1E2YA

Tryparedoxin peroxidase from crithidia fasciculata
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
167
structure length
167
Chain Sequence
GAAKLNHPAPEFDDMALMPNGTFKKVSLSSYKGKYVVLFFYPMDFTFVCPTEIIQFSDDAKRFAEINTEVISCSCDSEYSHLQWTSVDRKKGGLGPMAIPMLADKTKAIARAYGVLDEDSGVAYRGVFIIDPNGKLRQIIINDMPIGRNVEEVIRLVEALQFVEEHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords TRYPAREDOXIN PEROXIDASE
publication title The Structure of Reduced Tryparedoxin Peroxidase Reveals a Decamer and Insight Into Reactivity of 2Cys-Peroxiredoxins
pubmed doi rcsb
source organism Crithidia fasciculata
total genus 46
structure length 167
sequence length 167
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2000-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1e2yA00
1MTCA 1GULA 2B5XA 3A2VA 10GSA 1TP9A 3OR5A 3QFAC 4LA1A 1T1VA 2K18A 1SD8A 2F8FA 3O76A 1ZGNA 1PGTA 3CRUA 5E4WA 3ZMKA 2YP6A 3VWWA 1JZWA 1F2EA 3IE3A 4PURA 1V58A 5EL8A 1MDKA 1Z7PA 4N30A 2C0GA 3IK9A 12GSA 4KSMA 1JFUA 3RPNA 1PD21 3GUSA 1ZYQB 1SL0B 2P5RA 4IP1A 5J3RA 3GFKA 1SJIA 2WDUA 4GF0A 3RBTA 4POBA 2HXKA 4N0ZA 1PMTA 2FY6A 3C7MA 2CVBA 1C72A 2VLTA 2GSQA 2KLXA 2DJ2A 3HZ8A 2WULA 2HZEA 4KW6A 5JWRB 4PQ1A 3J7Yb 2DJ3A 2KUCA 4X1UA 4OFMA 4ZBAA 4WEYA 1PQNA 2R5GA 3GRXA 2YJHA 3ZLPA 4YH2A 1M2DA 1JZRA 3CTFA 1N2AA 2NPBA 5L71A 18GSA 1G6YA 1J08A 1WP0A 3KXOA 3RHBA 4I8BA 4EXJA 1GSQA 1R7HA 3L78A 3UVTA 3KZQA 3HCZA 3L9VA 4FO5A 2YWMA 3GMFA 1A8LA 4KDYA 2OE1A 1PL2A 3UOMA 4O7HA 4I2UA 1ZL9A 6GSXA 2ZUPA 3ZFBA 4WBJA 2J9HA 5ID2B 4GXZA 1F3AA 3J7Yk 2RIIA 1SJZA 1K0DA 3KMNA 4DSSB 3FZAA 2OE0A 1QFNA 17GSA 2QGVA 4D73A 1SK2A 3SBCA 2NBSA 2B7JA 3GYKA 2DLXA 2FHEA 1GSFA 2N5FA 3HKRA 2CAIA 1T4YA 2PGTA 4OFTA 5G2ZA 1SK1A 2HSYA 3ZREA 2X8HA 3TKPA 3VWXA 2GZYA 1XW5A 2EIQA 3KGKA 5EPFA 2H75A 4F0CA 3SWLA 4IJ3A 4XS4A 5CREA 1T3BA 3S9FA 1LJRA 2DMLA 3GKNA 5IQYA 3QPMA 5HFKA 1FAAA 2C8UA 2FLSA 1PKZA 1A8YA 4DSQA 20GSA 3LFLA 3EWLA 2H0GA 3M1GA 4XHMA 2CZ2A 5DBQA 1PL1A 3BD2A 4Q5FA 3D21A 3C73A 2E2GA 3GH9A 4YAVA 4BVYA 1YJ6A 4HOJA 1ERWA 5DJLA 4V2LA 1GL8A 5CRDA 3EE2A 1O6JA 2JADA 5CRHA 2V1MA 2GS3A 5HR2A 3FHKA 1TRWA 1A2LA 2AHEA 1XWAA 3LWAA 1LBKA 1K0BA 5J9CA 3F3RA 4MABA 4YAPA 1K0MA 4ECJA 3FR9A 3I69A 4F0BA 1GNWA 4XIHA 1B4PA 2H72A 3Q74A 4EKZA 1Y25A 1GSDA 4POMA 5IM9A 5G31A 2ZCTA 4JZQA 5AIXA 13GSA 1V57A 1M99A 1V2AA 4XS1A 3FRCA 4KDXA 3LEFA 3QOUA 2MMOA 5ECPB 3FY7A 3LSZA 3RPPA 3LG6A 3C1RA 4IQAA 5ECHB 1GSUA 1S3CA 3TJGA 4PXOA 1HNBA 2L6CA 2GQMA 5LNKe 2H1DA 4WKWA 5D9WA 2LKUA 4ZXGA 2BMXA 4EL1A 1YKAA 3GTUA 1W89A 1XWKA 4GRFA 4PX1A 4IP6A 4MK3A 2V41A 2TRCP 3M9KA 4KAEA 3F0IA 2VD1A 4EO3A 1F9MA 2FWGA 1A2MA 4ECCA 1V9WA 2FWHA 1ON4A 3U6VA 3CYNA 3Q6OA 5B8BA 2JZTA 3C1SA 1XOAA 2C3QA 5EY6A 3TUEA 3DYRA 1XWCA 3ERFA 2OKAA 3CSHA 2I1UA 2ON5A 3KEBA 4HZ4A 3GL3A 4PGTA 1EZKA 2GSTA 2IIYA 2K9FA 3DIEA 2VAFA 1OE7A 4MPGA 1G6WA 1GH2A 1LU4A 5GZZB 1PA3A 3P2AA 5AGYA 3FKFA 2G2QA 3FEUA 3IAS2 4HUAA 1WOUA 4RQXA 1R4WA 2HZFA 1MD4A 2ALBA 4DVCA 4TRXA 3FYGA 2E2MA 1O81A 2HZEB 9GSSA 2I3YA 3N9JA 2I9HA 2AJQB 2YOIA 2CAQA 4IGJA 4GWRA 4WR4A 4KE3A 4JR6A 5FHIA 2QC7A 3F3QA 4K7IA 5G5FA 2O89A 4YQVA 5F05A 4G9HA 3JCML 2HRFA 5IPHA 3D4MA 4K7NA 4KGIA 1XXUA 3MNGA 3A5WA 4OD7A 4MJCA 2H70A 3O6TA 4E8EA 5AIVA 5LD0A 2GDRA 2Z9SA 1X5EA 3IDVA 2N5BA 4JBBA 2L59A 2FA4A 1UA5A 2EIOA 4ILFA 2VIMA 4NV2A 2YNXA 1TI3A 4ZBBA 2C0FA 5ELGA 3TCOA 2PN8A 5ECOB 3EVIA 1O8XA 3DKSA 4YQUA 4HU7A 4MF5A 4HQSA 3WT2A 3EMPA 1T7PB 4BWSA 2G0FA 4D73B 3IK7A 4PNGA 22GSA 1TU8A 4IKHA 2R37A 1RQMA 3GSSA 4K7OA 3HJPA 3MSZA 3HZ4A 5KN2A 5F07A 1YQ1A 1TK0B 3APOA 1WMJA 5DCGA 4KB3A 4OCEA 1NM3A 1GLPA 5H5RA 4XS4B 1EP8A 2WS2A 3UEMA 1K3LA 1U88A 5FWGA 1X5CA 3IBHA 4WBRD 3TJBA 5G1KA 3U5RE 4MJEA 3Q18A 4CHSA 1BEDA 3IPZA 4OO5A 1EEJA 1URMA 2LRNA 2KOKA 3HY2A 2LNSA 3A2XA 7GSSA 4O5RA 2YV9A 4NHZA 3GSTA 1ZYEA 5B6MA 4OCFA 5GAND 4MJAA 3W8SA 3ERWA 2IWTA 3ZVJA 3IV4A 4BVXA 5C04A 3F8UA 3F6FA 3FZ9A 3H1NA 3TRPA 3VPQA 3ZTLA 4MPFA 4N10A 2RLIA 3I43A 2YCDA 5IO2A 2VM2A 2IL3A 4FYUA 4K2DA 1N8JA 1XVWA 3TKRA 4KUNA 3QAGA 2LQOA 3HD5A 2NTOA 4G2EA 3ME7A 4QL9A 2IFQA 3M0FA 3LYKA 3UARA 3QD9A 2VCXA 2RUFA 2HFDA 5D73A 3DD3A 1GRXA 5HR0A 5DJMA 4ID0A 3UL3A 3GTUB 3A2WA 2XPDA 2AB6A 6GSUA 2OADA 4QQ7A 5ECRB 4TXOA 2LQQA 1TRVA 3EURA 4GTUA 3DGQA 3DEXA 3DVXA 1T00A 2H0IA 3ERGA 1K3OA 4L0UA 4LMWA 2A2SA 2LUSA 3KMOA 1G7EA 5J9BA 4TR1A 3KTLA 3F4TA 4OMVA 4KA0A 1OC8A 3KP9A 1KNGA 2FD3A 1HYUA 4ZIJA 1NHYA 1VF2A 3C71A 4FYCA 2C0DA 1X9SB 1UC7A 4HQZA 1O85A 3G7IA 2DMMA 2CVDA 1VGLA 16GSA 5A4UA 3AY8A 1M2BA 3FW2A 4N0VA 1DE1A 3I6AA 2C4JA 4J56E 2P0GA 1F3BA 2KP1A 1BQ7A 1SD9A 3EU4A 3VURA 2XC2A 2B5EA 3QDNA 4IELA 1NW2A 1H75A 2VCWA 4K0NA 1SL2B 4V1Ap 3TJJA 4ECBA 2HLSA 1A23A 5F0GA 1K0AA 2LRCA 2GSSA 2LRTA 1HQOA 5KN1A 3PH9A 5G1LA 2YZUA 4MF6A 3VI7A 3UBLA 1FOVA 3GV1A 1GTAA 2H73A 1ABAA 1R5AA 4WR5A 2I4AA 4TOPA 3M9JA 2IMIA 3HXSA 4EUYA 1THXA 1M7TA 2GSRA 4MDCA 2H1BA 1TU7A 1AIUA 2PERA 1PX6A 2N5AA 5ECIB 1X5DA 3R2QA 1M0UA 1AAZA 3WGDA 4L5OA 2FWEA 2PPTA 3KJYA 3VWUA 1PX7A 3UMAA 1TW9A 4GQCA 3C8EA 5J41A 1FG4A 1SENA 3HDCA 1MDIA 2H1AA 3IAM2 3GX0A 4MH3A 3BBYA 4IW9A 2OA7A 1QQ2A 1IYHA 2MZCA 4L0WA 3G7JA 2V6OA 4LL1B 1SJ6A 3WD6A 1V98A 5COHA 4AJ6A 3V1WA 5ELAA 1AXDA 2D2ZA 1WJKA 2F3MA 3E9JB 4HZ2A 3DRNA 3L9SA 4H86A 1XW9A 2PWJA 5A4WA 2HE3A 1I9DA 1XCCA 2HNLA 2P5QA 4L8EA 3FR3A 5ECMB 1WRYA 2JACA 2H6YA 3EC3A 2B5YA 5ECQB 1JZDA 1TKDB 1JZOA 5CAXA 5CRWA 4KSOA 4WF4A 5ECLB 2B1KA 2DJJA 1ERUA 5F06A 2WB9A 2OE3A 2B7KA 4XS6A 3CMIA 3GKKA 4ECIA 1U6TA 1ERVA 5GSTA 3WGEA 5HFIA 1EWXA 1HNCA 1A2JA 5DCHA 1JLVA 1VF4A 2I81A 4BWQA 5JWOB 5DALA 2JZSA 4Q5QA 4IQ1A 1ZCPA 1XW6A 2VLVA 2VL9A 3ZZXA 1OVNA 1GUHA 4EE0A 1TDIA 3PINA 5JCGA 1R26A 4IJIA 2WJUA 1XWBA 3GKXA 5INYA 3PGTA 1WWJA 1BG5A 1OC9A 1EGOA 4K8MA 2IFQB 1SYRA 5IO0A 1OKDA 4NXIA 1M9AA 2PBJA 2H6ZA 5IMZA 3DVWA 2AYTA 11GSA 3CBUA 3HVVA 2CQ9A 2NDOA 3MWHA 3UIWA 1DBYA 3HYPA 5HQPA 2LJKA 3TKSE 3QCPA 4TXOB 5J4UA 4ZBDA 1E6BA 6GSTA 2K6VA 3GA4A 4CW9A 1X9MB 3KCMA 3GKMA 3M3MA 1VRSD 5D9VA 2MMNA 3BCIA 3HHVA 3KH9A 2YWIA 2R2JA 1AQWA 3E0UA 5H5QA 2HT9A 3VK9A 4TR1B 1AW9A 5B8AA 2H74A 2H6XA 1T8EB 2V32A 2LV3A 4DEJA 1FVJA 2WGRA 4AF2A 4KCEA 2VCQA 3IR4A 1YF1A 2CA8A 3G9BA 1B9YC 3KP8A 4JE1A 4KCAA 1I5GA 1W4VA 4POLA 2F51A 2IMKA 4K0GA 2PUKC 3WGXA 3QMXA 4BPYA 3NZNA 1CQHA 4Q5NA 3IHQA 4XRDA 1TRUA 2EIRA 3TKSA 2IMEA 3D22A 2JU5A 4Z7XA 4F82A 1KBNA 2H01A 1BAYA 1U87A 4TXVA 1WPIA 4I6XA 1PKWA 1EP7A 1Z7RA 2CX4A 5CRGA 1O73A 3HA9A 4JEDA 1SKWB 2J23A 3ZIJA 1WE0A 3HJOA 5FT3A 1ZOFA 3LXZA 3BOAA 1EGRA 4MF7A 5D9XA 2H30A 2GQLA 4HI7A 2RM5A 1SL1B 1PN9A 1GTIA 2C0EA 1G0TA 1A0RP 2QSIA 2VD0A 2O8VB 1YDKA 4HJ2A 3DMLA 4K1FA 4IN0A 2NVLA 1QMVA 2LTKA 1TXXA 5E59A 5H5SA 2R3XA 4HS1A 1GTUA 1THOA 1FB0A 2PMTA 4K9ZA 1V40A 1U3IA 1QGVA 4HEA2 4KNDA 3D5JA 2AAWA 4V2NA 1RK4A 5D93A 2JSZA 6GSWA 3TKSC 1OYJA 1BYEA 1DE2A 4MJBA 5F8BA 2VCVA 1GUKA 4RI7A 1RW1A 4EC0A 4G10A 5DAKA 3ME8A 5IMAA 5J5NA 3D0ZA 3APSA 2ZNMA 5CO3A 2OJLA 2KHPA 2F9SA 2PVQA 5CYYA 3CTGA 2TIRA 3ZVJD 1K3YA 2MBTA 4RUVA 3UAPA 2O85A 1XZOA 4KDUA 5HFGA 3FZ4A 2B6MA 3LQ7A 4FYBA 4WF5A 1M9BA 4EDYA 4TR3A 3UBKA 5D9TA 1OC3A 5DQSA 2HYXA 4NMUA 4LLRA 3RHCA 4ZILA 2XBIA 3O3TA 4TR0A 3UJ1A 3LYPA 4JRRA 1AC1A 3LJRA 5A5KA 4PQIA 2QKEA 1WIKA 3ZYWA 6GSSA 3TGZA 1TTZA 3GL5A 1UVZA 2A2RA 5DALB 4N11A 2VM1A 3E3EA 1XOBA 4RQRA 4MP4A 3TOTA 2CT6A 4EVMA 1U3AA 4MZWA 2L5OA 2VCTA 1E2YA 1Q98A 1OC9B 4TR4A 2IN3A 3NIVA 2L4CA 3L9UA 3IA1A 4V1Ag 2FCHA 1NSWA 2DIZA 4I97A 2V6KA 5CP1A 1Z6NA 3ISOA 2KP2A 4AJ7A 3IRAA 4TKYA 2H0HA 4ZL8A 3CSJA 2L5LA 3RAZA 2C3TA 2GTUA 3ZITA 1TJDA 2DJ1A 2JZRA 1S3DA 3IOSA 2VCZA 1M2AA 2YWOA 4GSNA 3KM6A 1HNAA 1SU9A 1A24A 2DIYA 5KEJA 2E7PA 3GURA 3Q19A 1AQVA 2GT5A 5IOXA 2MBSA 2GVPA 2LSTA 1YY7A 3KIJA 2DBCA 3QR6A 3LXTA 2YANA 1TOFA 14GSA 1SKSB 5ECSA 5JCWA 3TJKA 4RI6A 3MAKA 1VF1A 5IOWA 4POKA 3TRXA 5KN3A 1HD2A 3CRTA 1KTEA 4ACSA 1BJXA 2VL2C 4PQHA 3WYWA 1SKRB 2RM6A 4BL7A 3L4NA 2FGXA 3EMXA 3L0HA 2GLRA 5G5EA 2XHFA 3GH6A 5IIZA 1K0NA 4ZL7A 5CNWA 2VL3A 1B8XA 3D4TA 4G19A 2HSHA 5B6NA 1GNEA 3EINA 2FUG2 3H79A 2GZPA 1B4QA 2P31A 5C00A 3F4SA 2MMZA 2X99A 2XPEA 3VPTA 3MDKA 5IMVA 5EVOA 2DSAA 1GSYA 2L4QA 4HU9A 1FW1A 4E8HA 2LS5A 2WCIA 1USBA 5ECNB 3GHAA 1GTBA 1JLWA 2X8GA 3VLNA 5JCUA 4TVEA 5ECKB 2WFCA 3FR6A 4GCIA 1K0OA 2F8AA 3KD0A 1F37A 2H8LA 3KTBA 2HI7A 2IPAA 4WXTA 3P8WA 2H19A 3GNJA 1SK0A 4MZBA 2PVOC 3F9UA 2X8CA 3CXGA 19GSA 1MDJA 2JL4A 5DQYA 1PRXA 2OBIA 3VI5A 1O8WA 1QK8A 2LJAA 4NHWA 1GLQA 4BA7A 1GUMA 1KEBA 4L5LA 1YZXA 3ZL5A 3D6IA 1B48A 3M8NA 1DSBA 4TW5A 4TN8A 4AJ8A 3H4KA 2CZ3A 2DJKA 1S3AA 4FIWA 3KH7A 4I2TA 5D96A 3GX8A 5DAKB 1IYIA 2GZZA 4XRAA 1FHEA 2E0QA 1OAZA 1X0RA 2H76A 1CQGA 2BJXA 3W6GA 1FVKA 1ZMAA 5AN1A 1PSQA 4AGSA 5B7CA 1XVQA 2VUPA 2EC4A 2FA8A 2YZHA 5AISA 1GWCA 2MMAA 1K0CA 1XWGA 2H71A 3US3A 4F03A 4EDZA 3IC4A 1ML6A 5ABRA 1QUWA 3H8QA 2HRNA 1F6MC 5G30A 1YF0A 3DXBA 4O92A 4EF0A 2VO4A 3PR8A 2FNOA 3RDWA 1EV4A 4XCSA 2K8SA 2B1LA 5A4VA 3ZRDA 4MCUA 4JR4A 1Z9HA 1TI1A 4NV5A 5KN0A 3K8NA 2CX3A 4MZCA 3N5OA 3TDGA 1GSSA 2IMDA 4X43A 3IXRA 5DDLA 3HVXA 2O7KA 5IPGA 3H93A 4K6XA 4OO4A 4X0XA 3HJMA 2IJYA 3HVSA 1FO5A 4PUAA 4NAXA 1OE8A 1YEXA 1Y6EA 4J2FA 1Z6MA 1EEMA 2DJ0A 2OBKA 4ZB9A 4ZL9A 1O7UA 4XTSA 2WZ9A 2REMA 5GAPD 2IMFA 4ISDA 2A4VA 2MYGA 4CDOA 2VOCA 4LL4B 4MMMA 1GSEA 1EOHA 4IS0A 3TRQA 2PU9C 2H66A 3ZFLA 2GGTA 5IMFA 6GSYA 3FK8A 5GSSA 4J57E 3TJFA 1EOGA 1Z3EA 1J9BA 1XIYA 2X64A 3F4RA 2CV4A 2R4VA 1H4OA 3F63A 4ML1A 1A0FA 3LGCA 3VWVA 2YV7A 1ACVA 3QAWA 3VFIA 1NHOA 3QAVA 1DUGA 1R5PA 1AUCA 1BX9A 4KH7A 2M80A 4GSSA 2V2GA 4OWYA 2AV4A 2CVKA 1FB6A 1UN2A 4GSTA 2C1YA 3ZIVA 2RUEA 4MA9A 3APQA 1T4ZA 1XPVA 1TK8B 5ID2A 2BTOT 3EU3A 2OACA 3NOFA 1TK5B 4I5QA 1GP1A 4YQMA 2H1GA 4DSSA 1TRSA 1QXHA 3W8JA 2GQKA 3I9V2 1YKCA 4FH8A 3F6DA 4IHUA 1Q4JA 5D8IA 1YEPA 5IMCA 2YWNA 4JU5A 4P3YB 4MLYA 2TRXA 4F2IA 2FWFA 4NPBA 1B9XC 5DVBA 2AUVA 4ZB6A 2LNTA 2ON7A 5HR3A 2M72A 3DWVA 2ES7A 2LJRA 4MH2A 4ML6A 3ZMLA 2R6KA 4Q5RA 3G7YA 3GN3A 4GLTA 6GSVA 3ED3A 3GIXA 4LMVA 1ST9A 5ENUA 8GSSA 2DC5A 2C80A 1AQXA 3A3TA 4O32A 4OFNA 1VF3A 2K8VA 4DSRA 3TB2A 5JWQB 2XBQA 1JHBA 3P7XA 2L57A 1MEKA 4GQFA 1XFLA 1X9WB 4IVFA 2B3SA 3BCKA 5IMDA 3WT1A 3UVHA 1ILOA 1SYXA 1ZZYA 2L6DA 5LCZA 4KX4A 5HR1A 1XBSA 2LEGA 1EV9A 3CSIA 3LORA 2C3NA 2GT6A 4ZB8A 3EYTA 4PUFC 4WETA 3FZ5A 2O87A 1OKTA 2VLUA 1MD3A 3BJ5A 4V2MA 3QFBC 2WRTA 2YPMA 2YN1A 2M46A 3TKQA 3TOUA 4QL7A 4HDEA 2YJ7A 1Z5YE 1ERTA 1J0FA 4ULXA 4IBPA 4PNFA 3P90A 4HJMA 2JSYA 4F9ZA 4NWYA 2VL2A 1G7OA
chains in the Genus database with same CATH superfamily
1MTCA 1GULA 2B5XA 3A2VA 10GSA 2R0GA 1TP9A 3OR5A 3QFAC 4LA1A 1T1VA 2K18A 1SD8A 2F8FA 3O76A 1ZGNA 1PGTA 3CRUA 5E4WA 3ZMKA 2YP6A 3VWWA 1JZWA 1F2EA 3IE3A 4PURA 1V58A 5EL8A 1MDKA 1Z7PA 4N30A 4BIKA 2C0GA 3IK9A 12GSA 4KSMA 1JFUA 3RPNA 1PD21 3GUSA 1ZYQB 1SL0B 2P5RA 4IP1A 5J3RA 3GFKA 1SJIA 2WDUA 4GF0A 3RBTA 4POBA 2HXKA 4N0ZA 1PMTA 2FY6A 3C7MA 2CVBA 1C72A 2VLTA 2GSQA 2KLXA 2DJ2A 3HZ8A 2WULA 2HZEA 4KW6A 5JWRB 4PQ1A 3J7Yb 2DJ3A 2KUCA 4X1UA 4OFMA 4ZBAA 4WEYA 1PQNA 2R5GA 3GRXA 2YJHA 3ZLPA 4YH2A 1M2DA 1JZRA 3CTFA 1N2AA 2NPBA 1PFOA 5L71A 18GSA 1G6YA 1J08A 1WP0A 3KXOA 3RHBA 4I8BA 4EXJA 1GSQA 1R7HA 3L78A 3UVTA 3KZQA 3HCZA 3L9VA 4FO5A 2YWMA 2A4HA 3GMFA 1A8LA 4KDYA 2OE1A 1PL2A 3UOMA 4O7HA 4I2UA 1ZL9A 6GSXA 2ZUPA 3ZFBA 4WBJA 2J9HA 5ID2B 4GXZA 1F3AA 4YKGA 3J7Yk 2RIIA 1SJZA 1K0DA 3KMNA 4DSSB 3FZAA 2OE0A 1QFNA 17GSA 2QGVA 4D73A 1SK2A 4Z2UA 3SBCA 1XG8A 2NBSA 2B7JA 3GYKA 2DLXA 2FHEA 1GSFA 2N5FA 3HKRA 2CAIA 1T4YA 2PGTA 4OFTA 5G2ZA 1SK1A 2HSYA 3ZREA 2X8HA 3TKPA 3VWXA 2GZYA 3HVNA 1XW5A 2EIQA 3KGKA 5EPFA 2H75A 4F0CA 3SWLA 4IJ3A 4XS4A 5CREA 1T3BA 3S9FA 1LJRA 2DMLA 3GKNA 5IQYA 3QPMA 5HFKA 1FAAA 2C8UA 4X4JA 2FLSA 1PKZA 1A8YA 4DSQA 20GSA 3LFLA 3EWLA 2H0GA 3M1GA 4XHMA 2CZ2A 5DBQA 1PL1A 3BD2A 4Q5FA 3D21A 3C73A 2E2GA 3GH9A 4YAVA 4BVYA 1YJ6A 4HOJA 1ERWA 2DKHA 5DJLA 4V2LA 1GL8A 5CRDA 3EE2A 1O6JA 2JADA 5CRHA 2V1MA 2GS3A 5HR2A 3FHKA 1TRWA 1A2LA 2AHEA 1XWAA 3LWAA 1LBKA 1K0BA 5J9CA 3F3RA 4MABA 4YAPA 1K0MA 4ECJA 3FR9A 3I69A 4F0BA 1GNWA 4XIHA 1B4PA 2H72A 3Q74A 4EKZA 1Y25A 1GSDA 4POMA 5IM9A 5G31A 2ZCTA 4JZQA 5AIXA 13GSA 1V57A 1M99A 1V2AA 4XS1A 3FRCA 4KDXA 3LEFA 3QOUA 2MMOA 5ECPB 3FY7A 3LSZA 3RPPA 3LG6A 3C1RA 4IQAA 5ECHB 1GSUA 1S3CA 3TJGA 4PXOA 1HNBA 2L6CA 2GQMA 5LNKe 2H1DA 4WKWA 5D9WA 2LKUA 4ZXGA 2BMXA 4EL1A 1YKAA 3GTUA 1W89A 1XWKA 4GRFA 4PX1A 4IP6A 4MK3A 2V41A 2TRCP 3M9KA 4KAEA 3F0IA 2VD1A 4EO3A 1F9MA 2FWGA 1A2MA 4ECCA 1V9WA 2FWHA 1ON4A 3U6VA 3CYNA 3Q6OA 5B8BA 2JZTA 3C1SA 1XOAA 2C3QA 5EY6A 3TUEA 3DYRA 1XWCA 3ERFA 2OKAA 3CSHA 2I1UA 2ON5A 3KEBA 4HZ4A 3GL3A 4PGTA 1EZKA 2GSTA 2IIYA 2K9FA 3DIEA 2VAFA 1OE7A 4MPGA 1G6WA 1GH2A 1LU4A 5GZZB 1PA3A 3P2AA 5AGYA 3FKFA 2G2QA 3FEUA 3IAS2 4HUAA 1WOUA 4RQXA 1R4WA 2HZFA 1MD4A 2ALBA 4DVCA 4TRXA 3FYGA 2E2MA 1O81A 2HZEB 9GSSA 2I3YA 3N9JA 2I9HA 2AJQB 5KOWA 2YOIA 2CAQA 4IGJA 4GWRA 4WR4A 4KE3A 4JR6A 5FHIA 2QC7A 3F3QA 4K7IA 5G5FA 2O89A 4YQVA 5F05A 4G9HA 3JCML 2HRFA 5IPHA 3D4MA 4K7NA 4Z2TA 4ICYA 4KGIA 1XXUA 3MNGA 3A5WA 4YKFA 4OD7A 4MJCA 2H70A 3O6TA 4E8EA 3IC8A 5AIVA 5BMUA 5LD0A 2GDRA 2Z9SA 1X5EA 3IDVA 2N5BA 4JBBA 2L59A 2FA4A 1UA5A 2EIOA 4ILFA 2VIMA 4NV2A 2YNXA 1TI3A 4ZBBA 2C0FA 5ELGA 3TCOA 2PN8A 5ECOB 3EVIA 1O8XA 3DKSA 4YQUA 4HU7A 4MF5A 4HQSA 3WT2A 3EMPA 1T7PB 4BWSA 2G0FA 1PN0A 3IK7A 4D73B 4PNGA 22GSA 1TU8A 4IKHA 2R37A 1RQMA 3GSSA 4K7OA 3HJPA 3MSZA 3HZ4A 5KN2A 5F07A 4K5SA 1YQ1A 1TK0B 3APOA 1WMJA 5DCGA 4KB3A 4OCEA 1NM3A 1GLPA 5H5RA 4XS4B 1EP8A 2WS2A 3UEMA 1K3LA 1U88A 5FWGA 1X5CA 3IBHA 4WBRD 3TJBA 5G1KA 3U5RE 4MJEA 3Q18A 4CHSA 1BEDA 3IPZA 4OO5A 1EEJA 1URMA 2LRNA 2KOKA 3HY2A 4BVYB 2LNSA 3A2XA 7GSSA 4O5RA 2YV9A 4NHZA 3GSTA 1ZYEA 5B6MA 4OCFA 5GAND 4MJAA 3W8SA 3ERWA 2IWTA 3ZVJA 3IV4A 4BVXA 5C04A 3F8UA 3F6FA 3FZ9A 3H1NA 3TRPA 3VPQA 3ZTLA 4MPFA 4N10A 2RLIA 3I43A 2YCDA 5IO2A 2VM2A 2IL3A 4FYUA 4K2DA 1N8JA 1XVWA 3TKRA 4KUNA 3QAGA 2LQOA 3HD5A 2NTOA 4G2EA 3ME7A 4QL9A 2IFQA 3M0FA 3LYKA 3UARA 3QD9A 2VCXA 2RUFA 2HFDA 5D73A 3DD3A 1GRXA 5HR0A 5DJMA 4ID0A 3UL3A 3GTUB 3A2WA 2XPDA 2AB6A 6GSUA 2OADA 4QQ7A 5ECRB 4TXOA 2LQQA 1TRVA 3EURA 4GTUA 3DGQA 3DEXA 3DVXA 1T00A 2H0IA 3ERGA 1K3OA 4L0UA 4LMWA 2A2SA 2LUSA 3KMOA 1G7EA 5J9BA 4TR1A 3KTLA 3F4TA 4OMVA 4KA0A 1OC8A 3KP9A 1KNGA 2FD3A 1HYUA 4ZIJA 1NHYA 1VF2A 3C71A 4FYCA 2C0DA 1X9SB 1UC7A 4HQZA 1O85A 3G7IA 2DMMA 2CVDA 1VGLA 16GSA 5A4UA 3AY8A 1M2BA 3FW2A 4N0VA 1DE1A 3I6AA 2C4JA 4J56E 2P0GA 1F3BA 2KP1A 1BQ7A 1SD9A 3EU4A 3VURA 2XC2A 2B5EA 3QDNA 4IELA 1NW2A 1H75A 2VCWA 3MIXA 4K0NA 1SL2B 4V1Ap 3TJJA 4ECBA 3EPTA 2HLSA 1A23A 5F0GA 1K0AA 2LRCA 2GSSA 2LRTA 1HQOA 5KN1A 3PH9A 5G1LA 2YZUA 4MF6A 3VI7A 3UBLA 1FOVA 3GV1A 1GTAA 2H73A 1ABAA 1R5AA 4WR5A 2I4AA 1ZYPA 4TOPA 3M9JA 2IMIA 3HXSA 4EUYA 1THXA 1M7TA 2GSRA 4MDCA 2H1BA 1TU7A 1AIUA 2PERA 1PX6A 1M3JA 2N5AA 5ECIB 1X5DA 3R2QA 1M0UA 1AAZA 3WGDA 4L5OA 2FWEA 2PPTA 3KJYA 3VWUA 1PX7A 3UMAA 1TW9A 4GQCA 3C8EA 5J41A 1FG4A 1SENA 3HDCA 1MDIA 2H1AA 3IAM2 3GX0A 4MH3A 3BBYA 4G0IA 4IW9A 2OA7A 1QQ2A 1IYHA 2MZCA 4L0WA 3G7JA 2V6OA 4LL1B 1SJ6A 3WD6A 1V98A 5COHA 4AJ6A 3V1WA 5ELAA 1AXDA 2D2ZA 1WJKA 2F3MA 3E9JB 4HZ2A 3DRNA 3L9SA 4H86A 1XW9A 2PWJA 5A4WA 2HE3A 1I9DA 1XCCA 2HNLA 2P5QA 4L8EA 3FR3A 5ECMB 1WRYA 2JACA 2H6YA 3EC3A 2B5YA 5ECQB 1JZDA 1TKDB 1JZOA 5CAXA 5CRWA 4KSOA 1FOHA 3FMWA 4WF4A 5ECLB 2B1KA 2DJJA 1ERUA 4K5RA 5F06A 2WB9A 2OE3A 2B7KA 4XS6A 3CMIA 3GKKA 4ECIA 1U6TA 1ERVA 5GSTA 4BVXB 3WGEA 5HFIA 1EWXA 1HNCA 1A2JA 5DCHA 1JLVA 1VF4A 2I81A 4BWQA 5JWOB 5DALA 2JZSA 4Q5QA 4IQ1A 1ZCPA 1XW6A 2VLVA 2VL9A 3ZZXA 1OVNA 1GUHA 4EE0A 1TDIA 3PINA 5JCGA 1R26A 4IJIA 2WJUA 1XWBA 3GKXA 5INYA 3PGTA 1WWJA 1BG5A 1OC9A 1EGOA 4K8MA 2IFQB 1SYRA 5IO0A 1OKDA 4NXIA 1M9AA 2PBJA 2H6ZA 5IMZA 3DVWA 2AYTA 11GSA 3CBUA 3HVVA 5BRTA 2CQ9A 2NDOA 3MWHA 3UIWA 1DBYA 3HYPA 5HQPA 2LJKA 3TKSE 3QCPA 4TXOB 5J4UA 4ZBDA 1E6BA 6GSTA 2K6VA 3GA4A 4CW9A 1X9MB 3KCMA 3GKMA 3M3MA 1VRSD 5D9VA 2MMNA 3BCIA 3HHVA 3KH9A 2YWIA 2R2JA 1AQWA 3E0UA 5H5QA 2HT9A 3VK9A 4TR1B 1AW9A 5B8AA 2H74A 2H6XA 1T8EB 2V32A 2LV3A 4DEJA 1FVJA 2WGRA 4AF2A 4KCEA 2VCQA 3IR4A 1YF1A 2CA8A 3G9BA 1B9YC 3KP8A 3LW9A 4JE1A 4KCAA 1I5GA 1W4VA 4POLA 2F51A 2IMKA 4K0GA 2PUKC 3WGXA 3QMXA 4BPYA 4KF9A 3NZNA 1CQHA 4Q5NA 3IHQA 4XRDA 1TRUA 2EIRA 3TKSA 2IMEA 3D22A 2JU5A 4Z7XA 4F82A 1KBNA 2H01A 1BAYA 1U87A 3IHGA 4TXVA 1WPIA 4I6XA 1PKWA 1EP7A 1Z7RA 2CX4A 5CRGA 1O73A 3HA9A 4JEDA 1SKWB 2J23A 3ZIJA 1WE0A 3HJOA 5FT3A 1ZOFA 3LXZA 3BOAA 1EGRA 4Z2RA 4MF7A 2UZ8A 5D9XA 2H30A 2GQLA 4HI7A 2RM5A 1SL1B 1PN9A 1GTIA 2C0EA 1G0TA 1A0RP 2QSIA 2VD0A 2O8VB 1YDKA 4HJ2A 3DMLA 4K1FA 4IN0A 2NVLA 1QMVA 2LTKA 1TXXA 5E59A 5H5SA 2R3XA 4HS1A 1GTUA 1THOA 1FB0A 2PMTA 4K9ZA 4USSA 1V40A 1U3IA 1QGVA 4HEA2 4KNDA 3D5JA 2AAWA 4V2NA 1RK4A 5D93A 2JSZA 6GSWA 1M3IA 3TKSC 1OYJA 1BYEA 1DE2A 4MJBA 5F8BA 2VCVA 1GUKA 4RI7A 1RW1A 4EC0A 4G10A 5DAKA 3ME8A 5IMAA 5J5NA 3D0ZA 3APSA 2ZNMA 5CO3A 2OJLA 2KHPA 2F9SA 2PVQA 5CYYA 3CTGA 4A5PA 2TIRA 3ZVJD 1K3YA 2MBTA 4RUVA 3UAPA 2O85A 1XZOA 4KDUA 5HFGA 3FZ4A 2B6MA 3LQ7A 4FYBA 4WF5A 1M9BA 4EDYA 4TR3A 3UBKA 5D9TA 1OC3A 5DQSA 2HYXA 4CY6A 4NMUA 4LLRA 3RHCA 4ZILA 2XBIA 3O3TA 4TR0A 3UJ1A 3LYPA 4JRRA 1AC1A 4FQUA 3LJRA 5A5KA 4PQIA 2QKEA 1WIKA 3ZYWA 6GSSA 3TGZA 1TTZA 3GL5A 1UVZA 2A2RA 5DALB 4N11A 2VM1A 3E3EA 1XOBA 4RQRA 4MP4A 3TOTA 2CT6A 4EVMA 1U3AA 4MZWA 4K2XA 2L5OA 2VCTA 4G0LA 1E2YA 1Q98A 1OC9B 4TR4A 2IN3A 3NIVA 2L4CA 3L9UA 3IA1A 4V1Ag 2FCHA 1NSWA 2DIZA 4I97A 4MNNA 2V6KA 5CP1A 1Z6NA 3ISOA 2KP2A 4AJ7A 3IRAA 4TKYA 2H0HA 4ZL8A 3CSJA 2L5LA 3RAZA 2QA1A 2C3TA 2GTUA 3ZITA 1TJDA 2X4AA 2DJ1A 2JZRA 4O5QA 1S3DA 3IOSA 2VCZA 1M2AA 2YWOA 4GSNA 3KM6A 1HNAA 1SU9A 1A24A 2DIYA 5KEJA 2E7PA 3GURA 3Q19A 1AQVA 2GT5A 5IOXA 2MBSA 2GVPA 2LSTA 1YY7A 3KIJA 2DBCA 3QR6A 3LXTA 2YANA 1TOFA 14GSA 1SKSB 5ECSA 5JCWA 3TJKA 4RI6A 3MAKA 1VF1A 5IOWA 4POKA 3TRXA 5KN3A 2R0PA 4G0KA 1HD2A 3A5IA 3CRTA 1KTEA 4ACSA 1BJXA 2VL2C 4PQHA 3WYWA 1SKRB 2RM6A 4BL7A 3L4NA 2FGXA 3EMXA 3L0HA 2GLRA 5G5EA 2XHFA 3GH6A 5IIZA 1K0NA 4ZL7A 5CNWA 2VL3A 1B8XA 3D4TA 4G19A 2HSHA 5B6NA 1GNEA 3EINA 2FUG2 3H79A 2GZPA 1B4QA 2P31A 5C00A 3F4SA 2MMZA 2X99A 2XPEA 3VPTA 3MDKA 5IMVA 2R0CA 5EVOA 2DSAA 1GSYA 2L4QA 4HU9A 1FW1A 4E8HA 2LS5A 2WCIA 1USBA 5ECNB 3GHAA 1GTBA 1JLWA 2X8GA 3VLNA 5JCUA 4TVEA 5ECKB 2WFCA 3FR6A 4GCIA 1K0OA 2F8AA 3KD0A 3MYDA 1F37A 2H8LA 3KTBA 2HI7A 2IPAA 4WXTA 3P8WA 2H19A 3GNJA 1SK0A 4MZBA 2PVOC 3F9UA 2X8CA 3CXGA 19GSA 1MDJA 2JL4A 5DQYA 1PRXA 2OBIA 3VI5A 1O8WA 1QK8A 2LJAA 4NHWA 1GLQA 4BA7A 1GUMA 1KEBA 4L5LA 1YZXA 3CQFA 3ZL5A 3D6IA 1B48A 3M8NA 1DSBA 4TW5A 4TN8A 4AJ8A 3H4KA 2CZ3A 2DJKA 1S3AA 4FIWA 3KH7A 4I2TA 5D96A 3GX8A 5DAKB 1IYIA 2GZZA 4XRAA 2X49A 1FHEA 2E0QA 1OAZA 1X0RA 2H76A 1CQGA 2BJXA 3W6GA 1FVKA 1ZMAA 5AN1A 3PPUA 1S3RA 1PSQA 4AGSA 5B7CA 1XVQA 2VUPA 2EC4A 2FA8A 2YZHA 5AISA 1GWCA 2MMAA 1K0CA 1XWGA 2H71A 3US3A 4F03A 4EDZA 3IC4A 1ML6A 5ABRA 1QUWA 3H8QA 2HRNA 1F6MC 5G30A 1YF0A 3DXBA 4O92A 4EF0A 2VO4A 3PR8A 2FNOA 3RDWA 1EV4A 4HSCX 4XCSA 2K8SA 2B1LA 2QA2A 5A4VA 3ZRDA 4MCUA 2HRAA 4JR4A 1Z9HA 1TI1A 4NV5A 5KN0A 3K8NA 2CX3A 4MZCA 3N5OA 3TDGA 1GSSA 2IMDA 4X43A 3IXRA 5DDLA 3HVXA 2O7KA 5IPGA 3H93A 4K6XA 4OO4A 4X0XA 3HJMA 2IJYA 3HVSA 1FO5A 4PUAA 4NAXA 1OE8A 1YEXA 1Y6EA 4J2FA 1Z6MA 1EEMA 2DJ0A 2OBKA 4ZB9A 4ZL9A 1O7UA 4XTSA 2WZ9A 2REMA 5GAPD 2IMFA 4ISDA 2A4VA 2MYGA 4CDOA 2VOCA 4CY8A 4LL4B 4MMMA 1GSEA 1ZYNA 1EOHA 4IS0A 3TRQA 2PU9C 2H66A 3ZFLA 2GGTA 5IMFA 6GSYA 3FK8A 5GSSA 4J57E 3TJFA 1EOGA 1Z3EA 1J9BA 1XIYA 2X64A 3F4RA 2CV4A 2R4VA 1H4OA 3F63A 4ML1A 1A0FA 3LGCA 3VWVA 2YV7A 1ACVA 3QAWA 3VFIA 1NHOA 3QAVA 1DUGA 1R5PA 1AUCA 1BX9A 2HRKA 4KH7A 2M80A 4GSSA 2V2GA 4OWYA 4BL7B 2AV4A 2CVKA 1FB6A 1UN2A 4GSTA 2C1YA 3ZIVA 2RUEA 4MA9A 3APQA 1T4ZA 1XPVA 1TK8B 5ID2A 2BTOT 3EU3A 2OACA 3NOFA 2A2PA 1TK5B 4I5QA 1GP1A 4YQMA 2H1GA 4DSSA 1TRSA 1QXHA 3W8JA 2GQKA 3I9V2 1YKCA 4FH8A 3F6DA 2DKIA 4IHUA 1Q4JA 5D8IA 1YEPA 5IMCA 2YWNA 4JU5A 4P3YB 4MLYA 2TRXA 4F2IA 2FWFA 2HSMA 4NPBA 1B9XC 5DVBA 4EIQA 2AUVA 4ZB6A 2LNTA 2ON7A 5HR3A 2M72A 3R3EA 3DWVA 2ES7A 2LJRA 4MH2A 4ML6A 3ZMLA 4O5UA 2R6KA 4Q5RA 3G7YA 3GN3A 4GLTA 6GSVA 3ED3A 3GIXA 4LMVA 1ST9A 5ENUA 8GSSA 2DC5A 2C80A 1AQXA 3A3TA 4O32A 4OFNA 1VF3A 2K8VA 4DSRA 3TB2A 5JWQB 2XBQA 1JHBA 3P7XA 2L57A 1MEKA 4PTSA 4GQFA 1XFLA 1X9WB 4IVFA 2B3SA 3BCKA 5IMDA 3WT1A 3UVHA 1ILOA 1SYXA 1ZZYA 2L6DA 5LCZA 4KX4A 5HR1A 1XBSA 2LEGA 1EV9A 3CSIA 3LORA 2C3NA 4EIPA 2GT6A 4ZB8A 3EYTA 4PUFC 4WETA 3FZ5A 2O87A 1OKTA 2VLUA 1MD3A 3BJ5A 4V2MA 5KOXA 3QFBC 2WRTA 2YPMA 2YN1A 2M46A 3TKQA 3TOUA 4QL7A 4HDEA 2YJ7A 1Z5YE 1ERTA 1J0FA 4ULXA 4IBPA 4PNFA 3P90A 4HJMA 2JSYA 4F9ZA 4NWYA 2VL2A 1G7OA
chains in the Genus database with same CATH topology
1MTCA 1GULA 2B5XA 3A2VA 10GSA 2R0GA 1TP9A 3OR5A 3QFAC 4LA1A 1T1VA 2K18A 1SD8A 2F8FA 3O76A 1ZGNA 1PGTA 3CRUA 5E4WA 3ZMKA 2YP6A 3VWWA 1JZWA 1F2EA 3IE3A 4PURA 1V58A 5EL8A 1MDKA 1Z7PA 4N30A 2C0GA 3IK9A 12GSA 4KSMA 1JFUA 3RPNA 1PD21 3GUSA 1ZYQB 1SL0B 2P5RA 4IP1A 5J3RA 3GFKA 1SJIA 2WDUA 4GF0A 3RBTA 4POBA 2HXKA 4N0ZA 1PMTA 2FY6A 3C7MA 2CVBA 1C72A 2VLTA 2GSQA 2KLXA 2DJ2A 3HZ8A 2WULA 2HZEA 4KW6A 5JWRB 4PQ1A 3J7Yb 2DJ3A 2KUCA 4X1UA 4OFMA 4ZBAA 4WEYA 1PQNA 2R5GA 3GRXA 2YJHA 3ZLPA 4YH2A 1M2DA 1JZRA 3CTFA 1N2AA 2NPBA 5L71A 18GSA 1G6YA 1J08A 1WP0A 3KXOA 3RHBA 4I8BA 4EXJA 1GSQA 1R7HA 3L78A 3UVTA 3KZQA 3HCZA 3L9VA 4FO5A 2YWMA 2A4HA 3GMFA 1A8LA 4KDYA 2OE1A 1PL2A 3UOMA 4O7HA 4I2UA 1ZL9A 6GSXA 2ZUPA 3ZFBA 4WBJA 2J9HA 5ID2B 4GXZA 1F3AA 4YKGA 3J7Yk 2RIIA 1SJZA 1K0DA 3KMNA 4DSSB 3FZAA 2OE0A 1QFNA 17GSA 2QGVA 4D73A 1SK2A 4Z2UA 3SBCA 2NBSA 2B7JA 3GYKA 2DLXA 2FHEA 1GSFA 2N5FA 3HKRA 2CAIA 1T4YA 2PGTA 4OFTA 5G2ZA 1SK1A 2HSYA 3ZREA 2X8HA 3TKPA 3VWXA 2GZYA 1XW5A 2EIQA 3KGKA 5EPFA 2H75A 4F0CA 3SWLA 4IJ3A 4XS4A 5CREA 1T3BA 3S9FA 1LJRA 2DMLA 3GKNA 5IQYA 3QPMA 5HFKA 1FAAA 2C8UA 4X4JA 2FLSA 1PKZA 1A8YA 4DSQA 20GSA 3LFLA 3EWLA 2H0GA 3M1GA 4XHMA 2CZ2A 5DBQA 1PL1A 3BD2A 4Q5FA 3D21A 3C73A 2E2GA 3GH9A 4YAVA 4BVYA 1YJ6A 4HOJA 1ERWA 2DKHA 5DJLA 4V2LA 1GL8A 5CRDA 3EE2A 1O6JA 2JADA 5CRHA 2V1MA 2GS3A 5HR2A 3FHKA 1TRWA 1A2LA 2AHEA 1XWAA 3LWAA 1LBKA 1K0BA 5J9CA 3F3RA 4MABA 4YAPA 1K0MA 4ECJA 3FR9A 3I69A 4F0BA 1GNWA 4XIHA 1B4PA 2H72A 3Q74A 4EKZA 1Y25A 1GSDA 4POMA 5IM9A 5G31A 2ZCTA 4JZQA 5AIXA 13GSA 1V57A 1M99A 1V2AA 4XS1A 3FRCA 4KDXA 3LEFA 3QOUA 2MMOA 5ECPB 3FY7A 3LSZA 3RPPA 3LG6A 3C1RA 4IQAA 5ECHB 1GSUA 1S3CA 3TJGA 4PXOA 1HNBA 2L6CA 2GQMA 5LNKe 2H1DA 4WKWA 5D9WA 2LKUA 4ZXGA 2BMXA 4EL1A 1YKAA 3GTUA 1W89A 1XWKA 4GRFA 4PX1A 4IP6A 4MK3A 2V41A 2TRCP 3M9KA 4KAEA 3F0IA 2VD1A 4EO3A 1F9MA 2FWGA 1A2MA 4ECCA 1V9WA 2FWHA 1ON4A 3U6VA 3CYNA 3Q6OA 5B8BA 2JZTA 3C1SA 1XOAA 2C3QA 5EY6A 3TUEA 3DYRA 1XWCA 3ERFA 2OKAA 3CSHA 2I1UA 2ON5A 3KEBA 4HZ4A 3GL3A 4PGTA 1EZKA 2GSTA 2IIYA 2K9FA 3DIEA 2VAFA 1OE7A 4MPGA 1G6WA 1GH2A 1LU4A 5GZZB 1PA3A 3P2AA 5AGYA 3FKFA 2G2QA 3FEUA 3IAS2 4HUAA 1WOUA 4RQXA 1R4WA 2HZFA 1MD4A 2ALBA 4DVCA 4TRXA 3FYGA 2E2MA 1O81A 2HZEB 9GSSA 2I3YA 3N9JA 2I9HA 2AJQB 5KOWA 2YOIA 2CAQA 4IGJA 4GWRA 4WR4A 4KE3A 4JR6A 5FHIA 2QC7A 3F3QA 4K7IA 5G5FA 2O89A 4YQVA 5F05A 4G9HA 3JCML 2HRFA 5IPHA 3D4MA 4K7NA 4Z2TA 4ICYA 4KGIA 1XXUA 3MNGA 3A5WA 4YKFA 4OD7A 4MJCA 2H70A 3O6TA 4E8EA 3IC8A 5AIVA 5BMUA 5LD0A 2GDRA 2Z9SA 1X5EA 3IDVA 2N5BA 4JBBA 2L59A 2FA4A 1UA5A 2EIOA 4ILFA 2VIMA 4NV2A 2YNXA 1TI3A 4ZBBA 2C0FA 5ELGA 3TCOA 2PN8A 5ECOB 3EVIA 1O8XA 3DKSA 4YQUA 4HU7A 4MF5A 4HQSA 3WT2A 3EMPA 1T7PB 4BWSA 2G0FA 1PN0A 3IK7A 4D73B 4PNGA 22GSA 1TU8A 4IKHA 2R37A 1RQMA 3GSSA 4K7OA 3HJPA 3MSZA 3HZ4A 5KN2A 5F07A 4K5SA 1YQ1A 1TK0B 3APOA 1WMJA 5DCGA 4KB3A 4OCEA 1NM3A 1GLPA 5H5RA 4XS4B 1EP8A 2WS2A 3UEMA 1K3LA 1U88A 5FWGA 1X5CA 3IBHA 4WBRD 3TJBA 5G1KA 3U5RE 4MJEA 3Q18A 4CHSA 1BEDA 3IPZA 4OO5A 1EEJA 1URMA 2LRNA 2KOKA 3HY2A 4BVYB 2LNSA 3A2XA 7GSSA 4O5RA 2YV9A 4NHZA 3GSTA 1ZYEA 5B6MA 4OCFA 5GAND 4MJAA 3W8SA 3ERWA 2IWTA 3ZVJA 3IV4A 4BVXA 5C04A 3F8UA 3F6FA 3FZ9A 3H1NA 3TRPA 3VPQA 3ZTLA 4MPFA 4N10A 2RLIA 3I43A 2YCDA 5IO2A 2VM2A 2IL3A 4FYUA 4K2DA 1N8JA 1XVWA 3TKRA 4KUNA 3QAGA 2LQOA 3HD5A 2NTOA 4G2EA 3ME7A 4QL9A 2IFQA 3M0FA 3LYKA 3UARA 3QD9A 2VCXA 2RUFA 2HFDA 5D73A 3DD3A 1GRXA 5HR0A 5DJMA 4ID0A 3UL3A 3GTUB 3A2WA 2XPDA 2AB6A 6GSUA 2OADA 4QQ7A 5ECRB 4TXOA 2LQQA 1TRVA 3EURA 4GTUA 3DGQA 3DEXA 3DVXA 1T00A 2H0IA 3ERGA 1K3OA 4L0UA 4LMWA 2A2SA 2LUSA 3KMOA 1G7EA 5J9BA 4TR1A 3KTLA 3F4TA 4OMVA 4KA0A 1OC8A 3KP9A 1KNGA 2FD3A 1HYUA 4ZIJA 1NHYA 1VF2A 3C71A 4FYCA 2C0DA 1X9SB 1UC7A 4HQZA 1O85A 3G7IA 2DMMA 2CVDA 1VGLA 16GSA 5A4UA 3AY8A 1M2BA 3FW2A 4N0VA 1DE1A 3I6AA 2C4JA 4J56E 2P0GA 1F3BA 2KP1A 1BQ7A 1SD9A 3EU4A 3VURA 2XC2A 2B5EA 3QDNA 4IELA 1NW2A 1H75A 2VCWA 3MIXA 4K0NA 1SL2B 4V1Ap 3TJJA 4ECBA 3EPTA 2HLSA 1A23A 5F0GA 1K0AA 2LRCA 2GSSA 2LRTA 1HQOA 5KN1A 3PH9A 5G1LA 2YZUA 4MF6A 3VI7A 3UBLA 1FOVA 3GV1A 1GTAA 2H73A 1ABAA 1R5AA 4WR5A 2I4AA 1ZYPA 4TOPA 3M9JA 2IMIA 3HXSA 4EUYA 1THXA 1M7TA 2GSRA 4MDCA 2H1BA 1TU7A 1AIUA 2PERA 1PX6A 2N5AA 5ECIB 1X5DA 3R2QA 1M0UA 1AAZA 3WGDA 4L5OA 2FWEA 2PPTA 3KJYA 3VWUA 1PX7A 3UMAA 1TW9A 4GQCA 3C8EA 5J41A 1FG4A 1SENA 3HDCA 1MDIA 2H1AA 3IAM2 3GX0A 4MH3A 3BBYA 4G0IA 4IW9A 2OA7A 1QQ2A 1IYHA 2MZCA 4L0WA 3G7JA 2V6OA 4LL1B 1SJ6A 3WD6A 1V98A 5COHA 4AJ6A 3V1WA 5ELAA 1AXDA 2D2ZA 1WJKA 2F3MA 3E9JB 4HZ2A 3DRNA 3L9SA 4H86A 1XW9A 2PWJA 5A4WA 2HE3A 1I9DA 1XCCA 2HNLA 2P5QA 4L8EA 3FR3A 5ECMB 1WRYA 2JACA 2H6YA 3EC3A 2B5YA 5ECQB 1JZDA 1TKDB 1JZOA 5CAXA 5CRWA 4KSOA 1FOHA 3FMWA 4WF4A 5ECLB 2B1KA 2DJJA 1ERUA 4K5RA 5F06A 2WB9A 2OE3A 2B7KA 4XS6A 3CMIA 3GKKA 4ECIA 1U6TA 1ERVA 5GSTA 4BVXB 3WGEA 5HFIA 1EWXA 1HNCA 1A2JA 5DCHA 1JLVA 1VF4A 2I81A 4BWQA 5JWOB 5DALA 2JZSA 4Q5QA 4IQ1A 1ZCPA 1XW6A 2VLVA 2VL9A 3ZZXA 1OVNA 1GUHA 4EE0A 1TDIA 3PINA 5JCGA 1R26A 4IJIA 2WJUA 1XWBA 3GKXA 5INYA 3PGTA 1WWJA 1BG5A 1OC9A 1EGOA 4K8MA 2IFQB 1SYRA 5IO0A 1OKDA 4NXIA 1M9AA 2PBJA 2H6ZA 5IMZA 3DVWA 2AYTA 11GSA 3CBUA 3HVVA 5BRTA 2CQ9A 2NDOA 3MWHA 3UIWA 1DBYA 3HYPA 5HQPA 2LJKA 3TKSE 3QCPA 4TXOB 5J4UA 4ZBDA 1E6BA 6GSTA 2K6VA 3GA4A 4CW9A 1X9MB 3KCMA 3GKMA 3M3MA 1VRSD 5D9VA 2MMNA 3BCIA 3HHVA 3KH9A 2YWIA 2R2JA 1AQWA 3E0UA 5H5QA 2HT9A 3VK9A 4TR1B 1AW9A 5B8AA 2H74A 2H6XA 1T8EB 2V32A 2LV3A 4DEJA 1FVJA 2WGRA 4AF2A 4KCEA 2VCQA 3IR4A 1YF1A 2CA8A 3G9BA 1B9YC 3KP8A 3LW9A 4JE1A 4KCAA 1I5GA 1W4VA 4POLA 2F51A 2IMKA 4K0GA 2PUKC 3WGXA 3QMXA 4BPYA 4KF9A 3NZNA 1CQHA 4Q5NA 3IHQA 4XRDA 1TRUA 2EIRA 3TKSA 2IMEA 3D22A 2JU5A 4Z7XA 4F82A 1KBNA 2H01A 1BAYA 1U87A 3IHGA 4TXVA 1WPIA 4I6XA 1PKWA 1EP7A 1Z7RA 2CX4A 5CRGA 1O73A 3HA9A 4JEDA 1SKWB 2J23A 3ZIJA 1WE0A 3HJOA 5FT3A 1ZOFA 3LXZA 3BOAA 1EGRA 4Z2RA 4MF7A 2UZ8A 5D9XA 2H30A 2GQLA 4HI7A 2RM5A 1SL1B 1PN9A 1GTIA 2C0EA 1G0TA 1A0RP 2QSIA 2VD0A 2O8VB 1YDKA 4HJ2A 3DMLA 4K1FA 4IN0A 2NVLA 1QMVA 2LTKA 1TXXA 5E59A 5H5SA 2R3XA 4HS1A 1GTUA 1THOA 1FB0A 2PMTA 4K9ZA 4USSA 1V40A 1U3IA 1QGVA 4HEA2 4KNDA 3D5JA 2AAWA 4V2NA 1RK4A 5D93A 2JSZA 6GSWA 3TKSC 1OYJA 1BYEA 1DE2A 4MJBA 5F8BA 2VCVA 1GUKA 4RI7A 1RW1A 4EC0A 4G10A 5DAKA 3ME8A 5IMAA 5J5NA 3D0ZA 3APSA 2ZNMA 5CO3A 2OJLA 2KHPA 2F9SA 2PVQA 5CYYA 3CTGA 4A5PA 2TIRA 3ZVJD 1K3YA 2MBTA 4RUVA 3UAPA 2O85A 1XZOA 4KDUA 5HFGA 3FZ4A 2B6MA 3LQ7A 4FYBA 4WF5A 1M9BA 4EDYA 4TR3A 3UBKA 5D9TA 1OC3A 5DQSA 2HYXA 4CY6A 4NMUA 4LLRA 3RHCA 4ZILA 2XBIA 3O3TA 4TR0A 3UJ1A 3LYPA 4JRRA 1AC1A 4FQUA 3LJRA 5A5KA 4PQIA 2QKEA 1WIKA 3ZYWA 6GSSA 3TGZA 1TTZA 3GL5A 1UVZA 2A2RA 5DALB 4N11A 2VM1A 3E3EA 1XOBA 4RQRA 4MP4A 3TOTA 2CT6A 4EVMA 1U3AA 4MZWA 4K2XA 2L5OA 2VCTA 4G0LA 1E2YA 1Q98A 1OC9B 4TR4A 2IN3A 3NIVA 2L4CA 3L9UA 3IA1A 4V1Ag 2FCHA 1NSWA 2DIZA 4I97A 4MNNA 2V6KA 5CP1A 1Z6NA 3ISOA 2KP2A 4AJ7A 3IRAA 4TKYA 2H0HA 4ZL8A 3CSJA 2L5LA 3RAZA 2QA1A 2C3TA 2GTUA 3ZITA 1TJDA 2X4AA 2DJ1A 2JZRA 4O5QA 1S3DA 3IOSA 2VCZA 1M2AA 2YWOA 4GSNA 3KM6A 1HNAA 1SU9A 1A24A 2DIYA 5KEJA 2E7PA 3GURA 3Q19A 1AQVA 2GT5A 5IOXA 2MBSA 2GVPA 2LSTA 1YY7A 3KIJA 2DBCA 3QR6A 3LXTA 2YANA 1TOFA 14GSA 1SKSB 5ECSA 5JCWA 3TJKA 4RI6A 3MAKA 1VF1A 5IOWA 4POKA 3TRXA 5KN3A 2R0PA 4G0KA 1HD2A 3A5IA 3CRTA 1KTEA 4ACSA 1BJXA 2VL2C 4PQHA 3WYWA 1SKRB 2RM6A 4BL7A 3L4NA 2FGXA 3EMXA 3L0HA 2GLRA 5G5EA 2XHFA 3GH6A 5IIZA 1K0NA 4ZL7A 5CNWA 2VL3A 1B8XA 3D4TA 4G19A 2HSHA 5B6NA 1GNEA 3EINA 2FUG2 3H79A 2GZPA 1B4QA 2P31A 5C00A 3F4SA 2MMZA 2X99A 2XPEA 3VPTA 3MDKA 5IMVA 2R0CA 5EVOA 2DSAA 1GSYA 2L4QA 4HU9A 1FW1A 4E8HA 2LS5A 2WCIA 1USBA 5ECNB 3GHAA 1GTBA 1JLWA 2X8GA 3VLNA 5JCUA 4TVEA 5ECKB 2WFCA 3FR6A 4GCIA 1K0OA 2F8AA 3KD0A 3MYDA 1F37A 2H8LA 3KTBA 2HI7A 2IPAA 4WXTA 3P8WA 2H19A 3GNJA 1SK0A 4MZBA 2PVOC 3F9UA 2X8CA 3CXGA 19GSA 1MDJA 2JL4A 5DQYA 1PRXA 2OBIA 3VI5A 1O8WA 1QK8A 2LJAA 4NHWA 1GLQA 4BA7A 1GUMA 1KEBA 4L5LA 1YZXA 3ZL5A 3D6IA 1B48A 3M8NA 1DSBA 4TW5A 4TN8A 4AJ8A 3H4KA 2CZ3A 2DJKA 1S3AA 4FIWA 3KH7A 4I2TA 5D96A 3GX8A 5DAKB 1IYIA 2GZZA 4XRAA 2X49A 1FHEA 2E0QA 1OAZA 1X0RA 2H76A 1CQGA 2BJXA 3W6GA 1FVKA 1ZMAA 5AN1A 3PPUA 1PSQA 4AGSA 5B7CA 1XVQA 2VUPA 2EC4A 2FA8A 2YZHA 5AISA 1GWCA 2MMAA 1K0CA 1XWGA 2H71A 3US3A 4F03A 4EDZA 3IC4A 1ML6A 5ABRA 1QUWA 3H8QA 2HRNA 1F6MC 5G30A 1YF0A 3DXBA 4O92A 4EF0A 2VO4A 3PR8A 2FNOA 3RDWA 1EV4A 4XCSA 2K8SA 2B1LA 2QA2A 5A4VA 3ZRDA 4MCUA 2HRAA 4JR4A 1Z9HA 1TI1A 4NV5A 5KN0A 3K8NA 2CX3A 4MZCA 3N5OA 3TDGA 1GSSA 2IMDA 4X43A 3IXRA 5DDLA 3HVXA 2O7KA 5IPGA 3H93A 4K6XA 4OO4A 4X0XA 3HJMA 2IJYA 3HVSA 1FO5A 4PUAA 4NAXA 1OE8A 1YEXA 1Y6EA 4J2FA 1Z6MA 1EEMA 2DJ0A 2OBKA 4ZB9A 4ZL9A 1O7UA 4XTSA 2WZ9A 2REMA 5GAPD 2IMFA 4ISDA 2A4VA 2MYGA 4CDOA 2VOCA 4CY8A 4LL4B 4MMMA 1GSEA 1ZYNA 1EOHA 4IS0A 3TRQA 2PU9C 2H66A 3ZFLA 2GGTA 5IMFA 6GSYA 3FK8A 5GSSA 4J57E 3TJFA 1EOGA 1Z3EA 1J9BA 1XIYA 2X64A 3F4RA 2CV4A 2R4VA 1H4OA 3F63A 4ML1A 1A0FA 3LGCA 3VWVA 2YV7A 1ACVA 3QAWA 3VFIA 1NHOA 3QAVA 1DUGA 1R5PA 1AUCA 1BX9A 2HRKA 4KH7A 2M80A 4GSSA 2V2GA 4OWYA 4BL7B 2AV4A 2CVKA 1FB6A 1UN2A 4GSTA 2C1YA 3ZIVA 2RUEA 4MA9A 3APQA 1T4ZA 1XPVA 1TK8B 5ID2A 2BTOT 3EU3A 2OACA 3NOFA 2A2PA 1TK5B 4I5QA 1GP1A 4YQMA 2H1GA 4DSSA 1TRSA 1QXHA 3W8JA 2GQKA 3I9V2 1YKCA 4FH8A 3F6DA 2DKIA 4IHUA 1Q4JA 5D8IA 1YEPA 5IMCA 2YWNA 4JU5A 4P3YB 4MLYA 2TRXA 4F2IA 2FWFA 2HSMA 4NPBA 1B9XC 5DVBA 4EIQA 2AUVA 4ZB6A 2LNTA 2ON7A 5HR3A 2M72A 3R3EA 3DWVA 2ES7A 2LJRA 4MH2A 4ML6A 3ZMLA 4O5UA 2R6KA 4Q5RA 3G7YA 3GN3A 4GLTA 6GSVA 3ED3A 3GIXA 4LMVA 1ST9A 5ENUA 8GSSA 2DC5A 2C80A 1AQXA 3A3TA 4O32A 4OFNA 1VF3A 2K8VA 4DSRA 3TB2A 5JWQB 2XBQA 1JHBA 3P7XA 2L57A 1MEKA 4PTSA 4GQFA 1XFLA 1X9WB 4IVFA 2B3SA 3BCKA 5IMDA 3WT1A 3UVHA 1ILOA 1SYXA 1ZZYA 2L6DA 5LCZA 4KX4A 5HR1A 1XBSA 2LEGA 1EV9A 3CSIA 3LORA 2C3NA 4EIPA 2GT6A 4ZB8A 3EYTA 4PUFC 4WETA 3FZ5A 2O87A 1OKTA 2VLUA 1MD3A 3BJ5A 4V2MA 5KOXA 3QFBC 2WRTA 2YPMA 2YN1A 2M46A 3TKQA 3TOUA 4QL7A 4HDEA 2YJ7A 1Z5YE 1ERTA 1J0FA 4ULXA 4IBPA 4PNFA 3P90A 4HJMA 2JSYA 4F9ZA 4NWYA 2VL2A 1G7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MTC A;  1GUL A;  2B5X A;  3A2V A;  10GS A;  1TP9 A;  3OR5 A;  3QFA C;  4LA1 A;  1T1V A;  2K18 A;  1SD8 A;  2F8F A;  3O76 A;  1ZGN A;  1PGT A;  3CRU A;  5E4W A;  3ZMK A;  2YP6 A;  3VWW A;  1JZW A;  1F2E A;  3IE3 A;  4PUR A;  1V58 A;  5EL8 A;  1MDK A;  1Z7P A;  4N30 A;  2C0G A;  3IK9 A;  12GS A;  4KSM A;  1JFU A;  3RPN A;  1PD2 1;  3GUS A;  1ZYQ B;  1SL0 B;  2P5R A;  4IP1 A;  5J3R A;  3GFK A;  1SJI A;  2WDU A;  4GF0 A;  3RBT A;  4POB A;  2HXK A;  4N0Z A;  1PMT A;  2FY6 A;  3C7M A;  2CVB A;  1C72 A;  2VLT A;  2GSQ A;  2KLX A;  2DJ2 A;  3HZ8 A;  2WUL A;  2HZE A;  4KW6 A;  5JWR B;  4PQ1 A;  3J7Y b;  2DJ3 A;  2KUC A;  4X1U A;  4OFM A;  4ZBA A;  4WEY A;  1PQN A;  2R5G A;  3GRX A;  2YJH A;  3ZLP A;  4YH2 A;  1M2D A;  1JZR A;  3CTF A;  1N2A A;  2NPB A;  5L71 A;  18GS A;  1G6Y A;  1J08 A;  1WP0 A;  3KXO A;  3RHB A;  4I8B A;  4EXJ A;  1GSQ A;  1R7H A;  3L78 A;  3UVT A;  3KZQ A;  3HCZ A;  3L9V A;  4FO5 A;  2YWM A;  3GMF A;  1A8L A;  4KDY A;  2OE1 A;  1PL2 A;  3UOM A;  4O7H A;  4I2U A;  1ZL9 A;  6GSX A;  2ZUP A;  3ZFB A;  4WBJ A;  2J9H A;  5ID2 B;  4GXZ A;  1F3A A;  3J7Y k;  2RII A;  1SJZ A;  1K0D A;  3KMN A;  4DSS B;  3FZA A;  2OE0 A;  1QFN A;  17GS A;  2QGV A;  4D73 A;  1SK2 A;  3SBC A;  2NBS A;  2B7J A;  3GYK A;  2DLX A;  2FHE A;  1GSF A;  2N5F A;  3HKR A;  2CAI A;  1T4Y A;  2PGT A;  4OFT A;  5G2Z A;  1SK1 A;  2HSY A;  3ZRE A;  2X8H A;  3TKP A;  3VWX A;  2GZY A;  1XW5 A;  2EIQ A;  3KGK A;  5EPF A;  2H75 A;  4F0C A;  3SWL A;  4IJ3 A;  4XS4 A;  5CRE A;  1T3B A;  3S9F A;  1LJR A;  2DML A;  3GKN A;  5IQY A;  3QPM A;  5HFK A;  1FAA A;  2C8U A;  2FLS A;  1PKZ A;  1A8Y A;  4DSQ A;  20GS A;  3LFL A;  3EWL A;  2H0G A;  3M1G A;  4XHM A;  2CZ2 A;  5DBQ A;  1PL1 A;  3BD2 A;  4Q5F A;  3D21 A;  3C73 A;  2E2G A;  3GH9 A;  4YAV A;  4BVY A;  1YJ6 A;  4HOJ A;  1ERW A;  5DJL A;  4V2L A;  1GL8 A;  5CRD A;  3EE2 A;  1O6J A;  2JAD A;  5CRH A;  2V1M A;  2GS3 A;  5HR2 A;  3FHK A;  1TRW A;  1A2L A;  2AHE A;  1XWA A;  3LWA A;  1LBK A;  1K0B A;  5J9C A;  3F3R A;  4MAB A;  4YAP A;  1K0M A;  4ECJ A;  3FR9 A;  3I69 A;  4F0B A;  1GNW A;  4XIH A;  1B4P A;  2H72 A;  3Q74 A;  4EKZ A;  1Y25 A;  1GSD A;  4POM A;  5IM9 A;  5G31 A;  2ZCT A;  4JZQ A;  5AIX A;  13GS A;  1V57 A;  1M99 A;  1V2A A;  4XS1 A;  3FRC A;  4KDX A;  3LEF A;  3QOU A;  2MMO A;  5ECP B;  3FY7 A;  3LSZ A;  3RPP A;  3LG6 A;  3C1R A;  4IQA A;  5ECH B;  1GSU A;  1S3C A;  3TJG A;  4PXO A;  1HNB A;  2L6C A;  2GQM A;  5LNK e;  2H1D A;  4WKW A;  5D9W A;  2LKU A;  4ZXG A;  2BMX A;  4EL1 A;  1YKA A;  3GTU A;  1W89 A;  1XWK A;  4GRF A;  4PX1 A;  4IP6 A;  4MK3 A;  2V41 A;  2TRC P;  3M9K A;  4KAE A;  3F0I A;  2VD1 A;  4EO3 A;  1F9M A;  2FWG A;  1A2M A;  4ECC A;  1V9W A;  2FWH A;  1ON4 A;  3U6V A;  3CYN A;  3Q6O A;  5B8B A;  2JZT A;  3C1S A;  1XOA A;  2C3Q A;  5EY6 A;  3TUE A;  3DYR A;  1XWC A;  3ERF A;  2OKA A;  3CSH A;  2I1U A;  2ON5 A;  3KEB A;  4HZ4 A;  3GL3 A;  4PGT A;  1EZK A;  2GST A;  2IIY A;  2K9F A;  3DIE A;  2VAF A;  1OE7 A;  4MPG A;  1G6W A;  1GH2 A;  1LU4 A;  5GZZ B;  1PA3 A;  3P2A A;  5AGY A;  3FKF A;  2G2Q A;  3FEU A;  3IAS 2;  4HUA A;  1WOU A;  4RQX A;  1R4W A;  2HZF A;  1MD4 A;  2ALB A;  4DVC A;  4TRX A;  3FYG A;  2E2M A;  1O81 A;  2HZE B;  9GSS A;  2I3Y A;  3N9J A;  2I9H A;  2AJQ B;  2YOI A;  2CAQ A;  4IGJ A;  4GWR A;  4WR4 A;  4KE3 A;  4JR6 A;  5FHI A;  2QC7 A;  3F3Q A;  4K7I A;  5G5F A;  2O89 A;  4YQV A;  5F05 A;  4G9H A;  3JCM L;  2HRF A;  5IPH A;  3D4M A;  4K7N A;  4KGI A;  1XXU A;  3MNG A;  3A5W A;  4OD7 A;  4MJC A;  2H70 A;  3O6T A;  4E8E A;  5AIV A;  5LD0 A;  2GDR A;  2Z9S A;  1X5E A;  3IDV A;  2N5B A;  4JBB A;  2L59 A;  2FA4 A;  1UA5 A;  2EIO A;  4ILF A;  2VIM A;  4NV2 A;  2YNX A;  1TI3 A;  4ZBB A;  2C0F A;  5ELG A;  3TCO A;  2PN8 A;  5ECO B;  3EVI A;  1O8X A;  3DKS A;  4YQU A;  4HU7 A;  4MF5 A;  4HQS A;  3WT2 A;  3EMP A;  1T7P B;  4BWS A;  2G0F A;  4D73 B;  3IK7 A;  4PNG A;  22GS A;  1TU8 A;  4IKH A;  2R37 A;  1RQM A;  3GSS A;  4K7O A;  3HJP A;  3MSZ A;  3HZ4 A;  5KN2 A;  5F07 A;  1YQ1 A;  1TK0 B;  3APO A;  1WMJ A;  5DCG A;  4KB3 A;  4OCE A;  1NM3 A;  1GLP A;  5H5R A;  4XS4 B;  1EP8 A;  2WS2 A;  3UEM A;  1K3L A;  1U88 A;  5FWG A;  1X5C A;  3IBH A;  4WBR D;  3TJB A;  5G1K A;  3U5R E;  4MJE A;  3Q18 A;  4CHS A;  1BED A;  3IPZ A;  4OO5 A;  1EEJ A;  1URM A;  2LRN A;  2KOK A;  3HY2 A;  2LNS A;  3A2X A;  7GSS A;  4O5R A;  2YV9 A;  4NHZ A;  3GST A;  1ZYE A;  5B6M A;  4OCF A;  5GAN D;  4MJA A;  3W8S A;  3ERW A;  2IWT A;  3ZVJ A;  3IV4 A;  4BVX A;  5C04 A;  3F8U A;  3F6F A;  3FZ9 A;  3H1N A;  3TRP A;  3VPQ A;  3ZTL A;  4MPF A;  4N10 A;  2RLI A;  3I43 A;  2YCD A;  5IO2 A;  2VM2 A;  2IL3 A;  4FYU A;  4K2D A;  1N8J A;  1XVW A;  3TKR A;  4KUN A;  3QAG A;  2LQO A;  3HD5 A;  2NTO A;  4G2E A;  3ME7 A;  4QL9 A;  2IFQ A;  3M0F A;  3LYK A;  3UAR A;  3QD9 A;  2VCX A;  2RUF A;  2HFD A;  5D73 A;  3DD3 A;  1GRX A;  5HR0 A;  5DJM A;  4ID0 A;  3UL3 A;  3GTU B;  3A2W A;  2XPD A;  2AB6 A;  6GSU A;  2OAD A;  4QQ7 A;  5ECR B;  4TXO A;  2LQQ A;  1TRV A;  3EUR A;  4GTU A;  3DGQ A;  3DEX A;  3DVX A;  1T00 A;  2H0I A;  3ERG A;  1K3O A;  4L0U A;  4LMW A;  2A2S A;  2LUS A;  3KMO A;  1G7E A;  5J9B A;  4TR1 A;  3KTL A;  3F4T A;  4OMV A;  4KA0 A;  1OC8 A;  3KP9 A;  1KNG A;  2FD3 A;  1HYU A;  4ZIJ A;  1NHY A;  1VF2 A;  3C71 A;  4FYC A;  2C0D A;  1X9S B;  1UC7 A;  4HQZ A;  1O85 A;  3G7I A;  2DMM A;  2CVD A;  1VGL A;  16GS A;  5A4U A;  3AY8 A;  1M2B A;  3FW2 A;  4N0V A;  1DE1 A;  3I6A A;  2C4J A;  4J56 E;  2P0G A;  1F3B A;  2KP1 A;  1BQ7 A;  1SD9 A;  3EU4 A;  3VUR A;  2XC2 A;  2B5E A;  3QDN A;  4IEL A;  1NW2 A;  1H75 A;  2VCW A;  4K0N A;  1SL2 B;  4V1A p;  3TJJ A;  4ECB A;  2HLS A;  1A23 A;  5F0G A;  1K0A A;  2LRC A;  2GSS A;  2LRT A;  1HQO A;  5KN1 A;  3PH9 A;  5G1L A;  2YZU A;  4MF6 A;  3VI7 A;  3UBL A;  1FOV A;  3GV1 A;  1GTA A;  2H73 A;  1ABA A;  1R5A A;  4WR5 A;  2I4A A;  4TOP A;  3M9J A;  2IMI A;  3HXS A;  4EUY A;  1THX A;  1M7T A;  2GSR A;  4MDC A;  2H1B A;  1TU7 A;  1AIU A;  2PER A;  1PX6 A;  2N5A A;  5ECI B;  1X5D A;  3R2Q A;  1M0U A;  1AAZ A;  3WGD A;  4L5O A;  2FWE A;  2PPT A;  3KJY A;  3VWU A;  1PX7 A;  3UMA A;  1TW9 A;  4GQC A;  3C8E A;  5J41 A;  1FG4 A;  1SEN A;  3HDC A;  1MDI A;  2H1A A;  3IAM 2;  3GX0 A;  4MH3 A;  3BBY A;  4IW9 A;  2OA7 A;  1QQ2 A;  1IYH A;  2MZC A;  4L0W A;  3G7J A;  2V6O A;  4LL1 B;  1SJ6 A;  3WD6 A;  1V98 A;  5COH A;  4AJ6 A;  3V1W A;  5ELA A;  1AXD A;  2D2Z A;  1WJK A;  2F3M A;  3E9J B;  4HZ2 A;  3DRN A;  3L9S A;  4H86 A;  1XW9 A;  2PWJ A;  5A4W A;  2HE3 A;  1I9D A;  1XCC A;  2HNL A;  2P5Q A;  4L8E A;  3FR3 A;  5ECM B;  1WRY A;  2JAC A;  2H6Y A;  3EC3 A;  2B5Y A;  5ECQ B;  1JZD A;  1TKD B;  1JZO A;  5CAX A;  5CRW A;  4KSO A;  4WF4 A;  5ECL B;  2B1K A;  2DJJ A;  1ERU A;  5F06 A;  2WB9 A;  2OE3 A;  2B7K A;  4XS6 A;  3CMI A;  3GKK A;  4ECI A;  1U6T A;  1ERV A;  5GST A;  3WGE A;  5HFI A;  1EWX A;  1HNC A;  1A2J A;  5DCH A;  1JLV A;  1VF4 A;  2I81 A;  4BWQ A;  5JWO B;  5DAL A;  2JZS A;  4Q5Q A;  4IQ1 A;  1ZCP A;  1XW6 A;  2VLV A;  2VL9 A;  3ZZX A;  1OVN A;  1GUH A;  4EE0 A;  1TDI A;  3PIN A;  5JCG A;  1R26 A;  4IJI A;  2WJU A;  1XWB A;  3GKX A;  5INY A;  3PGT A;  1WWJ A;  1BG5 A;  1OC9 A;  1EGO A;  4K8M A;  2IFQ B;  1SYR A;  5IO0 A;  1OKD A;  4NXI A;  1M9A A;  2PBJ A;  2H6Z A;  5IMZ A;  3DVW A;  2AYT A;  11GS A;  3CBU A;  3HVV A;  2CQ9 A;  2NDO A;  3MWH A;  3UIW A;  1DBY A;  3HYP A;  5HQP A;  2LJK A;  3TKS E;  3QCP A;  4TXO B;  5J4U A;  4ZBD A;  1E6B A;  6GST A;  2K6V A;  3GA4 A;  4CW9 A;  1X9M B;  3KCM A;  3GKM A;  3M3M A;  1VRS D;  5D9V A;  2MMN A;  3BCI A;  3HHV A;  3KH9 A;  2YWI A;  2R2J A;  1AQW A;  3E0U A;  5H5Q A;  2HT9 A;  3VK9 A;  4TR1 B;  1AW9 A;  5B8A A;  2H74 A;  2H6X A;  1T8E B;  2V32 A;  2LV3 A;  4DEJ A;  1FVJ A;  2WGR A;  4AF2 A;  4KCE A;  2VCQ A;  3IR4 A;  1YF1 A;  2CA8 A;  3G9B A;  1B9Y C;  3KP8 A;  4JE1 A;  4KCA A;  1I5G A;  1W4V A;  4POL A;  2F51 A;  2IMK A;  4K0G A;  2PUK C;  3WGX A;  3QMX A;  4BPY A;  3NZN A;  1CQH A;  4Q5N A;  3IHQ A;  4XRD A;  1TRU A;  2EIR A;  3TKS A;  2IME A;  3D22 A;  2JU5 A;  4Z7X A;  4F82 A;  1KBN A;  2H01 A;  1BAY A;  1U87 A;  4TXV A;  1WPI A;  4I6X A;  1PKW A;  1EP7 A;  1Z7R A;  2CX4 A;  5CRG A;  1O73 A;  3HA9 A;  4JED A;  1SKW B;  2J23 A;  3ZIJ A;  1WE0 A;  3HJO A;  5FT3 A;  1ZOF A;  3LXZ A;  3BOA A;  1EGR A;  4MF7 A;  5D9X A;  2H30 A;  2GQL A;  4HI7 A;  2RM5 A;  1SL1 B;  1PN9 A;  1GTI A;  2C0E A;  1G0T A;  1A0R P;  2QSI A;  2VD0 A;  2O8V B;  1YDK A;  4HJ2 A;  3DML A;  4K1F A;  4IN0 A;  2NVL A;  1QMV A;  2LTK A;  1TXX A;  5E59 A;  5H5S A;  2R3X A;  4HS1 A;  1GTU A;  1THO A;  1FB0 A;  2PMT A;  4K9Z A;  1V40 A;  1U3I A;  1QGV A;  4HEA 2;  4KND A;  3D5J A;  2AAW A;  4V2N A;  1RK4 A;  5D93 A;  2JSZ A;  6GSW A;  3TKS C;  1OYJ A;  1BYE A;  1DE2 A;  4MJB A;  5F8B A;  2VCV A;  1GUK A;  4RI7 A;  1RW1 A;  4EC0 A;  4G10 A;  5DAK A;  3ME8 A;  5IMA A;  5J5N A;  3D0Z A;  3APS A;  2ZNM A;  5CO3 A;  2OJL A;  2KHP A;  2F9S A;  2PVQ A;  5CYY A;  3CTG A;  2TIR A;  3ZVJ D;  1K3Y A;  2MBT A;  4RUV A;  3UAP A;  2O85 A;  1XZO A;  4KDU A;  5HFG A;  3FZ4 A;  2B6M A;  3LQ7 A;  4FYB A;  4WF5 A;  1M9B A;  4EDY A;  4TR3 A;  3UBK A;  5D9T A;  1OC3 A;  5DQS A;  2HYX A;  4NMU A;  4LLR A;  3RHC A;  4ZIL A;  2XBI A;  3O3T A;  4TR0 A;  3UJ1 A;  3LYP A;  4JRR A;  1AC1 A;  3LJR A;  5A5K A;  4PQI A;  2QKE A;  1WIK A;  3ZYW A;  6GSS A;  3TGZ A;  1TTZ A;  3GL5 A;  1UVZ A;  2A2R A;  5DAL B;  4N11 A;  2VM1 A;  3E3E A;  1XOB A;  4RQR A;  4MP4 A;  3TOT A;  2CT6 A;  4EVM A;  1U3A A;  4MZW A;  2L5O A;  2VCT A;  1E2Y A;  1Q98 A;  1OC9 B;  4TR4 A;  2IN3 A;  3NIV A;  2L4C A;  3L9U A;  3IA1 A;  4V1A g;  2FCH A;  1NSW A;  2DIZ A;  4I97 A;  2V6K A;  5CP1 A;  1Z6N A;  3ISO A;  2KP2 A;  4AJ7 A;  3IRA A;  4TKY A;  2H0H A;  4ZL8 A;  3CSJ A;  2L5L A;  3RAZ A;  2C3T A;  2GTU A;  3ZIT A;  1TJD A;  2DJ1 A;  2JZR A;  1S3D A;  3IOS A;  2VCZ A;  1M2A A;  2YWO A;  4GSN A;  3KM6 A;  1HNA A;  1SU9 A;  1A24 A;  2DIY A;  5KEJ A;  2E7P A;  3GUR A;  3Q19 A;  1AQV A;  2GT5 A;  5IOX A;  2MBS A;  2GVP A;  2LST A;  1YY7 A;  3KIJ A;  2DBC A;  3QR6 A;  3LXT A;  2YAN A;  1TOF A;  14GS A;  1SKS B;  5ECS A;  5JCW A;  3TJK A;  4RI6 A;  3MAK A;  1VF1 A;  5IOW A;  4POK A;  3TRX A;  5KN3 A;  1HD2 A;  3CRT A;  1KTE A;  4ACS A;  1BJX A;  2VL2 C;  4PQH A;  3WYW A;  1SKR B;  2RM6 A;  4BL7 A;  3L4N A;  2FGX A;  3EMX A;  3L0H A;  2GLR A;  5G5E A;  2XHF A;  3GH6 A;  5IIZ A;  1K0N A;  4ZL7 A;  5CNW A;  2VL3 A;  1B8X A;  3D4T A;  4G19 A;  2HSH A;  5B6N A;  1GNE A;  3EIN A;  2FUG 2;  3H79 A;  2GZP A;  1B4Q A;  2P31 A;  5C00 A;  3F4S A;  2MMZ A;  2X99 A;  2XPE A;  3VPT A;  3MDK A;  5IMV A;  5EVO A;  2DSA A;  1GSY A;  2L4Q A;  4HU9 A;  1FW1 A;  4E8H A;  2LS5 A;  2WCI A;  1USB A;  5ECN B;  3GHA A;  1GTB A;  1JLW A;  2X8G A;  3VLN A;  5JCU A;  4TVE A;  5ECK B;  2WFC A;  3FR6 A;  4GCI A;  1K0O A;  2F8A A;  3KD0 A;  1F37 A;  2H8L A;  3KTB A;  2HI7 A;  2IPA A;  4WXT A;  3P8W A;  2H19 A;  3GNJ A;  1SK0 A;  4MZB A;  2PVO C;  3F9U A;  2X8C A;  3CXG A;  19GS A;  1MDJ A;  2JL4 A;  5DQY A;  1PRX A;  2OBI A;  3VI5 A;  1O8W A;  1QK8 A;  2LJA A;  4NHW A;  1GLQ A;  4BA7 A;  1GUM A;  1KEB A;  4L5L A;  1YZX A;  3ZL5 A;  3D6I A;  1B48 A;  3M8N A;  1DSB A;  4TW5 A;  4TN8 A;  4AJ8 A;  3H4K A;  2CZ3 A;  2DJK A;  1S3A A;  4FIW A;  3KH7 A;  4I2T A;  5D96 A;  3GX8 A;  5DAK B;  1IYI A;  2GZZ A;  4XRA A;  1FHE A;  2E0Q A;  1OAZ A;  1X0R A;  2H76 A;  1CQG A;  2BJX A;  3W6G A;  1FVK A;  1ZMA A;  5AN1 A;  1PSQ A;  4AGS A;  5B7C A;  1XVQ A;  2VUP A;  2EC4 A;  2FA8 A;  2YZH A;  5AIS A;  1GWC A;  2MMA A;  1K0C A;  1XWG A;  2H71 A;  3US3 A;  4F03 A;  4EDZ A;  3IC4 A;  1ML6 A;  5ABR A;  1QUW A;  3H8Q A;  2HRN A;  1F6M C;  5G30 A;  1YF0 A;  3DXB A;  4O92 A;  4EF0 A;  2VO4 A;  3PR8 A;  2FNO A;  3RDW A;  1EV4 A;  4XCS A;  2K8S A;  2B1L A;  5A4V A;  3ZRD A;  4MCU A;  4JR4 A;  1Z9H A;  1TI1 A;  4NV5 A;  5KN0 A;  3K8N A;  2CX3 A;  4MZC A;  3N5O A;  3TDG A;  1GSS A;  2IMD A;  4X43 A;  3IXR A;  5DDL A;  3HVX A;  2O7K A;  5IPG A;  3H93 A;  4K6X A;  4OO4 A;  4X0X A;  3HJM A;  2IJY A;  3HVS A;  1FO5 A;  4PUA A;  4NAX A;  1OE8 A;  1YEX A;  1Y6E A;  4J2F A;  1Z6M A;  1EEM A;  2DJ0 A;  2OBK A;  4ZB9 A;  4ZL9 A;  1O7U A;  4XTS A;  2WZ9 A;  2REM A;  5GAP D;  2IMF A;  4ISD A;  2A4V A;  2MYG A;  4CDO A;  2VOC A;  4LL4 B;  4MMM A;  1GSE A;  1EOH A;  4IS0 A;  3TRQ A;  2PU9 C;  2H66 A;  3ZFL A;  2GGT A;  5IMF A;  6GSY A;  3FK8 A;  5GSS A;  4J57 E;  3TJF A;  1EOG A;  1Z3E A;  1J9B A;  1XIY A;  2X64 A;  3F4R A;  2CV4 A;  2R4V A;  1H4O A;  3F63 A;  4ML1 A;  1A0F A;  3LGC A;  3VWV A;  2YV7 A;  1ACV A;  3QAW A;  3VFI A;  1NHO A;  3QAV A;  1DUG A;  1R5P A;  1AUC A;  1BX9 A;  4KH7 A;  2M80 A;  4GSS A;  2V2G A;  4OWY A;  2AV4 A;  2CVK A;  1FB6 A;  1UN2 A;  4GST A;  2C1Y A;  3ZIV A;  2RUE A;  4MA9 A;  3APQ A;  1T4Z A;  1XPV A;  1TK8 B;  5ID2 A;  2BTO T;  3EU3 A;  2OAC A;  3NOF A;  1TK5 B;  4I5Q A;  1GP1 A;  4YQM A;  2H1G A;  4DSS A;  1TRS A;  1QXH A;  3W8J A;  2GQK A;  3I9V 2;  1YKC A;  4FH8 A;  3F6D A;  4IHU A;  1Q4J A;  5D8I A;  1YEP A;  5IMC A;  2YWN A;  4JU5 A;  4P3Y B;  4MLY A;  2TRX A;  4F2I A;  2FWF A;  4NPB A;  1B9X C;  5DVB A;  2AUV A;  4ZB6 A;  2LNT A;  2ON7 A;  5HR3 A;  2M72 A;  3DWV A;  2ES7 A;  2LJR A;  4MH2 A;  4ML6 A;  3ZML A;  2R6K A;  4Q5R A;  3G7Y A;  3GN3 A;  4GLT A;  6GSV A;  3ED3 A;  3GIX A;  4LMV A;  1ST9 A;  5ENU A;  8GSS A;  2DC5 A;  2C80 A;  1AQX A;  3A3T A;  4O32 A;  4OFN A;  1VF3 A;  2K8V A;  4DSR A;  3TB2 A;  5JWQ B;  2XBQ A;  1JHB A;  3P7X A;  2L57 A;  1MEK A;  4GQF A;  1XFL A;  1X9W B;  4IVF A;  2B3S A;  3BCK A;  5IMD A;  3WT1 A;  3UVH A;  1ILO A;  1SYX A;  1ZZY A;  2L6D A;  5LCZ A;  4KX4 A;  5HR1 A;  1XBS A;  2LEG A;  1EV9 A;  3CSI A;  3LOR A;  2C3N A;  2GT6 A;  4ZB8 A;  3EYT A;  4PUF C;  4WET A;  3FZ5 A;  2O87 A;  1OKT A;  2VLU A;  1MD3 A;  3BJ5 A;  4V2M A;  3QFB C;  2WRT A;  2YPM A;  2YN1 A;  2M46 A;  3TKQ A;  3TOU A;  4QL7 A;  4HDE A;  2YJ7 A;  1Z5Y E;  1ERT A;  1J0F A;  4ULX A;  4IBP A;  4PNF A;  3P90 A;  4HJM A;  2JSY A;  4F9Z A;  4NWY A;  2VL2 A;  1G7O A; 
#chains in the Genus database with same CATH topology
 1MTC A;  1GUL A;  2B5X A;  3A2V A;  10GS A;  2R0G A;  1TP9 A;  3OR5 A;  3QFA C;  4LA1 A;  1T1V A;  2K18 A;  1SD8 A;  2F8F A;  3O76 A;  1ZGN A;  1PGT A;  3CRU A;  5E4W A;  3ZMK A;  2YP6 A;  3VWW A;  1JZW A;  1F2E A;  3IE3 A;  4PUR A;  1V58 A;  5EL8 A;  1MDK A;  1Z7P A;  4N30 A;  4BIK A;  2C0G A;  3IK9 A;  12GS A;  4KSM A;  1JFU A;  3RPN A;  1PD2 1;  3GUS A;  1ZYQ B;  1SL0 B;  2P5R A;  4IP1 A;  5J3R A;  3GFK A;  1SJI A;  2WDU A;  4GF0 A;  3RBT A;  4POB A;  2HXK A;  4N0Z A;  1PMT A;  2FY6 A;  3C7M A;  2CVB A;  1C72 A;  2VLT A;  2GSQ A;  2KLX A;  2DJ2 A;  3HZ8 A;  2WUL A;  2HZE A;  4KW6 A;  5JWR B;  4PQ1 A;  3J7Y b;  2DJ3 A;  2KUC A;  4X1U A;  4OFM A;  4ZBA A;  4WEY A;  1PQN A;  2R5G A;  3GRX A;  2YJH A;  3ZLP A;  4YH2 A;  1M2D A;  1JZR A;  3CTF A;  1N2A A;  2NPB A;  1PFO A;  5L71 A;  18GS A;  1G6Y A;  1J08 A;  1WP0 A;  3KXO A;  3RHB A;  4I8B A;  4EXJ A;  1GSQ A;  1R7H A;  3L78 A;  3UVT A;  3KZQ A;  3HCZ A;  3L9V A;  4FO5 A;  2YWM A;  2A4H A;  3GMF A;  1A8L A;  4KDY A;  2OE1 A;  1PL2 A;  3UOM A;  4O7H A;  4I2U A;  1ZL9 A;  6GSX A;  2ZUP A;  3ZFB A;  4WBJ A;  2J9H A;  5ID2 B;  4GXZ A;  1F3A A;  4YKG A;  3J7Y k;  2RII A;  1SJZ A;  1K0D A;  3KMN A;  4DSS B;  3FZA A;  2OE0 A;  1QFN A;  17GS A;  2QGV A;  4D73 A;  1SK2 A;  4Z2U A;  3SBC A;  1XG8 A;  2NBS A;  2B7J A;  3GYK A;  2DLX A;  2FHE A;  1GSF A;  2N5F A;  3HKR A;  2CAI A;  1T4Y A;  2PGT A;  4OFT A;  5G2Z A;  1SK1 A;  2HSY A;  3ZRE A;  2X8H A;  3TKP A;  3VWX A;  2GZY A;  3HVN A;  1XW5 A;  2EIQ A;  3KGK A;  5EPF A;  2H75 A;  4F0C A;  3SWL A;  4IJ3 A;  4XS4 A;  5CRE A;  1T3B A;  3S9F A;  1LJR A;  2DML A;  3GKN A;  5IQY A;  3QPM A;  5HFK A;  1FAA A;  2C8U A;  4X4J A;  2FLS A;  1PKZ A;  1A8Y A;  4DSQ A;  20GS A;  3LFL A;  3EWL A;  2H0G A;  3M1G A;  4XHM A;  2CZ2 A;  5DBQ A;  1PL1 A;  3BD2 A;  4Q5F A;  3D21 A;  3C73 A;  2E2G A;  3GH9 A;  4YAV A;  4BVY A;  1YJ6 A;  4HOJ A;  1ERW A;  2DKH A;  5DJL A;  4V2L A;  1GL8 A;  5CRD A;  3EE2 A;  1O6J A;  2JAD A;  5CRH A;  2V1M A;  2GS3 A;  5HR2 A;  3FHK A;  1TRW A;  1A2L A;  2AHE A;  1XWA A;  3LWA A;  1LBK A;  1K0B A;  5J9C A;  3F3R A;  4MAB A;  4YAP A;  1K0M A;  4ECJ A;  3FR9 A;  3I69 A;  4F0B A;  1GNW A;  4XIH A;  1B4P A;  2H72 A;  3Q74 A;  4EKZ A;  1Y25 A;  1GSD A;  4POM A;  5IM9 A;  5G31 A;  2ZCT A;  4JZQ A;  5AIX A;  13GS A;  1V57 A;  1M99 A;  1V2A A;  4XS1 A;  3FRC A;  4KDX A;  3LEF A;  3QOU A;  2MMO A;  5ECP B;  3FY7 A;  3LSZ A;  3RPP A;  3LG6 A;  3C1R A;  4IQA A;  5ECH B;  1GSU A;  1S3C A;  3TJG A;  4PXO A;  1HNB A;  2L6C A;  2GQM A;  5LNK e;  2H1D A;  4WKW A;  5D9W A;  2LKU A;  4ZXG A;  2BMX A;  4EL1 A;  1YKA A;  3GTU A;  1W89 A;  1XWK A;  4GRF A;  4PX1 A;  4IP6 A;  4MK3 A;  2V41 A;  2TRC P;  3M9K A;  4KAE A;  3F0I A;  2VD1 A;  4EO3 A;  1F9M A;  2FWG A;  1A2M A;  4ECC A;  1V9W A;  2FWH A;  1ON4 A;  3U6V A;  3CYN A;  3Q6O A;  5B8B A;  2JZT A;  3C1S A;  1XOA A;  2C3Q A;  5EY6 A;  3TUE A;  3DYR A;  1XWC A;  3ERF A;  2OKA A;  3CSH A;  2I1U A;  2ON5 A;  3KEB A;  4HZ4 A;  3GL3 A;  4PGT A;  1EZK A;  2GST A;  2IIY A;  2K9F A;  3DIE A;  2VAF A;  1OE7 A;  4MPG A;  1G6W A;  1GH2 A;  1LU4 A;  5GZZ B;  1PA3 A;  3P2A A;  5AGY A;  3FKF A;  2G2Q A;  3FEU A;  3IAS 2;  4HUA A;  1WOU A;  4RQX A;  1R4W A;  2HZF A;  1MD4 A;  2ALB A;  4DVC A;  4TRX A;  3FYG A;  2E2M A;  1O81 A;  2HZE B;  9GSS A;  2I3Y A;  3N9J A;  2I9H A;  2AJQ B;  5KOW A;  2YOI A;  2CAQ A;  4IGJ A;  4GWR A;  4WR4 A;  4KE3 A;  4JR6 A;  5FHI A;  2QC7 A;  3F3Q A;  4K7I A;  5G5F A;  2O89 A;  4YQV A;  5F05 A;  4G9H A;  3JCM L;  2HRF A;  5IPH A;  3D4M A;  4K7N A;  4Z2T A;  4ICY A;  4KGI A;  1XXU A;  3MNG A;  3A5W A;  4YKF A;  4OD7 A;  4MJC A;  2H70 A;  3O6T A;  4E8E A;  3IC8 A;  5AIV A;  5BMU A;  5LD0 A;  2GDR A;  2Z9S A;  1X5E A;  3IDV A;  2N5B A;  4JBB A;  2L59 A;  2FA4 A;  1UA5 A;  2EIO A;  4ILF A;  2VIM A;  4NV2 A;  2YNX A;  1TI3 A;  4ZBB A;  2C0F A;  5ELG A;  3TCO A;  2PN8 A;  5ECO B;  3EVI A;  1O8X A;  3DKS A;  4YQU A;  4HU7 A;  4MF5 A;  4HQS A;  3WT2 A;  3EMP A;  1T7P B;  4BWS A;  2G0F A;  1PN0 A;  3IK7 A;  4D73 B;  4PNG A;  22GS A;  1TU8 A;  4IKH A;  2R37 A;  1RQM A;  3GSS A;  4K7O A;  3HJP A;  3MSZ A;  3HZ4 A;  5KN2 A;  5F07 A;  4K5S A;  1YQ1 A;  1TK0 B;  3APO A;  1WMJ A;  5DCG A;  4KB3 A;  4OCE A;  1NM3 A;  1GLP A;  5H5R A;  4XS4 B;  1EP8 A;  2WS2 A;  3UEM A;  1K3L A;  1U88 A;  5FWG A;  1X5C A;  3IBH A;  4WBR D;  3TJB A;  5G1K A;  3U5R E;  4MJE A;  3Q18 A;  4CHS A;  1BED A;  3IPZ A;  4OO5 A;  1EEJ A;  1URM A;  2LRN A;  2KOK A;  3HY2 A;  4BVY B;  2LNS A;  3A2X A;  7GSS A;  4O5R A;  2YV9 A;  4NHZ A;  3GST A;  1ZYE A;  5B6M A;  4OCF A;  5GAN D;  4MJA A;  3W8S A;  3ERW A;  2IWT A;  3ZVJ A;  3IV4 A;  4BVX A;  5C04 A;  3F8U A;  3F6F A;  3FZ9 A;  3H1N A;  3TRP A;  3VPQ A;  3ZTL A;  4MPF A;  4N10 A;  2RLI A;  3I43 A;  2YCD A;  5IO2 A;  2VM2 A;  2IL3 A;  4FYU A;  4K2D A;  1N8J A;  1XVW A;  3TKR A;  4KUN A;  3QAG A;  2LQO A;  3HD5 A;  2NTO A;  4G2E A;  3ME7 A;  4QL9 A;  2IFQ A;  3M0F A;  3LYK A;  3UAR A;  3QD9 A;  2VCX A;  2RUF A;  2HFD A;  5D73 A;  3DD3 A;  1GRX A;  5HR0 A;  5DJM A;  4ID0 A;  3UL3 A;  3GTU B;  3A2W A;  2XPD A;  2AB6 A;  6GSU A;  2OAD A;  4QQ7 A;  5ECR B;  4TXO A;  2LQQ A;  1TRV A;  3EUR A;  4GTU A;  3DGQ A;  3DEX A;  3DVX A;  1T00 A;  2H0I A;  3ERG A;  1K3O A;  4L0U A;  4LMW A;  2A2S A;  2LUS A;  3KMO A;  1G7E A;  5J9B A;  4TR1 A;  3KTL A;  3F4T A;  4OMV A;  4KA0 A;  1OC8 A;  3KP9 A;  1KNG A;  2FD3 A;  1HYU A;  4ZIJ A;  1NHY A;  1VF2 A;  3C71 A;  4FYC A;  2C0D A;  1X9S B;  1UC7 A;  4HQZ A;  1O85 A;  3G7I A;  2DMM A;  2CVD A;  1VGL A;  16GS A;  5A4U A;  3AY8 A;  1M2B A;  3FW2 A;  4N0V A;  1DE1 A;  3I6A A;  2C4J A;  4J56 E;  2P0G A;  1F3B A;  2KP1 A;  1BQ7 A;  1SD9 A;  3EU4 A;  3VUR A;  2XC2 A;  2B5E A;  3QDN A;  4IEL A;  1NW2 A;  1H75 A;  2VCW A;  3MIX A;  4K0N A;  1SL2 B;  4V1A p;  3TJJ A;  4ECB A;  3EPT A;  2HLS A;  1A23 A;  5F0G A;  1K0A A;  2LRC A;  2GSS A;  2LRT A;  1HQO A;  5KN1 A;  3PH9 A;  5G1L A;  2YZU A;  4MF6 A;  3VI7 A;  3UBL A;  1FOV A;  3GV1 A;  1GTA A;  2H73 A;  1ABA A;  1R5A A;  4WR5 A;  2I4A A;  1ZYP A;  4TOP A;  3M9J A;  2IMI A;  3HXS A;  4EUY A;  1THX A;  1M7T A;  2GSR A;  4MDC A;  2H1B A;  1TU7 A;  1AIU A;  2PER A;  1PX6 A;  1M3J A;  2N5A A;  5ECI B;  1X5D A;  3R2Q A;  1M0U A;  1AAZ A;  3WGD A;  4L5O A;  2FWE A;  2PPT A;  3KJY A;  3VWU A;  1PX7 A;  3UMA A;  1TW9 A;  4GQC A;  3C8E A;  5J41 A;  1FG4 A;  1SEN A;  3HDC A;  1MDI A;  2H1A A;  3IAM 2;  3GX0 A;  4MH3 A;  3BBY A;  4G0I A;  4IW9 A;  2OA7 A;  1QQ2 A;  1IYH A;  2MZC A;  4L0W A;  3G7J A;  2V6O A;  4LL1 B;  1SJ6 A;  3WD6 A;  1V98 A;  5COH A;  4AJ6 A;  3V1W A;  5ELA A;  1AXD A;  2D2Z A;  1WJK A;  2F3M A;  3E9J B;  4HZ2 A;  3DRN A;  3L9S A;  4H86 A;  1XW9 A;  2PWJ A;  5A4W A;  2HE3 A;  1I9D A;  1XCC A;  2HNL A;  2P5Q A;  4L8E A;  3FR3 A;  5ECM B;  1WRY A;  2JAC A;  2H6Y A;  3EC3 A;  2B5Y A;  5ECQ B;  1JZD A;  1TKD B;  1JZO A;  5CAX A;  5CRW A;  4KSO A;  1FOH A;  3FMW A;  4WF4 A;  5ECL B;  2B1K A;  2DJJ A;  1ERU A;  4K5R A;  5F06 A;  2WB9 A;  2OE3 A;  2B7K A;  4XS6 A;  3CMI A;  3GKK A;  4ECI A;  1U6T A;  1ERV A;  5GST A;  4BVX B;  3WGE A;  5HFI A;  1EWX A;  1HNC A;  1A2J A;  5DCH A;  1JLV A;  1VF4 A;  2I81 A;  4BWQ A;  5JWO B;  5DAL A;  2JZS A;  4Q5Q A;  4IQ1 A;  1ZCP A;  1XW6 A;  2VLV A;  2VL9 A;  3ZZX A;  1OVN A;  1GUH A;  4EE0 A;  1TDI A;  3PIN A;  5JCG A;  1R26 A;  4IJI A;  2WJU A;  1XWB A;  3GKX A;  5INY A;  3PGT A;  1WWJ A;  1BG5 A;  1OC9 A;  1EGO A;  4K8M A;  2IFQ B;  1SYR A;  5IO0 A;  1OKD A;  4NXI A;  1M9A A;  2PBJ A;  2H6Z A;  5IMZ A;  3DVW A;  2AYT A;  11GS A;  3CBU A;  3HVV A;  5BRT A;  2CQ9 A;  2NDO A;  3MWH A;  3UIW A;  1DBY A;  3HYP A;  5HQP A;  2LJK A;  3TKS E;  3QCP A;  4TXO B;  5J4U A;  4ZBD A;  1E6B A;  6GST A;  2K6V A;  3GA4 A;  4CW9 A;  1X9M B;  3KCM A;  3GKM A;  3M3M A;  1VRS D;  5D9V A;  2MMN A;  3BCI A;  3HHV A;  3KH9 A;  2YWI A;  2R2J A;  1AQW A;  3E0U A;  5H5Q A;  2HT9 A;  3VK9 A;  4TR1 B;  1AW9 A;  5B8A A;  2H74 A;  2H6X A;  1T8E B;  2V32 A;  2LV3 A;  4DEJ A;  1FVJ A;  2WGR A;  4AF2 A;  4KCE A;  2VCQ A;  3IR4 A;  1YF1 A;  2CA8 A;  3G9B A;  1B9Y C;  3KP8 A;  3LW9 A;  4JE1 A;  4KCA A;  1I5G A;  1W4V A;  4POL A;  2F51 A;  2IMK A;  4K0G A;  2PUK C;  3WGX A;  3QMX A;  4BPY A;  4KF9 A;  3NZN A;  1CQH A;  4Q5N A;  3IHQ A;  4XRD A;  1TRU A;  2EIR A;  3TKS A;  2IME A;  3D22 A;  2JU5 A;  4Z7X A;  4F82 A;  1KBN A;  2H01 A;  1BAY A;  1U87 A;  3IHG A;  4TXV A;  1WPI A;  4I6X A;  1PKW A;  1EP7 A;  1Z7R A;  2CX4 A;  5CRG A;  1O73 A;  3HA9 A;  4JED A;  1SKW B;  2J23 A;  3ZIJ A;  1WE0 A;  3HJO A;  5FT3 A;  1ZOF A;  3LXZ A;  3BOA A;  1EGR A;  4Z2R A;  4MF7 A;  2UZ8 A;  5D9X A;  2H30 A;  2GQL A;  4HI7 A;  2RM5 A;  1SL1 B;  1PN9 A;  1GTI A;  2C0E A;  1G0T A;  1A0R P;  2QSI A;  2VD0 A;  2O8V B;  1YDK A;  4HJ2 A;  3DML A;  4K1F A;  4IN0 A;  2NVL A;  1QMV A;  2LTK A;  1TXX A;  5E59 A;  5H5S A;  2R3X A;  4HS1 A;  1GTU A;  1THO A;  1FB0 A;  2PMT A;  4K9Z A;  4USS A;  1V40 A;  1U3I A;  1QGV A;  4HEA 2;  4KND A;  3D5J A;  2AAW A;  4V2N A;  1RK4 A;  5D93 A;  2JSZ A;  6GSW A;  1M3I A;  3TKS C;  1OYJ A;  1BYE A;  1DE2 A;  4MJB A;  5F8B A;  2VCV A;  1GUK A;  4RI7 A;  1RW1 A;  4EC0 A;  4G10 A;  5DAK A;  3ME8 A;  5IMA A;  5J5N A;  3D0Z A;  3APS A;  2ZNM A;  5CO3 A;  2OJL A;  2KHP A;  2F9S A;  2PVQ A;  5CYY A;  3CTG A;  4A5P A;  2TIR A;  3ZVJ D;  1K3Y A;  2MBT A;  4RUV A;  3UAP A;  2O85 A;  1XZO A;  4KDU A;  5HFG A;  3FZ4 A;  2B6M A;  3LQ7 A;  4FYB A;  4WF5 A;  1M9B A;  4EDY A;  4TR3 A;  3UBK A;  5D9T A;  1OC3 A;  5DQS A;  2HYX A;  4CY6 A;  4NMU A;  4LLR A;  3RHC A;  4ZIL A;  2XBI A;  3O3T A;  4TR0 A;  3UJ1 A;  3LYP A;  4JRR A;  1AC1 A;  4FQU A;  3LJR A;  5A5K A;  4PQI A;  2QKE A;  1WIK A;  3ZYW A;  6GSS A;  3TGZ A;  1TTZ A;  3GL5 A;  1UVZ A;  2A2R A;  5DAL B;  4N11 A;  2VM1 A;  3E3E A;  1XOB A;  4RQR A;  4MP4 A;  3TOT A;  2CT6 A;  4EVM A;  1U3A A;  4MZW A;  4K2X A;  2L5O A;  2VCT A;  4G0L A;  1E2Y A;  1Q98 A;  1OC9 B;  4TR4 A;  2IN3 A;  3NIV A;  2L4C A;  3L9U A;  3IA1 A;  4V1A g;  2FCH A;  1NSW A;  2DIZ A;  4I97 A;  4MNN A;  2V6K A;  5CP1 A;  1Z6N A;  3ISO A;  2KP2 A;  4AJ7 A;  3IRA A;  4TKY A;  2H0H A;  4ZL8 A;  3CSJ A;  2L5L A;  3RAZ A;  2QA1 A;  2C3T A;  2GTU A;  3ZIT A;  1TJD A;  2X4A A;  2DJ1 A;  2JZR A;  4O5Q A;  1S3D A;  3IOS A;  2VCZ A;  1M2A A;  2YWO A;  4GSN A;  3KM6 A;  1HNA A;  1SU9 A;  1A24 A;  2DIY A;  5KEJ A;  2E7P A;  3GUR A;  3Q19 A;  1AQV A;  2GT5 A;  5IOX A;  2MBS A;  2GVP A;  2LST A;  1YY7 A;  3KIJ A;  2DBC A;  3QR6 A;  3LXT A;  2YAN A;  1TOF A;  14GS A;  1SKS B;  5ECS A;  5JCW A;  3TJK A;  4RI6 A;  3MAK A;  1VF1 A;  5IOW A;  4POK A;  3TRX A;  5KN3 A;  2R0P A;  4G0K A;  1HD2 A;  3A5I A;  3CRT A;  1KTE A;  4ACS A;  1BJX A;  2VL2 C;  4PQH A;  3WYW A;  1SKR B;  2RM6 A;  4BL7 A;  3L4N A;  2FGX A;  3EMX A;  3L0H A;  2GLR A;  5G5E A;  2XHF A;  3GH6 A;  5IIZ A;  1K0N A;  4ZL7 A;  5CNW A;  2VL3 A;  1B8X A;  3D4T A;  4G19 A;  2HSH A;  5B6N A;  1GNE A;  3EIN A;  2FUG 2;  3H79 A;  2GZP A;  1B4Q A;  2P31 A;  5C00 A;  3F4S A;  2MMZ A;  2X99 A;  2XPE A;  3VPT A;  3MDK A;  5IMV A;  2R0C A;  5EVO A;  2DSA A;  1GSY A;  2L4Q A;  4HU9 A;  1FW1 A;  4E8H A;  2LS5 A;  2WCI A;  1USB A;  5ECN B;  3GHA A;  1GTB A;  1JLW A;  2X8G A;  3VLN A;  5JCU A;  4TVE A;  5ECK B;  2WFC A;  3FR6 A;  4GCI A;  1K0O A;  2F8A A;  3KD0 A;  3MYD A;  1F37 A;  2H8L A;  3KTB A;  2HI7 A;  2IPA A;  4WXT A;  3P8W A;  2H19 A;  3GNJ A;  1SK0 A;  4MZB A;  2PVO C;  3F9U A;  2X8C A;  3CXG A;  19GS A;  1MDJ A;  2JL4 A;  5DQY A;  1PRX A;  2OBI A;  3VI5 A;  1O8W A;  1QK8 A;  2LJA A;  4NHW A;  1GLQ A;  4BA7 A;  1GUM A;  1KEB A;  4L5L A;  1YZX A;  3CQF A;  3ZL5 A;  3D6I A;  1B48 A;  3M8N A;  1DSB A;  4TW5 A;  4TN8 A;  4AJ8 A;  3H4K A;  2CZ3 A;  2DJK A;  1S3A A;  4FIW A;  3KH7 A;  4I2T A;  5D96 A;  3GX8 A;  5DAK B;  1IYI A;  2GZZ A;  4XRA A;  2X49 A;  1FHE A;  2E0Q A;  1OAZ A;  1X0R A;  2H76 A;  1CQG A;  2BJX A;  3W6G A;  1FVK A;  1ZMA A;  5AN1 A;  3PPU A;  1S3R A;  1PSQ A;  4AGS A;  5B7C A;  1XVQ A;  2VUP A;  2EC4 A;  2FA8 A;  2YZH A;  5AIS A;  1GWC A;  2MMA A;  1K0C A;  1XWG A;  2H71 A;  3US3 A;  4F03 A;  4EDZ A;  3IC4 A;  1ML6 A;  5ABR A;  1QUW A;  3H8Q A;  2HRN A;  1F6M C;  5G30 A;  1YF0 A;  3DXB A;  4O92 A;  4EF0 A;  2VO4 A;  3PR8 A;  2FNO A;  3RDW A;  1EV4 A;  4HSC X;  4XCS A;  2K8S A;  2B1L A;  2QA2 A;  5A4V A;  3ZRD A;  4MCU A;  2HRA A;  4JR4 A;  1Z9H A;  1TI1 A;  4NV5 A;  5KN0 A;  3K8N A;  2CX3 A;  4MZC A;  3N5O A;  3TDG A;  1GSS A;  2IMD A;  4X43 A;  3IXR A;  5DDL A;  3HVX A;  2O7K A;  5IPG A;  3H93 A;  4K6X A;  4OO4 A;  4X0X A;  3HJM A;  2IJY A;  3HVS A;  1FO5 A;  4PUA A;  4NAX A;  1OE8 A;  1YEX A;  1Y6E A;  4J2F A;  1Z6M A;  1EEM A;  2DJ0 A;  2OBK A;  4ZB9 A;  4ZL9 A;  1O7U A;  4XTS A;  2WZ9 A;  2REM A;  5GAP D;  2IMF A;  4ISD A;  2A4V A;  2MYG A;  4CDO A;  2VOC A;  4CY8 A;  4LL4 B;  4MMM A;  1GSE A;  1ZYN A;  1EOH A;  4IS0 A;  3TRQ A;  2PU9 C;  2H66 A;  3ZFL A;  2GGT A;  5IMF A;  6GSY A;  3FK8 A;  5GSS A;  4J57 E;  3TJF A;  1EOG A;  1Z3E A;  1J9B A;  1XIY A;  2X64 A;  3F4R A;  2CV4 A;  2R4V A;  1H4O A;  3F63 A;  4ML1 A;  1A0F A;  3LGC A;  3VWV A;  2YV7 A;  1ACV A;  3QAW A;  3VFI A;  1NHO A;  3QAV A;  1DUG A;  1R5P A;  1AUC A;  1BX9 A;  2HRK A;  4KH7 A;  2M80 A;  4GSS A;  2V2G A;  4OWY A;  4BL7 B;  2AV4 A;  2CVK A;  1FB6 A;  1UN2 A;  4GST A;  2C1Y A;  3ZIV A;  2RUE A;  4MA9 A;  3APQ A;  1T4Z A;  1XPV A;  1TK8 B;  5ID2 A;  2BTO T;  3EU3 A;  2OAC A;  3NOF A;  2A2P A;  1TK5 B;  4I5Q A;  1GP1 A;  4YQM A;  2H1G A;  4DSS A;  1TRS A;  1QXH A;  3W8J A;  2GQK A;  3I9V 2;  1YKC A;  4FH8 A;  3F6D A;  2DKI A;  4IHU A;  1Q4J A;  5D8I A;  1YEP A;  5IMC A;  2YWN A;  4JU5 A;  4P3Y B;  4MLY A;  2TRX A;  4F2I A;  2FWF A;  2HSM A;  4NPB A;  1B9X C;  5DVB A;  4EIQ A;  2AUV A;  4ZB6 A;  2LNT A;  2ON7 A;  5HR3 A;  2M72 A;  3R3E A;  3DWV A;  2ES7 A;  2LJR A;  4MH2 A;  4ML6 A;  3ZML A;  4O5U A;  2R6K A;  4Q5R A;  3G7Y A;  3GN3 A;  4GLT A;  6GSV A;  3ED3 A;  3GIX A;  4LMV A;  1ST9 A;  5ENU A;  8GSS A;  2DC5 A;  2C80 A;  1AQX A;  3A3T A;  4O32 A;  4OFN A;  1VF3 A;  2K8V A;  4DSR A;  3TB2 A;  5JWQ B;  2XBQ A;  1JHB A;  3P7X A;  2L57 A;  1MEK A;  4PTS A;  4GQF A;  1XFL A;  1X9W B;  4IVF A;  2B3S A;  3BCK A;  5IMD A;  3WT1 A;  3UVH A;  1ILO A;  1SYX A;  1ZZY A;  2L6D A;  5LCZ A;  4KX4 A;  5HR1 A;  1XBS A;  2LEG A;  1EV9 A;  3CSI A;  3LOR A;  2C3N A;  4EIP A;  2GT6 A;  4ZB8 A;  3EYT A;  4PUF C;  4WET A;  3FZ5 A;  2O87 A;  1OKT A;  2VLU A;  1MD3 A;  3BJ5 A;  4V2M A;  5KOX A;  3QFB C;  2WRT A;  2YPM A;  2YN1 A;  2M46 A;  3TKQ A;  3TOU A;  4QL7 A;  4HDE A;  2YJ7 A;  1Z5Y E;  1ERT A;  1J0F A;  4ULX A;  4IBP A;  4PNF A;  3P90 A;  4HJM A;  2JSY A;  4F9Z A;  4NWY A;  2VL2 A;  1G7O A; 
#chains in the Genus database with same CATH homology
 1MTC A;  1GUL A;  2B5X A;  3A2V A;  10GS A;  2R0G A;  1TP9 A;  3OR5 A;  3QFA C;  4LA1 A;  1T1V A;  2K18 A;  1SD8 A;  2F8F A;  3O76 A;  1ZGN A;  1PGT A;  3CRU A;  5E4W A;  3ZMK A;  2YP6 A;  3VWW A;  1JZW A;  1F2E A;  3IE3 A;  4PUR A;  1V58 A;  5EL8 A;  1MDK A;  1Z7P A;  4N30 A;  2C0G A;  3IK9 A;  12GS A;  4KSM A;  1JFU A;  3RPN A;  1PD2 1;  3GUS A;  1ZYQ B;  1SL0 B;  2P5R A;  4IP1 A;  5J3R A;  3GFK A;  1SJI A;  2WDU A;  4GF0 A;  3RBT A;  4POB A;  2HXK A;  4N0Z A;  1PMT A;  2FY6 A;  3C7M A;  2CVB A;  1C72 A;  2VLT A;  2GSQ A;  2KLX A;  2DJ2 A;  3HZ8 A;  2WUL A;  2HZE A;  4KW6 A;  5JWR B;  4PQ1 A;  3J7Y b;  2DJ3 A;  2KUC A;  4X1U A;  4OFM A;  4ZBA A;  4WEY A;  1PQN A;  2R5G A;  3GRX A;  2YJH A;  3ZLP A;  4YH2 A;  1M2D A;  1JZR A;  3CTF A;  1N2A A;  2NPB A;  5L71 A;  18GS A;  1G6Y A;  1J08 A;  1WP0 A;  3KXO A;  3RHB A;  4I8B A;  4EXJ A;  1GSQ A;  1R7H A;  3L78 A;  3UVT A;  3KZQ A;  3HCZ A;  3L9V A;  4FO5 A;  2YWM A;  2A4H A;  3GMF A;  1A8L A;  4KDY A;  2OE1 A;  1PL2 A;  3UOM A;  4O7H A;  4I2U A;  1ZL9 A;  6GSX A;  2ZUP A;  3ZFB A;  4WBJ A;  2J9H A;  5ID2 B;  4GXZ A;  1F3A A;  4YKG A;  3J7Y k;  2RII A;  1SJZ A;  1K0D A;  3KMN A;  4DSS B;  3FZA A;  2OE0 A;  1QFN A;  17GS A;  2QGV A;  4D73 A;  1SK2 A;  4Z2U A;  3SBC A;  2NBS A;  2B7J A;  3GYK A;  2DLX A;  2FHE A;  1GSF A;  2N5F A;  3HKR A;  2CAI A;  1T4Y A;  2PGT A;  4OFT A;  5G2Z A;  1SK1 A;  2HSY A;  3ZRE A;  2X8H A;  3TKP A;  3VWX A;  2GZY A;  1XW5 A;  2EIQ A;  3KGK A;  5EPF A;  2H75 A;  4F0C A;  3SWL A;  4IJ3 A;  4XS4 A;  5CRE A;  1T3B A;  3S9F A;  1LJR A;  2DML A;  3GKN A;  5IQY A;  3QPM A;  5HFK A;  1FAA A;  2C8U A;  4X4J A;  2FLS A;  1PKZ A;  1A8Y A;  4DSQ A;  20GS A;  3LFL A;  3EWL A;  2H0G A;  3M1G A;  4XHM A;  2CZ2 A;  5DBQ A;  1PL1 A;  3BD2 A;  4Q5F A;  3D21 A;  3C73 A;  2E2G A;  3GH9 A;  4YAV A;  4BVY A;  1YJ6 A;  4HOJ A;  1ERW A;  2DKH A;  5DJL A;  4V2L A;  1GL8 A;  5CRD A;  3EE2 A;  1O6J A;  2JAD A;  5CRH A;  2V1M A;  2GS3 A;  5HR2 A;  3FHK A;  1TRW A;  1A2L A;  2AHE A;  1XWA A;  3LWA A;  1LBK A;  1K0B A;  5J9C A;  3F3R A;  4MAB A;  4YAP A;  1K0M A;  4ECJ A;  3FR9 A;  3I69 A;  4F0B A;  1GNW A;  4XIH A;  1B4P A;  2H72 A;  3Q74 A;  4EKZ A;  1Y25 A;  1GSD A;  4POM A;  5IM9 A;  5G31 A;  2ZCT A;  4JZQ A;  5AIX A;  13GS A;  1V57 A;  1M99 A;  1V2A A;  4XS1 A;  3FRC A;  4KDX A;  3LEF A;  3QOU A;  2MMO A;  5ECP B;  3FY7 A;  3LSZ A;  3RPP A;  3LG6 A;  3C1R A;  4IQA A;  5ECH B;  1GSU A;  1S3C A;  3TJG A;  4PXO A;  1HNB A;  2L6C A;  2GQM A;  5LNK e;  2H1D A;  4WKW A;  5D9W A;  2LKU A;  4ZXG A;  2BMX A;  4EL1 A;  1YKA A;  3GTU A;  1W89 A;  1XWK A;  4GRF A;  4PX1 A;  4IP6 A;  4MK3 A;  2V41 A;  2TRC P;  3M9K A;  4KAE A;  3F0I A;  2VD1 A;  4EO3 A;  1F9M A;  2FWG A;  1A2M A;  4ECC A;  1V9W A;  2FWH A;  1ON4 A;  3U6V A;  3CYN A;  3Q6O A;  5B8B A;  2JZT A;  3C1S A;  1XOA A;  2C3Q A;  5EY6 A;  3TUE A;  3DYR A;  1XWC A;  3ERF A;  2OKA A;  3CSH A;  2I1U A;  2ON5 A;  3KEB A;  4HZ4 A;  3GL3 A;  4PGT A;  1EZK A;  2GST A;  2IIY A;  2K9F A;  3DIE A;  2VAF A;  1OE7 A;  4MPG A;  1G6W A;  1GH2 A;  1LU4 A;  5GZZ B;  1PA3 A;  3P2A A;  5AGY A;  3FKF A;  2G2Q A;  3FEU A;  3IAS 2;  4HUA A;  1WOU A;  4RQX A;  1R4W A;  2HZF A;  1MD4 A;  2ALB A;  4DVC A;  4TRX A;  3FYG A;  2E2M A;  1O81 A;  2HZE B;  9GSS A;  2I3Y A;  3N9J A;  2I9H A;  2AJQ B;  5KOW A;  2YOI A;  2CAQ A;  4IGJ A;  4GWR A;  4WR4 A;  4KE3 A;  4JR6 A;  5FHI A;  2QC7 A;  3F3Q A;  4K7I A;  5G5F A;  2O89 A;  4YQV A;  5F05 A;  4G9H A;  3JCM L;  2HRF A;  5IPH A;  3D4M A;  4K7N A;  4Z2T A;  4ICY A;  4KGI A;  1XXU A;  3MNG A;  3A5W A;  4YKF A;  4OD7 A;  4MJC A;  2H70 A;  3O6T A;  4E8E A;  3IC8 A;  5AIV A;  5BMU A;  5LD0 A;  2GDR A;  2Z9S A;  1X5E A;  3IDV A;  2N5B A;  4JBB A;  2L59 A;  2FA4 A;  1UA5 A;  2EIO A;  4ILF A;  2VIM A;  4NV2 A;  2YNX A;  1TI3 A;  4ZBB A;  2C0F A;  5ELG A;  3TCO A;  2PN8 A;  5ECO B;  3EVI A;  1O8X A;  3DKS A;  4YQU A;  4HU7 A;  4MF5 A;  4HQS A;  3WT2 A;  3EMP A;  1T7P B;  4BWS A;  2G0F A;  1PN0 A;  3IK7 A;  4D73 B;  4PNG A;  22GS A;  1TU8 A;  4IKH A;  2R37 A;  1RQM A;  3GSS A;  4K7O A;  3HJP A;  3MSZ A;  3HZ4 A;  5KN2 A;  5F07 A;  4K5S A;  1YQ1 A;  1TK0 B;  3APO A;  1WMJ A;  5DCG A;  4KB3 A;  4OCE A;  1NM3 A;  1GLP A;  5H5R A;  4XS4 B;  1EP8 A;  2WS2 A;  3UEM A;  1K3L A;  1U88 A;  5FWG A;  1X5C A;  3IBH A;  4WBR D;  3TJB A;  5G1K A;  3U5R E;  4MJE A;  3Q18 A;  4CHS A;  1BED A;  3IPZ A;  4OO5 A;  1EEJ A;  1URM A;  2LRN A;  2KOK A;  3HY2 A;  4BVY B;  2LNS A;  3A2X A;  7GSS A;  4O5R A;  2YV9 A;  4NHZ A;  3GST A;  1ZYE A;  5B6M A;  4OCF A;  5GAN D;  4MJA A;  3W8S A;  3ERW A;  2IWT A;  3ZVJ A;  3IV4 A;  4BVX A;  5C04 A;  3F8U A;  3F6F A;  3FZ9 A;  3H1N A;  3TRP A;  3VPQ A;  3ZTL A;  4MPF A;  4N10 A;  2RLI A;  3I43 A;  2YCD A;  5IO2 A;  2VM2 A;  2IL3 A;  4FYU A;  4K2D A;  1N8J A;  1XVW A;  3TKR A;  4KUN A;  3QAG A;  2LQO A;  3HD5 A;  2NTO A;  4G2E A;  3ME7 A;  4QL9 A;  2IFQ A;  3M0F A;  3LYK A;  3UAR A;  3QD9 A;  2VCX A;  2RUF A;  2HFD A;  5D73 A;  3DD3 A;  1GRX A;  5HR0 A;  5DJM A;  4ID0 A;  3UL3 A;  3GTU B;  3A2W A;  2XPD A;  2AB6 A;  6GSU A;  2OAD A;  4QQ7 A;  5ECR B;  4TXO A;  2LQQ A;  1TRV A;  3EUR A;  4GTU A;  3DGQ A;  3DEX A;  3DVX A;  1T00 A;  2H0I A;  3ERG A;  1K3O A;  4L0U A;  4LMW A;  2A2S A;  2LUS A;  3KMO A;  1G7E A;  5J9B A;  4TR1 A;  3KTL A;  3F4T A;  4OMV A;  4KA0 A;  1OC8 A;  3KP9 A;  1KNG A;  2FD3 A;  1HYU A;  4ZIJ A;  1NHY A;  1VF2 A;  3C71 A;  4FYC A;  2C0D A;  1X9S B;  1UC7 A;  4HQZ A;  1O85 A;  3G7I A;  2DMM A;  2CVD A;  1VGL A;  16GS A;  5A4U A;  3AY8 A;  1M2B A;  3FW2 A;  4N0V A;  1DE1 A;  3I6A A;  2C4J A;  4J56 E;  2P0G A;  1F3B A;  2KP1 A;  1BQ7 A;  1SD9 A;  3EU4 A;  3VUR A;  2XC2 A;  2B5E A;  3QDN A;  4IEL A;  1NW2 A;  1H75 A;  2VCW A;  3MIX A;  4K0N A;  1SL2 B;  4V1A p;  3TJJ A;  4ECB A;  3EPT A;  2HLS A;  1A23 A;  5F0G A;  1K0A A;  2LRC A;  2GSS A;  2LRT A;  1HQO A;  5KN1 A;  3PH9 A;  5G1L A;  2YZU A;  4MF6 A;  3VI7 A;  3UBL A;  1FOV A;  3GV1 A;  1GTA A;  2H73 A;  1ABA A;  1R5A A;  4WR5 A;  2I4A A;  1ZYP A;  4TOP A;  3M9J A;  2IMI A;  3HXS A;  4EUY A;  1THX A;  1M7T A;  2GSR A;  4MDC A;  2H1B A;  1TU7 A;  1AIU A;  2PER A;  1PX6 A;  2N5A A;  5ECI B;  1X5D A;  3R2Q A;  1M0U A;  1AAZ A;  3WGD A;  4L5O A;  2FWE A;  2PPT A;  3KJY A;  3VWU A;  1PX7 A;  3UMA A;  1TW9 A;  4GQC A;  3C8E A;  5J41 A;  1FG4 A;  1SEN A;  3HDC A;  1MDI A;  2H1A A;  3IAM 2;  3GX0 A;  4MH3 A;  3BBY A;  4G0I A;  4IW9 A;  2OA7 A;  1QQ2 A;  1IYH A;  2MZC A;  4L0W A;  3G7J A;  2V6O A;  4LL1 B;  1SJ6 A;  3WD6 A;  1V98 A;  5COH A;  4AJ6 A;  3V1W A;  5ELA A;  1AXD A;  2D2Z A;  1WJK A;  2F3M A;  3E9J B;  4HZ2 A;  3DRN A;  3L9S A;  4H86 A;  1XW9 A;  2PWJ A;  5A4W A;  2HE3 A;  1I9D A;  1XCC A;  2HNL A;  2P5Q A;  4L8E A;  3FR3 A;  5ECM B;  1WRY A;  2JAC A;  2H6Y A;  3EC3 A;  2B5Y A;  5ECQ B;  1JZD A;  1TKD B;  1JZO A;  5CAX A;  5CRW A;  4KSO A;  1FOH A;  3FMW A;  4WF4 A;  5ECL B;  2B1K A;  2DJJ A;  1ERU A;  4K5R A;  5F06 A;  2WB9 A;  2OE3 A;  2B7K A;  4XS6 A;  3CMI A;  3GKK A;  4ECI A;  1U6T A;  1ERV A;  5GST A;  4BVX B;  3WGE A;  5HFI A;  1EWX A;  1HNC A;  1A2J A;  5DCH A;  1JLV A;  1VF4 A;  2I81 A;  4BWQ A;  5JWO B;  5DAL A;  2JZS A;  4Q5Q A;  4IQ1 A;  1ZCP A;  1XW6 A;  2VLV A;  2VL9 A;  3ZZX A;  1OVN A;  1GUH A;  4EE0 A;  1TDI A;  3PIN A;  5JCG A;  1R26 A;  4IJI A;  2WJU A;  1XWB A;  3GKX A;  5INY A;  3PGT A;  1WWJ A;  1BG5 A;  1OC9 A;  1EGO A;  4K8M A;  2IFQ B;  1SYR A;  5IO0 A;  1OKD A;  4NXI A;  1M9A A;  2PBJ A;  2H6Z A;  5IMZ A;  3DVW A;  2AYT A;  11GS A;  3CBU A;  3HVV A;  5BRT A;  2CQ9 A;  2NDO A;  3MWH A;  3UIW A;  1DBY A;  3HYP A;  5HQP A;  2LJK A;  3TKS E;  3QCP A;  4TXO B;  5J4U A;  4ZBD A;  1E6B A;  6GST A;  2K6V A;  3GA4 A;  4CW9 A;  1X9M B;  3KCM A;  3GKM A;  3M3M A;  1VRS D;  5D9V A;  2MMN A;  3BCI A;  3HHV A;  3KH9 A;  2YWI A;  2R2J A;  1AQW A;  3E0U A;  5H5Q A;  2HT9 A;  3VK9 A;  4TR1 B;  1AW9 A;  5B8A A;  2H74 A;  2H6X A;  1T8E B;  2V32 A;  2LV3 A;  4DEJ A;  1FVJ A;  2WGR A;  4AF2 A;  4KCE A;  2VCQ A;  3IR4 A;  1YF1 A;  2CA8 A;  3G9B A;  1B9Y C;  3KP8 A;  3LW9 A;  4JE1 A;  4KCA A;  1I5G A;  1W4V A;  4POL A;  2F51 A;  2IMK A;  4K0G A;  2PUK C;  3WGX A;  3QMX A;  4BPY A;  4KF9 A;  3NZN A;  1CQH A;  4Q5N A;  3IHQ A;  4XRD A;  1TRU A;  2EIR A;  3TKS A;  2IME A;  3D22 A;  2JU5 A;  4Z7X A;  4F82 A;  1KBN A;  2H01 A;  1BAY A;  1U87 A;  3IHG A;  4TXV A;  1WPI A;  4I6X A;  1PKW A;  1EP7 A;  1Z7R A;  2CX4 A;  5CRG A;  1O73 A;  3HA9 A;  4JED A;  1SKW B;  2J23 A;  3ZIJ A;  1WE0 A;  3HJO A;  5FT3 A;  1ZOF A;  3LXZ A;  3BOA A;  1EGR A;  4Z2R A;  4MF7 A;  2UZ8 A;  5D9X A;  2H30 A;  2GQL A;  4HI7 A;  2RM5 A;  1SL1 B;  1PN9 A;  1GTI A;  2C0E A;  1G0T A;  1A0R P;  2QSI A;  2VD0 A;  2O8V B;  1YDK A;  4HJ2 A;  3DML A;  4K1F A;  4IN0 A;  2NVL A;  1QMV A;  2LTK A;  1TXX A;  5E59 A;  5H5S A;  2R3X A;  4HS1 A;  1GTU A;  1THO A;  1FB0 A;  2PMT A;  4K9Z A;  4USS A;  1V40 A;  1U3I A;  1QGV A;  4HEA 2;  4KND A;  3D5J A;  2AAW A;  4V2N A;  1RK4 A;  5D93 A;  2JSZ A;  6GSW A;  3TKS C;  1OYJ A;  1BYE A;  1DE2 A;  4MJB A;  5F8B A;  2VCV A;  1GUK A;  4RI7 A;  1RW1 A;  4EC0 A;  4G10 A;  5DAK A;  3ME8 A;  5IMA A;  5J5N A;  3D0Z A;  3APS A;  2ZNM A;  5CO3 A;  2OJL A;  2KHP A;  2F9S A;  2PVQ A;  5CYY A;  3CTG A;  4A5P A;  2TIR A;  3ZVJ D;  1K3Y A;  2MBT A;  4RUV A;  3UAP A;  2O85 A;  1XZO A;  4KDU A;  5HFG A;  3FZ4 A;  2B6M A;  3LQ7 A;  4FYB A;  4WF5 A;  1M9B A;  4EDY A;  4TR3 A;  3UBK A;  5D9T A;  1OC3 A;  5DQS A;  2HYX A;  4CY6 A;  4NMU A;  4LLR A;  3RHC A;  4ZIL A;  2XBI A;  3O3T A;  4TR0 A;  3UJ1 A;  3LYP A;  4JRR A;  1AC1 A;  4FQU A;  3LJR A;  5A5K A;  4PQI A;  2QKE A;  1WIK A;  3ZYW A;  6GSS A;  3TGZ A;  1TTZ A;  3GL5 A;  1UVZ A;  2A2R A;  5DAL B;  4N11 A;  2VM1 A;  3E3E A;  1XOB A;  4RQR A;  4MP4 A;  3TOT A;  2CT6 A;  4EVM A;  1U3A A;  4MZW A;  4K2X A;  2L5O A;  2VCT A;  4G0L A;  1E2Y A;  1Q98 A;  1OC9 B;  4TR4 A;  2IN3 A;  3NIV A;  2L4C A;  3L9U A;  3IA1 A;  4V1A g;  2FCH A;  1NSW A;  2DIZ A;  4I97 A;  4MNN A;  2V6K A;  5CP1 A;  1Z6N A;  3ISO A;  2KP2 A;  4AJ7 A;  3IRA A;  4TKY A;  2H0H A;  4ZL8 A;  3CSJ A;  2L5L A;  3RAZ A;  2QA1 A;  2C3T A;  2GTU A;  3ZIT A;  1TJD A;  2X4A A;  2DJ1 A;  2JZR A;  4O5Q A;  1S3D A;  3IOS A;  2VCZ A;  1M2A A;  2YWO A;  4GSN A;  3KM6 A;  1HNA A;  1SU9 A;  1A24 A;  2DIY A;  5KEJ A;  2E7P A;  3GUR A;  3Q19 A;  1AQV A;  2GT5 A;  5IOX A;  2MBS A;  2GVP A;  2LST A;  1YY7 A;  3KIJ A;  2DBC A;  3QR6 A;  3LXT A;  2YAN A;  1TOF A;  14GS A;  1SKS B;  5ECS A;  5JCW A;  3TJK A;  4RI6 A;  3MAK A;  1VF1 A;  5IOW A;  4POK A;  3TRX A;  5KN3 A;  2R0P A;  4G0K A;  1HD2 A;  3A5I A;  3CRT A;  1KTE A;  4ACS A;  1BJX A;  2VL2 C;  4PQH A;  3WYW A;  1SKR B;  2RM6 A;  4BL7 A;  3L4N A;  2FGX A;  3EMX A;  3L0H A;  2GLR A;  5G5E A;  2XHF A;  3GH6 A;  5IIZ A;  1K0N A;  4ZL7 A;  5CNW A;  2VL3 A;  1B8X A;  3D4T A;  4G19 A;  2HSH A;  5B6N A;  1GNE A;  3EIN A;  2FUG 2;  3H79 A;  2GZP A;  1B4Q A;  2P31 A;  5C00 A;  3F4S A;  2MMZ A;  2X99 A;  2XPE A;  3VPT A;  3MDK A;  5IMV A;  2R0C A;  5EVO A;  2DSA A;  1GSY A;  2L4Q A;  4HU9 A;  1FW1 A;  4E8H A;  2LS5 A;  2WCI A;  1USB A;  5ECN B;  3GHA A;  1GTB A;  1JLW A;  2X8G A;  3VLN A;  5JCU A;  4TVE A;  5ECK B;  2WFC A;  3FR6 A;  4GCI A;  1K0O A;  2F8A A;  3KD0 A;  3MYD A;  1F37 A;  2H8L A;  3KTB A;  2HI7 A;  2IPA A;  4WXT A;  3P8W A;  2H19 A;  3GNJ A;  1SK0 A;  4MZB A;  2PVO C;  3F9U A;  2X8C A;  3CXG A;  19GS A;  1MDJ A;  2JL4 A;  5DQY A;  1PRX A;  2OBI A;  3VI5 A;  1O8W A;  1QK8 A;  2LJA A;  4NHW A;  1GLQ A;  4BA7 A;  1GUM A;  1KEB A;  4L5L A;  1YZX A;  3ZL5 A;  3D6I A;  1B48 A;  3M8N A;  1DSB A;  4TW5 A;  4TN8 A;  4AJ8 A;  3H4K A;  2CZ3 A;  2DJK A;  1S3A A;  4FIW A;  3KH7 A;  4I2T A;  5D96 A;  3GX8 A;  5DAK B;  1IYI A;  2GZZ A;  4XRA A;  2X49 A;  1FHE A;  2E0Q A;  1OAZ A;  1X0R A;  2H76 A;  1CQG A;  2BJX A;  3W6G A;  1FVK A;  1ZMA A;  5AN1 A;  3PPU A;  1PSQ A;  4AGS A;  5B7C A;  1XVQ A;  2VUP A;  2EC4 A;  2FA8 A;  2YZH A;  5AIS A;  1GWC A;  2MMA A;  1K0C A;  1XWG A;  2H71 A;  3US3 A;  4F03 A;  4EDZ A;  3IC4 A;  1ML6 A;  5ABR A;  1QUW A;  3H8Q A;  2HRN A;  1F6M C;  5G30 A;  1YF0 A;  3DXB A;  4O92 A;  4EF0 A;  2VO4 A;  3PR8 A;  2FNO A;  3RDW A;  1EV4 A;  4XCS A;  2K8S A;  2B1L A;  2QA2 A;  5A4V A;  3ZRD A;  4MCU A;  2HRA A;  4JR4 A;  1Z9H A;  1TI1 A;  4NV5 A;  5KN0 A;  3K8N A;  2CX3 A;  4MZC A;  3N5O A;  3TDG A;  1GSS A;  2IMD A;  4X43 A;  3IXR A;  5DDL A;  3HVX A;  2O7K A;  5IPG A;  3H93 A;  4K6X A;  4OO4 A;  4X0X A;  3HJM A;  2IJY A;  3HVS A;  1FO5 A;  4PUA A;  4NAX A;  1OE8 A;  1YEX A;  1Y6E A;  4J2F A;  1Z6M A;  1EEM A;  2DJ0 A;  2OBK A;  4ZB9 A;  4ZL9 A;  1O7U A;  4XTS A;  2WZ9 A;  2REM A;  5GAP D;  2IMF A;  4ISD A;  2A4V A;  2MYG A;  4CDO A;  2VOC A;  4CY8 A;  4LL4 B;  4MMM A;  1GSE A;  1ZYN A;  1EOH A;  4IS0 A;  3TRQ A;  2PU9 C;  2H66 A;  3ZFL A;  2GGT A;  5IMF A;  6GSY A;  3FK8 A;  5GSS A;  4J57 E;  3TJF A;  1EOG A;  1Z3E A;  1J9B A;  1XIY A;  2X64 A;  3F4R A;  2CV4 A;  2R4V A;  1H4O A;  3F63 A;  4ML1 A;  1A0F A;  3LGC A;  3VWV A;  2YV7 A;  1ACV A;  3QAW A;  3VFI A;  1NHO A;  3QAV A;  1DUG A;  1R5P A;  1AUC A;  1BX9 A;  2HRK A;  4KH7 A;  2M80 A;  4GSS A;  2V2G A;  4OWY A;  4BL7 B;  2AV4 A;  2CVK A;  1FB6 A;  1UN2 A;  4GST A;  2C1Y A;  3ZIV A;  2RUE A;  4MA9 A;  3APQ A;  1T4Z A;  1XPV A;  1TK8 B;  5ID2 A;  2BTO T;  3EU3 A;  2OAC A;  3NOF A;  2A2P A;  1TK5 B;  4I5Q A;  1GP1 A;  4YQM A;  2H1G A;  4DSS A;  1TRS A;  1QXH A;  3W8J A;  2GQK A;  3I9V 2;  1YKC A;  4FH8 A;  3F6D A;  2DKI A;  4IHU A;  1Q4J A;  5D8I A;  1YEP A;  5IMC A;  2YWN A;  4JU5 A;  4P3Y B;  4MLY A;  2TRX A;  4F2I A;  2FWF A;  2HSM A;  4NPB A;  1B9X C;  5DVB A;  4EIQ A;  2AUV A;  4ZB6 A;  2LNT A;  2ON7 A;  5HR3 A;  2M72 A;  3R3E A;  3DWV A;  2ES7 A;  2LJR A;  4MH2 A;  4ML6 A;  3ZML A;  4O5U A;  2R6K A;  4Q5R A;  3G7Y A;  3GN3 A;  4GLT A;  6GSV A;  3ED3 A;  3GIX A;  4LMV A;  1ST9 A;  5ENU A;  8GSS A;  2DC5 A;  2C80 A;  1AQX A;  3A3T A;  4O32 A;  4OFN A;  1VF3 A;  2K8V A;  4DSR A;  3TB2 A;  5JWQ B;  2XBQ A;  1JHB A;  3P7X A;  2L57 A;  1MEK A;  4PTS A;  4GQF A;  1XFL A;  1X9W B;  4IVF A;  2B3S A;  3BCK A;  5IMD A;  3WT1 A;  3UVH A;  1ILO A;  1SYX A;  1ZZY A;  2L6D A;  5LCZ A;  4KX4 A;  5HR1 A;  1XBS A;  2LEG A;  1EV9 A;  3CSI A;  3LOR A;  2C3N A;  4EIP A;  2GT6 A;  4ZB8 A;  3EYT A;  4PUF C;  4WET A;  3FZ5 A;  2O87 A;  1OKT A;  2VLU A;  1MD3 A;  3BJ5 A;  4V2M A;  5KOX A;  3QFB C;  2WRT A;  2YPM A;  2YN1 A;  2M46 A;  3TKQ A;  3TOU A;  4QL7 A;  4HDE A;  2YJ7 A;  1Z5Y E;  1ERT A;  1J0F A;  4ULX A;  4IBP A;  4PNF A;  3P90 A;  4HJM A;  2JSY A;  4F9Z A;  4NWY A;  2VL2 A;  1G7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...