2O85A

S. aureus thioredoxin p31t mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
AIVKVTDADFDSKVESGVQLVDFWATWCGTCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Thioredoxin
publication title The conserved active site proline determines the reducing power of Staphylococcus aureus thioredoxin
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 27
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2o85A00
3FEUA 2B7JA 1SK0A 5ECMB 3APOA 4PQIA 4N11A 2ON7A 3RAZA 3A5WA 5B6NA 5CP1A 4NXIA 2YWMA 1YEXA 2X64A 1XW9A 4HQZA 1BQ7A 3CBUA 2PMTA 3CTFA 4O7HA 9GSSA 2WGRA 1SENA 1SYXA 2CZ3A 1YKAA 4JR4A 1THOA 5EY6A 2YZHA 2WZ9A 4ILFA 2H70A 4J57E 4RI6A 4ECIA 1TU8A 1FVJA 2R6KA 2PVOC 4IHUA 2WFCA 2IN3A 2GZZA 2GZYA 2IMFA 1WWJA 2LKUA 2H1BA 4F0CA 1BG5A 1A0FA 2H74A 1FO5A 2VCTA 1USBA 4GWRA 1Z9HA 1JZDA 4IELA 3VWVA 5HR0A 1HNBA 4CW9A 3LXZA 4V2MA 4V2LA 4GLTA 2DJJA 5DAKA 5CNWA 4RQXA 1QQ2A 1YY7A 1A23A 1XIYA 2HSHA 5DAKB 4LA1A 5ECSA 3CYNA 4ZB6A 2FWHA 1TU7A 2NPBA 3G7IA 2DJKA 3GKKA 1AIUA 2A2RA 2VD1A 1E6BA 2B1KA 2R5GA 4PXOA 2ZNMA 5J5NA 2XPDA 4IS0A 2IL3A 2VLUA 3BCKA 3IHQA 4I8BA 4WF5A 1K3LA 5GZZB 2CA8A 4JBBA 4NAXA 1GSSA 18GSA 2C8UA 1TRVA 4HZ4A 2K9FA 1TRSA 1K0BA 4HI7A 4LMWA 1HNAA 2GGTA 1NSWA 4GF0A 2EIQA 1XVWA 4GCIA 3L4NA 4KDXA 2F51A 5AN1A 5HFKA 5KEJA 6GSTA 3KTBA 3P7XA 3I6AA 2H01A 4ZBAA 1TW9A 2CAQA 2GQKA 3WT1A 4ZB8A 1IYHA 3N9JA 5G1LA 4PQHA 1PRXA 3VK9A 1SK2A 3ME7A 3CMIA 1XOAA 2DMLA 5CRGA 1Y25A 2GVPA 2IMIA 3ZIVA 1Z6NA 1O6JA 14GSA 2RIIA 3BBYA 1DSBA 3G9BA 4KDUA 1RQMA 3L9UA 22GSA 1IYIA 2HNLA 1FB0A 3EMPA 16GSA 1B8XA 1HQOA 3ZREA 2PVQA 3TOUA 4POLA 4IJ3A 1M2BA 2PU9C 3PINA 7GSSA 1WE0A 3UIWA 2XPEA 3UVHA 6GSYA 1NHYA 3QMXA 5D8IA 2LV3A 1XOBA 4MJAA 3HVVA 2PUKC 1SD8A 1G6YA 1PKWA 2XHFA 1U88A 3EU4A 3F0IA 2D2ZA 2O7KA 1AQXA 5IOWA 3C7MA 1FHEA 4WF4A 4XRAA 4PURA 1M2AA 4LL4B 1JZOA 1LBKA 3QOUA 2C3TA 1GLPA 3KEBA 4YAVA 4G10A 5HR1A 1FAAA 2AHEA 4EVMA 3TJJA 5A5KA 2PBJA 3ZRDA 1MTCA 2VIMA 3G7JA 1GULA 2JZTA 2Z9SA 2DC5A 3D21A 3MNGA 2ZUPA 4Q5RA 1T4YA 5ECKB 1N8JA 2HRFA 2FWEA 4GSSA 4J2FA 5A4UA 3UBLA 1R26A 4ML1A 5GAND 3TJFA 3GV1A 2YV7A 1WRYA 4GSTA 1MEKA 3P8WA 4WKWA 5B6MA 3GKXA 1X5CA 3C71A 1XW6A 4HJMA 13GSA 2LUSA 5LD0A 1R5PA 3CTGA 4Q5QA 1QFNA 2MYGA 3EMXA 4Q5FA 3ZVJD 4GXZA 3IAM2 1RW1A 3TDGA 2K18A 1FW1A 2H71A 1MDIA 2B7KA 5ECLB 3F4TA 3JCML 3H1NA 3FKFA 2B3SA 5L71A 3O6TA 3US3A 5IO0A 5IMDA 3CSHA 2JSYA 4MDCA 3W8SA 3KMNA 5JCUA 1OC9A 4L8EA 1PL1A 3IDVA 4LMVA 2E2GA 3CSIA 3NZNA 4L5LA 1OC9B 3RHCA 3EC3A 2EIOA 1OKDA 3KD0A 1F6MC 4KDYA 1PN9A 1M2DA 5AIXA 4YQMA 3C1RA 5D93A 2FD3A 1DE2A 2I81A 5DALA 2I9HA 1EP8A 1OC3A 1A8LA 4JU5A 2V41A 2GSRA 2WRTA 1A2MA 2LS5A 1I5GA 2FGXA 4KAEA 2LNSA 1SD9A 4G19A 4HUAA 2REMA 2CVKA 4PUAA 1MD3A 4N0VA 4POMA 1W89A 3Q19A 1X5EA 2CX4A 1KTEA 1NM3A 3HDCA 2L5LA 5ECHB 5G5EA 3HXSA 4TKYA 1K0MA 1PL2A 4JZQA 3FZ4A 4DSSA 3CXGA 3TKQA 1SJZA 2V2GA 4XS1A 4NHZA 3D0ZA 4DSSB 2JZRA 2I3YA 5E59A 3ZLPA 2OE0A 4IQ1A 1ZYEA 2C4JA 4IP6A 3QDNA 1U3IA 1BJXA 4P3YB 2P5RA 2FA8A 4PGTA 3GSTA 1UN2A 3G7YA 4MF5A 3QAGA 4YQUA 4K7IA 5A4VA 2L4QA 3TJKA 5ENUA 4FO5A 4DVCA 3DVXA 5D9TA 5KN2A 4MPGA 1T7PB 5LCZA 2YOIA 4ZBDA 1X9SB 5CRWA 4AJ7A 4BVYA 3KM6A 3ZYWA 2O8VB 2J23A 4N10A 2MZCA 2VCWA 4EL1A 4ZL7A 3KJYA 2VL3A 2R37A 4BPYA 1CQHA 2GSSA 1GTAA 3F63A 4YH2A 3Q6OA 3EURA 5DCHA 3C73A 4KX4A 1YEPA 4OFNA 2CVBA 1WMJA 3UARA 1MD4A 2C3QA 1X9MB 3EYTA 3L9SA 3GX0A 4JRRA 1T4ZA 3IV4A 4EUYA 1FG4A 3GN3A 2YZUA 6GSSA 3FZ5A 3DYRA 1J0FA 3KP9A 3KH9A 1U6TA 4XS4A 5CRHA 3I69A 2TRXA 3A3TA 5J41A 1MDKA 2FNOA 1B4PA 6GSVA 2VCXA 4XS4B 4FIWA 3ME8A 3UEMA 5F0GA 4K2DA 1VF3A 4ECJA 2YV9A 3CRTA 4N0ZA 1O7UA 3HYPA 3U6VA 3FR9A 3TKRA 2VAFA 2AV4A 1V58A 3LYKA 2GSTA 4EXJA 5IQYA 1TDIA 2H1AA 2IMDA 1ABAA 2CQ9A 5DVBA 2VL9A 4HDEA 4DEJA 1WOUA 3WYWA 2GZPA 3I43A 3MWHA 3ERGA 5COHA 3APQA 3GH9A 3LG6A 1UC7A 5GAPD 5HR3A 4V1Ap 4OFTA 3KGKA 1VF1A 5HR2A 1XVQA 3UJ1A 1QMVA 5J9CA 2WJUA 4ML6A 2WS2A 4RQRA 4EDZA 1JZRA 4HJ2A 5IO2A 1Q98A 3F6DA 3GIXA 3GUSA 2LJKA 3J7Yb 1AXDA 2DIYA 3A2WA 4K7OA 4MZBA 3UOMA 1PGTA 4OO4A 1C72A 1M0UA 1OKTA 1X9WB 2X8GA 1EGRA 3QAVA 1WIKA 4TRXA 2LEGA 1GTUA 3UBKA 1WJKA 1I9DA 2L59A 2F8AA 5AGYA 5E4WA 2YCDA 3M0FA 3ERFA 5CO3A 2HE3A 3D5JA 3HJMA 5IPHA 4V1Ag 3VPTA 3HVSA 4MMMA 4XHMA 2OBIA 5CAXA 1TKDB 1GSDA 1KNGA 3D22A 2DSAA 4EE0A 1UA5A 1A2LA 4X0XA 11GSA 2K8SA 4MP4A 5IMAA 2CZ2A 5J4UA 2DJ2A 2IWTA 4DSRA 2PPTA 3ERWA 1SKSB 1SKRB 2AAWA 2LRTA 3W6GA 1Y6EA 4BWSA 3FW2A 2ON5A 3FR3A 1GNWA 1B48A 1GUKA 3KH7A 3WGEA 3D6IA 4MZWA 1XXUA 1BEDA 2NVLA 5DJLA 1QK8A 1FOVA 2O87A 3QFAC 3VPQA 4WBRD 3ZFBA 4ULXA 1CQGA 2KOKA 2NDOA 2V32A 3ZFLA 4G9HA 3GX8A 1Z6MA 2LJAA 4GQCA 5CRDA 1JZWA 1WPIA 2H0HA 1SK1A 4MJBA 3QFBC 2QSIA 2OA7A 3PR8A 2H30A 5D73A 1KEBA 2B6MA 2H73A 1YF0A 4IP1A 4KNDA 2H75A 1V2AA 3QCPA 1AQWA 2YWNA 3APSA 2CV4A 5DBQA 3GKMA 1TP9A 1SKWB 5F06A 3F6FA 5B8AA 5ECRB 2I4AA 3WT2A 1A0RP 2GT5A 2E2MA 3HD5A 5KN1A 1XBSA 5KN3A 3O76A 3TGZA 1QXHA 2JACA 4O32A 2WULA 2C1YA 4ECCA 4MPFA 3GHAA 2OJLA 2DJ1A 3F8UA 2LQOA 5IMCA 3TKSE 2BJXA 3TRXA 5G1KA 3PH9A 1ML6A 4NV2A 5ECOB 3L0HA 4ZXGA 1ERWA 1HYUA 1VRSD 1XCCA 4WR5A 2MMNA 1MDJA 1GSFA 1EZKA 20GSA 2H1GA 2YJHA 2YP6A 1ILOA 3EVIA 1HD2A 1GH2A 2L6CA 2C0FA 3LQ7A 1GSEA 2VLTA 3CRUA 2RLIA 1XZOA 3O3TA 2LJRA 2OADA 3M9JA 1JFUA 3Q74A 1Z5YE 4YAPA 4XCSA 1TK0B 4MF6A 1GSYA 2M80A 1R7HA 2L57A 3EINA 2EC4A 2RM5A 2IFQA 3R2QA 4OCEA 1BAYA 2H6YA 1TOFA 3F9UA 5C00A 1H75A 2IFQB 1VF4A 4HEA2 4IKHA 4OWYA 4FYUA 3TOTA 4MLYA 6GSXA 1XWCA 2F3MA 4NV5A 5HQPA 1J9BA 4BA7A 2FY6A 3QR6A 4KCAA 3P2AA 4EO3A 1YJ6A 1TI1A 2MMAA 2VLVA 5F05A 1OE7A 3MDKA 1PA3A 1VF2A 4RUVA 3E0UA 2WCIA 1Z7PA 4ZL9A 1X0RA 3GA4A 2M72A 4HQSA 1JLVA 4WXTA 5FWGA 1PMTA 2MBTA 1AAZA 3KXOA 5ECQB 1F37A 3LEFA 3U5RE 1O73A 4ECBA 2LNTA 3C1SA 2R4VA 1G6WA 1DUGA 4MK3A 5JCGA 4E8HA 2L5OA 4XRDA 1PKZA 2H76A 4ACSA 1B4QA 2MMOA 6GSUA 2FCHA 2KP2A 1SJ6A 4KH7A 4NWYA 3HA9A 2P5QA 3LFLA 3PGTA 1ZGNA 3LXTA 2E0QA 1GSUA 2CX3A 2KP1A 1KBNA 1K0DA 2VL2C 1UVZA 5JWRB 3I9V2 3HJPA 1LU4A 5J9BA 3ZMLA 5J3RA 3RPNA 5D96A 2H72A 2HLSA 4I6XA 2LQQA 1EWXA 2O89A 2EIRA 2HXKA 3VURA 2ALBA 4K7NA 4F0BA 2LRNA 3BJ5A 3A2XA 3DD3A 1EOGA 1O8XA 4JEDA 3IXRA 3TRPA 5G30A 2VCZA 1F2EA 4AJ6A 3AY8A 2H66A 1RK4A 1Q4JA 3UAPA 1K3OA 1ERTA 2DIZA 3KCMA 4TVEA 4ZB9A 5AISA 5DCGA 3IR4A 3F4RA 1TRWA 3KTLA 3EWLA 3IK7A 5DDLA 5JCWA 5LNKe 2K6VA 1XWKA 4IVFA 1SL0B 2FLSA 3LWAA 3GMFA 2A4VA 1SL1B 2BMXA 1XW5A 2HYXA 3J7Yk 1ZOFA 4MABA 4BVXA 5DQYA 1G7OA 3TJGA 4EDYA 2LTKA 4D73B 4TR4A 3MSZA 2HT9A 4MJCA 3M1GA 3HCZA 3TCOA 4LL1B 3RPPA 2GQMA 5G5FA 2FA4A 2B5YA 3TJBA 3IOSA 4E8EA 2FHEA 2H0GA 1EV4A 1U87A 5EVOA 4F9ZA 3FK8A 2M46A 1EEMA 4WR4A 4ID0A 1K3YA 1O8WA 3GFKA 5IOXA 5EL8A 4AJ8A 3VWXA 4AGSA 3WGXA 1OVNA 4QL9A 3DKSA 5ELGA 4ZILA 2HRNA 4PNFA 4K9ZA 2MMZA 1URMA 1TRUA 1GP1A 1GUMA 19GSA 1QGVA 3BD2A 3F3RA 5F8BA 1DE1A 3F4SA 3IRAA 2P31A 3HJOA 3Q18A 5C04A 1WP0A 2CVDA 2DJ3A 3DWVA 2DBCA 1V9WA 2OBKA 4WETA 4KGIA 5INYA 2DMMA 3FHKA 2JSZA 2H19A 4KE3A 4EC0A 1QUWA 2FWFA 4J56E 2IMKA 5G31A 5D9WA 4PNGA 3TB2A 4ISDA 4KCEA 3HZ8A 2VM1A 1O85A 4IGJA 3VFIA 3IA1A 4BL7A 3DXBA 1O81A 2KUCA 1EGOA 1THXA 3GURA 4KUNA 1OE8A 3TRQA 3NOFA 4QQ7A 4GSNA 5D9XA 2JZSA 4I5QA 3KZQA 4KSMA 2VCVA 1F9MA 4K8MA 3RBTA 3RHBA 3CSJA 4XIHA 1TTZA 1GUHA 3HVXA 3H8QA 2QC7A 2J9HA 1PX6A 2H6ZA 4YQVA 3H93A 1T00A 1SJIA 3NIVA 2MBSA 3GSSA 2X8CA 4HU9A 3TKSA 5ECPB 4H86A 4TN8A 3SBCA 4MH2A 2H1DA 2VL2A 5GSTA 4XTSA 4L0UA 5IIZA 3QAWA 3DRNA 8GSSA 3V1WA 4K1FA 2N5FA 2RUEA 4IBPA 4KA0A 1YQ1A 5AIVA 4IJIA 3DMLA 1AQVA 1T3BA 5ID2A 2HFDA 2PERA 5B7CA 3S9FA 5ID2B 3C8EA 1SYRA 3GKNA 4MA9A 4DSQA 3SWLA 1YDKA 1R5AA 2QGVA 3IC4A 4IW9A 3DGQA 3LYPA 1V98A 2ES7A 3D4MA 2XBIA 3UL3A 1T1VA 3IK9A 3LGCA 4L0WA 2R3XA 1ZCPA 2K8VA 3VWWA 3W8JA 4MZCA 4ZBBA 3P90A 3EU3A 3VI5A 2AYTA 2IIYA 2P0GA 2CAIA 5D9VA 4WEYA 4Q5NA 2VD0A 2B5XA 5JWQB 2KHPA 2C0DA 4K6XA 1B9YC 4TR0A 1TJDA 2BTOT 3UMAA 2YJ7A 1AUCA 1K0NA 1PQNA 1ST9A 2IJYA 3M3MA 1BYEA 2I1UA 2GQLA 1ON4A 6GSWA 1V40A 2AB6A 4MJEA 2GDRA 1ERUA 3L78A 4X43A 1XFLA 1G7EA 1E2YA 4NPBA 1GRXA 4POKA 3H79A 1PX7A 1GL8A 4IQAA 3K8NA 3GH6A 4TW5A 5G2ZA 12GSA 2X99A 2YWIA 3IE3A 2ZCTA 4GTUA 1PD21 1Z7RA 4POBA 5IMZA 3KP8A 1B9XC 3GL3A 5IM9A 4WBJA 1T8EB 2H6XA 1EV9A 3ZVJA 5IPGA 1AW9A 1GTBA 3A2VA 2HI7A 1A24A 4HS1A 2JU5A 3F3QA 5DQSA 2PWJA 2X8HA 5GSSA 1F3BA 3ZMKA 2GLRA 2YN1A 1N2AA 3VWUA 4JR6A 2TRCP 2LRCA 4ZIJA 1S3CA 2GS3A 1M7TA 5HFIA 1M99A 2OE3A 4PUFC 2A2SA 3OR5A 3GYKA 3IPZA 5JWOB 1GNEA 3FYGA 1PSQA 4TR1A 5ABRA 3FZ9A 5CREA 1JHBA 1K0CA 3M8NA 1NHOA 1XWGA 4TR1B 2YPMA 5HFGA 3HHVA 2PN8A 4FYCA 4TXOA 3KIJA 1GSQA 4TXOB 2L6DA 1V57A 4G2EA 1GWCA 1FVKA 2VOCA 3GTUA 2C0EA 3WD6A 3ED3A 2PGTA 2V6KA 3KMOA 3GTUB 2N5AA 4FYBA 1H4OA 1EEJA 3FZAA 4K0GA 1J08A 2JADA 3FR6A 1NW2A 1EP7A 3BCIA 2TIRA 2YNXA 3WGDA 2AUVA 1SL2B 4F2IA 1GLQA 1YKCA 1G0TA 1F3AA 1S3AA 2HSYA 5KN0A 1HNCA 1A8YA 2YWOA 1XWAA 3BOAA 3VI7A 1YF1A 4KB3A 3IBHA 4V2NA 2IPAA 3TKPA 4PQ1A 2F8FA 1TK5B 3FRCA 2V6OA 1K0OA 4KSOA 1OYJA 3ZTLA 4JE1A 4XS6A 1U3AA 3ISOA 4TXVA 5B8BA 2NTOA 3MAKA 5FT3A 5H5QA 1AC1A 4NHWA 1VGLA 3TUEA 3UVTA 2QKEA 2XC2A 5H5RA 3E3EA 4GRFA 2H0IA 5F07A 2O85A 17GSA 4F03A 4BWQA 1XPVA 4OD7A 4F82A 2OE1A 5A4WA 3LSZA 3GL5A 2N5BA 1SU9A 2GSQA 3TKSC 2GT6A 1Z3EA 3HKRA 2LSTA 4GQFA 2YANA 1R4WA 4NMUA 4CHSA 3LJRA 4TR3A 3ZIJA 2VM2A 4I2TA 2L4CA 2E7PA 4O92A 3GRXA 4IN0A 2C3NA 4L5OA 4MH3A 5DALB 2FUG2 4X1UA 3H4KA 5EPFA 1ZZYA 2HZEA 1S3DA 1TXXA 4ZL8A 3DVWA 3VLNA 2HZEB 3EE2A 4QL7A 4PX1A 3ZITA 4Z7XA 1EOHA 1GTIA 1FB6A 1M9AA 3M9KA 4HU7A 4HZ2A 3DIEA 1ZMAA 1ZL9A 4K0NA 3LORA 2B1LA 2C80A 2OACA 4I2UA 3ZL5A 2DLXA 3L9VA 2RM6A 5ECIB 1OAZA 1DBYA 4OO5A 2GTUA 1K0AA 4FH8A 4OFMA 2HZFA 4MCUA 1ERVA 4O5RA 5ELAA 4D73A 2NBSA 2R2JA 5H5SA 3QPMA 2VO4A 2OKAA 3HY2A 5CYYA 3ZZXA 4AF2A 1LJRA 4RI7A 1TK8B 2G0FA 4OMVA 4EKZA 3QD9A 3RDWA 2IMEA 2XBQA 4EF0A 2V1MA 2FWGA 4I97A 1ACVA 2H8LA 5IMFA 4KW6A 4CDOA 2CT6A 1OC8A 2B5EA 2DJ0A 2VCQA 4LLRA 2F9SA 1TI3A 2RUFA 3GNJA 4N30A 2KLXA 4TOPA 2VUPA 1XWBA 3IAS2 3N5OA 3DEXA 4MF7A 3HZ4A 2JL4A 5ECNB 10GSA 3E9JB 3D4TA 1X5DA 1A2JA 2AJQB 3FY7A 1M9BA 5IMVA 5DJMA 2WB9A 2C0GA 1W4VA 4OCFA 1YZXA 2WDUA 2G2QA 4HOJA 1JLWA 5FHIA 1ZYQB 1BX9A
chains in the Genus database with same CATH superfamily
3FEUA 2B7JA 1SK0A 5ECMB 3APOA 4PQIA 4N11A 2ON7A 3RAZA 3A5WA 5B6NA 4O5UA 5CP1A 4NXIA 2YWMA 1YEXA 2X64A 1XW9A 4HQZA 1BQ7A 3CBUA 2PMTA 3CTFA 4O7HA 9GSSA 2WGRA 1SENA 1SYXA 2CZ3A 1YKAA 4JR4A 1THOA 5EY6A 2YZHA 2WZ9A 4ILFA 2H70A 4J57E 4RI6A 4ECIA 1TU8A 1FVJA 2R6KA 2PVOC 4IHUA 2WFCA 2IN3A 2GZZA 2GZYA 2IMFA 1WWJA 2LKUA 2H1BA 4F0CA 1BG5A 1A0FA 2H74A 1FO5A 2A4HA 2VCTA 1USBA 4GWRA 1Z9HA 1JZDA 4IELA 3VWVA 5HR0A 1HNBA 4CW9A 3LXZA 4V2MA 4V2LA 4GLTA 2DJJA 5DAKA 5CNWA 4RQXA 1QQ2A 1YY7A 1A23A 1XIYA 2HSHA 5DAKB 4LA1A 5ECSA 3CYNA 4ZB6A 2FWHA 1TU7A 2NPBA 3G7IA 2DJKA 3GKKA 1AIUA 2A2RA 2VD1A 1E6BA 2B1KA 2R5GA 4PXOA 2ZNMA 5J5NA 2XPDA 2X4AA 4IS0A 2IL3A 2VLUA 3BCKA 3IHQA 4I8BA 4WF5A 1K3LA 5GZZB 2CA8A 4JBBA 4NAXA 1GSSA 4K5SA 18GSA 4EIQA 2C8UA 1TRVA 4HZ4A 3CQFA 2K9FA 1TRSA 1K0BA 2HRAA 4HI7A 4LMWA 1HNAA 2GGTA 1NSWA 4GF0A 2EIQA 1XVWA 4GCIA 3L4NA 4KDXA 2F51A 5AN1A 5HFKA 5KEJA 6GSTA 3KTBA 3P7XA 3I6AA 2H01A 4ZBAA 1TW9A 2CAQA 2GQKA 3WT1A 4ZB8A 1IYHA 2HRKA 3N9JA 5G1LA 4G0KA 4PQHA 1PRXA 3VK9A 1SK2A 3ME7A 3CMIA 1XOAA 2DMLA 5CRGA 1Y25A 2GVPA 2IMIA 3ZIVA 5BMUA 1Z6NA 1O6JA 14GSA 2RIIA 3BBYA 1DSBA 3G9BA 4KDUA 1RQMA 3L9UA 22GSA 1IYIA 2HNLA 1FB0A 3EMPA 16GSA 1B8XA 1HQOA 3ZREA 2PVQA 3TOUA 4POLA 4IJ3A 1M2BA 2PU9C 3PINA 4A5PA 7GSSA 1WE0A 3UIWA 2XPEA 3UVHA 6GSYA 1NHYA 3QMXA 5D8IA 2LV3A 1XOBA 4MJAA 3HVVA 2PUKC 4BIKA 1SD8A 1G6YA 1PKWA 2XHFA 1U88A 3EU4A 3F0IA 2D2ZA 2O7KA 1AQXA 5IOWA 3C7MA 1FHEA 4WF4A 4XRAA 4PURA 1M2AA 4LL4B 4HSCX 1JZOA 1LBKA 3QOUA 2C3TA 1GLPA 3KEBA 4YAVA 4G10A 5HR1A 4K2XA 1FAAA 2AHEA 4EVMA 3TJJA 5A5KA 4X4JA 2PBJA 3ZRDA 1MTCA 2VIMA 3G7JA 1GULA 2JZTA 2Z9SA 2DC5A 3D21A 3MNGA 2ZUPA 4Q5RA 1T4YA 5ECKB 1N8JA 2HRFA 2FWEA 4GSSA 4J2FA 5A4UA 3UBLA 1ZYPA 1R26A 3IC8A 4ML1A 5GAND 3TJFA 3GV1A 2YV7A 1WRYA 4GSTA 1MEKA 3P8WA 4WKWA 5B6MA 3GKXA 1X5CA 3C71A 1XW6A 4HJMA 13GSA 2LUSA 5LD0A 1R5PA 3CTGA 4Q5QA 1QFNA 2MYGA 3EMXA 4Q5FA 3ZVJD 4GXZA 3IAM2 1RW1A 3TDGA 2K18A 1FW1A 2H71A 1MDIA 2B7KA 5ECLB 1S3RA 3F4TA 3JCML 3H1NA 3FKFA 2B3SA 5L71A 3O6TA 3US3A 5IO0A 5IMDA 3CSHA 2JSYA 4MDCA 3W8SA 3KMNA 5JCUA 1OC9A 1PFOA 4L8EA 1PL1A 3IDVA 4LMVA 2E2GA 3CSIA 3NZNA 4L5LA 1OC9B 3RHCA 4Z2TA 3EC3A 3MIXA 2EIOA 1OKDA 3KD0A 1F6MC 4KDYA 1PN9A 1M2DA 5AIXA 4YQMA 3C1RA 5D93A 2FD3A 1DE2A 2I81A 5DALA 2I9HA 1EP8A 1OC3A 1A8LA 4JU5A 2V41A 2GSRA 2WRTA 4O5QA 1A2MA 2LS5A 1I5GA 2FGXA 4KAEA 2LNSA 1SD9A 4PTSA 4G19A 4HUAA 2REMA 2CVKA 4PUAA 1MD3A 4N0VA 4POMA 1W89A 3Q19A 1X5EA 2CX4A 1KTEA 1NM3A 3HDCA 2L5LA 5ECHB 5G5EA 3HXSA 4TKYA 1K0MA 1PL2A 4JZQA 3FZ4A 4DSSA 3CXGA 3TKQA 1SJZA 2V2GA 4XS1A 4NHZA 3D0ZA 4DSSB 2JZRA 2I3YA 5E59A 3ZLPA 2OE0A 4IQ1A 1ZYEA 2C4JA 4IP6A 3QDNA 1U3IA 1BJXA 4P3YB 2P5RA 2FA8A 4PGTA 3GSTA 1UN2A 3G7YA 4MF5A 3QAGA 4YQUA 4K7IA 5A4VA 2L4QA 3TJKA 5ENUA 4FO5A 4DVCA 3DVXA 5D9TA 5KN2A 4MPGA 1T7PB 5LCZA 2YOIA 4ZBDA 1X9SB 5CRWA 4AJ7A 4BVYA 3KM6A 3ZYWA 2O8VB 4BVYB 2J23A 2R0PA 4N10A 2MZCA 2VCWA 4EL1A 4ZL7A 3KJYA 5KOWA 2VL3A 2R37A 4BPYA 1CQHA 2GSSA 1GTAA 3F63A 4YH2A 3Q6OA 3EURA 5DCHA 3C73A 4KX4A 1YEPA 4OFNA 2CVBA 1WMJA 3UARA 1MD4A 2C3QA 1X9MB 3EYTA 3L9SA 3GX0A 4JRRA 1T4ZA 3IV4A 4EUYA 1FG4A 3GN3A 2YZUA 6GSSA 3FZ5A 3DYRA 1J0FA 1XG8A 3KP9A 3KH9A 1U6TA 4XS4A 5CRHA 3I69A 2TRXA 3A3TA 5J41A 1MDKA 2FNOA 1B4PA 6GSVA 2VCXA 4XS4B 4FIWA 3ME8A 3UEMA 5F0GA 4K2DA 1VF3A 4ECJA 2YV9A 3CRTA 4N0ZA 1O7UA 3HYPA 3U6VA 3FR9A 3TKRA 2VAFA 2AV4A 1V58A 3LYKA 2GSTA 4EXJA 5IQYA 1TDIA 2H1AA 2IMDA 1ABAA 2CQ9A 5DVBA 2VL9A 4HDEA 4DEJA 1WOUA 3WYWA 2GZPA 3I43A 3MWHA 3ERGA 5COHA 3R3EA 3APQA 3GH9A 3LG6A 1UC7A 5GAPD 5HR3A 4V1Ap 4OFTA 3KGKA 1VF1A 5HR2A 1XVQA 3UJ1A 1QMVA 5J9CA 2WJUA 4ML6A 2WS2A 4RQRA 4EDZA 1JZRA 4HJ2A 5IO2A 1Q98A 3F6DA 3GIXA 3GUSA 2LJKA 3J7Yb 1AXDA 2DIYA 3A2WA 4K7OA 4MZBA 3UOMA 1PGTA 4OO4A 1C72A 1M0UA 1OKTA 1X9WB 2X8GA 1EGRA 3QAVA 1WIKA 4TRXA 2LEGA 1GTUA 3UBKA 1WJKA 1I9DA 2L59A 2F8AA 5AGYA 5E4WA 4FQUA 2YCDA 3M0FA 3ERFA 5CO3A 2HE3A 3D5JA 3HJMA 5IPHA 4V1Ag 3VPTA 3HVSA 4MMMA 4XHMA 2OBIA 5CAXA 1TKDB 1GSDA 1KNGA 4KF9A 3D22A 2DSAA 4EE0A 3PPUA 1UA5A 1A2LA 4X0XA 11GSA 2K8SA 4MP4A 5IMAA 2CZ2A 5J4UA 2DJ2A 2IWTA 4DSRA 2PPTA 3ERWA 1SKSB 1SKRB 2AAWA 2LRTA 3W6GA 1Y6EA 4BWSA 3FW2A 2ON5A 4EIPA 3FR3A 1GNWA 1B48A 1GUKA 3KH7A 3WGEA 3D6IA 4MZWA 1XXUA 3MYDA 1BEDA 2NVLA 5DJLA 1QK8A 1FOVA 2O87A 3QFAC 3VPQA 4WBRD 3ZFBA 4ULXA 1CQGA 2KOKA 2NDOA 2V32A 3ZFLA 4YKFA 4G9HA 3GX8A 1Z6MA 2LJAA 4GQCA 5CRDA 1JZWA 1WPIA 2H0HA 1SK1A 4MJBA 4G0IA 3QFBC 2QSIA 2OA7A 2X49A 3PR8A 2H30A 5D73A 1KEBA 2B6MA 2H73A 1YF0A 4IP1A 4KNDA 2H75A 1V2AA 3QCPA 1AQWA 2YWNA 3APSA 2CV4A 5DBQA 3GKMA 1TP9A 1SKWB 5F06A 4CY8A 3F6FA 5B8AA 5ECRB 2I4AA 3WT2A 1A0RP 2GT5A 2E2MA 3HD5A 5KN1A 1XBSA 5KN3A 3O76A 3TGZA 1QXHA 2JACA 4O32A 2WULA 2C1YA 4ECCA 4MPFA 3GHAA 2OJLA 2DJ1A 3F8UA 2LQOA 5IMCA 3TKSE 2BJXA 3TRXA 5G1KA 3PH9A 1ML6A 4NV2A 2R0GA 3L0HA 5ECOB 4ZXGA 1ERWA 1HYUA 1VRSD 1XCCA 4WR5A 2MMNA 1MDJA 1GSFA 1EZKA 20GSA 2H1GA 2YJHA 2YP6A 1ILOA 3EVIA 1HD2A 1GH2A 2L6CA 2C0FA 3LQ7A 1GSEA 2VLTA 3CRUA 2RLIA 1XZOA 3O3TA 2LJRA 2OADA 3M9JA 1JFUA 3Q74A 1Z5YE 4YAPA 4XCSA 1TK0B 4MF6A 1GSYA 2M80A 1R7HA 2L57A 3EINA 2EC4A 2RM5A 2IFQA 3R2QA 4OCEA 1BAYA 2H6YA 1TOFA 3F9UA 5C00A 1H75A 2IFQB 1VF4A 4HEA2 4IKHA 4OWYA 4FYUA 3TOTA 4MLYA 6GSXA 1XWCA 3EPTA 2F3MA 4NV5A 5HQPA 1J9BA 4BA7A 2FY6A 3QR6A 4KCAA 3P2AA 4EO3A 1YJ6A 1TI1A 2MMAA 5BRTA 2VLVA 5F05A 1OE7A 3MDKA 1PA3A 1VF2A 4RUVA 3E0UA 2WCIA 1Z7PA 4ZL9A 1X0RA 3GA4A 2M72A 4HQSA 1JLVA 4WXTA 5FWGA 1PMTA 2MBTA 1AAZA 3KXOA 5ECQB 1F37A 3LEFA 3U5RE 1O73A 4ECBA 2LNTA 3C1SA 2R4VA 1G6WA 1DUGA 4MK3A 2A2PA 5JCGA 4E8HA 2L5OA 4XRDA 1PKZA 2H76A 4ACSA 1B4QA 2MMOA 6GSUA 2FCHA 2KP2A 1SJ6A 4KH7A 4NWYA 3HA9A 2P5QA 3LFLA 3PGTA 1ZGNA 3LXTA 2E0QA 1GSUA 2CX3A 2KP1A 1KBNA 1K0DA 2VL2C 1UVZA 5JWRB 3I9V2 3HJPA 1LU4A 5J9BA 3ZMLA 5J3RA 3RPNA 5D96A 2H72A 2HLSA 4I6XA 2LQQA 1EWXA 2O89A 2EIRA 2HXKA 3VURA 1ZYNA 2ALBA 3LW9A 4K7NA 4F0BA 2LRNA 3BJ5A 3A2XA 3DD3A 1EOGA 1O8XA 4JEDA 3IXRA 3TRPA 5G30A 2VCZA 1F2EA 4AJ6A 3AY8A 2H66A 1RK4A 1Q4JA 3UAPA 1K3OA 1ERTA 2DIZA 3KCMA 4TVEA 4ZB9A 5AISA 5DCGA 3IR4A 3F4RA 1TRWA 3KTLA 3EWLA 2UZ8A 3IK7A 5DDLA 5JCWA 2K6VA 5LNKe 1XWKA 4IVFA 1SL0B 2FLSA 3LWAA 3GMFA 2A4VA 1SL1B 2BMXA 1XW5A 2HYXA 4ICYA 3J7Yk 1ZOFA 4MABA 4BVXA 5DQYA 1G7OA 3TJGA 4EDYA 2LTKA 4D73B 4TR4A 3MSZA 4BVXB 2HT9A 4MJCA 3M1GA 3HCZA 3TCOA 4LL1B 3RPPA 2GQMA 5G5FA 2FA4A 2B5YA 3TJBA 3IOSA 4E8EA 2FHEA 2H0GA 1EV4A 1U87A 5EVOA 4F9ZA 3FK8A 2M46A 1EEMA 4WR4A 4ID0A 1K3YA 1O8WA 3GFKA 5IOXA 5EL8A 4AJ8A 3VWXA 4AGSA 3WGXA 1OVNA 4QL9A 3DKSA 5ELGA 4ZILA 2HRNA 4PNFA 4K9ZA 4CY6A 2MMZA 1URMA 1TRUA 1GP1A 1GUMA 19GSA 1QGVA 3BD2A 3F3RA 1M3JA 5F8BA 1DE1A 3F4SA 3IRAA 2P31A 3HJOA 3Q18A 5C04A 1WP0A 2CVDA 2DJ3A 3DWVA 2DBCA 1V9WA 2OBKA 4WETA 4KGIA 5INYA 2DMMA 3FHKA 2JSZA 2H19A 4KE3A 4EC0A 1QUWA 2FWFA 4J56E 2IMKA 5G31A 5D9WA 4PNGA 3TB2A 4ISDA 4KCEA 3HZ8A 2VM1A 1O85A 4IGJA 3VFIA 3IA1A 4MNNA 4BL7A 3DXBA 1O81A 2KUCA 1EGOA 1THXA 3GURA 4KUNA 4BL7B 1OE8A 3TRQA 3NOFA 4QQ7A 4GSNA 5D9XA 2JZSA 4I5QA 3KZQA 4KSMA 2VCVA 1F9MA 4K8MA 3RBTA 3RHBA 3CSJA 4XIHA 1TTZA 1GUHA 3HVXA 3H8QA 2QC7A 2J9HA 1PX6A 2DKIA 2H6ZA 4YQVA 3H93A 1T00A 1SJIA 3NIVA 2MBSA 3GSSA 2X8CA 4HU9A 3TKSA 5ECPB 4H86A 4TN8A 3SBCA 4MH2A 2H1DA 2VL2A 5GSTA 4XTSA 4L0UA 5IIZA 3QAWA 3DRNA 8GSSA 3IHGA 3V1WA 4K1FA 2N5FA 2RUEA 4IBPA 4KA0A 1YQ1A 5AIVA 4IJIA 3DMLA 1AQVA 1T3BA 5ID2A 2HFDA 2PERA 5B7CA 3S9FA 5ID2B 3C8EA 1SYRA 3GKNA 4MA9A 4DSQA 3SWLA 1YDKA 1R5AA 2QGVA 3IC4A 4IW9A 3DGQA 3LYPA 1V98A 2ES7A 3D4MA 2XBIA 3UL3A 1T1VA 3IK9A 3LGCA 4L0WA 2R3XA 1ZCPA 2K8VA 4Z2UA 3VWWA 3W8JA 4MZCA 4ZBBA 3P90A 3EU3A 3VI5A 2AYTA 2IIYA 2P0GA 2CAIA 5D9VA 4WEYA 4Q5NA 2VD0A 2B5XA 5JWQB 2KHPA 2C0DA 4K6XA 1B9YC 4TR0A 1TJDA 2BTOT 3UMAA 2YJ7A 1AUCA 1K0NA 1PQNA 1ST9A 2IJYA 3M3MA 1PN0A 1BYEA 2I1UA 2GQLA 1ON4A 6GSWA 1M3IA 1V40A 2AB6A 4MJEA 2GDRA 1ERUA 3L78A 4X43A 1XFLA 1G7EA 3HVNA 1E2YA 4NPBA 1GRXA 4POKA 3H79A 1PX7A 1GL8A 4IQAA 3K8NA 3GH6A 4TW5A 5G2ZA 12GSA 2X99A 2YWIA 3IE3A 2ZCTA 4GTUA 1PD21 1Z7RA 4POBA 5IMZA 3KP8A 1B9XC 3GL3A 5IM9A 4WBJA 1T8EB 2H6XA 1EV9A 3ZVJA 5IPGA 1AW9A 1GTBA 3A2VA 2HI7A 1A24A 4HS1A 2JU5A 3F3QA 5DQSA 2PWJA 2X8HA 5GSSA 1F3BA 3ZMKA 2GLRA 2YN1A 1N2AA 3VWUA 4JR6A 2TRCP 2LRCA 4ZIJA 1S3CA 2GS3A 1M7TA 5HFIA 1M99A 2OE3A 4PUFC 4YKGA 2A2SA 3OR5A 3GYKA 3IPZA 5JWOB 1GNEA 3FYGA 1PSQA 4TR1A 5ABRA 3FZ9A 5CREA 4G0LA 1JHBA 1K0CA 3M8NA 1NHOA 1XWGA 4TR1B 2YPMA 5HFGA 3HHVA 2PN8A 4FYCA 4TXOA 3KIJA 1GSQA 4TXOB 2L6DA 1V57A 4G2EA 1GWCA 1FVKA 2VOCA 3GTUA 2C0EA 3WD6A 3ED3A 2PGTA 2V6KA 3KMOA 3GTUB 2N5AA 4FYBA 1H4OA 1EEJA 3FZAA 4K0GA 1J08A 2JADA 3FR6A 1NW2A 1EP7A 3BCIA 2TIRA 2YNXA 3WGDA 2AUVA 1SL2B 4F2IA 1GLQA 1YKCA 1G0TA 1F3AA 1S3AA 2HSYA 5KN0A 1HNCA 1A8YA 2YWOA 1XWAA 3BOAA 3VI7A 1YF1A 4KB3A 3IBHA 4V2NA 2IPAA 3TKPA 4PQ1A 2F8FA 1TK5B 3FRCA 2V6OA 1K0OA 4KSOA 1OYJA 3ZTLA 4JE1A 4XS6A 1U3AA 3ISOA 4TXVA 5B8BA 2NTOA 3MAKA 5KOXA 5FT3A 5H5QA 1AC1A 4NHWA 1VGLA 3A5IA 3TUEA 3UVTA 2QKEA 2XC2A 5H5RA 3E3EA 4GRFA 2H0IA 5F07A 2O85A 17GSA 4F03A 4BWQA 1XPVA 1FOHA 4OD7A 4F82A 2OE1A 5A4WA 3LSZA 3GL5A 2N5BA 1SU9A 2GSQA 3TKSC 2GT6A 1Z3EA 2R0CA 3HKRA 2QA2A 2LSTA 4GQFA 2YANA 1R4WA 4NMUA 4CHSA 3LJRA 4TR3A 3ZIJA 2VM2A 4I2TA 2L4CA 2E7PA 4O92A 3GRXA 4IN0A 2C3NA 4L5OA 4MH3A 5DALB 2FUG2 4X1UA 3H4KA 5EPFA 1ZZYA 2HZEA 2DKHA 4Z2RA 1S3DA 1TXXA 4K5RA 4ZL8A 3DVWA 3FMWA 3VLNA 2HZEB 3EE2A 4QL7A 4PX1A 3ZITA 4Z7XA 1EOHA 1GTIA 1FB6A 1M9AA 3M9KA 4HU7A 2QA1A 4HZ2A 3DIEA 1ZMAA 1ZL9A 4K0NA 3LORA 4USSA 2B1LA 2C80A 2OACA 4I2UA 3ZL5A 2DLXA 3L9VA 2RM6A 5ECIB 1OAZA 1DBYA 4OO5A 2GTUA 1K0AA 4FH8A 4OFMA 2HZFA 4MCUA 1ERVA 4O5RA 5ELAA 4D73A 2NBSA 2R2JA 5H5SA 3QPMA 2VO4A 2OKAA 3HY2A 5CYYA 3ZZXA 4AF2A 1LJRA 4RI7A 1TK8B 2G0FA 4OMVA 4EKZA 3QD9A 3RDWA 2IMEA 2XBQA 4EF0A 2V1MA 2FWGA 4I97A 1ACVA 2H8LA 5IMFA 4KW6A 4CDOA 2CT6A 1OC8A 2B5EA 2DJ0A 2VCQA 4LLRA 2F9SA 1TI3A 2RUFA 3GNJA 4N30A 2KLXA 2HSMA 4TOPA 2VUPA 1XWBA 3IAS2 3N5OA 3DEXA 4MF7A 3HZ4A 2JL4A 5ECNB 10GSA 3E9JB 3D4TA 1X5DA 1A2JA 2AJQB 3FY7A 1M9BA 5IMVA 5DJMA 2WB9A 2C0GA 1W4VA 4OCFA 1YZXA 2WDUA 2G2QA 4HOJA 1JLWA 5FHIA 1ZYQB 1BX9A
chains in the Genus database with same CATH topology
3FEUA 2B7JA 1SK0A 5ECMB 3APOA 4PQIA 4N11A 2ON7A 3RAZA 3A5WA 5B6NA 4O5UA 5CP1A 4NXIA 2YWMA 1YEXA 2X64A 1XW9A 4HQZA 1BQ7A 3CBUA 2PMTA 3CTFA 4O7HA 9GSSA 2WGRA 1SENA 1SYXA 2CZ3A 1YKAA 4JR4A 1THOA 5EY6A 2YZHA 2WZ9A 4ILFA 2H70A 4J57E 4RI6A 4ECIA 1TU8A 1FVJA 2R6KA 2PVOC 4IHUA 2WFCA 2IN3A 2GZZA 2GZYA 2IMFA 1WWJA 2LKUA 2H1BA 4F0CA 1BG5A 1A0FA 2H74A 1FO5A 2A4HA 2VCTA 1USBA 4GWRA 1Z9HA 1JZDA 4IELA 3VWVA 5HR0A 1HNBA 4CW9A 3LXZA 4V2MA 4V2LA 4GLTA 2DJJA 5DAKA 5CNWA 4RQXA 1QQ2A 1YY7A 1A23A 1XIYA 2HSHA 5DAKB 4LA1A 5ECSA 3CYNA 4ZB6A 2FWHA 1TU7A 2NPBA 3G7IA 2DJKA 3GKKA 1AIUA 2A2RA 2VD1A 1E6BA 2B1KA 2R5GA 4PXOA 2ZNMA 5J5NA 2XPDA 2X4AA 4IS0A 2IL3A 2VLUA 3BCKA 3IHQA 4I8BA 4WF5A 1K3LA 5GZZB 2CA8A 4JBBA 4NAXA 1GSSA 4K5SA 18GSA 4EIQA 2C8UA 1TRVA 4HZ4A 2K9FA 1TRSA 1K0BA 2HRAA 4HI7A 4LMWA 1HNAA 2GGTA 1NSWA 4GF0A 2EIQA 1XVWA 4GCIA 3L4NA 4KDXA 2F51A 5AN1A 5HFKA 5KEJA 6GSTA 3KTBA 3P7XA 3I6AA 2H01A 4ZBAA 1TW9A 2CAQA 2GQKA 3WT1A 4ZB8A 1IYHA 2HRKA 3N9JA 5G1LA 4G0KA 4PQHA 1PRXA 3VK9A 1SK2A 3ME7A 3CMIA 1XOAA 2DMLA 5CRGA 1Y25A 2GVPA 2IMIA 3ZIVA 5BMUA 1Z6NA 1O6JA 14GSA 2RIIA 3BBYA 1DSBA 3G9BA 4KDUA 1RQMA 3L9UA 22GSA 1IYIA 2HNLA 1FB0A 3EMPA 16GSA 1B8XA 1HQOA 3ZREA 2PVQA 3TOUA 4POLA 4IJ3A 1M2BA 2PU9C 3PINA 4A5PA 7GSSA 1WE0A 3UIWA 2XPEA 3UVHA 6GSYA 1NHYA 3QMXA 5D8IA 2LV3A 1XOBA 4MJAA 3HVVA 2PUKC 1SD8A 1G6YA 1PKWA 2XHFA 1U88A 3EU4A 3F0IA 2D2ZA 2O7KA 1AQXA 5IOWA 3C7MA 1FHEA 4WF4A 4XRAA 4PURA 1M2AA 4LL4B 1JZOA 1LBKA 3QOUA 2C3TA 1GLPA 3KEBA 4YAVA 4G10A 5HR1A 4K2XA 1FAAA 2AHEA 4EVMA 3TJJA 5A5KA 4X4JA 2PBJA 3ZRDA 1MTCA 2VIMA 3G7JA 1GULA 2JZTA 2Z9SA 2DC5A 3D21A 3MNGA 2ZUPA 4Q5RA 1T4YA 5ECKB 1N8JA 2HRFA 2FWEA 4GSSA 4J2FA 5A4UA 3UBLA 1ZYPA 1R26A 3IC8A 4ML1A 5GAND 3TJFA 3GV1A 2YV7A 1WRYA 4GSTA 1MEKA 3P8WA 4WKWA 5B6MA 3GKXA 1X5CA 3C71A 1XW6A 4HJMA 13GSA 2LUSA 5LD0A 1R5PA 3CTGA 4Q5QA 1QFNA 2MYGA 3EMXA 4Q5FA 3ZVJD 4GXZA 3IAM2 1RW1A 3TDGA 2K18A 1FW1A 2H71A 1MDIA 2B7KA 5ECLB 3F4TA 3JCML 3H1NA 3FKFA 2B3SA 5L71A 3O6TA 3US3A 5IO0A 5IMDA 3CSHA 2JSYA 4MDCA 3W8SA 3KMNA 5JCUA 1OC9A 4L8EA 1PL1A 3IDVA 4LMVA 2E2GA 3CSIA 3NZNA 4L5LA 1OC9B 3RHCA 4Z2TA 3EC3A 3MIXA 2EIOA 1OKDA 3KD0A 1F6MC 4KDYA 1PN9A 1M2DA 5AIXA 4YQMA 3C1RA 5D93A 2FD3A 1DE2A 2I81A 5DALA 2I9HA 1EP8A 1OC3A 1A8LA 4JU5A 2V41A 2GSRA 2WRTA 4O5QA 1A2MA 2LS5A 1I5GA 2FGXA 4KAEA 2LNSA 1SD9A 4PTSA 4G19A 4HUAA 2REMA 2CVKA 4PUAA 1MD3A 4N0VA 4POMA 1W89A 3Q19A 1X5EA 2CX4A 1KTEA 1NM3A 3HDCA 2L5LA 5ECHB 5G5EA 3HXSA 4TKYA 1K0MA 1PL2A 4JZQA 3FZ4A 4DSSA 3CXGA 3TKQA 1SJZA 2V2GA 4XS1A 4NHZA 3D0ZA 4DSSB 2JZRA 2I3YA 5E59A 3ZLPA 2OE0A 4IQ1A 1ZYEA 2C4JA 4IP6A 3QDNA 1U3IA 1BJXA 4P3YB 2P5RA 2FA8A 4PGTA 3GSTA 1UN2A 3G7YA 4MF5A 3QAGA 4YQUA 4K7IA 5A4VA 2L4QA 3TJKA 5ENUA 4FO5A 4DVCA 3DVXA 5D9TA 5KN2A 4MPGA 1T7PB 5LCZA 2YOIA 4ZBDA 1X9SB 5CRWA 4AJ7A 4BVYA 3KM6A 3ZYWA 2O8VB 4BVYB 2J23A 2R0PA 4N10A 2MZCA 2VCWA 4EL1A 4ZL7A 3KJYA 5KOWA 2VL3A 2R37A 4BPYA 1CQHA 2GSSA 1GTAA 3F63A 4YH2A 3Q6OA 3EURA 5DCHA 3C73A 4KX4A 1YEPA 4OFNA 2CVBA 1WMJA 3UARA 1MD4A 2C3QA 1X9MB 3EYTA 3L9SA 3GX0A 4JRRA 1T4ZA 3IV4A 4EUYA 1FG4A 3GN3A 2YZUA 6GSSA 3FZ5A 3DYRA 1J0FA 3KP9A 3KH9A 1U6TA 4XS4A 5CRHA 3I69A 2TRXA 3A3TA 5J41A 1MDKA 2FNOA 1B4PA 6GSVA 2VCXA 4XS4B 4FIWA 3ME8A 3UEMA 5F0GA 4K2DA 1VF3A 4ECJA 2YV9A 3CRTA 4N0ZA 1O7UA 3HYPA 3U6VA 3FR9A 3TKRA 2VAFA 2AV4A 1V58A 3LYKA 2GSTA 4EXJA 5IQYA 1TDIA 2H1AA 2IMDA 1ABAA 2CQ9A 5DVBA 2VL9A 4HDEA 4DEJA 1WOUA 3WYWA 2GZPA 3I43A 3MWHA 3ERGA 5COHA 3R3EA 3APQA 3GH9A 3LG6A 1UC7A 5GAPD 5HR3A 4V1Ap 4OFTA 3KGKA 1VF1A 5HR2A 1XVQA 3UJ1A 1QMVA 5J9CA 2WJUA 4ML6A 2WS2A 4RQRA 4EDZA 1JZRA 4HJ2A 5IO2A 1Q98A 3F6DA 3GIXA 3GUSA 2LJKA 3J7Yb 1AXDA 2DIYA 3A2WA 4K7OA 4MZBA 3UOMA 1PGTA 4OO4A 1C72A 1M0UA 1OKTA 1X9WB 2X8GA 1EGRA 3QAVA 1WIKA 4TRXA 2LEGA 1GTUA 3UBKA 1WJKA 1I9DA 2L59A 2F8AA 5AGYA 5E4WA 4FQUA 2YCDA 3M0FA 3ERFA 5CO3A 2HE3A 3D5JA 3HJMA 5IPHA 4V1Ag 3VPTA 3HVSA 4MMMA 4XHMA 2OBIA 5CAXA 1TKDB 1GSDA 1KNGA 4KF9A 3D22A 2DSAA 4EE0A 3PPUA 1UA5A 1A2LA 4X0XA 11GSA 2K8SA 4MP4A 5IMAA 2CZ2A 5J4UA 2DJ2A 2IWTA 4DSRA 2PPTA 3ERWA 1SKSB 1SKRB 2AAWA 2LRTA 3W6GA 1Y6EA 4BWSA 3FW2A 2ON5A 4EIPA 3FR3A 1GNWA 1B48A 1GUKA 3KH7A 3WGEA 3D6IA 4MZWA 1XXUA 3MYDA 1BEDA 2NVLA 5DJLA 1QK8A 1FOVA 2O87A 3QFAC 3VPQA 4WBRD 3ZFBA 4ULXA 1CQGA 2KOKA 2NDOA 2V32A 3ZFLA 4YKFA 4G9HA 3GX8A 1Z6MA 2LJAA 4GQCA 5CRDA 1JZWA 1WPIA 2H0HA 1SK1A 4MJBA 4G0IA 3QFBC 2QSIA 2OA7A 2X49A 3PR8A 2H30A 5D73A 1KEBA 2B6MA 2H73A 1YF0A 4IP1A 4KNDA 2H75A 1V2AA 3QCPA 1AQWA 2YWNA 3APSA 2CV4A 5DBQA 3GKMA 1TP9A 1SKWB 5F06A 4CY8A 3F6FA 5B8AA 5ECRB 2I4AA 3WT2A 1A0RP 2GT5A 2E2MA 3HD5A 5KN1A 1XBSA 5KN3A 3O76A 3TGZA 1QXHA 2JACA 4O32A 2WULA 2C1YA 4ECCA 4MPFA 3GHAA 2OJLA 2DJ1A 3F8UA 2LQOA 5IMCA 3TKSE 2BJXA 3TRXA 5G1KA 3PH9A 1ML6A 4NV2A 2R0GA 3L0HA 5ECOB 4ZXGA 1ERWA 1HYUA 1VRSD 1XCCA 4WR5A 2MMNA 1MDJA 1GSFA 1EZKA 20GSA 2H1GA 2YJHA 2YP6A 1ILOA 3EVIA 1HD2A 1GH2A 2L6CA 2C0FA 3LQ7A 1GSEA 2VLTA 3CRUA 2RLIA 1XZOA 3O3TA 2LJRA 2OADA 3M9JA 1JFUA 3Q74A 1Z5YE 4YAPA 4XCSA 1TK0B 4MF6A 1GSYA 2M80A 1R7HA 2L57A 3EINA 2EC4A 2RM5A 2IFQA 3R2QA 4OCEA 1BAYA 2H6YA 1TOFA 3F9UA 5C00A 1H75A 2IFQB 1VF4A 4HEA2 4IKHA 4OWYA 4FYUA 3TOTA 4MLYA 6GSXA 1XWCA 3EPTA 2F3MA 4NV5A 5HQPA 1J9BA 4BA7A 2FY6A 3QR6A 4KCAA 3P2AA 4EO3A 1YJ6A 1TI1A 2MMAA 5BRTA 2VLVA 5F05A 1OE7A 3MDKA 1PA3A 1VF2A 4RUVA 3E0UA 2WCIA 1Z7PA 4ZL9A 1X0RA 3GA4A 2M72A 4HQSA 1JLVA 4WXTA 5FWGA 1PMTA 2MBTA 1AAZA 3KXOA 5ECQB 1F37A 3LEFA 3U5RE 1O73A 4ECBA 2LNTA 3C1SA 2R4VA 1G6WA 1DUGA 4MK3A 2A2PA 5JCGA 4E8HA 2L5OA 4XRDA 1PKZA 2H76A 4ACSA 1B4QA 2MMOA 6GSUA 2FCHA 2KP2A 1SJ6A 4KH7A 4NWYA 3HA9A 2P5QA 3LFLA 3PGTA 1ZGNA 3LXTA 2E0QA 1GSUA 2CX3A 2KP1A 1KBNA 1K0DA 2VL2C 1UVZA 5JWRB 3I9V2 3HJPA 1LU4A 5J9BA 3ZMLA 5J3RA 3RPNA 5D96A 2H72A 2HLSA 4I6XA 2LQQA 1EWXA 2O89A 2EIRA 2HXKA 3VURA 1ZYNA 2ALBA 3LW9A 4K7NA 4F0BA 2LRNA 3BJ5A 3A2XA 3DD3A 1EOGA 1O8XA 4JEDA 3IXRA 3TRPA 5G30A 2VCZA 1F2EA 4AJ6A 3AY8A 2H66A 1RK4A 1Q4JA 3UAPA 1K3OA 1ERTA 2DIZA 3KCMA 4TVEA 4ZB9A 5AISA 5DCGA 3IR4A 3F4RA 1TRWA 3KTLA 3EWLA 2UZ8A 3IK7A 5DDLA 5JCWA 2K6VA 5LNKe 1XWKA 4IVFA 1SL0B 2FLSA 3LWAA 3GMFA 2A4VA 1SL1B 2BMXA 1XW5A 2HYXA 4ICYA 3J7Yk 1ZOFA 4MABA 4BVXA 5DQYA 1G7OA 3TJGA 4EDYA 2LTKA 4D73B 4TR4A 3MSZA 4BVXB 2HT9A 4MJCA 3M1GA 3HCZA 3TCOA 4LL1B 3RPPA 2GQMA 5G5FA 2FA4A 2B5YA 3TJBA 3IOSA 4E8EA 2FHEA 2H0GA 1EV4A 1U87A 5EVOA 4F9ZA 3FK8A 2M46A 1EEMA 4WR4A 4ID0A 1K3YA 1O8WA 3GFKA 5IOXA 5EL8A 4AJ8A 3VWXA 4AGSA 3WGXA 1OVNA 4QL9A 3DKSA 5ELGA 4ZILA 2HRNA 4PNFA 4K9ZA 4CY6A 2MMZA 1URMA 1TRUA 1GP1A 1GUMA 19GSA 1QGVA 3BD2A 3F3RA 5F8BA 1DE1A 3F4SA 3IRAA 2P31A 3HJOA 3Q18A 5C04A 1WP0A 2CVDA 2DJ3A 3DWVA 2DBCA 1V9WA 2OBKA 4WETA 4KGIA 5INYA 2DMMA 3FHKA 2JSZA 2H19A 4KE3A 4EC0A 1QUWA 2FWFA 4J56E 2IMKA 5G31A 5D9WA 4PNGA 3TB2A 4ISDA 4KCEA 3HZ8A 2VM1A 1O85A 4IGJA 3VFIA 3IA1A 4MNNA 4BL7A 3DXBA 1O81A 2KUCA 1EGOA 1THXA 3GURA 4KUNA 4BL7B 1OE8A 3TRQA 3NOFA 4QQ7A 4GSNA 5D9XA 2JZSA 4I5QA 3KZQA 4KSMA 2VCVA 1F9MA 4K8MA 3RBTA 3RHBA 3CSJA 4XIHA 1TTZA 1GUHA 3HVXA 3H8QA 2QC7A 2J9HA 1PX6A 2DKIA 2H6ZA 4YQVA 3H93A 1T00A 1SJIA 3NIVA 2MBSA 3GSSA 2X8CA 4HU9A 3TKSA 5ECPB 4H86A 4TN8A 3SBCA 4MH2A 2H1DA 2VL2A 5GSTA 4XTSA 4L0UA 5IIZA 3QAWA 3DRNA 8GSSA 3IHGA 3V1WA 4K1FA 2N5FA 2RUEA 4IBPA 4KA0A 1YQ1A 5AIVA 4IJIA 3DMLA 1AQVA 1T3BA 5ID2A 2HFDA 2PERA 5B7CA 3S9FA 5ID2B 3C8EA 1SYRA 3GKNA 4MA9A 4DSQA 3SWLA 1YDKA 1R5AA 2QGVA 3IC4A 4IW9A 3DGQA 3LYPA 1V98A 2ES7A 3D4MA 2XBIA 3UL3A 1T1VA 3IK9A 3LGCA 4L0WA 2R3XA 1ZCPA 2K8VA 4Z2UA 3VWWA 3W8JA 4MZCA 4ZBBA 3P90A 3EU3A 3VI5A 2AYTA 2IIYA 2P0GA 2CAIA 5D9VA 4WEYA 4Q5NA 2VD0A 2B5XA 5JWQB 2KHPA 2C0DA 4K6XA 1B9YC 4TR0A 1TJDA 2BTOT 3UMAA 2YJ7A 1AUCA 1K0NA 1PQNA 1ST9A 2IJYA 3M3MA 1PN0A 1BYEA 2I1UA 2GQLA 1ON4A 6GSWA 1V40A 2AB6A 4MJEA 2GDRA 1ERUA 3L78A 4X43A 1XFLA 1G7EA 1E2YA 4NPBA 1GRXA 4POKA 3H79A 1PX7A 1GL8A 4IQAA 3K8NA 3GH6A 4TW5A 5G2ZA 12GSA 2X99A 2YWIA 3IE3A 2ZCTA 4GTUA 1PD21 1Z7RA 4POBA 5IMZA 3KP8A 1B9XC 3GL3A 5IM9A 4WBJA 1T8EB 2H6XA 1EV9A 3ZVJA 5IPGA 1AW9A 1GTBA 3A2VA 2HI7A 1A24A 4HS1A 2JU5A 3F3QA 5DQSA 2PWJA 2X8HA 5GSSA 1F3BA 3ZMKA 2GLRA 2YN1A 1N2AA 3VWUA 4JR6A 2TRCP 2LRCA 4ZIJA 1S3CA 2GS3A 1M7TA 5HFIA 1M99A 2OE3A 4PUFC 4YKGA 2A2SA 3OR5A 3GYKA 3IPZA 5JWOB 1GNEA 3FYGA 1PSQA 4TR1A 5ABRA 3FZ9A 5CREA 4G0LA 1JHBA 1K0CA 3M8NA 1NHOA 1XWGA 4TR1B 2YPMA 5HFGA 3HHVA 2PN8A 4FYCA 4TXOA 3KIJA 1GSQA 4TXOB 2L6DA 1V57A 4G2EA 1GWCA 1FVKA 2VOCA 3GTUA 2C0EA 3WD6A 3ED3A 2PGTA 2V6KA 3KMOA 3GTUB 2N5AA 4FYBA 1H4OA 1EEJA 3FZAA 4K0GA 1J08A 2JADA 3FR6A 1NW2A 1EP7A 3BCIA 2TIRA 2YNXA 3WGDA 2AUVA 1SL2B 4F2IA 1GLQA 1YKCA 1G0TA 1F3AA 1S3AA 2HSYA 5KN0A 1HNCA 1A8YA 2YWOA 1XWAA 3BOAA 3VI7A 1YF1A 4KB3A 3IBHA 4V2NA 2IPAA 3TKPA 4PQ1A 2F8FA 1TK5B 3FRCA 2V6OA 1K0OA 4KSOA 1OYJA 3ZTLA 4JE1A 4XS6A 1U3AA 3ISOA 4TXVA 5B8BA 2NTOA 3MAKA 5KOXA 5FT3A 5H5QA 1AC1A 4NHWA 1VGLA 3A5IA 3TUEA 3UVTA 2QKEA 2XC2A 5H5RA 3E3EA 4GRFA 2H0IA 5F07A 2O85A 17GSA 4F03A 4BWQA 1XPVA 1FOHA 4OD7A 4F82A 2OE1A 5A4WA 3LSZA 3GL5A 2N5BA 1SU9A 2GSQA 3TKSC 2GT6A 1Z3EA 2R0CA 3HKRA 2QA2A 2LSTA 4GQFA 2YANA 1R4WA 4NMUA 4CHSA 3LJRA 4TR3A 3ZIJA 2VM2A 4I2TA 2L4CA 2E7PA 4O92A 3GRXA 4IN0A 2C3NA 4L5OA 4MH3A 5DALB 2FUG2 4X1UA 3H4KA 5EPFA 1ZZYA 2HZEA 2DKHA 4Z2RA 1S3DA 1TXXA 4K5RA 4ZL8A 3DVWA 3FMWA 3VLNA 2HZEB 3EE2A 4QL7A 4PX1A 3ZITA 4Z7XA 1EOHA 1GTIA 1FB6A 1M9AA 3M9KA 4HU7A 2QA1A 4HZ2A 3DIEA 1ZMAA 1ZL9A 4K0NA 3LORA 4USSA 2B1LA 2C80A 2OACA 4I2UA 3ZL5A 2DLXA 3L9VA 2RM6A 5ECIB 1OAZA 1DBYA 4OO5A 2GTUA 1K0AA 4FH8A 4OFMA 2HZFA 4MCUA 1ERVA 4O5RA 5ELAA 4D73A 2NBSA 2R2JA 5H5SA 3QPMA 2VO4A 2OKAA 3HY2A 5CYYA 3ZZXA 4AF2A 1LJRA 4RI7A 1TK8B 2G0FA 4OMVA 4EKZA 3QD9A 3RDWA 2IMEA 2XBQA 4EF0A 2V1MA 2FWGA 4I97A 1ACVA 2H8LA 5IMFA 4KW6A 4CDOA 2CT6A 1OC8A 2B5EA 2DJ0A 2VCQA 4LLRA 2F9SA 1TI3A 2RUFA 3GNJA 4N30A 2KLXA 2HSMA 4TOPA 2VUPA 1XWBA 3IAS2 3N5OA 3DEXA 4MF7A 3HZ4A 2JL4A 5ECNB 10GSA 3E9JB 3D4TA 1X5DA 1A2JA 2AJQB 3FY7A 1M9BA 5IMVA 5DJMA 2WB9A 2C0GA 1W4VA 4OCFA 1YZXA 2WDUA 2G2QA 4HOJA 1JLWA 5FHIA 1ZYQB 1BX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FEU A;  2B7J A;  1SK0 A;  5ECM B;  3APO A;  4PQI A;  4N11 A;  2ON7 A;  3RAZ A;  3A5W A;  5B6N A;  5CP1 A;  4NXI A;  2YWM A;  1YEX A;  2X64 A;  1XW9 A;  4HQZ A;  1BQ7 A;  3CBU A;  2PMT A;  3CTF A;  4O7H A;  9GSS A;  2WGR A;  1SEN A;  1SYX A;  2CZ3 A;  1YKA A;  4JR4 A;  1THO A;  5EY6 A;  2YZH A;  2WZ9 A;  4ILF A;  2H70 A;  4J57 E;  4RI6 A;  4ECI A;  1TU8 A;  1FVJ A;  2R6K A;  2PVO C;  4IHU A;  2WFC A;  2IN3 A;  2GZZ A;  2GZY A;  2IMF A;  1WWJ A;  2LKU A;  2H1B A;  4F0C A;  1BG5 A;  1A0F A;  2H74 A;  1FO5 A;  2VCT A;  1USB A;  4GWR A;  1Z9H A;  1JZD A;  4IEL A;  3VWV A;  5HR0 A;  1HNB A;  4CW9 A;  3LXZ A;  4V2M A;  4V2L A;  4GLT A;  2DJJ A;  5DAK A;  5CNW A;  4RQX A;  1QQ2 A;  1YY7 A;  1A23 A;  1XIY A;  2HSH A;  5DAK B;  4LA1 A;  5ECS A;  3CYN A;  4ZB6 A;  2FWH A;  1TU7 A;  2NPB A;  3G7I A;  2DJK A;  3GKK A;  1AIU A;  2A2R A;  2VD1 A;  1E6B A;  2B1K A;  2R5G A;  4PXO A;  2ZNM A;  5J5N A;  2XPD A;  4IS0 A;  2IL3 A;  2VLU A;  3BCK A;  3IHQ A;  4I8B A;  4WF5 A;  1K3L A;  5GZZ B;  2CA8 A;  4JBB A;  4NAX A;  1GSS A;  18GS A;  2C8U A;  1TRV A;  4HZ4 A;  2K9F A;  1TRS A;  1K0B A;  4HI7 A;  4LMW A;  1HNA A;  2GGT A;  1NSW A;  4GF0 A;  2EIQ A;  1XVW A;  4GCI A;  3L4N A;  4KDX A;  2F51 A;  5AN1 A;  5HFK A;  5KEJ A;  6GST A;  3KTB A;  3P7X A;  3I6A A;  2H01 A;  4ZBA A;  1TW9 A;  2CAQ A;  2GQK A;  3WT1 A;  4ZB8 A;  1IYH A;  3N9J A;  5G1L A;  4PQH A;  1PRX A;  3VK9 A;  1SK2 A;  3ME7 A;  3CMI A;  1XOA A;  2DML A;  5CRG A;  1Y25 A;  2GVP A;  2IMI A;  3ZIV A;  1Z6N A;  1O6J A;  14GS A;  2RII A;  3BBY A;  1DSB A;  3G9B A;  4KDU A;  1RQM A;  3L9U A;  22GS A;  1IYI A;  2HNL A;  1FB0 A;  3EMP A;  16GS A;  1B8X A;  1HQO A;  3ZRE A;  2PVQ A;  3TOU A;  4POL A;  4IJ3 A;  1M2B A;  2PU9 C;  3PIN A;  7GSS A;  1WE0 A;  3UIW A;  2XPE A;  3UVH A;  6GSY A;  1NHY A;  3QMX A;  5D8I A;  2LV3 A;  1XOB A;  4MJA A;  3HVV A;  2PUK C;  1SD8 A;  1G6Y A;  1PKW A;  2XHF A;  1U88 A;  3EU4 A;  3F0I A;  2D2Z A;  2O7K A;  1AQX A;  5IOW A;  3C7M A;  1FHE A;  4WF4 A;  4XRA A;  4PUR A;  1M2A A;  4LL4 B;  1JZO A;  1LBK A;  3QOU A;  2C3T A;  1GLP A;  3KEB A;  4YAV A;  4G10 A;  5HR1 A;  1FAA A;  2AHE A;  4EVM A;  3TJJ A;  5A5K A;  2PBJ A;  3ZRD A;  1MTC A;  2VIM A;  3G7J A;  1GUL A;  2JZT A;  2Z9S A;  2DC5 A;  3D21 A;  3MNG A;  2ZUP A;  4Q5R A;  1T4Y A;  5ECK B;  1N8J A;  2HRF A;  2FWE A;  4GSS A;  4J2F A;  5A4U A;  3UBL A;  1R26 A;  4ML1 A;  5GAN D;  3TJF A;  3GV1 A;  2YV7 A;  1WRY A;  4GST A;  1MEK A;  3P8W A;  4WKW A;  5B6M A;  3GKX A;  1X5C A;  3C71 A;  1XW6 A;  4HJM A;  13GS A;  2LUS A;  5LD0 A;  1R5P A;  3CTG A;  4Q5Q A;  1QFN A;  2MYG A;  3EMX A;  4Q5F A;  3ZVJ D;  4GXZ A;  3IAM 2;  1RW1 A;  3TDG A;  2K18 A;  1FW1 A;  2H71 A;  1MDI A;  2B7K A;  5ECL B;  3F4T A;  3JCM L;  3H1N A;  3FKF A;  2B3S A;  5L71 A;  3O6T A;  3US3 A;  5IO0 A;  5IMD A;  3CSH A;  2JSY A;  4MDC A;  3W8S A;  3KMN A;  5JCU A;  1OC9 A;  4L8E A;  1PL1 A;  3IDV A;  4LMV A;  2E2G A;  3CSI A;  3NZN A;  4L5L A;  1OC9 B;  3RHC A;  3EC3 A;  2EIO A;  1OKD A;  3KD0 A;  1F6M C;  4KDY A;  1PN9 A;  1M2D A;  5AIX A;  4YQM A;  3C1R A;  5D93 A;  2FD3 A;  1DE2 A;  2I81 A;  5DAL A;  2I9H A;  1EP8 A;  1OC3 A;  1A8L A;  4JU5 A;  2V41 A;  2GSR A;  2WRT A;  1A2M A;  2LS5 A;  1I5G A;  2FGX A;  4KAE A;  2LNS A;  1SD9 A;  4G19 A;  4HUA A;  2REM A;  2CVK A;  4PUA A;  1MD3 A;  4N0V A;  4POM A;  1W89 A;  3Q19 A;  1X5E A;  2CX4 A;  1KTE A;  1NM3 A;  3HDC A;  2L5L A;  5ECH B;  5G5E A;  3HXS A;  4TKY A;  1K0M A;  1PL2 A;  4JZQ A;  3FZ4 A;  4DSS A;  3CXG A;  3TKQ A;  1SJZ A;  2V2G A;  4XS1 A;  4NHZ A;  3D0Z A;  4DSS B;  2JZR A;  2I3Y A;  5E59 A;  3ZLP A;  2OE0 A;  4IQ1 A;  1ZYE A;  2C4J A;  4IP6 A;  3QDN A;  1U3I A;  1BJX A;  4P3Y B;  2P5R A;  2FA8 A;  4PGT A;  3GST A;  1UN2 A;  3G7Y A;  4MF5 A;  3QAG A;  4YQU A;  4K7I A;  5A4V A;  2L4Q A;  3TJK A;  5ENU A;  4FO5 A;  4DVC A;  3DVX A;  5D9T A;  5KN2 A;  4MPG A;  1T7P B;  5LCZ A;  2YOI A;  4ZBD A;  1X9S B;  5CRW A;  4AJ7 A;  4BVY A;  3KM6 A;  3ZYW A;  2O8V B;  2J23 A;  4N10 A;  2MZC A;  2VCW A;  4EL1 A;  4ZL7 A;  3KJY A;  2VL3 A;  2R37 A;  4BPY A;  1CQH A;  2GSS A;  1GTA A;  3F63 A;  4YH2 A;  3Q6O A;  3EUR A;  5DCH A;  3C73 A;  4KX4 A;  1YEP A;  4OFN A;  2CVB A;  1WMJ A;  3UAR A;  1MD4 A;  2C3Q A;  1X9M B;  3EYT A;  3L9S A;  3GX0 A;  4JRR A;  1T4Z A;  3IV4 A;  4EUY A;  1FG4 A;  3GN3 A;  2YZU A;  6GSS A;  3FZ5 A;  3DYR A;  1J0F A;  3KP9 A;  3KH9 A;  1U6T A;  4XS4 A;  5CRH A;  3I69 A;  2TRX A;  3A3T A;  5J41 A;  1MDK A;  2FNO A;  1B4P A;  6GSV A;  2VCX A;  4XS4 B;  4FIW A;  3ME8 A;  3UEM A;  5F0G A;  4K2D A;  1VF3 A;  4ECJ A;  2YV9 A;  3CRT A;  4N0Z A;  1O7U A;  3HYP A;  3U6V A;  3FR9 A;  3TKR A;  2VAF A;  2AV4 A;  1V58 A;  3LYK A;  2GST A;  4EXJ A;  5IQY A;  1TDI A;  2H1A A;  2IMD A;  1ABA A;  2CQ9 A;  5DVB A;  2VL9 A;  4HDE A;  4DEJ A;  1WOU A;  3WYW A;  2GZP A;  3I43 A;  3MWH A;  3ERG A;  5COH A;  3APQ A;  3GH9 A;  3LG6 A;  1UC7 A;  5GAP D;  5HR3 A;  4V1A p;  4OFT A;  3KGK A;  1VF1 A;  5HR2 A;  1XVQ A;  3UJ1 A;  1QMV A;  5J9C A;  2WJU A;  4ML6 A;  2WS2 A;  4RQR A;  4EDZ A;  1JZR A;  4HJ2 A;  5IO2 A;  1Q98 A;  3F6D A;  3GIX A;  3GUS A;  2LJK A;  3J7Y b;  1AXD A;  2DIY A;  3A2W A;  4K7O A;  4MZB A;  3UOM A;  1PGT A;  4OO4 A;  1C72 A;  1M0U A;  1OKT A;  1X9W B;  2X8G A;  1EGR A;  3QAV A;  1WIK A;  4TRX A;  2LEG A;  1GTU A;  3UBK A;  1WJK A;  1I9D A;  2L59 A;  2F8A A;  5AGY A;  5E4W A;  2YCD A;  3M0F A;  3ERF A;  5CO3 A;  2HE3 A;  3D5J A;  3HJM A;  5IPH A;  4V1A g;  3VPT A;  3HVS A;  4MMM A;  4XHM A;  2OBI A;  5CAX A;  1TKD B;  1GSD A;  1KNG A;  3D22 A;  2DSA A;  4EE0 A;  1UA5 A;  1A2L A;  4X0X A;  11GS A;  2K8S A;  4MP4 A;  5IMA A;  2CZ2 A;  5J4U A;  2DJ2 A;  2IWT A;  4DSR A;  2PPT A;  3ERW A;  1SKS B;  1SKR B;  2AAW A;  2LRT A;  3W6G A;  1Y6E A;  4BWS A;  3FW2 A;  2ON5 A;  3FR3 A;  1GNW A;  1B48 A;  1GUK A;  3KH7 A;  3WGE A;  3D6I A;  4MZW A;  1XXU A;  1BED A;  2NVL A;  5DJL A;  1QK8 A;  1FOV A;  2O87 A;  3QFA C;  3VPQ A;  4WBR D;  3ZFB A;  4ULX A;  1CQG A;  2KOK A;  2NDO A;  2V32 A;  3ZFL A;  4G9H A;  3GX8 A;  1Z6M A;  2LJA A;  4GQC A;  5CRD A;  1JZW A;  1WPI A;  2H0H A;  1SK1 A;  4MJB A;  3QFB C;  2QSI A;  2OA7 A;  3PR8 A;  2H30 A;  5D73 A;  1KEB A;  2B6M A;  2H73 A;  1YF0 A;  4IP1 A;  4KND A;  2H75 A;  1V2A A;  3QCP A;  1AQW A;  2YWN A;  3APS A;  2CV4 A;  5DBQ A;  3GKM A;  1TP9 A;  1SKW B;  5F06 A;  3F6F A;  5B8A A;  5ECR B;  2I4A A;  3WT2 A;  1A0R P;  2GT5 A;  2E2M A;  3HD5 A;  5KN1 A;  1XBS A;  5KN3 A;  3O76 A;  3TGZ A;  1QXH A;  2JAC A;  4O32 A;  2WUL A;  2C1Y A;  4ECC A;  4MPF A;  3GHA A;  2OJL A;  2DJ1 A;  3F8U A;  2LQO A;  5IMC A;  3TKS E;  2BJX A;  3TRX A;  5G1K A;  3PH9 A;  1ML6 A;  4NV2 A;  5ECO B;  3L0H A;  4ZXG A;  1ERW A;  1HYU A;  1VRS D;  1XCC A;  4WR5 A;  2MMN A;  1MDJ A;  1GSF A;  1EZK A;  20GS A;  2H1G A;  2YJH A;  2YP6 A;  1ILO A;  3EVI A;  1HD2 A;  1GH2 A;  2L6C A;  2C0F A;  3LQ7 A;  1GSE A;  2VLT A;  3CRU A;  2RLI A;  1XZO A;  3O3T A;  2LJR A;  2OAD A;  3M9J A;  1JFU A;  3Q74 A;  1Z5Y E;  4YAP A;  4XCS A;  1TK0 B;  4MF6 A;  1GSY A;  2M80 A;  1R7H A;  2L57 A;  3EIN A;  2EC4 A;  2RM5 A;  2IFQ A;  3R2Q A;  4OCE A;  1BAY A;  2H6Y A;  1TOF A;  3F9U A;  5C00 A;  1H75 A;  2IFQ B;  1VF4 A;  4HEA 2;  4IKH A;  4OWY A;  4FYU A;  3TOT A;  4MLY A;  6GSX A;  1XWC A;  2F3M A;  4NV5 A;  5HQP A;  1J9B A;  4BA7 A;  2FY6 A;  3QR6 A;  4KCA A;  3P2A A;  4EO3 A;  1YJ6 A;  1TI1 A;  2MMA A;  2VLV A;  5F05 A;  1OE7 A;  3MDK A;  1PA3 A;  1VF2 A;  4RUV A;  3E0U A;  2WCI A;  1Z7P A;  4ZL9 A;  1X0R A;  3GA4 A;  2M72 A;  4HQS A;  1JLV A;  4WXT A;  5FWG A;  1PMT A;  2MBT A;  1AAZ A;  3KXO A;  5ECQ B;  1F37 A;  3LEF A;  3U5R E;  1O73 A;  4ECB A;  2LNT A;  3C1S A;  2R4V A;  1G6W A;  1DUG A;  4MK3 A;  5JCG A;  4E8H A;  2L5O A;  4XRD A;  1PKZ A;  2H76 A;  4ACS A;  1B4Q A;  2MMO A;  6GSU A;  2FCH A;  2KP2 A;  1SJ6 A;  4KH7 A;  4NWY A;  3HA9 A;  2P5Q A;  3LFL A;  3PGT A;  1ZGN A;  3LXT A;  2E0Q A;  1GSU A;  2CX3 A;  2KP1 A;  1KBN A;  1K0D A;  2VL2 C;  1UVZ A;  5JWR B;  3I9V 2;  3HJP A;  1LU4 A;  5J9B A;  3ZML A;  5J3R A;  3RPN A;  5D96 A;  2H72 A;  2HLS A;  4I6X A;  2LQQ A;  1EWX A;  2O89 A;  2EIR A;  2HXK A;  3VUR A;  2ALB A;  4K7N A;  4F0B A;  2LRN A;  3BJ5 A;  3A2X A;  3DD3 A;  1EOG A;  1O8X A;  4JED A;  3IXR A;  3TRP A;  5G30 A;  2VCZ A;  1F2E A;  4AJ6 A;  3AY8 A;  2H66 A;  1RK4 A;  1Q4J A;  3UAP A;  1K3O A;  1ERT A;  2DIZ A;  3KCM A;  4TVE A;  4ZB9 A;  5AIS A;  5DCG A;  3IR4 A;  3F4R A;  1TRW A;  3KTL A;  3EWL A;  3IK7 A;  5DDL A;  5JCW A;  5LNK e;  2K6V A;  1XWK A;  4IVF A;  1SL0 B;  2FLS A;  3LWA A;  3GMF A;  2A4V A;  1SL1 B;  2BMX A;  1XW5 A;  2HYX A;  3J7Y k;  1ZOF A;  4MAB A;  4BVX A;  5DQY A;  1G7O A;  3TJG A;  4EDY A;  2LTK A;  4D73 B;  4TR4 A;  3MSZ A;  2HT9 A;  4MJC A;  3M1G A;  3HCZ A;  3TCO A;  4LL1 B;  3RPP A;  2GQM A;  5G5F A;  2FA4 A;  2B5Y A;  3TJB A;  3IOS A;  4E8E A;  2FHE A;  2H0G A;  1EV4 A;  1U87 A;  5EVO A;  4F9Z A;  3FK8 A;  2M46 A;  1EEM A;  4WR4 A;  4ID0 A;  1K3Y A;  1O8W A;  3GFK A;  5IOX A;  5EL8 A;  4AJ8 A;  3VWX A;  4AGS A;  3WGX A;  1OVN A;  4QL9 A;  3DKS A;  5ELG A;  4ZIL A;  2HRN A;  4PNF A;  4K9Z A;  2MMZ A;  1URM A;  1TRU A;  1GP1 A;  1GUM A;  19GS A;  1QGV A;  3BD2 A;  3F3R A;  5F8B A;  1DE1 A;  3F4S A;  3IRA A;  2P31 A;  3HJO A;  3Q18 A;  5C04 A;  1WP0 A;  2CVD A;  2DJ3 A;  3DWV A;  2DBC A;  1V9W A;  2OBK A;  4WET A;  4KGI A;  5INY A;  2DMM A;  3FHK A;  2JSZ A;  2H19 A;  4KE3 A;  4EC0 A;  1QUW A;  2FWF A;  4J56 E;  2IMK A;  5G31 A;  5D9W A;  4PNG A;  3TB2 A;  4ISD A;  4KCE A;  3HZ8 A;  2VM1 A;  1O85 A;  4IGJ A;  3VFI A;  3IA1 A;  4BL7 A;  3DXB A;  1O81 A;  2KUC A;  1EGO A;  1THX A;  3GUR A;  4KUN A;  1OE8 A;  3TRQ A;  3NOF A;  4QQ7 A;  4GSN A;  5D9X A;  2JZS A;  4I5Q A;  3KZQ A;  4KSM A;  2VCV A;  1F9M A;  4K8M A;  3RBT A;  3RHB A;  3CSJ A;  4XIH A;  1TTZ A;  1GUH A;  3HVX A;  3H8Q A;  2QC7 A;  2J9H A;  1PX6 A;  2H6Z A;  4YQV A;  3H93 A;  1T00 A;  1SJI A;  3NIV A;  2MBS A;  3GSS A;  2X8C A;  4HU9 A;  3TKS A;  5ECP B;  4H86 A;  4TN8 A;  3SBC A;  4MH2 A;  2H1D A;  2VL2 A;  5GST A;  4XTS A;  4L0U A;  5IIZ A;  3QAW A;  3DRN A;  8GSS A;  3V1W A;  4K1F A;  2N5F A;  2RUE A;  4IBP A;  4KA0 A;  1YQ1 A;  5AIV A;  4IJI A;  3DML A;  1AQV A;  1T3B A;  5ID2 A;  2HFD A;  2PER A;  5B7C A;  3S9F A;  5ID2 B;  3C8E A;  1SYR A;  3GKN A;  4MA9 A;  4DSQ A;  3SWL A;  1YDK A;  1R5A A;  2QGV A;  3IC4 A;  4IW9 A;  3DGQ A;  3LYP A;  1V98 A;  2ES7 A;  3D4M A;  2XBI A;  3UL3 A;  1T1V A;  3IK9 A;  3LGC A;  4L0W A;  2R3X A;  1ZCP A;  2K8V A;  3VWW A;  3W8J A;  4MZC A;  4ZBB A;  3P90 A;  3EU3 A;  3VI5 A;  2AYT A;  2IIY A;  2P0G A;  2CAI A;  5D9V A;  4WEY A;  4Q5N A;  2VD0 A;  2B5X A;  5JWQ B;  2KHP A;  2C0D A;  4K6X A;  1B9Y C;  4TR0 A;  1TJD A;  2BTO T;  3UMA A;  2YJ7 A;  1AUC A;  1K0N A;  1PQN A;  1ST9 A;  2IJY A;  3M3M A;  1BYE A;  2I1U A;  2GQL A;  1ON4 A;  6GSW A;  1V40 A;  2AB6 A;  4MJE A;  2GDR A;  1ERU A;  3L78 A;  4X43 A;  1XFL A;  1G7E A;  1E2Y A;  4NPB A;  1GRX A;  4POK A;  3H79 A;  1PX7 A;  1GL8 A;  4IQA A;  3K8N A;  3GH6 A;  4TW5 A;  5G2Z A;  12GS A;  2X99 A;  2YWI A;  3IE3 A;  2ZCT A;  4GTU A;  1PD2 1;  1Z7R A;  4POB A;  5IMZ A;  3KP8 A;  1B9X C;  3GL3 A;  5IM9 A;  4WBJ A;  1T8E B;  2H6X A;  1EV9 A;  3ZVJ A;  5IPG A;  1AW9 A;  1GTB A;  3A2V A;  2HI7 A;  1A24 A;  4HS1 A;  2JU5 A;  3F3Q A;  5DQS A;  2PWJ A;  2X8H A;  5GSS A;  1F3B A;  3ZMK A;  2GLR A;  2YN1 A;  1N2A A;  3VWU A;  4JR6 A;  2TRC P;  2LRC A;  4ZIJ A;  1S3C A;  2GS3 A;  1M7T A;  5HFI A;  1M99 A;  2OE3 A;  4PUF C;  2A2S A;  3OR5 A;  3GYK A;  3IPZ A;  5JWO B;  1GNE A;  3FYG A;  1PSQ A;  4TR1 A;  5ABR A;  3FZ9 A;  5CRE A;  1JHB A;  1K0C A;  3M8N A;  1NHO A;  1XWG A;  4TR1 B;  2YPM A;  5HFG A;  3HHV A;  2PN8 A;  4FYC A;  4TXO A;  3KIJ A;  1GSQ A;  4TXO B;  2L6D A;  1V57 A;  4G2E A;  1GWC A;  1FVK A;  2VOC A;  3GTU A;  2C0E A;  3WD6 A;  3ED3 A;  2PGT A;  2V6K A;  3KMO A;  3GTU B;  2N5A A;  4FYB A;  1H4O A;  1EEJ A;  3FZA A;  4K0G A;  1J08 A;  2JAD A;  3FR6 A;  1NW2 A;  1EP7 A;  3BCI A;  2TIR A;  2YNX A;  3WGD A;  2AUV A;  1SL2 B;  4F2I A;  1GLQ A;  1YKC A;  1G0T A;  1F3A A;  1S3A A;  2HSY A;  5KN0 A;  1HNC A;  1A8Y A;  2YWO A;  1XWA A;  3BOA A;  3VI7 A;  1YF1 A;  4KB3 A;  3IBH A;  4V2N A;  2IPA A;  3TKP A;  4PQ1 A;  2F8F A;  1TK5 B;  3FRC A;  2V6O A;  1K0O A;  4KSO A;  1OYJ A;  3ZTL A;  4JE1 A;  4XS6 A;  1U3A A;  3ISO A;  4TXV A;  5B8B A;  2NTO A;  3MAK A;  5FT3 A;  5H5Q A;  1AC1 A;  4NHW A;  1VGL A;  3TUE A;  3UVT A;  2QKE A;  2XC2 A;  5H5R A;  3E3E A;  4GRF A;  2H0I A;  5F07 A;  2O85 A;  17GS A;  4F03 A;  4BWQ A;  1XPV A;  4OD7 A;  4F82 A;  2OE1 A;  5A4W A;  3LSZ A;  3GL5 A;  2N5B A;  1SU9 A;  2GSQ A;  3TKS C;  2GT6 A;  1Z3E A;  3HKR A;  2LST A;  4GQF A;  2YAN A;  1R4W A;  4NMU A;  4CHS A;  3LJR A;  4TR3 A;  3ZIJ A;  2VM2 A;  4I2T A;  2L4C A;  2E7P A;  4O92 A;  3GRX A;  4IN0 A;  2C3N A;  4L5O A;  4MH3 A;  5DAL B;  2FUG 2;  4X1U A;  3H4K A;  5EPF A;  1ZZY A;  2HZE A;  1S3D A;  1TXX A;  4ZL8 A;  3DVW A;  3VLN A;  2HZE B;  3EE2 A;  4QL7 A;  4PX1 A;  3ZIT A;  4Z7X A;  1EOH A;  1GTI A;  1FB6 A;  1M9A A;  3M9K A;  4HU7 A;  4HZ2 A;  3DIE A;  1ZMA A;  1ZL9 A;  4K0N A;  3LOR A;  2B1L A;  2C80 A;  2OAC A;  4I2U A;  3ZL5 A;  2DLX A;  3L9V A;  2RM6 A;  5ECI B;  1OAZ A;  1DBY A;  4OO5 A;  2GTU A;  1K0A A;  4FH8 A;  4OFM A;  2HZF A;  4MCU A;  1ERV A;  4O5R A;  5ELA A;  4D73 A;  2NBS A;  2R2J A;  5H5S A;  3QPM A;  2VO4 A;  2OKA A;  3HY2 A;  5CYY A;  3ZZX A;  4AF2 A;  1LJR A;  4RI7 A;  1TK8 B;  2G0F A;  4OMV A;  4EKZ A;  3QD9 A;  3RDW A;  2IME A;  2XBQ A;  4EF0 A;  2V1M A;  2FWG A;  4I97 A;  1ACV A;  2H8L A;  5IMF A;  4KW6 A;  4CDO A;  2CT6 A;  1OC8 A;  2B5E A;  2DJ0 A;  2VCQ A;  4LLR A;  2F9S A;  1TI3 A;  2RUF A;  3GNJ A;  4N30 A;  2KLX A;  4TOP A;  2VUP A;  1XWB A;  3IAS 2;  3N5O A;  3DEX A;  4MF7 A;  3HZ4 A;  2JL4 A;  5ECN B;  10GS A;  3E9J B;  3D4T A;  1X5D A;  1A2J A;  2AJQ B;  3FY7 A;  1M9B A;  5IMV A;  5DJM A;  2WB9 A;  2C0G A;  1W4V A;  4OCF A;  1YZX A;  2WDU A;  2G2Q A;  4HOJ A;  1JLW A;  5FHI A;  1ZYQ B;  1BX9 A; 
#chains in the Genus database with same CATH topology
 3FEU A;  2B7J A;  1SK0 A;  5ECM B;  3APO A;  4PQI A;  4N11 A;  2ON7 A;  3RAZ A;  3A5W A;  5B6N A;  4O5U A;  5CP1 A;  4NXI A;  2YWM A;  1YEX A;  2X64 A;  1XW9 A;  4HQZ A;  1BQ7 A;  3CBU A;  2PMT A;  3CTF A;  4O7H A;  9GSS A;  2WGR A;  1SEN A;  1SYX A;  2CZ3 A;  1YKA A;  4JR4 A;  1THO A;  5EY6 A;  2YZH A;  2WZ9 A;  4ILF A;  2H70 A;  4J57 E;  4RI6 A;  4ECI A;  1TU8 A;  1FVJ A;  2R6K A;  2PVO C;  4IHU A;  2WFC A;  2IN3 A;  2GZZ A;  2GZY A;  2IMF A;  1WWJ A;  2LKU A;  2H1B A;  4F0C A;  1BG5 A;  1A0F A;  2H74 A;  1FO5 A;  2A4H A;  2VCT A;  1USB A;  4GWR A;  1Z9H A;  1JZD A;  4IEL A;  3VWV A;  5HR0 A;  1HNB A;  4CW9 A;  3LXZ A;  4V2M A;  4V2L A;  4GLT A;  2DJJ A;  5DAK A;  5CNW A;  4RQX A;  1QQ2 A;  1YY7 A;  1A23 A;  1XIY A;  2HSH A;  5DAK B;  4LA1 A;  5ECS A;  3CYN A;  4ZB6 A;  2FWH A;  1TU7 A;  2NPB A;  3G7I A;  2DJK A;  3GKK A;  1AIU A;  2A2R A;  2VD1 A;  1E6B A;  2B1K A;  2R5G A;  4PXO A;  2ZNM A;  5J5N A;  2XPD A;  2X4A A;  4IS0 A;  2IL3 A;  2VLU A;  3BCK A;  3IHQ A;  4I8B A;  4WF5 A;  1K3L A;  5GZZ B;  2CA8 A;  4JBB A;  4NAX A;  1GSS A;  4K5S A;  18GS A;  4EIQ A;  2C8U A;  1TRV A;  4HZ4 A;  3CQF A;  2K9F A;  1TRS A;  1K0B A;  2HRA A;  4HI7 A;  4LMW A;  1HNA A;  2GGT A;  1NSW A;  4GF0 A;  2EIQ A;  1XVW A;  4GCI A;  3L4N A;  4KDX A;  2F51 A;  5AN1 A;  5HFK A;  5KEJ A;  6GST A;  3KTB A;  3P7X A;  3I6A A;  2H01 A;  4ZBA A;  1TW9 A;  2CAQ A;  2GQK A;  3WT1 A;  4ZB8 A;  1IYH A;  2HRK A;  3N9J A;  5G1L A;  4G0K A;  4PQH A;  1PRX A;  3VK9 A;  1SK2 A;  3ME7 A;  3CMI A;  1XOA A;  2DML A;  5CRG A;  1Y25 A;  2GVP A;  2IMI A;  3ZIV A;  5BMU A;  1Z6N A;  1O6J A;  14GS A;  2RII A;  3BBY A;  1DSB A;  3G9B A;  4KDU A;  1RQM A;  3L9U A;  22GS A;  1IYI A;  2HNL A;  1FB0 A;  3EMP A;  16GS A;  1B8X A;  1HQO A;  3ZRE A;  2PVQ A;  3TOU A;  4POL A;  4IJ3 A;  1M2B A;  2PU9 C;  3PIN A;  4A5P A;  7GSS A;  1WE0 A;  3UIW A;  2XPE A;  3UVH A;  6GSY A;  1NHY A;  3QMX A;  5D8I A;  2LV3 A;  1XOB A;  4MJA A;  3HVV A;  2PUK C;  4BIK A;  1SD8 A;  1G6Y A;  1PKW A;  2XHF A;  1U88 A;  3EU4 A;  3F0I A;  2D2Z A;  2O7K A;  1AQX A;  5IOW A;  3C7M A;  1FHE A;  4WF4 A;  4XRA A;  4PUR A;  1M2A A;  4LL4 B;  4HSC X;  1JZO A;  1LBK A;  3QOU A;  2C3T A;  1GLP A;  3KEB A;  4YAV A;  4G10 A;  5HR1 A;  4K2X A;  1FAA A;  2AHE A;  4EVM A;  3TJJ A;  5A5K A;  4X4J A;  2PBJ A;  3ZRD A;  1MTC A;  2VIM A;  3G7J A;  1GUL A;  2JZT A;  2Z9S A;  2DC5 A;  3D21 A;  3MNG A;  2ZUP A;  4Q5R A;  1T4Y A;  5ECK B;  1N8J A;  2HRF A;  2FWE A;  4GSS A;  4J2F A;  5A4U A;  3UBL A;  1ZYP A;  1R26 A;  3IC8 A;  4ML1 A;  5GAN D;  3TJF A;  3GV1 A;  2YV7 A;  1WRY A;  4GST A;  1MEK A;  3P8W A;  4WKW A;  5B6M A;  3GKX A;  1X5C A;  3C71 A;  1XW6 A;  4HJM A;  13GS A;  2LUS A;  5LD0 A;  1R5P A;  3CTG A;  4Q5Q A;  1QFN A;  2MYG A;  3EMX A;  4Q5F A;  3ZVJ D;  4GXZ A;  3IAM 2;  1RW1 A;  3TDG A;  2K18 A;  1FW1 A;  2H71 A;  1MDI A;  2B7K A;  5ECL B;  1S3R A;  3F4T A;  3JCM L;  3H1N A;  3FKF A;  2B3S A;  5L71 A;  3O6T A;  3US3 A;  5IO0 A;  5IMD A;  3CSH A;  2JSY A;  4MDC A;  3W8S A;  3KMN A;  5JCU A;  1OC9 A;  1PFO A;  4L8E A;  1PL1 A;  3IDV A;  4LMV A;  2E2G A;  3CSI A;  3NZN A;  4L5L A;  1OC9 B;  3RHC A;  4Z2T A;  3EC3 A;  3MIX A;  2EIO A;  1OKD A;  3KD0 A;  1F6M C;  4KDY A;  1PN9 A;  1M2D A;  5AIX A;  4YQM A;  3C1R A;  5D93 A;  2FD3 A;  1DE2 A;  2I81 A;  5DAL A;  2I9H A;  1EP8 A;  1OC3 A;  1A8L A;  4JU5 A;  2V41 A;  2GSR A;  2WRT A;  4O5Q A;  1A2M A;  2LS5 A;  1I5G A;  2FGX A;  4KAE A;  2LNS A;  1SD9 A;  4PTS A;  4G19 A;  4HUA A;  2REM A;  2CVK A;  4PUA A;  1MD3 A;  4N0V A;  4POM A;  1W89 A;  3Q19 A;  1X5E A;  2CX4 A;  1KTE A;  1NM3 A;  3HDC A;  2L5L A;  5ECH B;  5G5E A;  3HXS A;  4TKY A;  1K0M A;  1PL2 A;  4JZQ A;  3FZ4 A;  4DSS A;  3CXG A;  3TKQ A;  1SJZ A;  2V2G A;  4XS1 A;  4NHZ A;  3D0Z A;  4DSS B;  2JZR A;  2I3Y A;  5E59 A;  3ZLP A;  2OE0 A;  4IQ1 A;  1ZYE A;  2C4J A;  4IP6 A;  3QDN A;  1U3I A;  1BJX A;  4P3Y B;  2P5R A;  2FA8 A;  4PGT A;  3GST A;  1UN2 A;  3G7Y A;  4MF5 A;  3QAG A;  4YQU A;  4K7I A;  5A4V A;  2L4Q A;  3TJK A;  5ENU A;  4FO5 A;  4DVC A;  3DVX A;  5D9T A;  5KN2 A;  4MPG A;  1T7P B;  5LCZ A;  2YOI A;  4ZBD A;  1X9S B;  5CRW A;  4AJ7 A;  4BVY A;  3KM6 A;  3ZYW A;  2O8V B;  4BVY B;  2J23 A;  2R0P A;  4N10 A;  2MZC A;  2VCW A;  4EL1 A;  4ZL7 A;  3KJY A;  5KOW A;  2VL3 A;  2R37 A;  4BPY A;  1CQH A;  2GSS A;  1GTA A;  3F63 A;  4YH2 A;  3Q6O A;  3EUR A;  5DCH A;  3C73 A;  4KX4 A;  1YEP A;  4OFN A;  2CVB A;  1WMJ A;  3UAR A;  1MD4 A;  2C3Q A;  1X9M B;  3EYT A;  3L9S A;  3GX0 A;  4JRR A;  1T4Z A;  3IV4 A;  4EUY A;  1FG4 A;  3GN3 A;  2YZU A;  6GSS A;  3FZ5 A;  3DYR A;  1J0F A;  1XG8 A;  3KP9 A;  3KH9 A;  1U6T A;  4XS4 A;  5CRH A;  3I69 A;  2TRX A;  3A3T A;  5J41 A;  1MDK A;  2FNO A;  1B4P A;  6GSV A;  2VCX A;  4XS4 B;  4FIW A;  3ME8 A;  3UEM A;  5F0G A;  4K2D A;  1VF3 A;  4ECJ A;  2YV9 A;  3CRT A;  4N0Z A;  1O7U A;  3HYP A;  3U6V A;  3FR9 A;  3TKR A;  2VAF A;  2AV4 A;  1V58 A;  3LYK A;  2GST A;  4EXJ A;  5IQY A;  1TDI A;  2H1A A;  2IMD A;  1ABA A;  2CQ9 A;  5DVB A;  2VL9 A;  4HDE A;  4DEJ A;  1WOU A;  3WYW A;  2GZP A;  3I43 A;  3MWH A;  3ERG A;  5COH A;  3R3E A;  3APQ A;  3GH9 A;  3LG6 A;  1UC7 A;  5GAP D;  5HR3 A;  4V1A p;  4OFT A;  3KGK A;  1VF1 A;  5HR2 A;  1XVQ A;  3UJ1 A;  1QMV A;  5J9C A;  2WJU A;  4ML6 A;  2WS2 A;  4RQR A;  4EDZ A;  1JZR A;  4HJ2 A;  5IO2 A;  1Q98 A;  3F6D A;  3GIX A;  3GUS A;  2LJK A;  3J7Y b;  1AXD A;  2DIY A;  3A2W A;  4K7O A;  4MZB A;  3UOM A;  1PGT A;  4OO4 A;  1C72 A;  1M0U A;  1OKT A;  1X9W B;  2X8G A;  1EGR A;  3QAV A;  1WIK A;  4TRX A;  2LEG A;  1GTU A;  3UBK A;  1WJK A;  1I9D A;  2L59 A;  2F8A A;  5AGY A;  5E4W A;  4FQU A;  2YCD A;  3M0F A;  3ERF A;  5CO3 A;  2HE3 A;  3D5J A;  3HJM A;  5IPH A;  4V1A g;  3VPT A;  3HVS A;  4MMM A;  4XHM A;  2OBI A;  5CAX A;  1TKD B;  1GSD A;  1KNG A;  4KF9 A;  3D22 A;  2DSA A;  4EE0 A;  3PPU A;  1UA5 A;  1A2L A;  4X0X A;  11GS A;  2K8S A;  4MP4 A;  5IMA A;  2CZ2 A;  5J4U A;  2DJ2 A;  2IWT A;  4DSR A;  2PPT A;  3ERW A;  1SKS B;  1SKR B;  2AAW A;  2LRT A;  3W6G A;  1Y6E A;  4BWS A;  3FW2 A;  2ON5 A;  4EIP A;  3FR3 A;  1GNW A;  1B48 A;  1GUK A;  3KH7 A;  3WGE A;  3D6I A;  4MZW A;  1XXU A;  3MYD A;  1BED A;  2NVL A;  5DJL A;  1QK8 A;  1FOV A;  2O87 A;  3QFA C;  3VPQ A;  4WBR D;  3ZFB A;  4ULX A;  1CQG A;  2KOK A;  2NDO A;  2V32 A;  3ZFL A;  4YKF A;  4G9H A;  3GX8 A;  1Z6M A;  2LJA A;  4GQC A;  5CRD A;  1JZW A;  1WPI A;  2H0H A;  1SK1 A;  4MJB A;  4G0I A;  3QFB C;  2QSI A;  2OA7 A;  2X49 A;  3PR8 A;  2H30 A;  5D73 A;  1KEB A;  2B6M A;  2H73 A;  1YF0 A;  4IP1 A;  4KND A;  2H75 A;  1V2A A;  3QCP A;  1AQW A;  2YWN A;  3APS A;  2CV4 A;  5DBQ A;  3GKM A;  1TP9 A;  1SKW B;  5F06 A;  4CY8 A;  3F6F A;  5B8A A;  5ECR B;  2I4A A;  3WT2 A;  1A0R P;  2GT5 A;  2E2M A;  3HD5 A;  5KN1 A;  1XBS A;  5KN3 A;  3O76 A;  3TGZ A;  1QXH A;  2JAC A;  4O32 A;  2WUL A;  2C1Y A;  4ECC A;  4MPF A;  3GHA A;  2OJL A;  2DJ1 A;  3F8U A;  2LQO A;  5IMC A;  3TKS E;  2BJX A;  3TRX A;  5G1K A;  3PH9 A;  1ML6 A;  4NV2 A;  2R0G A;  3L0H A;  5ECO B;  4ZXG A;  1ERW A;  1HYU A;  1VRS D;  1XCC A;  4WR5 A;  2MMN A;  1MDJ A;  1GSF A;  1EZK A;  20GS A;  2H1G A;  2YJH A;  2YP6 A;  1ILO A;  3EVI A;  1HD2 A;  1GH2 A;  2L6C A;  2C0F A;  3LQ7 A;  1GSE A;  2VLT A;  3CRU A;  2RLI A;  1XZO A;  3O3T A;  2LJR A;  2OAD A;  3M9J A;  1JFU A;  3Q74 A;  1Z5Y E;  4YAP A;  4XCS A;  1TK0 B;  4MF6 A;  1GSY A;  2M80 A;  1R7H A;  2L57 A;  3EIN A;  2EC4 A;  2RM5 A;  2IFQ A;  3R2Q A;  4OCE A;  1BAY A;  2H6Y A;  1TOF A;  3F9U A;  5C00 A;  1H75 A;  2IFQ B;  1VF4 A;  4HEA 2;  4IKH A;  4OWY A;  4FYU A;  3TOT A;  4MLY A;  6GSX A;  1XWC A;  3EPT A;  2F3M A;  4NV5 A;  5HQP A;  1J9B A;  4BA7 A;  2FY6 A;  3QR6 A;  4KCA A;  3P2A A;  4EO3 A;  1YJ6 A;  1TI1 A;  2MMA A;  5BRT A;  2VLV A;  5F05 A;  1OE7 A;  3MDK A;  1PA3 A;  1VF2 A;  4RUV A;  3E0U A;  2WCI A;  1Z7P A;  4ZL9 A;  1X0R A;  3GA4 A;  2M72 A;  4HQS A;  1JLV A;  4WXT A;  5FWG A;  1PMT A;  2MBT A;  1AAZ A;  3KXO A;  5ECQ B;  1F37 A;  3LEF A;  3U5R E;  1O73 A;  4ECB A;  2LNT A;  3C1S A;  2R4V A;  1G6W A;  1DUG A;  4MK3 A;  2A2P A;  5JCG A;  4E8H A;  2L5O A;  4XRD A;  1PKZ A;  2H76 A;  4ACS A;  1B4Q A;  2MMO A;  6GSU A;  2FCH A;  2KP2 A;  1SJ6 A;  4KH7 A;  4NWY A;  3HA9 A;  2P5Q A;  3LFL A;  3PGT A;  1ZGN A;  3LXT A;  2E0Q A;  1GSU A;  2CX3 A;  2KP1 A;  1KBN A;  1K0D A;  2VL2 C;  1UVZ A;  5JWR B;  3I9V 2;  3HJP A;  1LU4 A;  5J9B A;  3ZML A;  5J3R A;  3RPN A;  5D96 A;  2H72 A;  2HLS A;  4I6X A;  2LQQ A;  1EWX A;  2O89 A;  2EIR A;  2HXK A;  3VUR A;  1ZYN A;  2ALB A;  3LW9 A;  4K7N A;  4F0B A;  2LRN A;  3BJ5 A;  3A2X A;  3DD3 A;  1EOG A;  1O8X A;  4JED A;  3IXR A;  3TRP A;  5G30 A;  2VCZ A;  1F2E A;  4AJ6 A;  3AY8 A;  2H66 A;  1RK4 A;  1Q4J A;  3UAP A;  1K3O A;  1ERT A;  2DIZ A;  3KCM A;  4TVE A;  4ZB9 A;  5AIS A;  5DCG A;  3IR4 A;  3F4R A;  1TRW A;  3KTL A;  3EWL A;  2UZ8 A;  3IK7 A;  5DDL A;  5JCW A;  2K6V A;  5LNK e;  1XWK A;  4IVF A;  1SL0 B;  2FLS A;  3LWA A;  3GMF A;  2A4V A;  1SL1 B;  2BMX A;  1XW5 A;  2HYX A;  4ICY A;  3J7Y k;  1ZOF A;  4MAB A;  4BVX A;  5DQY A;  1G7O A;  3TJG A;  4EDY A;  2LTK A;  4D73 B;  4TR4 A;  3MSZ A;  4BVX B;  2HT9 A;  4MJC A;  3M1G A;  3HCZ A;  3TCO A;  4LL1 B;  3RPP A;  2GQM A;  5G5F A;  2FA4 A;  2B5Y A;  3TJB A;  3IOS A;  4E8E A;  2FHE A;  2H0G A;  1EV4 A;  1U87 A;  5EVO A;  4F9Z A;  3FK8 A;  2M46 A;  1EEM A;  4WR4 A;  4ID0 A;  1K3Y A;  1O8W A;  3GFK A;  5IOX A;  5EL8 A;  4AJ8 A;  3VWX A;  4AGS A;  3WGX A;  1OVN A;  4QL9 A;  3DKS A;  5ELG A;  4ZIL A;  2HRN A;  4PNF A;  4K9Z A;  4CY6 A;  2MMZ A;  1URM A;  1TRU A;  1GP1 A;  1GUM A;  19GS A;  1QGV A;  3BD2 A;  3F3R A;  1M3J A;  5F8B A;  1DE1 A;  3F4S A;  3IRA A;  2P31 A;  3HJO A;  3Q18 A;  5C04 A;  1WP0 A;  2CVD A;  2DJ3 A;  3DWV A;  2DBC A;  1V9W A;  2OBK A;  4WET A;  4KGI A;  5INY A;  2DMM A;  3FHK A;  2JSZ A;  2H19 A;  4KE3 A;  4EC0 A;  1QUW A;  2FWF A;  4J56 E;  2IMK A;  5G31 A;  5D9W A;  4PNG A;  3TB2 A;  4ISD A;  4KCE A;  3HZ8 A;  2VM1 A;  1O85 A;  4IGJ A;  3VFI A;  3IA1 A;  4MNN A;  4BL7 A;  3DXB A;  1O81 A;  2KUC A;  1EGO A;  1THX A;  3GUR A;  4KUN A;  4BL7 B;  1OE8 A;  3TRQ A;  3NOF A;  4QQ7 A;  4GSN A;  5D9X A;  2JZS A;  4I5Q A;  3KZQ A;  4KSM A;  2VCV A;  1F9M A;  4K8M A;  3RBT A;  3RHB A;  3CSJ A;  4XIH A;  1TTZ A;  1GUH A;  3HVX A;  3H8Q A;  2QC7 A;  2J9H A;  1PX6 A;  2DKI A;  2H6Z A;  4YQV A;  3H93 A;  1T00 A;  1SJI A;  3NIV A;  2MBS A;  3GSS A;  2X8C A;  4HU9 A;  3TKS A;  5ECP B;  4H86 A;  4TN8 A;  3SBC A;  4MH2 A;  2H1D A;  2VL2 A;  5GST A;  4XTS A;  4L0U A;  5IIZ A;  3QAW A;  3DRN A;  8GSS A;  3IHG A;  3V1W A;  4K1F A;  2N5F A;  2RUE A;  4IBP A;  4KA0 A;  1YQ1 A;  5AIV A;  4IJI A;  3DML A;  1AQV A;  1T3B A;  5ID2 A;  2HFD A;  2PER A;  5B7C A;  3S9F A;  5ID2 B;  3C8E A;  1SYR A;  3GKN A;  4MA9 A;  4DSQ A;  3SWL A;  1YDK A;  1R5A A;  2QGV A;  3IC4 A;  4IW9 A;  3DGQ A;  3LYP A;  1V98 A;  2ES7 A;  3D4M A;  2XBI A;  3UL3 A;  1T1V A;  3IK9 A;  3LGC A;  4L0W A;  2R3X A;  1ZCP A;  2K8V A;  4Z2U A;  3VWW A;  3W8J A;  4MZC A;  4ZBB A;  3P90 A;  3EU3 A;  3VI5 A;  2AYT A;  2IIY A;  2P0G A;  2CAI A;  5D9V A;  4WEY A;  4Q5N A;  2VD0 A;  2B5X A;  5JWQ B;  2KHP A;  2C0D A;  4K6X A;  1B9Y C;  4TR0 A;  1TJD A;  2BTO T;  3UMA A;  2YJ7 A;  1AUC A;  1K0N A;  1PQN A;  1ST9 A;  2IJY A;  3M3M A;  1PN0 A;  1BYE A;  2I1U A;  2GQL A;  1ON4 A;  6GSW A;  1M3I A;  1V40 A;  2AB6 A;  4MJE A;  2GDR A;  1ERU A;  3L78 A;  4X43 A;  1XFL A;  1G7E A;  3HVN A;  1E2Y A;  4NPB A;  1GRX A;  4POK A;  3H79 A;  1PX7 A;  1GL8 A;  4IQA A;  3K8N A;  3GH6 A;  4TW5 A;  5G2Z A;  12GS A;  2X99 A;  2YWI A;  3IE3 A;  2ZCT A;  4GTU A;  1PD2 1;  1Z7R A;  4POB A;  5IMZ A;  3KP8 A;  1B9X C;  3GL3 A;  5IM9 A;  4WBJ A;  1T8E B;  2H6X A;  1EV9 A;  3ZVJ A;  5IPG A;  1AW9 A;  1GTB A;  3A2V A;  2HI7 A;  1A24 A;  4HS1 A;  2JU5 A;  3F3Q A;  5DQS A;  2PWJ A;  2X8H A;  5GSS A;  1F3B A;  3ZMK A;  2GLR A;  2YN1 A;  1N2A A;  3VWU A;  4JR6 A;  2TRC P;  2LRC A;  4ZIJ A;  1S3C A;  2GS3 A;  1M7T A;  5HFI A;  1M99 A;  2OE3 A;  4PUF C;  4YKG A;  2A2S A;  3OR5 A;  3GYK A;  3IPZ A;  5JWO B;  1GNE A;  3FYG A;  1PSQ A;  4TR1 A;  5ABR A;  3FZ9 A;  5CRE A;  4G0L A;  1JHB A;  1K0C A;  3M8N A;  1NHO A;  1XWG A;  4TR1 B;  2YPM A;  5HFG A;  3HHV A;  2PN8 A;  4FYC A;  4TXO A;  3KIJ A;  1GSQ A;  4TXO B;  2L6D A;  1V57 A;  4G2E A;  1GWC A;  1FVK A;  2VOC A;  3GTU A;  2C0E A;  3WD6 A;  3ED3 A;  2PGT A;  2V6K A;  3KMO A;  3GTU B;  2N5A A;  4FYB A;  1H4O A;  1EEJ A;  3FZA A;  4K0G A;  1J08 A;  2JAD A;  3FR6 A;  1NW2 A;  1EP7 A;  3BCI A;  2TIR A;  2YNX A;  3WGD A;  2AUV A;  1SL2 B;  4F2I A;  1GLQ A;  1YKC A;  1G0T A;  1F3A A;  1S3A A;  2HSY A;  5KN0 A;  1HNC A;  1A8Y A;  2YWO A;  1XWA A;  3BOA A;  3VI7 A;  1YF1 A;  4KB3 A;  3IBH A;  4V2N A;  2IPA A;  3TKP A;  4PQ1 A;  2F8F A;  1TK5 B;  3FRC A;  2V6O A;  1K0O A;  4KSO A;  1OYJ A;  3ZTL A;  4JE1 A;  4XS6 A;  1U3A A;  3ISO A;  4TXV A;  5B8B A;  2NTO A;  3MAK A;  5KOX A;  5FT3 A;  5H5Q A;  1AC1 A;  4NHW A;  1VGL A;  3A5I A;  3TUE A;  3UVT A;  2QKE A;  2XC2 A;  5H5R A;  3E3E A;  4GRF A;  2H0I A;  5F07 A;  2O85 A;  17GS A;  4F03 A;  4BWQ A;  1XPV A;  1FOH A;  4OD7 A;  4F82 A;  2OE1 A;  5A4W A;  3LSZ A;  3GL5 A;  2N5B A;  1SU9 A;  2GSQ A;  3TKS C;  2GT6 A;  1Z3E A;  2R0C A;  3HKR A;  2QA2 A;  2LST A;  4GQF A;  2YAN A;  1R4W A;  4NMU A;  4CHS A;  3LJR A;  4TR3 A;  3ZIJ A;  2VM2 A;  4I2T A;  2L4C A;  2E7P A;  4O92 A;  3GRX A;  4IN0 A;  2C3N A;  4L5O A;  4MH3 A;  5DAL B;  2FUG 2;  4X1U A;  3H4K A;  5EPF A;  1ZZY A;  2HZE A;  2DKH A;  4Z2R A;  1S3D A;  1TXX A;  4K5R A;  4ZL8 A;  3DVW A;  3FMW A;  3VLN A;  2HZE B;  3EE2 A;  4QL7 A;  4PX1 A;  3ZIT A;  4Z7X A;  1EOH A;  1GTI A;  1FB6 A;  1M9A A;  3M9K A;  4HU7 A;  2QA1 A;  4HZ2 A;  3DIE A;  1ZMA A;  1ZL9 A;  4K0N A;  3LOR A;  4USS A;  2B1L A;  2C80 A;  2OAC A;  4I2U A;  3ZL5 A;  2DLX A;  3L9V A;  2RM6 A;  5ECI B;  1OAZ A;  1DBY A;  4OO5 A;  2GTU A;  1K0A A;  4FH8 A;  4OFM A;  2HZF A;  4MCU A;  1ERV A;  4O5R A;  5ELA A;  4D73 A;  2NBS A;  2R2J A;  5H5S A;  3QPM A;  2VO4 A;  2OKA A;  3HY2 A;  5CYY A;  3ZZX A;  4AF2 A;  1LJR A;  4RI7 A;  1TK8 B;  2G0F A;  4OMV A;  4EKZ A;  3QD9 A;  3RDW A;  2IME A;  2XBQ A;  4EF0 A;  2V1M A;  2FWG A;  4I97 A;  1ACV A;  2H8L A;  5IMF A;  4KW6 A;  4CDO A;  2CT6 A;  1OC8 A;  2B5E A;  2DJ0 A;  2VCQ A;  4LLR A;  2F9S A;  1TI3 A;  2RUF A;  3GNJ A;  4N30 A;  2KLX A;  2HSM A;  4TOP A;  2VUP A;  1XWB A;  3IAS 2;  3N5O A;  3DEX A;  4MF7 A;  3HZ4 A;  2JL4 A;  5ECN B;  10GS A;  3E9J B;  3D4T A;  1X5D A;  1A2J A;  2AJQ B;  3FY7 A;  1M9B A;  5IMV A;  5DJM A;  2WB9 A;  2C0G A;  1W4V A;  4OCF A;  1YZX A;  2WDU A;  2G2Q A;  4HOJ A;  1JLW A;  5FHI A;  1ZYQ B;  1BX9 A; 
#chains in the Genus database with same CATH homology
 3FEU A;  2B7J A;  1SK0 A;  5ECM B;  3APO A;  4PQI A;  4N11 A;  2ON7 A;  3RAZ A;  3A5W A;  5B6N A;  4O5U A;  5CP1 A;  4NXI A;  2YWM A;  1YEX A;  2X64 A;  1XW9 A;  4HQZ A;  1BQ7 A;  3CBU A;  2PMT A;  3CTF A;  4O7H A;  9GSS A;  2WGR A;  1SEN A;  1SYX A;  2CZ3 A;  1YKA A;  4JR4 A;  1THO A;  5EY6 A;  2YZH A;  2WZ9 A;  4ILF A;  2H70 A;  4J57 E;  4RI6 A;  4ECI A;  1TU8 A;  1FVJ A;  2R6K A;  2PVO C;  4IHU A;  2WFC A;  2IN3 A;  2GZZ A;  2GZY A;  2IMF A;  1WWJ A;  2LKU A;  2H1B A;  4F0C A;  1BG5 A;  1A0F A;  2H74 A;  1FO5 A;  2A4H A;  2VCT A;  1USB A;  4GWR A;  1Z9H A;  1JZD A;  4IEL A;  3VWV A;  5HR0 A;  1HNB A;  4CW9 A;  3LXZ A;  4V2M A;  4V2L A;  4GLT A;  2DJJ A;  5DAK A;  5CNW A;  4RQX A;  1QQ2 A;  1YY7 A;  1A23 A;  1XIY A;  2HSH A;  5DAK B;  4LA1 A;  5ECS A;  3CYN A;  4ZB6 A;  2FWH A;  1TU7 A;  2NPB A;  3G7I A;  2DJK A;  3GKK A;  1AIU A;  2A2R A;  2VD1 A;  1E6B A;  2B1K A;  2R5G A;  4PXO A;  2ZNM A;  5J5N A;  2XPD A;  2X4A A;  4IS0 A;  2IL3 A;  2VLU A;  3BCK A;  3IHQ A;  4I8B A;  4WF5 A;  1K3L A;  5GZZ B;  2CA8 A;  4JBB A;  4NAX A;  1GSS A;  4K5S A;  18GS A;  4EIQ A;  2C8U A;  1TRV A;  4HZ4 A;  2K9F A;  1TRS A;  1K0B A;  2HRA A;  4HI7 A;  4LMW A;  1HNA A;  2GGT A;  1NSW A;  4GF0 A;  2EIQ A;  1XVW A;  4GCI A;  3L4N A;  4KDX A;  2F51 A;  5AN1 A;  5HFK A;  5KEJ A;  6GST A;  3KTB A;  3P7X A;  3I6A A;  2H01 A;  4ZBA A;  1TW9 A;  2CAQ A;  2GQK A;  3WT1 A;  4ZB8 A;  1IYH A;  2HRK A;  3N9J A;  5G1L A;  4G0K A;  4PQH A;  1PRX A;  3VK9 A;  1SK2 A;  3ME7 A;  3CMI A;  1XOA A;  2DML A;  5CRG A;  1Y25 A;  2GVP A;  2IMI A;  3ZIV A;  5BMU A;  1Z6N A;  1O6J A;  14GS A;  2RII A;  3BBY A;  1DSB A;  3G9B A;  4KDU A;  1RQM A;  3L9U A;  22GS A;  1IYI A;  2HNL A;  1FB0 A;  3EMP A;  16GS A;  1B8X A;  1HQO A;  3ZRE A;  2PVQ A;  3TOU A;  4POL A;  4IJ3 A;  1M2B A;  2PU9 C;  3PIN A;  4A5P A;  7GSS A;  1WE0 A;  3UIW A;  2XPE A;  3UVH A;  6GSY A;  1NHY A;  3QMX A;  5D8I A;  2LV3 A;  1XOB A;  4MJA A;  3HVV A;  2PUK C;  1SD8 A;  1G6Y A;  1PKW A;  2XHF A;  1U88 A;  3EU4 A;  3F0I A;  2D2Z A;  2O7K A;  1AQX A;  5IOW A;  3C7M A;  1FHE A;  4WF4 A;  4XRA A;  4PUR A;  1M2A A;  4LL4 B;  1JZO A;  1LBK A;  3QOU A;  2C3T A;  1GLP A;  3KEB A;  4YAV A;  4G10 A;  5HR1 A;  4K2X A;  1FAA A;  2AHE A;  4EVM A;  3TJJ A;  5A5K A;  4X4J A;  2PBJ A;  3ZRD A;  1MTC A;  2VIM A;  3G7J A;  1GUL A;  2JZT A;  2Z9S A;  2DC5 A;  3D21 A;  3MNG A;  2ZUP A;  4Q5R A;  1T4Y A;  5ECK B;  1N8J A;  2HRF A;  2FWE A;  4GSS A;  4J2F A;  5A4U A;  3UBL A;  1ZYP A;  1R26 A;  3IC8 A;  4ML1 A;  5GAN D;  3TJF A;  3GV1 A;  2YV7 A;  1WRY A;  4GST A;  1MEK A;  3P8W A;  4WKW A;  5B6M A;  3GKX A;  1X5C A;  3C71 A;  1XW6 A;  4HJM A;  13GS A;  2LUS A;  5LD0 A;  1R5P A;  3CTG A;  4Q5Q A;  1QFN A;  2MYG A;  3EMX A;  4Q5F A;  3ZVJ D;  4GXZ A;  3IAM 2;  1RW1 A;  3TDG A;  2K18 A;  1FW1 A;  2H71 A;  1MDI A;  2B7K A;  5ECL B;  3F4T A;  3JCM L;  3H1N A;  3FKF A;  2B3S A;  5L71 A;  3O6T A;  3US3 A;  5IO0 A;  5IMD A;  3CSH A;  2JSY A;  4MDC A;  3W8S A;  3KMN A;  5JCU A;  1OC9 A;  4L8E A;  1PL1 A;  3IDV A;  4LMV A;  2E2G A;  3CSI A;  3NZN A;  4L5L A;  1OC9 B;  3RHC A;  4Z2T A;  3EC3 A;  3MIX A;  2EIO A;  1OKD A;  3KD0 A;  1F6M C;  4KDY A;  1PN9 A;  1M2D A;  5AIX A;  4YQM A;  3C1R A;  5D93 A;  2FD3 A;  1DE2 A;  2I81 A;  5DAL A;  2I9H A;  1EP8 A;  1OC3 A;  1A8L A;  4JU5 A;  2V41 A;  2GSR A;  2WRT A;  4O5Q A;  1A2M A;  2LS5 A;  1I5G A;  2FGX A;  4KAE A;  2LNS A;  1SD9 A;  4PTS A;  4G19 A;  4HUA A;  2REM A;  2CVK A;  4PUA A;  1MD3 A;  4N0V A;  4POM A;  1W89 A;  3Q19 A;  1X5E A;  2CX4 A;  1KTE A;  1NM3 A;  3HDC A;  2L5L A;  5ECH B;  5G5E A;  3HXS A;  4TKY A;  1K0M A;  1PL2 A;  4JZQ A;  3FZ4 A;  4DSS A;  3CXG A;  3TKQ A;  1SJZ A;  2V2G A;  4XS1 A;  4NHZ A;  3D0Z A;  4DSS B;  2JZR A;  2I3Y A;  5E59 A;  3ZLP A;  2OE0 A;  4IQ1 A;  1ZYE A;  2C4J A;  4IP6 A;  3QDN A;  1U3I A;  1BJX A;  4P3Y B;  2P5R A;  2FA8 A;  4PGT A;  3GST A;  1UN2 A;  3G7Y A;  4MF5 A;  3QAG A;  4YQU A;  4K7I A;  5A4V A;  2L4Q A;  3TJK A;  5ENU A;  4FO5 A;  4DVC A;  3DVX A;  5D9T A;  5KN2 A;  4MPG A;  1T7P B;  5LCZ A;  2YOI A;  4ZBD A;  1X9S B;  5CRW A;  4AJ7 A;  4BVY A;  3KM6 A;  3ZYW A;  2O8V B;  4BVY B;  2J23 A;  2R0P A;  4N10 A;  2MZC A;  2VCW A;  4EL1 A;  4ZL7 A;  3KJY A;  5KOW A;  2VL3 A;  2R37 A;  4BPY A;  1CQH A;  2GSS A;  1GTA A;  3F63 A;  4YH2 A;  3Q6O A;  3EUR A;  5DCH A;  3C73 A;  4KX4 A;  1YEP A;  4OFN A;  2CVB A;  1WMJ A;  3UAR A;  1MD4 A;  2C3Q A;  1X9M B;  3EYT A;  3L9S A;  3GX0 A;  4JRR A;  1T4Z A;  3IV4 A;  4EUY A;  1FG4 A;  3GN3 A;  2YZU A;  6GSS A;  3FZ5 A;  3DYR A;  1J0F A;  3KP9 A;  3KH9 A;  1U6T A;  4XS4 A;  5CRH A;  3I69 A;  2TRX A;  3A3T A;  5J41 A;  1MDK A;  2FNO A;  1B4P A;  6GSV A;  2VCX A;  4XS4 B;  4FIW A;  3ME8 A;  3UEM A;  5F0G A;  4K2D A;  1VF3 A;  4ECJ A;  2YV9 A;  3CRT A;  4N0Z A;  1O7U A;  3HYP A;  3U6V A;  3FR9 A;  3TKR A;  2VAF A;  2AV4 A;  1V58 A;  3LYK A;  2GST A;  4EXJ A;  5IQY A;  1TDI A;  2H1A A;  2IMD A;  1ABA A;  2CQ9 A;  5DVB A;  2VL9 A;  4HDE A;  4DEJ A;  1WOU A;  3WYW A;  2GZP A;  3I43 A;  3MWH A;  3ERG A;  5COH A;  3R3E A;  3APQ A;  3GH9 A;  3LG6 A;  1UC7 A;  5GAP D;  5HR3 A;  4V1A p;  4OFT A;  3KGK A;  1VF1 A;  5HR2 A;  1XVQ A;  3UJ1 A;  1QMV A;  5J9C A;  2WJU A;  4ML6 A;  2WS2 A;  4RQR A;  4EDZ A;  1JZR A;  4HJ2 A;  5IO2 A;  1Q98 A;  3F6D A;  3GIX A;  3GUS A;  2LJK A;  3J7Y b;  1AXD A;  2DIY A;  3A2W A;  4K7O A;  4MZB A;  3UOM A;  1PGT A;  4OO4 A;  1C72 A;  1M0U A;  1OKT A;  1X9W B;  2X8G A;  1EGR A;  3QAV A;  1WIK A;  4TRX A;  2LEG A;  1GTU A;  3UBK A;  1WJK A;  1I9D A;  2L59 A;  2F8A A;  5AGY A;  5E4W A;  4FQU A;  2YCD A;  3M0F A;  3ERF A;  5CO3 A;  2HE3 A;  3D5J A;  3HJM A;  5IPH A;  4V1A g;  3VPT A;  3HVS A;  4MMM A;  4XHM A;  2OBI A;  5CAX A;  1TKD B;  1GSD A;  1KNG A;  4KF9 A;  3D22 A;  2DSA A;  4EE0 A;  3PPU A;  1UA5 A;  1A2L A;  4X0X A;  11GS A;  2K8S A;  4MP4 A;  5IMA A;  2CZ2 A;  5J4U A;  2DJ2 A;  2IWT A;  4DSR A;  2PPT A;  3ERW A;  1SKS B;  1SKR B;  2AAW A;  2LRT A;  3W6G A;  1Y6E A;  4BWS A;  3FW2 A;  2ON5 A;  4EIP A;  3FR3 A;  1GNW A;  1B48 A;  1GUK A;  3KH7 A;  3WGE A;  3D6I A;  4MZW A;  1XXU A;  3MYD A;  1BED A;  2NVL A;  5DJL A;  1QK8 A;  1FOV A;  2O87 A;  3QFA C;  3VPQ A;  4WBR D;  3ZFB A;  4ULX A;  1CQG A;  2KOK A;  2NDO A;  2V32 A;  3ZFL A;  4YKF A;  4G9H A;  3GX8 A;  1Z6M A;  2LJA A;  4GQC A;  5CRD A;  1JZW A;  1WPI A;  2H0H A;  1SK1 A;  4MJB A;  4G0I A;  3QFB C;  2QSI A;  2OA7 A;  2X49 A;  3PR8 A;  2H30 A;  5D73 A;  1KEB A;  2B6M A;  2H73 A;  1YF0 A;  4IP1 A;  4KND A;  2H75 A;  1V2A A;  3QCP A;  1AQW A;  2YWN A;  3APS A;  2CV4 A;  5DBQ A;  3GKM A;  1TP9 A;  1SKW B;  5F06 A;  4CY8 A;  3F6F A;  5B8A A;  5ECR B;  2I4A A;  3WT2 A;  1A0R P;  2GT5 A;  2E2M A;  3HD5 A;  5KN1 A;  1XBS A;  5KN3 A;  3O76 A;  3TGZ A;  1QXH A;  2JAC A;  4O32 A;  2WUL A;  2C1Y A;  4ECC A;  4MPF A;  3GHA A;  2OJL A;  2DJ1 A;  3F8U A;  2LQO A;  5IMC A;  3TKS E;  2BJX A;  3TRX A;  5G1K A;  3PH9 A;  1ML6 A;  4NV2 A;  2R0G A;  3L0H A;  5ECO B;  4ZXG A;  1ERW A;  1HYU A;  1VRS D;  1XCC A;  4WR5 A;  2MMN A;  1MDJ A;  1GSF A;  1EZK A;  20GS A;  2H1G A;  2YJH A;  2YP6 A;  1ILO A;  3EVI A;  1HD2 A;  1GH2 A;  2L6C A;  2C0F A;  3LQ7 A;  1GSE A;  2VLT A;  3CRU A;  2RLI A;  1XZO A;  3O3T A;  2LJR A;  2OAD A;  3M9J A;  1JFU A;  3Q74 A;  1Z5Y E;  4YAP A;  4XCS A;  1TK0 B;  4MF6 A;  1GSY A;  2M80 A;  1R7H A;  2L57 A;  3EIN A;  2EC4 A;  2RM5 A;  2IFQ A;  3R2Q A;  4OCE A;  1BAY A;  2H6Y A;  1TOF A;  3F9U A;  5C00 A;  1H75 A;  2IFQ B;  1VF4 A;  4HEA 2;  4IKH A;  4OWY A;  4FYU A;  3TOT A;  4MLY A;  6GSX A;  1XWC A;  3EPT A;  2F3M A;  4NV5 A;  5HQP A;  1J9B A;  4BA7 A;  2FY6 A;  3QR6 A;  4KCA A;  3P2A A;  4EO3 A;  1YJ6 A;  1TI1 A;  2MMA A;  5BRT A;  2VLV A;  5F05 A;  1OE7 A;  3MDK A;  1PA3 A;  1VF2 A;  4RUV A;  3E0U A;  2WCI A;  1Z7P A;  4ZL9 A;  1X0R A;  3GA4 A;  2M72 A;  4HQS A;  1JLV A;  4WXT A;  5FWG A;  1PMT A;  2MBT A;  1AAZ A;  3KXO A;  5ECQ B;  1F37 A;  3LEF A;  3U5R E;  1O73 A;  4ECB A;  2LNT A;  3C1S A;  2R4V A;  1G6W A;  1DUG A;  4MK3 A;  2A2P A;  5JCG A;  4E8H A;  2L5O A;  4XRD A;  1PKZ A;  2H76 A;  4ACS A;  1B4Q A;  2MMO A;  6GSU A;  2FCH A;  2KP2 A;  1SJ6 A;  4KH7 A;  4NWY A;  3HA9 A;  2P5Q A;  3LFL A;  3PGT A;  1ZGN A;  3LXT A;  2E0Q A;  1GSU A;  2CX3 A;  2KP1 A;  1KBN A;  1K0D A;  2VL2 C;  1UVZ A;  5JWR B;  3I9V 2;  3HJP A;  1LU4 A;  5J9B A;  3ZML A;  5J3R A;  3RPN A;  5D96 A;  2H72 A;  2HLS A;  4I6X A;  2LQQ A;  1EWX A;  2O89 A;  2EIR A;  2HXK A;  3VUR A;  1ZYN A;  2ALB A;  3LW9 A;  4K7N A;  4F0B A;  2LRN A;  3BJ5 A;  3A2X A;  3DD3 A;  1EOG A;  1O8X A;  4JED A;  3IXR A;  3TRP A;  5G30 A;  2VCZ A;  1F2E A;  4AJ6 A;  3AY8 A;  2H66 A;  1RK4 A;  1Q4J A;  3UAP A;  1K3O A;  1ERT A;  2DIZ A;  3KCM A;  4TVE A;  4ZB9 A;  5AIS A;  5DCG A;  3IR4 A;  3F4R A;  1TRW A;  3KTL A;  3EWL A;  2UZ8 A;  3IK7 A;  5DDL A;  5JCW A;  2K6V A;  5LNK e;  1XWK A;  4IVF A;  1SL0 B;  2FLS A;  3LWA A;  3GMF A;  2A4V A;  1SL1 B;  2BMX A;  1XW5 A;  2HYX A;  4ICY A;  3J7Y k;  1ZOF A;  4MAB A;  4BVX A;  5DQY A;  1G7O A;  3TJG A;  4EDY A;  2LTK A;  4D73 B;  4TR4 A;  3MSZ A;  4BVX B;  2HT9 A;  4MJC A;  3M1G A;  3HCZ A;  3TCO A;  4LL1 B;  3RPP A;  2GQM A;  5G5F A;  2FA4 A;  2B5Y A;  3TJB A;  3IOS A;  4E8E A;  2FHE A;  2H0G A;  1EV4 A;  1U87 A;  5EVO A;  4F9Z A;  3FK8 A;  2M46 A;  1EEM A;  4WR4 A;  4ID0 A;  1K3Y A;  1O8W A;  3GFK A;  5IOX A;  5EL8 A;  4AJ8 A;  3VWX A;  4AGS A;  3WGX A;  1OVN A;  4QL9 A;  3DKS A;  5ELG A;  4ZIL A;  2HRN A;  4PNF A;  4K9Z A;  4CY6 A;  2MMZ A;  1URM A;  1TRU A;  1GP1 A;  1GUM A;  19GS A;  1QGV A;  3BD2 A;  3F3R A;  5F8B A;  1DE1 A;  3F4S A;  3IRA A;  2P31 A;  3HJO A;  3Q18 A;  5C04 A;  1WP0 A;  2CVD A;  2DJ3 A;  3DWV A;  2DBC A;  1V9W A;  2OBK A;  4WET A;  4KGI A;  5INY A;  2DMM A;  3FHK A;  2JSZ A;  2H19 A;  4KE3 A;  4EC0 A;  1QUW A;  2FWF A;  4J56 E;  2IMK A;  5G31 A;  5D9W A;  4PNG A;  3TB2 A;  4ISD A;  4KCE A;  3HZ8 A;  2VM1 A;  1O85 A;  4IGJ A;  3VFI A;  3IA1 A;  4MNN A;  4BL7 A;  3DXB A;  1O81 A;  2KUC A;  1EGO A;  1THX A;  3GUR A;  4KUN A;  4BL7 B;  1OE8 A;  3TRQ A;  3NOF A;  4QQ7 A;  4GSN A;  5D9X A;  2JZS A;  4I5Q A;  3KZQ A;  4KSM A;  2VCV A;  1F9M A;  4K8M A;  3RBT A;  3RHB A;  3CSJ A;  4XIH A;  1TTZ A;  1GUH A;  3HVX A;  3H8Q A;  2QC7 A;  2J9H A;  1PX6 A;  2DKI A;  2H6Z A;  4YQV A;  3H93 A;  1T00 A;  1SJI A;  3NIV A;  2MBS A;  3GSS A;  2X8C A;  4HU9 A;  3TKS A;  5ECP B;  4H86 A;  4TN8 A;  3SBC A;  4MH2 A;  2H1D A;  2VL2 A;  5GST A;  4XTS A;  4L0U A;  5IIZ A;  3QAW A;  3DRN A;  8GSS A;  3IHG A;  3V1W A;  4K1F A;  2N5F A;  2RUE A;  4IBP A;  4KA0 A;  1YQ1 A;  5AIV A;  4IJI A;  3DML A;  1AQV A;  1T3B A;  5ID2 A;  2HFD A;  2PER A;  5B7C A;  3S9F A;  5ID2 B;  3C8E A;  1SYR A;  3GKN A;  4MA9 A;  4DSQ A;  3SWL A;  1YDK A;  1R5A A;  2QGV A;  3IC4 A;  4IW9 A;  3DGQ A;  3LYP A;  1V98 A;  2ES7 A;  3D4M A;  2XBI A;  3UL3 A;  1T1V A;  3IK9 A;  3LGC A;  4L0W A;  2R3X A;  1ZCP A;  2K8V A;  4Z2U A;  3VWW A;  3W8J A;  4MZC A;  4ZBB A;  3P90 A;  3EU3 A;  3VI5 A;  2AYT A;  2IIY A;  2P0G A;  2CAI A;  5D9V A;  4WEY A;  4Q5N A;  2VD0 A;  2B5X A;  5JWQ B;  2KHP A;  2C0D A;  4K6X A;  1B9Y C;  4TR0 A;  1TJD A;  2BTO T;  3UMA A;  2YJ7 A;  1AUC A;  1K0N A;  1PQN A;  1ST9 A;  2IJY A;  3M3M A;  1PN0 A;  1BYE A;  2I1U A;  2GQL A;  1ON4 A;  6GSW A;  1V40 A;  2AB6 A;  4MJE A;  2GDR A;  1ERU A;  3L78 A;  4X43 A;  1XFL A;  1G7E A;  1E2Y A;  4NPB A;  1GRX A;  4POK A;  3H79 A;  1PX7 A;  1GL8 A;  4IQA A;  3K8N A;  3GH6 A;  4TW5 A;  5G2Z A;  12GS A;  2X99 A;  2YWI A;  3IE3 A;  2ZCT A;  4GTU A;  1PD2 1;  1Z7R A;  4POB A;  5IMZ A;  3KP8 A;  1B9X C;  3GL3 A;  5IM9 A;  4WBJ A;  1T8E B;  2H6X A;  1EV9 A;  3ZVJ A;  5IPG A;  1AW9 A;  1GTB A;  3A2V A;  2HI7 A;  1A24 A;  4HS1 A;  2JU5 A;  3F3Q A;  5DQS A;  2PWJ A;  2X8H A;  5GSS A;  1F3B A;  3ZMK A;  2GLR A;  2YN1 A;  1N2A A;  3VWU A;  4JR6 A;  2TRC P;  2LRC A;  4ZIJ A;  1S3C A;  2GS3 A;  1M7T A;  5HFI A;  1M99 A;  2OE3 A;  4PUF C;  4YKG A;  2A2S A;  3OR5 A;  3GYK A;  3IPZ A;  5JWO B;  1GNE A;  3FYG A;  1PSQ A;  4TR1 A;  5ABR A;  3FZ9 A;  5CRE A;  4G0L A;  1JHB A;  1K0C A;  3M8N A;  1NHO A;  1XWG A;  4TR1 B;  2YPM A;  5HFG A;  3HHV A;  2PN8 A;  4FYC A;  4TXO A;  3KIJ A;  1GSQ A;  4TXO B;  2L6D A;  1V57 A;  4G2E A;  1GWC A;  1FVK A;  2VOC A;  3GTU A;  2C0E A;  3WD6 A;  3ED3 A;  2PGT A;  2V6K A;  3KMO A;  3GTU B;  2N5A A;  4FYB A;  1H4O A;  1EEJ A;  3FZA A;  4K0G A;  1J08 A;  2JAD A;  3FR6 A;  1NW2 A;  1EP7 A;  3BCI A;  2TIR A;  2YNX A;  3WGD A;  2AUV A;  1SL2 B;  4F2I A;  1GLQ A;  1YKC A;  1G0T A;  1F3A A;  1S3A A;  2HSY A;  5KN0 A;  1HNC A;  1A8Y A;  2YWO A;  1XWA A;  3BOA A;  3VI7 A;  1YF1 A;  4KB3 A;  3IBH A;  4V2N A;  2IPA A;  3TKP A;  4PQ1 A;  2F8F A;  1TK5 B;  3FRC A;  2V6O A;  1K0O A;  4KSO A;  1OYJ A;  3ZTL A;  4JE1 A;  4XS6 A;  1U3A A;  3ISO A;  4TXV A;  5B8B A;  2NTO A;  3MAK A;  5KOX A;  5FT3 A;  5H5Q A;  1AC1 A;  4NHW A;  1VGL A;  3A5I A;  3TUE A;  3UVT A;  2QKE A;  2XC2 A;  5H5R A;  3E3E A;  4GRF A;  2H0I A;  5F07 A;  2O85 A;  17GS A;  4F03 A;  4BWQ A;  1XPV A;  1FOH A;  4OD7 A;  4F82 A;  2OE1 A;  5A4W A;  3LSZ A;  3GL5 A;  2N5B A;  1SU9 A;  2GSQ A;  3TKS C;  2GT6 A;  1Z3E A;  2R0C A;  3HKR A;  2QA2 A;  2LST A;  4GQF A;  2YAN A;  1R4W A;  4NMU A;  4CHS A;  3LJR A;  4TR3 A;  3ZIJ A;  2VM2 A;  4I2T A;  2L4C A;  2E7P A;  4O92 A;  3GRX A;  4IN0 A;  2C3N A;  4L5O A;  4MH3 A;  5DAL B;  2FUG 2;  4X1U A;  3H4K A;  5EPF A;  1ZZY A;  2HZE A;  2DKH A;  4Z2R A;  1S3D A;  1TXX A;  4K5R A;  4ZL8 A;  3DVW A;  3FMW A;  3VLN A;  2HZE B;  3EE2 A;  4QL7 A;  4PX1 A;  3ZIT A;  4Z7X A;  1EOH A;  1GTI A;  1FB6 A;  1M9A A;  3M9K A;  4HU7 A;  2QA1 A;  4HZ2 A;  3DIE A;  1ZMA A;  1ZL9 A;  4K0N A;  3LOR A;  4USS A;  2B1L A;  2C80 A;  2OAC A;  4I2U A;  3ZL5 A;  2DLX A;  3L9V A;  2RM6 A;  5ECI B;  1OAZ A;  1DBY A;  4OO5 A;  2GTU A;  1K0A A;  4FH8 A;  4OFM A;  2HZF A;  4MCU A;  1ERV A;  4O5R A;  5ELA A;  4D73 A;  2NBS A;  2R2J A;  5H5S A;  3QPM A;  2VO4 A;  2OKA A;  3HY2 A;  5CYY A;  3ZZX A;  4AF2 A;  1LJR A;  4RI7 A;  1TK8 B;  2G0F A;  4OMV A;  4EKZ A;  3QD9 A;  3RDW A;  2IME A;  2XBQ A;  4EF0 A;  2V1M A;  2FWG A;  4I97 A;  1ACV A;  2H8L A;  5IMF A;  4KW6 A;  4CDO A;  2CT6 A;  1OC8 A;  2B5E A;  2DJ0 A;  2VCQ A;  4LLR A;  2F9S A;  1TI3 A;  2RUF A;  3GNJ A;  4N30 A;  2KLX A;  2HSM A;  4TOP A;  2VUP A;  1XWB A;  3IAS 2;  3N5O A;  3DEX A;  4MF7 A;  3HZ4 A;  2JL4 A;  5ECN B;  10GS A;  3E9J B;  3D4T A;  1X5D A;  1A2J A;  2AJQ B;  3FY7 A;  1M9B A;  5IMV A;  5DJM A;  2WB9 A;  2C0G A;  1W4V A;  4OCF A;  1YZX A;  2WDU A;  2G2Q A;  4HOJ A;  1JLW A;  5FHI A;  1ZYQ B;  1BX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...