3EU3A

Crystal structure of bdbd from bacillus subtilis (reduced)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
186
structure length
186
Chain Sequence
NDAVSGQPSIKGQPVLGKDDAPVTVVEFGDYKCPSCKVFNSDIFPKIQKDFIDKGDVKFSFVNVMFHGKGSRLAALASEEVWKEDPDSFWDFHEKLFEKQPDTEQEWVTPGLLGDLAKSTTKIKPETLKENLDKETFASQVEKDSDLNQKMNIQATPTIYVNDKVIKNFADYDEIKETIEKELKGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords BdbD
publication title Crystal Structure and Biophysical Properties of Bacillus subtilis BdbD: AN OXIDIZING THIOL:DISULFIDE OXIDOREDUCTASE CONTAINING A NOVEL METAL SITE
pubmed doi rcsb
source organism Bacillus subtilis
total genus 71
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2008-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3eu3A00
5D9VA 2RUEA 4RI6A 1PRXA 3BD2A 1H4OA 3ERGA 5F0GA 2X64A 1W89A 1GSQA 4G2EA 3CBUA 4ACSA 2CVBA 2IIYA 2LJAA 5ECPB 3G7IA 3I6AA 2K8VA 1AAZA 3ZVJA 4F2IA 2IMEA 3F6DA 1UC7A 3UMAA 3BCKA 2I1UA 5G5FA 3ZL5A 2YJHA 1DE1A 1WJKA 1TI3A 17GSA 3VWVA 3GMFA 3DGQA 2FHEA 2C0FA 1ML6A 3F3QA 4BVYA 1J9BA 2ES7A 3LFLA 2H6ZA 4WXTA 1GNWA 1GSDA 5J9BA 2O7KA 2PMTA 2B7JA 2ALBA 3N9JA 2WFCA 3HZ8A 3UL3A 3LXZA 5G31A 2RLIA 5IOWA 4EKZA 1PD21 4MZBA 5IMCA 5ECHB 11GSA 2X8HA 2FUG2 2ZCTA 4K7NA 4HUAA 5ID2A 4MH2A 4K7IA 3ZFBA 1K0AA 1X0RA 2FWFA 2VCXA 4HEA2 1XVQA 1E2YA 3NOFA 5D73A 4I6XA 4HZ2A 1GSFA 4IJ3A 1TK5B 2LTKA 2YP6A 2C0DA 1XOBA 4ZILA 3VWUA 3QDNA 5CAXA 2MZCA 1EOHA 2YV9A 3HHVA 1PSQA 2HLSA 2A2SA 3VPTA 2FA8A 2NBSA 1JFUA 4G19A 4PUFC 1SYRA 3J7Yb 5D93A 4IQAA 1BAYA 1R5PA 4J57E 5IO2A 2YV7A 3MDKA 1M9BA 1F2EA 4V2MA 2PN8A 5ID2B 4TN8A 3DRNA 2LQQA 1H75A 2V6OA 3HD5A 1MDJA 4MLYA 4EC0A 1XIYA 3FHKA 2CAQA 4OO4A 4E8EA 4PURA 1FVKA 5DALA 1U3AA 1AQXA 3TKSC 5HQPA 4ZXGA 4PNFA 1PL2A 1QMVA 3UBLA 5CRHA 3IC4A 4JE1A 5HR1A 4PNGA 16GSA 1ON4A 3LEFA 2JACA 5F06A 3GN3A 4NXIA 5G30A 5ECOB 4L5OA 4KB3A 2OADA 4KCAA 3APSA 1YEXA 2DJ1A 3TRPA 2K18A 2NTOA 2O87A 3O3TA 5JCGA 4V2LA 4OFNA 5J41A 1YF1A 1OC8A 2H0HA 2R3XA 2JSYA 4TR1B 4GSSA 3BCIA 2CQ9A 2G0FA 1GRXA 3N5OA 4KUNA 3WYWA 1Z7PA 2R2JA 2JSZA 3UJ1A 1EP7A 2F3MA 22GSA 1R26A 1MD4A 3NZNA 4LMWA 5DALB 2F51A 1GH2A 3FK8A 1SK0A 2GQKA 1A2LA 2YZHA 5AISA 5DJMA 2YWNA 1VGLA 5IM9A 2R4VA 1OVNA 2PGTA 3LORA 4N0VA 4RQRA 3E0UA 1ZZYA 2IMKA 3H8QA 5HFIA 2HXKA 4KH7A 2PBJA 2OKAA 4ZL8A 1ZMAA 3HVXA 3UARA 3IHQA 5B7CA 2C8UA 2P31A 1Q4JA 2G2QA 4OCEA 3HVVA 1OE8A 2RIIA 4JRRA 4JR6A 1FO5A 4FH8A 2ON5A 19GSA 3ME8A 1XPVA 2JU5A 4KA0A 5DCHA 2H66A 3F4TA 1AIUA 3FYGA 1O73A 3IK9A 3EWLA 1ST9A 2L4CA 1TRWA 3US3A 1OKTA 12GSA 4BVXA 1G6YA 1O6JA 1XW5A 2J9HA 1F6MC 1SD9A 1SJZA 5EL8A 2OA7A 2YANA 1FB6A 4O32A 1EWXA 2EIRA 2GZZA 1EP8A 2PPTA 2AAWA 2V1MA 1OE7A 1I9DA 5GSTA 3MWHA 1RK4A 5IMFA 1C72A 1SKRB 2B3SA 4JR4A 6GSUA 3C73A 2E0QA 8GSSA 2M80A 2JZRA 3O76A 5CP1A 5CYYA 1WMJA 4ZBAA 2H76A 3PH9A 4PXOA 3FY7A 1F3BA 4WF5A 5B6NA 2WULA 2VL2A 1K0MA 3LG6A 3FZ5A 2PWJA 1FG4A 1Z5YE 3EVIA 3I9V2 1HD2A 3H4KA 3GKXA 2L6CA 3QAGA 2L59A 3RDWA 4YQUA 4PGTA 2Z9SA 1ZOFA 5B8BA 4D73A 3EYTA 2CX4A 3ZMKA 4LMVA 3ERFA 3TKSE 3KM6A 3IE3A 3R2QA 5L71A 3CMIA 3MSZA 1SK2A 5ECSA 4IKHA 4DSSA 4F9ZA 2LSTA 2TRCP 2I4AA 2VL2C 3MAKA 1PQNA 3M9KA 4NHWA 2XPDA 5HR0A 1V57A 1VF2A 3DEXA 1T7PB 4L5LA 1EGOA 3UAPA 4LL4B 2LEGA 1VF1A 1NW2A 2H73A 3G9BA 3I43A 4XS6A 3L9UA 4AJ6A 4MP4A 5A4UA 5J5NA 1ZYQB 1FVJA 3TB2A 1YY7A 2N5FA 2ZNMA 3A2XA 5CRDA 2JL4A 5KN3A 5DQSA 1TI1A 1DUGA 3M0FA 1JZDA 1ZGNA 4TXVA 4D73B 1XW9A 3L9VA 3C71A 2VD0A 3GUSA 4OCFA 1GTUA 4TXOA 5G1KA 3L0HA 5JCWA 2H0IA 2YNXA 1DBYA 1O8XA 4OWYA 2YPMA 2MMOA 5HFGA 1XWBA 2I3YA 4DSSB 2AV4A 4ULXA 2O8VB 2MMZA 1RW1A 3IOSA 1TKDB 4TOPA 4XCSA 4WF4A 2WGRA 4F0CA 3D6IA 2GVPA 1THXA 1A24A 5IQYA 20GSA 4HOJA 1MEKA 3APQA 3VWXA 2XC2A 1A2JA 4IJIA 3TJFA 4K6XA 2YZUA 1TRUA 18GSA 2WRTA 2L57A 4IW9A 4ZB9A 3A2WA 1SL0B 2VIMA 4FYCA 3HZ4A 3QOUA 4KGIA 2AUVA 2DIYA 1AW9A 1PX7A 3C1RA 2F8FA 4ECIA 4V1Ag 4TXOB 4TR3A 1OAZA 1M2DA 4AF2A 2LKUA 2P5QA 1OYJA 1XWKA 4MZCA 5FHIA 3EE2A 1Z3EA 3BOAA 3KXOA 3VK9A 1GP1A 3FR3A 2V2GA 3GH6A 2IMFA 3CRTA 1ERUA 5D9XA 1TOFA 5IOXA 4ZBBA 1JZOA 3ZTLA 2LJKA 3PGTA 2GS3A 1XWAA 5C00A 2VCZA 4DEJA 1TJDA 3QAVA 5JCUA 1XW6A 5D9WA 2QGVA 4IN0A 2IPAA 4IP6A 3F9UA 3IK7A 4YQVA 3DXBA 1ACVA 1ERTA 3G7JA 3GX0A 3QAWA 1CQHA 4XIHA 5J4UA 3O6TA 2N5BA 4GSTA 3TJBA 1T4ZA 2OJLA 3GSTA 1YJ6A 3Q6OA 2B5EA 1M99A 2HRNA 3EU3A 4ML6A 4RI7A 3GH9A 1QXHA 1AC1A 3ZFLA 3UBKA 2WDUA 2R6KA 1XCCA 3KD0A 1TRSA 4CHSA 4MF6A 3IRAA 2KP2A 5IIZA 2MYGA 3RPNA 4TKYA 1SK1A 2FWHA 4GRFA 1PKWA 1T8EB 4KX4A 2P5RA 2DC5A 2CVDA 4GF0A 2H70A 2BTOT 3M9JA 5GAPD 1NSWA 2XBQA 5G5EA 1ERWA 1G6WA 4YAVA 3A2VA 1Z6NA 2DJ3A 1GULA 2VL3A 3QPMA 2DBCA 2LRNA 2X8GA 3UVHA 1TXXA 2FNOA 1GUHA 3M1GA 2IMIA 3TKSA 1XBSA 4I97A 4ZBDA 3TKQA 2HZEA 2IN3A 1UVZA 1GL8A 2FA4A 3D21A 1QGVA 3ZREA 2HNLA 2LRCA 3GKKA 3GA4A 3GIXA 4KAEA 5IMZA 4POBA 3K8NA 1G0TA 1GSYA 1K3LA 3LXTA 5DVBA 6GSXA 1E6BA 1SENA 3CRUA 4O5RA 3Q19A 1EGRA 4TR1A 3D22A 2LJRA 1YKAA 3I69A 2VCTA 5F8BA 5EY6A 2L4QA 1THOA 1A0RP 2F8AA 1W4VA 4BA7A 2TRXA 2XHFA 3VWWA 3DD3A 3SBCA 1A8YA 5KN2A 4CDOA 2H1BA 2CV4A 1MD3A 1T00A 4XS1A 3F6FA 2XPEA 2IJYA 2H01A 1NM3A 4EVMA 3L78A 2QSIA 1BX9A 1ERVA 3M3MA 1KBNA 10GSA 3P90A 4QL7A 2HZEB 3PR8A 2LRTA 3GHAA 2R5GA 4YQMA 5CREA 4O7HA 1YF0A 2KOKA 4I2TA 1J0FA 1V58A 1QFNA 2H6XA 2HSHA 1YDKA 2REMA 4HDEA 4POMA 1A8LA 4KSOA 1B8XA 1USBA 2V32A 4KNDA 2VM2A 4EDZA 5INYA 1HQOA 4TW5A 3ZRDA 1O85A 3ME7A 2VCVA 3HYPA 1U3IA 2B7KA 4KDUA 4PQ1A 4IP1A 2MBTA 2A2RA 1B9YC 1URMA 4MJBA 3KMNA 4K2DA 1S3DA 5F07A 5G1LA 1V2AA 2HZFA 2MMNA 2H30A 2OE1A 1X9WB 1YZXA 2H6YA 1X5DA 3IV4A 2I81A 4IS0A 2C3QA 2GT5A 1GWCA 5ECLB 1B9XC 3GTUA 1WWJA 3TJGA 3KGKA 1I5GA 1K0BA 1U88A 1XFLA 2YWIA 4MPFA 4Q5NA 5C04A 3QD9A 4L0UA 1G7EA 4TRXA 3KEBA 4ILFA 5COHA 2JZTA 3CSHA 5H5SA 4DVCA 5ABRA 4OMVA 1VF3A 1HNAA 3FW2A 4GLTA 3GRXA 1MDKA 1B4PA 2RM6A 1VRSD 4HQZA 5IPGA 1AUCA 4G9HA 2DJJA 3D0ZA 5EVOA 4N11A 5DCGA 1Y6EA 1ZL9A 1GUMA 1N8JA 3TJKA 1EEJA 1TU7A 4BWQA 4MJAA 1O8WA 1FHEA 2E2GA 3QCPA 4GQFA 3A5WA 5A5KA 4ID0A 3GTUB 1SKSB 3L9SA 2VCWA 2B1LA 3JCML 6GSSA 4MF7A 4K0GA 2YCDA 1X9SB 2E2MA 2GQMA 5H5RA 2J23A 3BJ5A 1WIKA 2HE3A 2CZ2A 4BWSA 3ISOA 2AYTA 3C1SA 3KP9A 2OBKA 3G7YA 5EPFA 3DVWA 1XXUA 1GTIA 3F63A 5KEJA 2V41A 1SJ6A 4QQ7A 3V1WA 3UEMA 4KW6A 1HNBA 2C3TA 3LJRA 2M46A 3P7XA 3VFIA 4FYUA 1WP0A 3QFBC 4WBRD 2F9SA 4OO5A 3LYKA 1PX6A 1X9MB 2PUKC 1BQ7A 4H86A 4Q5QA 3WGEA 1EEMA 2JZSA 3FR6A 2PVQA 3EINA 3RHBA 5LD0A 1NHOA 1EV9A 3HXSA 1BG5A 3LSZA 5G2ZA 4IVFA 4HQSA 2DLXA 4RUVA 4K7OA 2WS2A 4TR4A 1EV4A 1V9WA 4EF0A 2VOCA 2WJUA 1SJIA 3KIJA 5LNKe 1GLQA 2QC7A 4RQXA 3HJMA 3IA1A 5AN1A 3IXRA 3ZZXA 2CA8A 2FWEA 4WKWA 2P0GA 1LU4A 5E59A 5ECMB 1Q98A 3D5JA 1ABAA 5AIVA 1DE2A 4WR4A 2GQLA 2AHEA 2ON7A 3KH9A 3W6GA 2H0GA 2BJXA 3UOMA 2KLXA 13GSA 1WOUA 2DJ0A 3ED3A 4XHMA 1KNGA 1U87A 1TP9A 1S3AA 14GSA 2JADA 1K0DA 2PVOC 4I5QA 2GT6A 2FLSA 4EO3A 2QKEA 3CXGA 1FOVA 4MDCA 1FB0A 3KZQA 2OE0A 4JEDA 1YQ1A 4F82A 4PX1A 1JHBA 2HYXA 3H79A 4EXJA 3TKRA 1RQMA 1TRVA 1KEBA 1K0NA 3TJJA 2FCHA 4OFMA 2V6KA 3EMXA 3DYRA 4NAXA 4NWYA 2BMXA 3TDGA 2VCQA 3DKSA 1SL1B 2CAIA 2H1GA 4YH2A 4MPGA 2H72A 4EUYA 1Z6MA 1EZKA 1QUWA 2HT9A 1LJRA 2N5AA 4X0XA 4ZL7A 4HI7A 5GZZB 4MJCA 1AXDA 2GSQA 3IAM2 5JWRB 2DJKA 3TKPA 5HR2A 5KN1A 4L8EA 2EIQA 5ECNB 4GSNA 3DMLA 2E7PA 3FRCA 1JZWA 4MK3A 3Q18A 2KHPA 3GL5A 1TDIA 4AGSA 1UA5A 1N2AA 1XWGA 2FY6A 5H5QA 3VLNA 1OC3A 3FEUA 3P8WA 3A3TA 5DAKA 1ZCPA 3QMXA 3D4TA 2C0EA 4FO5A 2CZ3A 1F9MA 4ML1A 3TOTA 6GSWA 2B1KA 1F3AA 2RUFA 2C1YA 2H19A 4JZQA 5ENUA 1LBKA 4WETA 3CYNA 3WGXA 2MMAA 2H8LA 4HZ4A 4MF5A 1GSSA 2B6MA 3H1NA 3FZAA 2FGXA 4KDYA 4QL9A 3VI7A 3D4MA 1M2AA 2NVLA 5HFKA 4YAPA 4K8MA 4L0WA 3APOA 3ZIJA 3PINA 5LCZA 2C0GA 2LNTA 4K0NA 3IR4A 3GKNA 2OBIA 1ZYEA 2VL9A 1BJXA 4N30A 1JLVA 1SD8A 4EDYA 1O7UA 5CO3A 1M2BA 3ERWA 4GTUA 3DIEA 1XZOA 5DAKB 2GZPA 1FW1A 4EE0A 1T3BA 5A4VA 5J9CA 1SKWB 4IHUA 2X99A 4ZB6A 3FZ4A 4FIWA 4I2UA 2R37A 2H75A 2K8SA 2M72A 2PERA 3KMOA 4DSRA 2O89A 1K3YA 2WB9A 4J2FA 2FWGA 4KDXA 3GV1A 4F0BA 2EC4A 1M9AA 4LA1A 3E9JB 1R4WA 2DMLA 4NMUA 4XS4A 4WBJA 4J56E 4DSQA 2CX3A 2K9FA 2PU9C 3U6VA 2AJQB 1V40A 2VD1A 4ZL9A 2YOIA 4PQIA 3ZVJD 4MH3A 3ZITA 3WD6A 1K0OA 1DSBA 1OKDA 4CW9A 3S9FA 1WE0A 2B5YA 3U5RE 4E8HA 3CTGA 1ILOA 2TIRA 2IMDA 3IPZA 3TUEA 4BL7A 3GNJA 4OD7A 2VO4A 5GSSA 4G10A 1GLPA 1A0FA 2L5OA 1PA3A 5JWQB 3KTBA 4GWRA 4XTSA 1OC9A 4IBPA 4LLRA 4I8BA 3FKFA 1Z9HA 4MA9A 6GSVA 3J7Yk 4P3YB 4TVEA 2HSYA 2VLUA 2GDRA 2X8CA 4EL1A 2VAFA 2K6VA 3WT1A 3HA9A 5D96A 3TRQA 4XS4B 3UVTA 4K9ZA 4X1UA 1G7OA 1AQVA 2HFDA 3P2AA 4IQ1A 3HJPA 2WCIA 4V2NA 5IMVA 1PKZA 2GSTA 3ZYWA 1TU8A 5ECQB 5ELGA 3VURA 2A4VA 3GFKA 3W8SA 2DMMA 3TGZA 6GSTA 2C3NA 3KTLA 1TK8B 3F4RA 3LQ7A 4IELA 4JBBA 3E3EA 1OC9B 2VUPA 2GSSA 4HU7A 1WPIA 2AB6A 2O85A 2EIOA 3ZMLA 1A2MA 1FAAA 3FZ9A 1GUKA 3IDVA 5IPHA 2YWOA 1GNEA 5DBQA 3F4SA 3TCOA 3GYKA 5DQYA 5CRGA 3HCZA 2CT6A 3WT2A 1PMTA 2GTUA 1WRYA 3FR9A 3HY2A 4HJ2A 4OFTA 4AJ7A 4PQHA 3GURA 4V1Ap 4GQCA 2LV3A 1V98A 2GGTA 1PGTA 2ZUPA 3TRXA 2IWTA 2NDOA 3WGDA 4IGJA 5A4WA 3CSIA 5ELAA 7GSSA 2CVKA 5E4WA 3CSJA 5CNWA 1UN2A 5JWOB 2H71A 6GSYA 2YWMA 2LNSA 1M7TA 4POKA 5DJLA 3W8JA 1MDIA 3Q74A 4MABA 1T1VA 5DDLA 2DJ2A 1SU9A 4XRDA 1K0CA 3KH7A 5AGYA 3ZIVA 3LGCA 4MCUA 4K1FA 2OACA 4AJ8A 3EC3A 3UIWA 5HR3A 3BBYA 1IYIA 3OR5A 1GSUA 1MTCA 3HDCA 1TK0B 1VF4A 3HVSA 1Z7RA 1TTZA 5ECIB 5FWGA 1XOAA 4KSMA 3TOUA 2OE3A 3GX8A 2H1AA 2VLVA 1HYUA 2D2ZA 1K3OA 3F0IA 1XVWA 3EURA 4ECJA 4XRAA 4MMMA 2GZYA 2L5LA 3C8EA 2DSAA 1GSEA 5IMAA 1YKCA 2KP1A 3KCMA 3RHCA 1R5AA 2IFQA 2WZ9A 4WEYA 2VLTA 1M0UA 1B48A 3C7MA 4HU9A 3SWLA 5F05A 2HRFA 3CTFA 1T4YA 2VM1A 3LWAA 1SYXA 2H74A 3RPPA 1GTBA 4ISDA 5J3RA 4Q5RA 1EOGA 2NPBA 3GL3A 5ECRB 2L6DA 4HJMA 1QQ2A 4POLA 3RBTA 5IMDA 2B5XA 2GSRA 9GSSA 2LS5A 1JLWA 4X43A 2XBIA 3H93A 1S3CA 2YJ7A 1JZRA 4N10A 3M8NA 5B8AA 2GLRA 4GXZA 5FT3A 4MJEA 4F03A 2C4JA 2MBSA 3VPQA 1Y25A 3KP8A 4FYBA 3IAS2 2IFQB 4MZWA 2I9HA 1F37A 3DVXA 3F3RA 4KE3A 3HJOA 5IO0A 5GAND 1GTAA 1BEDA 1XWCA 3AY8A 5B6MA 4BPYA 1X5EA 3EMPA 1BYEA 3GKMA 2FD3A 4ECBA 3L4NA 3HKRA 4Z7XA 2C80A 3F8UA 2RM5A 1J08A 3QR6A 5KN0A 1KTEA 2IL3A 1NHYA 1R7HA 3ZLPA 1U6TA 3LYPA 3DWVA 5CRWA 4WR5A 1CQGA 3EU4A 1AQWA 2H1DA 3RAZA 4HS1A 4ECCA 3MNGA 2LUSA 5D9TA 4KCEA 2KUCA 3QFAC 3NIVA 4ZB8A 1X5CA 4NV5A 4LL1B 1TW9A 4NPBA 4PUAA 2HI7A 1O81A 3KJYA 2YN1A 4GCIA 4NHZA 1PL1A 1A23A 1QK8A 1YEPA 4O92A 3IBHA 2LQOA 3VI5A 4N0ZA 5ECKB 1IYHA 1B4QA 3GSSA 4ZIJA 1PN9A 5D8IA 4JU5A 4Q5FA 5AIXA 4NV2A 2DIZA 1SL2B 4TR0A 1HNCA
chains in the Genus database with same CATH superfamily
5D9VA 2RUEA 4RI6A 1PRXA 3BD2A 1H4OA 3ERGA 5F0GA 2X64A 1W89A 1GSQA 4G2EA 3CBUA 4ACSA 2CVBA 2IIYA 2LJAA 5ECPB 3G7IA 3I6AA 2K8VA 1AAZA 3ZVJA 4F2IA 2IMEA 3F6DA 1UC7A 3UMAA 3BCKA 1M3IA 2I1UA 5G5FA 3ZL5A 2YJHA 1DE1A 1WJKA 1TI3A 17GSA 3VWVA 4CY8A 3GMFA 3DGQA 2FHEA 2C0FA 1ML6A 3F3QA 4BVYA 1J9BA 2ES7A 3LFLA 2H6ZA 4WXTA 1GNWA 1GSDA 5J9BA 2O7KA 2PMTA 2B7JA 2ALBA 3N9JA 2WFCA 3HZ8A 2HRKA 3UL3A 3LXZA 5G31A 2RLIA 5IOWA 4EKZA 1PD21 4MZBA 5IMCA 5ECHB 11GSA 2X8HA 2FUG2 2ZCTA 4K7NA 4HUAA 5ID2A 4MH2A 4K7IA 3ZFBA 1K0AA 1X0RA 2FWFA 2VCXA 4HEA2 1XVQA 1E2YA 3NOFA 5D73A 4I6XA 2HRAA 4HZ2A 1GSFA 4IJ3A 1TK5B 2LTKA 2YP6A 2C0DA 1XOBA 4ZILA 3VWUA 3QDNA 5CAXA 2MZCA 1EOHA 2YV9A 3HHVA 1PSQA 2HLSA 3IC8A 2A2SA 3VPTA 2FA8A 2NBSA 1JFUA 4G19A 4PUFC 1SYRA 3J7Yb 5D93A 4IQAA 1BAYA 1R5PA 4J57E 5IO2A 2YV7A 4FQUA 3MDKA 1M9BA 1F2EA 4V2MA 2PN8A 5ID2B 4TN8A 3DRNA 2LQQA 1H75A 2V6OA 3HD5A 1MDJA 4MLYA 4EC0A 1XIYA 3FHKA 2CAQA 4OO4A 4E8EA 4PURA 1FVKA 5DALA 1U3AA 1AQXA 3TKSC 5HQPA 4ZXGA 4PNFA 1PL2A 1QMVA 3UBLA 5CRHA 4Z2TA 3IC4A 4JE1A 5HR1A 4PNGA 16GSA 1ON4A 3LEFA 2JACA 5F06A 3GN3A 4NXIA 5G30A 5ECOB 4L5OA 4KB3A 2OADA 4KCAA 3APSA 1YEXA 2DJ1A 3TRPA 2K18A 2NTOA 2O87A 3O3TA 5JCGA 4V2LA 4OFNA 5J41A 1YF1A 1OC8A 3MYDA 2H0HA 2R3XA 2JSYA 4TR1B 4GSSA 3BCIA 2CQ9A 2G0FA 1GRXA 3N5OA 4KUNA 3WYWA 1Z7PA 2R2JA 2JSZA 3UJ1A 1EP7A 2F3MA 22GSA 1R26A 1MD4A 3NZNA 4LMWA 5DALB 2F51A 1GH2A 3FK8A 1SK0A 2GQKA 1A2LA 2YZHA 5AISA 5DJMA 2YWNA 1VGLA 5IM9A 2R4VA 1OVNA 2PGTA 3LORA 4N0VA 4RQRA 3E0UA 1ZZYA 2IMKA 3H8QA 5HFIA 2HXKA 4KH7A 2PBJA 1S3RA 2OKAA 4ZL8A 1ZMAA 4YKFA 3HVXA 3UARA 3IHQA 5B7CA 2C8UA 2P31A 1Q4JA 2G2QA 4OCEA 3HVVA 1OE8A 3CQFA 2RIIA 4JRRA 4JR6A 1FO5A 4FH8A 2ON5A 19GSA 3ME8A 1XPVA 2JU5A 4KA0A 5DCHA 2H66A 3F4TA 1AIUA 3FYGA 1O73A 3IK9A 3EWLA 1ST9A 4BIKA 2L4CA 1TRWA 3US3A 1OKTA 12GSA 4BVXA 1G6YA 1O6JA 1XW5A 2J9HA 1F6MC 1SD9A 1SJZA 5EL8A 2OA7A 2YANA 1FB6A 4O32A 1EWXA 2EIRA 2GZZA 1EP8A 2PPTA 2AAWA 2V1MA 1OE7A 1I9DA 5GSTA 3MWHA 1RK4A 5IMFA 1C72A 1SKRB 2B3SA 4JR4A 6GSUA 3C73A 2E0QA 8GSSA 2M80A 2JZRA 3O76A 5CP1A 5CYYA 1WMJA 4ZBAA 2H76A 3PH9A 4PXOA 3FY7A 1F3BA 4WF5A 5B6NA 2WULA 2VL2A 1K0MA 3LG6A 3FZ5A 2PWJA 3LW9A 1FG4A 1Z5YE 3EVIA 3I9V2 1HD2A 3H4KA 1PN0A 3GKXA 2L6CA 3QAGA 4X4JA 2L59A 3RDWA 4YQUA 4PGTA 2Z9SA 4BVXB 1ZOFA 5B8BA 4D73A 3EPTA 3EYTA 2CX4A 3ZMKA 4LMVA 3ERFA 3TKSE 3KM6A 3IE3A 3R2QA 5L71A 3CMIA 3MSZA 1SK2A 5ECSA 4IKHA 4DSSA 4F9ZA 2LSTA 2TRCP 2I4AA 2VL2C 3MAKA 1PQNA 3M9KA 4NHWA 2XPDA 5HR0A 1V57A 1VF2A 3DEXA 1T7PB 4L5LA 1EGOA 3UAPA 4LL4B 2LEGA 1VF1A 1NW2A 2H73A 3G9BA 3I43A 4XS6A 3L9UA 4AJ6A 4MP4A 5A4UA 5J5NA 1ZYQB 1FVJA 3TB2A 1YY7A 2N5FA 2ZNMA 3A2XA 5CRDA 2JL4A 5KN3A 5DQSA 1TI1A 1DUGA 3M0FA 1JZDA 1ZGNA 4TXVA 4D73B 4MNNA 1XW9A 3L9VA 2X4AA 3C71A 2VD0A 3GUSA 4TXOA 1GTUA 4OCFA 5G1KA 3L0HA 5JCWA 2H0IA 2YNXA 1DBYA 1FOHA 1O8XA 4OWYA 2YPMA 2MMOA 5HFGA 1XWBA 2I3YA 4DSSB 2AV4A 4ULXA 2O8VB 2MMZA 1RW1A 3IOSA 1TKDB 4TOPA 4XCSA 4WF4A 2WGRA 4F0CA 3PPUA 3D6IA 2GVPA 1THXA 2R0PA 1A24A 5IQYA 20GSA 4HOJA 1MEKA 3APQA 3VWXA 2XC2A 1A2JA 4IJIA 3TJFA 4K6XA 2YZUA 1TRUA 18GSA 2WRTA 2L57A 4IW9A 4ZB9A 3A2WA 1SL0B 2VIMA 4FYCA 3HZ4A 3QOUA 4KGIA 2AUVA 2DIYA 3FMWA 1AW9A 1PX7A 3C1RA 2F8FA 4ECIA 4V1Ag 4TXOB 4TR3A 1OAZA 1M2DA 4AF2A 2LKUA 2R0GA 2P5QA 1OYJA 1XWKA 4MZCA 5FHIA 3EE2A 1Z3EA 3BOAA 3KXOA 3VK9A 1GP1A 3FR3A 2V2GA 3GH6A 4G0KA 2IMFA 3CRTA 1ERUA 5D9XA 1TOFA 5IOXA 4ZBBA 4Z2UA 1JZOA 3ZTLA 2LJKA 3PGTA 2GS3A 1XWAA 5C00A 2VCZA 4DEJA 1TJDA 3QAVA 5JCUA 1XW6A 5D9WA 2QGVA 4IN0A 2IPAA 4IP6A 3F9UA 3IK7A 4YQVA 3DXBA 1ACVA 1ERTA 3G7JA 3GX0A 3QAWA 1CQHA 4XIHA 5J4UA 3O6TA 2N5BA 4GSTA 3TJBA 1T4ZA 2OJLA 3GSTA 1YJ6A 3Q6OA 2B5EA 1M99A 2HRNA 3EU3A 4ML6A 4RI7A 3GH9A 1QXHA 1AC1A 3ZFLA 3UBKA 2WDUA 2R6KA 1XCCA 2DKHA 3KD0A 1TRSA 4CHSA 4MF6A 3IRAA 2KP2A 5IIZA 2MYGA 3RPNA 4TKYA 1SK1A 2FWHA 4GRFA 1PKWA 1T8EB 4KX4A 2P5RA 2DC5A 2CVDA 4GF0A 5BMUA 2H70A 2BTOT 3M9JA 5GAPD 1NSWA 2XBQA 5G5EA 1ERWA 1G6WA 4YAVA 3A2VA 1Z6NA 2DJ3A 1GULA 2VL3A 3QPMA 2DBCA 2LRNA 2X8GA 3UVHA 1TXXA 2FNOA 1GUHA 3M1GA 2IMIA 3TKSA 1XBSA 4I97A 4ZBDA 3TKQA 2HZEA 2IN3A 1UVZA 1GL8A 2FA4A 3D21A 1QGVA 3ZREA 2HNLA 2LRCA 3GKKA 3GA4A 3GIXA 4KAEA 5IMZA 4POBA 3K8NA 1G0TA 1GSYA 1K3LA 3LXTA 4O5QA 5DVBA 6GSXA 1E6BA 1SENA 3CRUA 4O5RA 3Q19A 1EGRA 4TR1A 3D22A 2LJRA 1YKAA 3I69A 2VCTA 5F8BA 5EY6A 2L4QA 1THOA 1A0RP 2F8AA 1W4VA 4BA7A 2TRXA 2XHFA 3VWWA 3DD3A 3SBCA 1A8YA 5KN2A 4CDOA 2H1BA 2CV4A 1MD3A 1T00A 4XS1A 3F6FA 2XPEA 2IJYA 2H01A 1NM3A 4EVMA 3L78A 2QSIA 1BX9A 1ERVA 3M3MA 1KBNA 10GSA 3P90A 4QL7A 2HZEB 3PR8A 2LRTA 3GHAA 2R5GA 4YQMA 5CREA 4O7HA 1YF0A 2KOKA 4I2TA 5BRTA 1J0FA 1V58A 1QFNA 2H6XA 4BL7B 2HSHA 1YDKA 2REMA 4HDEA 4POMA 1A8LA 4KSOA 1B8XA 1USBA 2V32A 4KNDA 2VM2A 4EDZA 5INYA 1HQOA 4TW5A 3ZRDA 1O85A 3ME7A 2VCVA 3HYPA 1U3IA 2B7KA 4KDUA 4PQ1A 4IP1A 2MBTA 2A2RA 4Z2RA 1B9YC 1URMA 4G0IA 3KMNA 4MJBA 4K2DA 1S3DA 5F07A 5G1LA 2A2PA 1V2AA 2HZFA 2MMNA 2H30A 2OE1A 1X9WB 1YZXA 2H6YA 1X5DA 3IV4A 2I81A 4IS0A 2C3QA 2GT5A 1GWCA 5ECLB 1B9XC 2DKIA 3GTUA 1WWJA 3TJGA 3KGKA 1I5GA 1K0BA 1U88A 1XFLA 2YWIA 4MPFA 4Q5NA 5C04A 3QD9A 4L0UA 1G7EA 4TRXA 3KEBA 4ILFA 5COHA 2JZTA 3CSHA 5H5SA 4DVCA 5ABRA 4OMVA 1VF3A 1HNAA 3FW2A 4GLTA 3GRXA 1MDKA 1B4PA 2RM6A 1VRSD 4HQZA 5IPGA 1AUCA 4G9HA 2DJJA 3D0ZA 5EVOA 4N11A 5DCGA 1Y6EA 1ZL9A 1GUMA 1N8JA 4G0LA 3TJKA 1EEJA 1TU7A 4BWQA 4MJAA 1O8WA 1FHEA 2E2GA 3QCPA 4GQFA 3A5WA 5A5KA 4ID0A 3GTUB 1SKSB 3L9SA 2VCWA 2B1LA 3JCML 4A5PA 6GSSA 4MF7A 4K0GA 2YCDA 1X9SB 2E2MA 2GQMA 5H5RA 2J23A 3BJ5A 1WIKA 2HE3A 2CZ2A 4BWSA 3ISOA 2AYTA 3C1SA 3KP9A 2OBKA 3G7YA 5EPFA 3DVWA 1XXUA 1GTIA 3F63A 5KEJA 2V41A 1SJ6A 4QQ7A 3V1WA 3UEMA 4KW6A 1HNBA 2C3TA 3LJRA 2M46A 3P7XA 3VFIA 4FYUA 1WP0A 3QFBC 4WBRD 2F9SA 4O5UA 4OO5A 3LYKA 1PX6A 1X9MB 2PUKC 1BQ7A 4H86A 4Q5QA 3WGEA 1EEMA 2JZSA 3FR6A 2PVQA 3EINA 3RHBA 5LD0A 1NHOA 1EV9A 3HXSA 1BG5A 3LSZA 5G2ZA 4IVFA 4HQSA 2DLXA 4RUVA 4K7OA 2WS2A 4TR4A 2QA2A 1EV4A 1V9WA 4EF0A 2VOCA 2WJUA 1SJIA 3KIJA 5LNKe 1GLQA 2QC7A 4RQXA 3HJMA 3IA1A 5AN1A 3IXRA 3ZZXA 2CA8A 2FWEA 4WKWA 2P0GA 1LU4A 5E59A 5ECMB 1Q98A 3D5JA 1ABAA 5AIVA 1DE2A 4WR4A 2GQLA 2AHEA 2ON7A 3KH9A 3W6GA 2H0GA 2BJXA 3UOMA 2KLXA 13GSA 1WOUA 2DJ0A 2HSMA 3ED3A 4XHMA 1KNGA 1U87A 1TP9A 1S3AA 14GSA 2JADA 1K0DA 2PVOC 4I5QA 2GT6A 2FLSA 4EO3A 2QKEA 3CXGA 1FOVA 4MDCA 1FB0A 3KZQA 2OE0A 4JEDA 1YQ1A 4F82A 4PX1A 1JHBA 2HYXA 3H79A 4EXJA 3TKRA 1RQMA 1TRVA 1KEBA 1K0NA 3TJJA 2FCHA 4OFMA 2V6KA 3EMXA 3DYRA 4NAXA 4NWYA 2BMXA 3TDGA 2VCQA 3DKSA 3IHGA 1SL1B 2CAIA 2H1GA 4YH2A 4MPGA 2H72A 4EUYA 1Z6MA 1EZKA 1QUWA 2HT9A 1LJRA 2N5AA 4X0XA 4ZL7A 4HI7A 5GZZB 4MJCA 1AXDA 2GSQA 3IAM2 5JWRB 2DJKA 3TKPA 5HR2A 5KN1A 4L8EA 2EIQA 4EIQA 5ECNB 4GSNA 3DMLA 2E7PA 3FRCA 1JZWA 4MK3A 3Q18A 2KHPA 3GL5A 1TDIA 4AGSA 1UA5A 1N2AA 1XWGA 2FY6A 5H5QA 3VLNA 1OC3A 3FEUA 3P8WA 3A3TA 5DAKA 1ZCPA 3QMXA 3D4TA 2C0EA 4FO5A 2CZ3A 1F9MA 4ML1A 3TOTA 6GSWA 2B1KA 1F3AA 2RUFA 2C1YA 2H19A 4JZQA 5ENUA 1LBKA 4WETA 3CYNA 3WGXA 2MMAA 2H8LA 4HZ4A 4MF5A 1GSSA 2B6MA 3H1NA 3FZAA 2FGXA 4KDYA 4QL9A 3VI7A 3D4MA 1M2AA 2NVLA 5HFKA 4YAPA 4K8MA 4L0WA 3APOA 3ZIJA 3PINA 5LCZA 2C0GA 2LNTA 4K0NA 3IR4A 3GKNA 2OBIA 1ZYEA 1XG8A 2VL9A 1BJXA 4N30A 1JLVA 1SD8A 4EDYA 1O7UA 5CO3A 1M2BA 3ERWA 4GTUA 3DIEA 1XZOA 5DAKB 2GZPA 1FW1A 4EE0A 1T3BA 5A4VA 5J9CA 1SKWB 4IHUA 2X99A 4ZB6A 3FZ4A 4FIWA 4I2UA 2R37A 2H75A 2K8SA 2M72A 2PERA 3KMOA 4DSRA 2O89A 1K3YA 2WB9A 4J2FA 2FWGA 4KDXA 3GV1A 4F0BA 2EC4A 1M9AA 4LA1A 3E9JB 1R4WA 2DMLA 4NMUA 4XS4A 4WBJA 4J56E 5KOXA 4DSQA 2CX3A 2K9FA 2PU9C 3U6VA 2AJQB 1V40A 2VD1A 4BVYB 4ZL9A 2YOIA 4PQIA 5KOWA 3ZVJD 4MH3A 3ZITA 3WD6A 1K0OA 1DSBA 1OKDA 4CW9A 3S9FA 1WE0A 2B5YA 3U5RE 4E8HA 3CTGA 1ILOA 2TIRA 2IMDA 3IPZA 3TUEA 4BL7A 3GNJA 4OD7A 2VO4A 5GSSA 4G10A 1GLPA 1A0FA 2QA1A 2L5OA 1PA3A 5JWQB 3KTBA 4GWRA 4XTSA 1OC9A 4IBPA 4LLRA 4I8BA 3FKFA 1Z9HA 3A5IA 4MA9A 6GSVA 3J7Yk 4P3YB 4TVEA 2HSYA 2VLUA 2GDRA 2X8CA 4EL1A 2VAFA 2K6VA 3WT1A 3HA9A 5D96A 3TRQA 4XS4B 3UVTA 4K9ZA 4X1UA 1G7OA 1AQVA 2HFDA 3P2AA 3R3EA 4IQ1A 3HJPA 2WCIA 4V2NA 5IMVA 1PKZA 2GSTA 3ZYWA 1TU8A 5ECQB 5ELGA 3VURA 2A4VA 3GFKA 3W8SA 2DMMA 3TGZA 1ZYPA 6GSTA 2C3NA 3KTLA 1TK8B 3F4RA 3LQ7A 4IELA 4JBBA 3E3EA 1OC9B 2VUPA 2GSSA 4HU7A 1WPIA 2AB6A 2O85A 2EIOA 3ZMLA 1A2MA 1FAAA 3FZ9A 1GUKA 3IDVA 5IPHA 2YWOA 1GNEA 5DBQA 3F4SA 3HVNA 3TCOA 3GYKA 4USSA 4EIPA 5DQYA 5CRGA 3HCZA 2CT6A 3WT2A 4YKGA 1PMTA 2GTUA 4K2XA 1WRYA 3FR9A 3HY2A 4HJ2A 4OFTA 4AJ7A 4PQHA 3GURA 4V1Ap 4GQCA 4K5RA 2LV3A 1V98A 2GGTA 1PGTA 2ZUPA 3TRXA 2IWTA 2NDOA 3WGDA 4IGJA 5A4WA 3CSIA 5ELAA 7GSSA 2CVKA 5E4WA 3CSJA 5CNWA 1UN2A 5JWOB 2H71A 6GSYA 2YWMA 2LNSA 1M7TA 4POKA 5DJLA 3W8JA 1MDIA 3Q74A 4MABA 1T1VA 5DDLA 2DJ2A 1SU9A 4XRDA 1K0CA 3KH7A 5AGYA 3ZIVA 3LGCA 4MCUA 4K1FA 1PFOA 2OACA 4AJ8A 3EC3A 3UIWA 5HR3A 3BBYA 1IYIA 3OR5A 1GSUA 1MTCA 3HDCA 1TK0B 1VF4A 3HVSA 1Z7RA 1TTZA 5ECIB 5FWGA 1XOAA 4KSMA 3TOUA 2OE3A 3GX8A 2H1AA 2VLVA 1HYUA 1M3JA 1K3OA 2D2ZA 3F0IA 1XVWA 3EURA 4ECJA 4XRAA 4MMMA 2GZYA 2L5LA 3C8EA 2DSAA 1GSEA 5IMAA 1YKCA 2KP1A 2UZ8A 3KCMA 3RHCA 1R5AA 2IFQA 2WZ9A 4WEYA 2VLTA 1M0UA 1B48A 3C7MA 4HU9A 3SWLA 5F05A 2HRFA 3CTFA 1T4YA 2VM1A 3LWAA 1SYXA 2H74A 3RPPA 1GTBA 4ISDA 5J3RA 4HSCX 4Q5RA 1EOGA 2NPBA 3GL3A 5ECRB 2L6DA 4HJMA 1QQ2A 4POLA 3RBTA 5IMDA 2B5XA 2GSRA 9GSSA 2LS5A 1JLWA 4X43A 2XBIA 3H93A 1S3CA 2YJ7A 1JZRA 4N10A 3M8NA 5B8AA 2R0CA 2GLRA 4GXZA 5FT3A 4MJEA 4F03A 2C4JA 2X49A 2MBSA 4KF9A 3VPQA 1Y25A 3KP8A 4FYBA 3IAS2 2IFQB 4MZWA 2I9HA 1F37A 3DVXA 3F3RA 4KE3A 3HJOA 5IO0A 5GAND 1GTAA 1BEDA 1XWCA 3AY8A 5B6MA 4BPYA 1X5EA 3MIXA 3EMPA 1BYEA 3GKMA 2FD3A 4ECBA 3L4NA 3HKRA 4Z7XA 2C80A 3F8UA 2RM5A 1J08A 3QR6A 5KN0A 1KTEA 2IL3A 4ICYA 1NHYA 1R7HA 3ZLPA 4PTSA 1U6TA 3LYPA 3DWVA 5CRWA 4WR5A 1CQGA 3EU4A 1AQWA 2H1DA 3RAZA 4HS1A 4ECCA 3MNGA 2LUSA 5D9TA 4KCEA 2KUCA 3QFAC 3NIVA 4ZB8A 1X5CA 4K5SA 4NV5A 4LL1B 4CY6A 1TW9A 4NPBA 4PUAA 2A4HA 2HI7A 1O81A 3KJYA 2YN1A 4GCIA 4NHZA 1PL1A 1A23A 1ZYNA 1QK8A 1YEPA 4O92A 3IBHA 2LQOA 3VI5A 4N0ZA 5ECKB 1IYHA 1B4QA 3GSSA 4ZIJA 1PN9A 5D8IA 4JU5A 4Q5FA 5AIXA 4NV2A 2DIZA 1SL2B 4TR0A 1HNCA
chains in the Genus database with same CATH topology
5D9VA 2RUEA 4RI6A 1PRXA 3BD2A 1H4OA 3ERGA 5F0GA 2X64A 1W89A 1GSQA 4G2EA 3CBUA 4ACSA 2CVBA 2IIYA 2LJAA 5ECPB 3G7IA 3I6AA 2K8VA 1AAZA 3ZVJA 4F2IA 2IMEA 3F6DA 1UC7A 3UMAA 3BCKA 2I1UA 5G5FA 3ZL5A 2YJHA 1DE1A 1WJKA 1TI3A 17GSA 3VWVA 4CY8A 3GMFA 3DGQA 2FHEA 2C0FA 1ML6A 3F3QA 4BVYA 1J9BA 2ES7A 3LFLA 2H6ZA 4WXTA 1GNWA 1GSDA 5J9BA 2O7KA 2PMTA 2B7JA 2ALBA 3N9JA 2WFCA 3HZ8A 2HRKA 3UL3A 3LXZA 5G31A 2RLIA 5IOWA 4EKZA 1PD21 4MZBA 5IMCA 5ECHB 11GSA 2X8HA 2FUG2 2ZCTA 4K7NA 4HUAA 5ID2A 4MH2A 4K7IA 3ZFBA 1K0AA 1X0RA 2FWFA 2VCXA 4HEA2 1XVQA 1E2YA 3NOFA 5D73A 4I6XA 2HRAA 4HZ2A 1GSFA 4IJ3A 1TK5B 2LTKA 2YP6A 2C0DA 1XOBA 4ZILA 3VWUA 3QDNA 5CAXA 2MZCA 1EOHA 2YV9A 3HHVA 1PSQA 2HLSA 3IC8A 2A2SA 3VPTA 2FA8A 2NBSA 1JFUA 4G19A 4PUFC 1SYRA 3J7Yb 5D93A 4IQAA 1BAYA 1R5PA 4J57E 5IO2A 2YV7A 4FQUA 3MDKA 1M9BA 1F2EA 4V2MA 2PN8A 5ID2B 4TN8A 3DRNA 2LQQA 1H75A 2V6OA 3HD5A 1MDJA 4MLYA 4EC0A 1XIYA 3FHKA 2CAQA 4OO4A 4E8EA 4PURA 1FVKA 5DALA 1U3AA 1AQXA 3TKSC 5HQPA 4ZXGA 4PNFA 1PL2A 1QMVA 3UBLA 5CRHA 4Z2TA 3IC4A 4JE1A 5HR1A 4PNGA 16GSA 1ON4A 3LEFA 2JACA 5F06A 3GN3A 4NXIA 5G30A 5ECOB 4L5OA 4KB3A 2OADA 4KCAA 3APSA 1YEXA 2DJ1A 3TRPA 2K18A 2NTOA 2O87A 3O3TA 5JCGA 4V2LA 4OFNA 5J41A 1YF1A 1OC8A 3MYDA 2H0HA 2R3XA 2JSYA 4TR1B 4GSSA 3BCIA 2CQ9A 2G0FA 1GRXA 3N5OA 4KUNA 3WYWA 1Z7PA 2R2JA 2JSZA 3UJ1A 1EP7A 2F3MA 22GSA 1R26A 1MD4A 3NZNA 4LMWA 5DALB 2F51A 1GH2A 3FK8A 1SK0A 2GQKA 1A2LA 2YZHA 5AISA 5DJMA 2YWNA 1VGLA 5IM9A 2R4VA 1OVNA 2PGTA 3LORA 4N0VA 4RQRA 3E0UA 1ZZYA 2IMKA 3H8QA 5HFIA 2HXKA 4KH7A 2PBJA 2OKAA 4ZL8A 1ZMAA 4YKFA 3HVXA 3UARA 3IHQA 5B7CA 2C8UA 2P31A 1Q4JA 2G2QA 4OCEA 3HVVA 1OE8A 2RIIA 4JRRA 4JR6A 1FO5A 4FH8A 2ON5A 19GSA 3ME8A 1XPVA 2JU5A 4KA0A 5DCHA 2H66A 3F4TA 1AIUA 3FYGA 1O73A 3IK9A 3EWLA 1ST9A 2L4CA 1TRWA 3US3A 1OKTA 12GSA 4BVXA 1G6YA 1O6JA 1XW5A 2J9HA 1F6MC 1SD9A 1SJZA 5EL8A 2OA7A 2YANA 1FB6A 4O32A 1EWXA 2EIRA 2GZZA 1EP8A 2PPTA 2AAWA 2V1MA 1OE7A 1I9DA 5GSTA 3MWHA 1RK4A 5IMFA 1C72A 1SKRB 2B3SA 4JR4A 6GSUA 3C73A 2E0QA 8GSSA 2M80A 2JZRA 3O76A 5CP1A 5CYYA 1WMJA 4ZBAA 2H76A 3PH9A 4PXOA 3FY7A 1F3BA 4WF5A 5B6NA 2WULA 2VL2A 1K0MA 3LG6A 3FZ5A 2PWJA 3LW9A 1FG4A 1Z5YE 3EVIA 3I9V2 1HD2A 3H4KA 1PN0A 3GKXA 2L6CA 3QAGA 4X4JA 2L59A 3RDWA 4YQUA 4PGTA 2Z9SA 4BVXB 1ZOFA 5B8BA 4D73A 3EPTA 3EYTA 2CX4A 3ZMKA 4LMVA 3ERFA 3TKSE 3KM6A 3IE3A 3R2QA 5L71A 3CMIA 3MSZA 1SK2A 5ECSA 4IKHA 4DSSA 4F9ZA 2LSTA 2TRCP 2I4AA 2VL2C 3MAKA 1PQNA 3M9KA 4NHWA 2XPDA 5HR0A 1V57A 1VF2A 3DEXA 1T7PB 4L5LA 1EGOA 3UAPA 4LL4B 2LEGA 1VF1A 1NW2A 2H73A 3G9BA 3I43A 4XS6A 3L9UA 4AJ6A 4MP4A 5A4UA 5J5NA 1ZYQB 1FVJA 3TB2A 1YY7A 2N5FA 2ZNMA 3A2XA 5CRDA 2JL4A 5KN3A 5DQSA 1TI1A 1DUGA 3M0FA 1JZDA 1ZGNA 4TXVA 4D73B 4MNNA 1XW9A 3L9VA 2X4AA 3C71A 2VD0A 3GUSA 4TXOA 1GTUA 4OCFA 5G1KA 3L0HA 5JCWA 2H0IA 2YNXA 1DBYA 1FOHA 1O8XA 4OWYA 2YPMA 2MMOA 5HFGA 1XWBA 2I3YA 4DSSB 2AV4A 4ULXA 2O8VB 2MMZA 1RW1A 3IOSA 1TKDB 4TOPA 4XCSA 4WF4A 2WGRA 4F0CA 3PPUA 3D6IA 2GVPA 1THXA 2R0PA 1A24A 5IQYA 20GSA 4HOJA 1MEKA 3APQA 3VWXA 2XC2A 1A2JA 4IJIA 3TJFA 4K6XA 2YZUA 1TRUA 18GSA 2WRTA 2L57A 4IW9A 4ZB9A 3A2WA 1SL0B 2VIMA 4FYCA 3HZ4A 3QOUA 4KGIA 2AUVA 2DIYA 3FMWA 1AW9A 1PX7A 3C1RA 2F8FA 4ECIA 4V1Ag 4TXOB 4TR3A 1OAZA 1M2DA 4AF2A 2LKUA 2R0GA 2P5QA 1OYJA 1XWKA 4MZCA 5FHIA 3EE2A 1Z3EA 3BOAA 3KXOA 3VK9A 1GP1A 3FR3A 2V2GA 3GH6A 4G0KA 2IMFA 3CRTA 1ERUA 5D9XA 1TOFA 5IOXA 4ZBBA 4Z2UA 1JZOA 3ZTLA 2LJKA 3PGTA 2GS3A 1XWAA 5C00A 2VCZA 4DEJA 1TJDA 3QAVA 5JCUA 1XW6A 5D9WA 2QGVA 4IN0A 2IPAA 4IP6A 3F9UA 3IK7A 4YQVA 3DXBA 1ACVA 1ERTA 3G7JA 3GX0A 3QAWA 1CQHA 4XIHA 5J4UA 3O6TA 2N5BA 4GSTA 3TJBA 1T4ZA 2OJLA 3GSTA 1YJ6A 3Q6OA 2B5EA 1M99A 2HRNA 3EU3A 4ML6A 4RI7A 3GH9A 1QXHA 1AC1A 3ZFLA 3UBKA 2WDUA 2R6KA 1XCCA 2DKHA 3KD0A 1TRSA 4CHSA 4MF6A 3IRAA 2KP2A 5IIZA 2MYGA 3RPNA 4TKYA 1SK1A 2FWHA 4GRFA 1PKWA 1T8EB 4KX4A 2P5RA 2DC5A 2CVDA 4GF0A 5BMUA 2H70A 2BTOT 3M9JA 5GAPD 1NSWA 2XBQA 5G5EA 1ERWA 1G6WA 4YAVA 3A2VA 1Z6NA 2DJ3A 1GULA 2VL3A 3QPMA 2DBCA 2LRNA 2X8GA 3UVHA 1TXXA 2FNOA 1GUHA 3M1GA 2IMIA 3TKSA 1XBSA 4I97A 4ZBDA 3TKQA 2HZEA 2IN3A 1UVZA 1GL8A 2FA4A 3D21A 1QGVA 3ZREA 2HNLA 2LRCA 3GKKA 3GA4A 3GIXA 4KAEA 5IMZA 4POBA 3K8NA 1G0TA 1GSYA 1K3LA 3LXTA 4O5QA 5DVBA 6GSXA 1E6BA 1SENA 3CRUA 4O5RA 3Q19A 1EGRA 4TR1A 3D22A 2LJRA 1YKAA 3I69A 2VCTA 5F8BA 5EY6A 2L4QA 1THOA 1A0RP 2F8AA 1W4VA 4BA7A 2TRXA 2XHFA 3VWWA 3DD3A 3SBCA 1A8YA 5KN2A 4CDOA 2H1BA 2CV4A 1MD3A 1T00A 4XS1A 3F6FA 2XPEA 2IJYA 2H01A 1NM3A 4EVMA 3L78A 2QSIA 1BX9A 1ERVA 3M3MA 1KBNA 10GSA 3P90A 4QL7A 2HZEB 3PR8A 2LRTA 3GHAA 2R5GA 4YQMA 5CREA 4O7HA 1YF0A 2KOKA 4I2TA 5BRTA 1J0FA 1V58A 1QFNA 2H6XA 4BL7B 2HSHA 1YDKA 2REMA 4HDEA 4POMA 1A8LA 4KSOA 1B8XA 1USBA 2V32A 4KNDA 2VM2A 4EDZA 5INYA 1HQOA 4TW5A 3ZRDA 1O85A 3ME7A 2VCVA 3HYPA 1U3IA 2B7KA 4KDUA 4PQ1A 4IP1A 2MBTA 2A2RA 4Z2RA 1B9YC 1URMA 4G0IA 3KMNA 4MJBA 4K2DA 1S3DA 5F07A 5G1LA 2A2PA 1V2AA 2HZFA 2MMNA 2H30A 2OE1A 1X9WB 1YZXA 2H6YA 1X5DA 3IV4A 2I81A 4IS0A 2C3QA 2GT5A 1GWCA 5ECLB 1B9XC 2DKIA 3GTUA 1WWJA 3TJGA 3KGKA 1I5GA 1K0BA 1U88A 1XFLA 2YWIA 4MPFA 4Q5NA 5C04A 3QD9A 4L0UA 1G7EA 4TRXA 3KEBA 4ILFA 5COHA 2JZTA 3CSHA 5H5SA 4DVCA 5ABRA 4OMVA 1VF3A 1HNAA 3FW2A 4GLTA 3GRXA 1MDKA 1B4PA 2RM6A 1VRSD 4HQZA 5IPGA 1AUCA 4G9HA 2DJJA 3D0ZA 5EVOA 4N11A 5DCGA 1Y6EA 1ZL9A 1GUMA 1N8JA 4G0LA 3TJKA 1EEJA 1TU7A 4BWQA 4MJAA 1O8WA 1FHEA 2E2GA 3QCPA 4GQFA 3A5WA 5A5KA 4ID0A 3GTUB 1SKSB 3L9SA 2VCWA 2B1LA 3JCML 4A5PA 6GSSA 4MF7A 4K0GA 2YCDA 1X9SB 2E2MA 2GQMA 5H5RA 2J23A 3BJ5A 1WIKA 2HE3A 2CZ2A 4BWSA 3ISOA 2AYTA 3C1SA 3KP9A 2OBKA 3G7YA 5EPFA 3DVWA 1XXUA 1GTIA 3F63A 5KEJA 2V41A 1SJ6A 4QQ7A 3V1WA 3UEMA 4KW6A 1HNBA 2C3TA 3LJRA 2M46A 3P7XA 3VFIA 4FYUA 1WP0A 3QFBC 4WBRD 2F9SA 4O5UA 4OO5A 3LYKA 1PX6A 1X9MB 2PUKC 1BQ7A 4H86A 4Q5QA 3WGEA 1EEMA 2JZSA 3FR6A 2PVQA 3EINA 3RHBA 5LD0A 1NHOA 1EV9A 3HXSA 1BG5A 3LSZA 5G2ZA 4IVFA 4HQSA 2DLXA 4RUVA 4K7OA 2WS2A 4TR4A 2QA2A 1EV4A 1V9WA 4EF0A 2VOCA 2WJUA 1SJIA 3KIJA 5LNKe 1GLQA 2QC7A 4RQXA 3HJMA 3IA1A 5AN1A 3IXRA 3ZZXA 2CA8A 2FWEA 4WKWA 2P0GA 1LU4A 5E59A 5ECMB 1Q98A 3D5JA 1ABAA 5AIVA 1DE2A 4WR4A 2GQLA 2AHEA 2ON7A 3KH9A 3W6GA 2H0GA 2BJXA 3UOMA 2KLXA 13GSA 1WOUA 2DJ0A 2HSMA 3ED3A 4XHMA 1KNGA 1U87A 1TP9A 1S3AA 14GSA 2JADA 1K0DA 2PVOC 4I5QA 2GT6A 2FLSA 4EO3A 2QKEA 3CXGA 1FOVA 4MDCA 1FB0A 3KZQA 2OE0A 4JEDA 1YQ1A 4F82A 4PX1A 1JHBA 2HYXA 3H79A 4EXJA 3TKRA 1RQMA 1TRVA 1KEBA 1K0NA 3TJJA 2FCHA 4OFMA 2V6KA 3EMXA 3DYRA 4NAXA 4NWYA 2BMXA 3TDGA 2VCQA 3DKSA 3IHGA 1SL1B 2CAIA 2H1GA 4YH2A 4MPGA 2H72A 4EUYA 1Z6MA 1EZKA 1QUWA 2HT9A 1LJRA 2N5AA 4X0XA 4ZL7A 4HI7A 5GZZB 4MJCA 1AXDA 2GSQA 3IAM2 5JWRB 2DJKA 3TKPA 5HR2A 5KN1A 4L8EA 2EIQA 4EIQA 5ECNB 4GSNA 3DMLA 2E7PA 3FRCA 1JZWA 4MK3A 3Q18A 2KHPA 3GL5A 1TDIA 4AGSA 1UA5A 1N2AA 1XWGA 2FY6A 5H5QA 3VLNA 1OC3A 3FEUA 3P8WA 3A3TA 5DAKA 1ZCPA 3QMXA 3D4TA 2C0EA 4FO5A 2CZ3A 1F9MA 4ML1A 3TOTA 6GSWA 2B1KA 1F3AA 2RUFA 2C1YA 2H19A 4JZQA 5ENUA 1LBKA 4WETA 3CYNA 3WGXA 2MMAA 2H8LA 4HZ4A 4MF5A 1GSSA 2B6MA 3H1NA 3FZAA 2FGXA 4KDYA 4QL9A 3VI7A 3D4MA 1M2AA 2NVLA 5HFKA 4YAPA 4K8MA 4L0WA 3APOA 3ZIJA 3PINA 5LCZA 2C0GA 2LNTA 4K0NA 3IR4A 3GKNA 2OBIA 1ZYEA 2VL9A 1BJXA 4N30A 1JLVA 1SD8A 4EDYA 1O7UA 5CO3A 1M2BA 3ERWA 4GTUA 3DIEA 1XZOA 5DAKB 2GZPA 1FW1A 4EE0A 1T3BA 5A4VA 5J9CA 1SKWB 4IHUA 2X99A 4ZB6A 3FZ4A 4FIWA 4I2UA 2R37A 2H75A 2K8SA 2M72A 2PERA 3KMOA 4DSRA 2O89A 1K3YA 2WB9A 4J2FA 2FWGA 4KDXA 3GV1A 4F0BA 2EC4A 1M9AA 4LA1A 3E9JB 1R4WA 2DMLA 4NMUA 4XS4A 4WBJA 4J56E 5KOXA 4DSQA 2CX3A 2K9FA 2PU9C 3U6VA 2AJQB 1V40A 2VD1A 4BVYB 4ZL9A 2YOIA 4PQIA 5KOWA 3ZVJD 4MH3A 3ZITA 3WD6A 1K0OA 1DSBA 1OKDA 4CW9A 3S9FA 1WE0A 2B5YA 3U5RE 4E8HA 3CTGA 1ILOA 2TIRA 2IMDA 3IPZA 3TUEA 4BL7A 3GNJA 4OD7A 2VO4A 5GSSA 4G10A 1GLPA 1A0FA 2QA1A 2L5OA 1PA3A 5JWQB 3KTBA 4GWRA 4XTSA 1OC9A 4IBPA 4LLRA 4I8BA 3FKFA 1Z9HA 3A5IA 4MA9A 6GSVA 3J7Yk 4P3YB 4TVEA 2HSYA 2VLUA 2GDRA 2X8CA 4EL1A 2VAFA 2K6VA 3WT1A 3HA9A 5D96A 3TRQA 4XS4B 3UVTA 4K9ZA 4X1UA 1G7OA 1AQVA 2HFDA 3P2AA 3R3EA 4IQ1A 3HJPA 2WCIA 4V2NA 5IMVA 1PKZA 2GSTA 3ZYWA 1TU8A 5ECQB 5ELGA 3VURA 2A4VA 3GFKA 3W8SA 2DMMA 3TGZA 1ZYPA 6GSTA 2C3NA 3KTLA 1TK8B 3F4RA 3LQ7A 4IELA 4JBBA 3E3EA 1OC9B 2VUPA 2GSSA 4HU7A 1WPIA 2AB6A 2O85A 2EIOA 3ZMLA 1A2MA 1FAAA 3FZ9A 1GUKA 3IDVA 5IPHA 2YWOA 1GNEA 5DBQA 3F4SA 3TCOA 3GYKA 4USSA 4EIPA 5DQYA 5CRGA 3HCZA 2CT6A 3WT2A 4YKGA 1PMTA 2GTUA 4K2XA 1WRYA 3FR9A 3HY2A 4HJ2A 4OFTA 4AJ7A 4PQHA 3GURA 4V1Ap 4GQCA 4K5RA 2LV3A 1V98A 2GGTA 1PGTA 2ZUPA 3TRXA 2IWTA 2NDOA 3WGDA 4IGJA 5A4WA 3CSIA 5ELAA 7GSSA 2CVKA 5E4WA 3CSJA 5CNWA 1UN2A 5JWOB 2H71A 6GSYA 2YWMA 2LNSA 1M7TA 4POKA 5DJLA 3W8JA 1MDIA 3Q74A 4MABA 1T1VA 5DDLA 2DJ2A 1SU9A 4XRDA 1K0CA 3KH7A 5AGYA 3ZIVA 3LGCA 4MCUA 4K1FA 2OACA 4AJ8A 3EC3A 3UIWA 5HR3A 3BBYA 1IYIA 3OR5A 1GSUA 1MTCA 3HDCA 1TK0B 1VF4A 3HVSA 1Z7RA 1TTZA 5ECIB 5FWGA 1XOAA 4KSMA 3TOUA 2OE3A 3GX8A 2H1AA 2VLVA 1HYUA 2D2ZA 1K3OA 3F0IA 1XVWA 3EURA 4ECJA 4XRAA 4MMMA 2GZYA 2L5LA 3C8EA 2DSAA 1GSEA 5IMAA 1YKCA 2KP1A 2UZ8A 3KCMA 3RHCA 1R5AA 2IFQA 2WZ9A 4WEYA 2VLTA 1M0UA 1B48A 3C7MA 4HU9A 3SWLA 5F05A 2HRFA 3CTFA 1T4YA 2VM1A 3LWAA 1SYXA 2H74A 3RPPA 1GTBA 4ISDA 5J3RA 4Q5RA 1EOGA 2NPBA 3GL3A 5ECRB 2L6DA 4HJMA 1QQ2A 4POLA 3RBTA 5IMDA 2B5XA 2GSRA 9GSSA 2LS5A 1JLWA 4X43A 2XBIA 3H93A 1S3CA 2YJ7A 1JZRA 4N10A 3M8NA 5B8AA 2R0CA 2GLRA 4GXZA 5FT3A 4MJEA 4F03A 2C4JA 2X49A 2MBSA 4KF9A 3VPQA 1Y25A 3KP8A 4FYBA 3IAS2 2IFQB 4MZWA 2I9HA 1F37A 3DVXA 3F3RA 4KE3A 3HJOA 5IO0A 5GAND 1GTAA 1BEDA 1XWCA 3AY8A 5B6MA 4BPYA 1X5EA 3MIXA 3EMPA 1BYEA 3GKMA 2FD3A 4ECBA 3L4NA 3HKRA 4Z7XA 2C80A 3F8UA 2RM5A 1J08A 3QR6A 5KN0A 1KTEA 2IL3A 4ICYA 1NHYA 1R7HA 3ZLPA 4PTSA 1U6TA 3LYPA 3DWVA 5CRWA 4WR5A 1CQGA 3EU4A 1AQWA 2H1DA 3RAZA 4HS1A 4ECCA 3MNGA 2LUSA 5D9TA 4KCEA 2KUCA 3QFAC 3NIVA 4ZB8A 1X5CA 4K5SA 4NV5A 4LL1B 4CY6A 1TW9A 4NPBA 4PUAA 2A4HA 2HI7A 1O81A 3KJYA 2YN1A 4GCIA 4NHZA 1PL1A 1A23A 1ZYNA 1QK8A 1YEPA 4O92A 3IBHA 2LQOA 3VI5A 4N0ZA 5ECKB 1IYHA 1B4QA 3GSSA 4ZIJA 1PN9A 5D8IA 4JU5A 4Q5FA 5AIXA 4NV2A 2DIZA 1SL2B 4TR0A 1HNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D9V A;  2RUE A;  4RI6 A;  1PRX A;  3BD2 A;  1H4O A;  3ERG A;  5F0G A;  2X64 A;  1W89 A;  1GSQ A;  4G2E A;  3CBU A;  4ACS A;  2CVB A;  2IIY A;  2LJA A;  5ECP B;  3G7I A;  3I6A A;  2K8V A;  1AAZ A;  3ZVJ A;  4F2I A;  2IME A;  3F6D A;  1UC7 A;  3UMA A;  3BCK A;  2I1U A;  5G5F A;  3ZL5 A;  2YJH A;  1DE1 A;  1WJK A;  1TI3 A;  17GS A;  3VWV A;  3GMF A;  3DGQ A;  2FHE A;  2C0F A;  1ML6 A;  3F3Q A;  4BVY A;  1J9B A;  2ES7 A;  3LFL A;  2H6Z A;  4WXT A;  1GNW A;  1GSD A;  5J9B A;  2O7K A;  2PMT A;  2B7J A;  2ALB A;  3N9J A;  2WFC A;  3HZ8 A;  3UL3 A;  3LXZ A;  5G31 A;  2RLI A;  5IOW A;  4EKZ A;  1PD2 1;  4MZB A;  5IMC A;  5ECH B;  11GS A;  2X8H A;  2FUG 2;  2ZCT A;  4K7N A;  4HUA A;  5ID2 A;  4MH2 A;  4K7I A;  3ZFB A;  1K0A A;  1X0R A;  2FWF A;  2VCX A;  4HEA 2;  1XVQ A;  1E2Y A;  3NOF A;  5D73 A;  4I6X A;  4HZ2 A;  1GSF A;  4IJ3 A;  1TK5 B;  2LTK A;  2YP6 A;  2C0D A;  1XOB A;  4ZIL A;  3VWU A;  3QDN A;  5CAX A;  2MZC A;  1EOH A;  2YV9 A;  3HHV A;  1PSQ A;  2HLS A;  2A2S A;  3VPT A;  2FA8 A;  2NBS A;  1JFU A;  4G19 A;  4PUF C;  1SYR A;  3J7Y b;  5D93 A;  4IQA A;  1BAY A;  1R5P A;  4J57 E;  5IO2 A;  2YV7 A;  3MDK A;  1M9B A;  1F2E A;  4V2M A;  2PN8 A;  5ID2 B;  4TN8 A;  3DRN A;  2LQQ A;  1H75 A;  2V6O A;  3HD5 A;  1MDJ A;  4MLY A;  4EC0 A;  1XIY A;  3FHK A;  2CAQ A;  4OO4 A;  4E8E A;  4PUR A;  1FVK A;  5DAL A;  1U3A A;  1AQX A;  3TKS C;  5HQP A;  4ZXG A;  4PNF A;  1PL2 A;  1QMV A;  3UBL A;  5CRH A;  3IC4 A;  4JE1 A;  5HR1 A;  4PNG A;  16GS A;  1ON4 A;  3LEF A;  2JAC A;  5F06 A;  3GN3 A;  4NXI A;  5G30 A;  5ECO B;  4L5O A;  4KB3 A;  2OAD A;  4KCA A;  3APS A;  1YEX A;  2DJ1 A;  3TRP A;  2K18 A;  2NTO A;  2O87 A;  3O3T A;  5JCG A;  4V2L A;  4OFN A;  5J41 A;  1YF1 A;  1OC8 A;  2H0H A;  2R3X A;  2JSY A;  4TR1 B;  4GSS A;  3BCI A;  2CQ9 A;  2G0F A;  1GRX A;  3N5O A;  4KUN A;  3WYW A;  1Z7P A;  2R2J A;  2JSZ A;  3UJ1 A;  1EP7 A;  2F3M A;  22GS A;  1R26 A;  1MD4 A;  3NZN A;  4LMW A;  5DAL B;  2F51 A;  1GH2 A;  3FK8 A;  1SK0 A;  2GQK A;  1A2L A;  2YZH A;  5AIS A;  5DJM A;  2YWN A;  1VGL A;  5IM9 A;  2R4V A;  1OVN A;  2PGT A;  3LOR A;  4N0V A;  4RQR A;  3E0U A;  1ZZY A;  2IMK A;  3H8Q A;  5HFI A;  2HXK A;  4KH7 A;  2PBJ A;  2OKA A;  4ZL8 A;  1ZMA A;  3HVX A;  3UAR A;  3IHQ A;  5B7C A;  2C8U A;  2P31 A;  1Q4J A;  2G2Q A;  4OCE A;  3HVV A;  1OE8 A;  2RII A;  4JRR A;  4JR6 A;  1FO5 A;  4FH8 A;  2ON5 A;  19GS A;  3ME8 A;  1XPV A;  2JU5 A;  4KA0 A;  5DCH A;  2H66 A;  3F4T A;  1AIU A;  3FYG A;  1O73 A;  3IK9 A;  3EWL A;  1ST9 A;  2L4C A;  1TRW A;  3US3 A;  1OKT A;  12GS A;  4BVX A;  1G6Y A;  1O6J A;  1XW5 A;  2J9H A;  1F6M C;  1SD9 A;  1SJZ A;  5EL8 A;  2OA7 A;  2YAN A;  1FB6 A;  4O32 A;  1EWX A;  2EIR A;  2GZZ A;  1EP8 A;  2PPT A;  2AAW A;  2V1M A;  1OE7 A;  1I9D A;  5GST A;  3MWH A;  1RK4 A;  5IMF A;  1C72 A;  1SKR B;  2B3S A;  4JR4 A;  6GSU A;  3C73 A;  2E0Q A;  8GSS A;  2M80 A;  2JZR A;  3O76 A;  5CP1 A;  5CYY A;  1WMJ A;  4ZBA A;  2H76 A;  3PH9 A;  4PXO A;  3FY7 A;  1F3B A;  4WF5 A;  5B6N A;  2WUL A;  2VL2 A;  1K0M A;  3LG6 A;  3FZ5 A;  2PWJ A;  1FG4 A;  1Z5Y E;  3EVI A;  3I9V 2;  1HD2 A;  3H4K A;  3GKX A;  2L6C A;  3QAG A;  2L59 A;  3RDW A;  4YQU A;  4PGT A;  2Z9S A;  1ZOF A;  5B8B A;  4D73 A;  3EYT A;  2CX4 A;  3ZMK A;  4LMV A;  3ERF A;  3TKS E;  3KM6 A;  3IE3 A;  3R2Q A;  5L71 A;  3CMI A;  3MSZ A;  1SK2 A;  5ECS A;  4IKH A;  4DSS A;  4F9Z A;  2LST A;  2TRC P;  2I4A A;  2VL2 C;  3MAK A;  1PQN A;  3M9K A;  4NHW A;  2XPD A;  5HR0 A;  1V57 A;  1VF2 A;  3DEX A;  1T7P B;  4L5L A;  1EGO A;  3UAP A;  4LL4 B;  2LEG A;  1VF1 A;  1NW2 A;  2H73 A;  3G9B A;  3I43 A;  4XS6 A;  3L9U A;  4AJ6 A;  4MP4 A;  5A4U A;  5J5N A;  1ZYQ B;  1FVJ A;  3TB2 A;  1YY7 A;  2N5F A;  2ZNM A;  3A2X A;  5CRD A;  2JL4 A;  5KN3 A;  5DQS A;  1TI1 A;  1DUG A;  3M0F A;  1JZD A;  1ZGN A;  4TXV A;  4D73 B;  1XW9 A;  3L9V A;  3C71 A;  2VD0 A;  3GUS A;  4OCF A;  1GTU A;  4TXO A;  5G1K A;  3L0H A;  5JCW A;  2H0I A;  2YNX A;  1DBY A;  1O8X A;  4OWY A;  2YPM A;  2MMO A;  5HFG A;  1XWB A;  2I3Y A;  4DSS B;  2AV4 A;  4ULX A;  2O8V B;  2MMZ A;  1RW1 A;  3IOS A;  1TKD B;  4TOP A;  4XCS A;  4WF4 A;  2WGR A;  4F0C A;  3D6I A;  2GVP A;  1THX A;  1A24 A;  5IQY A;  20GS A;  4HOJ A;  1MEK A;  3APQ A;  3VWX A;  2XC2 A;  1A2J A;  4IJI A;  3TJF A;  4K6X A;  2YZU A;  1TRU A;  18GS A;  2WRT A;  2L57 A;  4IW9 A;  4ZB9 A;  3A2W A;  1SL0 B;  2VIM A;  4FYC A;  3HZ4 A;  3QOU A;  4KGI A;  2AUV A;  2DIY A;  1AW9 A;  1PX7 A;  3C1R A;  2F8F A;  4ECI A;  4V1A g;  4TXO B;  4TR3 A;  1OAZ A;  1M2D A;  4AF2 A;  2LKU A;  2P5Q A;  1OYJ A;  1XWK A;  4MZC A;  5FHI A;  3EE2 A;  1Z3E A;  3BOA A;  3KXO A;  3VK9 A;  1GP1 A;  3FR3 A;  2V2G A;  3GH6 A;  2IMF A;  3CRT A;  1ERU A;  5D9X A;  1TOF A;  5IOX A;  4ZBB A;  1JZO A;  3ZTL A;  2LJK A;  3PGT A;  2GS3 A;  1XWA A;  5C00 A;  2VCZ A;  4DEJ A;  1TJD A;  3QAV A;  5JCU A;  1XW6 A;  5D9W A;  2QGV A;  4IN0 A;  2IPA A;  4IP6 A;  3F9U A;  3IK7 A;  4YQV A;  3DXB A;  1ACV A;  1ERT A;  3G7J A;  3GX0 A;  3QAW A;  1CQH A;  4XIH A;  5J4U A;  3O6T A;  2N5B A;  4GST A;  3TJB A;  1T4Z A;  2OJL A;  3GST A;  1YJ6 A;  3Q6O A;  2B5E A;  1M99 A;  2HRN A;  3EU3 A;  4ML6 A;  4RI7 A;  3GH9 A;  1QXH A;  1AC1 A;  3ZFL A;  3UBK A;  2WDU A;  2R6K A;  1XCC A;  3KD0 A;  1TRS A;  4CHS A;  4MF6 A;  3IRA A;  2KP2 A;  5IIZ A;  2MYG A;  3RPN A;  4TKY A;  1SK1 A;  2FWH A;  4GRF A;  1PKW A;  1T8E B;  4KX4 A;  2P5R A;  2DC5 A;  2CVD A;  4GF0 A;  2H70 A;  2BTO T;  3M9J A;  5GAP D;  1NSW A;  2XBQ A;  5G5E A;  1ERW A;  1G6W A;  4YAV A;  3A2V A;  1Z6N A;  2DJ3 A;  1GUL A;  2VL3 A;  3QPM A;  2DBC A;  2LRN A;  2X8G A;  3UVH A;  1TXX A;  2FNO A;  1GUH A;  3M1G A;  2IMI A;  3TKS A;  1XBS A;  4I97 A;  4ZBD A;  3TKQ A;  2HZE A;  2IN3 A;  1UVZ A;  1GL8 A;  2FA4 A;  3D21 A;  1QGV A;  3ZRE A;  2HNL A;  2LRC A;  3GKK A;  3GA4 A;  3GIX A;  4KAE A;  5IMZ A;  4POB A;  3K8N A;  1G0T A;  1GSY A;  1K3L A;  3LXT A;  5DVB A;  6GSX A;  1E6B A;  1SEN A;  3CRU A;  4O5R A;  3Q19 A;  1EGR A;  4TR1 A;  3D22 A;  2LJR A;  1YKA A;  3I69 A;  2VCT A;  5F8B A;  5EY6 A;  2L4Q A;  1THO A;  1A0R P;  2F8A A;  1W4V A;  4BA7 A;  2TRX A;  2XHF A;  3VWW A;  3DD3 A;  3SBC A;  1A8Y A;  5KN2 A;  4CDO A;  2H1B A;  2CV4 A;  1MD3 A;  1T00 A;  4XS1 A;  3F6F A;  2XPE A;  2IJY A;  2H01 A;  1NM3 A;  4EVM A;  3L78 A;  2QSI A;  1BX9 A;  1ERV A;  3M3M A;  1KBN A;  10GS A;  3P90 A;  4QL7 A;  2HZE B;  3PR8 A;  2LRT A;  3GHA A;  2R5G A;  4YQM A;  5CRE A;  4O7H A;  1YF0 A;  2KOK A;  4I2T A;  1J0F A;  1V58 A;  1QFN A;  2H6X A;  2HSH A;  1YDK A;  2REM A;  4HDE A;  4POM A;  1A8L A;  4KSO A;  1B8X A;  1USB A;  2V32 A;  4KND A;  2VM2 A;  4EDZ A;  5INY A;  1HQO A;  4TW5 A;  3ZRD A;  1O85 A;  3ME7 A;  2VCV A;  3HYP A;  1U3I A;  2B7K A;  4KDU A;  4PQ1 A;  4IP1 A;  2MBT A;  2A2R A;  1B9Y C;  1URM A;  4MJB A;  3KMN A;  4K2D A;  1S3D A;  5F07 A;  5G1L A;  1V2A A;  2HZF A;  2MMN A;  2H30 A;  2OE1 A;  1X9W B;  1YZX A;  2H6Y A;  1X5D A;  3IV4 A;  2I81 A;  4IS0 A;  2C3Q A;  2GT5 A;  1GWC A;  5ECL B;  1B9X C;  3GTU A;  1WWJ A;  3TJG A;  3KGK A;  1I5G A;  1K0B A;  1U88 A;  1XFL A;  2YWI A;  4MPF A;  4Q5N A;  5C04 A;  3QD9 A;  4L0U A;  1G7E A;  4TRX A;  3KEB A;  4ILF A;  5COH A;  2JZT A;  3CSH A;  5H5S A;  4DVC A;  5ABR A;  4OMV A;  1VF3 A;  1HNA A;  3FW2 A;  4GLT A;  3GRX A;  1MDK A;  1B4P A;  2RM6 A;  1VRS D;  4HQZ A;  5IPG A;  1AUC A;  4G9H A;  2DJJ A;  3D0Z A;  5EVO A;  4N11 A;  5DCG A;  1Y6E A;  1ZL9 A;  1GUM A;  1N8J A;  3TJK A;  1EEJ A;  1TU7 A;  4BWQ A;  4MJA A;  1O8W A;  1FHE A;  2E2G A;  3QCP A;  4GQF A;  3A5W A;  5A5K A;  4ID0 A;  3GTU B;  1SKS B;  3L9S A;  2VCW A;  2B1L A;  3JCM L;  6GSS A;  4MF7 A;  4K0G A;  2YCD A;  1X9S B;  2E2M A;  2GQM A;  5H5R A;  2J23 A;  3BJ5 A;  1WIK A;  2HE3 A;  2CZ2 A;  4BWS A;  3ISO A;  2AYT A;  3C1S A;  3KP9 A;  2OBK A;  3G7Y A;  5EPF A;  3DVW A;  1XXU A;  1GTI A;  3F63 A;  5KEJ A;  2V41 A;  1SJ6 A;  4QQ7 A;  3V1W A;  3UEM A;  4KW6 A;  1HNB A;  2C3T A;  3LJR A;  2M46 A;  3P7X A;  3VFI A;  4FYU A;  1WP0 A;  3QFB C;  4WBR D;  2F9S A;  4OO5 A;  3LYK A;  1PX6 A;  1X9M B;  2PUK C;  1BQ7 A;  4H86 A;  4Q5Q A;  3WGE A;  1EEM A;  2JZS A;  3FR6 A;  2PVQ A;  3EIN A;  3RHB A;  5LD0 A;  1NHO A;  1EV9 A;  3HXS A;  1BG5 A;  3LSZ A;  5G2Z A;  4IVF A;  4HQS A;  2DLX A;  4RUV A;  4K7O A;  2WS2 A;  4TR4 A;  1EV4 A;  1V9W A;  4EF0 A;  2VOC A;  2WJU A;  1SJI A;  3KIJ A;  5LNK e;  1GLQ A;  2QC7 A;  4RQX A;  3HJM A;  3IA1 A;  5AN1 A;  3IXR A;  3ZZX A;  2CA8 A;  2FWE A;  4WKW A;  2P0G A;  1LU4 A;  5E59 A;  5ECM B;  1Q98 A;  3D5J A;  1ABA A;  5AIV A;  1DE2 A;  4WR4 A;  2GQL A;  2AHE A;  2ON7 A;  3KH9 A;  3W6G A;  2H0G A;  2BJX A;  3UOM A;  2KLX A;  13GS A;  1WOU A;  2DJ0 A;  3ED3 A;  4XHM A;  1KNG A;  1U87 A;  1TP9 A;  1S3A A;  14GS A;  2JAD A;  1K0D A;  2PVO C;  4I5Q A;  2GT6 A;  2FLS A;  4EO3 A;  2QKE A;  3CXG A;  1FOV A;  4MDC A;  1FB0 A;  3KZQ A;  2OE0 A;  4JED A;  1YQ1 A;  4F82 A;  4PX1 A;  1JHB A;  2HYX A;  3H79 A;  4EXJ A;  3TKR A;  1RQM A;  1TRV A;  1KEB A;  1K0N A;  3TJJ A;  2FCH A;  4OFM A;  2V6K A;  3EMX A;  3DYR A;  4NAX A;  4NWY A;  2BMX A;  3TDG A;  2VCQ A;  3DKS A;  1SL1 B;  2CAI A;  2H1G A;  4YH2 A;  4MPG A;  2H72 A;  4EUY A;  1Z6M A;  1EZK A;  1QUW A;  2HT9 A;  1LJR A;  2N5A A;  4X0X A;  4ZL7 A;  4HI7 A;  5GZZ B;  4MJC A;  1AXD A;  2GSQ A;  3IAM 2;  5JWR B;  2DJK A;  3TKP A;  5HR2 A;  5KN1 A;  4L8E A;  2EIQ A;  5ECN B;  4GSN A;  3DML A;  2E7P A;  3FRC A;  1JZW A;  4MK3 A;  3Q18 A;  2KHP A;  3GL5 A;  1TDI A;  4AGS A;  1UA5 A;  1N2A A;  1XWG A;  2FY6 A;  5H5Q A;  3VLN A;  1OC3 A;  3FEU A;  3P8W A;  3A3T A;  5DAK A;  1ZCP A;  3QMX A;  3D4T A;  2C0E A;  4FO5 A;  2CZ3 A;  1F9M A;  4ML1 A;  3TOT A;  6GSW A;  2B1K A;  1F3A A;  2RUF A;  2C1Y A;  2H19 A;  4JZQ A;  5ENU A;  1LBK A;  4WET A;  3CYN A;  3WGX A;  2MMA A;  2H8L A;  4HZ4 A;  4MF5 A;  1GSS A;  2B6M A;  3H1N A;  3FZA A;  2FGX A;  4KDY A;  4QL9 A;  3VI7 A;  3D4M A;  1M2A A;  2NVL A;  5HFK A;  4YAP A;  4K8M A;  4L0W A;  3APO A;  3ZIJ A;  3PIN A;  5LCZ A;  2C0G A;  2LNT A;  4K0N A;  3IR4 A;  3GKN A;  2OBI A;  1ZYE A;  2VL9 A;  1BJX A;  4N30 A;  1JLV A;  1SD8 A;  4EDY A;  1O7U A;  5CO3 A;  1M2B A;  3ERW A;  4GTU A;  3DIE A;  1XZO A;  5DAK B;  2GZP A;  1FW1 A;  4EE0 A;  1T3B A;  5A4V A;  5J9C A;  1SKW B;  4IHU A;  2X99 A;  4ZB6 A;  3FZ4 A;  4FIW A;  4I2U A;  2R37 A;  2H75 A;  2K8S A;  2M72 A;  2PER A;  3KMO A;  4DSR A;  2O89 A;  1K3Y A;  2WB9 A;  4J2F A;  2FWG A;  4KDX A;  3GV1 A;  4F0B A;  2EC4 A;  1M9A A;  4LA1 A;  3E9J B;  1R4W A;  2DML A;  4NMU A;  4XS4 A;  4WBJ A;  4J56 E;  4DSQ A;  2CX3 A;  2K9F A;  2PU9 C;  3U6V A;  2AJQ B;  1V40 A;  2VD1 A;  4ZL9 A;  2YOI A;  4PQI A;  3ZVJ D;  4MH3 A;  3ZIT A;  3WD6 A;  1K0O A;  1DSB A;  1OKD A;  4CW9 A;  3S9F A;  1WE0 A;  2B5Y A;  3U5R E;  4E8H A;  3CTG A;  1ILO A;  2TIR A;  2IMD A;  3IPZ A;  3TUE A;  4BL7 A;  3GNJ A;  4OD7 A;  2VO4 A;  5GSS A;  4G10 A;  1GLP A;  1A0F A;  2L5O A;  1PA3 A;  5JWQ B;  3KTB A;  4GWR A;  4XTS A;  1OC9 A;  4IBP A;  4LLR A;  4I8B A;  3FKF A;  1Z9H A;  4MA9 A;  6GSV A;  3J7Y k;  4P3Y B;  4TVE A;  2HSY A;  2VLU A;  2GDR A;  2X8C A;  4EL1 A;  2VAF A;  2K6V A;  3WT1 A;  3HA9 A;  5D96 A;  3TRQ A;  4XS4 B;  3UVT A;  4K9Z A;  4X1U A;  1G7O A;  1AQV A;  2HFD A;  3P2A A;  4IQ1 A;  3HJP A;  2WCI A;  4V2N A;  5IMV A;  1PKZ A;  2GST A;  3ZYW A;  1TU8 A;  5ECQ B;  5ELG A;  3VUR A;  2A4V A;  3GFK A;  3W8S A;  2DMM A;  3TGZ A;  6GST A;  2C3N A;  3KTL A;  1TK8 B;  3F4R A;  3LQ7 A;  4IEL A;  4JBB A;  3E3E A;  1OC9 B;  2VUP A;  2GSS A;  4HU7 A;  1WPI A;  2AB6 A;  2O85 A;  2EIO A;  3ZML A;  1A2M A;  1FAA A;  3FZ9 A;  1GUK A;  3IDV A;  5IPH A;  2YWO A;  1GNE A;  5DBQ A;  3F4S A;  3TCO A;  3GYK A;  5DQY A;  5CRG A;  3HCZ A;  2CT6 A;  3WT2 A;  1PMT A;  2GTU A;  1WRY A;  3FR9 A;  3HY2 A;  4HJ2 A;  4OFT A;  4AJ7 A;  4PQH A;  3GUR A;  4V1A p;  4GQC A;  2LV3 A;  1V98 A;  2GGT A;  1PGT A;  2ZUP A;  3TRX A;  2IWT A;  2NDO A;  3WGD A;  4IGJ A;  5A4W A;  3CSI A;  5ELA A;  7GSS A;  2CVK A;  5E4W A;  3CSJ A;  5CNW A;  1UN2 A;  5JWO B;  2H71 A;  6GSY A;  2YWM A;  2LNS A;  1M7T A;  4POK A;  5DJL A;  3W8J A;  1MDI A;  3Q74 A;  4MAB A;  1T1V A;  5DDL A;  2DJ2 A;  1SU9 A;  4XRD A;  1K0C A;  3KH7 A;  5AGY A;  3ZIV A;  3LGC A;  4MCU A;  4K1F A;  2OAC A;  4AJ8 A;  3EC3 A;  3UIW A;  5HR3 A;  3BBY A;  1IYI A;  3OR5 A;  1GSU A;  1MTC A;  3HDC A;  1TK0 B;  1VF4 A;  3HVS A;  1Z7R A;  1TTZ A;  5ECI B;  5FWG A;  1XOA A;  4KSM A;  3TOU A;  2OE3 A;  3GX8 A;  2H1A A;  2VLV A;  1HYU A;  2D2Z A;  1K3O A;  3F0I A;  1XVW A;  3EUR A;  4ECJ A;  4XRA A;  4MMM A;  2GZY A;  2L5L A;  3C8E A;  2DSA A;  1GSE A;  5IMA A;  1YKC A;  2KP1 A;  3KCM A;  3RHC A;  1R5A A;  2IFQ A;  2WZ9 A;  4WEY A;  2VLT A;  1M0U A;  1B48 A;  3C7M A;  4HU9 A;  3SWL A;  5F05 A;  2HRF A;  3CTF A;  1T4Y A;  2VM1 A;  3LWA A;  1SYX A;  2H74 A;  3RPP A;  1GTB A;  4ISD A;  5J3R A;  4Q5R A;  1EOG A;  2NPB A;  3GL3 A;  5ECR B;  2L6D A;  4HJM A;  1QQ2 A;  4POL A;  3RBT A;  5IMD A;  2B5X A;  2GSR A;  9GSS A;  2LS5 A;  1JLW A;  4X43 A;  2XBI A;  3H93 A;  1S3C A;  2YJ7 A;  1JZR A;  4N10 A;  3M8N A;  5B8A A;  2GLR A;  4GXZ A;  5FT3 A;  4MJE A;  4F03 A;  2C4J A;  2MBS A;  3VPQ A;  1Y25 A;  3KP8 A;  4FYB A;  3IAS 2;  2IFQ B;  4MZW A;  2I9H A;  1F37 A;  3DVX A;  3F3R A;  4KE3 A;  3HJO A;  5IO0 A;  5GAN D;  1GTA A;  1BED A;  1XWC A;  3AY8 A;  5B6M A;  4BPY A;  1X5E A;  3EMP A;  1BYE A;  3GKM A;  2FD3 A;  4ECB A;  3L4N A;  3HKR A;  4Z7X A;  2C80 A;  3F8U A;  2RM5 A;  1J08 A;  3QR6 A;  5KN0 A;  1KTE A;  2IL3 A;  1NHY A;  1R7H A;  3ZLP A;  1U6T A;  3LYP A;  3DWV A;  5CRW A;  4WR5 A;  1CQG A;  3EU4 A;  1AQW A;  2H1D A;  3RAZ A;  4HS1 A;  4ECC A;  3MNG A;  2LUS A;  5D9T A;  4KCE A;  2KUC A;  3QFA C;  3NIV A;  4ZB8 A;  1X5C A;  4NV5 A;  4LL1 B;  1TW9 A;  4NPB A;  4PUA A;  2HI7 A;  1O81 A;  3KJY A;  2YN1 A;  4GCI A;  4NHZ A;  1PL1 A;  1A23 A;  1QK8 A;  1YEP A;  4O92 A;  3IBH A;  2LQO A;  3VI5 A;  4N0Z A;  5ECK B;  1IYH A;  1B4Q A;  3GSS A;  4ZIJ A;  1PN9 A;  5D8I A;  4JU5 A;  4Q5F A;  5AIX A;  4NV2 A;  2DIZ A;  1SL2 B;  4TR0 A;  1HNC A; 
#chains in the Genus database with same CATH topology
 5D9V A;  2RUE A;  4RI6 A;  1PRX A;  3BD2 A;  1H4O A;  3ERG A;  5F0G A;  2X64 A;  1W89 A;  1GSQ A;  4G2E A;  3CBU A;  4ACS A;  2CVB A;  2IIY A;  2LJA A;  5ECP B;  3G7I A;  3I6A A;  2K8V A;  1AAZ A;  3ZVJ A;  4F2I A;  2IME A;  3F6D A;  1UC7 A;  3UMA A;  3BCK A;  1M3I A;  2I1U A;  5G5F A;  3ZL5 A;  2YJH A;  1DE1 A;  1WJK A;  1TI3 A;  17GS A;  3VWV A;  4CY8 A;  3GMF A;  3DGQ A;  2FHE A;  2C0F A;  1ML6 A;  3F3Q A;  4BVY A;  1J9B A;  2ES7 A;  3LFL A;  2H6Z A;  4WXT A;  1GNW A;  1GSD A;  5J9B A;  2O7K A;  2PMT A;  2B7J A;  2ALB A;  3N9J A;  2WFC A;  3HZ8 A;  2HRK A;  3UL3 A;  3LXZ A;  5G31 A;  2RLI A;  5IOW A;  4EKZ A;  1PD2 1;  4MZB A;  5IMC A;  5ECH B;  11GS A;  2X8H A;  2FUG 2;  2ZCT A;  4K7N A;  4HUA A;  5ID2 A;  4MH2 A;  4K7I A;  3ZFB A;  1K0A A;  1X0R A;  2FWF A;  2VCX A;  4HEA 2;  1XVQ A;  1E2Y A;  3NOF A;  5D73 A;  4I6X A;  2HRA A;  4HZ2 A;  1GSF A;  4IJ3 A;  1TK5 B;  2LTK A;  2YP6 A;  2C0D A;  1XOB A;  4ZIL A;  3VWU A;  3QDN A;  5CAX A;  2MZC A;  1EOH A;  2YV9 A;  3HHV A;  1PSQ A;  2HLS A;  3IC8 A;  2A2S A;  3VPT A;  2FA8 A;  2NBS A;  1JFU A;  4G19 A;  4PUF C;  1SYR A;  3J7Y b;  5D93 A;  4IQA A;  1BAY A;  1R5P A;  4J57 E;  5IO2 A;  2YV7 A;  4FQU A;  3MDK A;  1M9B A;  1F2E A;  4V2M A;  2PN8 A;  5ID2 B;  4TN8 A;  3DRN A;  2LQQ A;  1H75 A;  2V6O A;  3HD5 A;  1MDJ A;  4MLY A;  4EC0 A;  1XIY A;  3FHK A;  2CAQ A;  4OO4 A;  4E8E A;  4PUR A;  1FVK A;  5DAL A;  1U3A A;  1AQX A;  3TKS C;  5HQP A;  4ZXG A;  4PNF A;  1PL2 A;  1QMV A;  3UBL A;  5CRH A;  4Z2T A;  3IC4 A;  4JE1 A;  5HR1 A;  4PNG A;  16GS A;  1ON4 A;  3LEF A;  2JAC A;  5F06 A;  3GN3 A;  4NXI A;  5G30 A;  5ECO B;  4L5O A;  4KB3 A;  2OAD A;  4KCA A;  3APS A;  1YEX A;  2DJ1 A;  3TRP A;  2K18 A;  2NTO A;  2O87 A;  3O3T A;  5JCG A;  4V2L A;  4OFN A;  5J41 A;  1YF1 A;  1OC8 A;  3MYD A;  2H0H A;  2R3X A;  2JSY A;  4TR1 B;  4GSS A;  3BCI A;  2CQ9 A;  2G0F A;  1GRX A;  3N5O A;  4KUN A;  3WYW A;  1Z7P A;  2R2J A;  2JSZ A;  3UJ1 A;  1EP7 A;  2F3M A;  22GS A;  1R26 A;  1MD4 A;  3NZN A;  4LMW A;  5DAL B;  2F51 A;  1GH2 A;  3FK8 A;  1SK0 A;  2GQK A;  1A2L A;  2YZH A;  5AIS A;  5DJM A;  2YWN A;  1VGL A;  5IM9 A;  2R4V A;  1OVN A;  2PGT A;  3LOR A;  4N0V A;  4RQR A;  3E0U A;  1ZZY A;  2IMK A;  3H8Q A;  5HFI A;  2HXK A;  4KH7 A;  2PBJ A;  1S3R A;  2OKA A;  4ZL8 A;  1ZMA A;  4YKF A;  3HVX A;  3UAR A;  3IHQ A;  5B7C A;  2C8U A;  2P31 A;  1Q4J A;  2G2Q A;  4OCE A;  3HVV A;  1OE8 A;  3CQF A;  2RII A;  4JRR A;  4JR6 A;  1FO5 A;  4FH8 A;  2ON5 A;  19GS A;  3ME8 A;  1XPV A;  2JU5 A;  4KA0 A;  5DCH A;  2H66 A;  3F4T A;  1AIU A;  3FYG A;  1O73 A;  3IK9 A;  3EWL A;  1ST9 A;  4BIK A;  2L4C A;  1TRW A;  3US3 A;  1OKT A;  12GS A;  4BVX A;  1G6Y A;  1O6J A;  1XW5 A;  2J9H A;  1F6M C;  1SD9 A;  1SJZ A;  5EL8 A;  2OA7 A;  2YAN A;  1FB6 A;  4O32 A;  1EWX A;  2EIR A;  2GZZ A;  1EP8 A;  2PPT A;  2AAW A;  2V1M A;  1OE7 A;  1I9D A;  5GST A;  3MWH A;  1RK4 A;  5IMF A;  1C72 A;  1SKR B;  2B3S A;  4JR4 A;  6GSU A;  3C73 A;  2E0Q A;  8GSS A;  2M80 A;  2JZR A;  3O76 A;  5CP1 A;  5CYY A;  1WMJ A;  4ZBA A;  2H76 A;  3PH9 A;  4PXO A;  3FY7 A;  1F3B A;  4WF5 A;  5B6N A;  2WUL A;  2VL2 A;  1K0M A;  3LG6 A;  3FZ5 A;  2PWJ A;  3LW9 A;  1FG4 A;  1Z5Y E;  3EVI A;  3I9V 2;  1HD2 A;  3H4K A;  1PN0 A;  3GKX A;  2L6C A;  3QAG A;  4X4J A;  2L59 A;  3RDW A;  4YQU A;  4PGT A;  2Z9S A;  4BVX B;  1ZOF A;  5B8B A;  4D73 A;  3EPT A;  3EYT A;  2CX4 A;  3ZMK A;  4LMV A;  3ERF A;  3TKS E;  3KM6 A;  3IE3 A;  3R2Q A;  5L71 A;  3CMI A;  3MSZ A;  1SK2 A;  5ECS A;  4IKH A;  4DSS A;  4F9Z A;  2LST A;  2TRC P;  2I4A A;  2VL2 C;  3MAK A;  1PQN A;  3M9K A;  4NHW A;  2XPD A;  5HR0 A;  1V57 A;  1VF2 A;  3DEX A;  1T7P B;  4L5L A;  1EGO A;  3UAP A;  4LL4 B;  2LEG A;  1VF1 A;  1NW2 A;  2H73 A;  3G9B A;  3I43 A;  4XS6 A;  3L9U A;  4AJ6 A;  4MP4 A;  5A4U A;  5J5N A;  1ZYQ B;  1FVJ A;  3TB2 A;  1YY7 A;  2N5F A;  2ZNM A;  3A2X A;  5CRD A;  2JL4 A;  5KN3 A;  5DQS A;  1TI1 A;  1DUG A;  3M0F A;  1JZD A;  1ZGN A;  4TXV A;  4D73 B;  4MNN A;  1XW9 A;  3L9V A;  2X4A A;  3C71 A;  2VD0 A;  3GUS A;  4TXO A;  1GTU A;  4OCF A;  5G1K A;  3L0H A;  5JCW A;  2H0I A;  2YNX A;  1DBY A;  1FOH A;  1O8X A;  4OWY A;  2YPM A;  2MMO A;  5HFG A;  1XWB A;  2I3Y A;  4DSS B;  2AV4 A;  4ULX A;  2O8V B;  2MMZ A;  1RW1 A;  3IOS A;  1TKD B;  4TOP A;  4XCS A;  4WF4 A;  2WGR A;  4F0C A;  3PPU A;  3D6I A;  2GVP A;  1THX A;  2R0P A;  1A24 A;  5IQY A;  20GS A;  4HOJ A;  1MEK A;  3APQ A;  3VWX A;  2XC2 A;  1A2J A;  4IJI A;  3TJF A;  4K6X A;  2YZU A;  1TRU A;  18GS A;  2WRT A;  2L57 A;  4IW9 A;  4ZB9 A;  3A2W A;  1SL0 B;  2VIM A;  4FYC A;  3HZ4 A;  3QOU A;  4KGI A;  2AUV A;  2DIY A;  3FMW A;  1AW9 A;  1PX7 A;  3C1R A;  2F8F A;  4ECI A;  4V1A g;  4TXO B;  4TR3 A;  1OAZ A;  1M2D A;  4AF2 A;  2LKU A;  2R0G A;  2P5Q A;  1OYJ A;  1XWK A;  4MZC A;  5FHI A;  3EE2 A;  1Z3E A;  3BOA A;  3KXO A;  3VK9 A;  1GP1 A;  3FR3 A;  2V2G A;  3GH6 A;  4G0K A;  2IMF A;  3CRT A;  1ERU A;  5D9X A;  1TOF A;  5IOX A;  4ZBB A;  4Z2U A;  1JZO A;  3ZTL A;  2LJK A;  3PGT A;  2GS3 A;  1XWA A;  5C00 A;  2VCZ A;  4DEJ A;  1TJD A;  3QAV A;  5JCU A;  1XW6 A;  5D9W A;  2QGV A;  4IN0 A;  2IPA A;  4IP6 A;  3F9U A;  3IK7 A;  4YQV A;  3DXB A;  1ACV A;  1ERT A;  3G7J A;  3GX0 A;  3QAW A;  1CQH A;  4XIH A;  5J4U A;  3O6T A;  2N5B A;  4GST A;  3TJB A;  1T4Z A;  2OJL A;  3GST A;  1YJ6 A;  3Q6O A;  2B5E A;  1M99 A;  2HRN A;  3EU3 A;  4ML6 A;  4RI7 A;  3GH9 A;  1QXH A;  1AC1 A;  3ZFL A;  3UBK A;  2WDU A;  2R6K A;  1XCC A;  2DKH A;  3KD0 A;  1TRS A;  4CHS A;  4MF6 A;  3IRA A;  2KP2 A;  5IIZ A;  2MYG A;  3RPN A;  4TKY A;  1SK1 A;  2FWH A;  4GRF A;  1PKW A;  1T8E B;  4KX4 A;  2P5R A;  2DC5 A;  2CVD A;  4GF0 A;  5BMU A;  2H70 A;  2BTO T;  3M9J A;  5GAP D;  1NSW A;  2XBQ A;  5G5E A;  1ERW A;  1G6W A;  4YAV A;  3A2V A;  1Z6N A;  2DJ3 A;  1GUL A;  2VL3 A;  3QPM A;  2DBC A;  2LRN A;  2X8G A;  3UVH A;  1TXX A;  2FNO A;  1GUH A;  3M1G A;  2IMI A;  3TKS A;  1XBS A;  4I97 A;  4ZBD A;  3TKQ A;  2HZE A;  2IN3 A;  1UVZ A;  1GL8 A;  2FA4 A;  3D21 A;  1QGV A;  3ZRE A;  2HNL A;  2LRC A;  3GKK A;  3GA4 A;  3GIX A;  4KAE A;  5IMZ A;  4POB A;  3K8N A;  1G0T A;  1GSY A;  1K3L A;  3LXT A;  4O5Q A;  5DVB A;  6GSX A;  1E6B A;  1SEN A;  3CRU A;  4O5R A;  3Q19 A;  1EGR A;  4TR1 A;  3D22 A;  2LJR A;  1YKA A;  3I69 A;  2VCT A;  5F8B A;  5EY6 A;  2L4Q A;  1THO A;  1A0R P;  2F8A A;  1W4V A;  4BA7 A;  2TRX A;  2XHF A;  3VWW A;  3DD3 A;  3SBC A;  1A8Y A;  5KN2 A;  4CDO A;  2H1B A;  2CV4 A;  1MD3 A;  1T00 A;  4XS1 A;  3F6F A;  2XPE A;  2IJY A;  2H01 A;  1NM3 A;  4EVM A;  3L78 A;  2QSI A;  1BX9 A;  1ERV A;  3M3M A;  1KBN A;  10GS A;  3P90 A;  4QL7 A;  2HZE B;  3PR8 A;  2LRT A;  3GHA A;  2R5G A;  4YQM A;  5CRE A;  4O7H A;  1YF0 A;  2KOK A;  4I2T A;  5BRT A;  1J0F A;  1V58 A;  1QFN A;  2H6X A;  4BL7 B;  2HSH A;  1YDK A;  2REM A;  4HDE A;  4POM A;  1A8L A;  4KSO A;  1B8X A;  1USB A;  2V32 A;  4KND A;  2VM2 A;  4EDZ A;  5INY A;  1HQO A;  4TW5 A;  3ZRD A;  1O85 A;  3ME7 A;  2VCV A;  3HYP A;  1U3I A;  2B7K A;  4KDU A;  4PQ1 A;  4IP1 A;  2MBT A;  2A2R A;  4Z2R A;  1B9Y C;  1URM A;  4G0I A;  3KMN A;  4MJB A;  4K2D A;  1S3D A;  5F07 A;  5G1L A;  2A2P A;  1V2A A;  2HZF A;  2MMN A;  2H30 A;  2OE1 A;  1X9W B;  1YZX A;  2H6Y A;  1X5D A;  3IV4 A;  2I81 A;  4IS0 A;  2C3Q A;  2GT5 A;  1GWC A;  5ECL B;  1B9X C;  2DKI A;  3GTU A;  1WWJ A;  3TJG A;  3KGK A;  1I5G A;  1K0B A;  1U88 A;  1XFL A;  2YWI A;  4MPF A;  4Q5N A;  5C04 A;  3QD9 A;  4L0U A;  1G7E A;  4TRX A;  3KEB A;  4ILF A;  5COH A;  2JZT A;  3CSH A;  5H5S A;  4DVC A;  5ABR A;  4OMV A;  1VF3 A;  1HNA A;  3FW2 A;  4GLT A;  3GRX A;  1MDK A;  1B4P A;  2RM6 A;  1VRS D;  4HQZ A;  5IPG A;  1AUC A;  4G9H A;  2DJJ A;  3D0Z A;  5EVO A;  4N11 A;  5DCG A;  1Y6E A;  1ZL9 A;  1GUM A;  1N8J A;  4G0L A;  3TJK A;  1EEJ A;  1TU7 A;  4BWQ A;  4MJA A;  1O8W A;  1FHE A;  2E2G A;  3QCP A;  4GQF A;  3A5W A;  5A5K A;  4ID0 A;  3GTU B;  1SKS B;  3L9S A;  2VCW A;  2B1L A;  3JCM L;  4A5P A;  6GSS A;  4MF7 A;  4K0G A;  2YCD A;  1X9S B;  2E2M A;  2GQM A;  5H5R A;  2J23 A;  3BJ5 A;  1WIK A;  2HE3 A;  2CZ2 A;  4BWS A;  3ISO A;  2AYT A;  3C1S A;  3KP9 A;  2OBK A;  3G7Y A;  5EPF A;  3DVW A;  1XXU A;  1GTI A;  3F63 A;  5KEJ A;  2V41 A;  1SJ6 A;  4QQ7 A;  3V1W A;  3UEM A;  4KW6 A;  1HNB A;  2C3T A;  3LJR A;  2M46 A;  3P7X A;  3VFI A;  4FYU A;  1WP0 A;  3QFB C;  4WBR D;  2F9S A;  4O5U A;  4OO5 A;  3LYK A;  1PX6 A;  1X9M B;  2PUK C;  1BQ7 A;  4H86 A;  4Q5Q A;  3WGE A;  1EEM A;  2JZS A;  3FR6 A;  2PVQ A;  3EIN A;  3RHB A;  5LD0 A;  1NHO A;  1EV9 A;  3HXS A;  1BG5 A;  3LSZ A;  5G2Z A;  4IVF A;  4HQS A;  2DLX A;  4RUV A;  4K7O A;  2WS2 A;  4TR4 A;  2QA2 A;  1EV4 A;  1V9W A;  4EF0 A;  2VOC A;  2WJU A;  1SJI A;  3KIJ A;  5LNK e;  1GLQ A;  2QC7 A;  4RQX A;  3HJM A;  3IA1 A;  5AN1 A;  3IXR A;  3ZZX A;  2CA8 A;  2FWE A;  4WKW A;  2P0G A;  1LU4 A;  5E59 A;  5ECM B;  1Q98 A;  3D5J A;  1ABA A;  5AIV A;  1DE2 A;  4WR4 A;  2GQL A;  2AHE A;  2ON7 A;  3KH9 A;  3W6G A;  2H0G A;  2BJX A;  3UOM A;  2KLX A;  13GS A;  1WOU A;  2DJ0 A;  2HSM A;  3ED3 A;  4XHM A;  1KNG A;  1U87 A;  1TP9 A;  1S3A A;  14GS A;  2JAD A;  1K0D A;  2PVO C;  4I5Q A;  2GT6 A;  2FLS A;  4EO3 A;  2QKE A;  3CXG A;  1FOV A;  4MDC A;  1FB0 A;  3KZQ A;  2OE0 A;  4JED A;  1YQ1 A;  4F82 A;  4PX1 A;  1JHB A;  2HYX A;  3H79 A;  4EXJ A;  3TKR A;  1RQM A;  1TRV A;  1KEB A;  1K0N A;  3TJJ A;  2FCH A;  4OFM A;  2V6K A;  3EMX A;  3DYR A;  4NAX A;  4NWY A;  2BMX A;  3TDG A;  2VCQ A;  3DKS A;  3IHG A;  1SL1 B;  2CAI A;  2H1G A;  4YH2 A;  4MPG A;  2H72 A;  4EUY A;  1Z6M A;  1EZK A;  1QUW A;  2HT9 A;  1LJR A;  2N5A A;  4X0X A;  4ZL7 A;  4HI7 A;  5GZZ B;  4MJC A;  1AXD A;  2GSQ A;  3IAM 2;  5JWR B;  2DJK A;  3TKP A;  5HR2 A;  5KN1 A;  4L8E A;  2EIQ A;  4EIQ A;  5ECN B;  4GSN A;  3DML A;  2E7P A;  3FRC A;  1JZW A;  4MK3 A;  3Q18 A;  2KHP A;  3GL5 A;  1TDI A;  4AGS A;  1UA5 A;  1N2A A;  1XWG A;  2FY6 A;  5H5Q A;  3VLN A;  1OC3 A;  3FEU A;  3P8W A;  3A3T A;  5DAK A;  1ZCP A;  3QMX A;  3D4T A;  2C0E A;  4FO5 A;  2CZ3 A;  1F9M A;  4ML1 A;  3TOT A;  6GSW A;  2B1K A;  1F3A A;  2RUF A;  2C1Y A;  2H19 A;  4JZQ A;  5ENU A;  1LBK A;  4WET A;  3CYN A;  3WGX A;  2MMA A;  2H8L A;  4HZ4 A;  4MF5 A;  1GSS A;  2B6M A;  3H1N A;  3FZA A;  2FGX A;  4KDY A;  4QL9 A;  3VI7 A;  3D4M A;  1M2A A;  2NVL A;  5HFK A;  4YAP A;  4K8M A;  4L0W A;  3APO A;  3ZIJ A;  3PIN A;  5LCZ A;  2C0G A;  2LNT A;  4K0N A;  3IR4 A;  3GKN A;  2OBI A;  1ZYE A;  1XG8 A;  2VL9 A;  1BJX A;  4N30 A;  1JLV A;  1SD8 A;  4EDY A;  1O7U A;  5CO3 A;  1M2B A;  3ERW A;  4GTU A;  3DIE A;  1XZO A;  5DAK B;  2GZP A;  1FW1 A;  4EE0 A;  1T3B A;  5A4V A;  5J9C A;  1SKW B;  4IHU A;  2X99 A;  4ZB6 A;  3FZ4 A;  4FIW A;  4I2U A;  2R37 A;  2H75 A;  2K8S A;  2M72 A;  2PER A;  3KMO A;  4DSR A;  2O89 A;  1K3Y A;  2WB9 A;  4J2F A;  2FWG A;  4KDX A;  3GV1 A;  4F0B A;  2EC4 A;  1M9A A;  4LA1 A;  3E9J B;  1R4W A;  2DML A;  4NMU A;  4XS4 A;  4WBJ A;  4J56 E;  5KOX A;  4DSQ A;  2CX3 A;  2K9F A;  2PU9 C;  3U6V A;  2AJQ B;  1V40 A;  2VD1 A;  4BVY B;  4ZL9 A;  2YOI A;  4PQI A;  5KOW A;  3ZVJ D;  4MH3 A;  3ZIT A;  3WD6 A;  1K0O A;  1DSB A;  1OKD A;  4CW9 A;  3S9F A;  1WE0 A;  2B5Y A;  3U5R E;  4E8H A;  3CTG A;  1ILO A;  2TIR A;  2IMD A;  3IPZ A;  3TUE A;  4BL7 A;  3GNJ A;  4OD7 A;  2VO4 A;  5GSS A;  4G10 A;  1GLP A;  1A0F A;  2QA1 A;  2L5O A;  1PA3 A;  5JWQ B;  3KTB A;  4GWR A;  4XTS A;  1OC9 A;  4IBP A;  4LLR A;  4I8B A;  3FKF A;  1Z9H A;  3A5I A;  4MA9 A;  6GSV A;  3J7Y k;  4P3Y B;  4TVE A;  2HSY A;  2VLU A;  2GDR A;  2X8C A;  4EL1 A;  2VAF A;  2K6V A;  3WT1 A;  3HA9 A;  5D96 A;  3TRQ A;  4XS4 B;  3UVT A;  4K9Z A;  4X1U A;  1G7O A;  1AQV A;  2HFD A;  3P2A A;  3R3E A;  4IQ1 A;  3HJP A;  2WCI A;  4V2N A;  5IMV A;  1PKZ A;  2GST A;  3ZYW A;  1TU8 A;  5ECQ B;  5ELG A;  3VUR A;  2A4V A;  3GFK A;  3W8S A;  2DMM A;  3TGZ A;  1ZYP A;  6GST A;  2C3N A;  3KTL A;  1TK8 B;  3F4R A;  3LQ7 A;  4IEL A;  4JBB A;  3E3E A;  1OC9 B;  2VUP A;  2GSS A;  4HU7 A;  1WPI A;  2AB6 A;  2O85 A;  2EIO A;  3ZML A;  1A2M A;  1FAA A;  3FZ9 A;  1GUK A;  3IDV A;  5IPH A;  2YWO A;  1GNE A;  5DBQ A;  3F4S A;  3HVN A;  3TCO A;  3GYK A;  4USS A;  4EIP A;  5DQY A;  5CRG A;  3HCZ A;  2CT6 A;  3WT2 A;  4YKG A;  1PMT A;  2GTU A;  4K2X A;  1WRY A;  3FR9 A;  3HY2 A;  4HJ2 A;  4OFT A;  4AJ7 A;  4PQH A;  3GUR A;  4V1A p;  4GQC A;  4K5R A;  2LV3 A;  1V98 A;  2GGT A;  1PGT A;  2ZUP A;  3TRX A;  2IWT A;  2NDO A;  3WGD A;  4IGJ A;  5A4W A;  3CSI A;  5ELA A;  7GSS A;  2CVK A;  5E4W A;  3CSJ A;  5CNW A;  1UN2 A;  5JWO B;  2H71 A;  6GSY A;  2YWM A;  2LNS A;  1M7T A;  4POK A;  5DJL A;  3W8J A;  1MDI A;  3Q74 A;  4MAB A;  1T1V A;  5DDL A;  2DJ2 A;  1SU9 A;  4XRD A;  1K0C A;  3KH7 A;  5AGY A;  3ZIV A;  3LGC A;  4MCU A;  4K1F A;  1PFO A;  2OAC A;  4AJ8 A;  3EC3 A;  3UIW A;  5HR3 A;  3BBY A;  1IYI A;  3OR5 A;  1GSU A;  1MTC A;  3HDC A;  1TK0 B;  1VF4 A;  3HVS A;  1Z7R A;  1TTZ A;  5ECI B;  5FWG A;  1XOA A;  4KSM A;  3TOU A;  2OE3 A;  3GX8 A;  2H1A A;  2VLV A;  1HYU A;  1M3J A;  1K3O A;  2D2Z A;  3F0I A;  1XVW A;  3EUR A;  4ECJ A;  4XRA A;  4MMM A;  2GZY A;  2L5L A;  3C8E A;  2DSA A;  1GSE A;  5IMA A;  1YKC A;  2KP1 A;  2UZ8 A;  3KCM A;  3RHC A;  1R5A A;  2IFQ A;  2WZ9 A;  4WEY A;  2VLT A;  1M0U A;  1B48 A;  3C7M A;  4HU9 A;  3SWL A;  5F05 A;  2HRF A;  3CTF A;  1T4Y A;  2VM1 A;  3LWA A;  1SYX A;  2H74 A;  3RPP A;  1GTB A;  4ISD A;  5J3R A;  4HSC X;  4Q5R A;  1EOG A;  2NPB A;  3GL3 A;  5ECR B;  2L6D A;  4HJM A;  1QQ2 A;  4POL A;  3RBT A;  5IMD A;  2B5X A;  2GSR A;  9GSS A;  2LS5 A;  1JLW A;  4X43 A;  2XBI A;  3H93 A;  1S3C A;  2YJ7 A;  1JZR A;  4N10 A;  3M8N A;  5B8A A;  2R0C A;  2GLR A;  4GXZ A;  5FT3 A;  4MJE A;  4F03 A;  2C4J A;  2X49 A;  2MBS A;  4KF9 A;  3VPQ A;  1Y25 A;  3KP8 A;  4FYB A;  3IAS 2;  2IFQ B;  4MZW A;  2I9H A;  1F37 A;  3DVX A;  3F3R A;  4KE3 A;  3HJO A;  5IO0 A;  5GAN D;  1GTA A;  1BED A;  1XWC A;  3AY8 A;  5B6M A;  4BPY A;  1X5E A;  3MIX A;  3EMP A;  1BYE A;  3GKM A;  2FD3 A;  4ECB A;  3L4N A;  3HKR A;  4Z7X A;  2C80 A;  3F8U A;  2RM5 A;  1J08 A;  3QR6 A;  5KN0 A;  1KTE A;  2IL3 A;  4ICY A;  1NHY A;  1R7H A;  3ZLP A;  4PTS A;  1U6T A;  3LYP A;  3DWV A;  5CRW A;  4WR5 A;  1CQG A;  3EU4 A;  1AQW A;  2H1D A;  3RAZ A;  4HS1 A;  4ECC A;  3MNG A;  2LUS A;  5D9T A;  4KCE A;  2KUC A;  3QFA C;  3NIV A;  4ZB8 A;  1X5C A;  4K5S A;  4NV5 A;  4LL1 B;  4CY6 A;  1TW9 A;  4NPB A;  4PUA A;  2A4H A;  2HI7 A;  1O81 A;  3KJY A;  2YN1 A;  4GCI A;  4NHZ A;  1PL1 A;  1A23 A;  1ZYN A;  1QK8 A;  1YEP A;  4O92 A;  3IBH A;  2LQO A;  3VI5 A;  4N0Z A;  5ECK B;  1IYH A;  1B4Q A;  3GSS A;  4ZIJ A;  1PN9 A;  5D8I A;  4JU5 A;  4Q5F A;  5AIX A;  4NV2 A;  2DIZ A;  1SL2 B;  4TR0 A;  1HNC A; 
#chains in the Genus database with same CATH homology
 5D9V A;  2RUE A;  4RI6 A;  1PRX A;  3BD2 A;  1H4O A;  3ERG A;  5F0G A;  2X64 A;  1W89 A;  1GSQ A;  4G2E A;  3CBU A;  4ACS A;  2CVB A;  2IIY A;  2LJA A;  5ECP B;  3G7I A;  3I6A A;  2K8V A;  1AAZ A;  3ZVJ A;  4F2I A;  2IME A;  3F6D A;  1UC7 A;  3UMA A;  3BCK A;  2I1U A;  5G5F A;  3ZL5 A;  2YJH A;  1DE1 A;  1WJK A;  1TI3 A;  17GS A;  3VWV A;  4CY8 A;  3GMF A;  3DGQ A;  2FHE A;  2C0F A;  1ML6 A;  3F3Q A;  4BVY A;  1J9B A;  2ES7 A;  3LFL A;  2H6Z A;  4WXT A;  1GNW A;  1GSD A;  5J9B A;  2O7K A;  2PMT A;  2B7J A;  2ALB A;  3N9J A;  2WFC A;  3HZ8 A;  2HRK A;  3UL3 A;  3LXZ A;  5G31 A;  2RLI A;  5IOW A;  4EKZ A;  1PD2 1;  4MZB A;  5IMC A;  5ECH B;  11GS A;  2X8H A;  2FUG 2;  2ZCT A;  4K7N A;  4HUA A;  5ID2 A;  4MH2 A;  4K7I A;  3ZFB A;  1K0A A;  1X0R A;  2FWF A;  2VCX A;  4HEA 2;  1XVQ A;  1E2Y A;  3NOF A;  5D73 A;  4I6X A;  2HRA A;  4HZ2 A;  1GSF A;  4IJ3 A;  1TK5 B;  2LTK A;  2YP6 A;  2C0D A;  1XOB A;  4ZIL A;  3VWU A;  3QDN A;  5CAX A;  2MZC A;  1EOH A;  2YV9 A;  3HHV A;  1PSQ A;  2HLS A;  3IC8 A;  2A2S A;  3VPT A;  2FA8 A;  2NBS A;  1JFU A;  4G19 A;  4PUF C;  1SYR A;  3J7Y b;  5D93 A;  4IQA A;  1BAY A;  1R5P A;  4J57 E;  5IO2 A;  2YV7 A;  4FQU A;  3MDK A;  1M9B A;  1F2E A;  4V2M A;  2PN8 A;  5ID2 B;  4TN8 A;  3DRN A;  2LQQ A;  1H75 A;  2V6O A;  3HD5 A;  1MDJ A;  4MLY A;  4EC0 A;  1XIY A;  3FHK A;  2CAQ A;  4OO4 A;  4E8E A;  4PUR A;  1FVK A;  5DAL A;  1U3A A;  1AQX A;  3TKS C;  5HQP A;  4ZXG A;  4PNF A;  1PL2 A;  1QMV A;  3UBL A;  5CRH A;  4Z2T A;  3IC4 A;  4JE1 A;  5HR1 A;  4PNG A;  16GS A;  1ON4 A;  3LEF A;  2JAC A;  5F06 A;  3GN3 A;  4NXI A;  5G30 A;  5ECO B;  4L5O A;  4KB3 A;  2OAD A;  4KCA A;  3APS A;  1YEX A;  2DJ1 A;  3TRP A;  2K18 A;  2NTO A;  2O87 A;  3O3T A;  5JCG A;  4V2L A;  4OFN A;  5J41 A;  1YF1 A;  1OC8 A;  3MYD A;  2H0H A;  2R3X A;  2JSY A;  4TR1 B;  4GSS A;  3BCI A;  2CQ9 A;  2G0F A;  1GRX A;  3N5O A;  4KUN A;  3WYW A;  1Z7P A;  2R2J A;  2JSZ A;  3UJ1 A;  1EP7 A;  2F3M A;  22GS A;  1R26 A;  1MD4 A;  3NZN A;  4LMW A;  5DAL B;  2F51 A;  1GH2 A;  3FK8 A;  1SK0 A;  2GQK A;  1A2L A;  2YZH A;  5AIS A;  5DJM A;  2YWN A;  1VGL A;  5IM9 A;  2R4V A;  1OVN A;  2PGT A;  3LOR A;  4N0V A;  4RQR A;  3E0U A;  1ZZY A;  2IMK A;  3H8Q A;  5HFI A;  2HXK A;  4KH7 A;  2PBJ A;  2OKA A;  4ZL8 A;  1ZMA A;  4YKF A;  3HVX A;  3UAR A;  3IHQ A;  5B7C A;  2C8U A;  2P31 A;  1Q4J A;  2G2Q A;  4OCE A;  3HVV A;  1OE8 A;  2RII A;  4JRR A;  4JR6 A;  1FO5 A;  4FH8 A;  2ON5 A;  19GS A;  3ME8 A;  1XPV A;  2JU5 A;  4KA0 A;  5DCH A;  2H66 A;  3F4T A;  1AIU A;  3FYG A;  1O73 A;  3IK9 A;  3EWL A;  1ST9 A;  2L4C A;  1TRW A;  3US3 A;  1OKT A;  12GS A;  4BVX A;  1G6Y A;  1O6J A;  1XW5 A;  2J9H A;  1F6M C;  1SD9 A;  1SJZ A;  5EL8 A;  2OA7 A;  2YAN A;  1FB6 A;  4O32 A;  1EWX A;  2EIR A;  2GZZ A;  1EP8 A;  2PPT A;  2AAW A;  2V1M A;  1OE7 A;  1I9D A;  5GST A;  3MWH A;  1RK4 A;  5IMF A;  1C72 A;  1SKR B;  2B3S A;  4JR4 A;  6GSU A;  3C73 A;  2E0Q A;  8GSS A;  2M80 A;  2JZR A;  3O76 A;  5CP1 A;  5CYY A;  1WMJ A;  4ZBA A;  2H76 A;  3PH9 A;  4PXO A;  3FY7 A;  1F3B A;  4WF5 A;  5B6N A;  2WUL A;  2VL2 A;  1K0M A;  3LG6 A;  3FZ5 A;  2PWJ A;  3LW9 A;  1FG4 A;  1Z5Y E;  3EVI A;  3I9V 2;  1HD2 A;  3H4K A;  1PN0 A;  3GKX A;  2L6C A;  3QAG A;  4X4J A;  2L59 A;  3RDW A;  4YQU A;  4PGT A;  2Z9S A;  4BVX B;  1ZOF A;  5B8B A;  4D73 A;  3EPT A;  3EYT A;  2CX4 A;  3ZMK A;  4LMV A;  3ERF A;  3TKS E;  3KM6 A;  3IE3 A;  3R2Q A;  5L71 A;  3CMI A;  3MSZ A;  1SK2 A;  5ECS A;  4IKH A;  4DSS A;  4F9Z A;  2LST A;  2TRC P;  2I4A A;  2VL2 C;  3MAK A;  1PQN A;  3M9K A;  4NHW A;  2XPD A;  5HR0 A;  1V57 A;  1VF2 A;  3DEX A;  1T7P B;  4L5L A;  1EGO A;  3UAP A;  4LL4 B;  2LEG A;  1VF1 A;  1NW2 A;  2H73 A;  3G9B A;  3I43 A;  4XS6 A;  3L9U A;  4AJ6 A;  4MP4 A;  5A4U A;  5J5N A;  1ZYQ B;  1FVJ A;  3TB2 A;  1YY7 A;  2N5F A;  2ZNM A;  3A2X A;  5CRD A;  2JL4 A;  5KN3 A;  5DQS A;  1TI1 A;  1DUG A;  3M0F A;  1JZD A;  1ZGN A;  4TXV A;  4D73 B;  4MNN A;  1XW9 A;  3L9V A;  2X4A A;  3C71 A;  2VD0 A;  3GUS A;  4TXO A;  1GTU A;  4OCF A;  5G1K A;  3L0H A;  5JCW A;  2H0I A;  2YNX A;  1DBY A;  1FOH A;  1O8X A;  4OWY A;  2YPM A;  2MMO A;  5HFG A;  1XWB A;  2I3Y A;  4DSS B;  2AV4 A;  4ULX A;  2O8V B;  2MMZ A;  1RW1 A;  3IOS A;  1TKD B;  4TOP A;  4XCS A;  4WF4 A;  2WGR A;  4F0C A;  3PPU A;  3D6I A;  2GVP A;  1THX A;  2R0P A;  1A24 A;  5IQY A;  20GS A;  4HOJ A;  1MEK A;  3APQ A;  3VWX A;  2XC2 A;  1A2J A;  4IJI A;  3TJF A;  4K6X A;  2YZU A;  1TRU A;  18GS A;  2WRT A;  2L57 A;  4IW9 A;  4ZB9 A;  3A2W A;  1SL0 B;  2VIM A;  4FYC A;  3HZ4 A;  3QOU A;  4KGI A;  2AUV A;  2DIY A;  3FMW A;  1AW9 A;  1PX7 A;  3C1R A;  2F8F A;  4ECI A;  4V1A g;  4TXO B;  4TR3 A;  1OAZ A;  1M2D A;  4AF2 A;  2LKU A;  2R0G A;  2P5Q A;  1OYJ A;  1XWK A;  4MZC A;  5FHI A;  3EE2 A;  1Z3E A;  3BOA A;  3KXO A;  3VK9 A;  1GP1 A;  3FR3 A;  2V2G A;  3GH6 A;  4G0K A;  2IMF A;  3CRT A;  1ERU A;  5D9X A;  1TOF A;  5IOX A;  4ZBB A;  4Z2U A;  1JZO A;  3ZTL A;  2LJK A;  3PGT A;  2GS3 A;  1XWA A;  5C00 A;  2VCZ A;  4DEJ A;  1TJD A;  3QAV A;  5JCU A;  1XW6 A;  5D9W A;  2QGV A;  4IN0 A;  2IPA A;  4IP6 A;  3F9U A;  3IK7 A;  4YQV A;  3DXB A;  1ACV A;  1ERT A;  3G7J A;  3GX0 A;  3QAW A;  1CQH A;  4XIH A;  5J4U A;  3O6T A;  2N5B A;  4GST A;  3TJB A;  1T4Z A;  2OJL A;  3GST A;  1YJ6 A;  3Q6O A;  2B5E A;  1M99 A;  2HRN A;  3EU3 A;  4ML6 A;  4RI7 A;  3GH9 A;  1QXH A;  1AC1 A;  3ZFL A;  3UBK A;  2WDU A;  2R6K A;  1XCC A;  2DKH A;  3KD0 A;  1TRS A;  4CHS A;  4MF6 A;  3IRA A;  2KP2 A;  5IIZ A;  2MYG A;  3RPN A;  4TKY A;  1SK1 A;  2FWH A;  4GRF A;  1PKW A;  1T8E B;  4KX4 A;  2P5R A;  2DC5 A;  2CVD A;  4GF0 A;  5BMU A;  2H70 A;  2BTO T;  3M9J A;  5GAP D;  1NSW A;  2XBQ A;  5G5E A;  1ERW A;  1G6W A;  4YAV A;  3A2V A;  1Z6N A;  2DJ3 A;  1GUL A;  2VL3 A;  3QPM A;  2DBC A;  2LRN A;  2X8G A;  3UVH A;  1TXX A;  2FNO A;  1GUH A;  3M1G A;  2IMI A;  3TKS A;  1XBS A;  4I97 A;  4ZBD A;  3TKQ A;  2HZE A;  2IN3 A;  1UVZ A;  1GL8 A;  2FA4 A;  3D21 A;  1QGV A;  3ZRE A;  2HNL A;  2LRC A;  3GKK A;  3GA4 A;  3GIX A;  4KAE A;  5IMZ A;  4POB A;  3K8N A;  1G0T A;  1GSY A;  1K3L A;  3LXT A;  4O5Q A;  5DVB A;  6GSX A;  1E6B A;  1SEN A;  3CRU A;  4O5R A;  3Q19 A;  1EGR A;  4TR1 A;  3D22 A;  2LJR A;  1YKA A;  3I69 A;  2VCT A;  5F8B A;  5EY6 A;  2L4Q A;  1THO A;  1A0R P;  2F8A A;  1W4V A;  4BA7 A;  2TRX A;  2XHF A;  3VWW A;  3DD3 A;  3SBC A;  1A8Y A;  5KN2 A;  4CDO A;  2H1B A;  2CV4 A;  1MD3 A;  1T00 A;  4XS1 A;  3F6F A;  2XPE A;  2IJY A;  2H01 A;  1NM3 A;  4EVM A;  3L78 A;  2QSI A;  1BX9 A;  1ERV A;  3M3M A;  1KBN A;  10GS A;  3P90 A;  4QL7 A;  2HZE B;  3PR8 A;  2LRT A;  3GHA A;  2R5G A;  4YQM A;  5CRE A;  4O7H A;  1YF0 A;  2KOK A;  4I2T A;  5BRT A;  1J0F A;  1V58 A;  1QFN A;  2H6X A;  4BL7 B;  2HSH A;  1YDK A;  2REM A;  4HDE A;  4POM A;  1A8L A;  4KSO A;  1B8X A;  1USB A;  2V32 A;  4KND A;  2VM2 A;  4EDZ A;  5INY A;  1HQO A;  4TW5 A;  3ZRD A;  1O85 A;  3ME7 A;  2VCV A;  3HYP A;  1U3I A;  2B7K A;  4KDU A;  4PQ1 A;  4IP1 A;  2MBT A;  2A2R A;  4Z2R A;  1B9Y C;  1URM A;  4G0I A;  3KMN A;  4MJB A;  4K2D A;  1S3D A;  5F07 A;  5G1L A;  2A2P A;  1V2A A;  2HZF A;  2MMN A;  2H30 A;  2OE1 A;  1X9W B;  1YZX A;  2H6Y A;  1X5D A;  3IV4 A;  2I81 A;  4IS0 A;  2C3Q A;  2GT5 A;  1GWC A;  5ECL B;  1B9X C;  2DKI A;  3GTU A;  1WWJ A;  3TJG A;  3KGK A;  1I5G A;  1K0B A;  1U88 A;  1XFL A;  2YWI A;  4MPF A;  4Q5N A;  5C04 A;  3QD9 A;  4L0U A;  1G7E A;  4TRX A;  3KEB A;  4ILF A;  5COH A;  2JZT A;  3CSH A;  5H5S A;  4DVC A;  5ABR A;  4OMV A;  1VF3 A;  1HNA A;  3FW2 A;  4GLT A;  3GRX A;  1MDK A;  1B4P A;  2RM6 A;  1VRS D;  4HQZ A;  5IPG A;  1AUC A;  4G9H A;  2DJJ A;  3D0Z A;  5EVO A;  4N11 A;  5DCG A;  1Y6E A;  1ZL9 A;  1GUM A;  1N8J A;  4G0L A;  3TJK A;  1EEJ A;  1TU7 A;  4BWQ A;  4MJA A;  1O8W A;  1FHE A;  2E2G A;  3QCP A;  4GQF A;  3A5W A;  5A5K A;  4ID0 A;  3GTU B;  1SKS B;  3L9S A;  2VCW A;  2B1L A;  3JCM L;  4A5P A;  6GSS A;  4MF7 A;  4K0G A;  2YCD A;  1X9S B;  2E2M A;  2GQM A;  5H5R A;  2J23 A;  3BJ5 A;  1WIK A;  2HE3 A;  2CZ2 A;  4BWS A;  3ISO A;  2AYT A;  3C1S A;  3KP9 A;  2OBK A;  3G7Y A;  5EPF A;  3DVW A;  1XXU A;  1GTI A;  3F63 A;  5KEJ A;  2V41 A;  1SJ6 A;  4QQ7 A;  3V1W A;  3UEM A;  4KW6 A;  1HNB A;  2C3T A;  3LJR A;  2M46 A;  3P7X A;  3VFI A;  4FYU A;  1WP0 A;  3QFB C;  4WBR D;  2F9S A;  4O5U A;  4OO5 A;  3LYK A;  1PX6 A;  1X9M B;  2PUK C;  1BQ7 A;  4H86 A;  4Q5Q A;  3WGE A;  1EEM A;  2JZS A;  3FR6 A;  2PVQ A;  3EIN A;  3RHB A;  5LD0 A;  1NHO A;  1EV9 A;  3HXS A;  1BG5 A;  3LSZ A;  5G2Z A;  4IVF A;  4HQS A;  2DLX A;  4RUV A;  4K7O A;  2WS2 A;  4TR4 A;  2QA2 A;  1EV4 A;  1V9W A;  4EF0 A;  2VOC A;  2WJU A;  1SJI A;  3KIJ A;  5LNK e;  1GLQ A;  2QC7 A;  4RQX A;  3HJM A;  3IA1 A;  5AN1 A;  3IXR A;  3ZZX A;  2CA8 A;  2FWE A;  4WKW A;  2P0G A;  1LU4 A;  5E59 A;  5ECM B;  1Q98 A;  3D5J A;  1ABA A;  5AIV A;  1DE2 A;  4WR4 A;  2GQL A;  2AHE A;  2ON7 A;  3KH9 A;  3W6G A;  2H0G A;  2BJX A;  3UOM A;  2KLX A;  13GS A;  1WOU A;  2DJ0 A;  2HSM A;  3ED3 A;  4XHM A;  1KNG A;  1U87 A;  1TP9 A;  1S3A A;  14GS A;  2JAD A;  1K0D A;  2PVO C;  4I5Q A;  2GT6 A;  2FLS A;  4EO3 A;  2QKE A;  3CXG A;  1FOV A;  4MDC A;  1FB0 A;  3KZQ A;  2OE0 A;  4JED A;  1YQ1 A;  4F82 A;  4PX1 A;  1JHB A;  2HYX A;  3H79 A;  4EXJ A;  3TKR A;  1RQM A;  1TRV A;  1KEB A;  1K0N A;  3TJJ A;  2FCH A;  4OFM A;  2V6K A;  3EMX A;  3DYR A;  4NAX A;  4NWY A;  2BMX A;  3TDG A;  2VCQ A;  3DKS A;  3IHG A;  1SL1 B;  2CAI A;  2H1G A;  4YH2 A;  4MPG A;  2H72 A;  4EUY A;  1Z6M A;  1EZK A;  1QUW A;  2HT9 A;  1LJR A;  2N5A A;  4X0X A;  4ZL7 A;  4HI7 A;  5GZZ B;  4MJC A;  1AXD A;  2GSQ A;  3IAM 2;  5JWR B;  2DJK A;  3TKP A;  5HR2 A;  5KN1 A;  4L8E A;  2EIQ A;  4EIQ A;  5ECN B;  4GSN A;  3DML A;  2E7P A;  3FRC A;  1JZW A;  4MK3 A;  3Q18 A;  2KHP A;  3GL5 A;  1TDI A;  4AGS A;  1UA5 A;  1N2A A;  1XWG A;  2FY6 A;  5H5Q A;  3VLN A;  1OC3 A;  3FEU A;  3P8W A;  3A3T A;  5DAK A;  1ZCP A;  3QMX A;  3D4T A;  2C0E A;  4FO5 A;  2CZ3 A;  1F9M A;  4ML1 A;  3TOT A;  6GSW A;  2B1K A;  1F3A A;  2RUF A;  2C1Y A;  2H19 A;  4JZQ A;  5ENU A;  1LBK A;  4WET A;  3CYN A;  3WGX A;  2MMA A;  2H8L A;  4HZ4 A;  4MF5 A;  1GSS A;  2B6M A;  3H1N A;  3FZA A;  2FGX A;  4KDY A;  4QL9 A;  3VI7 A;  3D4M A;  1M2A A;  2NVL A;  5HFK A;  4YAP A;  4K8M A;  4L0W A;  3APO A;  3ZIJ A;  3PIN A;  5LCZ A;  2C0G A;  2LNT A;  4K0N A;  3IR4 A;  3GKN A;  2OBI A;  1ZYE A;  2VL9 A;  1BJX A;  4N30 A;  1JLV A;  1SD8 A;  4EDY A;  1O7U A;  5CO3 A;  1M2B A;  3ERW A;  4GTU A;  3DIE A;  1XZO A;  5DAK B;  2GZP A;  1FW1 A;  4EE0 A;  1T3B A;  5A4V A;  5J9C A;  1SKW B;  4IHU A;  2X99 A;  4ZB6 A;  3FZ4 A;  4FIW A;  4I2U A;  2R37 A;  2H75 A;  2K8S A;  2M72 A;  2PER A;  3KMO A;  4DSR A;  2O89 A;  1K3Y A;  2WB9 A;  4J2F A;  2FWG A;  4KDX A;  3GV1 A;  4F0B A;  2EC4 A;  1M9A A;  4LA1 A;  3E9J B;  1R4W A;  2DML A;  4NMU A;  4XS4 A;  4WBJ A;  4J56 E;  5KOX A;  4DSQ A;  2CX3 A;  2K9F A;  2PU9 C;  3U6V A;  2AJQ B;  1V40 A;  2VD1 A;  4BVY B;  4ZL9 A;  2YOI A;  4PQI A;  5KOW A;  3ZVJ D;  4MH3 A;  3ZIT A;  3WD6 A;  1K0O A;  1DSB A;  1OKD A;  4CW9 A;  3S9F A;  1WE0 A;  2B5Y A;  3U5R E;  4E8H A;  3CTG A;  1ILO A;  2TIR A;  2IMD A;  3IPZ A;  3TUE A;  4BL7 A;  3GNJ A;  4OD7 A;  2VO4 A;  5GSS A;  4G10 A;  1GLP A;  1A0F A;  2QA1 A;  2L5O A;  1PA3 A;  5JWQ B;  3KTB A;  4GWR A;  4XTS A;  1OC9 A;  4IBP A;  4LLR A;  4I8B A;  3FKF A;  1Z9H A;  3A5I A;  4MA9 A;  6GSV A;  3J7Y k;  4P3Y B;  4TVE A;  2HSY A;  2VLU A;  2GDR A;  2X8C A;  4EL1 A;  2VAF A;  2K6V A;  3WT1 A;  3HA9 A;  5D96 A;  3TRQ A;  4XS4 B;  3UVT A;  4K9Z A;  4X1U A;  1G7O A;  1AQV A;  2HFD A;  3P2A A;  3R3E A;  4IQ1 A;  3HJP A;  2WCI A;  4V2N A;  5IMV A;  1PKZ A;  2GST A;  3ZYW A;  1TU8 A;  5ECQ B;  5ELG A;  3VUR A;  2A4V A;  3GFK A;  3W8S A;  2DMM A;  3TGZ A;  1ZYP A;  6GST A;  2C3N A;  3KTL A;  1TK8 B;  3F4R A;  3LQ7 A;  4IEL A;  4JBB A;  3E3E A;  1OC9 B;  2VUP A;  2GSS A;  4HU7 A;  1WPI A;  2AB6 A;  2O85 A;  2EIO A;  3ZML A;  1A2M A;  1FAA A;  3FZ9 A;  1GUK A;  3IDV A;  5IPH A;  2YWO A;  1GNE A;  5DBQ A;  3F4S A;  3TCO A;  3GYK A;  4USS A;  4EIP A;  5DQY A;  5CRG A;  3HCZ A;  2CT6 A;  3WT2 A;  4YKG A;  1PMT A;  2GTU A;  4K2X A;  1WRY A;  3FR9 A;  3HY2 A;  4HJ2 A;  4OFT A;  4AJ7 A;  4PQH A;  3GUR A;  4V1A p;  4GQC A;  4K5R A;  2LV3 A;  1V98 A;  2GGT A;  1PGT A;  2ZUP A;  3TRX A;  2IWT A;  2NDO A;  3WGD A;  4IGJ A;  5A4W A;  3CSI A;  5ELA A;  7GSS A;  2CVK A;  5E4W A;  3CSJ A;  5CNW A;  1UN2 A;  5JWO B;  2H71 A;  6GSY A;  2YWM A;  2LNS A;  1M7T A;  4POK A;  5DJL A;  3W8J A;  1MDI A;  3Q74 A;  4MAB A;  1T1V A;  5DDL A;  2DJ2 A;  1SU9 A;  4XRD A;  1K0C A;  3KH7 A;  5AGY A;  3ZIV A;  3LGC A;  4MCU A;  4K1F A;  2OAC A;  4AJ8 A;  3EC3 A;  3UIW A;  5HR3 A;  3BBY A;  1IYI A;  3OR5 A;  1GSU A;  1MTC A;  3HDC A;  1TK0 B;  1VF4 A;  3HVS A;  1Z7R A;  1TTZ A;  5ECI B;  5FWG A;  1XOA A;  4KSM A;  3TOU A;  2OE3 A;  3GX8 A;  2H1A A;  2VLV A;  1HYU A;  2D2Z A;  1K3O A;  3F0I A;  1XVW A;  3EUR A;  4ECJ A;  4XRA A;  4MMM A;  2GZY A;  2L5L A;  3C8E A;  2DSA A;  1GSE A;  5IMA A;  1YKC A;  2KP1 A;  2UZ8 A;  3KCM A;  3RHC A;  1R5A A;  2IFQ A;  2WZ9 A;  4WEY A;  2VLT A;  1M0U A;  1B48 A;  3C7M A;  4HU9 A;  3SWL A;  5F05 A;  2HRF A;  3CTF A;  1T4Y A;  2VM1 A;  3LWA A;  1SYX A;  2H74 A;  3RPP A;  1GTB A;  4ISD A;  5J3R A;  4Q5R A;  1EOG A;  2NPB A;  3GL3 A;  5ECR B;  2L6D A;  4HJM A;  1QQ2 A;  4POL A;  3RBT A;  5IMD A;  2B5X A;  2GSR A;  9GSS A;  2LS5 A;  1JLW A;  4X43 A;  2XBI A;  3H93 A;  1S3C A;  2YJ7 A;  1JZR A;  4N10 A;  3M8N A;  5B8A A;  2R0C A;  2GLR A;  4GXZ A;  5FT3 A;  4MJE A;  4F03 A;  2C4J A;  2X49 A;  2MBS A;  4KF9 A;  3VPQ A;  1Y25 A;  3KP8 A;  4FYB A;  3IAS 2;  2IFQ B;  4MZW A;  2I9H A;  1F37 A;  3DVX A;  3F3R A;  4KE3 A;  3HJO A;  5IO0 A;  5GAN D;  1GTA A;  1BED A;  1XWC A;  3AY8 A;  5B6M A;  4BPY A;  1X5E A;  3MIX A;  3EMP A;  1BYE A;  3GKM A;  2FD3 A;  4ECB A;  3L4N A;  3HKR A;  4Z7X A;  2C80 A;  3F8U A;  2RM5 A;  1J08 A;  3QR6 A;  5KN0 A;  1KTE A;  2IL3 A;  4ICY A;  1NHY A;  1R7H A;  3ZLP A;  4PTS A;  1U6T A;  3LYP A;  3DWV A;  5CRW A;  4WR5 A;  1CQG A;  3EU4 A;  1AQW A;  2H1D A;  3RAZ A;  4HS1 A;  4ECC A;  3MNG A;  2LUS A;  5D9T A;  4KCE A;  2KUC A;  3QFA C;  3NIV A;  4ZB8 A;  1X5C A;  4K5S A;  4NV5 A;  4LL1 B;  4CY6 A;  1TW9 A;  4NPB A;  4PUA A;  2A4H A;  2HI7 A;  1O81 A;  3KJY A;  2YN1 A;  4GCI A;  4NHZ A;  1PL1 A;  1A23 A;  1ZYN A;  1QK8 A;  1YEP A;  4O92 A;  3IBH A;  2LQO A;  3VI5 A;  4N0Z A;  5ECK B;  1IYH A;  1B4Q A;  3GSS A;  4ZIJ A;  1PN9 A;  5D8I A;  4JU5 A;  4Q5F A;  5AIX A;  4NV2 A;  2DIZ A;  1SL2 B;  4TR0 A;  1HNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...