1WPIA

Solution nmr structure of protein ykr049c from saccharomyces cerevisiae. ontario centre for structural proteomics target yst0250_1_133; northeast structural genomics consortium ytyst250
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
133
structure length
133
Chain Sequence
MSFWKTLQRQPRTISLFTNDIASNIKSQKCLQLLKGDVSHRFDVEIANRFPTWDQLQYMRTSCPQGPVSLQRQIPKLDSVLKYKHTDPTFGMDLQKCVQRGLWNPKEALWVDWENKLVGNEPADIDKYIIQRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical 15.6 kDa protein in NAP1-TRK2 intergenic region
publication title Solution structure of YKR049C, a putative redox protein from Saccharomyces cerevisiae
pubmed rcsb
source organism Saccharomyces cerevisiae
total genus 17
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2004-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07955 DUF1687 Protein of unknown function (DUF1687)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1wpiA00
5D9VA 3H1NA 2C3QA 3P90A 1HNAA 2B5XA 1XOBA 4MPFA 3IAM2 1GSDA 3HA9A 3ZVJA 5ECLB 2H01A 4F0BA 4KNDA 2F9SA 1XVWA 1I9DA 5ECRB 13GSA 5F0GA 1AQWA 4NHZA 5DCHA 2DJKA 3HHVA 1TRVA 4NV2A 2GQKA 2FWFA 1PL1A 1EWXA 2H70A 2L5OA 4PQIA 4K1FA 3ED3A 3ZMKA 4XS6A 4KCEA 2K8SA 5IQYA 4MCUA 2NBSA 2JSZA 2TRCP 2YWMA 2NTOA 2EIOA 14GSA 3N9JA 2EC4A 2LSTA 1ZYEA 3F4RA 4JR6A 1R5AA 5GSSA 5IOXA 2PERA 3TJFA 16GSA 3DVXA 1PX7A 2YV7A 3HXSA 1WMJA 2CX3A 4BVXA 1BG5A 2IMFA 5G30A 3E0UA 1EP8A 3EWLA 2VOCA 3LYPA 4IQ1A 3M1GA 2X64A 2A4VA 2NDOA 3J7Yb 1VGLA 4WEYA 1M2DA 4NXIA 3IR4A 3A2VA 4OCFA 2R6KA 2R3XA 4V1Ag 3EU4A 3BOAA 3QOUA 2OACA 1AAZA 4L8EA 3UIWA 2QC7A 4TR4A 4HDEA 5ECKB 1NHYA 2CVDA 3QFBC 3H4KA 1SK0A 5D93A 2R2JA 4IJ3A 1O8WA 4PGTA 4L5OA 1U3AA 2HRNA 2L6DA 3H79A 4J2FA 4ZB9A 4HI7A 5IPHA 1OC8A 4ZL9A 3UL3A 3M3MA 4NMUA 2C3TA 5CNWA 3RDWA 2VL2A 1ZZYA 2MMZA 3F63A 5EL8A 4MJAA 5ECIB 1HNBA 3GKKA 2GZYA 3TJBA 3VWVA 4AJ6A 1SD9A 2OJLA 2EIRA 3L78A 3TKSA 2H72A 2H73A 3FR3A 1SL2B 3MSZA 4RI6A 3QAGA 4GCIA 2B5EA 1J9BA 4EDZA 1XW6A 1V58A 2I81A 11GSA 1SYXA 1A23A 1OE8A 2H30A 1GL8A 2GZPA 1WPIA 2F8FA 1PD21 4I8BA 4MDCA 3TRQA 4V1Ap 1MTCA 2AV4A 5ID2A 1ST9A 2LV3A 3MDKA 4CW9A 3BBYA 1SK1A 2X99A 3C1RA 1XCCA 2RM5A 1Z7RA 4O7HA 5HR1A 5INYA 5G5EA 3DMLA 5COHA 2C4JA 1JZWA 6GSYA 3GKXA 3FZ9A 5DQSA 2VCWA 4F2IA 4EE0A 4MK3A 2MYGA 5HR3A 5IMFA 1GTBA 1WP0A 2C80A 3IDVA 2LKUA 2HNLA 2GZZA 2TRXA 3WGXA 2G0FA 1XOAA 2H0HA 3H8QA 1YQ1A 3KTLA 3KZQA 4GQCA 5ID2B 2WDUA 2D2ZA 1EV4A 4D73A 4KAEA 1PL2A 5IMZA 5CYYA 3UVTA 4DSSA 3HVVA 1MDKA 3GL5A 3GN3A 5DVBA 4MP4A 4PNFA 4RQRA 4K0NA 3U6VA 5GZZB 4ZBDA 4LL4B 3G7IA 2WZ9A 4Q5QA 1MD4A 4EVMA 1GRXA 3GKMA 3TKRA 3VPQA 3D21A 1Z5YE 2BJXA 4E8HA 3TJJA 4OD7A 3AY8A 4WBJA 3F8UA 3ZTLA 3FR6A 5G5FA 1MD3A 2C8UA 4D73B 2A2RA 4EF0A 1VF2A 3D6IA 5H5RA 2KHPA 4DSSB 3TKSC 1UC7A 2CQ9A 1IYIA 4H86A 4HQZA 3E3EA 3EMXA 3UBLA 2PUKC 2PGTA 1WOUA 1EGRA 1ZOFA 2E7PA 3D4TA 2VD0A 4TXOB 4TVEA 3DKSA 1Z6MA 2JL4A 3WT1A 3GH6A 4OMVA 5F05A 1S3CA 1SD8A 4N30A 3QD9A 2FNOA 3HZ4A 4OFNA 4HQSA 1DE1A 3EURA 3N5OA 5DJLA 1XW5A 2VCXA 3P8WA 1Z6NA 2LRTA 2V2GA 4MA9A 5D9TA 1THXA 1GTAA 2C0DA 3LFLA 1Y6EA 3TCOA 2H1GA 3ZYWA 3DGQA 4ML6A 1XXUA 4G10A 4GLTA 4Q5RA 3LSZA 4BWQA 2K6VA 5G1LA 5KN2A 1KBNA 3HKRA 4O5RA 4DVCA 2O87A 1PX6A 2HSHA 5DQYA 5EY6A 2PVOC 5CRDA 4YQUA 1T4YA 4ZILA 2X8CA 2GTUA 2WGRA 1XIYA 4ZL8A 2F8AA 1W89A 1U3IA 1XWGA 2ZUPA 2HSYA 3GUSA 4WF5A 1ERUA 4POKA 2H0GA 3TB2A 4ECBA 4G19A 4ISDA 4DSRA 4KDYA 1BEDA 1R7HA 3BCIA 1W4VA 2I1UA 4TR3A 4KH7A 2IJYA 2OBKA 2XPDA 3UMAA 4OFTA 3DYRA 3ZRDA 10GSA 2JACA 1GUKA 3FK8A 4JEDA 2IMEA 4ILFA 3ZFLA 5A4VA 2VLTA 4J56E 4IELA 2C1YA 1O8XA 4HJMA 2LRCA 2BMXA 1FG4A 5D8IA 2YCDA 4GSSA 3E9JB 2F3MA 3IC4A 4MF6A 1YF0A 2GSQA 3C71A 2B5YA 1F3BA 2MMNA 3J7Yk 5G1KA 5A5KA 5AIVA 3DVWA 1K0AA 4YH2A 1T7PB 1K3OA 3F3RA 2IWTA 1ZGNA 2H6YA 5E59A 5C00A 2AAWA 4L0WA 1UN2A 2DJ2A 2R37A 3SBCA 1XW9A 3APOA 3O76A 1SKSB 2KLXA 5LNKe 3ZLPA 4KSOA 3KMNA 1T1VA 3LXTA 4EDYA 1GULA 2P5RA 4I5QA 4PNGA 2FCHA 2VCZA 3LWAA 2LS5A 1EGOA 2YOIA 5ECQB 3L4NA 4N0ZA 2OBIA 4IP1A 3ERFA 2CVKA 1MDIA 2FA4A 3ZIJA 1TRUA 1LU4A 5A4UA 1JHBA 1OKTA 3FKFA 1Q4JA 4RQXA 3ZL5A 3W6GA 1PMTA 1X0RA 3FZ4A 4MF5A 3GX8A 3G9BA 2ON5A 1ZYQB 3VWUA 1GLPA 1QFNA 3IRAA 3OR5A 2J23A 3CXGA 3IBHA 2DLXA 1YJ6A 4X1UA 5IPGA 4K2DA 3EVIA 3TGZA 4LL1B 4KCAA 4JBBA 4RI7A 5D73A 3RHBA 1UA5A 1SL1B 3S9FA 2K18A 1V9WA 1X9WB 3ZREA 1B9XC 3O6TA 2KOKA 5DDLA 4FYCA 1BAYA 2L57A 5IMVA 1XBSA 1EOHA 3HJOA 2YPMA 4EO3A 2YWOA 4GSNA 1WRYA 5EVOA 4BA7A 2XBQA 2E0QA 4KX4A 4OFMA 1GNWA 1F2EA 2CT6A 2B7JA 1H75A 5B7CA 8GSSA 1SL0B 12GSA 5AGYA 1G6YA 2L59A 4ZBBA 4OWYA 1U6TA 4HUAA 3JCML 1DSBA 1O85A 4PUFC 1WIKA 2LNTA 1WE0A 2DC5A 2DJJA 1ILOA 4OO4A 3FYGA 1B9YC 3DIEA 1FOVA 2IMDA 2HE3A 5J5NA 1THOA 3A5WA 5H5QA 4F9ZA 4HZ4A 2YZUA 5B6NA 3GFKA 1QMVA 4MABA 1TI1A 3WGEA 1IYHA 2HZFA 3QR6A 3LORA 2JZSA 2LTKA 4ZL7A 3KIJA 3W8SA 2HI7A 4MZBA 3VK9A 2YNXA 1O7UA 3VURA 3IK9A 3TOTA 3C8EA 1EOGA 4LMVA 1CQGA 4Q5NA 3M9KA 4V2MA 2VAFA 2JZRA 2HFDA 4MH2A 5DAKB 3GIXA 2GQMA 4HU7A 2FWEA 1A2MA 3KM6A 2B6MA 4PXOA 9GSSA 1N8JA 19GSA 1VRSD 4AF2A 5KEJA 2GT6A 1DBYA 3IE3A 3IPZA 4JZQA 1E6BA 5FWGA 4JE1A 1JFUA 3O3TA 5J9CA 2B3SA 2V1MA 4P3YB 2YP6A 1FAAA 2L5LA 2OE0A 4MPGA 2LNSA 1XZOA 1TRSA 1JZRA 2RM6A 3CSIA 18GSA 1K3YA 4AJ7A 1USBA 4ZBAA 4LLRA 2FWHA 5CAXA 4FH8A 3I43A 3ZVJD 5LCZA 2P0GA 5FT3A 4K7IA 5ECOB 4ZIJA 4DEJA 4HS1A 4CDOA 1QQ2A 1YF1A 1YEXA 5IOWA 2IFQA 2CVBA 1R26A 1RQMA 1A8LA 5G31A 2YWIA 1T4ZA 2MBSA 2K8VA 2O85A 4I2UA 1U88A 1AQXA 3IOSA 4IVFA 1EEMA 2WS2A 3F4SA 5HR0A 3MWHA 2Z9SA 3GURA 5JCUA 4EC0A 4NV5A 5IMDA 2O8VB 4ZB6A 6GSXA 1HD2A 2GLRA 2P31A 4IKHA 1SKWB 2HRFA 1G6WA 1AIUA 3QAWA 1WWJA 1JLVA 3L9VA 1GUHA 1QK8A 2GGTA 3Q18A 1B48A 3QCPA 3RHCA 3KJYA 3KXOA 1R5PA 1M2BA 2HT9A 5HFIA 2H66A 2GDRA 4ACSA 2YN1A 4EL1A 2DBCA 2FGXA 1K0BA 3D22A 4XS1A 2IFQB 2V32A 1O81A 1F6MC 2RLIA 2VO4A 4PQ1A 1V57A 5GSTA 4TN8A 2WRTA 5IO0A 5B8AA 1OAZA 2CV4A 1AUCA 4XTSA 5AIXA 4L5LA 4QL9A 3GSTA 1TU8A 3KP9A 3DWVA 4BL7A 3GKNA 4TXOA 5D9XA 1AC1A 1A0RP 5HQPA 1ON4A 1J0FA 2I3YA 1B4PA 1KTEA 3ZMLA 3QMXA 4KB3A 4KA0A 2LRNA 3DEXA 5JWRB 3ME7A 2R4VA 2XHFA 4Q5FA 4ML1A 3IV4A 2QGVA 1LJRA 2H1DA 2R5GA 3I6AA 2L4QA 2VLUA 2CZ3A 2ZNMA 1YKCA 5J41A 1SKRB 2ZCTA 2O7KA 2VUPA 7GSSA 2IL3A 6GSTA 3ERGA 3GMFA 2KP1A 4PX1A 3C7MA 2OE1A 1A2JA 3HVXA 3EU3A 4FYBA 1X5DA 4G2EA 1M99A 2GSRA 1Q98A 3KTBA 4DSQA 3US3A 1K0NA 4YQVA 5JCGA 5AN1A 1PN9A 3HVSA 1CQHA 1XVQA 3L9UA 5ECSA 2XBIA 1M0UA 1V2AA 3QDNA 1VF3A 1HQOA 4KDUA 4E8EA 2IMKA 4XCSA 2HZEA 3M0FA 1LBKA 4BVYA 3QPMA 4WR4A 3Q6OA 1GSQA 4XRAA 2DJ3A 2CA8A 2I4AA 1TXXA 5JCWA 3EYTA 4GQFA 5HFGA 3KH7A 1O6JA 4X43A 2VLVA 5HFKA 1K0DA 4AGSA 2GSTA 1GTUA 3WYWA 1GWCA 4ECJA 1C72A 1ZMAA 1H4OA 3TUEA 2V41A 1F3AA 5J4UA 4XHMA 2QSIA 1HYUA 1NHOA 3CTFA 5IO2A 3IA1A 3GTUA 2DIZA 1TI3A 2HZEB 3LQ7A 1FHEA 2HYXA 2QKEA 4PURA 5C04A 4TR1A 4YQMA 3F3QA 5ENUA 2DIYA 3EE2A 5GAND 3ZITA 1ZCPA 4IN0A 4K6XA 4KUNA 5D9WA 3NZNA 1GP1A 4YAVA 4HOJA 3F9UA 2PU9C 3I69A 1T00A 1TK8B 2V6KA 2A2SA 4J57E 4ECIA 4YAPA 2I9HA 1SJIA 1PKWA 5J3RA 1JZOA 2L6CA 1VF1A 1AXDA 2PWJA 1Z3EA 3CYNA 1OE7A 1YY7A 4TKYA 4IQAA 6GSSA 4EUYA 4N10A 5HR2A 4IBPA 2GSSA 3FEUA 3GTUB 2V6OA 3TOUA 1MDJA 4QQ7A 2OE3A 1M9BA 3I9V2 4K8MA 2AJQB 2C0FA 4TR1B 5B8BA 2NPBA 3FHKA 2PBJA 4IGJA 1BYEA 3P7XA 2C0EA 2JADA 5CRWA 1ACVA 3M8NA 3G7JA 1OC9A 4NHWA 2L4CA 3L0HA 3BCKA 1Z7PA 2AUVA 2FA8A 4EXJA 1QGVA 2LJKA 2AHEA 1OYJA 3D0ZA 5LD0A 4KDXA 2FLSA 4QL7A 3KGKA 3TRXA 5B6MA 2O89A 1OVNA 2LQOA 3ME8A 1XWKA 3C1SA 3WD6A 4I2TA 5D96A 2JSYA 2H71A 3EMPA 4N11A 1E2YA 2VIMA 1WJKA 2KUCA 1B4QA 1JZDA 3CSHA 2OKAA 1RK4A 6GSUA 2DMMA 1ZL9A 4TR0A 3IAS2 1U87A 4Z7XA 3VPTA 4MH3A 1FB0A 1EV9A 1GNEA 1G7EA 1OC9B 1A2LA 2LEGA 3TRPA 4BPYA 4O32A 3GX0A 2PMTA 5DALA 4GWRA 1K0MA 1EP7A 1TP9A 2N5BA 1GSFA 2B1KA 1K0CA 4PUAA 3VFIA 4F03A 5CRHA 2YV9A 2F51A 3LYKA 1ERVA 3ZFBA 1G7OA 3KMOA 1QUWA 2H1AA 3ERWA 1GUMA 1PA3A 1TU7A 2H1BA 1A0FA 5DAKA 3NIVA 3PINA 3UVHA 2H76A 3VWWA 1GSUA 2MMAA 5CP1A 3CRTA 4HU9A 1EEJA 4WBRD 4LMWA 1O73A 1AQVA 2WB9A 5DALB 2ES7A 3VWXA 3LJRA 4WXTA 3FR9A 3FW2A 1S3DA 1ERWA 2VL3A 5ECPB 2NVLA 4LA1A 5J9BA 2H74A 3F4TA 4JRRA 2JU5A 4XRDA 4IW9A 5A4WA 4K7NA 5IIZA 1SJ6A 3IK7A 1T3BA 1B8XA 1V40A 4MZWA 3GSSA 2VM2A 4ZXGA 2H6XA 2OA7A 1KEBA 4XS4A 3F0IA 1FVJA 1GSYA 2YANA 4NAXA 2WCIA 2FD3A 3A3TA 3VI7A 4I6XA 5H5SA 1NW2A 3FZ5A 2FWGA 3HYPA 2MZCA 3FY7A 1X9MB 1FVKA 5IMCA 17GSA 1M9AA 2G2QA 2HLSA 3HZ8A 3KP8A 3KCMA 4V2NA 1K3LA 2WJUA 4TOPA 2VCVA 3D4MA 3IHQA 5CRGA 3KEBA 1NM3A 1OKDA 4G9HA 2BTOT 2N5FA 3UJ1A 3DD3A 1BX9A 2M72A 4OCEA 2FHEA 4JU5A 1S3AA 6GSVA 1BJXA 3F6FA 2GVPA 1TRWA 2LJAA 3BJ5A 2AYTA 2LUSA 3LXZA 3L9SA 3ZIVA 4GTUA 3UEMA 2E2MA 4RUVA 3IXRA 1FO5A 3VLNA 4XIHA 4XS4B 1SYRA 5AISA 2AB6A 4TXVA 5EPFA 2X8HA 3PH9A 2GQLA 5G2ZA 3DXBA 3PGTA 1I5GA 3RPPA 2VD1A 5ECMB 1F37A 1RW1A 4FO5A 3FRCA 4F82A 4K0GA 2IPAA 4HEA2 5ELGA 2B1LA 1GLQA 2CAIA 2DJ1A 1A24A 2E2GA 3P2AA 2LQQA 2FUG2 1XWCA 4O92A 1J08A 4MJBA 3VI5A 5ECNB 5F06A 3EINA 3WGDA 2XPEA 2YWNA 1DE2A 1TOFA 1X5CA 4WKWA 5JWOB 5ABRA 3PR8A 1N2AA 1ML6A 1URMA 3HJPA 3QFAC 3HJMA 4I97A 6GSWA 1TJDA 5KN0A 2HXKA 4IHUA 2RUFA 4KSMA 3WT2A 3RAZA 2ON7A 1SK2A 3GYKA 4K9ZA 22GSA 2YJHA 3GL3A 3GA4A 2XC2A 2DSAA 5KN1A 4POLA 4FIWA 3GNJA 1YDKA 1UVZA 1K0OA 1YZXA 3Q19A 3HY2A 1T8EB 1PQNA 2X8GA 3RPNA 4PQHA 1G0TA 1F9MA 4WETA 2H8LA 1OC3A 3TJGA 4POBA 2PVQA 2DJ0A 1BQ7A 5CREA 1DUGA 5DBQA 1X9SB 4IS0A 3CSJA 3UOMA 2KP2A 1ERTA 2VL2C 2J9HA 1PKZA 2VCTA 3D5JA 4TRXA 3GRXA 5L71A 2P5QA 1R4WA 2OADA 3M9JA 2K9FA 4MJEA 3LGCA 1PSQA 4WF4A 1SJZA 3UAPA 1Y25A 1FW1A 1XFLA 1ABAA 1GSEA 3G7YA 3BD2A 4NWYA 1XWBA 4GF0A 3A2WA 1TTZA 4WR5A 5IMAA 3CRUA 5E4WA 2B7KA 3MNGA 2MBTA 1AW9A 2C3NA 3TKQA 4TW5A 1A8YA 3F6DA 1GSSA 1M7TA 2ALBA 2IN3A 3A2XA 3TDGA 2FY6A 3APSA 2LJRA 4JR4A 3RBTA 5GAPD 2YJ7A 2H19A 2JZTA 5DCGA 4IP6A 1QXHA 3ZZXA 2MMOA 3NOFA 2RUEA 2IIYA 4MMMA 1M2AA 2YZHA 3QAVA 4NPBA 4GSTA 4ZB8A 1MEKA 3W8JA 4KE3A 1YKAA 2CAQA 2CX4A 3HDCA 1PGTA 4KGIA 2WFCA 3TKSE 3CTGA 3DRNA 2VM1A 3CBUA 4MZCA 4MF7A 5CO3A 4MJCA 4ULXA 3V1WA 5DJMA 1X5EA 3UARA 1YEPA 1XWAA 3LEFA 2EIQA 2H75A 4X0XA 1JLWA 1XPVA 2CZ2A 3TKPA 5JWQB 3KD0A 1GTIA 4N0VA 1Z9HA 1KNGA 4CHSA 2REMA 3GV1A 3H93A 1VF4A 4HZ2A 2N5AA 2TIRA 3APQA 4EKZA 2RIIA 5ECHB 1TKDB 3MAKA 5FHIA 3ISOA 1TK5B 2GS3A 1NSWA 1FB6A 2M80A 3R2QA 4OO5A 2PPTA 4L0UA 20GSA 5KN3A 1TK0B 3HD5A 3FZAA 1EZKA 4IJIA 4BWSA 5F07A 2VL9A 4ID0A 1HNCA 3EC3A 2WULA 2H6ZA 4POMA 3GH9A 4GRFA 2PN8A 4MLYA 4KW6A 4GXZA 4AJ8A 3LG6A 3TJKA 1SU9A 4HJ2A 2C0GA 2IMIA 2VCQA 1V98A 2H0IA 2GT5A 1TW9A 3K8NA 3CMIA 3KH9A 5ELAA 3C73A 4F0CA 5IM9A 3GHAA 5F8BA 3HCZA 3SWLA 4FYUA 1TDIA 4K7OA 1PRXA 1GH2A 4ECCA 2DMLA 2M46A 4V2LA 3UBKA 1SENA 3Q74A 3U5RE
chains in the Genus database with same CATH superfamily
5D9VA 3H1NA 2C3QA 3P90A 1HNAA 2B5XA 1XOBA 4MPFA 3IAM2 1GSDA 3HA9A 3ZVJA 5ECLB 2H01A 4F0BA 4KNDA 2F9SA 1XVWA 4EIQA 1I9DA 5ECRB 13GSA 5F0GA 1AQWA 4NHZA 5DCHA 2DJKA 3HHVA 1TRVA 4NV2A 2GQKA 2FWFA 1PL1A 1EWXA 2H70A 2L5OA 4PQIA 4K1FA 3ED3A 3ZMKA 4XS6A 4KCEA 2K8SA 5IQYA 4MCUA 2NBSA 2JSZA 2TRCP 2YWMA 2NTOA 2EIOA 14GSA 3N9JA 2EC4A 2LSTA 1ZYEA 3F4RA 4JR6A 1R5AA 5GSSA 5IOXA 2PERA 3TJFA 16GSA 5BMUA 3DVXA 1PX7A 2YV7A 3HXSA 1WMJA 2CX3A 4BVXA 1BG5A 2IMFA 5G30A 3E0UA 1EP8A 3EWLA 2VOCA 3LYPA 4IQ1A 3M1GA 2X64A 2A4VA 2NDOA 3J7Yb 2QA1A 1VGLA 4WEYA 1M2DA 4NXIA 3IR4A 3A2VA 4OCFA 2R6KA 2R3XA 4V1Ag 3EU4A 3BOAA 3QOUA 2OACA 3CQFA 1AAZA 4L8EA 3UIWA 2QC7A 4TR4A 4HDEA 5ECKB 4BIKA 1NHYA 2CVDA 3QFBC 3H4KA 1SK0A 5D93A 2R2JA 4IJ3A 1O8WA 4PGTA 4L5OA 1U3AA 2HRNA 2L6DA 3H79A 4J2FA 3HVNA 4ZB9A 4HI7A 5IPHA 1OC8A 4ZL9A 3IC8A 4BVXB 3UL3A 3M3MA 4NMUA 2C3TA 5CNWA 3RDWA 2VL2A 1ZZYA 2MMZA 3F63A 5EL8A 1PN0A 4MJAA 5ECIB 1HNBA 3GKKA 2GZYA 3TJBA 3VWVA 4AJ6A 1SD9A 2OJLA 2EIRA 3L78A 3TKSA 2H72A 2H73A 3FR3A 1SL2B 3MSZA 4RI6A 3QAGA 4GCIA 4KF9A 2B5EA 1J9BA 4EDZA 1XW6A 1V58A 2I81A 11GSA 1SYXA 1A23A 1OE8A 2H30A 1GL8A 4G0IA 2GZPA 1WPIA 2F8FA 1PD21 4I8BA 4MDCA 3TRQA 4V1Ap 1MTCA 2AV4A 5ID2A 1ST9A 2LV3A 3MDKA 4CW9A 3BBYA 1SK1A 2X99A 3C1RA 1XCCA 2RM5A 1Z7RA 4O7HA 5HR1A 5INYA 5G5EA 3DMLA 5COHA 2C4JA 1JZWA 6GSYA 3GKXA 3FZ9A 5DQSA 2VCWA 4F2IA 4EE0A 4MK3A 2MYGA 5HR3A 5IMFA 1GTBA 1WP0A 2C80A 3IDVA 2LKUA 2HNLA 2GZZA 2TRXA 3WGXA 2G0FA 1XOAA 2H0HA 3H8QA 1YQ1A 3KTLA 3KZQA 4GQCA 5ID2B 2WDUA 2D2ZA 1EV4A 4D73A 4KAEA 1PL2A 5IMZA 5CYYA 3UVTA 4DSSA 3HVVA 1MDKA 5BRTA 3GL5A 3GN3A 5DVBA 4MP4A 4PNFA 4RQRA 4K0NA 3U6VA 5GZZB 2X4AA 2R0PA 4LL4B 3G7IA 2WZ9A 4ZBDA 4Q5QA 1MD4A 4EVMA 1GRXA 3GKMA 3TKRA 3VPQA 3D21A 1Z5YE 2BJXA 4E8HA 3TJJA 4OD7A 3AY8A 4WBJA 3F8UA 3ZTLA 3FR6A 5G5FA 1MD3A 2C8UA 4D73B 2A2RA 4EF0A 1VF2A 3D6IA 5H5RA 2KHPA 4DSSB 3TKSC 1UC7A 2CQ9A 1IYIA 4H86A 4HQZA 3E3EA 3EMXA 3UBLA 2PUKC 2PGTA 1WOUA 1EGRA 1ZOFA 2E7PA 3D4TA 2VD0A 4TXOB 4TVEA 3DKSA 1S3RA 4PTSA 1Z6MA 2JL4A 3WT1A 3GH6A 4OMVA 5F05A 1S3CA 1SD8A 4N30A 3QD9A 2FNOA 3HZ4A 4OFNA 4HQSA 1DE1A 3EURA 3N5OA 5DJLA 1XW5A 4CY6A 2VCXA 3P8WA 1Z6NA 2LRTA 2V2GA 4MA9A 5D9TA 1THXA 1GTAA 2C0DA 3LFLA 1Y6EA 3TCOA 2H1GA 3ZYWA 3DGQA 4ML6A 1XXUA 4G10A 4GLTA 4Q5RA 3LSZA 4BWQA 2K6VA 5G1LA 5KN2A 1KBNA 4CY8A 3HKRA 4O5RA 4USSA 4DVCA 2O87A 1PX6A 2HSHA 5DQYA 5EY6A 2PVOC 4G0LA 5CRDA 4YQUA 1T4YA 4ZILA 2X8CA 2GTUA 2WGRA 1XIYA 4ZL8A 2F8AA 1W89A 1U3IA 2QA2A 1XWGA 2ZUPA 2HSYA 3GUSA 4WF5A 1ERUA 4POKA 2H0GA 3TB2A 4ECBA 4G19A 4ISDA 4DSRA 4KDYA 1BEDA 1R7HA 3BCIA 1W4VA 2I1UA 4TR3A 4KH7A 2IJYA 2OBKA 2XPDA 3UMAA 4OFTA 3DYRA 3ZRDA 10GSA 2JACA 1GUKA 3FK8A 4JEDA 2IMEA 4ILFA 3ZFLA 5A4VA 2VLTA 4J56E 4IELA 2C1YA 1O8XA 4HJMA 4Z2UA 2LRCA 2BMXA 4O5QA 1FG4A 5D8IA 2YCDA 4GSSA 3E9JB 2F3MA 3IC4A 4MF6A 1YF0A 5KOXA 3MYDA 2GSQA 3C71A 2B5YA 1F3BA 2MMNA 3J7Yk 5G1KA 5A5KA 5AIVA 4Z2TA 3DVWA 1K0AA 4YH2A 1T7PB 1K3OA 3F3RA 2IWTA 1ZGNA 2H6YA 5E59A 5C00A 2AAWA 4L0WA 1UN2A 2DJ2A 2R37A 3SBCA 1XW9A 3APOA 3O76A 1SKSB 2KLXA 5LNKe 3ZLPA 4KSOA 3KMNA 1T1VA 3LXTA 4EDYA 1GULA 2P5RA 4I5QA 4PNGA 2FCHA 2VCZA 3LWAA 2LS5A 1EGOA 2YOIA 5ECQB 3L4NA 4N0ZA 2OBIA 4IP1A 3ERFA 2CVKA 1MDIA 2FA4A 3ZIJA 1TRUA 1LU4A 5A4UA 1JHBA 1OKTA 3FKFA 1Q4JA 4RQXA 3ZL5A 3W6GA 1PMTA 1X0RA 3FZ4A 4MF5A 3GX8A 3G9BA 2ON5A 1ZYQB 3VWUA 1GLPA 1QFNA 3IRAA 3OR5A 2J23A 3CXGA 3IBHA 2DLXA 1YJ6A 4X1UA 5IPGA 4K2DA 3EVIA 3TGZA 4LL1B 4KCAA 4JBBA 4RI7A 5D73A 3RHBA 1UA5A 1SL1B 3S9FA 2K18A 1V9WA 1X9WB 3ZREA 1B9XC 3O6TA 2KOKA 5DDLA 4FYCA 1BAYA 2L57A 5IMVA 1XBSA 1EOHA 2HRAA 3HJOA 2YPMA 4EO3A 2YWOA 4GSNA 1WRYA 5EVOA 4BA7A 2XBQA 2E0QA 4KX4A 4OFMA 1GNWA 1F2EA 2CT6A 2B7JA 1H75A 5B7CA 8GSSA 1SL0B 12GSA 5AGYA 1G6YA 2L59A 4ZBBA 4OWYA 1U6TA 4HUAA 3JCML 1DSBA 1O85A 4PUFC 1WIKA 2LNTA 1WE0A 2DC5A 2DJJA 1ILOA 4OO4A 3FYGA 1B9YC 3DIEA 1FOVA 2IMDA 2HE3A 3R3EA 5J5NA 1THOA 3A5WA 5H5QA 2DKHA 4HZ4A 4F9ZA 2YZUA 5B6NA 3GFKA 1QMVA 4MABA 1TI1A 3WGEA 1IYHA 2HZFA 3QR6A 3LORA 2JZSA 2LTKA 4ZL7A 3KIJA 3W8SA 2HI7A 4MZBA 3VK9A 2YNXA 1O7UA 3VURA 3IK9A 3TOTA 3C8EA 1EOGA 4LMVA 1CQGA 4Q5NA 3M9KA 4V2MA 2VAFA 2JZRA 2HFDA 4MH2A 5DAKB 3GIXA 2GQMA 4HU7A 2FWEA 1A2MA 3KM6A 2B6MA 4YKGA 4PXOA 9GSSA 1N8JA 19GSA 1VRSD 4AF2A 5KEJA 2GT6A 1DBYA 3IE3A 3IPZA 4JZQA 1E6BA 5FWGA 4JE1A 1JFUA 3O3TA 1FOHA 5J9CA 2B3SA 2V1MA 4P3YB 2YP6A 1FAAA 2L5LA 2OE0A 4MPGA 2LNSA 1XZOA 1TRSA 1JZRA 2RM6A 3CSIA 18GSA 1K3YA 4AJ7A 1USBA 4ZBAA 4LLRA 2FWHA 5CAXA 4FH8A 3I43A 3ZVJD 5LCZA 2P0GA 5FT3A 4K7IA 5ECOB 4ZIJA 4DEJA 4HS1A 4CDOA 1QQ2A 1YF1A 1YEXA 5IOWA 2IFQA 2CVBA 1R26A 1RQMA 1A8LA 5G31A 2DKIA 2YWIA 1T4ZA 2MBSA 2K8VA 2O85A 4I2UA 1U88A 1AQXA 3IOSA 4IVFA 1EEMA 2WS2A 3F4SA 5HR0A 3MWHA 2Z9SA 3GURA 5JCUA 4EC0A 4FQUA 4NV5A 5IMDA 2O8VB 4ZB6A 6GSXA 1HD2A 2GLRA 2P31A 4IKHA 1SKWB 2HRFA 1G6WA 1AIUA 3QAWA 1WWJA 1JLVA 3L9VA 1GUHA 1QK8A 2GGTA 3Q18A 1B48A 3QCPA 3RHCA 3KJYA 3KXOA 1R5PA 1M2BA 2HT9A 5HFIA 2H66A 2GDRA 4ACSA 2YN1A 4EL1A 2DBCA 2FGXA 1K0BA 3D22A 4XS1A 2IFQB 2V32A 1O81A 3A5IA 1F6MC 2RLIA 2VO4A 4PQ1A 1V57A 5GSTA 4TN8A 2HRKA 2WRTA 5IO0A 5B8AA 1OAZA 2CV4A 1AUCA 4XTSA 5AIXA 4L5LA 4QL9A 3GSTA 1M3IA 1TU8A 3KP9A 3DWVA 4BL7A 3GKNA 4TXOA 5D9XA 1AC1A 1A0RP 5HQPA 1ON4A 1J0FA 2I3YA 1B4PA 1KTEA 1ZYPA 3QMXA 3ZMLA 4KB3A 4KA0A 4K5SA 2LRNA 3DEXA 5JWRB 3ME7A 2R4VA 2XHFA 4Q5FA 4ML1A 3IV4A 2QGVA 1LJRA 4G0KA 2H1DA 2R5GA 3I6AA 2L4QA 2VLUA 2CZ3A 5KOWA 2ZNMA 1YKCA 5J41A 1SKRB 2ZCTA 2O7KA 2VUPA 7GSSA 2IL3A 6GSTA 3ERGA 3GMFA 2KP1A 4PX1A 3C7MA 4Z2RA 4A5PA 4BL7B 2OE1A 1A2JA 3HVXA 2HSMA 3EU3A 1X5DA 4FYBA 4G2EA 1M99A 2GSRA 1Q98A 3KTBA 4DSQA 3US3A 1K0NA 4YQVA 5JCGA 5AN1A 1PN9A 3HVSA 1CQHA 1XVQA 3L9UA 5ECSA 2XBIA 1M0UA 1V2AA 3QDNA 1VF3A 1HQOA 4KDUA 4E8EA 2IMKA 4XCSA 2HZEA 3M0FA 1LBKA 4BVYA 3QPMA 4WR4A 3Q6OA 1GSQA 4XRAA 2DJ3A 2CA8A 2I4AA 1TXXA 5JCWA 3EYTA 4GQFA 5HFGA 3KH7A 1O6JA 4X43A 2VLVA 5HFKA 1K0DA 4AGSA 2GSTA 1GTUA 3WYWA 1GWCA 4ECJA 1C72A 1ZMAA 1H4OA 3TUEA 2V41A 1F3AA 5J4UA 4XHMA 2QSIA 1HYUA 1NHOA 3CTFA 5IO2A 3IA1A 3GTUA 2DIZA 1TI3A 2HZEB 3LQ7A 1FHEA 2HYXA 2QKEA 4PURA 5C04A 4TR1A 4BVYB 4YQMA 3F3QA 5ENUA 2DIYA 3EE2A 5GAND 3ZITA 1ZCPA 4IN0A 4K6XA 4KUNA 5D9WA 3NZNA 1GP1A 4YAVA 4HOJA 3F9UA 2PU9C 3I69A 1T00A 1TK8B 2V6KA 2A2SA 4J57E 4ECIA 4X4JA 4YAPA 2I9HA 4HSCX 1SJIA 1PKWA 5J3RA 1JZOA 2L6CA 1VF1A 1AXDA 2PWJA 1Z3EA 3CYNA 1OE7A 1YY7A 4TKYA 4IQAA 6GSSA 4EUYA 4N10A 5HR2A 4IBPA 2GSSA 3FEUA 3GTUB 2V6OA 3TOUA 1MDJA 4QQ7A 2OE3A 1M9BA 3I9V2 4K8MA 2AJQB 2C0FA 1ZYNA 4TR1B 5B8BA 2NPBA 3FHKA 2PBJA 2A4HA 4IGJA 1BYEA 3P7XA 2C0EA 2JADA 5CRWA 1ACVA 2R0CA 3M8NA 3G7JA 4ICYA 1OC9A 4NHWA 2L4CA 3L0HA 3BCKA 1Z7PA 2AUVA 2FA8A 4EXJA 1QGVA 2LJKA 2AHEA 1OYJA 2A2PA 3D0ZA 5LD0A 3EPTA 4KDXA 2FLSA 4QL7A 3KGKA 3TRXA 5B6MA 2O89A 1OVNA 2LQOA 3ME8A 1XWKA 3C1SA 3WD6A 4I2TA 5D96A 2JSYA 3MIXA 2H71A 3EMPA 4N11A 1E2YA 2VIMA 1WJKA 2KUCA 1B4QA 1JZDA 3CSHA 2OKAA 1RK4A 6GSUA 2DMMA 1ZL9A 4TR0A 4K5RA 3IAS2 1U87A 4Z7XA 3VPTA 4MH3A 1FB0A 1EV9A 1GNEA 1G7EA 1OC9B 1A2LA 2LEGA 3TRPA 4BPYA 4O32A 3GX0A 2PMTA 5DALA 4GWRA 1K0MA 4EIPA 1EP7A 1TP9A 2N5BA 1GSFA 2B1KA 1K0CA 4PUAA 3VFIA 4F03A 5CRHA 3FMWA 2YV9A 2F51A 3LYKA 1ERVA 3ZFBA 1G7OA 3KMOA 1QUWA 2H1AA 3ERWA 1GUMA 1PA3A 1TU7A 2H1BA 1A0FA 5DAKA 3NIVA 3PINA 3UVHA 2H76A 3VWWA 1GSUA 2MMAA 5CP1A 3CRTA 4HU9A 1EEJA 4WBRD 4LMWA 1O73A 1AQVA 2WB9A 5DALB 2ES7A 3VWXA 3LJRA 4WXTA 3FR9A 1PFOA 3FW2A 1S3DA 1ERWA 2VL3A 5ECPB 2NVLA 4LA1A 5J9BA 2H74A 3F4TA 4JRRA 2JU5A 4XRDA 4IW9A 5A4WA 4K7NA 5IIZA 1SJ6A 3IK7A 1T3BA 3IHGA 1B8XA 1V40A 4MZWA 3GSSA 2VM2A 4ZXGA 2H6XA 2OA7A 1KEBA 4XS4A 3F0IA 1FVJA 1GSYA 2YANA 4NAXA 2WCIA 2FD3A 3A3TA 3VI7A 4I6XA 5H5SA 1NW2A 3FZ5A 2FWGA 3HYPA 2MZCA 3FY7A 1X9MB 1FVKA 5IMCA 17GSA 1M9AA 2G2QA 2HLSA 3HZ8A 3KP8A 3KCMA 4V2NA 1K3LA 2WJUA 4TOPA 2VCVA 3D4MA 3IHQA 5CRGA 3KEBA 3PPUA 1NM3A 1OKDA 4G9HA 2BTOT 2N5FA 3UJ1A 3DD3A 1BX9A 2M72A 4OCEA 2FHEA 4JU5A 1S3AA 6GSVA 1BJXA 3F6FA 2GVPA 1TRWA 2LJAA 3BJ5A 2AYTA 2LUSA 3LXZA 3L9SA 3ZIVA 4GTUA 3UEMA 2E2MA 4RUVA 3IXRA 1FO5A 3VLNA 4XIHA 4XS4B 1SYRA 5AISA 2AB6A 4TXVA 5EPFA 2X8HA 3PH9A 2GQLA 5G2ZA 3DXBA 3PGTA 1I5GA 3RPPA 2VD1A 5ECMB 1F37A 1RW1A 4FO5A 3FRCA 4F82A 4K0GA 2IPAA 4HEA2 5ELGA 2B1LA 1GLQA 2CAIA 2DJ1A 1A24A 2E2GA 2X49A 3P2AA 2LQQA 2FUG2 1XWCA 4O92A 3LW9A 1J08A 4MJBA 3VI5A 5ECNB 5F06A 3EINA 3WGDA 2XPEA 2YWNA 1DE2A 1TOFA 1X5CA 2UZ8A 4WKWA 5JWOB 5ABRA 3PR8A 1N2AA 1ML6A 1URMA 3HJPA 3QFAC 3HJMA 4I97A 6GSWA 1TJDA 5KN0A 2HXKA 4IHUA 2RUFA 4KSMA 3WT2A 3RAZA 2ON7A 1SK2A 3GYKA 4K9ZA 22GSA 2YJHA 3GL3A 3GA4A 2XC2A 2DSAA 5KN1A 4POLA 4FIWA 3GNJA 1YDKA 1UVZA 1K0OA 1YZXA 3Q19A 3HY2A 1T8EB 1PQNA 2X8GA 3RPNA 4PQHA 1G0TA 1F9MA 4WETA 2H8LA 1OC3A 3TJGA 4POBA 2PVQA 2DJ0A 1BQ7A 5CREA 1DUGA 5DBQA 1X9SB 4IS0A 3CSJA 3UOMA 2KP2A 1ERTA 2VL2C 2J9HA 1PKZA 2VCTA 2R0GA 3D5JA 4TRXA 3GRXA 5L71A 2P5QA 1R4WA 2OADA 4YKFA 3M9JA 2K9FA 4MJEA 3LGCA 1PSQA 4WF4A 1SJZA 3UAPA 1Y25A 1FW1A 1XFLA 1ABAA 1GSEA 3G7YA 3BD2A 4NWYA 1XWBA 4GF0A 3A2WA 1TTZA 4WR5A 5IMAA 3CRUA 5E4WA 2B7KA 3MNGA 2MBTA 1AW9A 2C3NA 3TKQA 4TW5A 1A8YA 3F6DA 1GSSA 1M7TA 2ALBA 2IN3A 3A2XA 3TDGA 2FY6A 3APSA 4MNNA 2LJRA 4JR4A 3RBTA 5GAPD 2YJ7A 2H19A 2JZTA 5DCGA 4IP6A 1QXHA 3ZZXA 2MMOA 1M3JA 3NOFA 2RUEA 2IIYA 4MMMA 1M2AA 2YZHA 3QAVA 4NPBA 4GSTA 4ZB8A 1MEKA 3W8JA 4KE3A 1YKAA 2CAQA 2CX4A 3HDCA 1PGTA 4KGIA 2WFCA 3TKSE 3CTGA 3DRNA 2VM1A 3CBUA 4MZCA 4MF7A 5CO3A 4MJCA 4ULXA 3V1WA 5DJMA 1X5EA 3UARA 1YEPA 1XWAA 1XG8A 2EIQA 2H75A 3LEFA 4X0XA 1JLWA 1XPVA 2CZ2A 3TKPA 5JWQB 3KD0A 1GTIA 4N0VA 1Z9HA 1KNGA 4CHSA 2REMA 3GV1A 3H93A 1VF4A 4HZ2A 2N5AA 2TIRA 3APQA 4EKZA 2RIIA 5ECHB 1TKDB 3MAKA 5FHIA 3ISOA 1TK5B 2GS3A 1NSWA 1FB6A 2M80A 3R2QA 4OO5A 2PPTA 4L0UA 20GSA 5KN3A 1TK0B 3HD5A 3FZAA 1EZKA 4IJIA 4BWSA 2VL9A 5F07A 4ID0A 1HNCA 3EC3A 2WULA 2H6ZA 4POMA 3GH9A 4GRFA 2PN8A 4MLYA 4KW6A 4GXZA 4AJ8A 3LG6A 3TJKA 1SU9A 4HJ2A 2C0GA 4K2XA 2IMIA 2VCQA 1V98A 2H0IA 2GT5A 4O5UA 1TW9A 3K8NA 3CMIA 3KH9A 5ELAA 3C73A 4F0CA 5IM9A 3GHAA 5F8BA 3HCZA 3SWLA 4FYUA 1TDIA 4K7OA 1PRXA 1GH2A 4ECCA 2DMLA 2M46A 4V2LA 3UBKA 1SENA 3Q74A 3U5RE
chains in the Genus database with same CATH topology
5D9VA 3H1NA 2C3QA 3P90A 1HNAA 2B5XA 1XOBA 4MPFA 3IAM2 1GSDA 3HA9A 3ZVJA 5ECLB 2H01A 4F0BA 4KNDA 2F9SA 1XVWA 4EIQA 1I9DA 5ECRB 13GSA 5F0GA 1AQWA 4NHZA 5DCHA 2DJKA 3HHVA 1TRVA 4NV2A 2GQKA 2FWFA 1PL1A 1EWXA 2H70A 2L5OA 4PQIA 4K1FA 3ED3A 3ZMKA 4XS6A 4KCEA 2K8SA 5IQYA 4MCUA 2NBSA 2JSZA 2TRCP 2YWMA 2NTOA 2EIOA 14GSA 3N9JA 2EC4A 2LSTA 1ZYEA 3F4RA 4JR6A 1R5AA 5GSSA 5IOXA 2PERA 3TJFA 16GSA 5BMUA 3DVXA 1PX7A 2YV7A 3HXSA 1WMJA 2CX3A 4BVXA 1BG5A 2IMFA 5G30A 3E0UA 1EP8A 3EWLA 2VOCA 3LYPA 4IQ1A 3M1GA 2X64A 2A4VA 2NDOA 3J7Yb 2QA1A 1VGLA 4WEYA 1M2DA 4NXIA 3IR4A 3A2VA 4OCFA 2R6KA 2R3XA 4V1Ag 3EU4A 3BOAA 3QOUA 2OACA 1AAZA 4L8EA 3UIWA 2QC7A 4TR4A 4HDEA 5ECKB 1NHYA 2CVDA 3QFBC 3H4KA 1SK0A 5D93A 2R2JA 4IJ3A 1O8WA 4PGTA 4L5OA 1U3AA 2HRNA 2L6DA 3H79A 4J2FA 4ZB9A 4HI7A 5IPHA 1OC8A 4ZL9A 3IC8A 4BVXB 3UL3A 3M3MA 4NMUA 2C3TA 5CNWA 3RDWA 2VL2A 1ZZYA 2MMZA 3F63A 5EL8A 1PN0A 4MJAA 5ECIB 1HNBA 3GKKA 2GZYA 3TJBA 3VWVA 4AJ6A 1SD9A 2OJLA 2EIRA 3L78A 3TKSA 2H72A 2H73A 3FR3A 1SL2B 3MSZA 4RI6A 3QAGA 4GCIA 4KF9A 2B5EA 1J9BA 4EDZA 1XW6A 1V58A 2I81A 11GSA 1SYXA 1A23A 1OE8A 2H30A 1GL8A 4G0IA 2GZPA 1WPIA 2F8FA 1PD21 4I8BA 4MDCA 3TRQA 4V1Ap 1MTCA 2AV4A 5ID2A 1ST9A 2LV3A 3MDKA 4CW9A 3BBYA 1SK1A 2X99A 3C1RA 1XCCA 2RM5A 1Z7RA 4O7HA 5HR1A 5INYA 5G5EA 3DMLA 5COHA 2C4JA 1JZWA 6GSYA 3GKXA 3FZ9A 5DQSA 2VCWA 4F2IA 4EE0A 4MK3A 2MYGA 5HR3A 5IMFA 1GTBA 1WP0A 2C80A 3IDVA 2LKUA 2HNLA 2GZZA 2TRXA 3WGXA 2G0FA 1XOAA 2H0HA 3H8QA 1YQ1A 3KTLA 3KZQA 4GQCA 5ID2B 2WDUA 2D2ZA 1EV4A 4D73A 4KAEA 1PL2A 5IMZA 5CYYA 3UVTA 4DSSA 3HVVA 1MDKA 5BRTA 3GL5A 3GN3A 5DVBA 4MP4A 4PNFA 4RQRA 4K0NA 3U6VA 5GZZB 2X4AA 2R0PA 4LL4B 3G7IA 2WZ9A 4ZBDA 4Q5QA 1MD4A 4EVMA 1GRXA 3GKMA 3TKRA 3VPQA 3D21A 1Z5YE 2BJXA 4E8HA 3TJJA 4OD7A 3AY8A 4WBJA 3F8UA 3ZTLA 3FR6A 5G5FA 1MD3A 2C8UA 4D73B 2A2RA 4EF0A 1VF2A 3D6IA 5H5RA 2KHPA 4DSSB 3TKSC 1UC7A 2CQ9A 1IYIA 4H86A 4HQZA 3E3EA 3EMXA 3UBLA 2PUKC 2PGTA 1WOUA 1EGRA 1ZOFA 2E7PA 3D4TA 2VD0A 4TXOB 4TVEA 3DKSA 4PTSA 1Z6MA 2JL4A 3WT1A 3GH6A 4OMVA 5F05A 1S3CA 1SD8A 4N30A 3QD9A 2FNOA 3HZ4A 4OFNA 4HQSA 1DE1A 3EURA 3N5OA 5DJLA 1XW5A 4CY6A 2VCXA 3P8WA 1Z6NA 2LRTA 2V2GA 4MA9A 5D9TA 1THXA 1GTAA 2C0DA 3LFLA 1Y6EA 3TCOA 2H1GA 3ZYWA 3DGQA 4ML6A 1XXUA 4G10A 4GLTA 4Q5RA 3LSZA 4BWQA 2K6VA 5G1LA 5KN2A 1KBNA 4CY8A 3HKRA 4O5RA 4USSA 4DVCA 2O87A 1PX6A 2HSHA 5DQYA 5EY6A 2PVOC 4G0LA 5CRDA 4YQUA 1T4YA 4ZILA 2X8CA 2GTUA 2WGRA 1XIYA 4ZL8A 2F8AA 1W89A 1U3IA 2QA2A 1XWGA 2ZUPA 2HSYA 3GUSA 4WF5A 1ERUA 4POKA 2H0GA 3TB2A 4ECBA 4G19A 4ISDA 4DSRA 4KDYA 1BEDA 1R7HA 3BCIA 1W4VA 2I1UA 4TR3A 4KH7A 2IJYA 2OBKA 2XPDA 3UMAA 4OFTA 3DYRA 3ZRDA 10GSA 2JACA 1GUKA 3FK8A 4JEDA 2IMEA 4ILFA 3ZFLA 5A4VA 2VLTA 4J56E 4IELA 2C1YA 1O8XA 4HJMA 4Z2UA 2LRCA 2BMXA 4O5QA 1FG4A 5D8IA 2YCDA 4GSSA 3E9JB 2F3MA 3IC4A 4MF6A 1YF0A 5KOXA 3MYDA 2GSQA 3C71A 2B5YA 1F3BA 2MMNA 3J7Yk 5G1KA 5A5KA 5AIVA 4Z2TA 3DVWA 1K0AA 4YH2A 1T7PB 1K3OA 3F3RA 2IWTA 1ZGNA 2H6YA 5E59A 5C00A 2AAWA 4L0WA 1UN2A 2DJ2A 2R37A 3SBCA 1XW9A 3APOA 3O76A 1SKSB 2KLXA 5LNKe 3ZLPA 4KSOA 3KMNA 1T1VA 3LXTA 4EDYA 1GULA 2P5RA 4I5QA 4PNGA 2FCHA 2VCZA 3LWAA 2LS5A 1EGOA 2YOIA 5ECQB 3L4NA 4N0ZA 2OBIA 4IP1A 3ERFA 2CVKA 1MDIA 2FA4A 3ZIJA 1TRUA 1LU4A 5A4UA 1JHBA 1OKTA 3FKFA 1Q4JA 4RQXA 3ZL5A 3W6GA 1PMTA 1X0RA 3FZ4A 4MF5A 3GX8A 3G9BA 2ON5A 1ZYQB 3VWUA 1GLPA 1QFNA 3IRAA 3OR5A 2J23A 3CXGA 3IBHA 2DLXA 1YJ6A 4X1UA 5IPGA 4K2DA 3EVIA 3TGZA 4LL1B 4KCAA 4JBBA 4RI7A 5D73A 3RHBA 1UA5A 1SL1B 3S9FA 2K18A 1V9WA 1X9WB 3ZREA 1B9XC 3O6TA 2KOKA 5DDLA 4FYCA 1BAYA 2L57A 5IMVA 1XBSA 1EOHA 2HRAA 3HJOA 2YPMA 4EO3A 2YWOA 4GSNA 1WRYA 5EVOA 4BA7A 2XBQA 2E0QA 4KX4A 4OFMA 1GNWA 1F2EA 2CT6A 2B7JA 1H75A 5B7CA 8GSSA 1SL0B 12GSA 5AGYA 1G6YA 2L59A 4ZBBA 4OWYA 1U6TA 4HUAA 3JCML 1DSBA 1O85A 4PUFC 1WIKA 2LNTA 1WE0A 2DC5A 2DJJA 1ILOA 4OO4A 3FYGA 1B9YC 3DIEA 1FOVA 2IMDA 2HE3A 3R3EA 5J5NA 1THOA 3A5WA 5H5QA 2DKHA 4HZ4A 4F9ZA 2YZUA 5B6NA 3GFKA 1QMVA 4MABA 1TI1A 3WGEA 1IYHA 2HZFA 3QR6A 3LORA 2JZSA 2LTKA 4ZL7A 3KIJA 3W8SA 2HI7A 4MZBA 3VK9A 2YNXA 1O7UA 3VURA 3IK9A 3TOTA 3C8EA 1EOGA 4LMVA 1CQGA 4Q5NA 3M9KA 4V2MA 2VAFA 2JZRA 2HFDA 4MH2A 5DAKB 3GIXA 2GQMA 4HU7A 2FWEA 1A2MA 3KM6A 2B6MA 4YKGA 4PXOA 9GSSA 1N8JA 19GSA 1VRSD 4AF2A 5KEJA 2GT6A 1DBYA 3IE3A 3IPZA 4JZQA 1E6BA 5FWGA 4JE1A 1JFUA 3O3TA 1FOHA 5J9CA 2B3SA 2V1MA 4P3YB 2YP6A 1FAAA 2L5LA 2OE0A 4MPGA 2LNSA 1XZOA 1TRSA 1JZRA 2RM6A 3CSIA 18GSA 1K3YA 4AJ7A 1USBA 4ZBAA 4LLRA 2FWHA 5CAXA 4FH8A 3I43A 3ZVJD 5LCZA 2P0GA 5FT3A 4K7IA 5ECOB 4ZIJA 4DEJA 4HS1A 4CDOA 1QQ2A 1YF1A 1YEXA 5IOWA 2IFQA 2CVBA 1R26A 1RQMA 1A8LA 5G31A 2DKIA 2YWIA 1T4ZA 2MBSA 2K8VA 2O85A 4I2UA 1U88A 1AQXA 3IOSA 4IVFA 1EEMA 2WS2A 3F4SA 5HR0A 3MWHA 2Z9SA 3GURA 5JCUA 4EC0A 4FQUA 4NV5A 5IMDA 2O8VB 4ZB6A 6GSXA 1HD2A 2GLRA 2P31A 4IKHA 1SKWB 2HRFA 1G6WA 1AIUA 3QAWA 1WWJA 1JLVA 3L9VA 1GUHA 1QK8A 2GGTA 3Q18A 1B48A 3QCPA 3RHCA 3KJYA 3KXOA 1R5PA 1M2BA 2HT9A 5HFIA 2H66A 2GDRA 4ACSA 2YN1A 4EL1A 2DBCA 2FGXA 1K0BA 3D22A 4XS1A 2IFQB 2V32A 1O81A 3A5IA 1F6MC 2RLIA 2VO4A 4PQ1A 1V57A 5GSTA 4TN8A 2HRKA 2WRTA 5IO0A 5B8AA 1OAZA 2CV4A 1AUCA 4XTSA 5AIXA 4L5LA 4QL9A 3GSTA 1TU8A 3KP9A 3DWVA 4BL7A 3GKNA 4TXOA 5D9XA 1AC1A 1A0RP 5HQPA 1ON4A 1J0FA 2I3YA 1B4PA 1KTEA 1ZYPA 3QMXA 3ZMLA 4KB3A 4KA0A 4K5SA 2LRNA 3DEXA 5JWRB 3ME7A 2R4VA 2XHFA 4Q5FA 4ML1A 3IV4A 2QGVA 1LJRA 4G0KA 2H1DA 2R5GA 3I6AA 2L4QA 2VLUA 2CZ3A 5KOWA 2ZNMA 1YKCA 5J41A 1SKRB 2ZCTA 2O7KA 2VUPA 7GSSA 2IL3A 6GSTA 3ERGA 3GMFA 2KP1A 4PX1A 3C7MA 4Z2RA 4A5PA 4BL7B 2OE1A 1A2JA 3HVXA 2HSMA 3EU3A 1X5DA 4FYBA 4G2EA 1M99A 2GSRA 1Q98A 3KTBA 4DSQA 3US3A 1K0NA 4YQVA 5JCGA 5AN1A 1PN9A 3HVSA 1CQHA 1XVQA 3L9UA 5ECSA 2XBIA 1M0UA 1V2AA 3QDNA 1VF3A 1HQOA 4KDUA 4E8EA 2IMKA 4XCSA 2HZEA 3M0FA 1LBKA 4BVYA 3QPMA 4WR4A 3Q6OA 1GSQA 4XRAA 2DJ3A 2CA8A 2I4AA 1TXXA 5JCWA 3EYTA 4GQFA 5HFGA 3KH7A 1O6JA 4X43A 2VLVA 5HFKA 1K0DA 4AGSA 2GSTA 1GTUA 3WYWA 1GWCA 4ECJA 1C72A 1ZMAA 1H4OA 3TUEA 2V41A 1F3AA 5J4UA 4XHMA 2QSIA 1HYUA 1NHOA 3CTFA 5IO2A 3IA1A 3GTUA 2DIZA 1TI3A 2HZEB 3LQ7A 1FHEA 2HYXA 2QKEA 4PURA 5C04A 4TR1A 4BVYB 4YQMA 3F3QA 5ENUA 2DIYA 3EE2A 5GAND 3ZITA 1ZCPA 4IN0A 4K6XA 4KUNA 5D9WA 3NZNA 1GP1A 4YAVA 4HOJA 3F9UA 2PU9C 3I69A 1T00A 1TK8B 2V6KA 2A2SA 4J57E 4ECIA 4X4JA 4YAPA 2I9HA 1SJIA 1PKWA 5J3RA 1JZOA 2L6CA 1VF1A 1AXDA 2PWJA 1Z3EA 3CYNA 1OE7A 1YY7A 4TKYA 4IQAA 6GSSA 4EUYA 4N10A 5HR2A 4IBPA 2GSSA 3FEUA 3GTUB 2V6OA 3TOUA 1MDJA 4QQ7A 2OE3A 1M9BA 3I9V2 4K8MA 2AJQB 2C0FA 1ZYNA 4TR1B 5B8BA 2NPBA 3FHKA 2PBJA 2A4HA 4IGJA 1BYEA 3P7XA 2C0EA 2JADA 5CRWA 1ACVA 2R0CA 3M8NA 3G7JA 4ICYA 1OC9A 4NHWA 2L4CA 3L0HA 3BCKA 1Z7PA 2AUVA 2FA8A 4EXJA 1QGVA 2LJKA 2AHEA 1OYJA 2A2PA 3D0ZA 5LD0A 3EPTA 4KDXA 2FLSA 4QL7A 3KGKA 3TRXA 5B6MA 2O89A 1OVNA 2LQOA 3ME8A 1XWKA 3C1SA 3WD6A 4I2TA 5D96A 2JSYA 3MIXA 2H71A 3EMPA 4N11A 1E2YA 2VIMA 1WJKA 2KUCA 1B4QA 1JZDA 3CSHA 2OKAA 1RK4A 6GSUA 2DMMA 1ZL9A 4TR0A 4K5RA 3IAS2 1U87A 4Z7XA 3VPTA 4MH3A 1FB0A 1EV9A 1GNEA 1G7EA 1OC9B 1A2LA 2LEGA 3TRPA 4BPYA 4O32A 3GX0A 2PMTA 5DALA 4GWRA 1K0MA 4EIPA 1EP7A 1TP9A 2N5BA 1GSFA 2B1KA 1K0CA 4PUAA 3VFIA 4F03A 5CRHA 3FMWA 2YV9A 2F51A 3LYKA 1ERVA 3ZFBA 1G7OA 3KMOA 1QUWA 2H1AA 3ERWA 1GUMA 1PA3A 1TU7A 2H1BA 1A0FA 5DAKA 3NIVA 3PINA 3UVHA 2H76A 3VWWA 1GSUA 2MMAA 5CP1A 3CRTA 4HU9A 1EEJA 4WBRD 4LMWA 1O73A 1AQVA 2WB9A 5DALB 2ES7A 3VWXA 3LJRA 4WXTA 3FR9A 3FW2A 1S3DA 1ERWA 2VL3A 5ECPB 2NVLA 4LA1A 5J9BA 2H74A 3F4TA 4JRRA 2JU5A 4XRDA 4IW9A 5A4WA 4K7NA 5IIZA 1SJ6A 3IK7A 1T3BA 3IHGA 1B8XA 1V40A 4MZWA 3GSSA 2VM2A 4ZXGA 2H6XA 2OA7A 1KEBA 4XS4A 3F0IA 1FVJA 1GSYA 2YANA 4NAXA 2WCIA 2FD3A 3A3TA 3VI7A 4I6XA 5H5SA 1NW2A 3FZ5A 2FWGA 3HYPA 2MZCA 3FY7A 1X9MB 1FVKA 5IMCA 17GSA 1M9AA 2G2QA 2HLSA 3HZ8A 3KP8A 3KCMA 4V2NA 1K3LA 2WJUA 4TOPA 2VCVA 3D4MA 3IHQA 5CRGA 3KEBA 3PPUA 1NM3A 1OKDA 4G9HA 2BTOT 2N5FA 3UJ1A 3DD3A 1BX9A 2M72A 4OCEA 2FHEA 4JU5A 1S3AA 6GSVA 1BJXA 3F6FA 2GVPA 1TRWA 2LJAA 3BJ5A 2AYTA 2LUSA 3LXZA 3L9SA 3ZIVA 4GTUA 3UEMA 2E2MA 4RUVA 3IXRA 1FO5A 3VLNA 4XIHA 4XS4B 1SYRA 5AISA 2AB6A 4TXVA 5EPFA 2X8HA 3PH9A 2GQLA 5G2ZA 3DXBA 3PGTA 1I5GA 3RPPA 2VD1A 5ECMB 1F37A 1RW1A 4FO5A 3FRCA 4F82A 4K0GA 2IPAA 4HEA2 5ELGA 2B1LA 1GLQA 2CAIA 2DJ1A 1A24A 2E2GA 2X49A 3P2AA 2LQQA 2FUG2 1XWCA 4O92A 3LW9A 1J08A 4MJBA 3VI5A 5ECNB 5F06A 3EINA 3WGDA 2XPEA 2YWNA 1DE2A 1TOFA 1X5CA 2UZ8A 4WKWA 5JWOB 5ABRA 3PR8A 1N2AA 1ML6A 1URMA 3HJPA 3QFAC 3HJMA 4I97A 6GSWA 1TJDA 5KN0A 2HXKA 4IHUA 2RUFA 4KSMA 3WT2A 3RAZA 2ON7A 1SK2A 3GYKA 4K9ZA 22GSA 2YJHA 3GL3A 3GA4A 2XC2A 2DSAA 5KN1A 4POLA 4FIWA 3GNJA 1YDKA 1UVZA 1K0OA 1YZXA 3Q19A 3HY2A 1T8EB 1PQNA 2X8GA 3RPNA 4PQHA 1G0TA 1F9MA 4WETA 2H8LA 1OC3A 3TJGA 4POBA 2PVQA 2DJ0A 1BQ7A 5CREA 1DUGA 5DBQA 1X9SB 4IS0A 3CSJA 3UOMA 2KP2A 1ERTA 2VL2C 2J9HA 1PKZA 2VCTA 2R0GA 3D5JA 4TRXA 3GRXA 5L71A 2P5QA 1R4WA 2OADA 4YKFA 3M9JA 2K9FA 4MJEA 3LGCA 1PSQA 4WF4A 1SJZA 3UAPA 1Y25A 1FW1A 1XFLA 1ABAA 1GSEA 3G7YA 3BD2A 4NWYA 1XWBA 4GF0A 3A2WA 1TTZA 4WR5A 5IMAA 3CRUA 5E4WA 2B7KA 3MNGA 2MBTA 1AW9A 2C3NA 3TKQA 4TW5A 1A8YA 3F6DA 1GSSA 1M7TA 2ALBA 2IN3A 3A2XA 3TDGA 2FY6A 3APSA 4MNNA 2LJRA 4JR4A 3RBTA 5GAPD 2YJ7A 2H19A 2JZTA 5DCGA 4IP6A 1QXHA 3ZZXA 2MMOA 3NOFA 2RUEA 2IIYA 4MMMA 1M2AA 2YZHA 3QAVA 4NPBA 4GSTA 4ZB8A 1MEKA 3W8JA 4KE3A 1YKAA 2CAQA 2CX4A 3HDCA 1PGTA 4KGIA 2WFCA 3TKSE 3CTGA 3DRNA 2VM1A 3CBUA 4MZCA 4MF7A 5CO3A 4MJCA 4ULXA 3V1WA 5DJMA 1X5EA 3UARA 1YEPA 1XWAA 3LEFA 2EIQA 2H75A 4X0XA 1JLWA 1XPVA 2CZ2A 3TKPA 5JWQB 3KD0A 1GTIA 4N0VA 1Z9HA 1KNGA 4CHSA 2REMA 3GV1A 3H93A 1VF4A 4HZ2A 2N5AA 2TIRA 3APQA 4EKZA 2RIIA 5ECHB 1TKDB 3MAKA 5FHIA 3ISOA 1TK5B 2GS3A 1NSWA 1FB6A 2M80A 3R2QA 4OO5A 2PPTA 4L0UA 20GSA 5KN3A 1TK0B 3HD5A 3FZAA 1EZKA 4IJIA 4BWSA 2VL9A 5F07A 4ID0A 1HNCA 3EC3A 2WULA 2H6ZA 4POMA 3GH9A 4GRFA 2PN8A 4MLYA 4KW6A 4GXZA 4AJ8A 3LG6A 3TJKA 1SU9A 4HJ2A 2C0GA 4K2XA 2IMIA 2VCQA 1V98A 2H0IA 2GT5A 4O5UA 1TW9A 3K8NA 3CMIA 3KH9A 5ELAA 3C73A 4F0CA 5IM9A 3GHAA 5F8BA 3HCZA 3SWLA 4FYUA 1TDIA 4K7OA 1PRXA 1GH2A 4ECCA 2DMLA 2M46A 4V2LA 3UBKA 1SENA 3Q74A 3U5RE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D9V A;  3H1N A;  2C3Q A;  3P90 A;  1HNA A;  2B5X A;  1XOB A;  4MPF A;  3IAM 2;  1GSD A;  3HA9 A;  3ZVJ A;  5ECL B;  2H01 A;  4F0B A;  4KND A;  2F9S A;  1XVW A;  1I9D A;  5ECR B;  13GS A;  5F0G A;  1AQW A;  4NHZ A;  5DCH A;  2DJK A;  3HHV A;  1TRV A;  4NV2 A;  2GQK A;  2FWF A;  1PL1 A;  1EWX A;  2H70 A;  2L5O A;  4PQI A;  4K1F A;  3ED3 A;  3ZMK A;  4XS6 A;  4KCE A;  2K8S A;  5IQY A;  4MCU A;  2NBS A;  2JSZ A;  2TRC P;  2YWM A;  2NTO A;  2EIO A;  14GS A;  3N9J A;  2EC4 A;  2LST A;  1ZYE A;  3F4R A;  4JR6 A;  1R5A A;  5GSS A;  5IOX A;  2PER A;  3TJF A;  16GS A;  3DVX A;  1PX7 A;  2YV7 A;  3HXS A;  1WMJ A;  2CX3 A;  4BVX A;  1BG5 A;  2IMF A;  5G30 A;  3E0U A;  1EP8 A;  3EWL A;  2VOC A;  3LYP A;  4IQ1 A;  3M1G A;  2X64 A;  2A4V A;  2NDO A;  3J7Y b;  1VGL A;  4WEY A;  1M2D A;  4NXI A;  3IR4 A;  3A2V A;  4OCF A;  2R6K A;  2R3X A;  4V1A g;  3EU4 A;  3BOA A;  3QOU A;  2OAC A;  1AAZ A;  4L8E A;  3UIW A;  2QC7 A;  4TR4 A;  4HDE A;  5ECK B;  1NHY A;  2CVD A;  3QFB C;  3H4K A;  1SK0 A;  5D93 A;  2R2J A;  4IJ3 A;  1O8W A;  4PGT A;  4L5O A;  1U3A A;  2HRN A;  2L6D A;  3H79 A;  4J2F A;  4ZB9 A;  4HI7 A;  5IPH A;  1OC8 A;  4ZL9 A;  3UL3 A;  3M3M A;  4NMU A;  2C3T A;  5CNW A;  3RDW A;  2VL2 A;  1ZZY A;  2MMZ A;  3F63 A;  5EL8 A;  4MJA A;  5ECI B;  1HNB A;  3GKK A;  2GZY A;  3TJB A;  3VWV A;  4AJ6 A;  1SD9 A;  2OJL A;  2EIR A;  3L78 A;  3TKS A;  2H72 A;  2H73 A;  3FR3 A;  1SL2 B;  3MSZ A;  4RI6 A;  3QAG A;  4GCI A;  2B5E A;  1J9B A;  4EDZ A;  1XW6 A;  1V58 A;  2I81 A;  11GS A;  1SYX A;  1A23 A;  1OE8 A;  2H30 A;  1GL8 A;  2GZP A;  1WPI A;  2F8F A;  1PD2 1;  4I8B A;  4MDC A;  3TRQ A;  4V1A p;  1MTC A;  2AV4 A;  5ID2 A;  1ST9 A;  2LV3 A;  3MDK A;  4CW9 A;  3BBY A;  1SK1 A;  2X99 A;  3C1R A;  1XCC A;  2RM5 A;  1Z7R A;  4O7H A;  5HR1 A;  5INY A;  5G5E A;  3DML A;  5COH A;  2C4J A;  1JZW A;  6GSY A;  3GKX A;  3FZ9 A;  5DQS A;  2VCW A;  4F2I A;  4EE0 A;  4MK3 A;  2MYG A;  5HR3 A;  5IMF A;  1GTB A;  1WP0 A;  2C80 A;  3IDV A;  2LKU A;  2HNL A;  2GZZ A;  2TRX A;  3WGX A;  2G0F A;  1XOA A;  2H0H A;  3H8Q A;  1YQ1 A;  3KTL A;  3KZQ A;  4GQC A;  5ID2 B;  2WDU A;  2D2Z A;  1EV4 A;  4D73 A;  4KAE A;  1PL2 A;  5IMZ A;  5CYY A;  3UVT A;  4DSS A;  3HVV A;  1MDK A;  3GL5 A;  3GN3 A;  5DVB A;  4MP4 A;  4PNF A;  4RQR A;  4K0N A;  3U6V A;  5GZZ B;  4ZBD A;  4LL4 B;  3G7I A;  2WZ9 A;  4Q5Q A;  1MD4 A;  4EVM A;  1GRX A;  3GKM A;  3TKR A;  3VPQ A;  3D21 A;  1Z5Y E;  2BJX A;  4E8H A;  3TJJ A;  4OD7 A;  3AY8 A;  4WBJ A;  3F8U A;  3ZTL A;  3FR6 A;  5G5F A;  1MD3 A;  2C8U A;  4D73 B;  2A2R A;  4EF0 A;  1VF2 A;  3D6I A;  5H5R A;  2KHP A;  4DSS B;  3TKS C;  1UC7 A;  2CQ9 A;  1IYI A;  4H86 A;  4HQZ A;  3E3E A;  3EMX A;  3UBL A;  2PUK C;  2PGT A;  1WOU A;  1EGR A;  1ZOF A;  2E7P A;  3D4T A;  2VD0 A;  4TXO B;  4TVE A;  3DKS A;  1Z6M A;  2JL4 A;  3WT1 A;  3GH6 A;  4OMV A;  5F05 A;  1S3C A;  1SD8 A;  4N30 A;  3QD9 A;  2FNO A;  3HZ4 A;  4OFN A;  4HQS A;  1DE1 A;  3EUR A;  3N5O A;  5DJL A;  1XW5 A;  2VCX A;  3P8W A;  1Z6N A;  2LRT A;  2V2G A;  4MA9 A;  5D9T A;  1THX A;  1GTA A;  2C0D A;  3LFL A;  1Y6E A;  3TCO A;  2H1G A;  3ZYW A;  3DGQ A;  4ML6 A;  1XXU A;  4G10 A;  4GLT A;  4Q5R A;  3LSZ A;  4BWQ A;  2K6V A;  5G1L A;  5KN2 A;  1KBN A;  3HKR A;  4O5R A;  4DVC A;  2O87 A;  1PX6 A;  2HSH A;  5DQY A;  5EY6 A;  2PVO C;  5CRD A;  4YQU A;  1T4Y A;  4ZIL A;  2X8C A;  2GTU A;  2WGR A;  1XIY A;  4ZL8 A;  2F8A A;  1W89 A;  1U3I A;  1XWG A;  2ZUP A;  2HSY A;  3GUS A;  4WF5 A;  1ERU A;  4POK A;  2H0G A;  3TB2 A;  4ECB A;  4G19 A;  4ISD A;  4DSR A;  4KDY A;  1BED A;  1R7H A;  3BCI A;  1W4V A;  2I1U A;  4TR3 A;  4KH7 A;  2IJY A;  2OBK A;  2XPD A;  3UMA A;  4OFT A;  3DYR A;  3ZRD A;  10GS A;  2JAC A;  1GUK A;  3FK8 A;  4JED A;  2IME A;  4ILF A;  3ZFL A;  5A4V A;  2VLT A;  4J56 E;  4IEL A;  2C1Y A;  1O8X A;  4HJM A;  2LRC A;  2BMX A;  1FG4 A;  5D8I A;  2YCD A;  4GSS A;  3E9J B;  2F3M A;  3IC4 A;  4MF6 A;  1YF0 A;  2GSQ A;  3C71 A;  2B5Y A;  1F3B A;  2MMN A;  3J7Y k;  5G1K A;  5A5K A;  5AIV A;  3DVW A;  1K0A A;  4YH2 A;  1T7P B;  1K3O A;  3F3R A;  2IWT A;  1ZGN A;  2H6Y A;  5E59 A;  5C00 A;  2AAW A;  4L0W A;  1UN2 A;  2DJ2 A;  2R37 A;  3SBC A;  1XW9 A;  3APO A;  3O76 A;  1SKS B;  2KLX A;  5LNK e;  3ZLP A;  4KSO A;  3KMN A;  1T1V A;  3LXT A;  4EDY A;  1GUL A;  2P5R A;  4I5Q A;  4PNG A;  2FCH A;  2VCZ A;  3LWA A;  2LS5 A;  1EGO A;  2YOI A;  5ECQ B;  3L4N A;  4N0Z A;  2OBI A;  4IP1 A;  3ERF A;  2CVK A;  1MDI A;  2FA4 A;  3ZIJ A;  1TRU A;  1LU4 A;  5A4U A;  1JHB A;  1OKT A;  3FKF A;  1Q4J A;  4RQX A;  3ZL5 A;  3W6G A;  1PMT A;  1X0R A;  3FZ4 A;  4MF5 A;  3GX8 A;  3G9B A;  2ON5 A;  1ZYQ B;  3VWU A;  1GLP A;  1QFN A;  3IRA A;  3OR5 A;  2J23 A;  3CXG A;  3IBH A;  2DLX A;  1YJ6 A;  4X1U A;  5IPG A;  4K2D A;  3EVI A;  3TGZ A;  4LL1 B;  4KCA A;  4JBB A;  4RI7 A;  5D73 A;  3RHB A;  1UA5 A;  1SL1 B;  3S9F A;  2K18 A;  1V9W A;  1X9W B;  3ZRE A;  1B9X C;  3O6T A;  2KOK A;  5DDL A;  4FYC A;  1BAY A;  2L57 A;  5IMV A;  1XBS A;  1EOH A;  3HJO A;  2YPM A;  4EO3 A;  2YWO A;  4GSN A;  1WRY A;  5EVO A;  4BA7 A;  2XBQ A;  2E0Q A;  4KX4 A;  4OFM A;  1GNW A;  1F2E A;  2CT6 A;  2B7J A;  1H75 A;  5B7C A;  8GSS A;  1SL0 B;  12GS A;  5AGY A;  1G6Y A;  2L59 A;  4ZBB A;  4OWY A;  1U6T A;  4HUA A;  3JCM L;  1DSB A;  1O85 A;  4PUF C;  1WIK A;  2LNT A;  1WE0 A;  2DC5 A;  2DJJ A;  1ILO A;  4OO4 A;  3FYG A;  1B9Y C;  3DIE A;  1FOV A;  2IMD A;  2HE3 A;  5J5N A;  1THO A;  3A5W A;  5H5Q A;  4F9Z A;  4HZ4 A;  2YZU A;  5B6N A;  3GFK A;  1QMV A;  4MAB A;  1TI1 A;  3WGE A;  1IYH A;  2HZF A;  3QR6 A;  3LOR A;  2JZS A;  2LTK A;  4ZL7 A;  3KIJ A;  3W8S A;  2HI7 A;  4MZB A;  3VK9 A;  2YNX A;  1O7U A;  3VUR A;  3IK9 A;  3TOT A;  3C8E A;  1EOG A;  4LMV A;  1CQG A;  4Q5N A;  3M9K A;  4V2M A;  2VAF A;  2JZR A;  2HFD A;  4MH2 A;  5DAK B;  3GIX A;  2GQM A;  4HU7 A;  2FWE A;  1A2M A;  3KM6 A;  2B6M A;  4PXO A;  9GSS A;  1N8J A;  19GS A;  1VRS D;  4AF2 A;  5KEJ A;  2GT6 A;  1DBY A;  3IE3 A;  3IPZ A;  4JZQ A;  1E6B A;  5FWG A;  4JE1 A;  1JFU A;  3O3T A;  5J9C A;  2B3S A;  2V1M A;  4P3Y B;  2YP6 A;  1FAA A;  2L5L A;  2OE0 A;  4MPG A;  2LNS A;  1XZO A;  1TRS A;  1JZR A;  2RM6 A;  3CSI A;  18GS A;  1K3Y A;  4AJ7 A;  1USB A;  4ZBA A;  4LLR A;  2FWH A;  5CAX A;  4FH8 A;  3I43 A;  3ZVJ D;  5LCZ A;  2P0G A;  5FT3 A;  4K7I A;  5ECO B;  4ZIJ A;  4DEJ A;  4HS1 A;  4CDO A;  1QQ2 A;  1YF1 A;  1YEX A;  5IOW A;  2IFQ A;  2CVB A;  1R26 A;  1RQM A;  1A8L A;  5G31 A;  2YWI A;  1T4Z A;  2MBS A;  2K8V A;  2O85 A;  4I2U A;  1U88 A;  1AQX A;  3IOS A;  4IVF A;  1EEM A;  2WS2 A;  3F4S A;  5HR0 A;  3MWH A;  2Z9S A;  3GUR A;  5JCU A;  4EC0 A;  4NV5 A;  5IMD A;  2O8V B;  4ZB6 A;  6GSX A;  1HD2 A;  2GLR A;  2P31 A;  4IKH A;  1SKW B;  2HRF A;  1G6W A;  1AIU A;  3QAW A;  1WWJ A;  1JLV A;  3L9V A;  1GUH A;  1QK8 A;  2GGT A;  3Q18 A;  1B48 A;  3QCP A;  3RHC A;  3KJY A;  3KXO A;  1R5P A;  1M2B A;  2HT9 A;  5HFI A;  2H66 A;  2GDR A;  4ACS A;  2YN1 A;  4EL1 A;  2DBC A;  2FGX A;  1K0B A;  3D22 A;  4XS1 A;  2IFQ B;  2V32 A;  1O81 A;  1F6M C;  2RLI A;  2VO4 A;  4PQ1 A;  1V57 A;  5GST A;  4TN8 A;  2WRT A;  5IO0 A;  5B8A A;  1OAZ A;  2CV4 A;  1AUC A;  4XTS A;  5AIX A;  4L5L A;  4QL9 A;  3GST A;  1TU8 A;  3KP9 A;  3DWV A;  4BL7 A;  3GKN A;  4TXO A;  5D9X A;  1AC1 A;  1A0R P;  5HQP A;  1ON4 A;  1J0F A;  2I3Y A;  1B4P A;  1KTE A;  3ZML A;  3QMX A;  4KB3 A;  4KA0 A;  2LRN A;  3DEX A;  5JWR B;  3ME7 A;  2R4V A;  2XHF A;  4Q5F A;  4ML1 A;  3IV4 A;  2QGV A;  1LJR A;  2H1D A;  2R5G A;  3I6A A;  2L4Q A;  2VLU A;  2CZ3 A;  2ZNM A;  1YKC A;  5J41 A;  1SKR B;  2ZCT A;  2O7K A;  2VUP A;  7GSS A;  2IL3 A;  6GST A;  3ERG A;  3GMF A;  2KP1 A;  4PX1 A;  3C7M A;  2OE1 A;  1A2J A;  3HVX A;  3EU3 A;  4FYB A;  1X5D A;  4G2E A;  1M99 A;  2GSR A;  1Q98 A;  3KTB A;  4DSQ A;  3US3 A;  1K0N A;  4YQV A;  5JCG A;  5AN1 A;  1PN9 A;  3HVS A;  1CQH A;  1XVQ A;  3L9U A;  5ECS A;  2XBI A;  1M0U A;  1V2A A;  3QDN A;  1VF3 A;  1HQO A;  4KDU A;  4E8E A;  2IMK A;  4XCS A;  2HZE A;  3M0F A;  1LBK A;  4BVY A;  3QPM A;  4WR4 A;  3Q6O A;  1GSQ A;  4XRA A;  2DJ3 A;  2CA8 A;  2I4A A;  1TXX A;  5JCW A;  3EYT A;  4GQF A;  5HFG A;  3KH7 A;  1O6J A;  4X43 A;  2VLV A;  5HFK A;  1K0D A;  4AGS A;  2GST A;  1GTU A;  3WYW A;  1GWC A;  4ECJ A;  1C72 A;  1ZMA A;  1H4O A;  3TUE A;  2V41 A;  1F3A A;  5J4U A;  4XHM A;  2QSI A;  1HYU A;  1NHO A;  3CTF A;  5IO2 A;  3IA1 A;  3GTU A;  2DIZ A;  1TI3 A;  2HZE B;  3LQ7 A;  1FHE A;  2HYX A;  2QKE A;  4PUR A;  5C04 A;  4TR1 A;  4YQM A;  3F3Q A;  5ENU A;  2DIY A;  3EE2 A;  5GAN D;  3ZIT A;  1ZCP A;  4IN0 A;  4K6X A;  4KUN A;  5D9W A;  3NZN A;  1GP1 A;  4YAV A;  4HOJ A;  3F9U A;  2PU9 C;  3I69 A;  1T00 A;  1TK8 B;  2V6K A;  2A2S A;  4J57 E;  4ECI A;  4YAP A;  2I9H A;  1SJI A;  1PKW A;  5J3R A;  1JZO A;  2L6C A;  1VF1 A;  1AXD A;  2PWJ A;  1Z3E A;  3CYN A;  1OE7 A;  1YY7 A;  4TKY A;  4IQA A;  6GSS A;  4EUY A;  4N10 A;  5HR2 A;  4IBP A;  2GSS A;  3FEU A;  3GTU B;  2V6O A;  3TOU A;  1MDJ A;  4QQ7 A;  2OE3 A;  1M9B A;  3I9V 2;  4K8M A;  2AJQ B;  2C0F A;  4TR1 B;  5B8B A;  2NPB A;  3FHK A;  2PBJ A;  4IGJ A;  1BYE A;  3P7X A;  2C0E A;  2JAD A;  5CRW A;  1ACV A;  3M8N A;  3G7J A;  1OC9 A;  4NHW A;  2L4C A;  3L0H A;  3BCK A;  1Z7P A;  2AUV A;  2FA8 A;  4EXJ A;  1QGV A;  2LJK A;  2AHE A;  1OYJ A;  3D0Z A;  5LD0 A;  4KDX A;  2FLS A;  4QL7 A;  3KGK A;  3TRX A;  5B6M A;  2O89 A;  1OVN A;  2LQO A;  3ME8 A;  1XWK A;  3C1S A;  3WD6 A;  4I2T A;  5D96 A;  2JSY A;  2H71 A;  3EMP A;  4N11 A;  1E2Y A;  2VIM A;  1WJK A;  2KUC A;  1B4Q A;  1JZD A;  3CSH A;  2OKA A;  1RK4 A;  6GSU A;  2DMM A;  1ZL9 A;  4TR0 A;  3IAS 2;  1U87 A;  4Z7X A;  3VPT A;  4MH3 A;  1FB0 A;  1EV9 A;  1GNE A;  1G7E A;  1OC9 B;  1A2L A;  2LEG A;  3TRP A;  4BPY A;  4O32 A;  3GX0 A;  2PMT A;  5DAL A;  4GWR A;  1K0M A;  1EP7 A;  1TP9 A;  2N5B A;  1GSF A;  2B1K A;  1K0C A;  4PUA A;  3VFI A;  4F03 A;  5CRH A;  2YV9 A;  2F51 A;  3LYK A;  1ERV A;  3ZFB A;  1G7O A;  3KMO A;  1QUW A;  2H1A A;  3ERW A;  1GUM A;  1PA3 A;  1TU7 A;  2H1B A;  1A0F A;  5DAK A;  3NIV A;  3PIN A;  3UVH A;  2H76 A;  3VWW A;  1GSU A;  2MMA A;  5CP1 A;  3CRT A;  4HU9 A;  1EEJ A;  4WBR D;  4LMW A;  1O73 A;  1AQV A;  2WB9 A;  5DAL B;  2ES7 A;  3VWX A;  3LJR A;  4WXT A;  3FR9 A;  3FW2 A;  1S3D A;  1ERW A;  2VL3 A;  5ECP B;  2NVL A;  4LA1 A;  5J9B A;  2H74 A;  3F4T A;  4JRR A;  2JU5 A;  4XRD A;  4IW9 A;  5A4W A;  4K7N A;  5IIZ A;  1SJ6 A;  3IK7 A;  1T3B A;  1B8X A;  1V40 A;  4MZW A;  3GSS A;  2VM2 A;  4ZXG A;  2H6X A;  2OA7 A;  1KEB A;  4XS4 A;  3F0I A;  1FVJ A;  1GSY A;  2YAN A;  4NAX A;  2WCI A;  2FD3 A;  3A3T A;  3VI7 A;  4I6X A;  5H5S A;  1NW2 A;  3FZ5 A;  2FWG A;  3HYP A;  2MZC A;  3FY7 A;  1X9M B;  1FVK A;  5IMC A;  17GS A;  1M9A A;  2G2Q A;  2HLS A;  3HZ8 A;  3KP8 A;  3KCM A;  4V2N A;  1K3L A;  2WJU A;  4TOP A;  2VCV A;  3D4M A;  3IHQ A;  5CRG A;  3KEB A;  1NM3 A;  1OKD A;  4G9H A;  2BTO T;  2N5F A;  3UJ1 A;  3DD3 A;  1BX9 A;  2M72 A;  4OCE A;  2FHE A;  4JU5 A;  1S3A A;  6GSV A;  1BJX A;  3F6F A;  2GVP A;  1TRW A;  2LJA A;  3BJ5 A;  2AYT A;  2LUS A;  3LXZ A;  3L9S A;  3ZIV A;  4GTU A;  3UEM A;  2E2M A;  4RUV A;  3IXR A;  1FO5 A;  3VLN A;  4XIH A;  4XS4 B;  1SYR A;  5AIS A;  2AB6 A;  4TXV A;  5EPF A;  2X8H A;  3PH9 A;  2GQL A;  5G2Z A;  3DXB A;  3PGT A;  1I5G A;  3RPP A;  2VD1 A;  5ECM B;  1F37 A;  1RW1 A;  4FO5 A;  3FRC A;  4F82 A;  4K0G A;  2IPA A;  4HEA 2;  5ELG A;  2B1L A;  1GLQ A;  2CAI A;  2DJ1 A;  1A24 A;  2E2G A;  3P2A A;  2LQQ A;  2FUG 2;  1XWC A;  4O92 A;  1J08 A;  4MJB A;  3VI5 A;  5ECN B;  5F06 A;  3EIN A;  3WGD A;  2XPE A;  2YWN A;  1DE2 A;  1TOF A;  1X5C A;  4WKW A;  5JWO B;  5ABR A;  3PR8 A;  1N2A A;  1ML6 A;  1URM A;  3HJP A;  3QFA C;  3HJM A;  4I97 A;  6GSW A;  1TJD A;  5KN0 A;  2HXK A;  4IHU A;  2RUF A;  4KSM A;  3WT2 A;  3RAZ A;  2ON7 A;  1SK2 A;  3GYK A;  4K9Z A;  22GS A;  2YJH A;  3GL3 A;  3GA4 A;  2XC2 A;  2DSA A;  5KN1 A;  4POL A;  4FIW A;  3GNJ A;  1YDK A;  1UVZ A;  1K0O A;  1YZX A;  3Q19 A;  3HY2 A;  1T8E B;  1PQN A;  2X8G A;  3RPN A;  4PQH A;  1G0T A;  1F9M A;  4WET A;  2H8L A;  1OC3 A;  3TJG A;  4POB A;  2PVQ A;  2DJ0 A;  1BQ7 A;  5CRE A;  1DUG A;  5DBQ A;  1X9S B;  4IS0 A;  3CSJ A;  3UOM A;  2KP2 A;  1ERT A;  2VL2 C;  2J9H A;  1PKZ A;  2VCT A;  3D5J A;  4TRX A;  3GRX A;  5L71 A;  2P5Q A;  1R4W A;  2OAD A;  3M9J A;  2K9F A;  4MJE A;  3LGC A;  1PSQ A;  4WF4 A;  1SJZ A;  3UAP A;  1Y25 A;  1FW1 A;  1XFL A;  1ABA A;  1GSE A;  3G7Y A;  3BD2 A;  4NWY A;  1XWB A;  4GF0 A;  3A2W A;  1TTZ A;  4WR5 A;  5IMA A;  3CRU A;  5E4W A;  2B7K A;  3MNG A;  2MBT A;  1AW9 A;  2C3N A;  3TKQ A;  4TW5 A;  1A8Y A;  3F6D A;  1GSS A;  1M7T A;  2ALB A;  2IN3 A;  3A2X A;  3TDG A;  2FY6 A;  3APS A;  2LJR A;  4JR4 A;  3RBT A;  5GAP D;  2YJ7 A;  2H19 A;  2JZT A;  5DCG A;  4IP6 A;  1QXH A;  3ZZX A;  2MMO A;  3NOF A;  2RUE A;  2IIY A;  4MMM A;  1M2A A;  2YZH A;  3QAV A;  4NPB A;  4GST A;  4ZB8 A;  1MEK A;  3W8J A;  4KE3 A;  1YKA A;  2CAQ A;  2CX4 A;  3HDC A;  1PGT A;  4KGI A;  2WFC A;  3TKS E;  3CTG A;  3DRN A;  2VM1 A;  3CBU A;  4MZC A;  4MF7 A;  5CO3 A;  4MJC A;  4ULX A;  3V1W A;  5DJM A;  1X5E A;  3UAR A;  1YEP A;  1XWA A;  3LEF A;  2EIQ A;  2H75 A;  4X0X A;  1JLW A;  1XPV A;  2CZ2 A;  3TKP A;  5JWQ B;  3KD0 A;  1GTI A;  4N0V A;  1Z9H A;  1KNG A;  4CHS A;  2REM A;  3GV1 A;  3H93 A;  1VF4 A;  4HZ2 A;  2N5A A;  2TIR A;  3APQ A;  4EKZ A;  2RII A;  5ECH B;  1TKD B;  3MAK A;  5FHI A;  3ISO A;  1TK5 B;  2GS3 A;  1NSW A;  1FB6 A;  2M80 A;  3R2Q A;  4OO5 A;  2PPT A;  4L0U A;  20GS A;  5KN3 A;  1TK0 B;  3HD5 A;  3FZA A;  1EZK A;  4IJI A;  4BWS A;  5F07 A;  2VL9 A;  4ID0 A;  1HNC A;  3EC3 A;  2WUL A;  2H6Z A;  4POM A;  3GH9 A;  4GRF A;  2PN8 A;  4MLY A;  4KW6 A;  4GXZ A;  4AJ8 A;  3LG6 A;  3TJK A;  1SU9 A;  4HJ2 A;  2C0G A;  2IMI A;  2VCQ A;  1V98 A;  2H0I A;  2GT5 A;  1TW9 A;  3K8N A;  3CMI A;  3KH9 A;  5ELA A;  3C73 A;  4F0C A;  5IM9 A;  3GHA A;  5F8B A;  3HCZ A;  3SWL A;  4FYU A;  1TDI A;  4K7O A;  1PRX A;  1GH2 A;  4ECC A;  2DML A;  2M46 A;  4V2L A;  3UBK A;  1SEN A;  3Q74 A;  3U5R E; 
#chains in the Genus database with same CATH topology
 5D9V A;  3H1N A;  2C3Q A;  3P90 A;  1HNA A;  2B5X A;  1XOB A;  4MPF A;  3IAM 2;  1GSD A;  3HA9 A;  3ZVJ A;  5ECL B;  2H01 A;  4F0B A;  4KND A;  2F9S A;  1XVW A;  4EIQ A;  1I9D A;  5ECR B;  13GS A;  5F0G A;  1AQW A;  4NHZ A;  5DCH A;  2DJK A;  3HHV A;  1TRV A;  4NV2 A;  2GQK A;  2FWF A;  1PL1 A;  1EWX A;  2H70 A;  2L5O A;  4PQI A;  4K1F A;  3ED3 A;  3ZMK A;  4XS6 A;  4KCE A;  2K8S A;  5IQY A;  4MCU A;  2NBS A;  2JSZ A;  2TRC P;  2YWM A;  2NTO A;  2EIO A;  14GS A;  3N9J A;  2EC4 A;  2LST A;  1ZYE A;  3F4R A;  4JR6 A;  1R5A A;  5GSS A;  5IOX A;  2PER A;  3TJF A;  16GS A;  5BMU A;  3DVX A;  1PX7 A;  2YV7 A;  3HXS A;  1WMJ A;  2CX3 A;  4BVX A;  1BG5 A;  2IMF A;  5G30 A;  3E0U A;  1EP8 A;  3EWL A;  2VOC A;  3LYP A;  4IQ1 A;  3M1G A;  2X64 A;  2A4V A;  2NDO A;  3J7Y b;  2QA1 A;  1VGL A;  4WEY A;  1M2D A;  4NXI A;  3IR4 A;  3A2V A;  4OCF A;  2R6K A;  2R3X A;  4V1A g;  3EU4 A;  3BOA A;  3QOU A;  2OAC A;  3CQF A;  1AAZ A;  4L8E A;  3UIW A;  2QC7 A;  4TR4 A;  4HDE A;  5ECK B;  4BIK A;  1NHY A;  2CVD A;  3QFB C;  3H4K A;  1SK0 A;  5D93 A;  2R2J A;  4IJ3 A;  1O8W A;  4PGT A;  4L5O A;  1U3A A;  2HRN A;  2L6D A;  3H79 A;  4J2F A;  3HVN A;  4ZB9 A;  4HI7 A;  5IPH A;  1OC8 A;  4ZL9 A;  3IC8 A;  4BVX B;  3UL3 A;  3M3M A;  4NMU A;  2C3T A;  5CNW A;  3RDW A;  2VL2 A;  1ZZY A;  2MMZ A;  3F63 A;  5EL8 A;  1PN0 A;  4MJA A;  5ECI B;  1HNB A;  3GKK A;  2GZY A;  3TJB A;  3VWV A;  4AJ6 A;  1SD9 A;  2OJL A;  2EIR A;  3L78 A;  3TKS A;  2H72 A;  2H73 A;  3FR3 A;  1SL2 B;  3MSZ A;  4RI6 A;  3QAG A;  4GCI A;  4KF9 A;  2B5E A;  1J9B A;  4EDZ A;  1XW6 A;  1V58 A;  2I81 A;  11GS A;  1SYX A;  1A23 A;  1OE8 A;  2H30 A;  1GL8 A;  4G0I A;  2GZP A;  1WPI A;  2F8F A;  1PD2 1;  4I8B A;  4MDC A;  3TRQ A;  4V1A p;  1MTC A;  2AV4 A;  5ID2 A;  1ST9 A;  2LV3 A;  3MDK A;  4CW9 A;  3BBY A;  1SK1 A;  2X99 A;  3C1R A;  1XCC A;  2RM5 A;  1Z7R A;  4O7H A;  5HR1 A;  5INY A;  5G5E A;  3DML A;  5COH A;  2C4J A;  1JZW A;  6GSY A;  3GKX A;  3FZ9 A;  5DQS A;  2VCW A;  4F2I A;  4EE0 A;  4MK3 A;  2MYG A;  5HR3 A;  5IMF A;  1GTB A;  1WP0 A;  2C80 A;  3IDV A;  2LKU A;  2HNL A;  2GZZ A;  2TRX A;  3WGX A;  2G0F A;  1XOA A;  2H0H A;  3H8Q A;  1YQ1 A;  3KTL A;  3KZQ A;  4GQC A;  5ID2 B;  2WDU A;  2D2Z A;  1EV4 A;  4D73 A;  4KAE A;  1PL2 A;  5IMZ A;  5CYY A;  3UVT A;  4DSS A;  3HVV A;  1MDK A;  5BRT A;  3GL5 A;  3GN3 A;  5DVB A;  4MP4 A;  4PNF A;  4RQR A;  4K0N A;  3U6V A;  5GZZ B;  2X4A A;  2R0P A;  4LL4 B;  3G7I A;  2WZ9 A;  4ZBD A;  4Q5Q A;  1MD4 A;  4EVM A;  1GRX A;  3GKM A;  3TKR A;  3VPQ A;  3D21 A;  1Z5Y E;  2BJX A;  4E8H A;  3TJJ A;  4OD7 A;  3AY8 A;  4WBJ A;  3F8U A;  3ZTL A;  3FR6 A;  5G5F A;  1MD3 A;  2C8U A;  4D73 B;  2A2R A;  4EF0 A;  1VF2 A;  3D6I A;  5H5R A;  2KHP A;  4DSS B;  3TKS C;  1UC7 A;  2CQ9 A;  1IYI A;  4H86 A;  4HQZ A;  3E3E A;  3EMX A;  3UBL A;  2PUK C;  2PGT A;  1WOU A;  1EGR A;  1ZOF A;  2E7P A;  3D4T A;  2VD0 A;  4TXO B;  4TVE A;  3DKS A;  1S3R A;  4PTS A;  1Z6M A;  2JL4 A;  3WT1 A;  3GH6 A;  4OMV A;  5F05 A;  1S3C A;  1SD8 A;  4N30 A;  3QD9 A;  2FNO A;  3HZ4 A;  4OFN A;  4HQS A;  1DE1 A;  3EUR A;  3N5O A;  5DJL A;  1XW5 A;  4CY6 A;  2VCX A;  3P8W A;  1Z6N A;  2LRT A;  2V2G A;  4MA9 A;  5D9T A;  1THX A;  1GTA A;  2C0D A;  3LFL A;  1Y6E A;  3TCO A;  2H1G A;  3ZYW A;  3DGQ A;  4ML6 A;  1XXU A;  4G10 A;  4GLT A;  4Q5R A;  3LSZ A;  4BWQ A;  2K6V A;  5G1L A;  5KN2 A;  1KBN A;  4CY8 A;  3HKR A;  4O5R A;  4USS A;  4DVC A;  2O87 A;  1PX6 A;  2HSH A;  5DQY A;  5EY6 A;  2PVO C;  4G0L A;  5CRD A;  4YQU A;  1T4Y A;  4ZIL A;  2X8C A;  2GTU A;  2WGR A;  1XIY A;  4ZL8 A;  2F8A A;  1W89 A;  1U3I A;  2QA2 A;  1XWG A;  2ZUP A;  2HSY A;  3GUS A;  4WF5 A;  1ERU A;  4POK A;  2H0G A;  3TB2 A;  4ECB A;  4G19 A;  4ISD A;  4DSR A;  4KDY A;  1BED A;  1R7H A;  3BCI A;  1W4V A;  2I1U A;  4TR3 A;  4KH7 A;  2IJY A;  2OBK A;  2XPD A;  3UMA A;  4OFT A;  3DYR A;  3ZRD A;  10GS A;  2JAC A;  1GUK A;  3FK8 A;  4JED A;  2IME A;  4ILF A;  3ZFL A;  5A4V A;  2VLT A;  4J56 E;  4IEL A;  2C1Y A;  1O8X A;  4HJM A;  4Z2U A;  2LRC A;  2BMX A;  4O5Q A;  1FG4 A;  5D8I A;  2YCD A;  4GSS A;  3E9J B;  2F3M A;  3IC4 A;  4MF6 A;  1YF0 A;  5KOX A;  3MYD A;  2GSQ A;  3C71 A;  2B5Y A;  1F3B A;  2MMN A;  3J7Y k;  5G1K A;  5A5K A;  5AIV A;  4Z2T A;  3DVW A;  1K0A A;  4YH2 A;  1T7P B;  1K3O A;  3F3R A;  2IWT A;  1ZGN A;  2H6Y A;  5E59 A;  5C00 A;  2AAW A;  4L0W A;  1UN2 A;  2DJ2 A;  2R37 A;  3SBC A;  1XW9 A;  3APO A;  3O76 A;  1SKS B;  2KLX A;  5LNK e;  3ZLP A;  4KSO A;  3KMN A;  1T1V A;  3LXT A;  4EDY A;  1GUL A;  2P5R A;  4I5Q A;  4PNG A;  2FCH A;  2VCZ A;  3LWA A;  2LS5 A;  1EGO A;  2YOI A;  5ECQ B;  3L4N A;  4N0Z A;  2OBI A;  4IP1 A;  3ERF A;  2CVK A;  1MDI A;  2FA4 A;  3ZIJ A;  1TRU A;  1LU4 A;  5A4U A;  1JHB A;  1OKT A;  3FKF A;  1Q4J A;  4RQX A;  3ZL5 A;  3W6G A;  1PMT A;  1X0R A;  3FZ4 A;  4MF5 A;  3GX8 A;  3G9B A;  2ON5 A;  1ZYQ B;  3VWU A;  1GLP A;  1QFN A;  3IRA A;  3OR5 A;  2J23 A;  3CXG A;  3IBH A;  2DLX A;  1YJ6 A;  4X1U A;  5IPG A;  4K2D A;  3EVI A;  3TGZ A;  4LL1 B;  4KCA A;  4JBB A;  4RI7 A;  5D73 A;  3RHB A;  1UA5 A;  1SL1 B;  3S9F A;  2K18 A;  1V9W A;  1X9W B;  3ZRE A;  1B9X C;  3O6T A;  2KOK A;  5DDL A;  4FYC A;  1BAY A;  2L57 A;  5IMV A;  1XBS A;  1EOH A;  2HRA A;  3HJO A;  2YPM A;  4EO3 A;  2YWO A;  4GSN A;  1WRY A;  5EVO A;  4BA7 A;  2XBQ A;  2E0Q A;  4KX4 A;  4OFM A;  1GNW A;  1F2E A;  2CT6 A;  2B7J A;  1H75 A;  5B7C A;  8GSS A;  1SL0 B;  12GS A;  5AGY A;  1G6Y A;  2L59 A;  4ZBB A;  4OWY A;  1U6T A;  4HUA A;  3JCM L;  1DSB A;  1O85 A;  4PUF C;  1WIK A;  2LNT A;  1WE0 A;  2DC5 A;  2DJJ A;  1ILO A;  4OO4 A;  3FYG A;  1B9Y C;  3DIE A;  1FOV A;  2IMD A;  2HE3 A;  3R3E A;  5J5N A;  1THO A;  3A5W A;  5H5Q A;  2DKH A;  4HZ4 A;  4F9Z A;  2YZU A;  5B6N A;  3GFK A;  1QMV A;  4MAB A;  1TI1 A;  3WGE A;  1IYH A;  2HZF A;  3QR6 A;  3LOR A;  2JZS A;  2LTK A;  4ZL7 A;  3KIJ A;  3W8S A;  2HI7 A;  4MZB A;  3VK9 A;  2YNX A;  1O7U A;  3VUR A;  3IK9 A;  3TOT A;  3C8E A;  1EOG A;  4LMV A;  1CQG A;  4Q5N A;  3M9K A;  4V2M A;  2VAF A;  2JZR A;  2HFD A;  4MH2 A;  5DAK B;  3GIX A;  2GQM A;  4HU7 A;  2FWE A;  1A2M A;  3KM6 A;  2B6M A;  4YKG A;  4PXO A;  9GSS A;  1N8J A;  19GS A;  1VRS D;  4AF2 A;  5KEJ A;  2GT6 A;  1DBY A;  3IE3 A;  3IPZ A;  4JZQ A;  1E6B A;  5FWG A;  4JE1 A;  1JFU A;  3O3T A;  1FOH A;  5J9C A;  2B3S A;  2V1M A;  4P3Y B;  2YP6 A;  1FAA A;  2L5L A;  2OE0 A;  4MPG A;  2LNS A;  1XZO A;  1TRS A;  1JZR A;  2RM6 A;  3CSI A;  18GS A;  1K3Y A;  4AJ7 A;  1USB A;  4ZBA A;  4LLR A;  2FWH A;  5CAX A;  4FH8 A;  3I43 A;  3ZVJ D;  5LCZ A;  2P0G A;  5FT3 A;  4K7I A;  5ECO B;  4ZIJ A;  4DEJ A;  4HS1 A;  4CDO A;  1QQ2 A;  1YF1 A;  1YEX A;  5IOW A;  2IFQ A;  2CVB A;  1R26 A;  1RQM A;  1A8L A;  5G31 A;  2DKI A;  2YWI A;  1T4Z A;  2MBS A;  2K8V A;  2O85 A;  4I2U A;  1U88 A;  1AQX A;  3IOS A;  4IVF A;  1EEM A;  2WS2 A;  3F4S A;  5HR0 A;  3MWH A;  2Z9S A;  3GUR A;  5JCU A;  4EC0 A;  4FQU A;  4NV5 A;  5IMD A;  2O8V B;  4ZB6 A;  6GSX A;  1HD2 A;  2GLR A;  2P31 A;  4IKH A;  1SKW B;  2HRF A;  1G6W A;  1AIU A;  3QAW A;  1WWJ A;  1JLV A;  3L9V A;  1GUH A;  1QK8 A;  2GGT A;  3Q18 A;  1B48 A;  3QCP A;  3RHC A;  3KJY A;  3KXO A;  1R5P A;  1M2B A;  2HT9 A;  5HFI A;  2H66 A;  2GDR A;  4ACS A;  2YN1 A;  4EL1 A;  2DBC A;  2FGX A;  1K0B A;  3D22 A;  4XS1 A;  2IFQ B;  2V32 A;  1O81 A;  3A5I A;  1F6M C;  2RLI A;  2VO4 A;  4PQ1 A;  1V57 A;  5GST A;  4TN8 A;  2HRK A;  2WRT A;  5IO0 A;  5B8A A;  1OAZ A;  2CV4 A;  1AUC A;  4XTS A;  5AIX A;  4L5L A;  4QL9 A;  3GST A;  1M3I A;  1TU8 A;  3KP9 A;  3DWV A;  4BL7 A;  3GKN A;  4TXO A;  5D9X A;  1AC1 A;  1A0R P;  5HQP A;  1ON4 A;  1J0F A;  2I3Y A;  1B4P A;  1KTE A;  1ZYP A;  3QMX A;  3ZML A;  4KB3 A;  4KA0 A;  4K5S A;  2LRN A;  3DEX A;  5JWR B;  3ME7 A;  2R4V A;  2XHF A;  4Q5F A;  4ML1 A;  3IV4 A;  2QGV A;  1LJR A;  4G0K A;  2H1D A;  2R5G A;  3I6A A;  2L4Q A;  2VLU A;  2CZ3 A;  5KOW A;  2ZNM A;  1YKC A;  5J41 A;  1SKR B;  2ZCT A;  2O7K A;  2VUP A;  7GSS A;  2IL3 A;  6GST A;  3ERG A;  3GMF A;  2KP1 A;  4PX1 A;  3C7M A;  4Z2R A;  4A5P A;  4BL7 B;  2OE1 A;  1A2J A;  3HVX A;  2HSM A;  3EU3 A;  1X5D A;  4FYB A;  4G2E A;  1M99 A;  2GSR A;  1Q98 A;  3KTB A;  4DSQ A;  3US3 A;  1K0N A;  4YQV A;  5JCG A;  5AN1 A;  1PN9 A;  3HVS A;  1CQH A;  1XVQ A;  3L9U A;  5ECS A;  2XBI A;  1M0U A;  1V2A A;  3QDN A;  1VF3 A;  1HQO A;  4KDU A;  4E8E A;  2IMK A;  4XCS A;  2HZE A;  3M0F A;  1LBK A;  4BVY A;  3QPM A;  4WR4 A;  3Q6O A;  1GSQ A;  4XRA A;  2DJ3 A;  2CA8 A;  2I4A A;  1TXX A;  5JCW A;  3EYT A;  4GQF A;  5HFG A;  3KH7 A;  1O6J A;  4X43 A;  2VLV A;  5HFK A;  1K0D A;  4AGS A;  2GST A;  1GTU A;  3WYW A;  1GWC A;  4ECJ A;  1C72 A;  1ZMA A;  1H4O A;  3TUE A;  2V41 A;  1F3A A;  5J4U A;  4XHM A;  2QSI A;  1HYU A;  1NHO A;  3CTF A;  5IO2 A;  3IA1 A;  3GTU A;  2DIZ A;  1TI3 A;  2HZE B;  3LQ7 A;  1FHE A;  2HYX A;  2QKE A;  4PUR A;  5C04 A;  4TR1 A;  4BVY B;  4YQM A;  3F3Q A;  5ENU A;  2DIY A;  3EE2 A;  5GAN D;  3ZIT A;  1ZCP A;  4IN0 A;  4K6X A;  4KUN A;  5D9W A;  3NZN A;  1GP1 A;  4YAV A;  4HOJ A;  3F9U A;  2PU9 C;  3I69 A;  1T00 A;  1TK8 B;  2V6K A;  2A2S A;  4J57 E;  4ECI A;  4X4J A;  4YAP A;  2I9H A;  4HSC X;  1SJI A;  1PKW A;  5J3R A;  1JZO A;  2L6C A;  1VF1 A;  1AXD A;  2PWJ A;  1Z3E A;  3CYN A;  1OE7 A;  1YY7 A;  4TKY A;  4IQA A;  6GSS A;  4EUY A;  4N10 A;  5HR2 A;  4IBP A;  2GSS A;  3FEU A;  3GTU B;  2V6O A;  3TOU A;  1MDJ A;  4QQ7 A;  2OE3 A;  1M9B A;  3I9V 2;  4K8M A;  2AJQ B;  2C0F A;  1ZYN A;  4TR1 B;  5B8B A;  2NPB A;  3FHK A;  2PBJ A;  2A4H A;  4IGJ A;  1BYE A;  3P7X A;  2C0E A;  2JAD A;  5CRW A;  1ACV A;  2R0C A;  3M8N A;  3G7J A;  4ICY A;  1OC9 A;  4NHW A;  2L4C A;  3L0H A;  3BCK A;  1Z7P A;  2AUV A;  2FA8 A;  4EXJ A;  1QGV A;  2LJK A;  2AHE A;  1OYJ A;  2A2P A;  3D0Z A;  5LD0 A;  3EPT A;  4KDX A;  2FLS A;  4QL7 A;  3KGK A;  3TRX A;  5B6M A;  2O89 A;  1OVN A;  2LQO A;  3ME8 A;  1XWK A;  3C1S A;  3WD6 A;  4I2T A;  5D96 A;  2JSY A;  3MIX A;  2H71 A;  3EMP A;  4N11 A;  1E2Y A;  2VIM A;  1WJK A;  2KUC A;  1B4Q A;  1JZD A;  3CSH A;  2OKA A;  1RK4 A;  6GSU A;  2DMM A;  1ZL9 A;  4TR0 A;  4K5R A;  3IAS 2;  1U87 A;  4Z7X A;  3VPT A;  4MH3 A;  1FB0 A;  1EV9 A;  1GNE A;  1G7E A;  1OC9 B;  1A2L A;  2LEG A;  3TRP A;  4BPY A;  4O32 A;  3GX0 A;  2PMT A;  5DAL A;  4GWR A;  1K0M A;  4EIP A;  1EP7 A;  1TP9 A;  2N5B A;  1GSF A;  2B1K A;  1K0C A;  4PUA A;  3VFI A;  4F03 A;  5CRH A;  3FMW A;  2YV9 A;  2F51 A;  3LYK A;  1ERV A;  3ZFB A;  1G7O A;  3KMO A;  1QUW A;  2H1A A;  3ERW A;  1GUM A;  1PA3 A;  1TU7 A;  2H1B A;  1A0F A;  5DAK A;  3NIV A;  3PIN A;  3UVH A;  2H76 A;  3VWW A;  1GSU A;  2MMA A;  5CP1 A;  3CRT A;  4HU9 A;  1EEJ A;  4WBR D;  4LMW A;  1O73 A;  1AQV A;  2WB9 A;  5DAL B;  2ES7 A;  3VWX A;  3LJR A;  4WXT A;  3FR9 A;  1PFO A;  3FW2 A;  1S3D A;  1ERW A;  2VL3 A;  5ECP B;  2NVL A;  4LA1 A;  5J9B A;  2H74 A;  3F4T A;  4JRR A;  2JU5 A;  4XRD A;  4IW9 A;  5A4W A;  4K7N A;  5IIZ A;  1SJ6 A;  3IK7 A;  1T3B A;  3IHG A;  1B8X A;  1V40 A;  4MZW A;  3GSS A;  2VM2 A;  4ZXG A;  2H6X A;  2OA7 A;  1KEB A;  4XS4 A;  3F0I A;  1FVJ A;  1GSY A;  2YAN A;  4NAX A;  2WCI A;  2FD3 A;  3A3T A;  3VI7 A;  4I6X A;  5H5S A;  1NW2 A;  3FZ5 A;  2FWG A;  3HYP A;  2MZC A;  3FY7 A;  1X9M B;  1FVK A;  5IMC A;  17GS A;  1M9A A;  2G2Q A;  2HLS A;  3HZ8 A;  3KP8 A;  3KCM A;  4V2N A;  1K3L A;  2WJU A;  4TOP A;  2VCV A;  3D4M A;  3IHQ A;  5CRG A;  3KEB A;  3PPU A;  1NM3 A;  1OKD A;  4G9H A;  2BTO T;  2N5F A;  3UJ1 A;  3DD3 A;  1BX9 A;  2M72 A;  4OCE A;  2FHE A;  4JU5 A;  1S3A A;  6GSV A;  1BJX A;  3F6F A;  2GVP A;  1TRW A;  2LJA A;  3BJ5 A;  2AYT A;  2LUS A;  3LXZ A;  3L9S A;  3ZIV A;  4GTU A;  3UEM A;  2E2M A;  4RUV A;  3IXR A;  1FO5 A;  3VLN A;  4XIH A;  4XS4 B;  1SYR A;  5AIS A;  2AB6 A;  4TXV A;  5EPF A;  2X8H A;  3PH9 A;  2GQL A;  5G2Z A;  3DXB A;  3PGT A;  1I5G A;  3RPP A;  2VD1 A;  5ECM B;  1F37 A;  1RW1 A;  4FO5 A;  3FRC A;  4F82 A;  4K0G A;  2IPA A;  4HEA 2;  5ELG A;  2B1L A;  1GLQ A;  2CAI A;  2DJ1 A;  1A24 A;  2E2G A;  2X49 A;  3P2A A;  2LQQ A;  2FUG 2;  1XWC A;  4O92 A;  3LW9 A;  1J08 A;  4MJB A;  3VI5 A;  5ECN B;  5F06 A;  3EIN A;  3WGD A;  2XPE A;  2YWN A;  1DE2 A;  1TOF A;  1X5C A;  2UZ8 A;  4WKW A;  5JWO B;  5ABR A;  3PR8 A;  1N2A A;  1ML6 A;  1URM A;  3HJP A;  3QFA C;  3HJM A;  4I97 A;  6GSW A;  1TJD A;  5KN0 A;  2HXK A;  4IHU A;  2RUF A;  4KSM A;  3WT2 A;  3RAZ A;  2ON7 A;  1SK2 A;  3GYK A;  4K9Z A;  22GS A;  2YJH A;  3GL3 A;  3GA4 A;  2XC2 A;  2DSA A;  5KN1 A;  4POL A;  4FIW A;  3GNJ A;  1YDK A;  1UVZ A;  1K0O A;  1YZX A;  3Q19 A;  3HY2 A;  1T8E B;  1PQN A;  2X8G A;  3RPN A;  4PQH A;  1G0T A;  1F9M A;  4WET A;  2H8L A;  1OC3 A;  3TJG A;  4POB A;  2PVQ A;  2DJ0 A;  1BQ7 A;  5CRE A;  1DUG A;  5DBQ A;  1X9S B;  4IS0 A;  3CSJ A;  3UOM A;  2KP2 A;  1ERT A;  2VL2 C;  2J9H A;  1PKZ A;  2VCT A;  2R0G A;  3D5J A;  4TRX A;  3GRX A;  5L71 A;  2P5Q A;  1R4W A;  2OAD A;  4YKF A;  3M9J A;  2K9F A;  4MJE A;  3LGC A;  1PSQ A;  4WF4 A;  1SJZ A;  3UAP A;  1Y25 A;  1FW1 A;  1XFL A;  1ABA A;  1GSE A;  3G7Y A;  3BD2 A;  4NWY A;  1XWB A;  4GF0 A;  3A2W A;  1TTZ A;  4WR5 A;  5IMA A;  3CRU A;  5E4W A;  2B7K A;  3MNG A;  2MBT A;  1AW9 A;  2C3N A;  3TKQ A;  4TW5 A;  1A8Y A;  3F6D A;  1GSS A;  1M7T A;  2ALB A;  2IN3 A;  3A2X A;  3TDG A;  2FY6 A;  3APS A;  4MNN A;  2LJR A;  4JR4 A;  3RBT A;  5GAP D;  2YJ7 A;  2H19 A;  2JZT A;  5DCG A;  4IP6 A;  1QXH A;  3ZZX A;  2MMO A;  1M3J A;  3NOF A;  2RUE A;  2IIY A;  4MMM A;  1M2A A;  2YZH A;  3QAV A;  4NPB A;  4GST A;  4ZB8 A;  1MEK A;  3W8J A;  4KE3 A;  1YKA A;  2CAQ A;  2CX4 A;  3HDC A;  1PGT A;  4KGI A;  2WFC A;  3TKS E;  3CTG A;  3DRN A;  2VM1 A;  3CBU A;  4MZC A;  4MF7 A;  5CO3 A;  4MJC A;  4ULX A;  3V1W A;  5DJM A;  1X5E A;  3UAR A;  1YEP A;  1XWA A;  1XG8 A;  2EIQ A;  2H75 A;  3LEF A;  4X0X A;  1JLW A;  1XPV A;  2CZ2 A;  3TKP A;  5JWQ B;  3KD0 A;  1GTI A;  4N0V A;  1Z9H A;  1KNG A;  4CHS A;  2REM A;  3GV1 A;  3H93 A;  1VF4 A;  4HZ2 A;  2N5A A;  2TIR A;  3APQ A;  4EKZ A;  2RII A;  5ECH B;  1TKD B;  3MAK A;  5FHI A;  3ISO A;  1TK5 B;  2GS3 A;  1NSW A;  1FB6 A;  2M80 A;  3R2Q A;  4OO5 A;  2PPT A;  4L0U A;  20GS A;  5KN3 A;  1TK0 B;  3HD5 A;  3FZA A;  1EZK A;  4IJI A;  4BWS A;  2VL9 A;  5F07 A;  4ID0 A;  1HNC A;  3EC3 A;  2WUL A;  2H6Z A;  4POM A;  3GH9 A;  4GRF A;  2PN8 A;  4MLY A;  4KW6 A;  4GXZ A;  4AJ8 A;  3LG6 A;  3TJK A;  1SU9 A;  4HJ2 A;  2C0G A;  4K2X A;  2IMI A;  2VCQ A;  1V98 A;  2H0I A;  2GT5 A;  4O5U A;  1TW9 A;  3K8N A;  3CMI A;  3KH9 A;  5ELA A;  3C73 A;  4F0C A;  5IM9 A;  3GHA A;  5F8B A;  3HCZ A;  3SWL A;  4FYU A;  1TDI A;  4K7O A;  1PRX A;  1GH2 A;  4ECC A;  2DML A;  2M46 A;  4V2L A;  3UBK A;  1SEN A;  3Q74 A;  3U5R E; 
#chains in the Genus database with same CATH homology
 5D9V A;  3H1N A;  2C3Q A;  3P90 A;  1HNA A;  2B5X A;  1XOB A;  4MPF A;  3IAM 2;  1GSD A;  3HA9 A;  3ZVJ A;  5ECL B;  2H01 A;  4F0B A;  4KND A;  2F9S A;  1XVW A;  4EIQ A;  1I9D A;  5ECR B;  13GS A;  5F0G A;  1AQW A;  4NHZ A;  5DCH A;  2DJK A;  3HHV A;  1TRV A;  4NV2 A;  2GQK A;  2FWF A;  1PL1 A;  1EWX A;  2H70 A;  2L5O A;  4PQI A;  4K1F A;  3ED3 A;  3ZMK A;  4XS6 A;  4KCE A;  2K8S A;  5IQY A;  4MCU A;  2NBS A;  2JSZ A;  2TRC P;  2YWM A;  2NTO A;  2EIO A;  14GS A;  3N9J A;  2EC4 A;  2LST A;  1ZYE A;  3F4R A;  4JR6 A;  1R5A A;  5GSS A;  5IOX A;  2PER A;  3TJF A;  16GS A;  5BMU A;  3DVX A;  1PX7 A;  2YV7 A;  3HXS A;  1WMJ A;  2CX3 A;  4BVX A;  1BG5 A;  2IMF A;  5G30 A;  3E0U A;  1EP8 A;  3EWL A;  2VOC A;  3LYP A;  4IQ1 A;  3M1G A;  2X64 A;  2A4V A;  2NDO A;  3J7Y b;  2QA1 A;  1VGL A;  4WEY A;  1M2D A;  4NXI A;  3IR4 A;  3A2V A;  4OCF A;  2R6K A;  2R3X A;  4V1A g;  3EU4 A;  3BOA A;  3QOU A;  2OAC A;  1AAZ A;  4L8E A;  3UIW A;  2QC7 A;  4TR4 A;  4HDE A;  5ECK B;  1NHY A;  2CVD A;  3QFB C;  3H4K A;  1SK0 A;  5D93 A;  2R2J A;  4IJ3 A;  1O8W A;  4PGT A;  4L5O A;  1U3A A;  2HRN A;  2L6D A;  3H79 A;  4J2F A;  4ZB9 A;  4HI7 A;  5IPH A;  1OC8 A;  4ZL9 A;  3IC8 A;  4BVX B;  3UL3 A;  3M3M A;  4NMU A;  2C3T A;  5CNW A;  3RDW A;  2VL2 A;  1ZZY A;  2MMZ A;  3F63 A;  5EL8 A;  1PN0 A;  4MJA A;  5ECI B;  1HNB A;  3GKK A;  2GZY A;  3TJB A;  3VWV A;  4AJ6 A;  1SD9 A;  2OJL A;  2EIR A;  3L78 A;  3TKS A;  2H72 A;  2H73 A;  3FR3 A;  1SL2 B;  3MSZ A;  4RI6 A;  3QAG A;  4GCI A;  4KF9 A;  2B5E A;  1J9B A;  4EDZ A;  1XW6 A;  1V58 A;  2I81 A;  11GS A;  1SYX A;  1A23 A;  1OE8 A;  2H30 A;  1GL8 A;  4G0I A;  2GZP A;  1WPI A;  2F8F A;  1PD2 1;  4I8B A;  4MDC A;  3TRQ A;  4V1A p;  1MTC A;  2AV4 A;  5ID2 A;  1ST9 A;  2LV3 A;  3MDK A;  4CW9 A;  3BBY A;  1SK1 A;  2X99 A;  3C1R A;  1XCC A;  2RM5 A;  1Z7R A;  4O7H A;  5HR1 A;  5INY A;  5G5E A;  3DML A;  5COH A;  2C4J A;  1JZW A;  6GSY A;  3GKX A;  3FZ9 A;  5DQS A;  2VCW A;  4F2I A;  4EE0 A;  4MK3 A;  2MYG A;  5HR3 A;  5IMF A;  1GTB A;  1WP0 A;  2C80 A;  3IDV A;  2LKU A;  2HNL A;  2GZZ A;  2TRX A;  3WGX A;  2G0F A;  1XOA A;  2H0H A;  3H8Q A;  1YQ1 A;  3KTL A;  3KZQ A;  4GQC A;  5ID2 B;  2WDU A;  2D2Z A;  1EV4 A;  4D73 A;  4KAE A;  1PL2 A;  5IMZ A;  5CYY A;  3UVT A;  4DSS A;  3HVV A;  1MDK A;  5BRT A;  3GL5 A;  3GN3 A;  5DVB A;  4MP4 A;  4PNF A;  4RQR A;  4K0N A;  3U6V A;  5GZZ B;  2X4A A;  2R0P A;  4LL4 B;  3G7I A;  2WZ9 A;  4ZBD A;  4Q5Q A;  1MD4 A;  4EVM A;  1GRX A;  3GKM A;  3TKR A;  3VPQ A;  3D21 A;  1Z5Y E;  2BJX A;  4E8H A;  3TJJ A;  4OD7 A;  3AY8 A;  4WBJ A;  3F8U A;  3ZTL A;  3FR6 A;  5G5F A;  1MD3 A;  2C8U A;  4D73 B;  2A2R A;  4EF0 A;  1VF2 A;  3D6I A;  5H5R A;  2KHP A;  4DSS B;  3TKS C;  1UC7 A;  2CQ9 A;  1IYI A;  4H86 A;  4HQZ A;  3E3E A;  3EMX A;  3UBL A;  2PUK C;  2PGT A;  1WOU A;  1EGR A;  1ZOF A;  2E7P A;  3D4T A;  2VD0 A;  4TXO B;  4TVE A;  3DKS A;  4PTS A;  1Z6M A;  2JL4 A;  3WT1 A;  3GH6 A;  4OMV A;  5F05 A;  1S3C A;  1SD8 A;  4N30 A;  3QD9 A;  2FNO A;  3HZ4 A;  4OFN A;  4HQS A;  1DE1 A;  3EUR A;  3N5O A;  5DJL A;  1XW5 A;  4CY6 A;  2VCX A;  3P8W A;  1Z6N A;  2LRT A;  2V2G A;  4MA9 A;  5D9T A;  1THX A;  1GTA A;  2C0D A;  3LFL A;  1Y6E A;  3TCO A;  2H1G A;  3ZYW A;  3DGQ A;  4ML6 A;  1XXU A;  4G10 A;  4GLT A;  4Q5R A;  3LSZ A;  4BWQ A;  2K6V A;  5G1L A;  5KN2 A;  1KBN A;  4CY8 A;  3HKR A;  4O5R A;  4USS A;  4DVC A;  2O87 A;  1PX6 A;  2HSH A;  5DQY A;  5EY6 A;  2PVO C;  4G0L A;  5CRD A;  4YQU A;  1T4Y A;  4ZIL A;  2X8C A;  2GTU A;  2WGR A;  1XIY A;  4ZL8 A;  2F8A A;  1W89 A;  1U3I A;  2QA2 A;  1XWG A;  2ZUP A;  2HSY A;  3GUS A;  4WF5 A;  1ERU A;  4POK A;  2H0G A;  3TB2 A;  4ECB A;  4G19 A;  4ISD A;  4DSR A;  4KDY A;  1BED A;  1R7H A;  3BCI A;  1W4V A;  2I1U A;  4TR3 A;  4KH7 A;  2IJY A;  2OBK A;  2XPD A;  3UMA A;  4OFT A;  3DYR A;  3ZRD A;  10GS A;  2JAC A;  1GUK A;  3FK8 A;  4JED A;  2IME A;  4ILF A;  3ZFL A;  5A4V A;  2VLT A;  4J56 E;  4IEL A;  2C1Y A;  1O8X A;  4HJM A;  4Z2U A;  2LRC A;  2BMX A;  4O5Q A;  1FG4 A;  5D8I A;  2YCD A;  4GSS A;  3E9J B;  2F3M A;  3IC4 A;  4MF6 A;  1YF0 A;  5KOX A;  3MYD A;  2GSQ A;  3C71 A;  2B5Y A;  1F3B A;  2MMN A;  3J7Y k;  5G1K A;  5A5K A;  5AIV A;  4Z2T A;  3DVW A;  1K0A A;  4YH2 A;  1T7P B;  1K3O A;  3F3R A;  2IWT A;  1ZGN A;  2H6Y A;  5E59 A;  5C00 A;  2AAW A;  4L0W A;  1UN2 A;  2DJ2 A;  2R37 A;  3SBC A;  1XW9 A;  3APO A;  3O76 A;  1SKS B;  2KLX A;  5LNK e;  3ZLP A;  4KSO A;  3KMN A;  1T1V A;  3LXT A;  4EDY A;  1GUL A;  2P5R A;  4I5Q A;  4PNG A;  2FCH A;  2VCZ A;  3LWA A;  2LS5 A;  1EGO A;  2YOI A;  5ECQ B;  3L4N A;  4N0Z A;  2OBI A;  4IP1 A;  3ERF A;  2CVK A;  1MDI A;  2FA4 A;  3ZIJ A;  1TRU A;  1LU4 A;  5A4U A;  1JHB A;  1OKT A;  3FKF A;  1Q4J A;  4RQX A;  3ZL5 A;  3W6G A;  1PMT A;  1X0R A;  3FZ4 A;  4MF5 A;  3GX8 A;  3G9B A;  2ON5 A;  1ZYQ B;  3VWU A;  1GLP A;  1QFN A;  3IRA A;  3OR5 A;  2J23 A;  3CXG A;  3IBH A;  2DLX A;  1YJ6 A;  4X1U A;  5IPG A;  4K2D A;  3EVI A;  3TGZ A;  4LL1 B;  4KCA A;  4JBB A;  4RI7 A;  5D73 A;  3RHB A;  1UA5 A;  1SL1 B;  3S9F A;  2K18 A;  1V9W A;  1X9W B;  3ZRE A;  1B9X C;  3O6T A;  2KOK A;  5DDL A;  4FYC A;  1BAY A;  2L57 A;  5IMV A;  1XBS A;  1EOH A;  2HRA A;  3HJO A;  2YPM A;  4EO3 A;  2YWO A;  4GSN A;  1WRY A;  5EVO A;  4BA7 A;  2XBQ A;  2E0Q A;  4KX4 A;  4OFM A;  1GNW A;  1F2E A;  2CT6 A;  2B7J A;  1H75 A;  5B7C A;  8GSS A;  1SL0 B;  12GS A;  5AGY A;  1G6Y A;  2L59 A;  4ZBB A;  4OWY A;  1U6T A;  4HUA A;  3JCM L;  1DSB A;  1O85 A;  4PUF C;  1WIK A;  2LNT A;  1WE0 A;  2DC5 A;  2DJJ A;  1ILO A;  4OO4 A;  3FYG A;  1B9Y C;  3DIE A;  1FOV A;  2IMD A;  2HE3 A;  3R3E A;  5J5N A;  1THO A;  3A5W A;  5H5Q A;  2DKH A;  4HZ4 A;  4F9Z A;  2YZU A;  5B6N A;  3GFK A;  1QMV A;  4MAB A;  1TI1 A;  3WGE A;  1IYH A;  2HZF A;  3QR6 A;  3LOR A;  2JZS A;  2LTK A;  4ZL7 A;  3KIJ A;  3W8S A;  2HI7 A;  4MZB A;  3VK9 A;  2YNX A;  1O7U A;  3VUR A;  3IK9 A;  3TOT A;  3C8E A;  1EOG A;  4LMV A;  1CQG A;  4Q5N A;  3M9K A;  4V2M A;  2VAF A;  2JZR A;  2HFD A;  4MH2 A;  5DAK B;  3GIX A;  2GQM A;  4HU7 A;  2FWE A;  1A2M A;  3KM6 A;  2B6M A;  4YKG A;  4PXO A;  9GSS A;  1N8J A;  19GS A;  1VRS D;  4AF2 A;  5KEJ A;  2GT6 A;  1DBY A;  3IE3 A;  3IPZ A;  4JZQ A;  1E6B A;  5FWG A;  4JE1 A;  1JFU A;  3O3T A;  1FOH A;  5J9C A;  2B3S A;  2V1M A;  4P3Y B;  2YP6 A;  1FAA A;  2L5L A;  2OE0 A;  4MPG A;  2LNS A;  1XZO A;  1TRS A;  1JZR A;  2RM6 A;  3CSI A;  18GS A;  1K3Y A;  4AJ7 A;  1USB A;  4ZBA A;  4LLR A;  2FWH A;  5CAX A;  4FH8 A;  3I43 A;  3ZVJ D;  5LCZ A;  2P0G A;  5FT3 A;  4K7I A;  5ECO B;  4ZIJ A;  4DEJ A;  4HS1 A;  4CDO A;  1QQ2 A;  1YF1 A;  1YEX A;  5IOW A;  2IFQ A;  2CVB A;  1R26 A;  1RQM A;  1A8L A;  5G31 A;  2DKI A;  2YWI A;  1T4Z A;  2MBS A;  2K8V A;  2O85 A;  4I2U A;  1U88 A;  1AQX A;  3IOS A;  4IVF A;  1EEM A;  2WS2 A;  3F4S A;  5HR0 A;  3MWH A;  2Z9S A;  3GUR A;  5JCU A;  4EC0 A;  4FQU A;  4NV5 A;  5IMD A;  2O8V B;  4ZB6 A;  6GSX A;  1HD2 A;  2GLR A;  2P31 A;  4IKH A;  1SKW B;  2HRF A;  1G6W A;  1AIU A;  3QAW A;  1WWJ A;  1JLV A;  3L9V A;  1GUH A;  1QK8 A;  2GGT A;  3Q18 A;  1B48 A;  3QCP A;  3RHC A;  3KJY A;  3KXO A;  1R5P A;  1M2B A;  2HT9 A;  5HFI A;  2H66 A;  2GDR A;  4ACS A;  2YN1 A;  4EL1 A;  2DBC A;  2FGX A;  1K0B A;  3D22 A;  4XS1 A;  2IFQ B;  2V32 A;  1O81 A;  3A5I A;  1F6M C;  2RLI A;  2VO4 A;  4PQ1 A;  1V57 A;  5GST A;  4TN8 A;  2HRK A;  2WRT A;  5IO0 A;  5B8A A;  1OAZ A;  2CV4 A;  1AUC A;  4XTS A;  5AIX A;  4L5L A;  4QL9 A;  3GST A;  1TU8 A;  3KP9 A;  3DWV A;  4BL7 A;  3GKN A;  4TXO A;  5D9X A;  1AC1 A;  1A0R P;  5HQP A;  1ON4 A;  1J0F A;  2I3Y A;  1B4P A;  1KTE A;  1ZYP A;  3QMX A;  3ZML A;  4KB3 A;  4KA0 A;  4K5S A;  2LRN A;  3DEX A;  5JWR B;  3ME7 A;  2R4V A;  2XHF A;  4Q5F A;  4ML1 A;  3IV4 A;  2QGV A;  1LJR A;  4G0K A;  2H1D A;  2R5G A;  3I6A A;  2L4Q A;  2VLU A;  2CZ3 A;  5KOW A;  2ZNM A;  1YKC A;  5J41 A;  1SKR B;  2ZCT A;  2O7K A;  2VUP A;  7GSS A;  2IL3 A;  6GST A;  3ERG A;  3GMF A;  2KP1 A;  4PX1 A;  3C7M A;  4Z2R A;  4A5P A;  4BL7 B;  2OE1 A;  1A2J A;  3HVX A;  2HSM A;  3EU3 A;  1X5D A;  4FYB A;  4G2E A;  1M99 A;  2GSR A;  1Q98 A;  3KTB A;  4DSQ A;  3US3 A;  1K0N A;  4YQV A;  5JCG A;  5AN1 A;  1PN9 A;  3HVS A;  1CQH A;  1XVQ A;  3L9U A;  5ECS A;  2XBI A;  1M0U A;  1V2A A;  3QDN A;  1VF3 A;  1HQO A;  4KDU A;  4E8E A;  2IMK A;  4XCS A;  2HZE A;  3M0F A;  1LBK A;  4BVY A;  3QPM A;  4WR4 A;  3Q6O A;  1GSQ A;  4XRA A;  2DJ3 A;  2CA8 A;  2I4A A;  1TXX A;  5JCW A;  3EYT A;  4GQF A;  5HFG A;  3KH7 A;  1O6J A;  4X43 A;  2VLV A;  5HFK A;  1K0D A;  4AGS A;  2GST A;  1GTU A;  3WYW A;  1GWC A;  4ECJ A;  1C72 A;  1ZMA A;  1H4O A;  3TUE A;  2V41 A;  1F3A A;  5J4U A;  4XHM A;  2QSI A;  1HYU A;  1NHO A;  3CTF A;  5IO2 A;  3IA1 A;  3GTU A;  2DIZ A;  1TI3 A;  2HZE B;  3LQ7 A;  1FHE A;  2HYX A;  2QKE A;  4PUR A;  5C04 A;  4TR1 A;  4BVY B;  4YQM A;  3F3Q A;  5ENU A;  2DIY A;  3EE2 A;  5GAN D;  3ZIT A;  1ZCP A;  4IN0 A;  4K6X A;  4KUN A;  5D9W A;  3NZN A;  1GP1 A;  4YAV A;  4HOJ A;  3F9U A;  2PU9 C;  3I69 A;  1T00 A;  1TK8 B;  2V6K A;  2A2S A;  4J57 E;  4ECI A;  4X4J A;  4YAP A;  2I9H A;  1SJI A;  1PKW A;  5J3R A;  1JZO A;  2L6C A;  1VF1 A;  1AXD A;  2PWJ A;  1Z3E A;  3CYN A;  1OE7 A;  1YY7 A;  4TKY A;  4IQA A;  6GSS A;  4EUY A;  4N10 A;  5HR2 A;  4IBP A;  2GSS A;  3FEU A;  3GTU B;  2V6O A;  3TOU A;  1MDJ A;  4QQ7 A;  2OE3 A;  1M9B A;  3I9V 2;  4K8M A;  2AJQ B;  2C0F A;  1ZYN A;  4TR1 B;  5B8B A;  2NPB A;  3FHK A;  2PBJ A;  2A4H A;  4IGJ A;  1BYE A;  3P7X A;  2C0E A;  2JAD A;  5CRW A;  1ACV A;  2R0C A;  3M8N A;  3G7J A;  4ICY A;  1OC9 A;  4NHW A;  2L4C A;  3L0H A;  3BCK A;  1Z7P A;  2AUV A;  2FA8 A;  4EXJ A;  1QGV A;  2LJK A;  2AHE A;  1OYJ A;  2A2P A;  3D0Z A;  5LD0 A;  3EPT A;  4KDX A;  2FLS A;  4QL7 A;  3KGK A;  3TRX A;  5B6M A;  2O89 A;  1OVN A;  2LQO A;  3ME8 A;  1XWK A;  3C1S A;  3WD6 A;  4I2T A;  5D96 A;  2JSY A;  3MIX A;  2H71 A;  3EMP A;  4N11 A;  1E2Y A;  2VIM A;  1WJK A;  2KUC A;  1B4Q A;  1JZD A;  3CSH A;  2OKA A;  1RK4 A;  6GSU A;  2DMM A;  1ZL9 A;  4TR0 A;  4K5R A;  3IAS 2;  1U87 A;  4Z7X A;  3VPT A;  4MH3 A;  1FB0 A;  1EV9 A;  1GNE A;  1G7E A;  1OC9 B;  1A2L A;  2LEG A;  3TRP A;  4BPY A;  4O32 A;  3GX0 A;  2PMT A;  5DAL A;  4GWR A;  1K0M A;  4EIP A;  1EP7 A;  1TP9 A;  2N5B A;  1GSF A;  2B1K A;  1K0C A;  4PUA A;  3VFI A;  4F03 A;  5CRH A;  3FMW A;  2YV9 A;  2F51 A;  3LYK A;  1ERV A;  3ZFB A;  1G7O A;  3KMO A;  1QUW A;  2H1A A;  3ERW A;  1GUM A;  1PA3 A;  1TU7 A;  2H1B A;  1A0F A;  5DAK A;  3NIV A;  3PIN A;  3UVH A;  2H76 A;  3VWW A;  1GSU A;  2MMA A;  5CP1 A;  3CRT A;  4HU9 A;  1EEJ A;  4WBR D;  4LMW A;  1O73 A;  1AQV A;  2WB9 A;  5DAL B;  2ES7 A;  3VWX A;  3LJR A;  4WXT A;  3FR9 A;  3FW2 A;  1S3D A;  1ERW A;  2VL3 A;  5ECP B;  2NVL A;  4LA1 A;  5J9B A;  2H74 A;  3F4T A;  4JRR A;  2JU5 A;  4XRD A;  4IW9 A;  5A4W A;  4K7N A;  5IIZ A;  1SJ6 A;  3IK7 A;  1T3B A;  3IHG A;  1B8X A;  1V40 A;  4MZW A;  3GSS A;  2VM2 A;  4ZXG A;  2H6X A;  2OA7 A;  1KEB A;  4XS4 A;  3F0I A;  1FVJ A;  1GSY A;  2YAN A;  4NAX A;  2WCI A;  2FD3 A;  3A3T A;  3VI7 A;  4I6X A;  5H5S A;  1NW2 A;  3FZ5 A;  2FWG A;  3HYP A;  2MZC A;  3FY7 A;  1X9M B;  1FVK A;  5IMC A;  17GS A;  1M9A A;  2G2Q A;  2HLS A;  3HZ8 A;  3KP8 A;  3KCM A;  4V2N A;  1K3L A;  2WJU A;  4TOP A;  2VCV A;  3D4M A;  3IHQ A;  5CRG A;  3KEB A;  3PPU A;  1NM3 A;  1OKD A;  4G9H A;  2BTO T;  2N5F A;  3UJ1 A;  3DD3 A;  1BX9 A;  2M72 A;  4OCE A;  2FHE A;  4JU5 A;  1S3A A;  6GSV A;  1BJX A;  3F6F A;  2GVP A;  1TRW A;  2LJA A;  3BJ5 A;  2AYT A;  2LUS A;  3LXZ A;  3L9S A;  3ZIV A;  4GTU A;  3UEM A;  2E2M A;  4RUV A;  3IXR A;  1FO5 A;  3VLN A;  4XIH A;  4XS4 B;  1SYR A;  5AIS A;  2AB6 A;  4TXV A;  5EPF A;  2X8H A;  3PH9 A;  2GQL A;  5G2Z A;  3DXB A;  3PGT A;  1I5G A;  3RPP A;  2VD1 A;  5ECM B;  1F37 A;  1RW1 A;  4FO5 A;  3FRC A;  4F82 A;  4K0G A;  2IPA A;  4HEA 2;  5ELG A;  2B1L A;  1GLQ A;  2CAI A;  2DJ1 A;  1A24 A;  2E2G A;  2X49 A;  3P2A A;  2LQQ A;  2FUG 2;  1XWC A;  4O92 A;  3LW9 A;  1J08 A;  4MJB A;  3VI5 A;  5ECN B;  5F06 A;  3EIN A;  3WGD A;  2XPE A;  2YWN A;  1DE2 A;  1TOF A;  1X5C A;  2UZ8 A;  4WKW A;  5JWO B;  5ABR A;  3PR8 A;  1N2A A;  1ML6 A;  1URM A;  3HJP A;  3QFA C;  3HJM A;  4I97 A;  6GSW A;  1TJD A;  5KN0 A;  2HXK A;  4IHU A;  2RUF A;  4KSM A;  3WT2 A;  3RAZ A;  2ON7 A;  1SK2 A;  3GYK A;  4K9Z A;  22GS A;  2YJH A;  3GL3 A;  3GA4 A;  2XC2 A;  2DSA A;  5KN1 A;  4POL A;  4FIW A;  3GNJ A;  1YDK A;  1UVZ A;  1K0O A;  1YZX A;  3Q19 A;  3HY2 A;  1T8E B;  1PQN A;  2X8G A;  3RPN A;  4PQH A;  1G0T A;  1F9M A;  4WET A;  2H8L A;  1OC3 A;  3TJG A;  4POB A;  2PVQ A;  2DJ0 A;  1BQ7 A;  5CRE A;  1DUG A;  5DBQ A;  1X9S B;  4IS0 A;  3CSJ A;  3UOM A;  2KP2 A;  1ERT A;  2VL2 C;  2J9H A;  1PKZ A;  2VCT A;  2R0G A;  3D5J A;  4TRX A;  3GRX A;  5L71 A;  2P5Q A;  1R4W A;  2OAD A;  4YKF A;  3M9J A;  2K9F A;  4MJE A;  3LGC A;  1PSQ A;  4WF4 A;  1SJZ A;  3UAP A;  1Y25 A;  1FW1 A;  1XFL A;  1ABA A;  1GSE A;  3G7Y A;  3BD2 A;  4NWY A;  1XWB A;  4GF0 A;  3A2W A;  1TTZ A;  4WR5 A;  5IMA A;  3CRU A;  5E4W A;  2B7K A;  3MNG A;  2MBT A;  1AW9 A;  2C3N A;  3TKQ A;  4TW5 A;  1A8Y A;  3F6D A;  1GSS A;  1M7T A;  2ALB A;  2IN3 A;  3A2X A;  3TDG A;  2FY6 A;  3APS A;  4MNN A;  2LJR A;  4JR4 A;  3RBT A;  5GAP D;  2YJ7 A;  2H19 A;  2JZT A;  5DCG A;  4IP6 A;  1QXH A;  3ZZX A;  2MMO A;  3NOF A;  2RUE A;  2IIY A;  4MMM A;  1M2A A;  2YZH A;  3QAV A;  4NPB A;  4GST A;  4ZB8 A;  1MEK A;  3W8J A;  4KE3 A;  1YKA A;  2CAQ A;  2CX4 A;  3HDC A;  1PGT A;  4KGI A;  2WFC A;  3TKS E;  3CTG A;  3DRN A;  2VM1 A;  3CBU A;  4MZC A;  4MF7 A;  5CO3 A;  4MJC A;  4ULX A;  3V1W A;  5DJM A;  1X5E A;  3UAR A;  1YEP A;  1XWA A;  3LEF A;  2EIQ A;  2H75 A;  4X0X A;  1JLW A;  1XPV A;  2CZ2 A;  3TKP A;  5JWQ B;  3KD0 A;  1GTI A;  4N0V A;  1Z9H A;  1KNG A;  4CHS A;  2REM A;  3GV1 A;  3H93 A;  1VF4 A;  4HZ2 A;  2N5A A;  2TIR A;  3APQ A;  4EKZ A;  2RII A;  5ECH B;  1TKD B;  3MAK A;  5FHI A;  3ISO A;  1TK5 B;  2GS3 A;  1NSW A;  1FB6 A;  2M80 A;  3R2Q A;  4OO5 A;  2PPT A;  4L0U A;  20GS A;  5KN3 A;  1TK0 B;  3HD5 A;  3FZA A;  1EZK A;  4IJI A;  4BWS A;  2VL9 A;  5F07 A;  4ID0 A;  1HNC A;  3EC3 A;  2WUL A;  2H6Z A;  4POM A;  3GH9 A;  4GRF A;  2PN8 A;  4MLY A;  4KW6 A;  4GXZ A;  4AJ8 A;  3LG6 A;  3TJK A;  1SU9 A;  4HJ2 A;  2C0G A;  4K2X A;  2IMI A;  2VCQ A;  1V98 A;  2H0I A;  2GT5 A;  4O5U A;  1TW9 A;  3K8N A;  3CMI A;  3KH9 A;  5ELA A;  3C73 A;  4F0C A;  5IM9 A;  3GHA A;  5F8B A;  3HCZ A;  3SWL A;  4FYU A;  1TDI A;  4K7O A;  1PRX A;  1GH2 A;  4ECC A;  2DML A;  2M46 A;  4V2L A;  3UBK A;  1SEN A;  3Q74 A;  3U5R E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...