  1TDI A;  1VRS D;  5H5R A;  11GS A;  4FO5 A;  3QD9 A;  1XWB A;  4WR5 A;  3N5O A;  3G7J A;  4J56 E;  1QUW A;  1X9W B;  3ZML A;  2C3T A;  2P0G A;  3TKP A;  1Z7P A;  4PUA A;  4KX4 A;  4XCS A;  1SJI A;  3GRX A;  3IXR A;  1SKR B;  3ERG A;  4MDC A;  3TRQ A;  2KHP A;  2B7K A;  3GHA A;  5IMC A;  3TKQ A;  2A2S A;  4IVF A;  2CA8 A;  1K0A A;  5C00 A;  2H70 A;  5J9B A;  2VCW A;  5J41 A;  3KJY A;  2DJ3 A;  1GSE A;  3IOS A;  2H0I A;  4NMU A;  4XS4 B;  1LBK A;  1ERU A;  3RDW A;  3LGC A;  2V6O A;  4MZC A;  5DJM A;  5CNW A;  3ZFL A;  3O6T A;  2N5B A;  1ERV A;  2WS2 A;  2H73 A;  4DSS B;  12GS A;  1RQM A;  1WJK A;  3L78 A;  2O85 A;  1LJR A;  4I6X A;  2YN1 A;  4EVM A;  1PKZ A;  1JHB A;  4N10 A;  1WIK A;  3GIX A;  4ULX A;  3TOU A;  4GQF A;  5HQP A;  1TK0 B;  1S3C A;  3W8J A;  4K8M A;  4EDZ A;  4KE3 A;  1YZX A;  3DML A;  1EGO A;  3LFL A;  2GZZ A;  1XBS A;  1JZD A;  4K2D A;  3CSH A;  2ZCT A;  3D22 A;  4K7N A;  2I81 A;  2R0C A;  2X4A A;  4HS1 A;  2IMK A;  3U6V A;  1GH2 A;  2HZE A;  3KD0 A;  4FYU A;  2C0D A;  3QFB C;  4G0I A;  2E0Q A;  3M1G A;  3VK9 A;  1OC8 A;  5ID2 A;  3H93 A;  1B9X C;  5KEJ A;  1TP9 A;  3KH9 A;  1A8L A;  3HY2 A;  1XXU A;  3HVV A;  4G2E A;  4ICY A;  3M3M A;  4O5U A;  4MP4 A;  3GFK A;  3LEF A;  4JZQ A;  5ECL B;  2LS5 A;  2E2G A;  4G0K A;  4O32 A;  1AW9 A;  3APQ A;  3L9U A;  5G2Z A;  2LNS A;  2DIY A;  7GSS A;  4MA9 A;  2MBS A;  2R3X A;  3HJO A;  1BG5 A;  3F6F A;  4JU5 A;  4F0B A;  2OE3 A;  5AN1 A;  4A5P A;  2WUL A;  2PN8 A;  2P31 A;  4KND A;  3FR6 A;  3F4R A;  2B1L A;  2L57 A;  2OAD A;  4K0G A;  2XPE A;  2F9S A;  5AIX A;  5D96 A;  1MDK A;  3TJB A;  3I69 A;  3EIN A;  1TU8 A;  4EIP A;  5HFG A;  1Q4J A;  1Z9H A;  3ED3 A;  3GKN A;  2BJX A;  2FWE A;  1GUL A;  1ZL9 A;  2HLS A;  4GWR A;  1SK1 A;  5ECK B;  3VPQ A;  2YCD A;  4Z7X A;  2IN3 A;  4OFM A;  2CAI A;  2H6X A;  1GL8 A;  3EU3 A;  2C3Q A;  5H5Q A;  2B5Y A;  3IHG A;  3WGD A;  4WEY A;  2VOC A;  2J9H A;  5DQS A;  1K0N A;  3TRX A;  3FR9 A;  2VO4 A;  3R3E A;  4ML1 A;  2O7K A;  2C3N A;  5ELG A;  4F9Z A;  3ME8 A;  6GSS A;  2RLI A;  6GST A;  2L4C A;  2YV7 A;  3D0Z A;  1A2M A;  4O5R A;  4F82 A;  2H19 A;  3Q19 A;  4KUN A;  2A2P A;  1JZW A;  1CQH A;  1T00 A;  3KIJ A;  2VCQ A;  2MMZ A;  4Q5N A;  4GRF A;  3W6G A;  1X9M B;  2V6K A;  1R5P A;  1YY7 A;  3TJK A;  3FY7 A;  1SEN A;  1R7H A;  4O5Q A;  3LSZ A;  4NV2 A;  4CW9 A;  1QQ2 A;  1UVZ A;  4QL9 A;  1TRV A;  3HDC A;  4IHU A;  2P5R A;  5IQY A;  4IP1 A;  3MDK A;  1IYH A;  2VL9 A;  4WBR D;  4EIQ A;  3EMP A;  4PQI A;  1FHE A;  4PUR A;  2XBI A;  3DEX A;  3MSZ A;  5E4W A;  2I3Y A;  1EP7 A;  4V2M A;  3RHC A;  2M46 A;  1EEJ A;  3GN3 A;  3WT2 A;  2GLR A;  1M99 A;  1E2Y A;  2GS3 A;  2K8S A;  4MZB A;  1H75 A;  1M2D A;  2WDU A;  3D5J A;  2UZ8 A;  2HSY A;  5A4W A;  4YAP A;  1M0U A;  3HJP A;  2AHE A;  1TK5 B;  4FIW A;  1O73 A;  3UMA A;  2G2Q A;  1J08 A;  6GSU A;  5JWQ B;  4OFN A;  2LJA A;  1X9S B;  3ERF A;  3I9V 2;  1AXD A;  2G0F A;  1AQW A;  1AIU A;  4GSS A;  2DJ2 A;  4X1U A;  2C0E A;  3TJG A;  3VWW A;  2M80 A;  5ID2 B;  3HZ8 A;  4LMW A;  1GSY A;  3KZQ A;  4IW9 A;  3C1S A;  5JWR B;  1TW9 A;  2XBQ A;  4X43 A;  3BBY A;  2BTO T;  1G6W A;  1XVQ A;  3TKS A;  1XFL A;  1TRS A;  1FW1 A;  3TJJ A;  4ML6 A;  1TJD A;  22GS A;  2FA8 A;  5ECQ B;  4YQU A;  2F3M A;  4LMV A;  4N0V A;  3VPT A;  4MF6 A;  5CRW A;  4DSR A;  2XPD A;  5J9C A;  1I5G A;  1PQN A;  1WE0 A;  2YWI A;  4KCA A;  2VL2 C;  3IDV A;  1VF4 A;  2QC7 A;  2QKE A;  3CMI A;  1KNG A;  1N2A A;  2FWF A;  2CVB A;  2H6Y A;  3APS A;  4LL1 B;  3GKK A;  2LST A;  3EYT A;  4TOP A;  1BQ7 A;  4ZIL A;  3A5W A;  3FZ4 A;  3GNJ A;  3FRC A;  5C04 A;  2A4V A;  1PL2 A;  2WJU A;  5J4U A;  2ZNM A;  4XIH A;  2RUF A;  3TRP A;  3UEM A;  4ACS A;  2FWH A;  2IIY A;  2C8U A;  2VLV A;  3GUS A;  3LYP A;  1TTZ A;  2H01 A;  2H30 A;  5CRE A;  3KGK A;  1HQO A;  4KDX A;  4K7O A;  4NWY A;  3VI7 A;  1H4O A;  4FH8 A;  3DRN A;  5DAK A;  2OBK A;  1YJ6 A;  2CX3 A;  3UIW A;  4J2F A;  4POK A;  3C7M A;  4MF7 A;  3FZA A;  5FT3 A;  3FW2 A;  3VUR A;  4WBJ A;  4GCI A;  2H72 A;  3L4N A;  3GX0 A;  2EIR A;  1MDJ A;  1GNE A;  2R37 A;  3LXT A;  5IOX A;  2MMO A;  4EL1 A;  2N5F A;  1SJ6 A;  5DJL A;  4BL7 B;  1T4Z A;  4DVC A;  3DWV A;  1I9D A;  3DD3 A;  5G1K A;  5KN2 A;  3IK9 A;  5ECH B;  1TK8 B;  3CBU A;  4MNN A;  2WRT A;  2JSZ A;  2IJY A;  3KTL A;  5J5N A;  2K6V A;  2YAN A;  3GKX A;  4IQA A;  3NZN A;  5GZZ B;  3UBL A;  2KUC A;  4OCE A;  1QFN A;  3BCI A;  3D6I A;  1AUC A;  2L59 A;  3CRU A;  4ECC A;  1FG4 A;  3IPZ A;  2VIM A;  4K6X A;  1Z7R A;  2WZ9 A;  1FOV A;  3HA9 A;  2CQ9 A;  2EIO A;  5HR2 A;  3PH9 A;  4AF2 A;  1OC9 B;  3KM6 A;  5CO3 A;  4TR0 A;  2YWO A;  5ECR B;  3GV1 A;  5ECP B;  4MZW A;  1URM A;  3P2A A;  5KOW A;  1GTA A;  2DJK A;  3QPM A;  3GST A;  4ZL9 A;  1O6J A;  2FCH A;  1FVK A;  2VUP A;  1B48 A;  4MLY A;  1BED A;  1KTE A;  4MJC A;  1X5E A;  1TU7 A;  2WB9 A;  5DCG A;  1ZCP A;  5J3R A;  3M0F A;  3M8N A;  4TR3 A;  5F0G A;  2LJR A;  3G7I A;  1PN0 A;  1ZYN A;  1A0R P;  1EZK A;  3U5R E;  1B8X A;  2YV9 A;  4TN8 A;  1ZYQ B;  4ZIJ A;  3ZYW A;  2HSM A;  4OMV A;  4WF5 A;  3H8Q A;  3PGT A;  1SK2 A;  2H8L A;  3CYN A;  2H1B A;  2B6M A;  2XC2 A;  2L5L A;  3EMX A;  2HRA A;  2HE3 A;  4MPG A;  3D21 A;  2OA7 A;  4BWS A;  1PX7 A;  2V2G A;  5HFK A;  2QSI A;  3Q18 A;  3V1W A;  3WT1 A;  3IK7 A;  5LCZ A;  4HOJ A;  2V41 A;  2TRC P;  1GSD A;  4TR1 A;  4QQ7 A;  3IC8 A;  4XTS A;  4KGI A;  5DVB A;  1T4Y A;  3HD5 A;  4K0N A;  5GST A;  3HYP A;  2PPT A;  1M7T A;  3F4S A;  4ZBA A;  4CY6 A;  4HQZ A;  3TDG A;  4MJB A;  1SD8 A;  2X64 A;  5F8B A;  2H1D A;  3MWH A;  4ZL7 A;  1YKC A;  4JR4 A;  4AJ7 A;  2OKA A;  2RUE A;  2DKH A;  5ECN B;  3ISO A;  2DKI A;  4JR6 A;  2WGR A;  5JCU A;  1U88 A;  5B6N A;  2H76 A;  1YDK A;  1XZO A;  3SBC A;  2LNT A;  2LRC A;  1RW1 A;  3O3T A;  5FWG A;  4X4J A;  2B5X A;  4H86 A;  3CTG A;  2B5E A;  4E8E A;  4HZ2 A;  1ABA A;  2JSY A;  2H1G A;  1DUG A;  2IFQ B;  3F63 A;  5ECO B;  3F4T A;  3KMO A;  3PR8 A;  3VI5 A;  3APO A;  4TXV A;  3VWV A;  3GSS A;  4KW6 A;  5IPG A;  4ECI A;  1T7P B;  3IAM 2;  3GL5 A;  3TJF A;  2GST A;  3ERW A;  2ZUP A;  4KF9 A;  3EWL A;  3DVX A;  1OVN A;  1XPV A;  2VCX A;  3TUE A;  3F8U A;  5A5K A;  3US3 A;  4CY8 A;  1YKA A;  3MYD A;  2IMI A;  1SJZ A;  2GZP A;  4AJ6 A;  3RBT A;  3UOM A;  4ZXG A;  4QL7 A;  3P7X A;  3DIE A;  3IHQ A;  4D73 A;  1F37 A;  1XIY A;  4NXI A;  3L9S A;  1VF1 A;  1OYJ A;  2H1A A;  2L6D A;  5F07 A;  3LQ7 A;  4PQH A;  5LD0 A;  3KP8 A;  4ECB A;  2Z9S A;  4I8B A;  4HU9 A;  3G9B A;  10GS A;  1OC3 A;  2IPA A;  1T3B A;  4Z2U A;  2EIQ A;  4YH2 A;  1O8W A;  3A2W A;  4DEJ A;  1EV4 A;  4XRD A;  4OCF A;  3ZIJ A;  3TB2 A;  1HNA A;  2NPB A;  5DBQ A;  1ZMA A;  1M2B A;  3QCP A;  18GS A;  4WF4 A;  1BAY A;  2GZY A;  2VCV A;  3HXS A;  4G19 A;  4JE1 A;  3IBH A;  2C80 A;  4ID0 A;  4Q5F A;  2I1U A;  4RI7 A;  1G7O A;  1K0B A;  3QAW A;  2DIZ A;  2L5O A;  4CDO A;  2A2R A;  2VD0 A;  3GTU A;  5G30 A;  4F03 A;  1XOA A;  2TIR A;  2HFD A;  3F3Q A;  4WKW A;  2GQL A;  1O81 A;  4ZBD A;  5AGY A;  1PRX A;  3LWA A;  2R4V A;  3LJR A;  2AJQ B;  1V40 A;  4Q5R A;  3UVH A;  3QR6 A;  4EC0 A;  2VM2 A;  1C72 A;  3JCM L;  2HNL A;  2PWJ A;  5BMU A;  4WXT A;  1SU9 A;  2KLX A;  4BA7 A;  2DML A;  4YQM A;  1ACV A;  4FQU A;  3SWL A;  2MZC A;  2AB6 A;  4I5Q A;  1X0R A;  4IP6 A;  4LA1 A;  5EL8 A;  2TRX A;  2LQO A;  1K0O A;  2HRK A;  1Z5Y E;  5CRH A;  2LQQ A;  5B6M A;  4YAV A;  3QDN A;  3A2X A;  1V58 A;  3GYK A;  4GST A;  3LXZ A;  3BOA A;  3CQF A;  2JZT A;  1DE1 A;  3ZL5 A;  2CAQ A;  3GH9 A;  2H0H A;  5F06 A;  3N9J A;  4BVY A;  2GT5 A;  4IJ3 A;  1M9A A;  2FA4 A;  2HT9 A;  1ZOF A;  1TRW A;  2VL2 A;  3IR4 A;  3IE3 A;  3GA4 A;  2C1Y A;  5B7C A;  2VLU A;  4AGS A;  4EO3 A;  4O7H A;  4MF5 A;  2FWG A;  2LV3 A;  1S3R A;  1GLQ A;  5CYY A;  5ENU A;  6GSY A;  1K3L A;  2CZ2 A;  4JBB A;  1LU4 A;  2JAD A;  2JL4 A;  3WGX A;  2QA2 A;  4BVX A;  4K5S A;  1OE7 A;  4FYB A;  4XHM A;  2AYT A;  4EF0 A;  1XW6 A;  1SK0 A;  3TCO A;  2RII A;  1ILO A;  4IEL A;  4E8H A;  5D73 A;  3FK8 A;  2YZU A;  2QA1 A;  5IMA A;  2LRT A;  1WOU A;  2OAC A;  5G1L A;  1JLV A;  3F6D A;  4V1A g;  2R5G A;  2X99 A;  2FLS A;  2CVK A;  2PER A;  2H0G A;  4BIK A;  1ZYE A;  5CAX A;  1IYI A;  4MAB A;  4Z2R A;  1M9B A;  2HZE B;  2L6C A;  1PN9 A;  2GSQ A;  3P90 A;  1CQG A;  4LLR A;  1K3O A;  2HRF A;  4OFT A;  3VLN A;  5ECM B;  1N8J A;  2FUG 2;  1BJX A;  3UAR A;  2OJL A;  4PX1 A;  3FZ9 A;  5ELA A;  3EC3 A;  1GUK A;  4D73 B;  4XS4 A;  3L0H A;  4ZL8 A;  1PD2 1;  1X5C A;  1ON4 A;  5A4U A;  1FOH A;  2H66 A;  1OE8 A;  2B3S A;  5D93 A;  2NBS A;  2LEG A;  3IAS 2;  3C73 A;  1J9B A;  2A4H A;  4TRX A;  5HR1 A;  2X8C A;  2VCZ A;  2GSS A;  5IMZ A;  1HNB A;  4RI6 A;  4USS A;  3HKR A;  2YJH A;  4MJE A;  1B4Q A;  4GLT A;  1XW5 A;  2EC4 A;  5KN0 A;  1XWG A;  2FY6 A;  4MH3 A;  2IME A;  5B8B A;  2CX4 A;  4OD7 A;  1SD9 A;  4XS6 A;  2YWN A;  3GTU B;  3UAP A;  1FAA A;  1YF0 A;  3G7Y A;  5AIS A;  4HU7 A;  4BPY A;  3W8S A;  2MMA A;  5DAL A;  1TRU A;  1F2E A;  3KXO A;  3IRA A;  2AAW A;  1PSQ A;  1VF2 A;  1G0T A;  4EE0 A;  2K18 A;  4HUA A;  3H1N A;  2DLX A;  4TKY A;  4K5R A;  4XRA A;  2C0F A;  3RAZ A;  4MH2 A;  1FVJ A;  4HJM A;  3HHV A;  2V32 A;  3UBK A;  4V1A p;  1EOG A;  2HRN A;  1TXX A;  1R5A A;  5ECI B;  4PNG A;  2QGV A;  2RM5 A;  2E2M A;  2PGT A;  4ILF A;  2KP2 A;  3A3T A;  3WYW A;  1XWC A;  4MJA A;  5IM9 A;  4O92 A;  5HR0 A;  4HDE A;  1ERW A;  4JRR A;  4MPF A;  4IJI A;  3EUR A;  4RQR A;  3TKS C;  1GTB A;  2VM1 A;  4BVY B;  5GAP D;  2B7J A;  2X8H A;  4IS0 A;  3I43 A;  2VD1 A;  2CVD A;  1NHO A;  3EE2 A;  1QGV A;  3C1R A;  1WPI A;  1F3B A;  3Q74 A;  2K9F A;  4HJ2 A;  4BWQ A;  3HVN A;  2V1M A;  3DKS A;  1NM3 A;  1K0M A;  4MK3 A;  3A5I A;  2OE0 A;  3Q6O A;  3VFI A;  1GWC A;  4K1F A;  3TGZ A;  1V9W A;  1PL1 A;  5IO0 A;  2CT6 A;  3FR3 A;  3J7Y b;  1S3D A;  2O87 A;  2KP1 A;  5LNK e;  2HYX A;  5JCW A;  4EDY A;  3GMF A;  3GKM A;  3IC4 A;  5IOW A;  4N30 A;  1Z3E A;  5INY A;  1TKD B;  4KCE A;  4HSC X;  1F6M C;  1TOF A;  5IMD A;  1ERT A;  1QK8 A;  3UVT A;  4L0W A;  19GS A;  1XW9 A;  5DCH A;  2DJ1 A;  4K2X A;  3CRT A;  5COH A;  1PMT A;  2R2J A;  5IO2 A;  5KOX A;  4EUY A;  1DE2 A;  4NAX A;  4PQ1 A;  1R26 A;  5DQY A;  4YKG A;  2YZH A;  1GUM A;  3BD2 A;  4KH7 A;  1GRX A;  1V57 A;  3F3R A;  4GXZ A;  3GUR A;  4GSN A;  1U6T A;  2GDR A;  2F8A A;  2O8V B;  1YEP A;  3S9F A;  1M3I A;  1PA3 A;  5ECS A;  5IMV A;  1E6B A;  1EP8 A;  1ZZY A;  2PBJ A;  2NTO A;  1MEK A;  4L5L A;  2DC5 A;  5G5F A;  2L4Q A;  4NHZ A;  5IPH A;  1O7U A;  1A2L A;  2DBC A;  2PVQ A;  2F51 A;  1YEX A;  1GLP A;  2GT6 A;  1XCC A;  3FKF A;  5D9V A;  1UC7 A;  1GSF A;  2H75 A;  1DSB A;  3GX8 A;  1MTC A;  1UN2 A;  4AJ8 A;  5KN1 A;  1X5D A;  2WFC A;  4WET A;  4TVE A;  4KDY A;  1GP1 A;  1PKW A;  2GTU A;  6GSX A;  4GF0 A;  1ST9 A;  5BRT A;  3MAK A;  3MNG A;  3KP9 A;  4L8E A;  1HYU A;  3ZRE A;  5DAK B;  5DDL A;  4MMM A;  1M3J A;  3HCZ A;  1SL0 B;  3QOU A;  2J23 A;  5DAL B;  4EKZ A;  3QAG A;  3O76 A;  6GSW A;  1GSS A;  1Z6N A;  3WGE A;  1F9M A;  2D2Z A;  2OE1 A;  3EU4 A;  5EY6 A;  2WCI A;  3E3E A;  2ON5 A;  3PPU A;  4POM A;  5F05 A;  1EV9 A;  4KA0 A;  4G10 A;  4JED A;  2B1K A;  4ZB8 A;  1VGL A;  2ES7 A;  3K8N A;  2OBI A;  1WWJ A;  4P3Y B;  1NSW A;  3M9K A;  1K0C A;  9GSS A;  1A23 A;  2DMM A;  1SYX A;  4F2I A;  1OKT A;  2VLT A;  2R6K A;  3ZVJ A;  4G9H A;  1AC1 A;  1SL2 B;  4ZB9 A;  2R0G A;  4EXJ A;  3QAV A;  1HNC A;  2E7P A;  2C4J A;  3QMX A;  4HEA 2;  4IQ1 A;  5D9X A;  1PX6 A;  3A2V A;  4KB3 A;  1A24 A;  2F8F A;  3IV4 A;  4LL4 B;  2CZ3 A;  2VAF A;  2BMX A;  2FD3 A;  3KMN A;  5D9T A;  3KH7 A;  3F0I A;  1T8E B;  3E0U A;  4NV5 A;  5B8A A;  1V98 A;  1AQV A;  2GGT A;  3AY8 A;  2PUK C;  1QMV A;  3LG6 A;  5CRD A;  3H4K A;  3H79 A;  1Y25 A;  3C8E A;  1VF3 A;  4N0Z A;  1TI3 A;  5CRG A;  1Z6M A;  2GQM A;  3UJ1 A;  2R0P A;  1KEB A;  5CP1 A;  4IKH A;  3KEB A;  4X0X A;  2JU5 A;  1GSQ A;  4IBP A;  2LRN A;  1PGT A;  4G0L A;  3VWU A;  4PUF C;  1S3A A;  2RM6 A;  1Y6E A;  3ZVJ D;  1JZO A;  3ZFB A;  3TOT A;  3DVW A;  4PNF A;  4MCU A;  3TKR A;  1USB A;  1K3Y A;  13GS A;  4BL7 A;  2VCT A;  1O85 A;  3E9J B;  4I2U A;  4KAE A;  3DXB A;  4POB A;  1AAZ A;  1XG8 A;  1THX A;  2H71 A;  4L0U A;  4DSQ A;  2YWM A;  5D8I A;  4TR1 B;  2NDO A;  3OR5 A;  2MMN A;  3C71 A;  3EPT A;  1RK4 A;  4TW5 A;  2HI7 A;  1GTI A;  6GSV A;  3KCM A;  4ECJ A;  5IMF A;  1T1V A;  1OAZ A;  3NIV A;  4N11 A;  5ABR A;  1JLW A;  3FZ5 A;  2HZF A;  5AIV A;  5IIZ A;  1OC9 A;  3ZIT A;  2GVP A;  4OO5 A;  1V2A A;  5FHI A;  4TXO A;  2JZR A;  2CV4 A;  3CTF A;  1G7E A;  1JFU A;  4WR4 A;  5GAN D;  3PIN A;  2JAC A;  1MD3 A;  1NW2 A;  4FYC A;  8GSS A;  4K7I A;  3R2Q A;  1A8Y A;  2YJ7 A;  3BJ5 A;  2JZS A;  2C0G A;  5G5E A;  5HR3 A;  2FNO A;  1FB6 A;  2IMF A;  1GUH A;  2I4A A;  1K0D A;  4KSM A;  1XWK A;  4KDU A;  3DYR A;  3RPP A;  5GSS A;  3HJM A;  4YKF A;  2DJ0 A;  4YQV A;  2AV4 A;  3IA1 A;  4F0C A;  1XOB A;  1QXH A;  4V2N A;  3P8W A;  2PMT A;  2KOK A;  4HQS A;  4ZBB A;  1FB0 A;  5JWO B;  1U3I A;  3CSI A;  1ZGN A;  1U3A A;  3TKS E;  1Q98 A;  3CXG A;  4RQX A;  2REM A;  16GS A;  1MDI A;  3ZTL A;  2N5A A;  20GS A;  3ZMK A;  3HVS A;  2MBT A;  1U87 A;  1SKS B;  2YP6 A;  3NOF A;  2GSR A;  4GTU A;  3ZRD A;  3DGQ A;  1XVW A;  3WD6 A;  4DSS A;  1YQ1 A;  1SYR A;  1BYE A;  2DJJ A;  5L71 A;  1JZR A;  1ML6 A;  1MD4 A;  3ME7 A;  4Z2T A;  2PU9 C;  3GL3 A;  5E59 A;  1DBY A;  3D4T A;  4K9Z A;  2GQK A;  2IWT A;  1EGR A;  2YOI A;  3RHB A;  5KN3 A;  2X49 A;  2M72 A;  3LOR A;  4ISD A;  1HD2 A;  2H6Z A;  2HSH A;  3EVI A;  5HFI A;  1W89 A;  1YF1 A;  2DSA A;  2YNX A;  2NVL A;  2MYG A;  4OWY A;  2K8V A;  3D4M A;  4NHW A;  2IFQ A;  2LUS A;  4I97 A;  1PFO A;  5EPF A;  3FEU A;  2HXK A;  3UL3 A;  2LJK A;  3ZZX A;  4TR4 A;  1WP0 A;  1GTU A;  1GNW A;  1OKD A;  4IGJ A;  4V2L A;  3LW9 A;  3FYG A;  2IMD A;  4PTS A;  2FGX A;  3LYK A;  3F9U A;  1J0F A;  4L5O A;  1BX9 A;  3KTB A;  1B9Y C;  4GQC A;  3FHK A;  1ZYP A;  4PGT A;  1A0F A;  2LTK A;  1KBN A;  4HI7 A;  4KSO A;  4I2T A;  1NHY A;  1WMJ A;  2LKU A;  1EEM A;  1F3A A;  2P5Q A;  14GS A;  5A4V A;  5JCG A;  1SL1 B; 
#chains in the Genus database with same CATH homology
 1XWA A;  3L9V A;  4HZ4 A;  2FHE A;  3RPN A;  4OO4 A;  3QFA C;  1W4V A;  3FMW A;  4PXO A;  5H5S A;  3HVX A;  5D9W A;  5G31 A;  1FO5 A;  4XS1 A;  3ZIV A;  3HZ4 A;  1EOH A;  1M2A A;  2H74 A;  4ZB6 A;  3J7Y k;  2IL3 A;  1O8X A;  2PVO C;  2X8G A;  2ON7 A;  1AQX A;  3M9J A;  3MIX A;  1THO A;  5EVO A;  3CSJ A;  1WRY A;  1UA5 A;  4POL A;  4NPB A;  2VL3 A;  3VWX A;  1TI1 A;  3I6A A;  1B4P A;  3GH6 A;  2YPM A;  1SKW B;  1G6Y A;  4BVX B;  4TXO B;  17GS A;  2XHF A;  2AUV A;  3BCK A;  4IN0 A;  4RUV A;  4Q5Q A;  1GSU A;  1EWX A;  1A2J A;  3ZLP A;  2O89 A;  4CHS A;  2I9H A;  4J57 E;  1R4W A;  2ALB A;  1TDI A;  1VRS D;  5H5R A;  11GS A;  4FO5 A;  3QD9 A;  1XWB A;  4WR5 A;  3N5O A;  3G7J A;  4J56 E;  1QUW A;  1X9W B;  3ZML A;  2C3T A;  2P0G A;  3TKP A;  1Z7P A;  4PUA A;  4KX4 A;  4XCS A;  1SJI A;  3GRX A;  3IXR A;  1SKR B;  3ERG A;  4MDC A;  3TRQ A;  2KHP A;  2B7K A;  3GHA A;  5IMC A;  3TKQ A;  2A2S A;  4IVF A;  2CA8 A;  1K0A A;  5C00 A;  2H70 A;  5J9B A;  2VCW A;  5J41 A;  3KJY A;  2DJ3 A;  1GSE A;  3IOS A;  2H0I A;  4NMU A;  4XS4 B;  1LBK A;  1ERU A;  3RDW A;  3LGC A;  2V6O A;  4MZC A;  5DJM A;  5CNW A;  3ZFL A;  3O6T A;  2N5B A;  1ERV A;  2WS2 A;  2H73 A;  4DSS B;  12GS A;  1RQM A;  1WJK A;  3L78 A;  2O85 A;  1LJR A;  4I6X A;  2YN1 A;  4EVM A;  1PKZ A;  1JHB A;  4N10 A;  1WIK A;  3GIX A;  4ULX A;  3TOU A;  4GQF A;  5HQP A;  1TK0 B;  1S3C A;  3W8J A;  4K8M A;  4EDZ A;  4KE3 A;  1YZX A;  3DML A;  1EGO A;  3LFL A;  2GZZ A;  1XBS A;  1JZD A;  4K2D A;  3CSH A;  2ZCT A;  3D22 A;  4K7N A;  2I81 A;  2R0C A;  2X4A A;  4HS1 A;  2IMK A;  3U6V A;  1GH2 A;  2HZE A;  3KD0 A;  4FYU A;  2C0D A;  3QFB C;  4G0I A;  2E0Q A;  3M1G A;  3VK9 A;  1OC8 A;  5ID2 A;  3H93 A;  1B9X C;  5KEJ A;  1TP9 A;  3KH9 A;  1A8L A;  3HY2 A;  1XXU A;  3HVV A;  4G2E A;  4ICY A;  3M3M A;  4O5U A;  4MP4 A;  3GFK A;  3LEF A;  4JZQ A;  5ECL B;  2LS5 A;  2E2G A;  4G0K A;  4O32 A;  1AW9 A;  3APQ A;  3L9U A;  5G2Z A;  2LNS A;  2DIY A;  7GSS A;  4MA9 A;  2MBS A;  2R3X A;  3HJO A;  1BG5 A;  3F6F A;  4JU5 A;  4F0B A;  2OE3 A;  5AN1 A;  4A5P A;  2WUL A;  2PN8 A;  2P31 A;  4KND A;  3FR6 A;  3F4R A;  2B1L A;  2L57 A;  2OAD A;  4K0G A;  2XPE A;  2F9S A;  5AIX A;  5D96 A;  1MDK A;  3TJB A;  3I69 A;  3EIN A;  1TU8 A;  4EIP A;  5HFG A;  1Q4J A;  1Z9H A;  3ED3 A;  3GKN A;  2BJX A;  2FWE A;  1GUL A;  1ZL9 A;  2HLS A;  4GWR A;  1SK1 A;  5ECK B;  3VPQ A;  2YCD A;  4Z7X A;  2IN3 A;  4OFM A;  2CAI A;  2H6X A;  1GL8 A;  3EU3 A;  2C3Q A;  5H5Q A;  2B5Y A;  3IHG A;  3WGD A;  4WEY A;  2VOC A;  2J9H A;  5DQS A;  1K0N A;  3TRX A;  3FR9 A;  2VO4 A;  3R3E A;  4ML1 A;  2O7K A;  2C3N A;  5ELG A;  4F9Z A;  3ME8 A;  6GSS A;  2RLI A;  6GST A;  2L4C A;  2YV7 A;  3D0Z A;  1A2M A;  4O5R A;  4F82 A;  2H19 A;  3Q19 A;  4KUN A;  2A2P A;  1JZW A;  1CQH A;  1T00 A;  3KIJ A;  2VCQ A;  2MMZ A;  4Q5N A;  4GRF A;  3W6G A;  1X9M B;  2V6K A;  1R5P A;  1YY7 A;  3TJK A;  3FY7 A;  1SEN A;  1R7H A;  4O5Q A;  3LSZ A;  4NV2 A;  4CW9 A;  1QQ2 A;  1UVZ A;  4QL9 A;  1TRV A;  3HDC A;  4IHU A;  2P5R A;  5IQY A;  4IP1 A;  3MDK A;  1IYH A;  2VL9 A;  4WBR D;  4EIQ A;  3EMP A;  4PQI A;  1FHE A;  4PUR A;  2XBI A;  3DEX A;  3MSZ A;  5E4W A;  2I3Y A;  1EP7 A;  4V2M A;  3RHC A;  2M46 A;  1EEJ A;  3GN3 A;  3WT2 A;  2GLR A;  1M99 A;  1E2Y A;  2GS3 A;  2K8S A;  4MZB A;  1H75 A;  1M2D A;  2WDU A;  3D5J A;  2UZ8 A;  2HSY A;  5A4W A;  4YAP A;  1M0U A;  3HJP A;  2AHE A;  1TK5 B;  4FIW A;  1O73 A;  3UMA A;  2G2Q A;  1J08 A;  6GSU A;  5JWQ B;  4OFN A;  2LJA A;  1X9S B;  3ERF A;  3I9V 2;  1AXD A;  2G0F A;  1AQW A;  1AIU A;  4GSS A;  2DJ2 A;  4X1U A;  2C0E A;  3TJG A;  3VWW A;  2M80 A;  5ID2 B;  3HZ8 A;  4LMW A;  1GSY A;  3KZQ A;  4IW9 A;  3C1S A;  5JWR B;  1TW9 A;  2XBQ A;  4X43 A;  3BBY A;  2BTO T;  1G6W A;  1XVQ A;  3TKS A;  1XFL A;  1TRS A;  1FW1 A;  3TJJ A;  4ML6 A;  1TJD A;  22GS A;  2FA8 A;  5ECQ B;  4YQU A;  2F3M A;  4LMV A;  4N0V A;  3VPT A;  4MF6 A;  5CRW A;  4DSR A;  2XPD A;  5J9C A;  1I5G A;  1PQN A;  1WE0 A;  2YWI A;  4KCA A;  2VL2 C;  3IDV A;  1VF4 A;  2QC7 A;  2QKE A;  3CMI A;  1KNG A;  1N2A A;  2FWF A;  2CVB A;  2H6Y A;  3APS A;  4LL1 B;  3GKK A;  2LST A;  3EYT A;  4TOP A;  1BQ7 A;  4ZIL A;  3A5W A;  3FZ4 A;  3GNJ A;  3FRC A;  5C04 A;  2A4V A;  1PL2 A;  2WJU A;  5J4U A;  2ZNM A;  4XIH A;  2RUF A;  3TRP A;  3UEM A;  4ACS A;  2FWH A;  2IIY A;  2C8U A;  2VLV A;  3GUS A;  3LYP A;  1TTZ A;  2H01 A;  2H30 A;  5CRE A;  3KGK A;  1HQO A;  4KDX A;  4K7O A;  4NWY A;  3VI7 A;  1H4O A;  4FH8 A;  3DRN A;  5DAK A;  2OBK A;  1YJ6 A;  2CX3 A;  3UIW A;  4J2F A;  4POK A;  3C7M A;  4MF7 A;  3FZA A;  5FT3 A;  3FW2 A;  3VUR A;  4WBJ A;  4GCI A;  2H72 A;  3L4N A;  3GX0 A;  2EIR A;  1MDJ A;  1GNE A;  2R37 A;  3LXT A;  5IOX A;  2MMO A;  4EL1 A;  2N5F A;  1SJ6 A;  5DJL A;  4BL7 B;  1T4Z A;  4DVC A;  3DWV A;  1I9D A;  3DD3 A;  5G1K A;  5KN2 A;  3IK9 A;  5ECH B;  1TK8 B;  3CBU A;  4MNN A;  2WRT A;  2JSZ A;  2IJY A;  3KTL A;  5J5N A;  2K6V A;  2YAN A;  3GKX A;  4IQA A;  3NZN A;  5GZZ B;  3UBL A;  2KUC A;  4OCE A;  1QFN A;  3BCI A;  3D6I A;  1AUC A;  2L59 A;  3CRU A;  4ECC A;  1FG4 A;  3IPZ A;  2VIM A;  4K6X A;  1Z7R A;  2WZ9 A;  1FOV A;  3HA9 A;  2CQ9 A;  2EIO A;  5HR2 A;  3PH9 A;  4AF2 A;  1OC9 B;  3KM6 A;  5CO3 A;  4TR0 A;  2YWO A;  5ECR B;  3GV1 A;  5ECP B;  4MZW A;  1URM A;  3P2A A;  5KOW A;  1GTA A;  2DJK A;  3QPM A;  3GST A;  4ZL9 A;  1O6J A;  2FCH A;  1FVK A;  2VUP A;  1B48 A;  4MLY A;  1BED A;  1KTE A;  4MJC A;  1X5E A;  1TU7 A;  2WB9 A;  5DCG A;  1ZCP A;  5J3R A;  3M0F A;  3M8N A;  4TR3 A;  5F0G A;  2LJR A;  3G7I A;  1PN0 A;  1ZYN A;  1A0R P;  1EZK A;  3U5R E;  1B8X A;  2YV9 A;  4TN8 A;  1ZYQ B;  4ZIJ A;  3ZYW A;  2HSM A;  4OMV A;  4WF5 A;  3H8Q A;  3PGT A;  1SK2 A;  2H8L A;  3CYN A;  2H1B A;  2B6M A;  2XC2 A;  2L5L A;  3EMX A;  2HRA A;  2HE3 A;  4MPG A;  3D21 A;  2OA7 A;  4BWS A;  1PX7 A;  2V2G A;  5HFK A;  2QSI A;  3Q18 A;  3V1W A;  3WT1 A;  3IK7 A;  5LCZ A;  4HOJ A;  2V41 A;  2TRC P;  1GSD A;  4TR1 A;  4QQ7 A;  3IC8 A;  4XTS A;  4KGI A;  5DVB A;  1T4Y A;  3HD5 A;  4K0N A;  5GST A;  3HYP A;  2PPT A;  1M7T A;  3F4S A;  4ZBA A;  4CY6 A;  4HQZ A;  3TDG A;  4MJB A;  1SD8 A;  2X64 A;  5F8B A;  2H1D A;  3MWH A;  4ZL7 A;  1YKC A;  4JR4 A;  4AJ7 A;  2OKA A;  2RUE A;  2DKH A;  5ECN B;  3ISO A;  2DKI A;  4JR6 A;  2WGR A;  5JCU A;  1U88 A;  5B6N A;  2H76 A;  1YDK A;  1XZO A;  3SBC A;  2LNT A;  2LRC A;  1RW1 A;  3O3T A;  5FWG A;  4X4J A;  2B5X A;  4H86 A;  3CTG A;  2B5E A;  4E8E A;  4HZ2 A;  1ABA A;  2JSY A;  2H1G A;  1DUG A;  2IFQ B;  3F63 A;  5ECO B;  3F4T A;  3KMO A;  3PR8 A;  3VI5 A;  3APO A;  4TXV A;  3VWV A;  3GSS A;  4KW6 A;  5IPG A;  4ECI A;  1T7P B;  3IAM 2;  3GL5 A;  3TJF A;  2GST A;  3ERW A;  2ZUP A;  4KF9 A;  3EWL A;  3DVX A;  1OVN A;  1XPV A;  2VCX A;  3TUE A;  3F8U A;  5A5K A;  3US3 A;  4CY8 A;  1YKA A;  3MYD A;  2IMI A;  1SJZ A;  2GZP A;  4AJ6 A;  3RBT A;  3UOM A;  4ZXG A;  4QL7 A;  3P7X A;  3DIE A;  3IHQ A;  4D73 A;  1F37 A;  1XIY A;  4NXI A;  3L9S A;  1VF1 A;  1OYJ A;  2H1A A;  2L6D A;  5F07 A;  3LQ7 A;  4PQH A;  5LD0 A;  3KP8 A;  4ECB A;  2Z9S A;  4I8B A;  4HU9 A;  3G9B A;  10GS A;  1OC3 A;  2IPA A;  1T3B A;  4Z2U A;  2EIQ A;  4YH2 A;  1O8W A;  3A2W A;  4DEJ A;  1EV4 A;  4XRD A;  4OCF A;  3ZIJ A;  3TB2 A;  1HNA A;  2NPB A;  5DBQ A;  1ZMA A;  1M2B A;  3QCP A;  18GS A;  4WF4 A;  1BAY A;  2GZY A;  2VCV A;  3HXS A;  4G19 A;  4JE1 A;  3IBH A;  2C80 A;  4ID0 A;  4Q5F A;  2I1U A;  4RI7 A;  1G7O A;  1K0B A;  3QAW A;  2DIZ A;  2L5O A;  4CDO A;  2A2R A;  2VD0 A;  3GTU A;  5G30 A;  4F03 A;  1XOA A;  2TIR A;  2HFD A;  3F3Q A;  4WKW A;  2GQL A;  1O81 A;  4ZBD A;  5AGY A;  1PRX A;  3LWA A;  2R4V A;  3LJR A;  2AJQ B;  1V40 A;  4Q5R A;  3UVH A;  3QR6 A;  4EC0 A;  2VM2 A;  1C72 A;  3JCM L;  2HNL A;  2PWJ A;  5BMU A;  4WXT A;  1SU9 A;  2KLX A;  4BA7 A;  2DML A;  4YQM A;  1ACV A;  4FQU A;  3SWL A;  2MZC A;  2AB6 A;  4I5Q A;  1X0R A;  4IP6 A;  4LA1 A;  5EL8 A;  2TRX A;  2LQO A;  1K0O A;  2HRK A;  1Z5Y E;  5CRH A;  2LQQ A;  5B6M A;  4YAV A;  3QDN A;  3A2X A;  1V58 A;  3GYK A;  4GST A;  3LXZ A;  3BOA A;  2JZT A;  1DE1 A;  3ZL5 A;  2CAQ A;  3GH9 A;  2H0H A;  5F06 A;  3N9J A;  4BVY A;  2GT5 A;  4IJ3 A;  1M9A A;  2FA4 A;  2HT9 A;  1ZOF A;  1TRW A;  2VL2 A;  3IR4 A;  3IE3 A;  3GA4 A;  2C1Y A;  5B7C A;  2VLU A;  4AGS A;  4EO3 A;  4O7H A;  4MF5 A;  2FWG A;  2LV3 A;  1GLQ A;  5CYY A;  5ENU A;  6GSY A;  1K3L A;  2CZ2 A;  4JBB A;  1LU4 A;  2JAD A;  2JL4 A;  3WGX A;  2QA2 A;  4BVX A;  4K5S A;  1OE7 A;  4FYB A;  4XHM A;  2AYT A;  4EF0 A;  1XW6 A;  1SK0 A;  3TCO A;  2RII A;  1ILO A;  4IEL A;  4E8H A;  5D73 A;  3FK8 A;  2YZU A;  2QA1 A;  5IMA A;  2LRT A;  1WOU A;  2OAC A;  5G1L A;  1JLV A;  3F6D A;  4V1A g;  2R5G A;  2X99 A;  2FLS A;  2CVK A;  2PER A;  2H0G A;  1ZYE A;  5CAX A;  1IYI A;  4MAB A;  4Z2R A;  1M9B A;  2HZE B;  2L6C A;  1PN9 A;  2GSQ A;  3P90 A;  1CQG A;  4LLR A;  1K3O A;  2HRF A;  4OFT A;  3VLN A;  5ECM B;  1N8J A;  2FUG 2;  1BJX A;  3UAR A;  2OJL A;  4PX1 A;  3FZ9 A;  5ELA A;  3EC3 A;  1GUK A;  4D73 B;  4XS4 A;  3L0H A;  4ZL8 A;  1PD2 1;  1X5C A;  1ON4 A;  5A4U A;  1FOH A;  2H66 A;  1OE8 A;  2B3S A;  5D93 A;  2NBS A;  2LEG A;  3IAS 2;  3C73 A;  1J9B A;  2A4H A;  4TRX A;  5HR1 A;  2X8C A;  2VCZ A;  2GSS A;  5IMZ A;  1HNB A;  4RI6 A;  4USS A;  3HKR A;  2YJH A;  4MJE A;  1B4Q A;  4GLT A;  1XW5 A;  2EC4 A;  5KN0 A;  1XWG A;  2FY6 A;  4MH3 A;  2IME A;  5B8B A;  2CX4 A;  4OD7 A;  1SD9 A;  4XS6 A;  2YWN A;  3GTU B;  3UAP A;  1FAA A;  1YF0 A;  3G7Y A;  5AIS A;  4HU7 A;  4BPY A;  3W8S A;  2MMA A;  5DAL A;  1TRU A;  1F2E A;  3KXO A;  3IRA A;  2AAW A;  1PSQ A;  1VF2 A;  1G0T A;  4EE0 A;  2K18 A;  4HUA A;  3H1N A;  2DLX A;  4TKY A;  4K5R A;  4XRA A;  2C0F A;  3RAZ A;  4MH2 A;  1FVJ A;  4HJM A;  3HHV A;  2V32 A;  3UBK A;  4V1A p;  1EOG A;  2HRN A;  1TXX A;  1R5A A;  5ECI B;  4PNG A;  2QGV A;  2RM5 A;  2E2M A;  2PGT A;  4ILF A;  2KP2 A;  3A3T A;  3WYW A;  1XWC A;  4MJA A;  5IM9 A;  4O92 A;  5HR0 A;  4HDE A;  1ERW A;  4JRR A;  4MPF A;  4IJI A;  3EUR A;  4RQR A;  3TKS C;  1GTB A;  2VM1 A;  4BVY B;  5GAP D;  2B7J A;  2X8H A;  4IS0 A;  3I43 A;  2VD1 A;  2CVD A;  1NHO A;  3EE2 A;  1QGV A;  3C1R A;  1WPI A;  1F3B A;  3Q74 A;  2K9F A;  4HJ2 A;  4BWQ A;  2V1M A;  3DKS A;  1NM3 A;  1K0M A;  4MK3 A;  3A5I A;  2OE0 A;  3Q6O A;  3VFI A;  1GWC A;  4K1F A;  3TGZ A;  1V9W A;  1PL1 A;  5IO0 A;  2CT6 A;  3FR3 A;  3J7Y b;  1S3D A;  2O87 A;  2KP1 A;  5LNK e;  2HYX A;  5JCW A;  4EDY A;  3GMF A;  3GKM A;  3IC4 A;  5IOW A;  4N30 A;  1Z3E A;  5INY A;  1TKD B;  4KCE A;  1F6M C;  1TOF A;  5IMD A;  1ERT A;  1QK8 A;  3UVT A;  4L0W A;  19GS A;  1XW9 A;  5DCH A;  2DJ1 A;  4K2X A;  3CRT A;  5COH A;  1PMT A;  2R2J A;  5IO2 A;  5KOX A;  4EUY A;  1DE2 A;  4NAX A;  4PQ1 A;  1R26 A;  5DQY A;  4YKG A;  2YZH A;  1GUM A;  3BD2 A;  4KH7 A;  1GRX A;  1V57 A;  3F3R A;  4GXZ A;  3GUR A;  4GSN A;  1U6T A;  2GDR A;  2F8A A;  2O8V B;  1YEP A;  3S9F A;  1PA3 A;  5ECS A;  5IMV A;  1E6B A;  1EP8 A;  1ZZY A;  2PBJ A;  2NTO A;  1MEK A;  4L5L A;  2DC5 A;  5G5F A;  2L4Q A;  4NHZ A;  5IPH A;  1O7U A;  1A2L A;  2DBC A;  2PVQ A;  2F51 A;  1YEX A;  1GLP A;  2GT6 A;  1XCC A;  3FKF A;  5D9V A;  1UC7 A;  1GSF A;  2H75 A;  1DSB A;  3GX8 A;  1MTC A;  1UN2 A;  4AJ8 A;  5KN1 A;  1X5D A;  2WFC A;  4WET A;  4TVE A;  4KDY A;  1GP1 A;  1PKW A;  2GTU A;  6GSX A;  4GF0 A;  1ST9 A;  5BRT A;  3MAK A;  3MNG A;  3KP9 A;  4L8E A;  1HYU A;  3ZRE A;  5DAK B;  5DDL A;  4MMM A;  3HCZ A;  1SL0 B;  3QOU A;  2J23 A;  5DAL B;  4EKZ A;  3QAG A;  3O76 A;  6GSW A;  1GSS A;  1Z6N A;  3WGE A;  1F9M A;  2D2Z A;  2OE1 A;  3EU4 A;  5EY6 A;  2WCI A;  3E3E A;  2ON5 A;  3PPU A;  4POM A;  5F05 A;  1EV9 A;  4KA0 A;  4G10 A;  4JED A;  2B1K A;  4ZB8 A;  1VGL A;  2ES7 A;  3K8N A;  2OBI A;  1WWJ A;  4P3Y B;  1NSW A;  3M9K A;  1K0C A;  9GSS A;  1A23 A;  2DMM A;  1SYX A;  4F2I A;  1OKT A;  2VLT A;  2R6K A;  3ZVJ A;  4G9H A;  1AC1 A;  1SL2 B;  4ZB9 A;  2R0G A;  4EXJ A;  3QAV A;  1HNC A;  2E7P A;  2C4J A;  3QMX A;  4HEA 2;  4IQ1 A;  5D9X A;  1PX6 A;  3A2V A;  4KB3 A;  1A24 A;  2F8F A;  3IV4 A;  4LL4 B;  2CZ3 A;  2VAF A;  2BMX A;  2FD3 A;  3KMN A;  5D9T A;  3KH7 A;  3F0I A;  1T8E B;  3E0U A;  4NV5 A;  5B8A A;  1V98 A;  1AQV A;  2GGT A;  3AY8 A;  2PUK C;  1QMV A;  3LG6 A;  5CRD A;  3H4K A;  3H79 A;  1Y25 A;  3C8E A;  1VF3 A;  4N0Z A;  1TI3 A;  5CRG A;  1Z6M A;  2GQM A;  3UJ1 A;  2R0P A;  1KEB A;  5CP1 A;  4IKH A;  3KEB A;  4X0X A;  2JU5 A;  1GSQ A;  4IBP A;  2LRN A;  1PGT A;  4G0L A;  3VWU A;  4PUF C;  1S3A A;  2RM6 A;  1Y6E A;  3ZVJ D;  1JZO A;  3ZFB A;  3TOT A;  3DVW A;  4PNF A;  4MCU A;  3TKR A;  1USB A;  1K3Y A;  13GS A;  4BL7 A;  2VCT A;  1O85 A;  3E9J B;  4I2U A;  4KAE A;  3DXB A;  4POB A;  1AAZ A;  1THX A;  2H71 A;  4L0U A;  4DSQ A;  2YWM A;  5D8I A;  4TR1 B;  2NDO A;  3OR5 A;  2MMN A;  3C71 A;  3EPT A;  1RK4 A;  4TW5 A;  2HI7 A;  1GTI A;  6GSV A;  3KCM A;  4ECJ A;  5IMF A;  1T1V A;  1OAZ A;  3NIV A;  4N11 A;  5ABR A;  1JLW A;  3FZ5 A;  2HZF A;  5AIV A;  5IIZ A;  1OC9 A;  3ZIT A;  2GVP A;  4OO5 A;  1V2A A;  5FHI A;  4TXO A;  2JZR A;  2CV4 A;  3CTF A;  1G7E A;  1JFU A;  4WR4 A;  5GAN D;  3PIN A;  2JAC A;  1MD3 A;  1NW2 A;  4FYC A;  8GSS A;  4K7I A;  3R2Q A;  1A8Y A;  2YJ7 A;  3BJ5 A;  2JZS A;  2C0G A;  5G5E A;  5HR3 A;  2FNO A;  1FB6 A;  2IMF A;  1GUH A;  2I4A A;  1K0D A;  4KSM A;  1XWK A;  4KDU A;  3DYR A;  3RPP A;  5GSS A;  3HJM A;  4YKF A;  2DJ0 A;  4YQV A;  2AV4 A;  3IA1 A;  4F0C A;  1XOB A;  1QXH A;  4V2N A;  3P8W A;  2PMT A;  2KOK A;  4HQS A;  4ZBB A;  1FB0 A;  5JWO B;  1U3I A;  3CSI A;  1ZGN A;  1U3A A;  3TKS E;  1Q98 A;  3CXG A;  4RQX A;  2REM A;  16GS A;  1MDI A;  3ZTL A;  2N5A A;  20GS A;  3ZMK A;  3HVS A;  2MBT A;  1U87 A;  1SKS B;  2YP6 A;  3NOF A;  2GSR A;  4GTU A;  3ZRD A;  3DGQ A;  1XVW A;  3WD6 A;  4DSS A;  1YQ1 A;  1SYR A;  1BYE A;  2DJJ A;  5L71 A;  1JZR A;  1ML6 A;  1MD4 A;  3ME7 A;  4Z2T A;  2PU9 C;  3GL3 A;  5E59 A;  1DBY A;  3D4T A;  4K9Z A;  2GQK A;  2IWT A;  1EGR A;  2YOI A;  3RHB A;  5KN3 A;  2X49 A;  2M72 A;  3LOR A;  4ISD A;  1HD2 A;  2H6Z A;  2HSH A;  3EVI A;  5HFI A;  1W89 A;  1YF1 A;  2DSA A;  2YNX A;  2NVL A;  2MYG A;  4OWY A;  2K8V A;  3D4M A;  4NHW A;  2IFQ A;  2LUS A;  4I97 A;  5EPF A;  3FEU A;  2HXK A;  3UL3 A;  2LJK A;  3ZZX A;  4TR4 A;  1WP0 A;  1GTU A;  1GNW A;  1OKD A;  4IGJ A;  4V2L A;  3LW9 A;  3FYG A;  2IMD A;  4PTS A;  2FGX A;  3LYK A;  3F9U A;  1J0F A;  4L5O A;  1BX9 A;  3KTB A;  1B9Y C;  4GQC A;  3FHK A;  1ZYP A;  1A0F A;  4PGT A;  2LTK A;  1KBN A;  4HI7 A;  4KSO A;  4I2T A;  1NHY A;  1WMJ A;  2LKU A;  1EEM A;  1F3A A;  2P5Q A;  14GS A;  5A4V A;  5JCG A;  1SL1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...