1WPIA

Solution nmr structure of protein ykr049c from saccharomyces cerevisiae. ontario centre for structural proteomics target yst0250_1_133; northeast structural genomics consortium ytyst250
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
133
structure length
133
Chain Sequence
MSFWKTLQRQPRTISLFTNDIASNIKSQKCLQLLKGDVSHRFDVEIANRFPTWDQLQYMRTSCPQGPVSLQRQIPKLDSVLKYKHTDPTFGMDLQKCVQRGLWNPKEALWVDWENKLVGNEPADIDKYIIQRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 15.6 kDa protein in NAP1-TRK2 intergenic region
publication title Solution structure of YKR049C, a putative redox protein from Saccharomyces cerevisiae
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics, unknown function
total genus 17
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2004-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07955 DUF1687 Protein of unknown function (DUF1687)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1wpiA00
4KW6A 1ZL9A 1YDKA 4KDYA 4LMVA 4GSSA 1WP0A 1F9MA 2VL2A 2DJ3A 5E4WA 1QFNA 5ECSA 1T7PB 5DAKA 1E2YA 2WDUA 2FWGA 2DMLA 2I1UA 3KTBA 1EV4A 4NV5A 2YN1A 2GQMA 4TR3A 1DSBA 3N5OA 5GAPD 4ILFA 1T1VA 2H1BA 4JZQA 5G5EA 3TJKA 1PA3A 2B3SA 1V98A 3DGQA 2V41A 1SKWB 1K0DA 1SU9A 2P5QA 2E2MA 1SYRA 2MYGA 4JR6A 1TTZA 2JADA 4NHWA 1J0FA 1LJRA 2NBSA 2ZNMA 2FWFA 1EOHA 1V57A 4I97A 4KSMA 1ACVA 3QMXA 1XOBA 5JCUA 3KP9A 3ERWA 3TJGA 2GSRA 1A2MA 3RDWA 5ECOB 1XWAA 5FHIA 2XHFA 3QPMA 4OO4A 1V9WA 2B7JA 4IBPA 3F63A 3FRCA 1F37A 1B9YC 4BPYA 1TRUA 4NV2A 1KBNA 2PUKC 4HS1A 4TW5A 2VL3A 4GXZA 4MMMA 3UBLA 2IFQB 1XFLA 4TVEA 2AV4A 4L5LA 1OC9B 3F4TA 5IQYA 4MH2A 3PGTA 2GVPA 3TKQA 2R2JA 1OVNA 4KSOA 1EWXA 4EF0A 2M72A 1JZRA 5G5FA 4ZB8A 1DUGA 1BEDA 1M2DA 1W89A 2V2GA 4PUFC 4YQVA 1HNBA 2GDRA 4IP1A 3FR9A 5CAXA 4RUVA 4IHUA 3W8JA 3ZREA 2BMXA 1PQNA 2KOKA 4GRFA 5JWRB 2R6KA 3PINA 2OADA 3DRNA 3APSA 3TKSE 1SYXA 2O87A 1ERTA 4TKYA 2GGTA 2NDOA 2K9FA 4G9HA 3CSIA 4POLA 4L5OA 4ECJA 3WGXA 2DJJA 3GH9A 4X43A 1RW1A 4IJ3A 2L4CA 1YF0A 2LJAA 2PN8A 1GUHA 1OC9A 2YWOA 3HHVA 1ERVA 4FYCA 4F0CA 2H30A 2IN3A 3DEXA 1XBSA 3TKRA 5LNKe 4N10A 4V2NA 3KTLA 2GSTA 2OE1A 4XRAA 2Z9SA 5J41A 4Q5RA 1X5DA 6GSXA 2VUPA 5G1KA 2ZUPA 2DMMA 1A23A 3J7Yb 1SL0B 1WJKA 2X99A 3MDKA 1GP1A 3FZ9A 2H66A 3FZ5A 2F8AA 2WULA 1DE1A 4WF5A 4ZL7A 3IA1A 1S3DA 5F07A 4MF5A 5ECHB 5D9XA 4AJ8A 2H6XA 1XOAA 5IPHA 1OYJA 1FVKA 3H4KA 3LG6A 2XPDA 4LL1B 1A24A 2YANA 3V1WA 1C72A 1G6WA 3R2QA 3NIVA 3U6VA 2WRTA 3PH9A 4E8HA 5IMVA 4K0GA 1S3CA 2H1AA 13GSA 4K7IA 3WD6A 2QC7A 5CREA 1S3AA 3WT2A 3A5WA 2TRCP 1VF1A 1F2EA 4EXJA 4Q5NA 3ZFBA 1T00A 2E0QA 2MBTA 5IMAA 1WE0A 1GSEA 4TXVA 2B1KA 1GSSA 3Q74A 3WYWA 4RI6A 22GSA 3QD9A 2C80A 3SWLA 2LRCA 5EL8A 4KE3A 4POMA 1LBKA 19GSA 2JSYA 4GSNA 3RBTA 2LSTA 1XPVA 3HZ8A 1YF1A 4GSTA 2LEGA 3GX8A 1R5AA 3F3RA 4GF0A 3IAM2 1TU8A 2VAFA 4OCFA 2IL3A 4PXOA 1T4ZA 4LA1A 2I9HA 1TRSA 4NPBA 4N11A 3DMLA 4ML1A 1F3BA 5GAND 3CSJA 3UVTA 4MK3A 5AIVA 5CRDA 3KEBA 2EIRA 4RQXA 1ZYQB 4F9ZA 4H86A 3GIXA 1Z9HA 4IELA 5DCHA 3ZMLA 2HZEB 1EV9A 4GWRA 2EIQA 5DCGA 5AN1A 1ON4A 5CRHA 1OKTA 3D5JA 3MSZA 2AUVA 3ZFLA 3VWWA 2LQOA 4KX4A 3KMOA 5ELGA 5IPGA 3UMAA 5J5NA 3K8NA 4Q5FA 1ML6A 2OBIA 1SJ6A 2X8HA 1WPIA 2KP2A 3P90A 3TOTA 5DQYA 4WKWA 2VLTA 4KAEA 1TDIA 2OBKA 3APQA 5IMZA 4MPGA 2IMDA 2J9HA 1GSUA 1NHOA 3QAGA 4K0NA 5G2ZA 2GTUA 4BA7A 3QDNA 3KXOA 4NAXA 3TRPA 2LJKA 4TR0A 1MDKA 2DBCA 3TUEA 1THXA 2L6DA 1B4QA 3LFLA 2LJRA 5E59A 4G2EA 3VLNA 3P2AA 4MABA 1FVJA 2FY6A 4E8EA 3RPNA 1DE2A 2H73A 1OE8A 3C1RA 2LKUA 3DWVA 4D73A 3QAWA 2AB6A 3M8NA 1JLWA 2LNTA 4DVCA 2M80A 4V2MA 1EP8A 4TXOB 5AGYA 1SD9A 2H75A 3F6DA 4PGTA 1K0BA 2RM6A 1QMVA 5B6NA 1BX9A 3EWLA 3EE2A 2QKEA 2H0GA 3HA9A 3ZRDA 3C73A 5B7CA 2BTOT 3QR6A 11GSA 4Z7XA 5CNWA 4OD7A 5D9WA 4MP4A 2C4JA 3H8QA 4MA9A 1F6MC 2LS5A 3D22A 3HJMA 2YWIA 2AJQB 1HNAA 1EOGA 3M9KA 3LWAA 5DAKB 2HXKA 1ZCPA 1PL1A 3UVHA 4FYUA 1O81A 3GV1A 4Q5QA 1Z7RA 5GSTA 4HUAA 3TB2A 1RK4A 4N0VA 4KDUA 2JZTA 1EZKA 1V2AA 1XCCA 4X0XA 1PD21 4MCUA 1XW5A 1WWJA 5JWQB 1JZWA 2DJ2A 2J23A 2FNOA 1IYHA 1EEJA 2TRXA 3VI5A 5B8AA 3EINA 4POBA 3GMFA 4MDCA 3WGDA 4POKA 2YOIA 5HR1A 5HR0A 3WGEA 4V1Ag 2FUG2 1TW9A 5HQPA 4MZCA 2VL2C 2XBIA 2GQLA 2GS3A 3IOSA 4V2LA 2B5XA 3IDVA 1Z6NA 2VCVA 4WEYA 4AF2A 2C0EA 5J4UA 4P3YB 2WFCA 1V40A 2LUSA 3HVXA 5G1LA 4FO5A 2F8FA 16GSA 4BWSA 1THOA 4K7NA 2C0DA 5IM9A 4XTSA 2HYXA 1MDJA 5D93A 3LYPA 2GT6A 3L9UA 5D9TA 1BQ7A 5CP1A 4XRDA 2C3TA 1R26A 2CVKA 1T8EB 3ME7A 4KNDA 5ENUA 4OMVA 4XIHA 3GYKA 4FIWA 2A4VA 7GSSA 1GTIA 1MD3A 3W8SA 3VWUA 4MF7A 2BJXA 3LXTA 5JCWA 2CT6A 4HQZA 1Z3EA 5AISA 1UC7A 3DKSA 1QUWA 3G7YA 1GNEA 2O85A 3O6TA 4TR4A 1M2BA 4QQ7A 4WR4A 17GSA 2F3MA 2O8VB 2B5EA 1TXXA 1EGRA 4PURA 2YV7A 2HSHA 1TK5B 4J57E 3FY7A 1OC3A 5FWGA 1UN2A 5IOWA 3IHQA 3FKFA 5C04A 5JWOB 1H75A 1AUCA 3LEFA 2H6YA 5KN1A 2TIRA 4ZL8A 1PX6A 2K6VA 1PL2A 3EYTA 3L4NA 4HDEA 1E6BA 2HFDA 4ISDA 3FZ4A 3F6FA 2I4AA 4YQMA 3H79A 1Z6MA 1GLQA 1PSQA 5C00A 2DJ1A 2MMOA 1ZMAA 2RM5A 1TP9A 1YEXA 4JEDA 4KA0A 2AHEA 5F8BA 1HD2A 2YNXA 3M0FA 4K1FA 1X5CA 2YCDA 4MPFA 1GH2A 2OACA 4TRXA 1U6TA 3MNGA 3O3TA 4IKHA 4O92A 2D2ZA 3OR5A 4IS0A 2JSZA 1VF4A 3ERFA 2VCTA 2DC5A 4HU9A 5KN0A 3I43A 9GSSA 1AQXA 1U87A 3GKMA 5CO3A 4PQIA 1MDIA 5B6MA 2DIZA 2HSYA 3GKKA 2WZ9A 1XWBA 2H1DA 4LMWA 3L78A 3APOA 1GSQA 3GX0A 2F9SA 3D4TA 3N9JA 2M46A 4PUAA 4IJIA 1EEMA 5ID2B 1WMJA 2FHEA 1G7OA 1O8XA 2YJHA 2V6KA 5D73A 3G7JA 2OJLA 2HI7A 1EP7A 2PBJA 3FR6A 1XWCA 3EU4A 1U88A 2PWJA 4AJ7A 1FB6A 5ECIB 3ED3A 5DQSA 3RPPA 1XW6A 5LCZA 4G19A 4K9ZA 2YZHA 3U5RE 3KP8A 4HJ2A 2YP6A 3C7MA 20GSA 3IBHA 4GCIA 4J2FA 2PVOC 1K0CA 2VOCA 3O76A 3L9VA 2MMNA 3L9SA 3A2WA 1TU7A 1KEBA 5DJMA 1QGVA 4PQHA 1A2JA 1GTAA 3GN3A 3D0ZA 3VWXA 1NW2A 4ZILA 3KJYA 2FGXA 5ID2A 4EDYA 3ISOA 1UA5A 1JFUA 4HZ2A 2K18A 4ZB9A 2WCIA 1A0FA 4N0ZA 5KEJA 2V6OA 5F06A 3DYRA 5J9BA 4WXTA 2CZ2A 2H1GA 5G31A 5F05A 2VD1A 5CRWA 5IMCA 4EDZA 1XXUA 4MF6A 2R4VA 1X9MB 1XVQA 1A8YA 5A5KA 2B1LA 3HD5A 2GSSA 5D9VA 3F4RA 3KZQA 5FT3A 2QSIA 10GSA 3CRTA 3QAVA 3KCMA 4KGIA 2L4QA 3GKXA 4KDXA 2H71A 3FHKA 1B9XC 5H5SA 5ECRB 2VCQA 2FD3A 3ZZXA 1K3LA 1URMA 1O6JA 2PERA 4XCSA 3KGKA 4NXIA 3CSHA 4I8BA 2DLXA 4ECCA 2N5FA 3QFBC 3GFKA 4OFTA 5IO2A 2LNSA 2E7PA 1I5GA 8GSSA 2R37A 4XHMA 2VL9A 1N8JA 4OFMA 2B6MA 2JACA 1U3AA 1NHYA 2K8SA 2EC4A 3C1SA 4IGJA 4WF4A 1N2AA 2GLRA 3GL5A 1ERUA 12GSA 4D73B 2LRTA 3PR8A 3EURA 1GULA 5HFIA 2C8UA 2MBSA 3LXZA 1YKCA 1FOVA 2X64A 5LD0A 1XVWA 3IV4A 3VURA 3LQ7A 4O32A 5ELAA 6GSVA 3ZVJD 3GTUA 1HYUA 1YKAA 1Q4JA 2ALBA 2DJKA 3TDGA 3LSZA 1AXDA 2LTKA 3US3A 1G7EA 4MZWA 1PRXA 4CDOA 4DSSB 1YQ1A 1O8WA 5GSSA 2CX4A 2VIMA 4HI7A 1R5PA 3I9V2 2ZCTA 2L5LA 3FR3A 1ILOA 4KUNA 4YH2A 4GQFA 3UIWA 2VD0A 5EPFA 2H76A 4ECBA 3LJRA 2QGVA 3DVWA 3C71A 5HR3A 5JCGA 3QOUA 1Y25A 1TJDA 3EU3A 4OCEA 5ECMB 3ZIJA 3TGZA 4DSQA 2B7KA 2GSQA 1ZGNA 2FA4A 4NMUA 3I69A 5DBQA 1DBYA 1TI1A 4DSRA 2V32A 2H0HA 4HQSA 3E9JB 5ABRA 3A3TA 5HR2A 4WR5A 2RIIA 3FYGA 4KH7A 3TJFA 4DSSA 2ON5A 4CHSA 3I6AA 2G2QA 3HJPA 4ID0A 3P8WA 2WGRA 3C8EA 4RQRA 2ES7A 2IMKA 2EIOA 5ECKB 18GSA 1X9WB 2RUFA 4MJAA 2CVDA 1WIKA 3MAKA 5J3RA 4QL7A 1SENA 4HOJA 3HCZA 2G0FA 2FWHA 5GZZB 1K0AA 6GSTA 2JU5A 2LRNA 2VM1A 1JLVA 4LL4B 5ECPB 14GSA 2WJUA 4ZXGA 2XPEA 3NOFA 4IVFA 4EO3A 3JCML 3CTGA 4MJEA 4K7OA 3IPZA 1A0RP 1CQHA 3GURA 3E0UA 1GUMA 2CV4A 3UOMA 2LV3A 2WS2A 1QQ2A 5L71A 5DDLA 4DEJA 1GSDA 2NVLA 2L59A 3QFAC 3TJBA 2JL4A 3IRAA 4OFNA 3GKNA 1FO5A 4TN8A 4WBRD 4O5RA 3F4SA 3ERGA 4IP6A 3IK9A 3IXRA 3ME8A 2C3NA 4WETA 4BVXA 5IOXA 1JZDA 1J9BA 1PX7A 2YPMA 1OE7A 2PGTA 1A8LA 4YAPA 3GSTA 1B4PA 4XS1A 2H72A 1K0OA 2GZZA 3UAPA 4I2UA 5IMFA 3LGCA 1VF2A 1EGOA 5INYA 2OE0A 1LU4A 2OKAA 2MMZA 4HU7A 5EVOA 2B5YA 5A4WA 2JZRA 3KM6A 3HVVA 2HLSA 2CAIA 3M9JA 2VCZA 1SJIA 4X1UA 4EL1A 3ZMKA 3FZAA 4HEA2 3LORA 4G10A 2H01A 1PKZA 2YV9A 4L0UA 3D4MA 1VGLA 2CVBA 2K8VA 4GLTA 5AIXA 3IC4A 2A2SA 4HZ4A 3AY8A 1AQVA 1T3BA 4L0WA 2DSAA 4ZB6A 1G0TA 1K3OA 2KHPA 3ZL5A 3IAS2 2R5GA 4IN0A 4J56E 3TCOA 1O7UA 3BD2A 3RAZA 3KD0A 3VFIA 2HNLA 5HFKA 4JRRA 1FG4A 4HJMA 1MD4A 1QXHA 1KNGA 4AJ6A 6GSSA 4XS4B 4XS6A 3SBCA 3VI7A 1SL1B 3BCKA 1JZOA 3EVIA 1XWGA 2RLIA 3CXGA 4ZBBA 1WRYA 1M2AA 1XW9A 3ZLPA 1X0RA 2L5OA 1GSYA 2ON7A 1VF3A 1YY7A 2YWNA 1GL8A 2GQKA 4EC0A 4RI7A 3ZTLA 3CRUA 4YQUA 4F2IA 1TRVA 2HE3A 2IMEA 3IK7A 4MH3A 3TOUA 3A2XA 1M9AA 1ZZYA 1R4WA 2X8CA 1M9BA 3EC3A 3TKPA 4KCAA 2H0IA 2MMAA 1PMTA 5COHA 2VCWA 4PQ1A 2IFQA 4YAVA 1TKDB 1GSFA 1BJXA 3HXSA 2C0FA 3KH7A 1SK2A 2FA8A 2OA7A 4QL9A 4XS4A 3VK9A 5DALB 4JU5A 3HDCA 2PVQA 1G6YA 3LYKA 5CYYA 4NWYA 4IQAA 1PN9A 4KB3A 3EMPA 3TRXA 1X9SB 1U3IA 3Q6OA 1GUKA 4JBBA 1TOFA 1XWKA 1HNCA 1MEKA 1SL2B 3M3MA 1AQWA 3HVSA 2IMIA 2CZ3A 3GHAA 4L8EA 3MWHA 1YZXA 4F03A 3UEMA 3S9FA 3KIJA 1BAYA 3RHBA 1KTEA 3DD3A 3Q19A 3D6IA 2XC2A 3Q18A 1BG5A 1M0UA 2HRFA 1GTUA 2C1YA 1GRXA 5G30A 1QK8A 1SD8A 2N5BA 2KP1A 4PNFA 2H19A 5DALA 3CMIA 2NPBA 3TKSC 1B8XA 4EE0A 3H1NA 1GWCA 6GSUA 2C3QA 4K2DA 3W6GA 5EY6A 3TKSA 5F0GA 3ZITA 1X5EA 3ZIVA 5KN3A 2GT5A 3J7Yk 1FW1A 2E2GA 5A4VA 2N5AA 2L57A 1HQOA 2HT9A 4CW9A 1WOUA 4EVMA 4ACSA 2VLUA 1B48A 1K3YA 5B8BA 4ECIA 4BL7A 2P31A 3HZ4A 1MTCA 2CA8A 2AAWA 2IIYA 1JHBA 5A4UA 2REMA 2DJ0A 3F9UA 1AIUA 3GTUB 1W4VA 1SK0A 2KLXA 4TR1B 2FCHA 5DJLA 2OE3A 5ECNB 1Z7PA 3FEUA 5IO0A 3UARA 1XIYA 3IE3A 2MZCA 3G9BA 2WB9A 2YWMA 4IQ1A 1USBA 3DIEA 2F51A 3NZNA 5H5RA 1O85A 2L6CA 3ZYWA 4IW9A 1OKDA 2IPAA 4I5QA 6GSWA 2HRNA 1SK1A 5ECLB 2KUCA 4JR4A 4TOPA 3UBKA 3CYNA 2LQQA 2H6ZA 1M99A 4I2TA 2A2RA 4I6XA 5J9CA 4EKZA 3GA4A 1NM3A 2YZUA 4PX1A 1IYIA 1I9DA 2JZSA 1FAAA 3RHCA 4GQCA 1ZYEA 3GUSA 3F3QA 2H8LA 1OAZA 2HZFA 3GL3A 1TK0B 2O7KA 1GTBA 1XZOA 3HJOA 2C0GA 2VO4A 2DIYA 4F0BA 1M7TA 3GRXA 2FWEA 2O89A 2GZYA 3BOAA 4TR1A 3L0HA 3G7IA 2CQ9A 3BCIA 3VWVA 2P5RA 3BBYA 3UJ1A 2CX3A 4O7HA 4ZBDA 3TRQA 1Q98A 6GSYA 1RQMA 1TRWA 2PU9C 1FHEA 2H74A 5KN2A 1ZOFA 4MZBA 1VRSD 4MJCA 2V1MA 3GNJA 4ZBAA 3CTFA 2HZEA 2I3YA 1GLPA 1AAZA 3HY2A 5H5QA 4BVYA 4GTUA 2AYTA 1TI3A 5D96A 3KMNA 3D21A 3UL3A 2GZPA 1TK8B 1V58A 3GSSA 1K0MA 2I81A 1BYEA 2IWTA 3E3EA 1H4OA 1SKSB 5CRGA 2PMTA 3F8UA 3ZVJA 4ZIJA 3DXBA 2H70A 3FK8A 1T4YA 3DVXA 4V1Ap 3P7XA 3BJ5A 2RUEA 4OWYA 1AC1A 1YEPA 1AW9A 2NTOA 5D8IA 4EUYA 1YJ6A 4F82A 3HYPA 3H93A 1J08A 1GNWA 3FW2A 2X8GA 3EMXA 3KH9A 4ZL9A 2IJYA 1Y6EA 1PGTA 2VLVA 4JE1A 4OO5A 1ERWA 4AGSA 4K6XA 4PNGA 4K8MA 4ML6A 3QCPA 1OC8A 2CAQA 2R3XA 4FYBA 4N30A 3VPTA 4MJBA 2IMFA 2P0GA 1UVZA 4LLRA 3VPQA 5DVBA 5IIZA 2PPTA 3WT1A 2VM2A 4NHZA 1ST9A 3M1GA 4ULXA 3HKRA 4TXOA 1SKRB 1FB0A 4KCEA 1SJZA 3TJJA 4MLYA 1F3AA 4BWQA 1R7HA 1K0NA 2XBQA 5ECQB 1Z5YE 5HFGA 3IR4A 3F0IA 2YJ7A 3GH6A 1ABAA 1O73A 5IMDA 1NSWA 2VCXA 1CQGA 1PKWA 3CBUA 3A2VA 4WBJA 4FH8A 1A2LA 2FLSA
chains in the Genus database with same CATH superfamily
4KW6A 1ZL9A 1YDKA 4KDYA 4LMVA 5KOXA 4GSSA 1WP0A 1F9MA 2VL2A 2DJ3A 5E4WA 1QFNA 5ECSA 1T7PB 5DAKA 4G0KA 1E2YA 2WDUA 2FWGA 2DMLA 2I1UA 3KTBA 1EV4A 4NV5A 2YN1A 2GQMA 4TR3A 1DSBA 3N5OA 5GAPD 4ILFA 1T1VA 2H1BA 4JZQA 5G5EA 3TJKA 1PA3A 2B3SA 1V98A 3DGQA 2V41A 1SKWB 1K0DA 1SU9A 2P5QA 2E2MA 1SYRA 2MYGA 4JR6A 1TTZA 2JADA 4NHWA 1J0FA 1LJRA 2NBSA 2ZNMA 2FWFA 1EOHA 1V57A 4I97A 4KSMA 1ACVA 3QMXA 3CQFA 1XOBA 5JCUA 3KP9A 3ERWA 3TJGA 2GSRA 1A2MA 3HVNA 4BIKA 3RDWA 5ECOB 1XWAA 5FHIA 2XHFA 3QPMA 4OO4A 1V9WA 2B7JA 4IBPA 3F63A 3FRCA 1F37A 1B9YC 4BPYA 1TRUA 4NV2A 1KBNA 2PUKC 4HS1A 4TW5A 2VL3A 4GXZA 4MMMA 3UBLA 2IFQB 1XFLA 4TVEA 2AV4A 4L5LA 1OC9B 3F4TA 5IQYA 4MH2A 3PGTA 2GVPA 3TKQA 2R2JA 1OVNA 4KSOA 1EWXA 4EF0A 2M72A 1JZRA 5G5FA 4ZB8A 1DUGA 1BEDA 1M2DA 1W89A 2V2GA 4PUFC 4YQVA 1HNBA 2GDRA 4IP1A 4PTSA 3FR9A 5CAXA 4RUVA 4IHUA 3W8JA 3ZREA 2BMXA 1PQNA 2KOKA 4GRFA 5JWRB 2R6KA 3PINA 2OADA 3DRNA 3APSA 3TKSE 1S3RA 1SYXA 2O87A 1ERTA 4TKYA 2GGTA 2NDOA 2K9FA 4G9HA 3CSIA 4POLA 4L5OA 4ECJA 3WGXA 2DJJA 3GH9A 4X43A 1RW1A 4IJ3A 2L4CA 1YF0A 2LJAA 2PN8A 1GUHA 1OC9A 2YWOA 3HHVA 1ERVA 4FYCA 4F0CA 2H30A 2IN3A 3DEXA 1XBSA 3TKRA 5LNKe 4N10A 4V2NA 3KTLA 2GSTA 2OE1A 4XRAA 2Z9SA 5J41A 4Q5RA 1X5DA 6GSXA 2VUPA 5G1KA 2ZUPA 2DMMA 1A23A 3J7Yb 1SL0B 1WJKA 2X99A 3MDKA 1GP1A 3FZ9A 2H66A 3FZ5A 2F8AA 2WULA 1DE1A 4WF5A 4ZL7A 3IA1A 1S3DA 5F07A 2HRKA 4MF5A 5ECHB 5D9XA 4AJ8A 2H6XA 1XOAA 5IPHA 1OYJA 1FVKA 4CY8A 3H4KA 3LG6A 2XPDA 4LL1B 1A24A 2YANA 3V1WA 1C72A 1G6WA 3R2QA 3NIVA 3U6VA 2WRTA 3PH9A 4E8HA 5IMVA 4K0GA 1S3CA 2H1AA 13GSA 4K7IA 3WD6A 2QC7A 5CREA 1S3AA 3WT2A 3A5WA 2TRCP 1VF1A 1F2EA 4EXJA 4Q5NA 3ZFBA 1T00A 2E0QA 2MBTA 5IMAA 1WE0A 1GSEA 4TXVA 2B1KA 3MIXA 1GSSA 3Q74A 3WYWA 4RI6A 22GSA 3QD9A 2C80A 3SWLA 2LRCA 5EL8A 4KE3A 4POMA 1LBKA 19GSA 2JSYA 4GSNA 3RBTA 2LSTA 1XPVA 3HZ8A 1YF1A 4GSTA 2LEGA 3GX8A 1R5AA 3F3RA 4GF0A 3IAM2 2HRAA 1TU8A 2VAFA 4OCFA 2IL3A 4PXOA 1T4ZA 1FOHA 4LA1A 4Z2UA 2I9HA 1TRSA 4NPBA 4N11A 3DMLA 4ML1A 1F3BA 5GAND 3CSJA 3UVTA 4MK3A 5AIVA 4YKFA 5CRDA 3KEBA 2EIRA 4RQXA 1ZYQB 4F9ZA 4H86A 4USSA 3EPTA 3GIXA 1Z9HA 4IELA 5DCHA 3ZMLA 2HZEB 1EV9A 4GWRA 2EIQA 5DCGA 5AN1A 3R3EA 1ON4A 5CRHA 1OKTA 3D5JA 3MSZA 2AUVA 3ZFLA 3VWWA 2LQOA 4KX4A 3KMOA 5ELGA 5IPGA 3UMAA 5J5NA 3K8NA 4Q5FA 1ML6A 2OBIA 1SJ6A 2X8HA 1WPIA 2KP2A 3P90A 3TOTA 5DQYA 4WKWA 2VLTA 4KAEA 1TDIA 2OBKA 3APQA 5IMZA 4MPGA 2IMDA 2J9HA 1GSUA 1NHOA 3QAGA 4K0NA 5G2ZA 2GTUA 4BA7A 3QDNA 3KXOA 4NAXA 3TRPA 2LJKA 4TR0A 1MDKA 2DBCA 3TUEA 1THXA 2L6DA 1B4QA 3LFLA 2LJRA 5E59A 4G2EA 3VLNA 3P2AA 4MABA 1FVJA 2FY6A 4E8EA 3RPNA 1DE2A 2H73A 1OE8A 3C1RA 2LKUA 3DWVA 4D73A 3QAWA 2AB6A 3M8NA 1JLWA 2LNTA 4DVCA 2M80A 4V2MA 1EP8A 4TXOB 5AGYA 1SD9A 2H75A 3F6DA 4PGTA 1K0BA 2RM6A 1QMVA 5B6NA 1BX9A 3EWLA 3EE2A 2QKEA 2H0GA 3HA9A 3ZRDA 3C73A 5B7CA 2BTOT 3QR6A 11GSA 4Z7XA 5CNWA 4OD7A 5D9WA 4MP4A 2C4JA 3H8QA 4MA9A 1F6MC 2LS5A 3D22A 4K5RA 3HJMA 2YWIA 2AJQB 1HNAA 1EOGA 3M9KA 3LWAA 5DAKB 2HXKA 1ZCPA 1PL1A 3UVHA 4FYUA 1O81A 3GV1A 4Q5QA 1Z7RA 5GSTA 2X49A 4HUAA 3TB2A 1RK4A 4N0VA 4KDUA 2JZTA 1EZKA 1V2AA 1XCCA 4X0XA 1PD21 4MCUA 1XW5A 1WWJA 4ICYA 5JWQB 1JZWA 2DJ2A 2J23A 2FNOA 1IYHA 1EEJA 2TRXA 3VI5A 5B8AA 3EINA 4POBA 3GMFA 4MDCA 3WGDA 4POKA 2YOIA 5HR1A 5HR0A 3WGEA 4V1Ag 2FUG2 1TW9A 5HQPA 4MZCA 2VL2C 2XBIA 2GQLA 2GS3A 3IOSA 4V2LA 5KOWA 2B5XA 5BRTA 3IDVA 1Z6NA 1ZYNA 2VCVA 4WEYA 4AF2A 2C0EA 5J4UA 4P3YB 2WFCA 1V40A 2LUSA 3HVXA 5G1LA 4FO5A 2F8FA 16GSA 4BWSA 1THOA 3LW9A 4K7NA 2C0DA 5IM9A 4XTSA 2HYXA 1MDJA 5D93A 3LYPA 2GT6A 3L9UA 3A5IA 5D9TA 1BQ7A 5CP1A 4XRDA 2C3TA 1R26A 2CVKA 4Z2TA 1T8EB 3ME7A 4KNDA 5ENUA 4OMVA 4XIHA 3GYKA 4FIWA 2A4VA 7GSSA 1GTIA 1MD3A 3W8SA 3VWUA 4MF7A 2BJXA 3LXTA 5JCWA 2CT6A 4HQZA 1Z3EA 5AISA 1UC7A 3DKSA 1QUWA 3G7YA 1GNEA 2O85A 3O6TA 2DKIA 4TR4A 1M2BA 4QQ7A 4WR4A 17GSA 2F3MA 2O8VB 2B5EA 1TXXA 1EGRA 4PURA 2YV7A 2HSHA 1TK5B 4J57E 3FY7A 1OC3A 5FWGA 1UN2A 5IOWA 3IHQA 3FKFA 4HSCX 5C04A 5JWOB 1H75A 1AUCA 3LEFA 2H6YA 5KN1A 2TIRA 4ZL8A 1PX6A 3MYDA 2K6VA 1PL2A 3EYTA 3L4NA 4HDEA 1E6BA 2HFDA 4ISDA 3FZ4A 3F6FA 2I4AA 4YQMA 2A2PA 3H79A 1Z6MA 1GLQA 1PSQA 5C00A 2DJ1A 2MMOA 1ZMAA 2RM5A 1TP9A 1YEXA 4JEDA 4KA0A 2AHEA 5F8BA 1HD2A 2YNXA 3M0FA 4K1FA 1X5CA 2YCDA 4MPFA 1GH2A 2OACA 4TRXA 1U6TA 3MNGA 3O3TA 4IKHA 4O92A 2D2ZA 3OR5A 4IS0A 2JSZA 1VF4A 3FMWA 3ERFA 2VCTA 2DC5A 4HU9A 5KN0A 3PPUA 3IC8A 3I43A 4O5QA 9GSSA 1AQXA 1U87A 3GKMA 5CO3A 4O5UA 4PQIA 1MDIA 5B6MA 2DIZA 2HSYA 3GKKA 2WZ9A 1XWBA 2H1DA 4LMWA 3L78A 3APOA 1GSQA 3GX0A 2F9SA 3D4TA 3N9JA 2M46A 4PUAA 4IJIA 1EEMA 5ID2B 1WMJA 2FHEA 1G7OA 1O8XA 2YJHA 2V6KA 5D73A 3G7JA 2OJLA 2HI7A 1EP7A 2PBJA 3FR6A 1XWCA 3EU4A 1U88A 2PWJA 4AJ7A 1FB6A 5ECIB 3ED3A 5DQSA 3RPPA 1XW6A 2HSMA 5LCZA 4G19A 4K9ZA 4K5SA 2YZHA 3U5RE 3KP8A 4HJ2A 2YP6A 3C7MA 20GSA 3IBHA 4GCIA 4J2FA 2PVOC 1K0CA 2VOCA 3O76A 3L9VA 2MMNA 3L9SA 3A2WA 1TU7A 1KEBA 5DJMA 1QGVA 4PQHA 1A2JA 1GTAA 3GN3A 3D0ZA 3VWXA 1NW2A 4ZILA 3KJYA 2FGXA 5ID2A 4EDYA 3ISOA 1UA5A 1JFUA 4HZ2A 2K18A 4ZB9A 2WCIA 1A0FA 4N0ZA 5KEJA 2V6OA 5F06A 3DYRA 5J9BA 4WXTA 2CZ2A 2H1GA 5G31A 5F05A 2VD1A 5CRWA 5IMCA 4EDZA 1XXUA 4MF6A 2R4VA 4X4JA 1X9MB 1XVQA 1A8YA 5A5KA 2B1LA 3HD5A 2GSSA 5D9VA 3F4RA 3KZQA 5FT3A 2QSIA 10GSA 3CRTA 1XG8A 3QAVA 3KCMA 4KGIA 2L4QA 3GKXA 4KDXA 2H71A 3FHKA 1B9XC 5H5SA 4G0LA 5ECRB 2VCQA 2FD3A 3ZZXA 1K3LA 1URMA 1O6JA 2PERA 4XCSA 3KGKA 4NXIA 3CSHA 4I8BA 2DLXA 4ECCA 2N5FA 3QFBC 3GFKA 4OFTA 5IO2A 2LNSA 2E7PA 1I5GA 8GSSA 2R37A 4XHMA 2VL9A 1N8JA 4OFMA 2B6MA 2JACA 1U3AA 1NHYA 2K8SA 2EC4A 3C1SA 4IGJA 4WF4A 1N2AA 2GLRA 3GL5A 1ERUA 12GSA 4D73B 2LRTA 3PR8A 3EURA 1GULA 5HFIA 2C8UA 2MBSA 3LXZA 4EIPA 1YKCA 1FOVA 2X64A 5LD0A 1XVWA 3IV4A 3VURA 3LQ7A 4O32A 5ELAA 6GSVA 2R0GA 3ZVJD 3GTUA 1HYUA 1YKAA 1Q4JA 2ALBA 2DJKA 3TDGA 3LSZA 2R0PA 1AXDA 2LTKA 3US3A 1G7EA 4MZWA 1PRXA 4CDOA 4EIQA 4DSSB 1YQ1A 1O8WA 5GSSA 2CX4A 2VIMA 4HI7A 1R5PA 3I9V2 2ZCTA 2L5LA 3FR3A 1ILOA 4KUNA 4YH2A 4GQFA 3UIWA 2VD0A 5EPFA 2H76A 4ECBA 3LJRA 2QGVA 3DVWA 3C71A 5HR3A 5JCGA 3QOUA 1Y25A 1TJDA 3EU3A 4OCEA 5ECMB 3ZIJA 3TGZA 4DSQA 2B7KA 2GSQA 1ZGNA 2FA4A 4NMUA 3I69A 5DBQA 1DBYA 1TI1A 4DSRA 2V32A 2H0HA 4HQSA 3E9JB 5ABRA 3A3TA 5HR2A 4WR5A 2RIIA 3FYGA 4KH7A 3TJFA 4DSSA 2ON5A 4CHSA 2QA2A 3I6AA 2G2QA 3HJPA 4ID0A 3P8WA 2WGRA 3C8EA 4RQRA 2ES7A 2IMKA 2EIOA 5ECKB 18GSA 1X9WB 2RUFA 4MJAA 2CVDA 1WIKA 3MAKA 5J3RA 4QL7A 1SENA 4KF9A 4HOJA 3HCZA 2G0FA 2FWHA 5GZZB 1K0AA 6GSTA 2JU5A 4BVXB 2LRNA 2VM1A 1JLVA 4LL4B 5ECPB 14GSA 2WJUA 4ZXGA 2XPEA 3NOFA 4IVFA 4EO3A 3JCML 3CTGA 4MJEA 4K7OA 3IPZA 1A0RP 1CQHA 3GURA 3E0UA 1GUMA 2CV4A 3UOMA 2LV3A 4FQUA 2WS2A 1QQ2A 5L71A 5DDLA 4DEJA 1GSDA 2NVLA 2L59A 3QFAC 3TJBA 2JL4A 3IRAA 4OFNA 3GKNA 1FO5A 4TN8A 4WBRD 4O5RA 4K2XA 3F4SA 3ERGA 4IP6A 3IK9A 3IXRA 3ME8A 2C3NA 4WETA 4BVXA 5IOXA 1JZDA 1J9BA 1PX7A 2YPMA 1OE7A 2PGTA 1A8LA 4YAPA 3GSTA 1B4PA 4XS1A 2H72A 1K0OA 2GZZA 3UAPA 4I2UA 5IMFA 3LGCA 1VF2A 1EGOA 1PN0A 5INYA 2OE0A 1LU4A 2OKAA 2MMZA 4HU7A 5EVOA 2B5YA 5A4WA 2JZRA 3KM6A 3HVVA 2HLSA 2CAIA 3M9JA 2VCZA 1SJIA 4X1UA 4EL1A 3ZMKA 3FZAA 4HEA2 3LORA 4G10A 2H01A 1PKZA 2YV9A 4L0UA 3D4MA 1VGLA 2CVBA 2K8VA 4GLTA 3IC4A 5AIXA 2A2SA 4HZ4A 3AY8A 1AQVA 1T3BA 4L0WA 2DSAA 4ZB6A 1G0TA 1K3OA 2KHPA 3ZL5A 3IAS2 2R5GA 4IN0A 4J56E 3TCOA 1O7UA 3BD2A 3RAZA 3KD0A 3VFIA 2HNLA 5HFKA 4JRRA 1FG4A 4HJMA 4G0IA 1MD4A 1QXHA 1KNGA 4AJ6A 6GSSA 4XS4B 4XS6A 3SBCA 3VI7A 1SL1B 3BCKA 1JZOA 3EVIA 1XWGA 2RLIA 3CXGA 4ZBBA 1WRYA 1M2AA 1XW9A 3ZLPA 1X0RA 2L5OA 1GSYA 2ON7A 1VF3A 1YY7A 2YWNA 1GL8A 4Z2RA 2GQKA 4EC0A 4RI7A 3ZTLA 3CRUA 4YQUA 4F2IA 1TRVA 2HE3A 2IMEA 3IK7A 4MH3A 3IHGA 3TOUA 3A2XA 1M9AA 1ZZYA 1R4WA 2X8CA 1M9BA 3EC3A 3TKPA 4KCAA 5BMUA 2H0IA 2MMAA 1PMTA 5COHA 2VCWA 4PQ1A 2IFQA 2R0CA 4YAVA 1TKDB 1GSFA 1BJXA 3HXSA 2C0FA 3KH7A 1SK2A 2FA8A 2OA7A 4QL9A 4XS4A 3VK9A 5DALB 4JU5A 3HDCA 2PVQA 1G6YA 3LYKA 5CYYA 4NWYA 4IQAA 1PN9A 4KB3A 3EMPA 3TRXA 1X9SB 1U3IA 3Q6OA 1GUKA 4JBBA 1TOFA 1XWKA 1HNCA 2DKHA 1MEKA 1SL2B 3M3MA 1AQWA 3HVSA 2IMIA 2CZ3A 4MNNA 1ZYPA 3GHAA 4L8EA 3MWHA 1YZXA 4F03A 3UEMA 3S9FA 3KIJA 1BAYA 3RHBA 1KTEA 4YKGA 3DD3A 3Q19A 4BL7B 3D6IA 2XC2A 3Q18A 1BG5A 1M0UA 2HRFA 1GTUA 2C1YA 1GRXA 5G30A 1QK8A 1SD8A 2N5BA 2KP1A 4PNFA 2H19A 5DALA 2A4HA 3CMIA 2NPBA 3TKSC 1B8XA 4EE0A 3H1NA 1GWCA 6GSUA 2C3QA 4K2DA 3W6GA 5EY6A 3TKSA 5F0GA 3ZITA 1X5EA 3ZIVA 5KN3A 2GT5A 3J7Yk 1FW1A 2E2GA 5A4VA 2N5AA 2L57A 1HQOA 2HT9A 4CW9A 1WOUA 4EVMA 4ACSA 2VLUA 1B48A 1K3YA 5B8BA 1PFOA 2UZ8A 4ECIA 4BL7A 2P31A 3HZ4A 1MTCA 2CA8A 2AAWA 2IIYA 1JHBA 5A4UA 2REMA 2DJ0A 3F9UA 1AIUA 3GTUB 1W4VA 1SK0A 2KLXA 4TR1B 2FCHA 5DJLA 2OE3A 5ECNB 1Z7PA 3FEUA 5IO0A 3UARA 1XIYA 3IE3A 2MZCA 3G9BA 1M3JA 2WB9A 2YWMA 4IQ1A 1USBA 3DIEA 2F51A 3NZNA 5H5RA 1O85A 2L6CA 3ZYWA 4IW9A 1OKDA 2IPAA 4I5QA 6GSWA 2HRNA 1SK1A 5ECLB 2KUCA 4JR4A 4TOPA 3UBKA 3CYNA 2LQQA 2H6ZA 1M99A 4I2TA 2A2RA 4I6XA 4BVYB 5J9CA 4EKZA 3GA4A 1NM3A 2YZUA 4PX1A 1IYIA 1I9DA 2JZSA 1FAAA 3RHCA 4GQCA 1ZYEA 3GUSA 3F3QA 2QA1A 2H8LA 4A5PA 1OAZA 2HZFA 3GL3A 1TK0B 2O7KA 1GTBA 1XZOA 3HJOA 2C0GA 2VO4A 2DIYA 4F0BA 1M7TA 3GRXA 2FWEA 2O89A 2GZYA 3BOAA 4TR1A 3L0HA 3G7IA 2CQ9A 3BCIA 3VWVA 2P5RA 3BBYA 3UJ1A 2CX3A 4O7HA 4ZBDA 3TRQA 1Q98A 6GSYA 1RQMA 1TRWA 2PU9C 1FHEA 2H74A 5KN2A 1ZOFA 4MZBA 1VRSD 4MJCA 2V1MA 3GNJA 4ZBAA 3CTFA 2HZEA 2I3YA 1GLPA 1AAZA 3HY2A 5H5QA 4BVYA 4GTUA 1M3IA 2AYTA 1TI3A 5D96A 3KMNA 3D21A 3UL3A 2GZPA 1TK8B 1V58A 4CY6A 3GSSA 1K0MA 2I81A 1BYEA 2IWTA 3E3EA 1H4OA 1SKSB 5CRGA 2PMTA 3F8UA 3ZVJA 4ZIJA 3DXBA 2H70A 3FK8A 1T4YA 3DVXA 4V1Ap 3P7XA 3BJ5A 2RUEA 4OWYA 1AC1A 1YEPA 1AW9A 2NTOA 5D8IA 4EUYA 1YJ6A 4F82A 3HYPA 3H93A 1J08A 1GNWA 3FW2A 2X8GA 3EMXA 3KH9A 4ZL9A 2IJYA 1Y6EA 1PGTA 2VLVA 4JE1A 4OO5A 1ERWA 4AGSA 4K6XA 4PNGA 4K8MA 4ML6A 3QCPA 1OC8A 2CAQA 2R3XA 4FYBA 4N30A 3VPTA 4MJBA 2IMFA 2P0GA 1UVZA 4LLRA 3VPQA 5DVBA 5IIZA 2PPTA 3WT1A 2VM2A 4NHZA 1ST9A 3M1GA 4ULXA 3HKRA 4TXOA 1SKRB 1FB0A 4KCEA 1SJZA 3TJJA 4MLYA 1F3AA 4BWQA 1R7HA 1K0NA 2XBQA 5ECQB 1Z5YE 5HFGA 3IR4A 3F0IA 2YJ7A 3GH6A 2X4AA 1ABAA 1O73A 5IMDA 1NSWA 2VCXA 1CQGA 1PKWA 3CBUA 3A2VA 4WBJA 4FH8A 1A2LA 2FLSA
chains in the Genus database with same CATH topology
4KW6A 1ZL9A 1YDKA 4KDYA 4LMVA 5KOXA 4GSSA 1WP0A 1F9MA 2VL2A 2DJ3A 5E4WA 1QFNA 5ECSA 1T7PB 5DAKA 4G0KA 1E2YA 2WDUA 2FWGA 2DMLA 2I1UA 3KTBA 1EV4A 4NV5A 2YN1A 2GQMA 4TR3A 1DSBA 3N5OA 5GAPD 4ILFA 1T1VA 2H1BA 4JZQA 5G5EA 3TJKA 1PA3A 2B3SA 1V98A 3DGQA 2V41A 1SKWB 1K0DA 1SU9A 2P5QA 2E2MA 1SYRA 2MYGA 4JR6A 1TTZA 2JADA 4NHWA 1J0FA 1LJRA 2NBSA 2ZNMA 2FWFA 1EOHA 1V57A 4I97A 4KSMA 1ACVA 3QMXA 1XOBA 5JCUA 3KP9A 3ERWA 3TJGA 2GSRA 1A2MA 3RDWA 5ECOB 1XWAA 5FHIA 2XHFA 3QPMA 4OO4A 1V9WA 2B7JA 4IBPA 3F63A 3FRCA 1F37A 1B9YC 4BPYA 1TRUA 4NV2A 1KBNA 2PUKC 4HS1A 4TW5A 2VL3A 4GXZA 4MMMA 3UBLA 2IFQB 1XFLA 4TVEA 2AV4A 4L5LA 1OC9B 3F4TA 5IQYA 4MH2A 3PGTA 2GVPA 3TKQA 2R2JA 1OVNA 4KSOA 1EWXA 4EF0A 2M72A 1JZRA 5G5FA 4ZB8A 1DUGA 1BEDA 1M2DA 1W89A 2V2GA 4PUFC 4YQVA 1HNBA 2GDRA 4IP1A 4PTSA 3FR9A 5CAXA 4RUVA 4IHUA 3W8JA 3ZREA 2BMXA 1PQNA 2KOKA 4GRFA 5JWRB 2R6KA 3PINA 2OADA 3DRNA 3APSA 3TKSE 1SYXA 2O87A 1ERTA 4TKYA 2GGTA 2NDOA 2K9FA 4G9HA 3CSIA 4POLA 4L5OA 4ECJA 3WGXA 2DJJA 3GH9A 4X43A 1RW1A 4IJ3A 2L4CA 1YF0A 2LJAA 2PN8A 1GUHA 1OC9A 2YWOA 3HHVA 1ERVA 4FYCA 4F0CA 2H30A 2IN3A 3DEXA 1XBSA 3TKRA 5LNKe 4N10A 4V2NA 3KTLA 2GSTA 2OE1A 4XRAA 2Z9SA 5J41A 4Q5RA 1X5DA 6GSXA 2VUPA 5G1KA 2ZUPA 2DMMA 1A23A 3J7Yb 1SL0B 1WJKA 2X99A 3MDKA 1GP1A 3FZ9A 2H66A 3FZ5A 2F8AA 2WULA 1DE1A 4WF5A 4ZL7A 3IA1A 1S3DA 5F07A 2HRKA 4MF5A 5ECHB 5D9XA 4AJ8A 2H6XA 1XOAA 5IPHA 1OYJA 1FVKA 4CY8A 3H4KA 3LG6A 2XPDA 4LL1B 1A24A 2YANA 3V1WA 1C72A 1G6WA 3R2QA 3NIVA 3U6VA 2WRTA 3PH9A 4E8HA 5IMVA 4K0GA 1S3CA 2H1AA 13GSA 4K7IA 3WD6A 2QC7A 5CREA 1S3AA 3WT2A 3A5WA 2TRCP 1VF1A 1F2EA 4EXJA 4Q5NA 3ZFBA 1T00A 2E0QA 2MBTA 5IMAA 1WE0A 1GSEA 4TXVA 2B1KA 3MIXA 1GSSA 3Q74A 3WYWA 4RI6A 22GSA 3QD9A 2C80A 3SWLA 2LRCA 5EL8A 4KE3A 4POMA 1LBKA 19GSA 2JSYA 4GSNA 3RBTA 2LSTA 1XPVA 3HZ8A 1YF1A 4GSTA 2LEGA 3GX8A 1R5AA 3F3RA 4GF0A 3IAM2 2HRAA 1TU8A 2VAFA 4OCFA 2IL3A 4PXOA 1T4ZA 1FOHA 4LA1A 4Z2UA 2I9HA 1TRSA 4NPBA 4N11A 3DMLA 4ML1A 1F3BA 5GAND 3CSJA 3UVTA 4MK3A 5AIVA 4YKFA 5CRDA 3KEBA 2EIRA 4RQXA 1ZYQB 4F9ZA 4H86A 4USSA 3EPTA 3GIXA 1Z9HA 4IELA 5DCHA 3ZMLA 2HZEB 1EV9A 4GWRA 2EIQA 5DCGA 5AN1A 3R3EA 1ON4A 5CRHA 1OKTA 3D5JA 3MSZA 2AUVA 3ZFLA 3VWWA 2LQOA 4KX4A 3KMOA 5ELGA 5IPGA 3UMAA 5J5NA 3K8NA 4Q5FA 1ML6A 2OBIA 1SJ6A 2X8HA 1WPIA 2KP2A 3P90A 3TOTA 5DQYA 4WKWA 2VLTA 4KAEA 1TDIA 2OBKA 3APQA 5IMZA 4MPGA 2IMDA 2J9HA 1GSUA 1NHOA 3QAGA 4K0NA 5G2ZA 2GTUA 4BA7A 3QDNA 3KXOA 4NAXA 3TRPA 2LJKA 4TR0A 1MDKA 2DBCA 3TUEA 1THXA 2L6DA 1B4QA 3LFLA 2LJRA 5E59A 4G2EA 3VLNA 3P2AA 4MABA 1FVJA 2FY6A 4E8EA 3RPNA 1DE2A 2H73A 1OE8A 3C1RA 2LKUA 3DWVA 4D73A 3QAWA 2AB6A 3M8NA 1JLWA 2LNTA 4DVCA 2M80A 4V2MA 1EP8A 4TXOB 5AGYA 1SD9A 2H75A 3F6DA 4PGTA 1K0BA 2RM6A 1QMVA 5B6NA 1BX9A 3EWLA 3EE2A 2QKEA 2H0GA 3HA9A 3ZRDA 3C73A 5B7CA 2BTOT 3QR6A 11GSA 4Z7XA 5CNWA 4OD7A 5D9WA 4MP4A 2C4JA 3H8QA 4MA9A 1F6MC 2LS5A 3D22A 4K5RA 3HJMA 2YWIA 2AJQB 1HNAA 1EOGA 3M9KA 3LWAA 5DAKB 2HXKA 1ZCPA 1PL1A 3UVHA 4FYUA 1O81A 3GV1A 4Q5QA 1Z7RA 5GSTA 2X49A 4HUAA 3TB2A 1RK4A 4N0VA 4KDUA 2JZTA 1EZKA 1V2AA 1XCCA 4X0XA 1PD21 4MCUA 1XW5A 1WWJA 4ICYA 5JWQB 1JZWA 2DJ2A 2J23A 2FNOA 1IYHA 1EEJA 2TRXA 3VI5A 5B8AA 3EINA 4POBA 3GMFA 4MDCA 3WGDA 4POKA 2YOIA 5HR1A 5HR0A 3WGEA 4V1Ag 2FUG2 1TW9A 5HQPA 4MZCA 2VL2C 2XBIA 2GQLA 2GS3A 3IOSA 4V2LA 5KOWA 2B5XA 5BRTA 3IDVA 1Z6NA 1ZYNA 2VCVA 4WEYA 4AF2A 2C0EA 5J4UA 4P3YB 2WFCA 1V40A 2LUSA 3HVXA 5G1LA 4FO5A 2F8FA 16GSA 4BWSA 1THOA 3LW9A 4K7NA 2C0DA 5IM9A 4XTSA 2HYXA 1MDJA 5D93A 3LYPA 2GT6A 3L9UA 3A5IA 5D9TA 1BQ7A 5CP1A 4XRDA 2C3TA 1R26A 2CVKA 4Z2TA 1T8EB 3ME7A 4KNDA 5ENUA 4OMVA 4XIHA 3GYKA 4FIWA 2A4VA 7GSSA 1GTIA 1MD3A 3W8SA 3VWUA 4MF7A 2BJXA 3LXTA 5JCWA 2CT6A 4HQZA 1Z3EA 5AISA 1UC7A 3DKSA 1QUWA 3G7YA 1GNEA 2O85A 3O6TA 2DKIA 4TR4A 1M2BA 4QQ7A 4WR4A 17GSA 2F3MA 2O8VB 2B5EA 1TXXA 1EGRA 4PURA 2YV7A 2HSHA 1TK5B 4J57E 3FY7A 1OC3A 5FWGA 1UN2A 5IOWA 3IHQA 3FKFA 5C04A 5JWOB 1H75A 1AUCA 3LEFA 2H6YA 5KN1A 2TIRA 4ZL8A 1PX6A 3MYDA 2K6VA 1PL2A 3EYTA 3L4NA 4HDEA 1E6BA 2HFDA 4ISDA 3FZ4A 3F6FA 2I4AA 4YQMA 2A2PA 3H79A 1Z6MA 1GLQA 1PSQA 5C00A 2DJ1A 2MMOA 1ZMAA 2RM5A 1TP9A 1YEXA 4JEDA 4KA0A 2AHEA 5F8BA 1HD2A 2YNXA 3M0FA 4K1FA 1X5CA 2YCDA 4MPFA 1GH2A 2OACA 4TRXA 1U6TA 3MNGA 3O3TA 4IKHA 4O92A 2D2ZA 3OR5A 4IS0A 2JSZA 1VF4A 3FMWA 3ERFA 2VCTA 2DC5A 4HU9A 5KN0A 3PPUA 3IC8A 3I43A 4O5QA 9GSSA 1AQXA 1U87A 3GKMA 5CO3A 4O5UA 4PQIA 1MDIA 5B6MA 2DIZA 2HSYA 3GKKA 2WZ9A 1XWBA 2H1DA 4LMWA 3L78A 3APOA 1GSQA 3GX0A 2F9SA 3D4TA 3N9JA 2M46A 4PUAA 4IJIA 1EEMA 5ID2B 1WMJA 2FHEA 1G7OA 1O8XA 2YJHA 2V6KA 5D73A 3G7JA 2OJLA 2HI7A 1EP7A 2PBJA 3FR6A 1XWCA 3EU4A 1U88A 2PWJA 4AJ7A 1FB6A 5ECIB 3ED3A 5DQSA 3RPPA 1XW6A 2HSMA 5LCZA 4G19A 4K9ZA 4K5SA 2YZHA 3U5RE 3KP8A 4HJ2A 2YP6A 3C7MA 20GSA 3IBHA 4GCIA 4J2FA 2PVOC 1K0CA 2VOCA 3O76A 3L9VA 2MMNA 3L9SA 3A2WA 1TU7A 1KEBA 5DJMA 1QGVA 4PQHA 1A2JA 1GTAA 3GN3A 3D0ZA 3VWXA 1NW2A 4ZILA 3KJYA 2FGXA 5ID2A 4EDYA 3ISOA 1UA5A 1JFUA 4HZ2A 2K18A 4ZB9A 2WCIA 1A0FA 4N0ZA 5KEJA 2V6OA 5F06A 3DYRA 5J9BA 4WXTA 2CZ2A 2H1GA 5G31A 5F05A 2VD1A 5CRWA 5IMCA 4EDZA 1XXUA 4MF6A 2R4VA 4X4JA 1X9MB 1XVQA 1A8YA 5A5KA 2B1LA 3HD5A 2GSSA 5D9VA 3F4RA 3KZQA 5FT3A 2QSIA 10GSA 3CRTA 3QAVA 3KCMA 4KGIA 2L4QA 3GKXA 4KDXA 2H71A 3FHKA 1B9XC 5H5SA 4G0LA 5ECRB 2VCQA 2FD3A 3ZZXA 1K3LA 1URMA 1O6JA 2PERA 4XCSA 3KGKA 4NXIA 3CSHA 4I8BA 2DLXA 4ECCA 2N5FA 3QFBC 3GFKA 4OFTA 5IO2A 2LNSA 2E7PA 1I5GA 8GSSA 2R37A 4XHMA 2VL9A 1N8JA 4OFMA 2B6MA 2JACA 1U3AA 1NHYA 2K8SA 2EC4A 3C1SA 4IGJA 4WF4A 1N2AA 2GLRA 3GL5A 1ERUA 12GSA 4D73B 2LRTA 3PR8A 3EURA 1GULA 5HFIA 2C8UA 2MBSA 3LXZA 4EIPA 1YKCA 1FOVA 2X64A 5LD0A 1XVWA 3IV4A 3VURA 3LQ7A 4O32A 5ELAA 6GSVA 2R0GA 3ZVJD 3GTUA 1HYUA 1YKAA 1Q4JA 2ALBA 2DJKA 3TDGA 3LSZA 2R0PA 1AXDA 2LTKA 3US3A 1G7EA 4MZWA 1PRXA 4CDOA 4EIQA 4DSSB 1YQ1A 1O8WA 5GSSA 2CX4A 2VIMA 4HI7A 1R5PA 3I9V2 2ZCTA 2L5LA 3FR3A 1ILOA 4KUNA 4YH2A 4GQFA 3UIWA 2VD0A 5EPFA 2H76A 4ECBA 3LJRA 2QGVA 3DVWA 3C71A 5HR3A 5JCGA 3QOUA 1Y25A 1TJDA 3EU3A 4OCEA 5ECMB 3ZIJA 3TGZA 4DSQA 2B7KA 2GSQA 1ZGNA 2FA4A 4NMUA 3I69A 5DBQA 1DBYA 1TI1A 4DSRA 2V32A 2H0HA 4HQSA 3E9JB 5ABRA 3A3TA 5HR2A 4WR5A 2RIIA 3FYGA 4KH7A 3TJFA 4DSSA 2ON5A 4CHSA 2QA2A 3I6AA 2G2QA 3HJPA 4ID0A 3P8WA 2WGRA 3C8EA 4RQRA 2ES7A 2IMKA 2EIOA 5ECKB 18GSA 1X9WB 2RUFA 4MJAA 2CVDA 1WIKA 3MAKA 5J3RA 4QL7A 1SENA 4KF9A 4HOJA 3HCZA 2G0FA 2FWHA 5GZZB 1K0AA 6GSTA 2JU5A 4BVXB 2LRNA 2VM1A 1JLVA 4LL4B 5ECPB 14GSA 2WJUA 4ZXGA 2XPEA 3NOFA 4IVFA 4EO3A 3JCML 3CTGA 4MJEA 4K7OA 3IPZA 1A0RP 1CQHA 3GURA 3E0UA 1GUMA 2CV4A 3UOMA 2LV3A 4FQUA 2WS2A 1QQ2A 5L71A 5DDLA 4DEJA 1GSDA 2NVLA 2L59A 3QFAC 3TJBA 2JL4A 3IRAA 4OFNA 3GKNA 1FO5A 4TN8A 4WBRD 4O5RA 4K2XA 3F4SA 3ERGA 4IP6A 3IK9A 3IXRA 3ME8A 2C3NA 4WETA 4BVXA 5IOXA 1JZDA 1J9BA 1PX7A 2YPMA 1OE7A 2PGTA 1A8LA 4YAPA 3GSTA 1B4PA 4XS1A 2H72A 1K0OA 2GZZA 3UAPA 4I2UA 5IMFA 3LGCA 1VF2A 1EGOA 1PN0A 5INYA 2OE0A 1LU4A 2OKAA 2MMZA 4HU7A 5EVOA 2B5YA 5A4WA 2JZRA 3KM6A 3HVVA 2HLSA 2CAIA 3M9JA 2VCZA 1SJIA 4X1UA 4EL1A 3ZMKA 3FZAA 4HEA2 3LORA 4G10A 2H01A 1PKZA 2YV9A 4L0UA 3D4MA 1VGLA 2CVBA 2K8VA 4GLTA 5AIXA 3IC4A 2A2SA 4HZ4A 3AY8A 1AQVA 1T3BA 4L0WA 2DSAA 4ZB6A 1G0TA 1K3OA 2KHPA 3ZL5A 3IAS2 2R5GA 4IN0A 4J56E 3TCOA 1O7UA 3BD2A 3RAZA 3KD0A 3VFIA 2HNLA 5HFKA 4JRRA 1FG4A 4HJMA 4G0IA 1MD4A 1QXHA 1KNGA 4AJ6A 6GSSA 4XS4B 4XS6A 3SBCA 3VI7A 1SL1B 3BCKA 1JZOA 3EVIA 1XWGA 2RLIA 3CXGA 4ZBBA 1WRYA 1M2AA 1XW9A 3ZLPA 1X0RA 2L5OA 1GSYA 2ON7A 1VF3A 1YY7A 2YWNA 1GL8A 4Z2RA 2GQKA 4EC0A 4RI7A 3ZTLA 3CRUA 4YQUA 4F2IA 1TRVA 2HE3A 2IMEA 3IK7A 4MH3A 3IHGA 3TOUA 3A2XA 1M9AA 1ZZYA 1R4WA 2X8CA 1M9BA 3EC3A 3TKPA 4KCAA 5BMUA 2H0IA 2MMAA 1PMTA 5COHA 2VCWA 4PQ1A 2IFQA 2R0CA 4YAVA 1TKDB 1GSFA 1BJXA 3HXSA 2C0FA 3KH7A 1SK2A 2FA8A 2OA7A 4QL9A 4XS4A 3VK9A 5DALB 4JU5A 3HDCA 2PVQA 1G6YA 3LYKA 5CYYA 4NWYA 4IQAA 1PN9A 4KB3A 3EMPA 3TRXA 1X9SB 1U3IA 3Q6OA 1GUKA 4JBBA 1TOFA 1XWKA 1HNCA 2DKHA 1MEKA 1SL2B 3M3MA 1AQWA 3HVSA 2IMIA 2CZ3A 4MNNA 1ZYPA 3GHAA 4L8EA 3MWHA 1YZXA 4F03A 3UEMA 3S9FA 3KIJA 1BAYA 3RHBA 1KTEA 4YKGA 3DD3A 3Q19A 4BL7B 3D6IA 2XC2A 3Q18A 1BG5A 1M0UA 2HRFA 1GTUA 2C1YA 1GRXA 5G30A 1QK8A 1SD8A 2N5BA 2KP1A 4PNFA 2H19A 5DALA 2A4HA 3CMIA 2NPBA 3TKSC 1B8XA 4EE0A 3H1NA 1GWCA 6GSUA 2C3QA 4K2DA 3W6GA 5EY6A 3TKSA 5F0GA 3ZITA 1X5EA 3ZIVA 5KN3A 2GT5A 3J7Yk 1FW1A 2E2GA 5A4VA 2N5AA 2L57A 1HQOA 2HT9A 4CW9A 1WOUA 4EVMA 4ACSA 2VLUA 1B48A 1K3YA 5B8BA 2UZ8A 4ECIA 4BL7A 2P31A 3HZ4A 1MTCA 2CA8A 2AAWA 2IIYA 1JHBA 5A4UA 2REMA 2DJ0A 3F9UA 1AIUA 3GTUB 1W4VA 1SK0A 2KLXA 4TR1B 2FCHA 5DJLA 2OE3A 5ECNB 1Z7PA 3FEUA 5IO0A 3UARA 1XIYA 3IE3A 2MZCA 3G9BA 2WB9A 2YWMA 4IQ1A 1USBA 3DIEA 2F51A 3NZNA 5H5RA 1O85A 2L6CA 3ZYWA 4IW9A 1OKDA 2IPAA 4I5QA 6GSWA 2HRNA 1SK1A 5ECLB 2KUCA 4JR4A 4TOPA 3UBKA 3CYNA 2LQQA 2H6ZA 1M99A 4I2TA 2A2RA 4I6XA 4BVYB 5J9CA 4EKZA 3GA4A 1NM3A 2YZUA 4PX1A 1IYIA 1I9DA 2JZSA 1FAAA 3RHCA 4GQCA 1ZYEA 3GUSA 3F3QA 2QA1A 2H8LA 4A5PA 1OAZA 2HZFA 3GL3A 1TK0B 2O7KA 1GTBA 1XZOA 3HJOA 2C0GA 2VO4A 2DIYA 4F0BA 1M7TA 3GRXA 2FWEA 2O89A 2GZYA 3BOAA 4TR1A 3L0HA 3G7IA 2CQ9A 3BCIA 3VWVA 2P5RA 3BBYA 3UJ1A 2CX3A 4O7HA 4ZBDA 3TRQA 1Q98A 6GSYA 1RQMA 1TRWA 2PU9C 1FHEA 2H74A 5KN2A 1ZOFA 4MZBA 1VRSD 4MJCA 2V1MA 3GNJA 4ZBAA 3CTFA 2HZEA 2I3YA 1GLPA 1AAZA 3HY2A 5H5QA 4BVYA 4GTUA 2AYTA 1TI3A 5D96A 3KMNA 3D21A 3UL3A 2GZPA 1TK8B 1V58A 4CY6A 3GSSA 1K0MA 2I81A 1BYEA 2IWTA 3E3EA 1H4OA 1SKSB 5CRGA 2PMTA 3F8UA 3ZVJA 4ZIJA 3DXBA 2H70A 3FK8A 1T4YA 3DVXA 4V1Ap 3P7XA 3BJ5A 2RUEA 4OWYA 1AC1A 1YEPA 1AW9A 2NTOA 5D8IA 4EUYA 1YJ6A 4F82A 3HYPA 3H93A 1J08A 1GNWA 3FW2A 2X8GA 3EMXA 3KH9A 4ZL9A 2IJYA 1Y6EA 1PGTA 2VLVA 4JE1A 4OO5A 1ERWA 4AGSA 4K6XA 4PNGA 4K8MA 4ML6A 3QCPA 1OC8A 2CAQA 2R3XA 4FYBA 4N30A 3VPTA 4MJBA 2IMFA 2P0GA 1UVZA 4LLRA 3VPQA 5DVBA 5IIZA 2PPTA 3WT1A 2VM2A 4NHZA 1ST9A 3M1GA 4ULXA 3HKRA 4TXOA 1SKRB 1FB0A 4KCEA 1SJZA 3TJJA 4MLYA 1F3AA 4BWQA 1R7HA 1K0NA 2XBQA 5ECQB 1Z5YE 5HFGA 3IR4A 3F0IA 2YJ7A 3GH6A 2X4AA 1ABAA 1O73A 5IMDA 1NSWA 2VCXA 1CQGA 1PKWA 3CBUA 3A2VA 4WBJA 4FH8A 1A2LA 2FLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KW6 A;  1ZL9 A;  1YDK A;  4KDY A;  4LMV A;  4GSS A;  1WP0 A;  1F9M A;  2VL2 A;  2DJ3 A;  5E4W A;  1QFN A;  5ECS A;  1T7P B;  5DAK A;  1E2Y A;  2WDU A;  2FWG A;  2DML A;  2I1U A;  3KTB A;  1EV4 A;  4NV5 A;  2YN1 A;  2GQM A;  4TR3 A;  1DSB A;  3N5O A;  5GAP D;  4ILF A;  1T1V A;  2H1B A;  4JZQ A;  5G5E A;  3TJK A;  1PA3 A;  2B3S A;  1V98 A;  3DGQ A;  2V41 A;  1SKW B;  1K0D A;  1SU9 A;  2P5Q A;  2E2M A;  1SYR A;  2MYG A;  4JR6 A;  1TTZ A;  2JAD A;  4NHW A;  1J0F A;  1LJR A;  2NBS A;  2ZNM A;  2FWF A;  1EOH A;  1V57 A;  4I97 A;  4KSM A;  1ACV A;  3QMX A;  1XOB A;  5JCU A;  3KP9 A;  3ERW A;  3TJG A;  2GSR A;  1A2M A;  3RDW A;  5ECO B;  1XWA A;  5FHI A;  2XHF A;  3QPM A;  4OO4 A;  1V9W A;  2B7J A;  4IBP A;  3F63 A;  3FRC A;  1F37 A;  1B9Y C;  4BPY A;  1TRU A;  4NV2 A;  1KBN A;  2PUK C;  4HS1 A;  4TW5 A;  2VL3 A;  4GXZ A;  4MMM A;  3UBL A;  2IFQ B;  1XFL A;  4TVE A;  2AV4 A;  4L5L A;  1OC9 B;  3F4T A;  5IQY A;  4MH2 A;  3PGT A;  2GVP A;  3TKQ A;  2R2J A;  1OVN A;  4KSO A;  1EWX A;  4EF0 A;  2M72 A;  1JZR A;  5G5F A;  4ZB8 A;  1DUG A;  1BED A;  1M2D A;  1W89 A;  2V2G A;  4PUF C;  4YQV A;  1HNB A;  2GDR A;  4IP1 A;  3FR9 A;  5CAX A;  4RUV A;  4IHU A;  3W8J A;  3ZRE A;  2BMX A;  1PQN A;  2KOK A;  4GRF A;  5JWR B;  2R6K A;  3PIN A;  2OAD A;  3DRN A;  3APS A;  3TKS E;  1SYX A;  2O87 A;  1ERT A;  4TKY A;  2GGT A;  2NDO A;  2K9F A;  4G9H A;  3CSI A;  4POL A;  4L5O A;  4ECJ A;  3WGX A;  2DJJ A;  3GH9 A;  4X43 A;  1RW1 A;  4IJ3 A;  2L4C A;  1YF0 A;  2LJA A;  2PN8 A;  1GUH A;  1OC9 A;  2YWO A;  3HHV A;  1ERV A;  4FYC A;  4F0C A;  2H30 A;  2IN3 A;  3DEX A;  1XBS A;  3TKR A;  5LNK e;  4N10 A;  4V2N A;  3KTL A;  2GST A;  2OE1 A;  4XRA A;  2Z9S A;  5J41 A;  4Q5R A;  1X5D A;  6GSX A;  2VUP A;  5G1K A;  2ZUP A;  2DMM A;  1A23 A;  3J7Y b;  1SL0 B;  1WJK A;  2X99 A;  3MDK A;  1GP1 A;  3FZ9 A;  2H66 A;  3FZ5 A;  2F8A A;  2WUL A;  1DE1 A;  4WF5 A;  4ZL7 A;  3IA1 A;  1S3D A;  5F07 A;  4MF5 A;  5ECH B;  5D9X A;  4AJ8 A;  2H6X A;  1XOA A;  5IPH A;  1OYJ A;  1FVK A;  3H4K A;  3LG6 A;  2XPD A;  4LL1 B;  1A24 A;  2YAN A;  3V1W A;  1C72 A;  1G6W A;  3R2Q A;  3NIV A;  3U6V A;  2WRT A;  3PH9 A;  4E8H A;  5IMV A;  4K0G A;  1S3C A;  2H1A A;  13GS A;  4K7I A;  3WD6 A;  2QC7 A;  5CRE A;  1S3A A;  3WT2 A;  3A5W A;  2TRC P;  1VF1 A;  1F2E A;  4EXJ A;  4Q5N A;  3ZFB A;  1T00 A;  2E0Q A;  2MBT A;  5IMA A;  1WE0 A;  1GSE A;  4TXV A;  2B1K A;  1GSS A;  3Q74 A;  3WYW A;  4RI6 A;  22GS A;  3QD9 A;  2C80 A;  3SWL A;  2LRC A;  5EL8 A;  4KE3 A;  4POM A;  1LBK A;  19GS A;  2JSY A;  4GSN A;  3RBT A;  2LST A;  1XPV A;  3HZ8 A;  1YF1 A;  4GST A;  2LEG A;  3GX8 A;  1R5A A;  3F3R A;  4GF0 A;  3IAM 2;  1TU8 A;  2VAF A;  4OCF A;  2IL3 A;  4PXO A;  1T4Z A;  4LA1 A;  2I9H A;  1TRS A;  4NPB A;  4N11 A;  3DML A;  4ML1 A;  1F3B A;  5GAN D;  3CSJ A;  3UVT A;  4MK3 A;  5AIV A;  5CRD A;  3KEB A;  2EIR A;  4RQX A;  1ZYQ B;  4F9Z A;  4H86 A;  3GIX A;  1Z9H A;  4IEL A;  5DCH A;  3ZML A;  2HZE B;  1EV9 A;  4GWR A;  2EIQ A;  5DCG A;  5AN1 A;  1ON4 A;  5CRH A;  1OKT A;  3D5J A;  3MSZ A;  2AUV A;  3ZFL A;  3VWW A;  2LQO A;  4KX4 A;  3KMO A;  5ELG A;  5IPG A;  3UMA A;  5J5N A;  3K8N A;  4Q5F A;  1ML6 A;  2OBI A;  1SJ6 A;  2X8H A;  1WPI A;  2KP2 A;  3P90 A;  3TOT A;  5DQY A;  4WKW A;  2VLT A;  4KAE A;  1TDI A;  2OBK A;  3APQ A;  5IMZ A;  4MPG A;  2IMD A;  2J9H A;  1GSU A;  1NHO A;  3QAG A;  4K0N A;  5G2Z A;  2GTU A;  4BA7 A;  3QDN A;  3KXO A;  4NAX A;  3TRP A;  2LJK A;  4TR0 A;  1MDK A;  2DBC A;  3TUE A;  1THX A;  2L6D A;  1B4Q A;  3LFL A;  2LJR A;  5E59 A;  4G2E A;  3VLN A;  3P2A A;  4MAB A;  1FVJ A;  2FY6 A;  4E8E A;  3RPN A;  1DE2 A;  2H73 A;  1OE8 A;  3C1R A;  2LKU A;  3DWV A;  4D73 A;  3QAW A;  2AB6 A;  3M8N A;  1JLW A;  2LNT A;  4DVC A;  2M80 A;  4V2M A;  1EP8 A;  4TXO B;  5AGY A;  1SD9 A;  2H75 A;  3F6D A;  4PGT A;  1K0B A;  2RM6 A;  1QMV A;  5B6N A;  1BX9 A;  3EWL A;  3EE2 A;  2QKE A;  2H0G A;  3HA9 A;  3ZRD A;  3C73 A;  5B7C A;  2BTO T;  3QR6 A;  11GS A;  4Z7X A;  5CNW A;  4OD7 A;  5D9W A;  4MP4 A;  2C4J A;  3H8Q A;  4MA9 A;  1F6M C;  2LS5 A;  3D22 A;  3HJM A;  2YWI A;  2AJQ B;  1HNA A;  1EOG A;  3M9K A;  3LWA A;  5DAK B;  2HXK A;  1ZCP A;  1PL1 A;  3UVH A;  4FYU A;  1O81 A;  3GV1 A;  4Q5Q A;  1Z7R A;  5GST A;  4HUA A;  3TB2 A;  1RK4 A;  4N0V A;  4KDU A;  2JZT A;  1EZK A;  1V2A A;  1XCC A;  4X0X A;  1PD2 1;  4MCU A;  1XW5 A;  1WWJ A;  5JWQ B;  1JZW A;  2DJ2 A;  2J23 A;  2FNO A;  1IYH A;  1EEJ A;  2TRX A;  3VI5 A;  5B8A A;  3EIN A;  4POB A;  3GMF A;  4MDC A;  3WGD A;  4POK A;  2YOI A;  5HR1 A;  5HR0 A;  3WGE A;  4V1A g;  2FUG 2;  1TW9 A;  5HQP A;  4MZC A;  2VL2 C;  2XBI A;  2GQL A;  2GS3 A;  3IOS A;  4V2L A;  2B5X A;  3IDV A;  1Z6N A;  2VCV A;  4WEY A;  4AF2 A;  2C0E A;  5J4U A;  4P3Y B;  2WFC A;  1V40 A;  2LUS A;  3HVX A;  5G1L A;  4FO5 A;  2F8F A;  16GS A;  4BWS A;  1THO A;  4K7N A;  2C0D A;  5IM9 A;  4XTS A;  2HYX A;  1MDJ A;  5D93 A;  3LYP A;  2GT6 A;  3L9U A;  5D9T A;  1BQ7 A;  5CP1 A;  4XRD A;  2C3T A;  1R26 A;  2CVK A;  1T8E B;  3ME7 A;  4KND A;  5ENU A;  4OMV A;  4XIH A;  3GYK A;  4FIW A;  2A4V A;  7GSS A;  1GTI A;  1MD3 A;  3W8S A;  3VWU A;  4MF7 A;  2BJX A;  3LXT A;  5JCW A;  2CT6 A;  4HQZ A;  1Z3E A;  5AIS A;  1UC7 A;  3DKS A;  1QUW A;  3G7Y A;  1GNE A;  2O85 A;  3O6T A;  4TR4 A;  1M2B A;  4QQ7 A;  4WR4 A;  17GS A;  2F3M A;  2O8V B;  2B5E A;  1TXX A;  1EGR A;  4PUR A;  2YV7 A;  2HSH A;  1TK5 B;  4J57 E;  3FY7 A;  1OC3 A;  5FWG A;  1UN2 A;  5IOW A;  3IHQ A;  3FKF A;  5C04 A;  5JWO B;  1H75 A;  1AUC A;  3LEF A;  2H6Y A;  5KN1 A;  2TIR A;  4ZL8 A;  1PX6 A;  2K6V A;  1PL2 A;  3EYT A;  3L4N A;  4HDE A;  1E6B A;  2HFD A;  4ISD A;  3FZ4 A;  3F6F A;  2I4A A;  4YQM A;  3H79 A;  1Z6M A;  1GLQ A;  1PSQ A;  5C00 A;  2DJ1 A;  2MMO A;  1ZMA A;  2RM5 A;  1TP9 A;  1YEX A;  4JED A;  4KA0 A;  2AHE A;  5F8B A;  1HD2 A;  2YNX A;  3M0F A;  4K1F A;  1X5C A;  2YCD A;  4MPF A;  1GH2 A;  2OAC A;  4TRX A;  1U6T A;  3MNG A;  3O3T A;  4IKH A;  4O92 A;  2D2Z A;  3OR5 A;  4IS0 A;  2JSZ A;  1VF4 A;  3ERF A;  2VCT A;  2DC5 A;  4HU9 A;  5KN0 A;  3I43 A;  9GSS A;  1AQX A;  1U87 A;  3GKM A;  5CO3 A;  4PQI A;  1MDI A;  5B6M A;  2DIZ A;  2HSY A;  3GKK A;  2WZ9 A;  1XWB A;  2H1D A;  4LMW A;  3L78 A;  3APO A;  1GSQ A;  3GX0 A;  2F9S A;  3D4T A;  3N9J A;  2M46 A;  4PUA A;  4IJI A;  1EEM A;  5ID2 B;  1WMJ A;  2FHE A;  1G7O A;  1O8X A;  2YJH A;  2V6K A;  5D73 A;  3G7J A;  2OJL A;  2HI7 A;  1EP7 A;  2PBJ A;  3FR6 A;  1XWC A;  3EU4 A;  1U88 A;  2PWJ A;  4AJ7 A;  1FB6 A;  5ECI B;  3ED3 A;  5DQS A;  3RPP A;  1XW6 A;  5LCZ A;  4G19 A;  4K9Z A;  2YZH A;  3U5R E;  3KP8 A;  4HJ2 A;  2YP6 A;  3C7M A;  20GS A;  3IBH A;  4GCI A;  4J2F A;  2PVO C;  1K0C A;  2VOC A;  3O76 A;  3L9V A;  2MMN A;  3L9S A;  3A2W A;  1TU7 A;  1KEB A;  5DJM A;  1QGV A;  4PQH A;  1A2J A;  1GTA A;  3GN3 A;  3D0Z A;  3VWX A;  1NW2 A;  4ZIL A;  3KJY A;  2FGX A;  5ID2 A;  4EDY A;  3ISO A;  1UA5 A;  1JFU A;  4HZ2 A;  2K18 A;  4ZB9 A;  2WCI A;  1A0F A;  4N0Z A;  5KEJ A;  2V6O A;  5F06 A;  3DYR A;  5J9B A;  4WXT A;  2CZ2 A;  2H1G A;  5G31 A;  5F05 A;  2VD1 A;  5CRW A;  5IMC A;  4EDZ A;  1XXU A;  4MF6 A;  2R4V A;  1X9M B;  1XVQ A;  1A8Y A;  5A5K A;  2B1L A;  3HD5 A;  2GSS A;  5D9V A;  3F4R A;  3KZQ A;  5FT3 A;  2QSI A;  10GS A;  3CRT A;  3QAV A;  3KCM A;  4KGI A;  2L4Q A;  3GKX A;  4KDX A;  2H71 A;  3FHK A;  1B9X C;  5H5S A;  5ECR B;  2VCQ A;  2FD3 A;  3ZZX A;  1K3L A;  1URM A;  1O6J A;  2PER A;  4XCS A;  3KGK A;  4NXI A;  3CSH A;  4I8B A;  2DLX A;  4ECC A;  2N5F A;  3QFB C;  3GFK A;  4OFT A;  5IO2 A;  2LNS A;  2E7P A;  1I5G A;  8GSS A;  2R37 A;  4XHM A;  2VL9 A;  1N8J A;  4OFM A;  2B6M A;  2JAC A;  1U3A A;  1NHY A;  2K8S A;  2EC4 A;  3C1S A;  4IGJ A;  4WF4 A;  1N2A A;  2GLR A;  3GL5 A;  1ERU A;  12GS A;  4D73 B;  2LRT A;  3PR8 A;  3EUR A;  1GUL A;  5HFI A;  2C8U A;  2MBS A;  3LXZ A;  1YKC A;  1FOV A;  2X64 A;  5LD0 A;  1XVW A;  3IV4 A;  3VUR A;  3LQ7 A;  4O32 A;  5ELA A;  6GSV A;  3ZVJ D;  3GTU A;  1HYU A;  1YKA A;  1Q4J A;  2ALB A;  2DJK A;  3TDG A;  3LSZ A;  1AXD A;  2LTK A;  3US3 A;  1G7E A;  4MZW A;  1PRX A;  4CDO A;  4DSS B;  1YQ1 A;  1O8W A;  5GSS A;  2CX4 A;  2VIM A;  4HI7 A;  1R5P A;  3I9V 2;  2ZCT A;  2L5L A;  3FR3 A;  1ILO A;  4KUN A;  4YH2 A;  4GQF A;  3UIW A;  2VD0 A;  5EPF A;  2H76 A;  4ECB A;  3LJR A;  2QGV A;  3DVW A;  3C71 A;  5HR3 A;  5JCG A;  3QOU A;  1Y25 A;  1TJD A;  3EU3 A;  4OCE A;  5ECM B;  3ZIJ A;  3TGZ A;  4DSQ A;  2B7K A;  2GSQ A;  1ZGN A;  2FA4 A;  4NMU A;  3I69 A;  5DBQ A;  1DBY A;  1TI1 A;  4DSR A;  2V32 A;  2H0H A;  4HQS A;  3E9J B;  5ABR A;  3A3T A;  5HR2 A;  4WR5 A;  2RII A;  3FYG A;  4KH7 A;  3TJF A;  4DSS A;  2ON5 A;  4CHS A;  3I6A A;  2G2Q A;  3HJP A;  4ID0 A;  3P8W A;  2WGR A;  3C8E A;  4RQR A;  2ES7 A;  2IMK A;  2EIO A;  5ECK B;  18GS A;  1X9W B;  2RUF A;  4MJA A;  2CVD A;  1WIK A;  3MAK A;  5J3R A;  4QL7 A;  1SEN A;  4HOJ A;  3HCZ A;  2G0F A;  2FWH A;  5GZZ B;  1K0A A;  6GST A;  2JU5 A;  2LRN A;  2VM1 A;  1JLV A;  4LL4 B;  5ECP B;  14GS A;  2WJU A;  4ZXG A;  2XPE A;  3NOF A;  4IVF A;  4EO3 A;  3JCM L;  3CTG A;  4MJE A;  4K7O A;  3IPZ A;  1A0R P;  1CQH A;  3GUR A;  3E0U A;  1GUM A;  2CV4 A;  3UOM A;  2LV3 A;  2WS2 A;  1QQ2 A;  5L71 A;  5DDL A;  4DEJ A;  1GSD A;  2NVL A;  2L59 A;  3QFA C;  3TJB A;  2JL4 A;  3IRA A;  4OFN A;  3GKN A;  1FO5 A;  4TN8 A;  4WBR D;  4O5R A;  3F4S A;  3ERG A;  4IP6 A;  3IK9 A;  3IXR A;  3ME8 A;  2C3N A;  4WET A;  4BVX A;  5IOX A;  1JZD A;  1J9B A;  1PX7 A;  2YPM A;  1OE7 A;  2PGT A;  1A8L A;  4YAP A;  3GST A;  1B4P A;  4XS1 A;  2H72 A;  1K0O A;  2GZZ A;  3UAP A;  4I2U A;  5IMF A;  3LGC A;  1VF2 A;  1EGO A;  5INY A;  2OE0 A;  1LU4 A;  2OKA A;  2MMZ A;  4HU7 A;  5EVO A;  2B5Y A;  5A4W A;  2JZR A;  3KM6 A;  3HVV A;  2HLS A;  2CAI A;  3M9J A;  2VCZ A;  1SJI A;  4X1U A;  4EL1 A;  3ZMK A;  3FZA A;  4HEA 2;  3LOR A;  4G10 A;  2H01 A;  1PKZ A;  2YV9 A;  4L0U A;  3D4M A;  1VGL A;  2CVB A;  2K8V A;  4GLT A;  5AIX A;  3IC4 A;  2A2S A;  4HZ4 A;  3AY8 A;  1AQV A;  1T3B A;  4L0W A;  2DSA A;  4ZB6 A;  1G0T A;  1K3O A;  2KHP A;  3ZL5 A;  3IAS 2;  2R5G A;  4IN0 A;  4J56 E;  3TCO A;  1O7U A;  3BD2 A;  3RAZ A;  3KD0 A;  3VFI A;  2HNL A;  5HFK A;  4JRR A;  1FG4 A;  4HJM A;  1MD4 A;  1QXH A;  1KNG A;  4AJ6 A;  6GSS A;  4XS4 B;  4XS6 A;  3SBC A;  3VI7 A;  1SL1 B;  3BCK A;  1JZO A;  3EVI A;  1XWG A;  2RLI A;  3CXG A;  4ZBB A;  1WRY A;  1M2A A;  1XW9 A;  3ZLP A;  1X0R A;  2L5O A;  1GSY A;  2ON7 A;  1VF3 A;  1YY7 A;  2YWN A;  1GL8 A;  2GQK A;  4EC0 A;  4RI7 A;  3ZTL A;  3CRU A;  4YQU A;  4F2I A;  1TRV A;  2HE3 A;  2IME A;  3IK7 A;  4MH3 A;  3TOU A;  3A2X A;  1M9A A;  1ZZY A;  1R4W A;  2X8C A;  1M9B A;  3EC3 A;  3TKP A;  4KCA A;  2H0I A;  2MMA A;  1PMT A;  5COH A;  2VCW A;  4PQ1 A;  2IFQ A;  4YAV A;  1TKD B;  1GSF A;  1BJX A;  3HXS A;  2C0F A;  3KH7 A;  1SK2 A;  2FA8 A;  2OA7 A;  4QL9 A;  4XS4 A;  3VK9 A;  5DAL B;  4JU5 A;  3HDC A;  2PVQ A;  1G6Y A;  3LYK A;  5CYY A;  4NWY A;  4IQA A;  1PN9 A;  4KB3 A;  3EMP A;  3TRX A;  1X9S B;  1U3I A;  3Q6O A;  1GUK A;  4JBB A;  1TOF A;  1XWK A;  1HNC A;  1MEK A;  1SL2 B;  3M3M A;  1AQW A;  3HVS A;  2IMI A;  2CZ3 A;  3GHA A;  4L8E A;  3MWH A;  1YZX A;  4F03 A;  3UEM A;  3S9F A;  3KIJ A;  1BAY A;  3RHB A;  1KTE A;  3DD3 A;  3Q19 A;  3D6I A;  2XC2 A;  3Q18 A;  1BG5 A;  1M0U A;  2HRF A;  1GTU A;  2C1Y A;  1GRX A;  5G30 A;  1QK8 A;  1SD8 A;  2N5B A;  2KP1 A;  4PNF A;  2H19 A;  5DAL A;  3CMI A;  2NPB A;  3TKS C;  1B8X A;  4EE0 A;  3H1N A;  1GWC A;  6GSU A;  2C3Q A;  4K2D A;  3W6G A;  5EY6 A;  3TKS A;  5F0G A;  3ZIT A;  1X5E A;  3ZIV A;  5KN3 A;  2GT5 A;  3J7Y k;  1FW1 A;  2E2G A;  5A4V A;  2N5A A;  2L57 A;  1HQO A;  2HT9 A;  4CW9 A;  1WOU A;  4EVM A;  4ACS A;  2VLU A;  1B48 A;  1K3Y A;  5B8B A;  4ECI A;  4BL7 A;  2P31 A;  3HZ4 A;  1MTC A;  2CA8 A;  2AAW A;  2IIY A;  1JHB A;  5A4U A;  2REM A;  2DJ0 A;  3F9U A;  1AIU A;  3GTU B;  1W4V A;  1SK0 A;  2KLX A;  4TR1 B;  2FCH A;  5DJL A;  2OE3 A;  5ECN B;  1Z7P A;  3FEU A;  5IO0 A;  3UAR A;  1XIY A;  3IE3 A;  2MZC A;  3G9B A;  2WB9 A;  2YWM A;  4IQ1 A;  1USB A;  3DIE A;  2F51 A;  3NZN A;  5H5R A;  1O85 A;  2L6C A;  3ZYW A;  4IW9 A;  1OKD A;  2IPA A;  4I5Q A;  6GSW A;  2HRN A;  1SK1 A;  5ECL B;  2KUC A;  4JR4 A;  4TOP A;  3UBK A;  3CYN A;  2LQQ A;  2H6Z A;  1M99 A;  4I2T A;  2A2R A;  4I6X A;  5J9C A;  4EKZ A;  3GA4 A;  1NM3 A;  2YZU A;  4PX1 A;  1IYI A;  1I9D A;  2JZS A;  1FAA A;  3RHC A;  4GQC A;  1ZYE A;  3GUS A;  3F3Q A;  2H8L A;  1OAZ A;  2HZF A;  3GL3 A;  1TK0 B;  2O7K A;  1GTB A;  1XZO A;  3HJO A;  2C0G A;  2VO4 A;  2DIY A;  4F0B A;  1M7T A;  3GRX A;  2FWE A;  2O89 A;  2GZY A;  3BOA A;  4TR1 A;  3L0H A;  3G7I A;  2CQ9 A;  3BCI A;  3VWV A;  2P5R A;  3BBY A;  3UJ1 A;  2CX3 A;  4O7H A;  4ZBD A;  3TRQ A;  1Q98 A;  6GSY A;  1RQM A;  1TRW A;  2PU9 C;  1FHE A;  2H74 A;  5KN2 A;  1ZOF A;  4MZB A;  1VRS D;  4MJC A;  2V1M A;  3GNJ A;  4ZBA A;  3CTF A;  2HZE A;  2I3Y A;  1GLP A;  1AAZ A;  3HY2 A;  5H5Q A;  4BVY A;  4GTU A;  2AYT A;  1TI3 A;  5D96 A;  3KMN A;  3D21 A;  3UL3 A;  2GZP A;  1TK8 B;  1V58 A;  3GSS A;  1K0M A;  2I81 A;  1BYE A;  2IWT A;  3E3E A;  1H4O A;  1SKS B;  5CRG A;  2PMT A;  3F8U A;  3ZVJ A;  4ZIJ A;  3DXB A;  2H70 A;  3FK8 A;  1T4Y A;  3DVX A;  4V1A p;  3P7X A;  3BJ5 A;  2RUE A;  4OWY A;  1AC1 A;  1YEP A;  1AW9 A;  2NTO A;  5D8I A;  4EUY A;  1YJ6 A;  4F82 A;  3HYP A;  3H93 A;  1J08 A;  1GNW A;  3FW2 A;  2X8G A;  3EMX A;  3KH9 A;  4ZL9 A;  2IJY A;  1Y6E A;  1PGT A;  2VLV A;  4JE1 A;  4OO5 A;  1ERW A;  4AGS A;  4K6X A;  4PNG A;  4K8M A;  4ML6 A;  3QCP A;  1OC8 A;  2CAQ A;  2R3X A;  4FYB A;  4N30 A;  3VPT A;  4MJB A;  2IMF A;  2P0G A;  1UVZ A;  4LLR A;  3VPQ A;  5DVB A;  5IIZ A;  2PPT A;  3WT1 A;  2VM2 A;  4NHZ A;  1ST9 A;  3M1G A;  4ULX A;  3HKR A;  4TXO A;  1SKR B;  1FB0 A;  4KCE A;  1SJZ A;  3TJJ A;  4MLY A;  1F3A A;  4BWQ A;  1R7H A;  1K0N A;  2XBQ A;  5ECQ B;  1Z5Y E;  5HFG A;  3IR4 A;  3F0I A;  2YJ7 A;  3GH6 A;  1ABA A;  1O73 A;  5IMD A;  1NSW A;  2VCX A;  1CQG A;  1PKW A;  3CBU A;  3A2V A;  4WBJ A;  4FH8 A;  1A2L A;  2FLS A; 
#chains in the Genus database with same CATH topology
 4KW6 A;  1ZL9 A;  1YDK A;  4KDY A;  4LMV A;  5KOX A;  4GSS A;  1WP0 A;  1F9M A;  2VL2 A;  2DJ3 A;  5E4W A;  1QFN A;  5ECS A;  1T7P B;  5DAK A;  4G0K A;  1E2Y A;  2WDU A;  2FWG A;  2DML A;  2I1U A;  3KTB A;  1EV4 A;  4NV5 A;  2YN1 A;  2GQM A;  4TR3 A;  1DSB A;  3N5O A;  5GAP D;  4ILF A;  1T1V A;  2H1B A;  4JZQ A;  5G5E A;  3TJK A;  1PA3 A;  2B3S A;  1V98 A;  3DGQ A;  2V41 A;  1SKW B;  1K0D A;  1SU9 A;  2P5Q A;  2E2M A;  1SYR A;  2MYG A;  4JR6 A;  1TTZ A;  2JAD A;  4NHW A;  1J0F A;  1LJR A;  2NBS A;  2ZNM A;  2FWF A;  1EOH A;  1V57 A;  4I97 A;  4KSM A;  1ACV A;  3QMX A;  3CQF A;  1XOB A;  5JCU A;  3KP9 A;  3ERW A;  3TJG A;  2GSR A;  1A2M A;  3HVN A;  4BIK A;  3RDW A;  5ECO B;  1XWA A;  5FHI A;  2XHF A;  3QPM A;  4OO4 A;  1V9W A;  2B7J A;  4IBP A;  3F63 A;  3FRC A;  1F37 A;  1B9Y C;  4BPY A;  1TRU A;  4NV2 A;  1KBN A;  2PUK C;  4HS1 A;  4TW5 A;  2VL3 A;  4GXZ A;  4MMM A;  3UBL A;  2IFQ B;  1XFL A;  4TVE A;  2AV4 A;  4L5L A;  1OC9 B;  3F4T A;  5IQY A;  4MH2 A;  3PGT A;  2GVP A;  3TKQ A;  2R2J A;  1OVN A;  4KSO A;  1EWX A;  4EF0 A;  2M72 A;  1JZR A;  5G5F A;  4ZB8 A;  1DUG A;  1BED A;  1M2D A;  1W89 A;  2V2G A;  4PUF C;  4YQV A;  1HNB A;  2GDR A;  4IP1 A;  4PTS A;  3FR9 A;  5CAX A;  4RUV A;  4IHU A;  3W8J A;  3ZRE A;  2BMX A;  1PQN A;  2KOK A;  4GRF A;  5JWR B;  2R6K A;  3PIN A;  2OAD A;  3DRN A;  3APS A;  3TKS E;  1S3R A;  1SYX A;  2O87 A;  1ERT A;  4TKY A;  2GGT A;  2NDO A;  2K9F A;  4G9H A;  3CSI A;  4POL A;  4L5O A;  4ECJ A;  3WGX A;  2DJJ A;  3GH9 A;  4X43 A;  1RW1 A;  4IJ3 A;  2L4C A;  1YF0 A;  2LJA A;  2PN8 A;  1GUH A;  1OC9 A;  2YWO A;  3HHV A;  1ERV A;  4FYC A;  4F0C A;  2H30 A;  2IN3 A;  3DEX A;  1XBS A;  3TKR A;  5LNK e;  4N10 A;  4V2N A;  3KTL A;  2GST A;  2OE1 A;  4XRA A;  2Z9S A;  5J41 A;  4Q5R A;  1X5D A;  6GSX A;  2VUP A;  5G1K A;  2ZUP A;  2DMM A;  1A23 A;  3J7Y b;  1SL0 B;  1WJK A;  2X99 A;  3MDK A;  1GP1 A;  3FZ9 A;  2H66 A;  3FZ5 A;  2F8A A;  2WUL A;  1DE1 A;  4WF5 A;  4ZL7 A;  3IA1 A;  1S3D A;  5F07 A;  2HRK A;  4MF5 A;  5ECH B;  5D9X A;  4AJ8 A;  2H6X A;  1XOA A;  5IPH A;  1OYJ A;  1FVK A;  4CY8 A;  3H4K A;  3LG6 A;  2XPD A;  4LL1 B;  1A24 A;  2YAN A;  3V1W A;  1C72 A;  1G6W A;  3R2Q A;  3NIV A;  3U6V A;  2WRT A;  3PH9 A;  4E8H A;  5IMV A;  4K0G A;  1S3C A;  2H1A A;  13GS A;  4K7I A;  3WD6 A;  2QC7 A;  5CRE A;  1S3A A;  3WT2 A;  3A5W A;  2TRC P;  1VF1 A;  1F2E A;  4EXJ A;  4Q5N A;  3ZFB A;  1T00 A;  2E0Q A;  2MBT A;  5IMA A;  1WE0 A;  1GSE A;  4TXV A;  2B1K A;  3MIX A;  1GSS A;  3Q74 A;  3WYW A;  4RI6 A;  22GS A;  3QD9 A;  2C80 A;  3SWL A;  2LRC A;  5EL8 A;  4KE3 A;  4POM A;  1LBK A;  19GS A;  2JSY A;  4GSN A;  3RBT A;  2LST A;  1XPV A;  3HZ8 A;  1YF1 A;  4GST A;  2LEG A;  3GX8 A;  1R5A A;  3F3R A;  4GF0 A;  3IAM 2;  2HRA A;  1TU8 A;  2VAF A;  4OCF A;  2IL3 A;  4PXO A;  1T4Z A;  1FOH A;  4LA1 A;  4Z2U A;  2I9H A;  1TRS A;  4NPB A;  4N11 A;  3DML A;  4ML1 A;  1F3B A;  5GAN D;  3CSJ A;  3UVT A;  4MK3 A;  5AIV A;  4YKF A;  5CRD A;  3KEB A;  2EIR A;  4RQX A;  1ZYQ B;  4F9Z A;  4H86 A;  4USS A;  3EPT A;  3GIX A;  1Z9H A;  4IEL A;  5DCH A;  3ZML A;  2HZE B;  1EV9 A;  4GWR A;  2EIQ A;  5DCG A;  5AN1 A;  3R3E A;  1ON4 A;  5CRH A;  1OKT A;  3D5J A;  3MSZ A;  2AUV A;  3ZFL A;  3VWW A;  2LQO A;  4KX4 A;  3KMO A;  5ELG A;  5IPG A;  3UMA A;  5J5N A;  3K8N A;  4Q5F A;  1ML6 A;  2OBI A;  1SJ6 A;  2X8H A;  1WPI A;  2KP2 A;  3P90 A;  3TOT A;  5DQY A;  4WKW A;  2VLT A;  4KAE A;  1TDI A;  2OBK A;  3APQ A;  5IMZ A;  4MPG A;  2IMD A;  2J9H A;  1GSU A;  1NHO A;  3QAG A;  4K0N A;  5G2Z A;  2GTU A;  4BA7 A;  3QDN A;  3KXO A;  4NAX A;  3TRP A;  2LJK A;  4TR0 A;  1MDK A;  2DBC A;  3TUE A;  1THX A;  2L6D A;  1B4Q A;  3LFL A;  2LJR A;  5E59 A;  4G2E A;  3VLN A;  3P2A A;  4MAB A;  1FVJ A;  2FY6 A;  4E8E A;  3RPN A;  1DE2 A;  2H73 A;  1OE8 A;  3C1R A;  2LKU A;  3DWV A;  4D73 A;  3QAW A;  2AB6 A;  3M8N A;  1JLW A;  2LNT A;  4DVC A;  2M80 A;  4V2M A;  1EP8 A;  4TXO B;  5AGY A;  1SD9 A;  2H75 A;  3F6D A;  4PGT A;  1K0B A;  2RM6 A;  1QMV A;  5B6N A;  1BX9 A;  3EWL A;  3EE2 A;  2QKE A;  2H0G A;  3HA9 A;  3ZRD A;  3C73 A;  5B7C A;  2BTO T;  3QR6 A;  11GS A;  4Z7X A;  5CNW A;  4OD7 A;  5D9W A;  4MP4 A;  2C4J A;  3H8Q A;  4MA9 A;  1F6M C;  2LS5 A;  3D22 A;  4K5R A;  3HJM A;  2YWI A;  2AJQ B;  1HNA A;  1EOG A;  3M9K A;  3LWA A;  5DAK B;  2HXK A;  1ZCP A;  1PL1 A;  3UVH A;  4FYU A;  1O81 A;  3GV1 A;  4Q5Q A;  1Z7R A;  5GST A;  2X49 A;  4HUA A;  3TB2 A;  1RK4 A;  4N0V A;  4KDU A;  2JZT A;  1EZK A;  1V2A A;  1XCC A;  4X0X A;  1PD2 1;  4MCU A;  1XW5 A;  1WWJ A;  4ICY A;  5JWQ B;  1JZW A;  2DJ2 A;  2J23 A;  2FNO A;  1IYH A;  1EEJ A;  2TRX A;  3VI5 A;  5B8A A;  3EIN A;  4POB A;  3GMF A;  4MDC A;  3WGD A;  4POK A;  2YOI A;  5HR1 A;  5HR0 A;  3WGE A;  4V1A g;  2FUG 2;  1TW9 A;  5HQP A;  4MZC A;  2VL2 C;  2XBI A;  2GQL A;  2GS3 A;  3IOS A;  4V2L A;  5KOW A;  2B5X A;  5BRT A;  3IDV A;  1Z6N A;  1ZYN A;  2VCV A;  4WEY A;  4AF2 A;  2C0E A;  5J4U A;  4P3Y B;  2WFC A;  1V40 A;  2LUS A;  3HVX A;  5G1L A;  4FO5 A;  2F8F A;  16GS A;  4BWS A;  1THO A;  3LW9 A;  4K7N A;  2C0D A;  5IM9 A;  4XTS A;  2HYX A;  1MDJ A;  5D93 A;  3LYP A;  2GT6 A;  3L9U A;  3A5I A;  5D9T A;  1BQ7 A;  5CP1 A;  4XRD A;  2C3T A;  1R26 A;  2CVK A;  4Z2T A;  1T8E B;  3ME7 A;  4KND A;  5ENU A;  4OMV A;  4XIH A;  3GYK A;  4FIW A;  2A4V A;  7GSS A;  1GTI A;  1MD3 A;  3W8S A;  3VWU A;  4MF7 A;  2BJX A;  3LXT A;  5JCW A;  2CT6 A;  4HQZ A;  1Z3E A;  5AIS A;  1UC7 A;  3DKS A;  1QUW A;  3G7Y A;  1GNE A;  2O85 A;  3O6T A;  2DKI A;  4TR4 A;  1M2B A;  4QQ7 A;  4WR4 A;  17GS A;  2F3M A;  2O8V B;  2B5E A;  1TXX A;  1EGR A;  4PUR A;  2YV7 A;  2HSH A;  1TK5 B;  4J57 E;  3FY7 A;  1OC3 A;  5FWG A;  1UN2 A;  5IOW A;  3IHQ A;  3FKF A;  4HSC X;  5C04 A;  5JWO B;  1H75 A;  1AUC A;  3LEF A;  2H6Y A;  5KN1 A;  2TIR A;  4ZL8 A;  1PX6 A;  3MYD A;  2K6V A;  1PL2 A;  3EYT A;  3L4N A;  4HDE A;  1E6B A;  2HFD A;  4ISD A;  3FZ4 A;  3F6F A;  2I4A A;  4YQM A;  2A2P A;  3H79 A;  1Z6M A;  1GLQ A;  1PSQ A;  5C00 A;  2DJ1 A;  2MMO A;  1ZMA A;  2RM5 A;  1TP9 A;  1YEX A;  4JED A;  4KA0 A;  2AHE A;  5F8B A;  1HD2 A;  2YNX A;  3M0F A;  4K1F A;  1X5C A;  2YCD A;  4MPF A;  1GH2 A;  2OAC A;  4TRX A;  1U6T A;  3MNG A;  3O3T A;  4IKH A;  4O92 A;  2D2Z A;  3OR5 A;  4IS0 A;  2JSZ A;  1VF4 A;  3FMW A;  3ERF A;  2VCT A;  2DC5 A;  4HU9 A;  5KN0 A;  3PPU A;  3IC8 A;  3I43 A;  4O5Q A;  9GSS A;  1AQX A;  1U87 A;  3GKM A;  5CO3 A;  4O5U A;  4PQI A;  1MDI A;  5B6M A;  2DIZ A;  2HSY A;  3GKK A;  2WZ9 A;  1XWB A;  2H1D A;  4LMW A;  3L78 A;  3APO A;  1GSQ A;  3GX0 A;  2F9S A;  3D4T A;  3N9J A;  2M46 A;  4PUA A;  4IJI A;  1EEM A;  5ID2 B;  1WMJ A;  2FHE A;  1G7O A;  1O8X A;  2YJH A;  2V6K A;  5D73 A;  3G7J A;  2OJL A;  2HI7 A;  1EP7 A;  2PBJ A;  3FR6 A;  1XWC A;  3EU4 A;  1U88 A;  2PWJ A;  4AJ7 A;  1FB6 A;  5ECI B;  3ED3 A;  5DQS A;  3RPP A;  1XW6 A;  2HSM A;  5LCZ A;  4G19 A;  4K9Z A;  4K5S A;  2YZH A;  3U5R E;  3KP8 A;  4HJ2 A;  2YP6 A;  3C7M A;  20GS A;  3IBH A;  4GCI A;  4J2F A;  2PVO C;  1K0C A;  2VOC A;  3O76 A;  3L9V A;  2MMN A;  3L9S A;  3A2W A;  1TU7 A;  1KEB A;  5DJM A;  1QGV A;  4PQH A;  1A2J A;  1GTA A;  3GN3 A;  3D0Z A;  3VWX A;  1NW2 A;  4ZIL A;  3KJY A;  2FGX A;  5ID2 A;  4EDY A;  3ISO A;  1UA5 A;  1JFU A;  4HZ2 A;  2K18 A;  4ZB9 A;  2WCI A;  1A0F A;  4N0Z A;  5KEJ A;  2V6O A;  5F06 A;  3DYR A;  5J9B A;  4WXT A;  2CZ2 A;  2H1G A;  5G31 A;  5F05 A;  2VD1 A;  5CRW A;  5IMC A;  4EDZ A;  1XXU A;  4MF6 A;  2R4V A;  4X4J A;  1X9M B;  1XVQ A;  1A8Y A;  5A5K A;  2B1L A;  3HD5 A;  2GSS A;  5D9V A;  3F4R A;  3KZQ A;  5FT3 A;  2QSI A;  10GS A;  3CRT A;  1XG8 A;  3QAV A;  3KCM A;  4KGI A;  2L4Q A;  3GKX A;  4KDX A;  2H71 A;  3FHK A;  1B9X C;  5H5S A;  4G0L A;  5ECR B;  2VCQ A;  2FD3 A;  3ZZX A;  1K3L A;  1URM A;  1O6J A;  2PER A;  4XCS A;  3KGK A;  4NXI A;  3CSH A;  4I8B A;  2DLX A;  4ECC A;  2N5F A;  3QFB C;  3GFK A;  4OFT A;  5IO2 A;  2LNS A;  2E7P A;  1I5G A;  8GSS A;  2R37 A;  4XHM A;  2VL9 A;  1N8J A;  4OFM A;  2B6M A;  2JAC A;  1U3A A;  1NHY A;  2K8S A;  2EC4 A;  3C1S A;  4IGJ A;  4WF4 A;  1N2A A;  2GLR A;  3GL5 A;  1ERU A;  12GS A;  4D73 B;  2LRT A;  3PR8 A;  3EUR A;  1GUL A;  5HFI A;  2C8U A;  2MBS A;  3LXZ A;  4EIP A;  1YKC A;  1FOV A;  2X64 A;  5LD0 A;  1XVW A;  3IV4 A;  3VUR A;  3LQ7 A;  4O32 A;  5ELA A;  6GSV A;  2R0G A;  3ZVJ D;  3GTU A;  1HYU A;  1YKA A;  1Q4J A;  2ALB A;  2DJK A;  3TDG A;  3LSZ A;  2R0P A;  1AXD A;  2LTK A;  3US3 A;  1G7E A;  4MZW A;  1PRX A;  4CDO A;  4EIQ A;  4DSS B;  1YQ1 A;  1O8W A;  5GSS A;  2CX4 A;  2VIM A;  4HI7 A;  1R5P A;  3I9V 2;  2ZCT A;  2L5L A;  3FR3 A;  1ILO A;  4KUN A;  4YH2 A;  4GQF A;  3UIW A;  2VD0 A;  5EPF A;  2H76 A;  4ECB A;  3LJR A;  2QGV A;  3DVW A;  3C71 A;  5HR3 A;  5JCG A;  3QOU A;  1Y25 A;  1TJD A;  3EU3 A;  4OCE A;  5ECM B;  3ZIJ A;  3TGZ A;  4DSQ A;  2B7K A;  2GSQ A;  1ZGN A;  2FA4 A;  4NMU A;  3I69 A;  5DBQ A;  1DBY A;  1TI1 A;  4DSR A;  2V32 A;  2H0H A;  4HQS A;  3E9J B;  5ABR A;  3A3T A;  5HR2 A;  4WR5 A;  2RII A;  3FYG A;  4KH7 A;  3TJF A;  4DSS A;  2ON5 A;  4CHS A;  2QA2 A;  3I6A A;  2G2Q A;  3HJP A;  4ID0 A;  3P8W A;  2WGR A;  3C8E A;  4RQR A;  2ES7 A;  2IMK A;  2EIO A;  5ECK B;  18GS A;  1X9W B;  2RUF A;  4MJA A;  2CVD A;  1WIK A;  3MAK A;  5J3R A;  4QL7 A;  1SEN A;  4KF9 A;  4HOJ A;  3HCZ A;  2G0F A;  2FWH A;  5GZZ B;  1K0A A;  6GST A;  2JU5 A;  4BVX B;  2LRN A;  2VM1 A;  1JLV A;  4LL4 B;  5ECP B;  14GS A;  2WJU A;  4ZXG A;  2XPE A;  3NOF A;  4IVF A;  4EO3 A;  3JCM L;  3CTG A;  4MJE A;  4K7O A;  3IPZ A;  1A0R P;  1CQH A;  3GUR A;  3E0U A;  1GUM A;  2CV4 A;  3UOM A;  2LV3 A;  4FQU A;  2WS2 A;  1QQ2 A;  5L71 A;  5DDL A;  4DEJ A;  1GSD A;  2NVL A;  2L59 A;  3QFA C;  3TJB A;  2JL4 A;  3IRA A;  4OFN A;  3GKN A;  1FO5 A;  4TN8 A;  4WBR D;  4O5R A;  4K2X A;  3F4S A;  3ERG A;  4IP6 A;  3IK9 A;  3IXR A;  3ME8 A;  2C3N A;  4WET A;  4BVX A;  5IOX A;  1JZD A;  1J9B A;  1PX7 A;  2YPM A;  1OE7 A;  2PGT A;  1A8L A;  4YAP A;  3GST A;  1B4P A;  4XS1 A;  2H72 A;  1K0O A;  2GZZ A;  3UAP A;  4I2U A;  5IMF A;  3LGC A;  1VF2 A;  1EGO A;  1PN0 A;  5INY A;  2OE0 A;  1LU4 A;  2OKA A;  2MMZ A;  4HU7 A;  5EVO A;  2B5Y A;  5A4W A;  2JZR A;  3KM6 A;  3HVV A;  2HLS A;  2CAI A;  3M9J A;  2VCZ A;  1SJI A;  4X1U A;  4EL1 A;  3ZMK A;  3FZA A;  4HEA 2;  3LOR A;  4G10 A;  2H01 A;  1PKZ A;  2YV9 A;  4L0U A;  3D4M A;  1VGL A;  2CVB A;  2K8V A;  4GLT A;  3IC4 A;  5AIX A;  2A2S A;  4HZ4 A;  3AY8 A;  1AQV A;  1T3B A;  4L0W A;  2DSA A;  4ZB6 A;  1G0T A;  1K3O A;  2KHP A;  3ZL5 A;  3IAS 2;  2R5G A;  4IN0 A;  4J56 E;  3TCO A;  1O7U A;  3BD2 A;  3RAZ A;  3KD0 A;  3VFI A;  2HNL A;  5HFK A;  4JRR A;  1FG4 A;  4HJM A;  4G0I A;  1MD4 A;  1QXH A;  1KNG A;  4AJ6 A;  6GSS A;  4XS4 B;  4XS6 A;  3SBC A;  3VI7 A;  1SL1 B;  3BCK A;  1JZO A;  3EVI A;  1XWG A;  2RLI A;  3CXG A;  4ZBB A;  1WRY A;  1M2A A;  1XW9 A;  3ZLP A;  1X0R A;  2L5O A;  1GSY A;  2ON7 A;  1VF3 A;  1YY7 A;  2YWN A;  1GL8 A;  4Z2R A;  2GQK A;  4EC0 A;  4RI7 A;  3ZTL A;  3CRU A;  4YQU A;  4F2I A;  1TRV A;  2HE3 A;  2IME A;  3IK7 A;  4MH3 A;  3IHG A;  3TOU A;  3A2X A;  1M9A A;  1ZZY A;  1R4W A;  2X8C A;  1M9B A;  3EC3 A;  3TKP A;  4KCA A;  5BMU A;  2H0I A;  2MMA A;  1PMT A;  5COH A;  2VCW A;  4PQ1 A;  2IFQ A;  2R0C A;  4YAV A;  1TKD B;  1GSF A;  1BJX A;  3HXS A;  2C0F A;  3KH7 A;  1SK2 A;  2FA8 A;  2OA7 A;  4QL9 A;  4XS4 A;  3VK9 A;  5DAL B;  4JU5 A;  3HDC A;  2PVQ A;  1G6Y A;  3LYK A;  5CYY A;  4NWY A;  4IQA A;  1PN9 A;  4KB3 A;  3EMP A;  3TRX A;  1X9S B;  1U3I A;  3Q6O A;  1GUK A;  4JBB A;  1TOF A;  1XWK A;  1HNC A;  2DKH A;  1MEK A;  1SL2 B;  3M3M A;  1AQW A;  3HVS A;  2IMI A;  2CZ3 A;  4MNN A;  1ZYP A;  3GHA A;  4L8E A;  3MWH A;  1YZX A;  4F03 A;  3UEM A;  3S9F A;  3KIJ A;  1BAY A;  3RHB A;  1KTE A;  4YKG A;  3DD3 A;  3Q19 A;  4BL7 B;  3D6I A;  2XC2 A;  3Q18 A;  1BG5 A;  1M0U A;  2HRF A;  1GTU A;  2C1Y A;  1GRX A;  5G30 A;  1QK8 A;  1SD8 A;  2N5B A;  2KP1 A;  4PNF A;  2H19 A;  5DAL A;  2A4H A;  3CMI A;  2NPB A;  3TKS C;  1B8X A;  4EE0 A;  3H1N A;  1GWC A;  6GSU A;  2C3Q A;  4K2D A;  3W6G A;  5EY6 A;  3TKS A;  5F0G A;  3ZIT A;  1X5E A;  3ZIV A;  5KN3 A;  2GT5 A;  3J7Y k;  1FW1 A;  2E2G A;  5A4V A;  2N5A A;  2L57 A;  1HQO A;  2HT9 A;  4CW9 A;  1WOU A;  4EVM A;  4ACS A;  2VLU A;  1B48 A;  1K3Y A;  5B8B A;  1PFO A;  2UZ8 A;  4ECI A;  4BL7 A;  2P31 A;  3HZ4 A;  1MTC A;  2CA8 A;  2AAW A;  2IIY A;  1JHB A;  5A4U A;  2REM A;  2DJ0 A;  3F9U A;  1AIU A;  3GTU B;  1W4V A;  1SK0 A;  2KLX A;  4TR1 B;  2FCH A;  5DJL A;  2OE3 A;  5ECN B;  1Z7P A;  3FEU A;  5IO0 A;  3UAR A;  1XIY A;  3IE3 A;  2MZC A;  3G9B A;  1M3J A;  2WB9 A;  2YWM A;  4IQ1 A;  1USB A;  3DIE A;  2F51 A;  3NZN A;  5H5R A;  1O85 A;  2L6C A;  3ZYW A;  4IW9 A;  1OKD A;  2IPA A;  4I5Q A;  6GSW A;  2HRN A;  1SK1 A;  5ECL B;  2KUC A;  4JR4 A;  4TOP A;  3UBK A;  3CYN A;  2LQQ A;  2H6Z A;  1M99 A;  4I2T A;  2A2R A;  4I6X A;  4BVY B;  5J9C A;  4EKZ A;  3GA4 A;  1NM3 A;  2YZU A;  4PX1 A;  1IYI A;  1I9D A;  2JZS A;  1FAA A;  3RHC A;  4GQC A;  1ZYE A;  3GUS A;  3F3Q A;  2QA1 A;  2H8L A;  4A5P A;  1OAZ A;  2HZF A;  3GL3 A;  1TK0 B;  2O7K A;  1GTB A;  1XZO A;  3HJO A;  2C0G A;  2VO4 A;  2DIY A;  4F0B A;  1M7T A;  3GRX A;  2FWE A;  2O89 A;  2GZY A;  3BOA A;  4TR1 A;  3L0H A;  3G7I A;  2CQ9 A;  3BCI A;  3VWV A;  2P5R A;  3BBY A;  3UJ1 A;  2CX3 A;  4O7H A;  4ZBD A;  3TRQ A;  1Q98 A;  6GSY A;  1RQM A;  1TRW A;  2PU9 C;  1FHE A;  2H74 A;  5KN2 A;  1ZOF A;  4MZB A;  1VRS D;  4MJC A;  2V1M A;  3GNJ A;  4ZBA A;  3CTF A;  2HZE A;  2I3Y A;  1GLP A;  1AAZ A;  3HY2 A;  5H5Q A;  4BVY A;  4GTU A;  1M3I A;  2AYT A;  1TI3 A;  5D96 A;  3KMN A;  3D21 A;  3UL3 A;  2GZP A;  1TK8 B;  1V58 A;  4CY6 A;  3GSS A;  1K0M A;  2I81 A;  1BYE A;  2IWT A;  3E3E A;  1H4O A;  1SKS B;  5CRG A;  2PMT A;  3F8U A;  3ZVJ A;  4ZIJ A;  3DXB A;  2H70 A;  3FK8 A;  1T4Y A;  3DVX A;  4V1A p;  3P7X A;  3BJ5 A;  2RUE A;  4OWY A;  1AC1 A;  1YEP A;  1AW9 A;  2NTO A;  5D8I A;  4EUY A;  1YJ6 A;  4F82 A;  3HYP A;  3H93 A;  1J08 A;  1GNW A;  3FW2 A;  2X8G A;  3EMX A;  3KH9 A;  4ZL9 A;  2IJY A;  1Y6E A;  1PGT A;  2VLV A;  4JE1 A;  4OO5 A;  1ERW A;  4AGS A;  4K6X A;  4PNG A;  4K8M A;  4ML6 A;  3QCP A;  1OC8 A;  2CAQ A;  2R3X A;  4FYB A;  4N30 A;  3VPT A;  4MJB A;  2IMF A;  2P0G A;  1UVZ A;  4LLR A;  3VPQ A;  5DVB A;  5IIZ A;  2PPT A;  3WT1 A;  2VM2 A;  4NHZ A;  1ST9 A;  3M1G A;  4ULX A;  3HKR A;  4TXO A;  1SKR B;  1FB0 A;  4KCE A;  1SJZ A;  3TJJ A;  4MLY A;  1F3A A;  4BWQ A;  1R7H A;  1K0N A;  2XBQ A;  5ECQ B;  1Z5Y E;  5HFG A;  3IR4 A;  3F0I A;  2YJ7 A;  3GH6 A;  2X4A A;  1ABA A;  1O73 A;  5IMD A;  1NSW A;  2VCX A;  1CQG A;  1PKW A;  3CBU A;  3A2V A;  4WBJ A;  4FH8 A;  1A2L A;  2FLS A; 
#chains in the Genus database with same CATH homology
 4KW6 A;  1ZL9 A;  1YDK A;  4KDY A;  4LMV A;  5KOX A;  4GSS A;  1WP0 A;  1F9M A;  2VL2 A;  2DJ3 A;  5E4W A;  1QFN A;  5ECS A;  1T7P B;  5DAK A;  4G0K A;  1E2Y A;  2WDU A;  2FWG A;  2DML A;  2I1U A;  3KTB A;  1EV4 A;  4NV5 A;  2YN1 A;  2GQM A;  4TR3 A;  1DSB A;  3N5O A;  5GAP D;  4ILF A;  1T1V A;  2H1B A;  4JZQ A;  5G5E A;  3TJK A;  1PA3 A;  2B3S A;  1V98 A;  3DGQ A;  2V41 A;  1SKW B;  1K0D A;  1SU9 A;  2P5Q A;  2E2M A;  1SYR A;  2MYG A;  4JR6 A;  1TTZ A;  2JAD A;  4NHW A;  1J0F A;  1LJR A;  2NBS A;  2ZNM A;  2FWF A;  1EOH A;  1V57 A;  4I97 A;  4KSM A;  1ACV A;  3QMX A;  1XOB A;  5JCU A;  3KP9 A;  3ERW A;  3TJG A;  2GSR A;  1A2M A;  3RDW A;  5ECO B;  1XWA A;  5FHI A;  2XHF A;  3QPM A;  4OO4 A;  1V9W A;  2B7J A;  4IBP A;  3F63 A;  3FRC A;  1F37 A;  1B9Y C;  4BPY A;  1TRU A;  4NV2 A;  1KBN A;  2PUK C;  4HS1 A;  4TW5 A;  2VL3 A;  4GXZ A;  4MMM A;  3UBL A;  2IFQ B;  1XFL A;  4TVE A;  2AV4 A;  4L5L A;  1OC9 B;  3F4T A;  5IQY A;  4MH2 A;  3PGT A;  2GVP A;  3TKQ A;  2R2J A;  1OVN A;  4KSO A;  1EWX A;  4EF0 A;  2M72 A;  1JZR A;  5G5F A;  4ZB8 A;  1DUG A;  1BED A;  1M2D A;  1W89 A;  2V2G A;  4PUF C;  4YQV A;  1HNB A;  2GDR A;  4IP1 A;  4PTS A;  3FR9 A;  5CAX A;  4RUV A;  4IHU A;  3W8J A;  3ZRE A;  2BMX A;  1PQN A;  2KOK A;  4GRF A;  5JWR B;  2R6K A;  3PIN A;  2OAD A;  3DRN A;  3APS A;  3TKS E;  1SYX A;  2O87 A;  1ERT A;  4TKY A;  2GGT A;  2NDO A;  2K9F A;  4G9H A;  3CSI A;  4POL A;  4L5O A;  4ECJ A;  3WGX A;  2DJJ A;  3GH9 A;  4X43 A;  1RW1 A;  4IJ3 A;  2L4C A;  1YF0 A;  2LJA A;  2PN8 A;  1GUH A;  1OC9 A;  2YWO A;  3HHV A;  1ERV A;  4FYC A;  4F0C A;  2H30 A;  2IN3 A;  3DEX A;  1XBS A;  3TKR A;  5LNK e;  4N10 A;  4V2N A;  3KTL A;  2GST A;  2OE1 A;  4XRA A;  2Z9S A;  5J41 A;  4Q5R A;  1X5D A;  6GSX A;  2VUP A;  5G1K A;  2ZUP A;  2DMM A;  1A23 A;  3J7Y b;  1SL0 B;  1WJK A;  2X99 A;  3MDK A;  1GP1 A;  3FZ9 A;  2H66 A;  3FZ5 A;  2F8A A;  2WUL A;  1DE1 A;  4WF5 A;  4ZL7 A;  3IA1 A;  1S3D A;  5F07 A;  2HRK A;  4MF5 A;  5ECH B;  5D9X A;  4AJ8 A;  2H6X A;  1XOA A;  5IPH A;  1OYJ A;  1FVK A;  4CY8 A;  3H4K A;  3LG6 A;  2XPD A;  4LL1 B;  1A24 A;  2YAN A;  3V1W A;  1C72 A;  1G6W A;  3R2Q A;  3NIV A;  3U6V A;  2WRT A;  3PH9 A;  4E8H A;  5IMV A;  4K0G A;  1S3C A;  2H1A A;  13GS A;  4K7I A;  3WD6 A;  2QC7 A;  5CRE A;  1S3A A;  3WT2 A;  3A5W A;  2TRC P;  1VF1 A;  1F2E A;  4EXJ A;  4Q5N A;  3ZFB A;  1T00 A;  2E0Q A;  2MBT A;  5IMA A;  1WE0 A;  1GSE A;  4TXV A;  2B1K A;  3MIX A;  1GSS A;  3Q74 A;  3WYW A;  4RI6 A;  22GS A;  3QD9 A;  2C80 A;  3SWL A;  2LRC A;  5EL8 A;  4KE3 A;  4POM A;  1LBK A;  19GS A;  2JSY A;  4GSN A;  3RBT A;  2LST A;  1XPV A;  3HZ8 A;  1YF1 A;  4GST A;  2LEG A;  3GX8 A;  1R5A A;  3F3R A;  4GF0 A;  3IAM 2;  2HRA A;  1TU8 A;  2VAF A;  4OCF A;  2IL3 A;  4PXO A;  1T4Z A;  1FOH A;  4LA1 A;  4Z2U A;  2I9H A;  1TRS A;  4NPB A;  4N11 A;  3DML A;  4ML1 A;  1F3B A;  5GAN D;  3CSJ A;  3UVT A;  4MK3 A;  5AIV A;  4YKF A;  5CRD A;  3KEB A;  2EIR A;  4RQX A;  1ZYQ B;  4F9Z A;  4H86 A;  4USS A;  3EPT A;  3GIX A;  1Z9H A;  4IEL A;  5DCH A;  3ZML A;  2HZE B;  1EV9 A;  4GWR A;  2EIQ A;  5DCG A;  5AN1 A;  3R3E A;  1ON4 A;  5CRH A;  1OKT A;  3D5J A;  3MSZ A;  2AUV A;  3ZFL A;  3VWW A;  2LQO A;  4KX4 A;  3KMO A;  5ELG A;  5IPG A;  3UMA A;  5J5N A;  3K8N A;  4Q5F A;  1ML6 A;  2OBI A;  1SJ6 A;  2X8H A;  1WPI A;  2KP2 A;  3P90 A;  3TOT A;  5DQY A;  4WKW A;  2VLT A;  4KAE A;  1TDI A;  2OBK A;  3APQ A;  5IMZ A;  4MPG A;  2IMD A;  2J9H A;  1GSU A;  1NHO A;  3QAG A;  4K0N A;  5G2Z A;  2GTU A;  4BA7 A;  3QDN A;  3KXO A;  4NAX A;  3TRP A;  2LJK A;  4TR0 A;  1MDK A;  2DBC A;  3TUE A;  1THX A;  2L6D A;  1B4Q A;  3LFL A;  2LJR A;  5E59 A;  4G2E A;  3VLN A;  3P2A A;  4MAB A;  1FVJ A;  2FY6 A;  4E8E A;  3RPN A;  1DE2 A;  2H73 A;  1OE8 A;  3C1R A;  2LKU A;  3DWV A;  4D73 A;  3QAW A;  2AB6 A;  3M8N A;  1JLW A;  2LNT A;  4DVC A;  2M80 A;  4V2M A;  1EP8 A;  4TXO B;  5AGY A;  1SD9 A;  2H75 A;  3F6D A;  4PGT A;  1K0B A;  2RM6 A;  1QMV A;  5B6N A;  1BX9 A;  3EWL A;  3EE2 A;  2QKE A;  2H0G A;  3HA9 A;  3ZRD A;  3C73 A;  5B7C A;  2BTO T;  3QR6 A;  11GS A;  4Z7X A;  5CNW A;  4OD7 A;  5D9W A;  4MP4 A;  2C4J A;  3H8Q A;  4MA9 A;  1F6M C;  2LS5 A;  3D22 A;  4K5R A;  3HJM A;  2YWI A;  2AJQ B;  1HNA A;  1EOG A;  3M9K A;  3LWA A;  5DAK B;  2HXK A;  1ZCP A;  1PL1 A;  3UVH A;  4FYU A;  1O81 A;  3GV1 A;  4Q5Q A;  1Z7R A;  5GST A;  2X49 A;  4HUA A;  3TB2 A;  1RK4 A;  4N0V A;  4KDU A;  2JZT A;  1EZK A;  1V2A A;  1XCC A;  4X0X A;  1PD2 1;  4MCU A;  1XW5 A;  1WWJ A;  4ICY A;  5JWQ B;  1JZW A;  2DJ2 A;  2J23 A;  2FNO A;  1IYH A;  1EEJ A;  2TRX A;  3VI5 A;  5B8A A;  3EIN A;  4POB A;  3GMF A;  4MDC A;  3WGD A;  4POK A;  2YOI A;  5HR1 A;  5HR0 A;  3WGE A;  4V1A g;  2FUG 2;  1TW9 A;  5HQP A;  4MZC A;  2VL2 C;  2XBI A;  2GQL A;  2GS3 A;  3IOS A;  4V2L A;  5KOW A;  2B5X A;  5BRT A;  3IDV A;  1Z6N A;  1ZYN A;  2VCV A;  4WEY A;  4AF2 A;  2C0E A;  5J4U A;  4P3Y B;  2WFC A;  1V40 A;  2LUS A;  3HVX A;  5G1L A;  4FO5 A;  2F8F A;  16GS A;  4BWS A;  1THO A;  3LW9 A;  4K7N A;  2C0D A;  5IM9 A;  4XTS A;  2HYX A;  1MDJ A;  5D93 A;  3LYP A;  2GT6 A;  3L9U A;  3A5I A;  5D9T A;  1BQ7 A;  5CP1 A;  4XRD A;  2C3T A;  1R26 A;  2CVK A;  4Z2T A;  1T8E B;  3ME7 A;  4KND A;  5ENU A;  4OMV A;  4XIH A;  3GYK A;  4FIW A;  2A4V A;  7GSS A;  1GTI A;  1MD3 A;  3W8S A;  3VWU A;  4MF7 A;  2BJX A;  3LXT A;  5JCW A;  2CT6 A;  4HQZ A;  1Z3E A;  5AIS A;  1UC7 A;  3DKS A;  1QUW A;  3G7Y A;  1GNE A;  2O85 A;  3O6T A;  2DKI A;  4TR4 A;  1M2B A;  4QQ7 A;  4WR4 A;  17GS A;  2F3M A;  2O8V B;  2B5E A;  1TXX A;  1EGR A;  4PUR A;  2YV7 A;  2HSH A;  1TK5 B;  4J57 E;  3FY7 A;  1OC3 A;  5FWG A;  1UN2 A;  5IOW A;  3IHQ A;  3FKF A;  5C04 A;  5JWO B;  1H75 A;  1AUC A;  3LEF A;  2H6Y A;  5KN1 A;  2TIR A;  4ZL8 A;  1PX6 A;  3MYD A;  2K6V A;  1PL2 A;  3EYT A;  3L4N A;  4HDE A;  1E6B A;  2HFD A;  4ISD A;  3FZ4 A;  3F6F A;  2I4A A;  4YQM A;  2A2P A;  3H79 A;  1Z6M A;  1GLQ A;  1PSQ A;  5C00 A;  2DJ1 A;  2MMO A;  1ZMA A;  2RM5 A;  1TP9 A;  1YEX A;  4JED A;  4KA0 A;  2AHE A;  5F8B A;  1HD2 A;  2YNX A;  3M0F A;  4K1F A;  1X5C A;  2YCD A;  4MPF A;  1GH2 A;  2OAC A;  4TRX A;  1U6T A;  3MNG A;  3O3T A;  4IKH A;  4O92 A;  2D2Z A;  3OR5 A;  4IS0 A;  2JSZ A;  1VF4 A;  3FMW A;  3ERF A;  2VCT A;  2DC5 A;  4HU9 A;  5KN0 A;  3PPU A;  3IC8 A;  3I43 A;  4O5Q A;  9GSS A;  1AQX A;  1U87 A;  3GKM A;  5CO3 A;  4O5U A;  4PQI A;  1MDI A;  5B6M A;  2DIZ A;  2HSY A;  3GKK A;  2WZ9 A;  1XWB A;  2H1D A;  4LMW A;  3L78 A;  3APO A;  1GSQ A;  3GX0 A;  2F9S A;  3D4T A;  3N9J A;  2M46 A;  4PUA A;  4IJI A;  1EEM A;  5ID2 B;  1WMJ A;  2FHE A;  1G7O A;  1O8X A;  2YJH A;  2V6K A;  5D73 A;  3G7J A;  2OJL A;  2HI7 A;  1EP7 A;  2PBJ A;  3FR6 A;  1XWC A;  3EU4 A;  1U88 A;  2PWJ A;  4AJ7 A;  1FB6 A;  5ECI B;  3ED3 A;  5DQS A;  3RPP A;  1XW6 A;  2HSM A;  5LCZ A;  4G19 A;  4K9Z A;  4K5S A;  2YZH A;  3U5R E;  3KP8 A;  4HJ2 A;  2YP6 A;  3C7M A;  20GS A;  3IBH A;  4GCI A;  4J2F A;  2PVO C;  1K0C A;  2VOC A;  3O76 A;  3L9V A;  2MMN A;  3L9S A;  3A2W A;  1TU7 A;  1KEB A;  5DJM A;  1QGV A;  4PQH A;  1A2J A;  1GTA A;  3GN3 A;  3D0Z A;  3VWX A;  1NW2 A;  4ZIL A;  3KJY A;  2FGX A;  5ID2 A;  4EDY A;  3ISO A;  1UA5 A;  1JFU A;  4HZ2 A;  2K18 A;  4ZB9 A;  2WCI A;  1A0F A;  4N0Z A;  5KEJ A;  2V6O A;  5F06 A;  3DYR A;  5J9B A;  4WXT A;  2CZ2 A;  2H1G A;  5G31 A;  5F05 A;  2VD1 A;  5CRW A;  5IMC A;  4EDZ A;  1XXU A;  4MF6 A;  2R4V A;  4X4J A;  1X9M B;  1XVQ A;  1A8Y A;  5A5K A;  2B1L A;  3HD5 A;  2GSS A;  5D9V A;  3F4R A;  3KZQ A;  5FT3 A;  2QSI A;  10GS A;  3CRT A;  3QAV A;  3KCM A;  4KGI A;  2L4Q A;  3GKX A;  4KDX A;  2H71 A;  3FHK A;  1B9X C;  5H5S A;  4G0L A;  5ECR B;  2VCQ A;  2FD3 A;  3ZZX A;  1K3L A;  1URM A;  1O6J A;  2PER A;  4XCS A;  3KGK A;  4NXI A;  3CSH A;  4I8B A;  2DLX A;  4ECC A;  2N5F A;  3QFB C;  3GFK A;  4OFT A;  5IO2 A;  2LNS A;  2E7P A;  1I5G A;  8GSS A;  2R37 A;  4XHM A;  2VL9 A;  1N8J A;  4OFM A;  2B6M A;  2JAC A;  1U3A A;  1NHY A;  2K8S A;  2EC4 A;  3C1S A;  4IGJ A;  4WF4 A;  1N2A A;  2GLR A;  3GL5 A;  1ERU A;  12GS A;  4D73 B;  2LRT A;  3PR8 A;  3EUR A;  1GUL A;  5HFI A;  2C8U A;  2MBS A;  3LXZ A;  4EIP A;  1YKC A;  1FOV A;  2X64 A;  5LD0 A;  1XVW A;  3IV4 A;  3VUR A;  3LQ7 A;  4O32 A;  5ELA A;  6GSV A;  2R0G A;  3ZVJ D;  3GTU A;  1HYU A;  1YKA A;  1Q4J A;  2ALB A;  2DJK A;  3TDG A;  3LSZ A;  2R0P A;  1AXD A;  2LTK A;  3US3 A;  1G7E A;  4MZW A;  1PRX A;  4CDO A;  4EIQ A;  4DSS B;  1YQ1 A;  1O8W A;  5GSS A;  2CX4 A;  2VIM A;  4HI7 A;  1R5P A;  3I9V 2;  2ZCT A;  2L5L A;  3FR3 A;  1ILO A;  4KUN A;  4YH2 A;  4GQF A;  3UIW A;  2VD0 A;  5EPF A;  2H76 A;  4ECB A;  3LJR A;  2QGV A;  3DVW A;  3C71 A;  5HR3 A;  5JCG A;  3QOU A;  1Y25 A;  1TJD A;  3EU3 A;  4OCE A;  5ECM B;  3ZIJ A;  3TGZ A;  4DSQ A;  2B7K A;  2GSQ A;  1ZGN A;  2FA4 A;  4NMU A;  3I69 A;  5DBQ A;  1DBY A;  1TI1 A;  4DSR A;  2V32 A;  2H0H A;  4HQS A;  3E9J B;  5ABR A;  3A3T A;  5HR2 A;  4WR5 A;  2RII A;  3FYG A;  4KH7 A;  3TJF A;  4DSS A;  2ON5 A;  4CHS A;  2QA2 A;  3I6A A;  2G2Q A;  3HJP A;  4ID0 A;  3P8W A;  2WGR A;  3C8E A;  4RQR A;  2ES7 A;  2IMK A;  2EIO A;  5ECK B;  18GS A;  1X9W B;  2RUF A;  4MJA A;  2CVD A;  1WIK A;  3MAK A;  5J3R A;  4QL7 A;  1SEN A;  4KF9 A;  4HOJ A;  3HCZ A;  2G0F A;  2FWH A;  5GZZ B;  1K0A A;  6GST A;  2JU5 A;  4BVX B;  2LRN A;  2VM1 A;  1JLV A;  4LL4 B;  5ECP B;  14GS A;  2WJU A;  4ZXG A;  2XPE A;  3NOF A;  4IVF A;  4EO3 A;  3JCM L;  3CTG A;  4MJE A;  4K7O A;  3IPZ A;  1A0R P;  1CQH A;  3GUR A;  3E0U A;  1GUM A;  2CV4 A;  3UOM A;  2LV3 A;  4FQU A;  2WS2 A;  1QQ2 A;  5L71 A;  5DDL A;  4DEJ A;  1GSD A;  2NVL A;  2L59 A;  3QFA C;  3TJB A;  2JL4 A;  3IRA A;  4OFN A;  3GKN A;  1FO5 A;  4TN8 A;  4WBR D;  4O5R A;  4K2X A;  3F4S A;  3ERG A;  4IP6 A;  3IK9 A;  3IXR A;  3ME8 A;  2C3N A;  4WET A;  4BVX A;  5IOX A;  1JZD A;  1J9B A;  1PX7 A;  2YPM A;  1OE7 A;  2PGT A;  1A8L A;  4YAP A;  3GST A;  1B4P A;  4XS1 A;  2H72 A;  1K0O A;  2GZZ A;  3UAP A;  4I2U A;  5IMF A;  3LGC A;  1VF2 A;  1EGO A;  1PN0 A;  5INY A;  2OE0 A;  1LU4 A;  2OKA A;  2MMZ A;  4HU7 A;  5EVO A;  2B5Y A;  5A4W A;  2JZR A;  3KM6 A;  3HVV A;  2HLS A;  2CAI A;  3M9J A;  2VCZ A;  1SJI A;  4X1U A;  4EL1 A;  3ZMK A;  3FZA A;  4HEA 2;  3LOR A;  4G10 A;  2H01 A;  1PKZ A;  2YV9 A;  4L0U A;  3D4M A;  1VGL A;  2CVB A;  2K8V A;  4GLT A;  5AIX A;  3IC4 A;  2A2S A;  4HZ4 A;  3AY8 A;  1AQV A;  1T3B A;  4L0W A;  2DSA A;  4ZB6 A;  1G0T A;  1K3O A;  2KHP A;  3ZL5 A;  3IAS 2;  2R5G A;  4IN0 A;  4J56 E;  3TCO A;  1O7U A;  3BD2 A;  3RAZ A;  3KD0 A;  3VFI A;  2HNL A;  5HFK A;  4JRR A;  1FG4 A;  4HJM A;  4G0I A;  1MD4 A;  1QXH A;  1KNG A;  4AJ6 A;  6GSS A;  4XS4 B;  4XS6 A;  3SBC A;  3VI7 A;  1SL1 B;  3BCK A;  1JZO A;  3EVI A;  1XWG A;  2RLI A;  3CXG A;  4ZBB A;  1WRY A;  1M2A A;  1XW9 A;  3ZLP A;  1X0R A;  2L5O A;  1GSY A;  2ON7 A;  1VF3 A;  1YY7 A;  2YWN A;  1GL8 A;  4Z2R A;  2GQK A;  4EC0 A;  4RI7 A;  3ZTL A;  3CRU A;  4YQU A;  4F2I A;  1TRV A;  2HE3 A;  2IME A;  3IK7 A;  4MH3 A;  3IHG A;  3TOU A;  3A2X A;  1M9A A;  1ZZY A;  1R4W A;  2X8C A;  1M9B A;  3EC3 A;  3TKP A;  4KCA A;  5BMU A;  2H0I A;  2MMA A;  1PMT A;  5COH A;  2VCW A;  4PQ1 A;  2IFQ A;  2R0C A;  4YAV A;  1TKD B;  1GSF A;  1BJX A;  3HXS A;  2C0F A;  3KH7 A;  1SK2 A;  2FA8 A;  2OA7 A;  4QL9 A;  4XS4 A;  3VK9 A;  5DAL B;  4JU5 A;  3HDC A;  2PVQ A;  1G6Y A;  3LYK A;  5CYY A;  4NWY A;  4IQA A;  1PN9 A;  4KB3 A;  3EMP A;  3TRX A;  1X9S B;  1U3I A;  3Q6O A;  1GUK A;  4JBB A;  1TOF A;  1XWK A;  1HNC A;  2DKH A;  1MEK A;  1SL2 B;  3M3M A;  1AQW A;  3HVS A;  2IMI A;  2CZ3 A;  4MNN A;  1ZYP A;  3GHA A;  4L8E A;  3MWH A;  1YZX A;  4F03 A;  3UEM A;  3S9F A;  3KIJ A;  1BAY A;  3RHB A;  1KTE A;  4YKG A;  3DD3 A;  3Q19 A;  4BL7 B;  3D6I A;  2XC2 A;  3Q18 A;  1BG5 A;  1M0U A;  2HRF A;  1GTU A;  2C1Y A;  1GRX A;  5G30 A;  1QK8 A;  1SD8 A;  2N5B A;  2KP1 A;  4PNF A;  2H19 A;  5DAL A;  2A4H A;  3CMI A;  2NPB A;  3TKS C;  1B8X A;  4EE0 A;  3H1N A;  1GWC A;  6GSU A;  2C3Q A;  4K2D A;  3W6G A;  5EY6 A;  3TKS A;  5F0G A;  3ZIT A;  1X5E A;  3ZIV A;  5KN3 A;  2GT5 A;  3J7Y k;  1FW1 A;  2E2G A;  5A4V A;  2N5A A;  2L57 A;  1HQO A;  2HT9 A;  4CW9 A;  1WOU A;  4EVM A;  4ACS A;  2VLU A;  1B48 A;  1K3Y A;  5B8B A;  2UZ8 A;  4ECI A;  4BL7 A;  2P31 A;  3HZ4 A;  1MTC A;  2CA8 A;  2AAW A;  2IIY A;  1JHB A;  5A4U A;  2REM A;  2DJ0 A;  3F9U A;  1AIU A;  3GTU B;  1W4V A;  1SK0 A;  2KLX A;  4TR1 B;  2FCH A;  5DJL A;  2OE3 A;  5ECN B;  1Z7P A;  3FEU A;  5IO0 A;  3UAR A;  1XIY A;  3IE3 A;  2MZC A;  3G9B A;  2WB9 A;  2YWM A;  4IQ1 A;  1USB A;  3DIE A;  2F51 A;  3NZN A;  5H5R A;  1O85 A;  2L6C A;  3ZYW A;  4IW9 A;  1OKD A;  2IPA A;  4I5Q A;  6GSW A;  2HRN A;  1SK1 A;  5ECL B;  2KUC A;  4JR4 A;  4TOP A;  3UBK A;  3CYN A;  2LQQ A;  2H6Z A;  1M99 A;  4I2T A;  2A2R A;  4I6X A;  4BVY B;  5J9C A;  4EKZ A;  3GA4 A;  1NM3 A;  2YZU A;  4PX1 A;  1IYI A;  1I9D A;  2JZS A;  1FAA A;  3RHC A;  4GQC A;  1ZYE A;  3GUS A;  3F3Q A;  2QA1 A;  2H8L A;  4A5P A;  1OAZ A;  2HZF A;  3GL3 A;  1TK0 B;  2O7K A;  1GTB A;  1XZO A;  3HJO A;  2C0G A;  2VO4 A;  2DIY A;  4F0B A;  1M7T A;  3GRX A;  2FWE A;  2O89 A;  2GZY A;  3BOA A;  4TR1 A;  3L0H A;  3G7I A;  2CQ9 A;  3BCI A;  3VWV A;  2P5R A;  3BBY A;  3UJ1 A;  2CX3 A;  4O7H A;  4ZBD A;  3TRQ A;  1Q98 A;  6GSY A;  1RQM A;  1TRW A;  2PU9 C;  1FHE A;  2H74 A;  5KN2 A;  1ZOF A;  4MZB A;  1VRS D;  4MJC A;  2V1M A;  3GNJ A;  4ZBA A;  3CTF A;  2HZE A;  2I3Y A;  1GLP A;  1AAZ A;  3HY2 A;  5H5Q A;  4BVY A;  4GTU A;  2AYT A;  1TI3 A;  5D96 A;  3KMN A;  3D21 A;  3UL3 A;  2GZP A;  1TK8 B;  1V58 A;  4CY6 A;  3GSS A;  1K0M A;  2I81 A;  1BYE A;  2IWT A;  3E3E A;  1H4O A;  1SKS B;  5CRG A;  2PMT A;  3F8U A;  3ZVJ A;  4ZIJ A;  3DXB A;  2H70 A;  3FK8 A;  1T4Y A;  3DVX A;  4V1A p;  3P7X A;  3BJ5 A;  2RUE A;  4OWY A;  1AC1 A;  1YEP A;  1AW9 A;  2NTO A;  5D8I A;  4EUY A;  1YJ6 A;  4F82 A;  3HYP A;  3H93 A;  1J08 A;  1GNW A;  3FW2 A;  2X8G A;  3EMX A;  3KH9 A;  4ZL9 A;  2IJY A;  1Y6E A;  1PGT A;  2VLV A;  4JE1 A;  4OO5 A;  1ERW A;  4AGS A;  4K6X A;  4PNG A;  4K8M A;  4ML6 A;  3QCP A;  1OC8 A;  2CAQ A;  2R3X A;  4FYB A;  4N30 A;  3VPT A;  4MJB A;  2IMF A;  2P0G A;  1UVZ A;  4LLR A;  3VPQ A;  5DVB A;  5IIZ A;  2PPT A;  3WT1 A;  2VM2 A;  4NHZ A;  1ST9 A;  3M1G A;  4ULX A;  3HKR A;  4TXO A;  1SKR B;  1FB0 A;  4KCE A;  1SJZ A;  3TJJ A;  4MLY A;  1F3A A;  4BWQ A;  1R7H A;  1K0N A;  2XBQ A;  5ECQ B;  1Z5Y E;  5HFG A;  3IR4 A;  3F0I A;  2YJ7 A;  3GH6 A;  2X4A A;  1ABA A;  1O73 A;  5IMD A;  1NSW A;  2VCX A;  1CQG A;  1PKW A;  3CBU A;  3A2V A;  4WBJ A;  4FH8 A;  1A2L A;  2FLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...