1E2YA

Tryparedoxin peroxidase from crithidia fasciculata
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
167
structure length
167
Chain Sequence
GAAKLNHPAPEFDDMALMPNGTFKKVSLSSYKGKYVVLFFYPMDFTFVCPTEIIQFSDDAKRFAEINTEVISCSCDSEYSHLQWTSVDRKKGGLGPMAIPMLADKTKAIARAYGVLDEDSGVAYRGVFIIDPNGKLRQIIINDMPIGRNVEEVIRLVEALQFVEEHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPAREDOXIN PEROXIDASE
publication title The Structure of Reduced Tryparedoxin Peroxidase Reveals a Decamer and Insight Into Reactivity of 2Cys-Peroxiredoxins
pubmed doi rcsb
source organism Crithidia fasciculata
molecule tags Oxidoreductase
total genus 46
structure length 167
sequence length 167
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2000-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1e2yA00
1A0RP 1F2EA 4JR4A 4Q5NA 3LJRA 1ON4A 4MZWA 1T4ZA 4GQCA 4IGJA 1R26A 3KJYA 5EY6A 3IDVA 1GUKA 4IN0A 2YJHA 1TI3A 2HXKA 4HUAA 1AXDA 5JWRB 2HFDA 3IV4A 1XVWA 2PERA 1FW1A 5A4UA 4O92A 2L5LA 1SENA 5E4WA 1M2AA 1O81A 1YF1A 3HJMA 2MMOA 4D73B 5IIZA 5CP1A 4V1Ag 2BTOT 2VM2A 5GAPD 1E6BA 3TJGA 2H73A 2H6ZA 2R2JA 2HRFA 2IJYA 1SD9A 3IRAA 1SK0A 4K0NA 5ECRB 4IJIA 3P90A 5H5SA 5F06A 1K0CA 2IMKA 2PPTA 1X9WB 4ECBA 5G1LA 2LRNA 3EU3A 3US3A 2H75A 1PRXA 1PX7A 1EGRA 10GSA 1EEMA 2GSSA 3I9V2 1H4OA 1B8XA 3FHKA 3ZFLA 1NW2A 2B5XA 5HR2A 2ZNMA 4EUYA 5IMFA 3FZ4A 4G10A 3TKPA 2EIQA 2JL4A 1CQHA 4MA9A 2VM1A 3TJJA 3GV1A 5G5FA 1XZOA 2B7KA 1EOGA 5J41A 3C8EA 1OYJA 1TOFA 1EOHA 4MH3A 1GTAA 4K7OA 4D73A 4GQFA 1Z9HA 3UBKA 2C0EA 2C8UA 2J23A 1W89A 3UJ1A 2HZFA 1K0OA 4BVYA 1BJXA 3RBTA 19GSA 4PX1A 4EL1A 1JZWA 3TKSE 3C73A 3NZNA 4JZQA 3QAVA 1YEXA 5DCGA 1F3AA 2H1DA 4MZCA 1T4YA 2F9SA 2I81A 2X99A 3FEUA 12GSA 2L59A 4Q5QA 4EE0A 4I97A 3QAWA 3GRXA 2CAQA 2I9HA 2GZPA 1AAZA 1ST9A 2PWJA 3ZITA 5B8BA 4HQZA 1OE7A 2WZ9A 2EIRA 5IMDA 3RPNA 3LG6A 4ZB6A 4ZILA 1K0DA 1EEJA 20GSA 1BEDA 4PXOA 1X0RA 2REMA 2DJ3A 4Q5RA 1JZDA 3M3MA 4N11A 2GSTA 2WDUA 1GTIA 2ON7A 1EP7A 3QMXA 5A4VA 1KNGA 1SL0B 3F4RA 4CW9A 3EVIA 3ZVJD 3ERGA 3U6VA 3TRQA 1A2JA 1LBKA 3VLNA 4PUAA 2DLXA 1PN9A 2F8AA 1PA3A 3GH6A 5GAND 2YZHA 3O6TA 1EV9A 4GRFA 1C72A 1AUCA 2IL3A 3FW2A 22GSA 4PNFA 5GSSA 5FT3A 4CHSA 3H79A 5CRWA 4QL7A 5ECPB 1A24A 3F3RA 3QFBC 2VCWA 4MJAA 1MD4A 2LQOA 1FG4A 2CZ2A 2H01A 2H6YA 4Q5FA 1AC1A 1MTCA 4ZL7A 2VL2A 2GGTA 3DGQA 5DJMA 2EC4A 1FB6A 5A4WA 1QFNA 2VD0A 2GZZA 3GX8A 1ACVA 1TU8A 2XBIA 1J08A 2F3MA 4OO4A 3WGXA 3S9FA 5CYYA 2DJJA 2OE0A 5ECIB 3M1GA 5GZZB 2K8VA 3L9SA 5LNKe 3FR9A 2GQLA 2AAWA 5DALB 2GT5A 3H8QA 2H6XA 4L8EA 3QPMA 1HD2A 1HQOA 2LV3A 5LD0A 2F8FA 4WF5A 3FR6A 4KCEA 2B5EA 4MF7A 1YKCA 1TK8B 2CV4A 1JFUA 3WT2A 2E0QA 3GTUB 1T3BA 2IWTA 1URMA 3TUEA 1K3LA 3KXOA 3TOUA 5D73A 3H4KA 1TRSA 2FLSA 4MZBA 1YQ1A 4YH2A 2HYXA 3LGCA 4KDYA 2VOCA 1Z5YE 1O7UA 2ES7A 2CX4A 1PMTA 3EURA 2X8CA 1OVNA 3DIEA 4EDYA 1FB0A 2PVQA 5KN2A 5ECSA 4OCEA 1WP0A 3ZIVA 1M2BA 1EP8A 1GLQA 4ECJA 3G7JA 1BX9A 2GQMA 3J7Yb 3ZMLA 4NV5A 1SK2A 1M9AA 6GSYA 1G7OA 2I3YA 4K6XA 2HZEB 4XTSA 17GSA 3ZL5A 4QQ7A 11GSA 1V98A 1T7PB 3ZLPA 4KDXA 2WULA 2FWGA 5B6NA 5J9BA 2WS2A 1QXHA 3EE2A 5DALA 4MABA 2VL9A 2I1UA 1AW9A 2C0GA 3HKRA 1T1VA 2C4JA 3SBCA 3GTUA 3KZQA 2O8VB 3QOUA 3Q74A 4RI6A 2QGVA 1WMJA 2BJXA 4WBRD 3A3TA 3W6GA 3L9VA 1W4VA 5G2ZA 1XWKA 1N8JA 3CSJA 1K3OA 2FGXA 4K8MA 4NHWA 4F0CA 3RHBA 2FA4A 4X1UA 4ILFA 4L0UA 1B4PA 4BA7A 4IVFA 4BL7A 1ZYQB 1GLPA 4K2DA 4N30A 1VGLA 3GNJA 1X9SB 2XPEA 2YCDA 5HFIA 2CZ3A 2HNLA 5F0GA 5JWOB 3RHCA 1F9MA 4PGTA 5E59A 3APSA 2A4VA 2HZEA 3K8NA 3M9KA 3TDGA 3EWLA 3ZRDA 2FWEA 2V2GA 1S3DA 3CXGA 13GSA 3GKKA 5ID2B 2N5AA 1EWXA 3P2AA 4GTUA 2AHEA 4IELA 2H1BA 3VURA 3ME8A 5IPGA 4HI7A 1DSBA 1B9YC 4XS6A 2HSHA 4IP1A 1U3IA 2K9FA 3VWWA 3EMPA 3GKNA 1SL2B 3IPZA 3DKSA 4WXTA 4HJ2A 2LJKA 5DQSA 1YY7A 4GSNA 2H70A 2ALBA 5DDLA 3GIXA 1RK4A 2A2SA 3KIJA 5KN0A 4J57E 4J56E 2FHEA 4BWSA 2LQQA 4F0BA 1WJKA 1N2AA 3PR8A 2I4AA 3CTGA 1KEBA 2V6OA 3Q18A 1F37A 1SJIA 2MBSA 2AUVA 4ZL9A 1XWBA 2DJKA 1YF0A 2XC2A 2IMFA 2FWFA 1QUWA 3WD6A 3UEMA 1FHEA 2VO4A 2YZUA 5D9TA 3I69A 3MAKA 3QR6A 4EF0A 3BBYA 1S3CA 3KM6A 4V2LA 5IPHA 2RM5A 1FVKA 1RQMA 5ID2A 1SL1B 4RQXA 2OACA 5IMAA 5DBQA 2GVPA 2NTOA 1SJZA 3MWHA 1V58A 2ZCTA 3D5JA 3KP9A 2X8HA 1TK5B 3VI7A 4KNDA 3VWUA 2YJ7A 4O32A 4LL1B 3O3TA 4AGSA 2WCIA 3CMIA 5H5RA 2VAFA 3AY8A 2B1LA 3ERWA 4G2EA 2IFQB 1O6JA 4WR5A 1ERUA 1CQGA 3CBUA 3E3EA 1ZGNA 4WF4A 3VK9A 3BCIA 3ERFA 4WKWA 5DAKB 1XVQA 1Z3EA 2LNSA 1EV4A 4YQMA 2GS3A 3GN3A 1H75A 3FZ5A 4OFNA 1TK0B 3LEFA 1JLVA 4GXZA 3TB2A 1AIUA 5HQPA 1V9WA 1XW9A 3UOMA 5IO2A 2PMTA 2PBJA 1ZL9A 1FO5A 3HA9A 4GWRA 5HFGA 1DE1A 4DSSB 2O89A 4IJ3A 4ZIJA 4KCAA 4MJCA 3HJOA 3D21A 3GL5A 5J3RA 2N5FA 3HJPA 4HU9A 2JZSA 4ZXGA 4MF6A 3E9JB 3TJBA 4MJBA 1GSQA 1WRYA 1KBNA 1ZMAA 2O7KA 4JU5A 1EZKA 2IFQA 5F07A 4TR1B 1OKDA 2PUKC 4FYBA 2E7PA 3ZZXA 2LRTA 2FCHA 1EGOA 2E2MA 5ELGA 1OC9B 1Y6EA 5DAKA 2O85A 4IQAA 4TXOB 2C0DA 3G7YA 3ZYWA 2E2GA 4K7NA 3GSSA 4AF2A 1O73A 2P0GA 5IMVA 2QC7A 4DSSA 4E8HA 2YANA 1THOA 1GNEA 1PQNA 1V40A 1E2YA 2VLTA 4G19A 1U88A 4ZBBA 1TXXA 5D9XA 2H66A 3KTBA 1TTZA 2NDOA 5EPFA 1YKAA 4KW6A 5HFKA 2K8SA 4XHMA 3APQA 5JWQB 5ECLB 3VFIA 2H0GA 4FO5A 4MLYA 4TR1A 4YQVA 3RAZA 2H8LA 2G0FA 5D8IA 2YOIA 2TIRA 4ZBAA 2VD1A 2R5GA 3D4TA 2EIOA 1OC9A 2A2RA 2L6CA 1HNAA 1XW6A 3VWVA 4TXOA 2YNXA 5ELAA 1VF4A 1TI1A 3LQ7A 4JEDA 1R5PA 1KTEA 5AIVA 1TRVA 4XRDA 1PX6A 5IQYA 2MMZA 4JE1A 1A2MA 3IXRA 5JCUA 4KA0A 1TP9A 3CRTA 3WT1A 1UA5A 2CVBA 4WBJA 1O8XA 5DQYA 4YQUA 3SWLA 1DUGA 1ERWA 1V57A 1SK1A 4F9ZA 4MF5A 2MMAA 1BAYA 3GSTA 3DMLA 1NSWA 3NIVA 2H1AA 1Q4JA 3WGEA 4POLA 3GA4A 2IIYA 2L4CA 5HR1A 1IYHA 2QKEA 4FIWA 5HR0A 3KTLA 2LSTA 4TRXA 4OMVA 3M9JA 5ECMB 3FK8A 4WETA 3J7Yk 4NAXA 3F0IA 4KSOA 9GSSA 2NPBA 2LNTA 2AB6A 1GWCA 2FWHA 1K3YA 3FRCA 3TJKA 3BD2A 4I5QA 1WIKA 3TGZA 4DSQA 1HNCA 4MPGA 2JZTA 2HRNA 1SYRA 5B8AA 1Z7PA 5J5NA 1GSUA 2IMEA 3D6IA 5ECHB 2R6KA 4V2NA 6GSUA 5KN3A 1J0FA 5D9WA 3TKSA 5JCWA 2OE1A 2HLSA 14GSA 2MBTA 2VCTA 2LTKA 1XXUA 18GSA 1G6WA 2DC5A 3UMAA 1XWCA 4HDEA 1GSFA 4TR3A 4HEA2 2HI7A 1GL8A 5CRGA 2OKAA 5CAXA 2JACA 2F51A 2ON5A 3TCOA 5CRDA 3P8WA 2J9HA 4X0XA 2H30A 1PKWA 3GUSA 4AJ8A 2RM6A 1Z6NA 4OFMA 4L5OA 5C00A 3HD5A 1TKDB 4K7IA 2P5QA 2N5BA 3Q6OA 1M99A 2IMIA 1SKRB 3KD0A 1Q98A 1F6MC 2GDRA 2Z9SA 2OJLA 3ISOA 5L71A 1YDKA 5F05A 3EINA 2WGRA 3GX0A 3FY7A 1JLWA 3I43A 1USBA 3CSIA 1J9BA 2B1KA 4IBPA 3EMXA 3IA1A 5DJLA 5ABRA 3GKXA 2YWMA 4PQHA 3HYPA 3N9JA 1G0TA 3LFLA 5HR3A 5AIXA 4XCSA 1SKWB 2HE3A 3UARA 2VLUA 2H19A 4LL4B 2X8GA 3KH7A 5IOXA 4I6XA 3VPQA 1QGVA 2OADA 5CNWA 2JSZA 3VI5A 3D4MA 2CVDA 4LMVA 4TN8A 3QD9A 2DIYA 2M46A 3MNGA 4HZ2A 1AQVA 6GSXA 1TW9A 3F9UA 4RUVA 4OFTA 4MK3A 1T8EB 3ZIJA 4K1FA 1MDIA 4I2UA 3M0FA 5ECNB 2DBCA 2JSYA 3UIWA 3DWVA 2AYTA 3IC4A 4FH8A 4DVCA 1WOUA 1ERVA 2DIZA 2JZRA 1XW5A 2H72A 2LJRA 2VCVA 1BQ7A 2YP6A 1K0NA 1AQWA 2DJ2A 2WFCA 2C1YA 2XHFA 2GZYA 1B9XC 2OA7A 1RW1A 4KDUA 3LSZA 1Z7RA 4XRAA 2FUG2 5FHIA 4KX4A 3H93A 1DE2A 2VUPA 5D9VA 3BCKA 3UVHA 2YV9A 3LORA 1QMVA 3MDKA 4KE3A 2L4QA 5ECQB 2FA8A 3TJFA 2VCXA 1ZYEA 4X43A 2VCZA 4F2IA 4QL9A 3F4TA 3F6FA 3LXTA 5IOWA 3KMOA 1X5EA 2R3XA 2PN8A 3IBHA 2RIIA 4G9HA 3IAM2 3TRXA 1K0BA 1M0UA 1GUMA 3HZ8A 2DMMA 1GNWA 1SKSB 3ZVJA 4MH2A 2IN3A 1JZRA 4PUFC 6GSSA 4XIHA 3O76A 5A5KA 5INYA 4KUNA 3GMFA 4XS4B 1V2AA 1OAZA 4MDCA 4V2MA 2C3QA 5EL8A 1XFLA 4KAEA 2VL3A 1XWAA 1G7EA 2QSIA 4JBBA 2B6MA 3EYTA 2L6DA 3LYKA 4KSMA 1S3AA 1R7HA 1K0AA 1NM3A 1TDIA 1GUHA 4HJMA 5DVBA 1OE8A 1XPVA 2NBSA 1JZOA 3PH9A 2YWNA 3EC3A 2P31A 1O85A 4POMA 3Q19A 3UL3A 5AGYA 3QCPA 3FZAA 2JU5A 4TR4A 4GSSA 1T00A 3IK7A 4PQIA 6GSVA 4BPYA 4GF0A 3W8SA 3IHQA 1PD21 4EDZA 1OC8A 1THXA 2DJ0A 5KN1A 2V41A 1LJRA 4TR0A 4XS4A 2HT9A 4WR4A 2DJ1A 1XBSA 1PKZA 1MDKA 5AN1A 1SYXA 1HYUA 1ZCPA 3F3QA 4IS0A 2X64A 1ZOFA 3UBLA 4EO3A 4IW9A 5G5EA 1FAAA 2LJAA 3FKFA 5IM9A 1IYIA 2K6VA 3LYPA 3ZMKA 1ERTA 1YZXA 2GLRA 1X9MB 4MP4A 1DBYA 1A8YA 2H74A 4O7HA 3TKRA 1PL1A 1Y25A 4NV2A 2TRCP 4BVXA 1GULA 4MCUA 2CA8A 2RUEA 3JCML 4BWQA 3V1WA 2H0IA 3F8UA 1F3BA 1UVZA 3F6DA 2DSAA 3L0HA 2IPAA 4GLTA 5D93A 3TKQA 3LWAA 5F8BA 5J4UA 4ML6A 2V6KA 4JR6A 4XS1A 3HVVA 3R2QA 2D2ZA 2HSYA 3ZREA 3P7XA 1ML6A 2GT6A 1MEKA 3HDCA 5J9CA 4PQ1A 4KGIA 2PU9C 3A5WA 5H5QA 3PGTA 2C0FA 4EKZA 3I6AA 1Z6MA 4N0ZA 3QDNA 2YPMA 4ZB9A 4I2TA 3G7IA 4CDOA 4NWYA 2KHPA 2CQ9A 2LKUA 3IK9A 4AJ7A 4EC0A 4LMWA 2C80A 4DEJA 3E0UA 3IR4A 4GCIA 2OBKA 3D22A 3HHVA 5KEJA 1GSSA 2B7JA 1G6YA 1VF2A 2XBQA 3UVTA 5B6MA 3DYRA 4ML1A 5DCHA 3HCZA 4N0VA 2GSQA 2GTUA 4IHUA 2FD3A 4PNGA 2FY6A 2KP2A 2CT6A 2FNOA 4L0WA 5ECOB 2NVLA 1PSQA 1VF1A 1PL2A 1GH2A 3C7MA 3GH9A 1A2LA 1O8WA 1U87A 2KUCA 1U6TA 5B7CA 3WGDA 2M72A 4ZBDA 2R37A 1WPIA 3F63A 2C3NA 3APOA 3DD3A 2VIMA 4HOJA 5CREA 1GSEA 1R5AA 4OO5A 1NHOA 1PGTA 3TOTA 4TKYA 2OBIA 4ECIA 2KLXA 1WE0A 1JHBA 2V32A 3KEBA 1XWGA 3FZ9A 4TVEA 5FWGA 4EXJA 4ZL8A 1ZZYA 1FOVA 3L4NA 2VL2C 2B3SA 2PVOC 4F82A 5ENUA 1YJ6A 4HQSA 1UC7A 3U5RE 3RDWA 1K0MA 2DMLA 2M80A 3ZTLA 5JCGA 7GSSA 3WYWA 1ILOA 3C1RA 4ACSA 1GSYA 4TXVA 2CX3A 3MSZA 2TRXA 2P5RA 4GSTA 2ZUPA 2LUSA 2WB9A 4MMMA 3DRNA 3KGKA 3C71A 1U3AA 4OD7A 4I8BA 1MDJA 4TW5A 2OE3A 4Z7XA 1M7TA 5D96A 3QAGA 2VLVA 3CSHA 2CVKA 4ULXA 1GTBA 2LEGA 4RI7A 3DVXA 1WWJA 2WJUA 2AV4A 2K18A 4HS1A 1QQ2A 3RPPA 2O87A 3KH9A 1TRWA 3DVWA 1BYEA 1OC3A 1B48A 3TRPA 5C04A 3TKSC 3NOFA 1GRXA 4JRRA 4TOPA 5IO0A 3DEXA 8GSSA 5CRHA 4K0GA 2JADA 4POKA 1FVJA 3UAPA 3GL3A 3KMNA 1R4WA 4P3YB 2KP1A 3CRUA 5ECKB 1ABAA 1X5CA 1XOBA 2XPDA 4MJEA 2VCQA 3IAS2 4RQRA 5G1KA 3VPTA 4NXIA 1XIYA 4L5LA 3KCMA 1LU4A 1VF3A 2YWIA 3PINA 1YEPA 2MYGA 3BOAA 2GQKA 4ECCA 1XOAA 4ISDA 4J2FA 1OKTA 4YAPA 1HNBA 2B5YA 3GYKA 1VRSD 1TJDA 4F03A 4WEYA 2MMNA 4HU7A 4OCFA 1SJ6A 2C3TA 4NHZA 1XCCA 3HVXA 6GSTA 3L9UA 3A2XA 2GSRA 2PGTA 3A2VA 2H76A 2YV7A 1A23A 2RUFA 2WRTA 4V1Ap 4KH7A 1A8LA 3ME7A 2AJQB 4DSRA 1BG5A 3H1NA 3ED3A 3VWXA 5EVOA 4OWYA 1SD8A 16GSA 3FR3A 4KB3A 3ZFBA 3IOSA 4PURA 2L57A 1GSDA 4K9ZA 1SU9A 2H71A 4FYUA 2LRCA 1M9BA 2IMDA 4H86A 3HXSA 2R4VA 4O5RA 3LXZA 3HZ4A 4YAVA 1AQXA 1MD3A 4POBA 1TRUA 4LLRA 1M2DA 1NHYA 2YN1A 3GKMA 3CTFA 3GURA 4IP6A 4LA1A 4N10A 5AISA 5GSTA 4IKHA 3G9BA 2L5OA 3KP8A 4IQ1A 1A0FA 1I9DA 3OR5A 2G2QA 2CAIA 3DXBA 5LCZA 4ID0A 3EU4A 4ZB8A 1GP1A 5CO3A 4EVMA 3C1SA 3HY2A 2H0HA 3GHAA 5IMZA 3GFKA 3FYGA 3L78A 3QFAC 2H1GA 3HVSA 5IMCA 1B4QA 2MZCA 3N5OA 3IE3A 3F4SA 4MPFA 4FYCA 3CYNA 5COHA 3D0ZA 2LS5A 3BJ5A 1I5GA 3M8NA 5G30A 2KOKA 1UN2A 2RLIA 4NMUA 4E8EA 2V1MA 1TU7A 2BMXA 4NPBA 1GTUA 4AJ6A 1X5DA 3A2WA 3W8JA 2YWOA 6GSWA 4HZ4A 1QK8A 5G31A
chains in the Genus database with same CATH superfamily
1A0RP 1F2EA 4KF9A 4JR4A 4Q5NA 3LW9A 3LJRA 1ON4A 4MZWA 1T4ZA 4GQCA 4IGJA 1R26A 3KJYA 5EY6A 3IDVA 1GUKA 4IN0A 2YJHA 1TI3A 2HXKA 4HUAA 1AXDA 5JWRB 2HFDA 3IV4A 1XVWA 2PERA 1FW1A 5A4UA 4CY6A 4O92A 2L5LA 1SENA 5E4WA 1M2AA 1O81A 1YF1A 3HJMA 2MMOA 4D73B 5IIZA 5CP1A 4V1Ag 2BTOT 4BVXB 2VM2A 5GAPD 1E6BA 3TJGA 2H73A 2H6ZA 2R2JA 2HRFA 2IJYA 1SD9A 3IRAA 1SK0A 4K0NA 5ECRB 4IJIA 4Z2UA 4O5UA 3P90A 5H5SA 5F06A 1K0CA 2IMKA 2PPTA 1X9WB 4ECBA 5G1LA 2LRNA 3EU3A 3US3A 2H75A 1PRXA 1PX7A 1EGRA 10GSA 1EEMA 2GSSA 3I9V2 1H4OA 1B8XA 3FHKA 3ZFLA 1NW2A 2B5XA 5HR2A 2ZNMA 4EUYA 5IMFA 3FZ4A 3MYDA 4G10A 3TKPA 2EIQA 2JL4A 1CQHA 4MA9A 2VM1A 3TJJA 3GV1A 5G5FA 1XZOA 2B7KA 1EOGA 5J41A 3C8EA 1OYJA 1TOFA 1EOHA 4MH3A 1GTAA 4K7OA 4D73A 4GQFA 1Z9HA 3UBKA 2C0EA 2C8UA 2J23A 1W89A 3UJ1A 2HZFA 1K0OA 4BVYA 1BJXA 3RBTA 19GSA 4PX1A 4EL1A 1JZWA 3TKSE 3C73A 3NZNA 4JZQA 3QAVA 1YEXA 5DCGA 1F3AA 2H1DA 4MZCA 1T4YA 2F9SA 2I81A 2X99A 3FEUA 12GSA 2L59A 4Q5QA 4EE0A 4I97A 3QAWA 3GRXA 2CAQA 1PN0A 2I9HA 2GZPA 1AAZA 1ST9A 2PWJA 3ZITA 5B8BA 4HQZA 1OE7A 2HRKA 2WZ9A 2EIRA 5IMDA 3RPNA 3LG6A 4ZB6A 4ZILA 2R0PA 1K0DA 1EEJA 20GSA 1BEDA 2X49A 4PXOA 1X0RA 2REMA 2DJ3A 4Q5RA 1JZDA 3M3MA 4N11A 2GSTA 2WDUA 1GTIA 2ON7A 1EP7A 3QMXA 5A4VA 1KNGA 1SL0B 3F4RA 4CW9A 3EVIA 3ZVJD 3ERGA 3U6VA 3TRQA 1A2JA 1LBKA 3VLNA 4PUAA 2DLXA 1PN9A 2F8AA 1PA3A 3GH6A 5GAND 2YZHA 3O6TA 1EV9A 4GRFA 1C72A 1AUCA 2IL3A 3FW2A 22GSA 4PNFA 5GSSA 5FT3A 4CHSA 3H79A 5CRWA 4QL7A 5ECPB 1A24A 3F3RA 3QFBC 2VCWA 4MJAA 1MD4A 2LQOA 1FG4A 2DKIA 2CZ2A 2H01A 2H6YA 4Q5FA 1AC1A 1MTCA 4ZL7A 2VL2A 2GGTA 1M3JA 2UZ8A 3DGQA 5DJMA 2EC4A 1FB6A 4ICYA 5A4WA 1QFNA 2VD0A 2GZZA 3GX8A 1ACVA 1TU8A 2XBIA 1J08A 2F3MA 4OO4A 3WGXA 3S9FA 5CYYA 2DJJA 2OE0A 5ECIB 3M1GA 5GZZB 2K8VA 3L9SA 5LNKe 3FR9A 2GQLA 2AAWA 5DALB 2GT5A 3H8QA 2H6XA 4L8EA 3QPMA 1HD2A 1HQOA 2LV3A 5LD0A 2F8FA 4WF5A 3FR6A 4KCEA 2B5EA 4MF7A 1YKCA 1TK8B 2CV4A 1JFUA 3WT2A 2E0QA 3GTUB 1T3BA 2IWTA 1URMA 3IHGA 3TUEA 1K3LA 3KXOA 3TOUA 2R0CA 5D73A 3H4KA 1TRSA 2FLSA 4MZBA 1YQ1A 4YH2A 2HYXA 3LGCA 4KDYA 2VOCA 1Z5YE 1O7UA 2ES7A 2CX4A 1PMTA 3EURA 2X8CA 1OVNA 3DIEA 4EDYA 1FB0A 2PVQA 4X4JA 5KN2A 5ECSA 4OCEA 1WP0A 3ZIVA 1M2BA 4BL7B 1EP8A 1GLQA 4ECJA 3G7JA 1BX9A 2GQMA 3J7Yb 3ZMLA 4NV5A 1SK2A 1M9AA 6GSYA 1G7OA 2I3YA 4K6XA 2HZEB 4XTSA 17GSA 3ZL5A 4QQ7A 11GSA 1V98A 1T7PB 3ZLPA 4KDXA 2WULA 2FWGA 5B6NA 5J9BA 2WS2A 1QXHA 3EE2A 5DALA 4MABA 2VL9A 2I1UA 1AW9A 2C0GA 2X4AA 3A5IA 3HKRA 1T1VA 2C4JA 3SBCA 3GTUA 3KZQA 2O8VB 3QOUA 3Q74A 4RI6A 2QGVA 1WMJA 2BJXA 4WBRD 3A3TA 3W6GA 3L9VA 1W4VA 5G2ZA 1XWKA 1N8JA 3CSJA 1K3OA 2FGXA 4K8MA 4NHWA 4F0CA 3RHBA 2FA4A 4X1UA 4ILFA 4L0UA 4Z2TA 1B4PA 4BA7A 4IVFA 4BL7A 1ZYQB 1GLPA 4K2DA 4N30A 1VGLA 3GNJA 1X9SB 2XPEA 2YCDA 5HFIA 2CZ3A 2HNLA 5F0GA 5JWOB 3RHCA 1F9MA 4PGTA 5E59A 3APSA 2A4VA 2HZEA 3K8NA 3M9KA 3TDGA 3EWLA 3ZRDA 2FWEA 2V2GA 1S3DA 3CXGA 13GSA 3GKKA 5ID2B 2N5AA 1EWXA 3P2AA 4GTUA 2AHEA 4IELA 2H1BA 3VURA 3ME8A 5IPGA 4HI7A 1DSBA 1B9YC 4XS6A 2HSHA 4IP1A 1U3IA 2K9FA 3VWWA 3EMPA 3GKNA 1SL2B 3IPZA 3DKSA 4WXTA 4HJ2A 2LJKA 5DQSA 1YY7A 4GSNA 2H70A 2ALBA 5DDLA 3GIXA 1RK4A 2A2SA 3KIJA 5KN0A 4J57E 4J56E 2FHEA 2DKHA 2LQQA 4BWSA 1WJKA 4F0BA 1N2AA 3PR8A 2I4AA 3CTGA 1KEBA 2V6OA 3Q18A 1F37A 1SJIA 2MBSA 2AUVA 4ZL9A 1XWBA 2DJKA 1YF0A 2XC2A 2IMFA 2FWFA 1ZYPA 1QUWA 3WD6A 3UEMA 1FHEA 2VO4A 2YZUA 5D9TA 3I69A 3MAKA 3QR6A 4EF0A 3BBYA 1S3CA 3KM6A 3MIXA 4V2LA 5IPHA 2RM5A 1FVKA 1RQMA 5ID2A 1SL1B 4RQXA 1PFOA 2OACA 5IMAA 5DBQA 2GVPA 2NTOA 1SJZA 3MWHA 4USSA 1V58A 2ZCTA 3D5JA 3KP9A 2X8HA 1TK5B 3VI7A 4KNDA 3VWUA 2YJ7A 4O32A 4LL1B 4Z2RA 3O3TA 4AGSA 2WCIA 3HVNA 3CMIA 4BVYB 5H5RA 4O5QA 2VAFA 3AY8A 2B1LA 3ERWA 4G2EA 2IFQB 1O6JA 4WR5A 1ERUA 1CQGA 3CBUA 3E3EA 1ZGNA 4WF4A 3VK9A 3BCIA 3ERFA 4WKWA 5DAKB 1XVQA 1Z3EA 2LNSA 1EV4A 4YQMA 2GS3A 3GN3A 1H75A 3FZ5A 4OFNA 1TK0B 3LEFA 1JLVA 4GXZA 3TB2A 4FQUA 3R3EA 1AIUA 5HQPA 1V9WA 1XW9A 3UOMA 5IO2A 2PMTA 2PBJA 1ZL9A 1FO5A 3HA9A 4GWRA 5HFGA 1DE1A 4DSSB 2O89A 4IJ3A 4ZIJA 4KCAA 4MJCA 3HJOA 3D21A 3GL5A 5J3RA 2N5FA 3HJPA 4HU9A 2JZSA 4ZXGA 4MF6A 3E9JB 3TJBA 4MJBA 1GSQA 1WRYA 1KBNA 1ZMAA 2O7KA 4JU5A 1EZKA 2IFQA 5F07A 4TR1B 1OKDA 2PUKC 4FYBA 2E7PA 3ZZXA 2LRTA 2FCHA 1EGOA 2E2MA 5ELGA 1OC9B 1Y6EA 5DAKA 2O85A 4IQAA 4TXOB 2C0DA 3G7YA 3ZYWA 2E2GA 4K7NA 3GSSA 4AF2A 1O73A 2P0GA 5IMVA 2QC7A 4DSSA 4E8HA 2YANA 1THOA 1GNEA 1PQNA 1V40A 1E2YA 2VLTA 4G19A 1U88A 4ZBBA 1TXXA 5D9XA 2H66A 3KTBA 1TTZA 2NDOA 5EPFA 1YKAA 4KW6A 5HFKA 2K8SA 4XHMA 3APQA 5JWQB 5ECLB 3VFIA 2H0GA 4FO5A 4MLYA 4TR1A 4YQVA 3RAZA 2H8LA 2G0FA 5D8IA 2YOIA 2TIRA 4ZBAA 2VD1A 2R5GA 3D4TA 2EIOA 1OC9A 2A2RA 2L6CA 1HNAA 1XW6A 3VWVA 4TXOA 2YNXA 5ELAA 1VF4A 3IC8A 1TI1A 3LQ7A 4JEDA 1R5PA 1KTEA 5AIVA 1TRVA 4XRDA 1PX6A 5IQYA 2MMZA 4JE1A 1A2MA 3IXRA 5JCUA 4KA0A 1TP9A 3CRTA 3WT1A 1UA5A 4A5PA 2CVBA 4WBJA 1O8XA 5DQYA 4YQUA 3SWLA 1DUGA 1ERWA 4EIQA 1V57A 1SK1A 4F9ZA 4MF5A 2MMAA 1BAYA 3GSTA 3DMLA 1NSWA 3NIVA 2H1AA 1Q4JA 3WGEA 4POLA 3GA4A 2IIYA 2L4CA 5HR1A 1IYHA 2QKEA 4FIWA 5HR0A 3KTLA 2LSTA 4TRXA 4OMVA 3M9JA 5ECMB 3FK8A 4WETA 3J7Yk 4NAXA 3F0IA 4KSOA 9GSSA 2NPBA 2LNTA 2AB6A 1GWCA 2FWHA 1K3YA 3FRCA 3TJKA 3BD2A 4I5QA 1WIKA 3TGZA 4DSQA 1HNCA 4MPGA 2JZTA 2HRNA 1SYRA 5B8AA 1Z7PA 5J5NA 1GSUA 2IMEA 3D6IA 5ECHB 2R6KA 4V2NA 6GSUA 5KN3A 1J0FA 5D9WA 3TKSA 5JCWA 2OE1A 3FMWA 2HLSA 14GSA 2MBTA 2VCTA 2LTKA 1XXUA 18GSA 1G6WA 3CQFA 2DC5A 3UMAA 4K5SA 1XWCA 4HDEA 1GSFA 4TR3A 4HEA2 2HI7A 1GL8A 5CRGA 2OKAA 5CAXA 2JACA 2F51A 2ON5A 3TCOA 5CRDA 3P8WA 2J9HA 4X0XA 2H30A 1PKWA 3GUSA 4AJ8A 2RM6A 5BRTA 1Z6NA 4OFMA 4L5OA 5C00A 3HD5A 1TKDB 4K7IA 2P5QA 2N5BA 3Q6OA 1M99A 2IMIA 1SKRB 3KD0A 1Q98A 1F6MC 2GDRA 2Z9SA 2OJLA 3ISOA 5L71A 4HSCX 1YDKA 5F05A 3EINA 2WGRA 3GX0A 3FY7A 1JLWA 3I43A 1USBA 3CSIA 1J9BA 2B1KA 4IBPA 3EMXA 3IA1A 5DJLA 5ABRA 3GKXA 2YWMA 4PQHA 3HYPA 3N9JA 1G0TA 1ZYNA 3LFLA 5HR3A 5AIXA 4XCSA 1SKWB 2HE3A 3UARA 2VLUA 2H19A 4LL4B 2X8GA 3KH7A 5IOXA 4I6XA 3VPQA 1QGVA 2OADA 5CNWA 2JSZA 3VI5A 3D4MA 2CVDA 4LMVA 4TN8A 3QD9A 4CY8A 2DIYA 2M46A 3MNGA 4HZ2A 1AQVA 6GSXA 1TW9A 3F9UA 4RUVA 4OFTA 4MK3A 1T8EB 3ZIJA 4K1FA 1MDIA 4I2UA 3M0FA 5ECNB 2DBCA 2JSYA 3UIWA 3DWVA 2AYTA 3IC4A 4FH8A 4DVCA 1WOUA 1ERVA 2DIZA 2JZRA 1XW5A 2H72A 2LJRA 2HSMA 1BQ7A 2VCVA 2YP6A 1K0NA 1AQWA 2DJ2A 2WFCA 2C1YA 2XHFA 2GZYA 1B9XC 2OA7A 1RW1A 4KDUA 3LSZA 1Z7RA 4XRAA 2FUG2 5FHIA 2HRAA 4KX4A 3H93A 1DE2A 2VUPA 5D9VA 3BCKA 3UVHA 2YV9A 3LORA 1QMVA 3MDKA 4KE3A 2L4QA 5ECQB 2FA8A 3TJFA 2VCXA 1ZYEA 4X43A 2VCZA 4F2IA 4QL9A 3F4TA 3F6FA 3LXTA 5IOWA 3KMOA 1X5EA 2R3XA 2PN8A 3IBHA 2RIIA 4G9HA 3IAM2 3TRXA 1K0BA 1M0UA 1GUMA 3HZ8A 2DMMA 1GNWA 1SKSB 3ZVJA 4MH2A 2IN3A 1JZRA 4PUFC 6GSSA 4XIHA 3O76A 5A5KA 5INYA 4KUNA 3GMFA 4XS4B 1V2AA 1OAZA 4MDCA 4V2MA 2C3QA 5EL8A 1XFLA 4KAEA 2VL3A 1XWAA 1G7EA 2QSIA 4JBBA 2B6MA 3EYTA 2L6DA 3LYKA 4KSMA 1S3AA 1R7HA 1K0AA 1NM3A 1TDIA 1GUHA 4HJMA 5DVBA 1OE8A 1XPVA 2NBSA 1JZOA 3PH9A 2YWNA 3EC3A 2P31A 1O85A 4POMA 3Q19A 3UL3A 5AGYA 3QCPA 3FZAA 2JU5A 4TR4A 4GSSA 1T00A 3IK7A 4PQIA 6GSVA 4BPYA 4MNNA 4GF0A 3W8SA 3IHQA 1PD21 4EDZA 1OC8A 1THXA 2DJ0A 5KN1A 2V41A 1LJRA 4TR0A 4XS4A 2HT9A 4WR4A 2DJ1A 1XBSA 1PKZA 1MDKA 5AN1A 1SYXA 1HYUA 1ZCPA 3F3QA 4IS0A 2X64A 1ZOFA 3UBLA 4EO3A 4IW9A 5G5EA 1FAAA 2LJAA 3FKFA 5IM9A 1IYIA 2K6VA 3LYPA 3ZMKA 1ERTA 2QA2A 1YZXA 2GLRA 1X9MB 4MP4A 1DBYA 1A8YA 2H74A 4O7HA 3TKRA 1PL1A 1Y25A 4NV2A 2TRCP 4BVXA 1XG8A 1GULA 4MCUA 2CA8A 2RUEA 3JCML 4BWQA 3V1WA 2H0IA 3F8UA 1F3BA 1UVZA 3F6DA 2DSAA 3L0HA 2IPAA 4GLTA 5D93A 3TKQA 3LWAA 5F8BA 5J4UA 4ML6A 2V6KA 4JR6A 4XS1A 3HVVA 4YKGA 3R2QA 2D2ZA 2HSYA 3ZREA 3P7XA 1ML6A 2GT6A 1MEKA 3HDCA 5J9CA 3EPTA 4PQ1A 4KGIA 2PU9C 3A5WA 5H5QA 3PGTA 2C0FA 4EKZA 3I6AA 4YKFA 1Z6MA 4N0ZA 3QDNA 2YPMA 4ZB9A 4I2TA 3G7IA 4CDOA 4NWYA 2KHPA 2CQ9A 2LKUA 3IK9A 4AJ7A 4EC0A 4LMWA 2C80A 4DEJA 4BIKA 3E0UA 3IR4A 4GCIA 2OBKA 3D22A 3HHVA 5KEJA 1GSSA 2B7JA 1G6YA 1VF2A 2XBQA 3UVTA 5B6MA 3DYRA 4ML1A 5DCHA 3HCZA 4N0VA 2GSQA 2GTUA 4IHUA 2FD3A 4PNGA 2FY6A 2KP2A 2CT6A 2FNOA 4L0WA 5ECOB 2A4HA 2NVLA 1PSQA 1VF1A 2A2PA 1PL2A 1GH2A 3C7MA 3GH9A 1A2LA 1O8WA 2R0GA 1U87A 2KUCA 1U6TA 5B7CA 3WGDA 2M72A 4ZBDA 2R37A 1WPIA 3F63A 2C3NA 3APOA 3DD3A 2VIMA 4K2XA 4HOJA 5CREA 1GSEA 1R5AA 4OO5A 1NHOA 1PGTA 3TOTA 4TKYA 2OBIA 4ECIA 2KLXA 1WE0A 1JHBA 2V32A 3KEBA 1XWGA 3FZ9A 4TVEA 5FWGA 4PTSA 4EXJA 4ZL8A 1ZZYA 1FOVA 3L4NA 2VL2C 2B3SA 2PVOC 4F82A 5ENUA 1YJ6A 4HQSA 1UC7A 3U5RE 3RDWA 1K0MA 2DMLA 2M80A 3ZTLA 5JCGA 7GSSA 3WYWA 1ILOA 3C1RA 4ACSA 1GSYA 4TXVA 2CX3A 3MSZA 2TRXA 2P5RA 4G0KA 4GSTA 2ZUPA 5KOXA 2LUSA 2WB9A 4MMMA 3DRNA 3KGKA 3C71A 1U3AA 4OD7A 4I8BA 1MDJA 4TW5A 2OE3A 4Z7XA 1M7TA 5D96A 5BMUA 3QAGA 2VLVA 3CSHA 2CVKA 4ULXA 1GTBA 2LEGA 4RI7A 3DVXA 1WWJA 2WJUA 2AV4A 2K18A 4HS1A 1QQ2A 3RPPA 2O87A 3KH9A 1TRWA 3DVWA 1BYEA 1OC3A 1B48A 3TRPA 5C04A 3TKSC 3NOFA 1GRXA 4JRRA 4TOPA 5IO0A 3DEXA 8GSSA 5CRHA 4K0GA 2JADA 4POKA 1S3RA 1FVJA 4EIPA 2QA1A 3UAPA 3GL3A 3KMNA 1R4WA 4P3YB 2KP1A 3CRUA 5ECKB 1ABAA 1X5CA 1XOBA 2XPDA 4MJEA 2VCQA 3IAS2 4RQRA 5G1KA 3VPTA 4NXIA 1XIYA 4L5LA 3KCMA 1LU4A 1VF3A 2YWIA 3PINA 1YEPA 2MYGA 3BOAA 2GQKA 4ECCA 1XOAA 4ISDA 4J2FA 1OKTA 4YAPA 1HNBA 2B5YA 3GYKA 1VRSD 1TJDA 4F03A 4WEYA 2MMNA 4HU7A 4OCFA 1SJ6A 2C3TA 4NHZA 1XCCA 3HVXA 6GSTA 3L9UA 3A2XA 2GSRA 2PGTA 3A2VA 2H76A 2YV7A 1A23A 1FOHA 2RUFA 2WRTA 4V1Ap 3PPUA 4KH7A 1A8LA 3ME7A 2AJQB 4DSRA 1BG5A 3H1NA 3ED3A 3VWXA 5EVOA 4OWYA 1SD8A 16GSA 3FR3A 4KB3A 3ZFBA 3IOSA 4PURA 2L57A 1GSDA 4K9ZA 1SU9A 2H71A 4FYUA 2LRCA 1M9BA 2IMDA 4H86A 4K5RA 3HXSA 2R4VA 4O5RA 3LXZA 3HZ4A 4YAVA 1AQXA 1MD3A 4POBA 1TRUA 4LLRA 1M2DA 5KOWA 1NHYA 2YN1A 3GKMA 3CTFA 3GURA 4IP6A 4LA1A 4N10A 5AISA 5GSTA 4IKHA 3G9BA 2L5OA 3KP8A 4IQ1A 1A0FA 1I9DA 1M3IA 3OR5A 2G2QA 2CAIA 3DXBA 5LCZA 4ID0A 3EU4A 4ZB8A 1GP1A 5CO3A 4EVMA 3C1SA 3HY2A 2H0HA 3GHAA 5IMZA 3GFKA 3FYGA 3L78A 3QFAC 2H1GA 3HVSA 5IMCA 1B4QA 2MZCA 3N5OA 3IE3A 3F4SA 4G0IA 4G0LA 4MPFA 4FYCA 3CYNA 5COHA 3D0ZA 2LS5A 3BJ5A 1I5GA 3M8NA 5G30A 2KOKA 1UN2A 2RLIA 4NMUA 4E8EA 2V1MA 1TU7A 2BMXA 4NPBA 1GTUA 4AJ6A 1X5DA 3A2WA 3W8JA 2YWOA 6GSWA 4HZ4A 1QK8A 5G31A
chains in the Genus database with same CATH topology
1A0RP 1F2EA 4KF9A 4JR4A 4Q5NA 3LW9A 3LJRA 1ON4A 4MZWA 1T4ZA 4GQCA 4IGJA 1R26A 3KJYA 5EY6A 3IDVA 1GUKA 4IN0A 2YJHA 1TI3A 2HXKA 4HUAA 1AXDA 5JWRB 2HFDA 3IV4A 1XVWA 2PERA 1FW1A 5A4UA 4CY6A 4O92A 2L5LA 1SENA 5E4WA 1M2AA 1O81A 1YF1A 3HJMA 2MMOA 4D73B 5IIZA 5CP1A 4V1Ag 2BTOT 4BVXB 2VM2A 5GAPD 1E6BA 3TJGA 2H73A 2H6ZA 2R2JA 2HRFA 2IJYA 1SD9A 3IRAA 1SK0A 4K0NA 5ECRB 4IJIA 4Z2UA 4O5UA 3P90A 5H5SA 5F06A 1K0CA 2IMKA 2PPTA 1X9WB 4ECBA 5G1LA 2LRNA 3EU3A 3US3A 2H75A 1PRXA 1PX7A 1EGRA 10GSA 1EEMA 2GSSA 3I9V2 1H4OA 1B8XA 3FHKA 3ZFLA 1NW2A 2B5XA 5HR2A 2ZNMA 4EUYA 5IMFA 3FZ4A 3MYDA 4G10A 3TKPA 2EIQA 2JL4A 1CQHA 4MA9A 2VM1A 3TJJA 3GV1A 5G5FA 1XZOA 2B7KA 1EOGA 5J41A 3C8EA 1OYJA 1TOFA 1EOHA 4MH3A 1GTAA 4K7OA 4D73A 4GQFA 1Z9HA 3UBKA 2C0EA 2C8UA 2J23A 1W89A 3UJ1A 2HZFA 1K0OA 4BVYA 1BJXA 3RBTA 19GSA 4PX1A 4EL1A 1JZWA 3TKSE 3C73A 3NZNA 4JZQA 3QAVA 1YEXA 5DCGA 1F3AA 2H1DA 4MZCA 1T4YA 2F9SA 2I81A 2X99A 3FEUA 12GSA 2L59A 4Q5QA 4EE0A 4I97A 3QAWA 3GRXA 2CAQA 1PN0A 2I9HA 2GZPA 1AAZA 1ST9A 2PWJA 3ZITA 5B8BA 4HQZA 1OE7A 2HRKA 2WZ9A 2EIRA 5IMDA 3RPNA 3LG6A 4ZB6A 4ZILA 2R0PA 1K0DA 1EEJA 20GSA 1BEDA 2X49A 4PXOA 1X0RA 2REMA 2DJ3A 4Q5RA 1JZDA 3M3MA 4N11A 2GSTA 2WDUA 1GTIA 2ON7A 1EP7A 3QMXA 5A4VA 1KNGA 1SL0B 3F4RA 4CW9A 3EVIA 3ZVJD 3ERGA 3U6VA 3TRQA 1A2JA 1LBKA 3VLNA 4PUAA 2DLXA 1PN9A 2F8AA 1PA3A 3GH6A 5GAND 2YZHA 3O6TA 1EV9A 4GRFA 1C72A 1AUCA 2IL3A 3FW2A 22GSA 4PNFA 5GSSA 5FT3A 4CHSA 3H79A 5CRWA 4QL7A 5ECPB 1A24A 3F3RA 3QFBC 2VCWA 4MJAA 1MD4A 2LQOA 1FG4A 2DKIA 2CZ2A 2H01A 2H6YA 4Q5FA 1AC1A 1MTCA 4ZL7A 2VL2A 2GGTA 2UZ8A 3DGQA 5DJMA 2EC4A 1FB6A 4ICYA 5A4WA 1QFNA 2VD0A 2GZZA 3GX8A 1ACVA 1TU8A 2XBIA 1J08A 2F3MA 4OO4A 3WGXA 3S9FA 5CYYA 2DJJA 2OE0A 5ECIB 3M1GA 5GZZB 2K8VA 3L9SA 5LNKe 3FR9A 2GQLA 2AAWA 5DALB 2GT5A 3H8QA 2H6XA 4L8EA 3QPMA 1HD2A 1HQOA 2LV3A 5LD0A 2F8FA 4WF5A 3FR6A 4KCEA 2B5EA 4MF7A 1YKCA 1TK8B 2CV4A 1JFUA 3WT2A 2E0QA 3GTUB 1T3BA 2IWTA 1URMA 3IHGA 3TUEA 1K3LA 3KXOA 3TOUA 2R0CA 5D73A 3H4KA 1TRSA 2FLSA 4MZBA 1YQ1A 4YH2A 2HYXA 3LGCA 4KDYA 2VOCA 1Z5YE 1O7UA 2ES7A 2CX4A 1PMTA 3EURA 2X8CA 1OVNA 3DIEA 4EDYA 1FB0A 2PVQA 4X4JA 5KN2A 5ECSA 4OCEA 1WP0A 3ZIVA 1M2BA 4BL7B 1EP8A 1GLQA 4ECJA 3G7JA 1BX9A 2GQMA 3J7Yb 3ZMLA 4NV5A 1SK2A 1M9AA 6GSYA 1G7OA 2I3YA 4K6XA 2HZEB 4XTSA 17GSA 3ZL5A 4QQ7A 11GSA 1V98A 1T7PB 3ZLPA 4KDXA 2WULA 2FWGA 5B6NA 5J9BA 2WS2A 1QXHA 3EE2A 5DALA 4MABA 2VL9A 2I1UA 1AW9A 2C0GA 2X4AA 3A5IA 3HKRA 1T1VA 2C4JA 3SBCA 3GTUA 3KZQA 2O8VB 3QOUA 3Q74A 4RI6A 2QGVA 1WMJA 2BJXA 4WBRD 3A3TA 3W6GA 3L9VA 1W4VA 5G2ZA 1XWKA 1N8JA 3CSJA 1K3OA 2FGXA 4K8MA 4NHWA 4F0CA 3RHBA 2FA4A 4X1UA 4ILFA 4L0UA 4Z2TA 1B4PA 4BA7A 4IVFA 4BL7A 1ZYQB 1GLPA 4K2DA 4N30A 1VGLA 3GNJA 1X9SB 2XPEA 2YCDA 5HFIA 2CZ3A 2HNLA 5F0GA 5JWOB 3RHCA 1F9MA 4PGTA 5E59A 3APSA 2A4VA 2HZEA 3K8NA 3M9KA 3TDGA 3EWLA 3ZRDA 2FWEA 2V2GA 1S3DA 3CXGA 13GSA 3GKKA 5ID2B 2N5AA 1EWXA 3P2AA 4GTUA 2AHEA 4IELA 2H1BA 3VURA 3ME8A 5IPGA 4HI7A 1DSBA 1B9YC 4XS6A 2HSHA 4IP1A 1U3IA 2K9FA 3VWWA 3EMPA 3GKNA 1SL2B 3IPZA 3DKSA 4WXTA 4HJ2A 2LJKA 5DQSA 1YY7A 4GSNA 2H70A 2ALBA 5DDLA 3GIXA 1RK4A 2A2SA 3KIJA 5KN0A 4J57E 4J56E 2FHEA 2DKHA 2LQQA 4BWSA 1WJKA 4F0BA 1N2AA 3PR8A 2I4AA 3CTGA 1KEBA 2V6OA 3Q18A 1F37A 1SJIA 2MBSA 2AUVA 4ZL9A 1XWBA 2DJKA 1YF0A 2XC2A 2IMFA 2FWFA 1ZYPA 1QUWA 3WD6A 3UEMA 1FHEA 2VO4A 2YZUA 5D9TA 3I69A 3MAKA 3QR6A 4EF0A 3BBYA 1S3CA 3KM6A 3MIXA 4V2LA 5IPHA 2RM5A 1FVKA 1RQMA 5ID2A 1SL1B 4RQXA 2OACA 5IMAA 5DBQA 2GVPA 2NTOA 1SJZA 3MWHA 4USSA 1V58A 2ZCTA 3D5JA 3KP9A 2X8HA 1TK5B 3VI7A 4KNDA 3VWUA 2YJ7A 4O32A 4LL1B 4Z2RA 3O3TA 4AGSA 2WCIA 3CMIA 4BVYB 5H5RA 4O5QA 2VAFA 3AY8A 2B1LA 3ERWA 4G2EA 2IFQB 1O6JA 4WR5A 1ERUA 1CQGA 3CBUA 3E3EA 1ZGNA 4WF4A 3VK9A 3BCIA 3ERFA 4WKWA 5DAKB 1XVQA 1Z3EA 2LNSA 1EV4A 4YQMA 2GS3A 3GN3A 1H75A 3FZ5A 4OFNA 1TK0B 3LEFA 1JLVA 4GXZA 3TB2A 4FQUA 3R3EA 1AIUA 5HQPA 1V9WA 1XW9A 3UOMA 5IO2A 2PMTA 2PBJA 1ZL9A 1FO5A 3HA9A 4GWRA 5HFGA 1DE1A 4DSSB 2O89A 4IJ3A 4ZIJA 4KCAA 4MJCA 3HJOA 3D21A 3GL5A 5J3RA 2N5FA 3HJPA 4HU9A 2JZSA 4ZXGA 4MF6A 3E9JB 3TJBA 4MJBA 1GSQA 1WRYA 1KBNA 1ZMAA 2O7KA 4JU5A 1EZKA 2IFQA 5F07A 4TR1B 1OKDA 2PUKC 4FYBA 2E7PA 3ZZXA 2LRTA 2FCHA 1EGOA 2E2MA 5ELGA 1OC9B 1Y6EA 5DAKA 2O85A 4IQAA 4TXOB 2C0DA 3G7YA 3ZYWA 2E2GA 4K7NA 3GSSA 4AF2A 1O73A 2P0GA 5IMVA 2QC7A 4DSSA 4E8HA 2YANA 1THOA 1GNEA 1PQNA 1V40A 1E2YA 2VLTA 4G19A 1U88A 4ZBBA 1TXXA 5D9XA 2H66A 3KTBA 1TTZA 2NDOA 5EPFA 1YKAA 4KW6A 5HFKA 2K8SA 4XHMA 3APQA 5JWQB 5ECLB 3VFIA 2H0GA 4FO5A 4MLYA 4TR1A 4YQVA 3RAZA 2H8LA 2G0FA 5D8IA 2YOIA 2TIRA 4ZBAA 2VD1A 2R5GA 3D4TA 2EIOA 1OC9A 2A2RA 2L6CA 1HNAA 1XW6A 3VWVA 4TXOA 2YNXA 5ELAA 1VF4A 3IC8A 1TI1A 3LQ7A 4JEDA 1R5PA 1KTEA 5AIVA 1TRVA 4XRDA 1PX6A 5IQYA 2MMZA 4JE1A 1A2MA 3IXRA 5JCUA 4KA0A 1TP9A 3CRTA 3WT1A 1UA5A 4A5PA 2CVBA 4WBJA 1O8XA 5DQYA 4YQUA 3SWLA 1DUGA 1ERWA 4EIQA 1V57A 1SK1A 4F9ZA 4MF5A 2MMAA 1BAYA 3GSTA 3DMLA 1NSWA 3NIVA 2H1AA 1Q4JA 3WGEA 4POLA 3GA4A 2IIYA 2L4CA 5HR1A 1IYHA 2QKEA 4FIWA 5HR0A 3KTLA 2LSTA 4TRXA 4OMVA 3M9JA 5ECMB 3FK8A 4WETA 3J7Yk 4NAXA 3F0IA 4KSOA 9GSSA 2NPBA 2LNTA 2AB6A 1GWCA 2FWHA 1K3YA 3FRCA 3TJKA 3BD2A 4I5QA 1WIKA 3TGZA 4DSQA 1HNCA 4MPGA 2JZTA 2HRNA 1SYRA 5B8AA 1Z7PA 5J5NA 1GSUA 2IMEA 3D6IA 5ECHB 2R6KA 4V2NA 6GSUA 5KN3A 1J0FA 5D9WA 3TKSA 5JCWA 2OE1A 3FMWA 2HLSA 14GSA 2MBTA 2VCTA 2LTKA 1XXUA 18GSA 1G6WA 2DC5A 3UMAA 4K5SA 1XWCA 4HDEA 1GSFA 4TR3A 4HEA2 2HI7A 1GL8A 5CRGA 2OKAA 5CAXA 2JACA 2F51A 2ON5A 3TCOA 5CRDA 3P8WA 2J9HA 4X0XA 2H30A 1PKWA 3GUSA 4AJ8A 2RM6A 5BRTA 1Z6NA 4OFMA 4L5OA 5C00A 3HD5A 1TKDB 4K7IA 2P5QA 2N5BA 3Q6OA 1M99A 2IMIA 1SKRB 3KD0A 1Q98A 1F6MC 2GDRA 2Z9SA 2OJLA 3ISOA 5L71A 1YDKA 5F05A 3EINA 2WGRA 3GX0A 3FY7A 1JLWA 3I43A 1USBA 3CSIA 1J9BA 2B1KA 4IBPA 3EMXA 3IA1A 5DJLA 5ABRA 3GKXA 2YWMA 4PQHA 3HYPA 3N9JA 1G0TA 1ZYNA 3LFLA 5HR3A 5AIXA 4XCSA 1SKWB 2HE3A 3UARA 2VLUA 2H19A 4LL4B 2X8GA 3KH7A 5IOXA 4I6XA 3VPQA 1QGVA 2OADA 5CNWA 2JSZA 3VI5A 3D4MA 2CVDA 4LMVA 4TN8A 3QD9A 4CY8A 2DIYA 2M46A 3MNGA 4HZ2A 1AQVA 6GSXA 1TW9A 3F9UA 4RUVA 4OFTA 4MK3A 1T8EB 3ZIJA 4K1FA 1MDIA 4I2UA 3M0FA 5ECNB 2DBCA 2JSYA 3UIWA 3DWVA 2AYTA 3IC4A 4FH8A 4DVCA 1WOUA 1ERVA 2DIZA 2JZRA 1XW5A 2H72A 2LJRA 2HSMA 1BQ7A 2VCVA 2YP6A 1K0NA 1AQWA 2DJ2A 2WFCA 2C1YA 2XHFA 2GZYA 1B9XC 2OA7A 1RW1A 4KDUA 3LSZA 1Z7RA 4XRAA 2FUG2 5FHIA 2HRAA 4KX4A 3H93A 1DE2A 2VUPA 5D9VA 3BCKA 3UVHA 2YV9A 3LORA 1QMVA 3MDKA 4KE3A 2L4QA 5ECQB 2FA8A 3TJFA 2VCXA 1ZYEA 4X43A 2VCZA 4F2IA 4QL9A 3F4TA 3F6FA 3LXTA 5IOWA 3KMOA 1X5EA 2R3XA 2PN8A 3IBHA 2RIIA 4G9HA 3IAM2 3TRXA 1K0BA 1M0UA 1GUMA 3HZ8A 2DMMA 1GNWA 1SKSB 3ZVJA 4MH2A 2IN3A 1JZRA 4PUFC 6GSSA 4XIHA 3O76A 5A5KA 5INYA 4KUNA 3GMFA 4XS4B 1V2AA 1OAZA 4MDCA 4V2MA 2C3QA 5EL8A 1XFLA 4KAEA 2VL3A 1XWAA 1G7EA 2QSIA 4JBBA 2B6MA 3EYTA 2L6DA 3LYKA 4KSMA 1S3AA 1R7HA 1K0AA 1NM3A 1TDIA 1GUHA 4HJMA 5DVBA 1OE8A 1XPVA 2NBSA 1JZOA 3PH9A 2YWNA 3EC3A 2P31A 1O85A 4POMA 3Q19A 3UL3A 5AGYA 3QCPA 3FZAA 2JU5A 4TR4A 4GSSA 1T00A 3IK7A 4PQIA 6GSVA 4BPYA 4MNNA 4GF0A 3W8SA 3IHQA 1PD21 4EDZA 1OC8A 1THXA 2DJ0A 5KN1A 2V41A 1LJRA 4TR0A 4XS4A 2HT9A 4WR4A 2DJ1A 1XBSA 1PKZA 1MDKA 5AN1A 1SYXA 1HYUA 1ZCPA 3F3QA 4IS0A 2X64A 1ZOFA 3UBLA 4EO3A 4IW9A 5G5EA 1FAAA 2LJAA 3FKFA 5IM9A 1IYIA 2K6VA 3LYPA 3ZMKA 1ERTA 2QA2A 1YZXA 2GLRA 1X9MB 4MP4A 1DBYA 1A8YA 2H74A 4O7HA 3TKRA 1PL1A 1Y25A 4NV2A 2TRCP 4BVXA 1GULA 4MCUA 2CA8A 2RUEA 3JCML 4BWQA 3V1WA 2H0IA 3F8UA 1F3BA 1UVZA 3F6DA 2DSAA 3L0HA 2IPAA 4GLTA 5D93A 3TKQA 3LWAA 5F8BA 5J4UA 4ML6A 2V6KA 4JR6A 4XS1A 3HVVA 4YKGA 3R2QA 2D2ZA 2HSYA 3ZREA 3P7XA 1ML6A 2GT6A 1MEKA 3HDCA 5J9CA 3EPTA 4PQ1A 4KGIA 2PU9C 3A5WA 5H5QA 3PGTA 2C0FA 4EKZA 3I6AA 4YKFA 1Z6MA 4N0ZA 3QDNA 2YPMA 4ZB9A 4I2TA 3G7IA 4CDOA 4NWYA 2KHPA 2CQ9A 2LKUA 3IK9A 4AJ7A 4EC0A 4LMWA 2C80A 4DEJA 3E0UA 3IR4A 4GCIA 2OBKA 3D22A 3HHVA 5KEJA 1GSSA 2B7JA 1G6YA 1VF2A 2XBQA 3UVTA 5B6MA 3DYRA 4ML1A 5DCHA 3HCZA 4N0VA 2GSQA 2GTUA 4IHUA 2FD3A 4PNGA 2FY6A 2KP2A 2CT6A 2FNOA 4L0WA 5ECOB 2A4HA 2NVLA 1PSQA 1VF1A 2A2PA 1PL2A 1GH2A 3C7MA 3GH9A 1A2LA 1O8WA 2R0GA 1U87A 2KUCA 1U6TA 5B7CA 3WGDA 2M72A 4ZBDA 2R37A 1WPIA 3F63A 2C3NA 3APOA 3DD3A 2VIMA 4K2XA 4HOJA 5CREA 1GSEA 1R5AA 4OO5A 1NHOA 1PGTA 3TOTA 4TKYA 2OBIA 4ECIA 2KLXA 1WE0A 1JHBA 2V32A 3KEBA 1XWGA 3FZ9A 4TVEA 5FWGA 4PTSA 4EXJA 4ZL8A 1ZZYA 1FOVA 3L4NA 2VL2C 2B3SA 2PVOC 4F82A 5ENUA 1YJ6A 4HQSA 1UC7A 3U5RE 3RDWA 1K0MA 2DMLA 2M80A 3ZTLA 5JCGA 7GSSA 3WYWA 1ILOA 3C1RA 4ACSA 1GSYA 4TXVA 2CX3A 3MSZA 2TRXA 2P5RA 4G0KA 4GSTA 2ZUPA 5KOXA 2LUSA 2WB9A 4MMMA 3DRNA 3KGKA 3C71A 1U3AA 4OD7A 4I8BA 1MDJA 4TW5A 2OE3A 4Z7XA 1M7TA 5D96A 5BMUA 3QAGA 2VLVA 3CSHA 2CVKA 4ULXA 1GTBA 2LEGA 4RI7A 3DVXA 1WWJA 2WJUA 2AV4A 2K18A 4HS1A 1QQ2A 3RPPA 2O87A 3KH9A 1TRWA 3DVWA 1BYEA 1OC3A 1B48A 3TRPA 5C04A 3TKSC 3NOFA 1GRXA 4JRRA 4TOPA 5IO0A 3DEXA 8GSSA 5CRHA 4K0GA 2JADA 4POKA 1FVJA 4EIPA 2QA1A 3UAPA 3GL3A 3KMNA 1R4WA 4P3YB 2KP1A 3CRUA 5ECKB 1ABAA 1X5CA 1XOBA 2XPDA 4MJEA 2VCQA 3IAS2 4RQRA 5G1KA 3VPTA 4NXIA 1XIYA 4L5LA 3KCMA 1LU4A 1VF3A 2YWIA 3PINA 1YEPA 2MYGA 3BOAA 2GQKA 4ECCA 1XOAA 4ISDA 4J2FA 1OKTA 4YAPA 1HNBA 2B5YA 3GYKA 1VRSD 1TJDA 4F03A 4WEYA 2MMNA 4HU7A 4OCFA 1SJ6A 2C3TA 4NHZA 1XCCA 3HVXA 6GSTA 3L9UA 3A2XA 2GSRA 2PGTA 3A2VA 2H76A 2YV7A 1A23A 1FOHA 2RUFA 2WRTA 4V1Ap 3PPUA 4KH7A 1A8LA 3ME7A 2AJQB 4DSRA 1BG5A 3H1NA 3ED3A 3VWXA 5EVOA 4OWYA 1SD8A 16GSA 3FR3A 4KB3A 3ZFBA 3IOSA 4PURA 2L57A 1GSDA 4K9ZA 1SU9A 2H71A 4FYUA 2LRCA 1M9BA 2IMDA 4H86A 4K5RA 3HXSA 2R4VA 4O5RA 3LXZA 3HZ4A 4YAVA 1AQXA 1MD3A 4POBA 1TRUA 4LLRA 1M2DA 5KOWA 1NHYA 2YN1A 3GKMA 3CTFA 3GURA 4IP6A 4LA1A 4N10A 5AISA 5GSTA 4IKHA 3G9BA 2L5OA 3KP8A 4IQ1A 1A0FA 1I9DA 3OR5A 2G2QA 2CAIA 3DXBA 5LCZA 4ID0A 3EU4A 4ZB8A 1GP1A 5CO3A 4EVMA 3C1SA 3HY2A 2H0HA 3GHAA 5IMZA 3GFKA 3FYGA 3L78A 3QFAC 2H1GA 3HVSA 5IMCA 1B4QA 2MZCA 3N5OA 3IE3A 3F4SA 4G0IA 4G0LA 4MPFA 4FYCA 3CYNA 5COHA 3D0ZA 2LS5A 3BJ5A 1I5GA 3M8NA 5G30A 2KOKA 1UN2A 2RLIA 4NMUA 4E8EA 2V1MA 1TU7A 2BMXA 4NPBA 1GTUA 4AJ6A 1X5DA 3A2WA 3W8JA 2YWOA 6GSWA 4HZ4A 1QK8A 5G31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A0R P;  1F2E A;  4JR4 A;  4Q5N A;  3LJR A;  1ON4 A;  4MZW A;  1T4Z A;  4GQC A;  4IGJ A;  1R26 A;  3KJY A;  5EY6 A;  3IDV A;  1GUK A;  4IN0 A;  2YJH A;  1TI3 A;  2HXK A;  4HUA A;  1AXD A;  5JWR B;  2HFD A;  3IV4 A;  1XVW A;  2PER A;  1FW1 A;  5A4U A;  4O92 A;  2L5L A;  1SEN A;  5E4W A;  1M2A A;  1O81 A;  1YF1 A;  3HJM A;  2MMO A;  4D73 B;  5IIZ A;  5CP1 A;  4V1A g;  2BTO T;  2VM2 A;  5GAP D;  1E6B A;  3TJG A;  2H73 A;  2H6Z A;  2R2J A;  2HRF A;  2IJY A;  1SD9 A;  3IRA A;  1SK0 A;  4K0N A;  5ECR B;  4IJI A;  3P90 A;  5H5S A;  5F06 A;  1K0C A;  2IMK A;  2PPT A;  1X9W B;  4ECB A;  5G1L A;  2LRN A;  3EU3 A;  3US3 A;  2H75 A;  1PRX A;  1PX7 A;  1EGR A;  10GS A;  1EEM A;  2GSS A;  3I9V 2;  1H4O A;  1B8X A;  3FHK A;  3ZFL A;  1NW2 A;  2B5X A;  5HR2 A;  2ZNM A;  4EUY A;  5IMF A;  3FZ4 A;  4G10 A;  3TKP A;  2EIQ A;  2JL4 A;  1CQH A;  4MA9 A;  2VM1 A;  3TJJ A;  3GV1 A;  5G5F A;  1XZO A;  2B7K A;  1EOG A;  5J41 A;  3C8E A;  1OYJ A;  1TOF A;  1EOH A;  4MH3 A;  1GTA A;  4K7O A;  4D73 A;  4GQF A;  1Z9H A;  3UBK A;  2C0E A;  2C8U A;  2J23 A;  1W89 A;  3UJ1 A;  2HZF A;  1K0O A;  4BVY A;  1BJX A;  3RBT A;  19GS A;  4PX1 A;  4EL1 A;  1JZW A;  3TKS E;  3C73 A;  3NZN A;  4JZQ A;  3QAV A;  1YEX A;  5DCG A;  1F3A A;  2H1D A;  4MZC A;  1T4Y A;  2F9S A;  2I81 A;  2X99 A;  3FEU A;  12GS A;  2L59 A;  4Q5Q A;  4EE0 A;  4I97 A;  3QAW A;  3GRX A;  2CAQ A;  2I9H A;  2GZP A;  1AAZ A;  1ST9 A;  2PWJ A;  3ZIT A;  5B8B A;  4HQZ A;  1OE7 A;  2WZ9 A;  2EIR A;  5IMD A;  3RPN A;  3LG6 A;  4ZB6 A;  4ZIL A;  1K0D A;  1EEJ A;  20GS A;  1BED A;  4PXO A;  1X0R A;  2REM A;  2DJ3 A;  4Q5R A;  1JZD A;  3M3M A;  4N11 A;  2GST A;  2WDU A;  1GTI A;  2ON7 A;  1EP7 A;  3QMX A;  5A4V A;  1KNG A;  1SL0 B;  3F4R A;  4CW9 A;  3EVI A;  3ZVJ D;  3ERG A;  3U6V A;  3TRQ A;  1A2J A;  1LBK A;  3VLN A;  4PUA A;  2DLX A;  1PN9 A;  2F8A A;  1PA3 A;  3GH6 A;  5GAN D;  2YZH A;  3O6T A;  1EV9 A;  4GRF A;  1C72 A;  1AUC A;  2IL3 A;  3FW2 A;  22GS A;  4PNF A;  5GSS A;  5FT3 A;  4CHS A;  3H79 A;  5CRW A;  4QL7 A;  5ECP B;  1A24 A;  3F3R A;  3QFB C;  2VCW A;  4MJA A;  1MD4 A;  2LQO A;  1FG4 A;  2CZ2 A;  2H01 A;  2H6Y A;  4Q5F A;  1AC1 A;  1MTC A;  4ZL7 A;  2VL2 A;  2GGT A;  3DGQ A;  5DJM A;  2EC4 A;  1FB6 A;  5A4W A;  1QFN A;  2VD0 A;  2GZZ A;  3GX8 A;  1ACV A;  1TU8 A;  2XBI A;  1J08 A;  2F3M A;  4OO4 A;  3WGX A;  3S9F A;  5CYY A;  2DJJ A;  2OE0 A;  5ECI B;  3M1G A;  5GZZ B;  2K8V A;  3L9S A;  5LNK e;  3FR9 A;  2GQL A;  2AAW A;  5DAL B;  2GT5 A;  3H8Q A;  2H6X A;  4L8E A;  3QPM A;  1HD2 A;  1HQO A;  2LV3 A;  5LD0 A;  2F8F A;  4WF5 A;  3FR6 A;  4KCE A;  2B5E A;  4MF7 A;  1YKC A;  1TK8 B;  2CV4 A;  1JFU A;  3WT2 A;  2E0Q A;  3GTU B;  1T3B A;  2IWT A;  1URM A;  3TUE A;  1K3L A;  3KXO A;  3TOU A;  5D73 A;  3H4K A;  1TRS A;  2FLS A;  4MZB A;  1YQ1 A;  4YH2 A;  2HYX A;  3LGC A;  4KDY A;  2VOC A;  1Z5Y E;  1O7U A;  2ES7 A;  2CX4 A;  1PMT A;  3EUR A;  2X8C A;  1OVN A;  3DIE A;  4EDY A;  1FB0 A;  2PVQ A;  5KN2 A;  5ECS A;  4OCE A;  1WP0 A;  3ZIV A;  1M2B A;  1EP8 A;  1GLQ A;  4ECJ A;  3G7J A;  1BX9 A;  2GQM A;  3J7Y b;  3ZML A;  4NV5 A;  1SK2 A;  1M9A A;  6GSY A;  1G7O A;  2I3Y A;  4K6X A;  2HZE B;  4XTS A;  17GS A;  3ZL5 A;  4QQ7 A;  11GS A;  1V98 A;  1T7P B;  3ZLP A;  4KDX A;  2WUL A;  2FWG A;  5B6N A;  5J9B A;  2WS2 A;  1QXH A;  3EE2 A;  5DAL A;  4MAB A;  2VL9 A;  2I1U A;  1AW9 A;  2C0G A;  3HKR A;  1T1V A;  2C4J A;  3SBC A;  3GTU A;  3KZQ A;  2O8V B;  3QOU A;  3Q74 A;  4RI6 A;  2QGV A;  1WMJ A;  2BJX A;  4WBR D;  3A3T A;  3W6G A;  3L9V A;  1W4V A;  5G2Z A;  1XWK A;  1N8J A;  3CSJ A;  1K3O A;  2FGX A;  4K8M A;  4NHW A;  4F0C A;  3RHB A;  2FA4 A;  4X1U A;  4ILF A;  4L0U A;  1B4P A;  4BA7 A;  4IVF A;  4BL7 A;  1ZYQ B;  1GLP A;  4K2D A;  4N30 A;  1VGL A;  3GNJ A;  1X9S B;  2XPE A;  2YCD A;  5HFI A;  2CZ3 A;  2HNL A;  5F0G A;  5JWO B;  3RHC A;  1F9M A;  4PGT A;  5E59 A;  3APS A;  2A4V A;  2HZE A;  3K8N A;  3M9K A;  3TDG A;  3EWL A;  3ZRD A;  2FWE A;  2V2G A;  1S3D A;  3CXG A;  13GS A;  3GKK A;  5ID2 B;  2N5A A;  1EWX A;  3P2A A;  4GTU A;  2AHE A;  4IEL A;  2H1B A;  3VUR A;  3ME8 A;  5IPG A;  4HI7 A;  1DSB A;  1B9Y C;  4XS6 A;  2HSH A;  4IP1 A;  1U3I A;  2K9F A;  3VWW A;  3EMP A;  3GKN A;  1SL2 B;  3IPZ A;  3DKS A;  4WXT A;  4HJ2 A;  2LJK A;  5DQS A;  1YY7 A;  4GSN A;  2H70 A;  2ALB A;  5DDL A;  3GIX A;  1RK4 A;  2A2S A;  3KIJ A;  5KN0 A;  4J57 E;  4J56 E;  2FHE A;  4BWS A;  2LQQ A;  4F0B A;  1WJK A;  1N2A A;  3PR8 A;  2I4A A;  3CTG A;  1KEB A;  2V6O A;  3Q18 A;  1F37 A;  1SJI A;  2MBS A;  2AUV A;  4ZL9 A;  1XWB A;  2DJK A;  1YF0 A;  2XC2 A;  2IMF A;  2FWF A;  1QUW A;  3WD6 A;  3UEM A;  1FHE A;  2VO4 A;  2YZU A;  5D9T A;  3I69 A;  3MAK A;  3QR6 A;  4EF0 A;  3BBY A;  1S3C A;  3KM6 A;  4V2L A;  5IPH A;  2RM5 A;  1FVK A;  1RQM A;  5ID2 A;  1SL1 B;  4RQX A;  2OAC A;  5IMA A;  5DBQ A;  2GVP A;  2NTO A;  1SJZ A;  3MWH A;  1V58 A;  2ZCT A;  3D5J A;  3KP9 A;  2X8H A;  1TK5 B;  3VI7 A;  4KND A;  3VWU A;  2YJ7 A;  4O32 A;  4LL1 B;  3O3T A;  4AGS A;  2WCI A;  3CMI A;  5H5R A;  2VAF A;  3AY8 A;  2B1L A;  3ERW A;  4G2E A;  2IFQ B;  1O6J A;  4WR5 A;  1ERU A;  1CQG A;  3CBU A;  3E3E A;  1ZGN A;  4WF4 A;  3VK9 A;  3BCI A;  3ERF A;  4WKW A;  5DAK B;  1XVQ A;  1Z3E A;  2LNS A;  1EV4 A;  4YQM A;  2GS3 A;  3GN3 A;  1H75 A;  3FZ5 A;  4OFN A;  1TK0 B;  3LEF A;  1JLV A;  4GXZ A;  3TB2 A;  1AIU A;  5HQP A;  1V9W A;  1XW9 A;  3UOM A;  5IO2 A;  2PMT A;  2PBJ A;  1ZL9 A;  1FO5 A;  3HA9 A;  4GWR A;  5HFG A;  1DE1 A;  4DSS B;  2O89 A;  4IJ3 A;  4ZIJ A;  4KCA A;  4MJC A;  3HJO A;  3D21 A;  3GL5 A;  5J3R A;  2N5F A;  3HJP A;  4HU9 A;  2JZS A;  4ZXG A;  4MF6 A;  3E9J B;  3TJB A;  4MJB A;  1GSQ A;  1WRY A;  1KBN A;  1ZMA A;  2O7K A;  4JU5 A;  1EZK A;  2IFQ A;  5F07 A;  4TR1 B;  1OKD A;  2PUK C;  4FYB A;  2E7P A;  3ZZX A;  2LRT A;  2FCH A;  1EGO A;  2E2M A;  5ELG A;  1OC9 B;  1Y6E A;  5DAK A;  2O85 A;  4IQA A;  4TXO B;  2C0D A;  3G7Y A;  3ZYW A;  2E2G A;  4K7N A;  3GSS A;  4AF2 A;  1O73 A;  2P0G A;  5IMV A;  2QC7 A;  4DSS A;  4E8H A;  2YAN A;  1THO A;  1GNE A;  1PQN A;  1V40 A;  1E2Y A;  2VLT A;  4G19 A;  1U88 A;  4ZBB A;  1TXX A;  5D9X A;  2H66 A;  3KTB A;  1TTZ A;  2NDO A;  5EPF A;  1YKA A;  4KW6 A;  5HFK A;  2K8S A;  4XHM A;  3APQ A;  5JWQ B;  5ECL B;  3VFI A;  2H0G A;  4FO5 A;  4MLY A;  4TR1 A;  4YQV A;  3RAZ A;  2H8L A;  2G0F A;  5D8I A;  2YOI A;  2TIR A;  4ZBA A;  2VD1 A;  2R5G A;  3D4T A;  2EIO A;  1OC9 A;  2A2R A;  2L6C A;  1HNA A;  1XW6 A;  3VWV A;  4TXO A;  2YNX A;  5ELA A;  1VF4 A;  1TI1 A;  3LQ7 A;  4JED A;  1R5P A;  1KTE A;  5AIV A;  1TRV A;  4XRD A;  1PX6 A;  5IQY A;  2MMZ A;  4JE1 A;  1A2M A;  3IXR A;  5JCU A;  4KA0 A;  1TP9 A;  3CRT A;  3WT1 A;  1UA5 A;  2CVB A;  4WBJ A;  1O8X A;  5DQY A;  4YQU A;  3SWL A;  1DUG A;  1ERW A;  1V57 A;  1SK1 A;  4F9Z A;  4MF5 A;  2MMA A;  1BAY A;  3GST A;  3DML A;  1NSW A;  3NIV A;  2H1A A;  1Q4J A;  3WGE A;  4POL A;  3GA4 A;  2IIY A;  2L4C A;  5HR1 A;  1IYH A;  2QKE A;  4FIW A;  5HR0 A;  3KTL A;  2LST A;  4TRX A;  4OMV A;  3M9J A;  5ECM B;  3FK8 A;  4WET A;  3J7Y k;  4NAX A;  3F0I A;  4KSO A;  9GSS A;  2NPB A;  2LNT A;  2AB6 A;  1GWC A;  2FWH A;  1K3Y A;  3FRC A;  3TJK A;  3BD2 A;  4I5Q A;  1WIK A;  3TGZ A;  4DSQ A;  1HNC A;  4MPG A;  2JZT A;  2HRN A;  1SYR A;  5B8A A;  1Z7P A;  5J5N A;  1GSU A;  2IME A;  3D6I A;  5ECH B;  2R6K A;  4V2N A;  6GSU A;  5KN3 A;  1J0F A;  5D9W A;  3TKS A;  5JCW A;  2OE1 A;  2HLS A;  14GS A;  2MBT A;  2VCT A;  2LTK A;  1XXU A;  18GS A;  1G6W A;  2DC5 A;  3UMA A;  1XWC A;  4HDE A;  1GSF A;  4TR3 A;  4HEA 2;  2HI7 A;  1GL8 A;  5CRG A;  2OKA A;  5CAX A;  2JAC A;  2F51 A;  2ON5 A;  3TCO A;  5CRD A;  3P8W A;  2J9H A;  4X0X A;  2H30 A;  1PKW A;  3GUS A;  4AJ8 A;  2RM6 A;  1Z6N A;  4OFM A;  4L5O A;  5C00 A;  3HD5 A;  1TKD B;  4K7I A;  2P5Q A;  2N5B A;  3Q6O A;  1M99 A;  2IMI A;  1SKR B;  3KD0 A;  1Q98 A;  1F6M C;  2GDR A;  2Z9S A;  2OJL A;  3ISO A;  5L71 A;  1YDK A;  5F05 A;  3EIN A;  2WGR A;  3GX0 A;  3FY7 A;  1JLW A;  3I43 A;  1USB A;  3CSI A;  1J9B A;  2B1K A;  4IBP A;  3EMX A;  3IA1 A;  5DJL A;  5ABR A;  3GKX A;  2YWM A;  4PQH A;  3HYP A;  3N9J A;  1G0T A;  3LFL A;  5HR3 A;  5AIX A;  4XCS A;  1SKW B;  2HE3 A;  3UAR A;  2VLU A;  2H19 A;  4LL4 B;  2X8G A;  3KH7 A;  5IOX A;  4I6X A;  3VPQ A;  1QGV A;  2OAD A;  5CNW A;  2JSZ A;  3VI5 A;  3D4M A;  2CVD A;  4LMV A;  4TN8 A;  3QD9 A;  2DIY A;  2M46 A;  3MNG A;  4HZ2 A;  1AQV A;  6GSX A;  1TW9 A;  3F9U A;  4RUV A;  4OFT A;  4MK3 A;  1T8E B;  3ZIJ A;  4K1F A;  1MDI A;  4I2U A;  3M0F A;  5ECN B;  2DBC A;  2JSY A;  3UIW A;  3DWV A;  2AYT A;  3IC4 A;  4FH8 A;  4DVC A;  1WOU A;  1ERV A;  2DIZ A;  2JZR A;  1XW5 A;  2H72 A;  2LJR A;  2VCV A;  1BQ7 A;  2YP6 A;  1K0N A;  1AQW A;  2DJ2 A;  2WFC A;  2C1Y A;  2XHF A;  2GZY A;  1B9X C;  2OA7 A;  1RW1 A;  4KDU A;  3LSZ A;  1Z7R A;  4XRA A;  2FUG 2;  5FHI A;  4KX4 A;  3H93 A;  1DE2 A;  2VUP A;  5D9V A;  3BCK A;  3UVH A;  2YV9 A;  3LOR A;  1QMV A;  3MDK A;  4KE3 A;  2L4Q A;  5ECQ B;  2FA8 A;  3TJF A;  2VCX A;  1ZYE A;  4X43 A;  2VCZ A;  4F2I A;  4QL9 A;  3F4T A;  3F6F A;  3LXT A;  5IOW A;  3KMO A;  1X5E A;  2R3X A;  2PN8 A;  3IBH A;  2RII A;  4G9H A;  3IAM 2;  3TRX A;  1K0B A;  1M0U A;  1GUM A;  3HZ8 A;  2DMM A;  1GNW A;  1SKS B;  3ZVJ A;  4MH2 A;  2IN3 A;  1JZR A;  4PUF C;  6GSS A;  4XIH A;  3O76 A;  5A5K A;  5INY A;  4KUN A;  3GMF A;  4XS4 B;  1V2A A;  1OAZ A;  4MDC A;  4V2M A;  2C3Q A;  5EL8 A;  1XFL A;  4KAE A;  2VL3 A;  1XWA A;  1G7E A;  2QSI A;  4JBB A;  2B6M A;  3EYT A;  2L6D A;  3LYK A;  4KSM A;  1S3A A;  1R7H A;  1K0A A;  1NM3 A;  1TDI A;  1GUH A;  4HJM A;  5DVB A;  1OE8 A;  1XPV A;  2NBS A;  1JZO A;  3PH9 A;  2YWN A;  3EC3 A;  2P31 A;  1O85 A;  4POM A;  3Q19 A;  3UL3 A;  5AGY A;  3QCP A;  3FZA A;  2JU5 A;  4TR4 A;  4GSS A;  1T00 A;  3IK7 A;  4PQI A;  6GSV A;  4BPY A;  4GF0 A;  3W8S A;  3IHQ A;  1PD2 1;  4EDZ A;  1OC8 A;  1THX A;  2DJ0 A;  5KN1 A;  2V41 A;  1LJR A;  4TR0 A;  4XS4 A;  2HT9 A;  4WR4 A;  2DJ1 A;  1XBS A;  1PKZ A;  1MDK A;  5AN1 A;  1SYX A;  1HYU A;  1ZCP A;  3F3Q A;  4IS0 A;  2X64 A;  1ZOF A;  3UBL A;  4EO3 A;  4IW9 A;  5G5E A;  1FAA A;  2LJA A;  3FKF A;  5IM9 A;  1IYI A;  2K6V A;  3LYP A;  3ZMK A;  1ERT A;  1YZX A;  2GLR A;  1X9M B;  4MP4 A;  1DBY A;  1A8Y A;  2H74 A;  4O7H A;  3TKR A;  1PL1 A;  1Y25 A;  4NV2 A;  2TRC P;  4BVX A;  1GUL A;  4MCU A;  2CA8 A;  2RUE A;  3JCM L;  4BWQ A;  3V1W A;  2H0I A;  3F8U A;  1F3B A;  1UVZ A;  3F6D A;  2DSA A;  3L0H A;  2IPA A;  4GLT A;  5D93 A;  3TKQ A;  3LWA A;  5F8B A;  5J4U A;  4ML6 A;  2V6K A;  4JR6 A;  4XS1 A;  3HVV A;  3R2Q A;  2D2Z A;  2HSY A;  3ZRE A;  3P7X A;  1ML6 A;  2GT6 A;  1MEK A;  3HDC A;  5J9C A;  4PQ1 A;  4KGI A;  2PU9 C;  3A5W A;  5H5Q A;  3PGT A;  2C0F A;  4EKZ A;  3I6A A;  1Z6M A;  4N0Z A;  3QDN A;  2YPM A;  4ZB9 A;  4I2T A;  3G7I A;  4CDO A;  4NWY A;  2KHP A;  2CQ9 A;  2LKU A;  3IK9 A;  4AJ7 A;  4EC0 A;  4LMW A;  2C80 A;  4DEJ A;  3E0U A;  3IR4 A;  4GCI A;  2OBK A;  3D22 A;  3HHV A;  5KEJ A;  1GSS A;  2B7J A;  1G6Y A;  1VF2 A;  2XBQ A;  3UVT A;  5B6M A;  3DYR A;  4ML1 A;  5DCH A;  3HCZ A;  4N0V A;  2GSQ A;  2GTU A;  4IHU A;  2FD3 A;  4PNG A;  2FY6 A;  2KP2 A;  2CT6 A;  2FNO A;  4L0W A;  5ECO B;  2NVL A;  1PSQ A;  1VF1 A;  1PL2 A;  1GH2 A;  3C7M A;  3GH9 A;  1A2L A;  1O8W A;  1U87 A;  2KUC A;  1U6T A;  5B7C A;  3WGD A;  2M72 A;  4ZBD A;  2R37 A;  1WPI A;  3F63 A;  2C3N A;  3APO A;  3DD3 A;  2VIM A;  4HOJ A;  5CRE A;  1GSE A;  1R5A A;  4OO5 A;  1NHO A;  1PGT A;  3TOT A;  4TKY A;  2OBI A;  4ECI A;  2KLX A;  1WE0 A;  1JHB A;  2V32 A;  3KEB A;  1XWG A;  3FZ9 A;  4TVE A;  5FWG A;  4EXJ A;  4ZL8 A;  1ZZY A;  1FOV A;  3L4N A;  2VL2 C;  2B3S A;  2PVO C;  4F82 A;  5ENU A;  1YJ6 A;  4HQS A;  1UC7 A;  3U5R E;  3RDW A;  1K0M A;  2DML A;  2M80 A;  3ZTL A;  5JCG A;  7GSS A;  3WYW A;  1ILO A;  3C1R A;  4ACS A;  1GSY A;  4TXV A;  2CX3 A;  3MSZ A;  2TRX A;  2P5R A;  4GST A;  2ZUP A;  2LUS A;  2WB9 A;  4MMM A;  3DRN A;  3KGK A;  3C71 A;  1U3A A;  4OD7 A;  4I8B A;  1MDJ A;  4TW5 A;  2OE3 A;  4Z7X A;  1M7T A;  5D96 A;  3QAG A;  2VLV A;  3CSH A;  2CVK A;  4ULX A;  1GTB A;  2LEG A;  4RI7 A;  3DVX A;  1WWJ A;  2WJU A;  2AV4 A;  2K18 A;  4HS1 A;  1QQ2 A;  3RPP A;  2O87 A;  3KH9 A;  1TRW A;  3DVW A;  1BYE A;  1OC3 A;  1B48 A;  3TRP A;  5C04 A;  3TKS C;  3NOF A;  1GRX A;  4JRR A;  4TOP A;  5IO0 A;  3DEX A;  8GSS A;  5CRH A;  4K0G A;  2JAD A;  4POK A;  1FVJ A;  3UAP A;  3GL3 A;  3KMN A;  1R4W A;  4P3Y B;  2KP1 A;  3CRU A;  5ECK B;  1ABA A;  1X5C A;  1XOB A;  2XPD A;  4MJE A;  2VCQ A;  3IAS 2;  4RQR A;  5G1K A;  3VPT A;  4NXI A;  1XIY A;  4L5L A;  3KCM A;  1LU4 A;  1VF3 A;  2YWI A;  3PIN A;  1YEP A;  2MYG A;  3BOA A;  2GQK A;  4ECC A;  1XOA A;  4ISD A;  4J2F A;  1OKT A;  4YAP A;  1HNB A;  2B5Y A;  3GYK A;  1VRS D;  1TJD A;  4F03 A;  4WEY A;  2MMN A;  4HU7 A;  4OCF A;  1SJ6 A;  2C3T A;  4NHZ A;  1XCC A;  3HVX A;  6GST A;  3L9U A;  3A2X A;  2GSR A;  2PGT A;  3A2V A;  2H76 A;  2YV7 A;  1A23 A;  2RUF A;  2WRT A;  4V1A p;  4KH7 A;  1A8L A;  3ME7 A;  2AJQ B;  4DSR A;  1BG5 A;  3H1N A;  3ED3 A;  3VWX A;  5EVO A;  4OWY A;  1SD8 A;  16GS A;  3FR3 A;  4KB3 A;  3ZFB A;  3IOS A;  4PUR A;  2L57 A;  1GSD A;  4K9Z A;  1SU9 A;  2H71 A;  4FYU A;  2LRC A;  1M9B A;  2IMD A;  4H86 A;  3HXS A;  2R4V A;  4O5R A;  3LXZ A;  3HZ4 A;  4YAV A;  1AQX A;  1MD3 A;  4POB A;  1TRU A;  4LLR A;  1M2D A;  1NHY A;  2YN1 A;  3GKM A;  3CTF A;  3GUR A;  4IP6 A;  4LA1 A;  4N10 A;  5AIS A;  5GST A;  4IKH A;  3G9B A;  2L5O A;  3KP8 A;  4IQ1 A;  1A0F A;  1I9D A;  3OR5 A;  2G2Q A;  2CAI A;  3DXB A;  5LCZ A;  4ID0 A;  3EU4 A;  4ZB8 A;  1GP1 A;  5CO3 A;  4EVM A;  3C1S A;  3HY2 A;  2H0H A;  3GHA A;  5IMZ A;  3GFK A;  3FYG A;  3L78 A;  3QFA C;  2H1G A;  3HVS A;  5IMC A;  1B4Q A;  2MZC A;  3N5O A;  3IE3 A;  3F4S A;  4MPF A;  4FYC A;  3CYN A;  5COH A;  3D0Z A;  2LS5 A;  3BJ5 A;  1I5G A;  3M8N A;  5G30 A;  2KOK A;  1UN2 A;  2RLI A;  4NMU A;  4E8E A;  2V1M A;  1TU7 A;  2BMX A;  4NPB A;  1GTU A;  4AJ6 A;  1X5D A;  3A2W A;  3W8J A;  2YWO A;  6GSW A;  4HZ4 A;  1QK8 A;  5G31 A; 
#chains in the Genus database with same CATH topology
 1A0R P;  1F2E A;  4KF9 A;  4JR4 A;  4Q5N A;  3LW9 A;  3LJR A;  1ON4 A;  4MZW A;  1T4Z A;  4GQC A;  4IGJ A;  1R26 A;  3KJY A;  5EY6 A;  3IDV A;  1GUK A;  4IN0 A;  2YJH A;  1TI3 A;  2HXK A;  4HUA A;  1AXD A;  5JWR B;  2HFD A;  3IV4 A;  1XVW A;  2PER A;  1FW1 A;  5A4U A;  4CY6 A;  4O92 A;  2L5L A;  1SEN A;  5E4W A;  1M2A A;  1O81 A;  1YF1 A;  3HJM A;  2MMO A;  4D73 B;  5IIZ A;  5CP1 A;  4V1A g;  2BTO T;  4BVX B;  2VM2 A;  5GAP D;  1E6B A;  3TJG A;  2H73 A;  2H6Z A;  2R2J A;  2HRF A;  2IJY A;  1SD9 A;  3IRA A;  1SK0 A;  4K0N A;  5ECR B;  4IJI A;  4Z2U A;  4O5U A;  3P90 A;  5H5S A;  5F06 A;  1K0C A;  2IMK A;  2PPT A;  1X9W B;  4ECB A;  5G1L A;  2LRN A;  3EU3 A;  3US3 A;  2H75 A;  1PRX A;  1PX7 A;  1EGR A;  10GS A;  1EEM A;  2GSS A;  3I9V 2;  1H4O A;  1B8X A;  3FHK A;  3ZFL A;  1NW2 A;  2B5X A;  5HR2 A;  2ZNM A;  4EUY A;  5IMF A;  3FZ4 A;  3MYD A;  4G10 A;  3TKP A;  2EIQ A;  2JL4 A;  1CQH A;  4MA9 A;  2VM1 A;  3TJJ A;  3GV1 A;  5G5F A;  1XZO A;  2B7K A;  1EOG A;  5J41 A;  3C8E A;  1OYJ A;  1TOF A;  1EOH A;  4MH3 A;  1GTA A;  4K7O A;  4D73 A;  4GQF A;  1Z9H A;  3UBK A;  2C0E A;  2C8U A;  2J23 A;  1W89 A;  3UJ1 A;  2HZF A;  1K0O A;  4BVY A;  1BJX A;  3RBT A;  19GS A;  4PX1 A;  4EL1 A;  1JZW A;  3TKS E;  3C73 A;  3NZN A;  4JZQ A;  3QAV A;  1YEX A;  5DCG A;  1F3A A;  2H1D A;  4MZC A;  1T4Y A;  2F9S A;  2I81 A;  2X99 A;  3FEU A;  12GS A;  2L59 A;  4Q5Q A;  4EE0 A;  4I97 A;  3QAW A;  3GRX A;  2CAQ A;  1PN0 A;  2I9H A;  2GZP A;  1AAZ A;  1ST9 A;  2PWJ A;  3ZIT A;  5B8B A;  4HQZ A;  1OE7 A;  2HRK A;  2WZ9 A;  2EIR A;  5IMD A;  3RPN A;  3LG6 A;  4ZB6 A;  4ZIL A;  2R0P A;  1K0D A;  1EEJ A;  20GS A;  1BED A;  2X49 A;  4PXO A;  1X0R A;  2REM A;  2DJ3 A;  4Q5R A;  1JZD A;  3M3M A;  4N11 A;  2GST A;  2WDU A;  1GTI A;  2ON7 A;  1EP7 A;  3QMX A;  5A4V A;  1KNG A;  1SL0 B;  3F4R A;  4CW9 A;  3EVI A;  3ZVJ D;  3ERG A;  3U6V A;  3TRQ A;  1A2J A;  1LBK A;  3VLN A;  4PUA A;  2DLX A;  1PN9 A;  2F8A A;  1PA3 A;  3GH6 A;  5GAN D;  2YZH A;  3O6T A;  1EV9 A;  4GRF A;  1C72 A;  1AUC A;  2IL3 A;  3FW2 A;  22GS A;  4PNF A;  5GSS A;  5FT3 A;  4CHS A;  3H79 A;  5CRW A;  4QL7 A;  5ECP B;  1A24 A;  3F3R A;  3QFB C;  2VCW A;  4MJA A;  1MD4 A;  2LQO A;  1FG4 A;  2DKI A;  2CZ2 A;  2H01 A;  2H6Y A;  4Q5F A;  1AC1 A;  1MTC A;  4ZL7 A;  2VL2 A;  2GGT A;  1M3J A;  2UZ8 A;  3DGQ A;  5DJM A;  2EC4 A;  1FB6 A;  4ICY A;  5A4W A;  1QFN A;  2VD0 A;  2GZZ A;  3GX8 A;  1ACV A;  1TU8 A;  2XBI A;  1J08 A;  2F3M A;  4OO4 A;  3WGX A;  3S9F A;  5CYY A;  2DJJ A;  2OE0 A;  5ECI B;  3M1G A;  5GZZ B;  2K8V A;  3L9S A;  5LNK e;  3FR9 A;  2GQL A;  2AAW A;  5DAL B;  2GT5 A;  3H8Q A;  2H6X A;  4L8E A;  3QPM A;  1HD2 A;  1HQO A;  2LV3 A;  5LD0 A;  2F8F A;  4WF5 A;  3FR6 A;  4KCE A;  2B5E A;  4MF7 A;  1YKC A;  1TK8 B;  2CV4 A;  1JFU A;  3WT2 A;  2E0Q A;  3GTU B;  1T3B A;  2IWT A;  1URM A;  3IHG A;  3TUE A;  1K3L A;  3KXO A;  3TOU A;  2R0C A;  5D73 A;  3H4K A;  1TRS A;  2FLS A;  4MZB A;  1YQ1 A;  4YH2 A;  2HYX A;  3LGC A;  4KDY A;  2VOC A;  1Z5Y E;  1O7U A;  2ES7 A;  2CX4 A;  1PMT A;  3EUR A;  2X8C A;  1OVN A;  3DIE A;  4EDY A;  1FB0 A;  2PVQ A;  4X4J A;  5KN2 A;  5ECS A;  4OCE A;  1WP0 A;  3ZIV A;  1M2B A;  4BL7 B;  1EP8 A;  1GLQ A;  4ECJ A;  3G7J A;  1BX9 A;  2GQM A;  3J7Y b;  3ZML A;  4NV5 A;  1SK2 A;  1M9A A;  6GSY A;  1G7O A;  2I3Y A;  4K6X A;  2HZE B;  4XTS A;  17GS A;  3ZL5 A;  4QQ7 A;  11GS A;  1V98 A;  1T7P B;  3ZLP A;  4KDX A;  2WUL A;  2FWG A;  5B6N A;  5J9B A;  2WS2 A;  1QXH A;  3EE2 A;  5DAL A;  4MAB A;  2VL9 A;  2I1U A;  1AW9 A;  2C0G A;  2X4A A;  3A5I A;  3HKR A;  1T1V A;  2C4J A;  3SBC A;  3GTU A;  3KZQ A;  2O8V B;  3QOU A;  3Q74 A;  4RI6 A;  2QGV A;  1WMJ A;  2BJX A;  4WBR D;  3A3T A;  3W6G A;  3L9V A;  1W4V A;  5G2Z A;  1XWK A;  1N8J A;  3CSJ A;  1K3O A;  2FGX A;  4K8M A;  4NHW A;  4F0C A;  3RHB A;  2FA4 A;  4X1U A;  4ILF A;  4L0U A;  4Z2T A;  1B4P A;  4BA7 A;  4IVF A;  4BL7 A;  1ZYQ B;  1GLP A;  4K2D A;  4N30 A;  1VGL A;  3GNJ A;  1X9S B;  2XPE A;  2YCD A;  5HFI A;  2CZ3 A;  2HNL A;  5F0G A;  5JWO B;  3RHC A;  1F9M A;  4PGT A;  5E59 A;  3APS A;  2A4V A;  2HZE A;  3K8N A;  3M9K A;  3TDG A;  3EWL A;  3ZRD A;  2FWE A;  2V2G A;  1S3D A;  3CXG A;  13GS A;  3GKK A;  5ID2 B;  2N5A A;  1EWX A;  3P2A A;  4GTU A;  2AHE A;  4IEL A;  2H1B A;  3VUR A;  3ME8 A;  5IPG A;  4HI7 A;  1DSB A;  1B9Y C;  4XS6 A;  2HSH A;  4IP1 A;  1U3I A;  2K9F A;  3VWW A;  3EMP A;  3GKN A;  1SL2 B;  3IPZ A;  3DKS A;  4WXT A;  4HJ2 A;  2LJK A;  5DQS A;  1YY7 A;  4GSN A;  2H70 A;  2ALB A;  5DDL A;  3GIX A;  1RK4 A;  2A2S A;  3KIJ A;  5KN0 A;  4J57 E;  4J56 E;  2FHE A;  2DKH A;  2LQQ A;  4BWS A;  1WJK A;  4F0B A;  1N2A A;  3PR8 A;  2I4A A;  3CTG A;  1KEB A;  2V6O A;  3Q18 A;  1F37 A;  1SJI A;  2MBS A;  2AUV A;  4ZL9 A;  1XWB A;  2DJK A;  1YF0 A;  2XC2 A;  2IMF A;  2FWF A;  1ZYP A;  1QUW A;  3WD6 A;  3UEM A;  1FHE A;  2VO4 A;  2YZU A;  5D9T A;  3I69 A;  3MAK A;  3QR6 A;  4EF0 A;  3BBY A;  1S3C A;  3KM6 A;  3MIX A;  4V2L A;  5IPH A;  2RM5 A;  1FVK A;  1RQM A;  5ID2 A;  1SL1 B;  4RQX A;  1PFO A;  2OAC A;  5IMA A;  5DBQ A;  2GVP A;  2NTO A;  1SJZ A;  3MWH A;  4USS A;  1V58 A;  2ZCT A;  3D5J A;  3KP9 A;  2X8H A;  1TK5 B;  3VI7 A;  4KND A;  3VWU A;  2YJ7 A;  4O32 A;  4LL1 B;  4Z2R A;  3O3T A;  4AGS A;  2WCI A;  3HVN A;  3CMI A;  4BVY B;  5H5R A;  4O5Q A;  2VAF A;  3AY8 A;  2B1L A;  3ERW A;  4G2E A;  2IFQ B;  1O6J A;  4WR5 A;  1ERU A;  1CQG A;  3CBU A;  3E3E A;  1ZGN A;  4WF4 A;  3VK9 A;  3BCI A;  3ERF A;  4WKW A;  5DAK B;  1XVQ A;  1Z3E A;  2LNS A;  1EV4 A;  4YQM A;  2GS3 A;  3GN3 A;  1H75 A;  3FZ5 A;  4OFN A;  1TK0 B;  3LEF A;  1JLV A;  4GXZ A;  3TB2 A;  4FQU A;  3R3E A;  1AIU A;  5HQP A;  1V9W A;  1XW9 A;  3UOM A;  5IO2 A;  2PMT A;  2PBJ A;  1ZL9 A;  1FO5 A;  3HA9 A;  4GWR A;  5HFG A;  1DE1 A;  4DSS B;  2O89 A;  4IJ3 A;  4ZIJ A;  4KCA A;  4MJC A;  3HJO A;  3D21 A;  3GL5 A;  5J3R A;  2N5F A;  3HJP A;  4HU9 A;  2JZS A;  4ZXG A;  4MF6 A;  3E9J B;  3TJB A;  4MJB A;  1GSQ A;  1WRY A;  1KBN A;  1ZMA A;  2O7K A;  4JU5 A;  1EZK A;  2IFQ A;  5F07 A;  4TR1 B;  1OKD A;  2PUK C;  4FYB A;  2E7P A;  3ZZX A;  2LRT A;  2FCH A;  1EGO A;  2E2M A;  5ELG A;  1OC9 B;  1Y6E A;  5DAK A;  2O85 A;  4IQA A;  4TXO B;  2C0D A;  3G7Y A;  3ZYW A;  2E2G A;  4K7N A;  3GSS A;  4AF2 A;  1O73 A;  2P0G A;  5IMV A;  2QC7 A;  4DSS A;  4E8H A;  2YAN A;  1THO A;  1GNE A;  1PQN A;  1V40 A;  1E2Y A;  2VLT A;  4G19 A;  1U88 A;  4ZBB A;  1TXX A;  5D9X A;  2H66 A;  3KTB A;  1TTZ A;  2NDO A;  5EPF A;  1YKA A;  4KW6 A;  5HFK A;  2K8S A;  4XHM A;  3APQ A;  5JWQ B;  5ECL B;  3VFI A;  2H0G A;  4FO5 A;  4MLY A;  4TR1 A;  4YQV A;  3RAZ A;  2H8L A;  2G0F A;  5D8I A;  2YOI A;  2TIR A;  4ZBA A;  2VD1 A;  2R5G A;  3D4T A;  2EIO A;  1OC9 A;  2A2R A;  2L6C A;  1HNA A;  1XW6 A;  3VWV A;  4TXO A;  2YNX A;  5ELA A;  1VF4 A;  3IC8 A;  1TI1 A;  3LQ7 A;  4JED A;  1R5P A;  1KTE A;  5AIV A;  1TRV A;  4XRD A;  1PX6 A;  5IQY A;  2MMZ A;  4JE1 A;  1A2M A;  3IXR A;  5JCU A;  4KA0 A;  1TP9 A;  3CRT A;  3WT1 A;  1UA5 A;  4A5P A;  2CVB A;  4WBJ A;  1O8X A;  5DQY A;  4YQU A;  3SWL A;  1DUG A;  1ERW A;  4EIQ A;  1V57 A;  1SK1 A;  4F9Z A;  4MF5 A;  2MMA A;  1BAY A;  3GST A;  3DML A;  1NSW A;  3NIV A;  2H1A A;  1Q4J A;  3WGE A;  4POL A;  3GA4 A;  2IIY A;  2L4C A;  5HR1 A;  1IYH A;  2QKE A;  4FIW A;  5HR0 A;  3KTL A;  2LST A;  4TRX A;  4OMV A;  3M9J A;  5ECM B;  3FK8 A;  4WET A;  3J7Y k;  4NAX A;  3F0I A;  4KSO A;  9GSS A;  2NPB A;  2LNT A;  2AB6 A;  1GWC A;  2FWH A;  1K3Y A;  3FRC A;  3TJK A;  3BD2 A;  4I5Q A;  1WIK A;  3TGZ A;  4DSQ A;  1HNC A;  4MPG A;  2JZT A;  2HRN A;  1SYR A;  5B8A A;  1Z7P A;  5J5N A;  1GSU A;  2IME A;  3D6I A;  5ECH B;  2R6K A;  4V2N A;  6GSU A;  5KN3 A;  1J0F A;  5D9W A;  3TKS A;  5JCW A;  2OE1 A;  3FMW A;  2HLS A;  14GS A;  2MBT A;  2VCT A;  2LTK A;  1XXU A;  18GS A;  1G6W A;  3CQF A;  2DC5 A;  3UMA A;  4K5S A;  1XWC A;  4HDE A;  1GSF A;  4TR3 A;  4HEA 2;  2HI7 A;  1GL8 A;  5CRG A;  2OKA A;  5CAX A;  2JAC A;  2F51 A;  2ON5 A;  3TCO A;  5CRD A;  3P8W A;  2J9H A;  4X0X A;  2H30 A;  1PKW A;  3GUS A;  4AJ8 A;  2RM6 A;  5BRT A;  1Z6N A;  4OFM A;  4L5O A;  5C00 A;  3HD5 A;  1TKD B;  4K7I A;  2P5Q A;  2N5B A;  3Q6O A;  1M99 A;  2IMI A;  1SKR B;  3KD0 A;  1Q98 A;  1F6M C;  2GDR A;  2Z9S A;  2OJL A;  3ISO A;  5L71 A;  4HSC X;  1YDK A;  5F05 A;  3EIN A;  2WGR A;  3GX0 A;  3FY7 A;  1JLW A;  3I43 A;  1USB A;  3CSI A;  1J9B A;  2B1K A;  4IBP A;  3EMX A;  3IA1 A;  5DJL A;  5ABR A;  3GKX A;  2YWM A;  4PQH A;  3HYP A;  3N9J A;  1G0T A;  1ZYN A;  3LFL A;  5HR3 A;  5AIX A;  4XCS A;  1SKW B;  2HE3 A;  3UAR A;  2VLU A;  2H19 A;  4LL4 B;  2X8G A;  3KH7 A;  5IOX A;  4I6X A;  3VPQ A;  1QGV A;  2OAD A;  5CNW A;  2JSZ A;  3VI5 A;  3D4M A;  2CVD A;  4LMV A;  4TN8 A;  3QD9 A;  4CY8 A;  2DIY A;  2M46 A;  3MNG A;  4HZ2 A;  1AQV A;  6GSX A;  1TW9 A;  3F9U A;  4RUV A;  4OFT A;  4MK3 A;  1T8E B;  3ZIJ A;  4K1F A;  1MDI A;  4I2U A;  3M0F A;  5ECN B;  2DBC A;  2JSY A;  3UIW A;  3DWV A;  2AYT A;  3IC4 A;  4FH8 A;  4DVC A;  1WOU A;  1ERV A;  2DIZ A;  2JZR A;  1XW5 A;  2H72 A;  2LJR A;  2HSM A;  1BQ7 A;  2VCV A;  2YP6 A;  1K0N A;  1AQW A;  2DJ2 A;  2WFC A;  2C1Y A;  2XHF A;  2GZY A;  1B9X C;  2OA7 A;  1RW1 A;  4KDU A;  3LSZ A;  1Z7R A;  4XRA A;  2FUG 2;  5FHI A;  2HRA A;  4KX4 A;  3H93 A;  1DE2 A;  2VUP A;  5D9V A;  3BCK A;  3UVH A;  2YV9 A;  3LOR A;  1QMV A;  3MDK A;  4KE3 A;  2L4Q A;  5ECQ B;  2FA8 A;  3TJF A;  2VCX A;  1ZYE A;  4X43 A;  2VCZ A;  4F2I A;  4QL9 A;  3F4T A;  3F6F A;  3LXT A;  5IOW A;  3KMO A;  1X5E A;  2R3X A;  2PN8 A;  3IBH A;  2RII A;  4G9H A;  3IAM 2;  3TRX A;  1K0B A;  1M0U A;  1GUM A;  3HZ8 A;  2DMM A;  1GNW A;  1SKS B;  3ZVJ A;  4MH2 A;  2IN3 A;  1JZR A;  4PUF C;  6GSS A;  4XIH A;  3O76 A;  5A5K A;  5INY A;  4KUN A;  3GMF A;  4XS4 B;  1V2A A;  1OAZ A;  4MDC A;  4V2M A;  2C3Q A;  5EL8 A;  1XFL A;  4KAE A;  2VL3 A;  1XWA A;  1G7E A;  2QSI A;  4JBB A;  2B6M A;  3EYT A;  2L6D A;  3LYK A;  4KSM A;  1S3A A;  1R7H A;  1K0A A;  1NM3 A;  1TDI A;  1GUH A;  4HJM A;  5DVB A;  1OE8 A;  1XPV A;  2NBS A;  1JZO A;  3PH9 A;  2YWN A;  3EC3 A;  2P31 A;  1O85 A;  4POM A;  3Q19 A;  3UL3 A;  5AGY A;  3QCP A;  3FZA A;  2JU5 A;  4TR4 A;  4GSS A;  1T00 A;  3IK7 A;  4PQI A;  6GSV A;  4BPY A;  4MNN A;  4GF0 A;  3W8S A;  3IHQ A;  1PD2 1;  4EDZ A;  1OC8 A;  1THX A;  2DJ0 A;  5KN1 A;  2V41 A;  1LJR A;  4TR0 A;  4XS4 A;  2HT9 A;  4WR4 A;  2DJ1 A;  1XBS A;  1PKZ A;  1MDK A;  5AN1 A;  1SYX A;  1HYU A;  1ZCP A;  3F3Q A;  4IS0 A;  2X64 A;  1ZOF A;  3UBL A;  4EO3 A;  4IW9 A;  5G5E A;  1FAA A;  2LJA A;  3FKF A;  5IM9 A;  1IYI A;  2K6V A;  3LYP A;  3ZMK A;  1ERT A;  2QA2 A;  1YZX A;  2GLR A;  1X9M B;  4MP4 A;  1DBY A;  1A8Y A;  2H74 A;  4O7H A;  3TKR A;  1PL1 A;  1Y25 A;  4NV2 A;  2TRC P;  4BVX A;  1XG8 A;  1GUL A;  4MCU A;  2CA8 A;  2RUE A;  3JCM L;  4BWQ A;  3V1W A;  2H0I A;  3F8U A;  1F3B A;  1UVZ A;  3F6D A;  2DSA A;  3L0H A;  2IPA A;  4GLT A;  5D93 A;  3TKQ A;  3LWA A;  5F8B A;  5J4U A;  4ML6 A;  2V6K A;  4JR6 A;  4XS1 A;  3HVV A;  4YKG A;  3R2Q A;  2D2Z A;  2HSY A;  3ZRE A;  3P7X A;  1ML6 A;  2GT6 A;  1MEK A;  3HDC A;  5J9C A;  3EPT A;  4PQ1 A;  4KGI A;  2PU9 C;  3A5W A;  5H5Q A;  3PGT A;  2C0F A;  4EKZ A;  3I6A A;  4YKF A;  1Z6M A;  4N0Z A;  3QDN A;  2YPM A;  4ZB9 A;  4I2T A;  3G7I A;  4CDO A;  4NWY A;  2KHP A;  2CQ9 A;  2LKU A;  3IK9 A;  4AJ7 A;  4EC0 A;  4LMW A;  2C80 A;  4DEJ A;  4BIK A;  3E0U A;  3IR4 A;  4GCI A;  2OBK A;  3D22 A;  3HHV A;  5KEJ A;  1GSS A;  2B7J A;  1G6Y A;  1VF2 A;  2XBQ A;  3UVT A;  5B6M A;  3DYR A;  4ML1 A;  5DCH A;  3HCZ A;  4N0V A;  2GSQ A;  2GTU A;  4IHU A;  2FD3 A;  4PNG A;  2FY6 A;  2KP2 A;  2CT6 A;  2FNO A;  4L0W A;  5ECO B;  2A4H A;  2NVL A;  1PSQ A;  1VF1 A;  2A2P A;  1PL2 A;  1GH2 A;  3C7M A;  3GH9 A;  1A2L A;  1O8W A;  2R0G A;  1U87 A;  2KUC A;  1U6T A;  5B7C A;  3WGD A;  2M72 A;  4ZBD A;  2R37 A;  1WPI A;  3F63 A;  2C3N A;  3APO A;  3DD3 A;  2VIM A;  4K2X A;  4HOJ A;  5CRE A;  1GSE A;  1R5A A;  4OO5 A;  1NHO A;  1PGT A;  3TOT A;  4TKY A;  2OBI A;  4ECI A;  2KLX A;  1WE0 A;  1JHB A;  2V32 A;  3KEB A;  1XWG A;  3FZ9 A;  4TVE A;  5FWG A;  4PTS A;  4EXJ A;  4ZL8 A;  1ZZY A;  1FOV A;  3L4N A;  2VL2 C;  2B3S A;  2PVO C;  4F82 A;  5ENU A;  1YJ6 A;  4HQS A;  1UC7 A;  3U5R E;  3RDW A;  1K0M A;  2DML A;  2M80 A;  3ZTL A;  5JCG A;  7GSS A;  3WYW A;  1ILO A;  3C1R A;  4ACS A;  1GSY A;  4TXV A;  2CX3 A;  3MSZ A;  2TRX A;  2P5R A;  4G0K A;  4GST A;  2ZUP A;  5KOX A;  2LUS A;  2WB9 A;  4MMM A;  3DRN A;  3KGK A;  3C71 A;  1U3A A;  4OD7 A;  4I8B A;  1MDJ A;  4TW5 A;  2OE3 A;  4Z7X A;  1M7T A;  5D96 A;  5BMU A;  3QAG A;  2VLV A;  3CSH A;  2CVK A;  4ULX A;  1GTB A;  2LEG A;  4RI7 A;  3DVX A;  1WWJ A;  2WJU A;  2AV4 A;  2K18 A;  4HS1 A;  1QQ2 A;  3RPP A;  2O87 A;  3KH9 A;  1TRW A;  3DVW A;  1BYE A;  1OC3 A;  1B48 A;  3TRP A;  5C04 A;  3TKS C;  3NOF A;  1GRX A;  4JRR A;  4TOP A;  5IO0 A;  3DEX A;  8GSS A;  5CRH A;  4K0G A;  2JAD A;  4POK A;  1S3R A;  1FVJ A;  4EIP A;  2QA1 A;  3UAP A;  3GL3 A;  3KMN A;  1R4W A;  4P3Y B;  2KP1 A;  3CRU A;  5ECK B;  1ABA A;  1X5C A;  1XOB A;  2XPD A;  4MJE A;  2VCQ A;  3IAS 2;  4RQR A;  5G1K A;  3VPT A;  4NXI A;  1XIY A;  4L5L A;  3KCM A;  1LU4 A;  1VF3 A;  2YWI A;  3PIN A;  1YEP A;  2MYG A;  3BOA A;  2GQK A;  4ECC A;  1XOA A;  4ISD A;  4J2F A;  1OKT A;  4YAP A;  1HNB A;  2B5Y A;  3GYK A;  1VRS D;  1TJD A;  4F03 A;  4WEY A;  2MMN A;  4HU7 A;  4OCF A;  1SJ6 A;  2C3T A;  4NHZ A;  1XCC A;  3HVX A;  6GST A;  3L9U A;  3A2X A;  2GSR A;  2PGT A;  3A2V A;  2H76 A;  2YV7 A;  1A23 A;  1FOH A;  2RUF A;  2WRT A;  4V1A p;  3PPU A;  4KH7 A;  1A8L A;  3ME7 A;  2AJQ B;  4DSR A;  1BG5 A;  3H1N A;  3ED3 A;  3VWX A;  5EVO A;  4OWY A;  1SD8 A;  16GS A;  3FR3 A;  4KB3 A;  3ZFB A;  3IOS A;  4PUR A;  2L57 A;  1GSD A;  4K9Z A;  1SU9 A;  2H71 A;  4FYU A;  2LRC A;  1M9B A;  2IMD A;  4H86 A;  4K5R A;  3HXS A;  2R4V A;  4O5R A;  3LXZ A;  3HZ4 A;  4YAV A;  1AQX A;  1MD3 A;  4POB A;  1TRU A;  4LLR A;  1M2D A;  5KOW A;  1NHY A;  2YN1 A;  3GKM A;  3CTF A;  3GUR A;  4IP6 A;  4LA1 A;  4N10 A;  5AIS A;  5GST A;  4IKH A;  3G9B A;  2L5O A;  3KP8 A;  4IQ1 A;  1A0F A;  1I9D A;  1M3I A;  3OR5 A;  2G2Q A;  2CAI A;  3DXB A;  5LCZ A;  4ID0 A;  3EU4 A;  4ZB8 A;  1GP1 A;  5CO3 A;  4EVM A;  3C1S A;  3HY2 A;  2H0H A;  3GHA A;  5IMZ A;  3GFK A;  3FYG A;  3L78 A;  3QFA C;  2H1G A;  3HVS A;  5IMC A;  1B4Q A;  2MZC A;  3N5O A;  3IE3 A;  3F4S A;  4G0I A;  4G0L A;  4MPF A;  4FYC A;  3CYN A;  5COH A;  3D0Z A;  2LS5 A;  3BJ5 A;  1I5G A;  3M8N A;  5G30 A;  2KOK A;  1UN2 A;  2RLI A;  4NMU A;  4E8E A;  2V1M A;  1TU7 A;  2BMX A;  4NPB A;  1GTU A;  4AJ6 A;  1X5D A;  3A2W A;  3W8J A;  2YWO A;  6GSW A;  4HZ4 A;  1QK8 A;  5G31 A; 
#chains in the Genus database with same CATH homology
 1A0R P;  1F2E A;  4KF9 A;  4JR4 A;  4Q5N A;  3LW9 A;  3LJR A;  1ON4 A;  4MZW A;  1T4Z A;  4GQC A;  4IGJ A;  1R26 A;  3KJY A;  5EY6 A;  3IDV A;  1GUK A;  4IN0 A;  2YJH A;  1TI3 A;  2HXK A;  4HUA A;  1AXD A;  5JWR B;  2HFD A;  3IV4 A;  1XVW A;  2PER A;  1FW1 A;  5A4U A;  4CY6 A;  4O92 A;  2L5L A;  1SEN A;  5E4W A;  1M2A A;  1O81 A;  1YF1 A;  3HJM A;  2MMO A;  4D73 B;  5IIZ A;  5CP1 A;  4V1A g;  2BTO T;  4BVX B;  2VM2 A;  5GAP D;  1E6B A;  3TJG A;  2H73 A;  2H6Z A;  2R2J A;  2HRF A;  2IJY A;  1SD9 A;  3IRA A;  1SK0 A;  4K0N A;  5ECR B;  4IJI A;  4Z2U A;  4O5U A;  3P90 A;  5H5S A;  5F06 A;  1K0C A;  2IMK A;  2PPT A;  1X9W B;  4ECB A;  5G1L A;  2LRN A;  3EU3 A;  3US3 A;  2H75 A;  1PRX A;  1PX7 A;  1EGR A;  10GS A;  1EEM A;  2GSS A;  3I9V 2;  1H4O A;  1B8X A;  3FHK A;  3ZFL A;  1NW2 A;  2B5X A;  5HR2 A;  2ZNM A;  4EUY A;  5IMF A;  3FZ4 A;  3MYD A;  4G10 A;  3TKP A;  2EIQ A;  2JL4 A;  1CQH A;  4MA9 A;  2VM1 A;  3TJJ A;  3GV1 A;  5G5F A;  1XZO A;  2B7K A;  1EOG A;  5J41 A;  3C8E A;  1OYJ A;  1TOF A;  1EOH A;  4MH3 A;  1GTA A;  4K7O A;  4D73 A;  4GQF A;  1Z9H A;  3UBK A;  2C0E A;  2C8U A;  2J23 A;  1W89 A;  3UJ1 A;  2HZF A;  1K0O A;  4BVY A;  1BJX A;  3RBT A;  19GS A;  4PX1 A;  4EL1 A;  1JZW A;  3TKS E;  3C73 A;  3NZN A;  4JZQ A;  3QAV A;  1YEX A;  5DCG A;  1F3A A;  2H1D A;  4MZC A;  1T4Y A;  2F9S A;  2I81 A;  2X99 A;  3FEU A;  12GS A;  2L59 A;  4Q5Q A;  4EE0 A;  4I97 A;  3QAW A;  3GRX A;  2CAQ A;  1PN0 A;  2I9H A;  2GZP A;  1AAZ A;  1ST9 A;  2PWJ A;  3ZIT A;  5B8B A;  4HQZ A;  1OE7 A;  2HRK A;  2WZ9 A;  2EIR A;  5IMD A;  3RPN A;  3LG6 A;  4ZB6 A;  4ZIL A;  2R0P A;  1K0D A;  1EEJ A;  20GS A;  1BED A;  2X49 A;  4PXO A;  1X0R A;  2REM A;  2DJ3 A;  4Q5R A;  1JZD A;  3M3M A;  4N11 A;  2GST A;  2WDU A;  1GTI A;  2ON7 A;  1EP7 A;  3QMX A;  5A4V A;  1KNG A;  1SL0 B;  3F4R A;  4CW9 A;  3EVI A;  3ZVJ D;  3ERG A;  3U6V A;  3TRQ A;  1A2J A;  1LBK A;  3VLN A;  4PUA A;  2DLX A;  1PN9 A;  2F8A A;  1PA3 A;  3GH6 A;  5GAN D;  2YZH A;  3O6T A;  1EV9 A;  4GRF A;  1C72 A;  1AUC A;  2IL3 A;  3FW2 A;  22GS A;  4PNF A;  5GSS A;  5FT3 A;  4CHS A;  3H79 A;  5CRW A;  4QL7 A;  5ECP B;  1A24 A;  3F3R A;  3QFB C;  2VCW A;  4MJA A;  1MD4 A;  2LQO A;  1FG4 A;  2DKI A;  2CZ2 A;  2H01 A;  2H6Y A;  4Q5F A;  1AC1 A;  1MTC A;  4ZL7 A;  2VL2 A;  2GGT A;  2UZ8 A;  3DGQ A;  5DJM A;  2EC4 A;  1FB6 A;  4ICY A;  5A4W A;  1QFN A;  2VD0 A;  2GZZ A;  3GX8 A;  1ACV A;  1TU8 A;  2XBI A;  1J08 A;  2F3M A;  4OO4 A;  3WGX A;  3S9F A;  5CYY A;  2DJJ A;  2OE0 A;  5ECI B;  3M1G A;  5GZZ B;  2K8V A;  3L9S A;  5LNK e;  3FR9 A;  2GQL A;  2AAW A;  5DAL B;  2GT5 A;  3H8Q A;  2H6X A;  4L8E A;  3QPM A;  1HD2 A;  1HQO A;  2LV3 A;  5LD0 A;  2F8F A;  4WF5 A;  3FR6 A;  4KCE A;  2B5E A;  4MF7 A;  1YKC A;  1TK8 B;  2CV4 A;  1JFU A;  3WT2 A;  2E0Q A;  3GTU B;  1T3B A;  2IWT A;  1URM A;  3IHG A;  3TUE A;  1K3L A;  3KXO A;  3TOU A;  2R0C A;  5D73 A;  3H4K A;  1TRS A;  2FLS A;  4MZB A;  1YQ1 A;  4YH2 A;  2HYX A;  3LGC A;  4KDY A;  2VOC A;  1Z5Y E;  1O7U A;  2ES7 A;  2CX4 A;  1PMT A;  3EUR A;  2X8C A;  1OVN A;  3DIE A;  4EDY A;  1FB0 A;  2PVQ A;  4X4J A;  5KN2 A;  5ECS A;  4OCE A;  1WP0 A;  3ZIV A;  1M2B A;  4BL7 B;  1EP8 A;  1GLQ A;  4ECJ A;  3G7J A;  1BX9 A;  2GQM A;  3J7Y b;  3ZML A;  4NV5 A;  1SK2 A;  1M9A A;  6GSY A;  1G7O A;  2I3Y A;  4K6X A;  2HZE B;  4XTS A;  17GS A;  3ZL5 A;  4QQ7 A;  11GS A;  1V98 A;  1T7P B;  3ZLP A;  4KDX A;  2WUL A;  2FWG A;  5B6N A;  5J9B A;  2WS2 A;  1QXH A;  3EE2 A;  5DAL A;  4MAB A;  2VL9 A;  2I1U A;  1AW9 A;  2C0G A;  2X4A A;  3A5I A;  3HKR A;  1T1V A;  2C4J A;  3SBC A;  3GTU A;  3KZQ A;  2O8V B;  3QOU A;  3Q74 A;  4RI6 A;  2QGV A;  1WMJ A;  2BJX A;  4WBR D;  3A3T A;  3W6G A;  3L9V A;  1W4V A;  5G2Z A;  1XWK A;  1N8J A;  3CSJ A;  1K3O A;  2FGX A;  4K8M A;  4NHW A;  4F0C A;  3RHB A;  2FA4 A;  4X1U A;  4ILF A;  4L0U A;  4Z2T A;  1B4P A;  4BA7 A;  4IVF A;  4BL7 A;  1ZYQ B;  1GLP A;  4K2D A;  4N30 A;  1VGL A;  3GNJ A;  1X9S B;  2XPE A;  2YCD A;  5HFI A;  2CZ3 A;  2HNL A;  5F0G A;  5JWO B;  3RHC A;  1F9M A;  4PGT A;  5E59 A;  3APS A;  2A4V A;  2HZE A;  3K8N A;  3M9K A;  3TDG A;  3EWL A;  3ZRD A;  2FWE A;  2V2G A;  1S3D A;  3CXG A;  13GS A;  3GKK A;  5ID2 B;  2N5A A;  1EWX A;  3P2A A;  4GTU A;  2AHE A;  4IEL A;  2H1B A;  3VUR A;  3ME8 A;  5IPG A;  4HI7 A;  1DSB A;  1B9Y C;  4XS6 A;  2HSH A;  4IP1 A;  1U3I A;  2K9F A;  3VWW A;  3EMP A;  3GKN A;  1SL2 B;  3IPZ A;  3DKS A;  4WXT A;  4HJ2 A;  2LJK A;  5DQS A;  1YY7 A;  4GSN A;  2H70 A;  2ALB A;  5DDL A;  3GIX A;  1RK4 A;  2A2S A;  3KIJ A;  5KN0 A;  4J57 E;  4J56 E;  2FHE A;  2DKH A;  2LQQ A;  4BWS A;  1WJK A;  4F0B A;  1N2A A;  3PR8 A;  2I4A A;  3CTG A;  1KEB A;  2V6O A;  3Q18 A;  1F37 A;  1SJI A;  2MBS A;  2AUV A;  4ZL9 A;  1XWB A;  2DJK A;  1YF0 A;  2XC2 A;  2IMF A;  2FWF A;  1ZYP A;  1QUW A;  3WD6 A;  3UEM A;  1FHE A;  2VO4 A;  2YZU A;  5D9T A;  3I69 A;  3MAK A;  3QR6 A;  4EF0 A;  3BBY A;  1S3C A;  3KM6 A;  3MIX A;  4V2L A;  5IPH A;  2RM5 A;  1FVK A;  1RQM A;  5ID2 A;  1SL1 B;  4RQX A;  2OAC A;  5IMA A;  5DBQ A;  2GVP A;  2NTO A;  1SJZ A;  3MWH A;  4USS A;  1V58 A;  2ZCT A;  3D5J A;  3KP9 A;  2X8H A;  1TK5 B;  3VI7 A;  4KND A;  3VWU A;  2YJ7 A;  4O32 A;  4LL1 B;  4Z2R A;  3O3T A;  4AGS A;  2WCI A;  3CMI A;  4BVY B;  5H5R A;  4O5Q A;  2VAF A;  3AY8 A;  2B1L A;  3ERW A;  4G2E A;  2IFQ B;  1O6J A;  4WR5 A;  1ERU A;  1CQG A;  3CBU A;  3E3E A;  1ZGN A;  4WF4 A;  3VK9 A;  3BCI A;  3ERF A;  4WKW A;  5DAK B;  1XVQ A;  1Z3E A;  2LNS A;  1EV4 A;  4YQM A;  2GS3 A;  3GN3 A;  1H75 A;  3FZ5 A;  4OFN A;  1TK0 B;  3LEF A;  1JLV A;  4GXZ A;  3TB2 A;  4FQU A;  3R3E A;  1AIU A;  5HQP A;  1V9W A;  1XW9 A;  3UOM A;  5IO2 A;  2PMT A;  2PBJ A;  1ZL9 A;  1FO5 A;  3HA9 A;  4GWR A;  5HFG A;  1DE1 A;  4DSS B;  2O89 A;  4IJ3 A;  4ZIJ A;  4KCA A;  4MJC A;  3HJO A;  3D21 A;  3GL5 A;  5J3R A;  2N5F A;  3HJP A;  4HU9 A;  2JZS A;  4ZXG A;  4MF6 A;  3E9J B;  3TJB A;  4MJB A;  1GSQ A;  1WRY A;  1KBN A;  1ZMA A;  2O7K A;  4JU5 A;  1EZK A;  2IFQ A;  5F07 A;  4TR1 B;  1OKD A;  2PUK C;  4FYB A;  2E7P A;  3ZZX A;  2LRT A;  2FCH A;  1EGO A;  2E2M A;  5ELG A;  1OC9 B;  1Y6E A;  5DAK A;  2O85 A;  4IQA A;  4TXO B;  2C0D A;  3G7Y A;  3ZYW A;  2E2G A;  4K7N A;  3GSS A;  4AF2 A;  1O73 A;  2P0G A;  5IMV A;  2QC7 A;  4DSS A;  4E8H A;  2YAN A;  1THO A;  1GNE A;  1PQN A;  1V40 A;  1E2Y A;  2VLT A;  4G19 A;  1U88 A;  4ZBB A;  1TXX A;  5D9X A;  2H66 A;  3KTB A;  1TTZ A;  2NDO A;  5EPF A;  1YKA A;  4KW6 A;  5HFK A;  2K8S A;  4XHM A;  3APQ A;  5JWQ B;  5ECL B;  3VFI A;  2H0G A;  4FO5 A;  4MLY A;  4TR1 A;  4YQV A;  3RAZ A;  2H8L A;  2G0F A;  5D8I A;  2YOI A;  2TIR A;  4ZBA A;  2VD1 A;  2R5G A;  3D4T A;  2EIO A;  1OC9 A;  2A2R A;  2L6C A;  1HNA A;  1XW6 A;  3VWV A;  4TXO A;  2YNX A;  5ELA A;  1VF4 A;  3IC8 A;  1TI1 A;  3LQ7 A;  4JED A;  1R5P A;  1KTE A;  5AIV A;  1TRV A;  4XRD A;  1PX6 A;  5IQY A;  2MMZ A;  4JE1 A;  1A2M A;  3IXR A;  5JCU A;  4KA0 A;  1TP9 A;  3CRT A;  3WT1 A;  1UA5 A;  4A5P A;  2CVB A;  4WBJ A;  1O8X A;  5DQY A;  4YQU A;  3SWL A;  1DUG A;  1ERW A;  4EIQ A;  1V57 A;  1SK1 A;  4F9Z A;  4MF5 A;  2MMA A;  1BAY A;  3GST A;  3DML A;  1NSW A;  3NIV A;  2H1A A;  1Q4J A;  3WGE A;  4POL A;  3GA4 A;  2IIY A;  2L4C A;  5HR1 A;  1IYH A;  2QKE A;  4FIW A;  5HR0 A;  3KTL A;  2LST A;  4TRX A;  4OMV A;  3M9J A;  5ECM B;  3FK8 A;  4WET A;  3J7Y k;  4NAX A;  3F0I A;  4KSO A;  9GSS A;  2NPB A;  2LNT A;  2AB6 A;  1GWC A;  2FWH A;  1K3Y A;  3FRC A;  3TJK A;  3BD2 A;  4I5Q A;  1WIK A;  3TGZ A;  4DSQ A;  1HNC A;  4MPG A;  2JZT A;  2HRN A;  1SYR A;  5B8A A;  1Z7P A;  5J5N A;  1GSU A;  2IME A;  3D6I A;  5ECH B;  2R6K A;  4V2N A;  6GSU A;  5KN3 A;  1J0F A;  5D9W A;  3TKS A;  5JCW A;  2OE1 A;  3FMW A;  2HLS A;  14GS A;  2MBT A;  2VCT A;  2LTK A;  1XXU A;  18GS A;  1G6W A;  2DC5 A;  3UMA A;  4K5S A;  1XWC A;  4HDE A;  1GSF A;  4TR3 A;  4HEA 2;  2HI7 A;  1GL8 A;  5CRG A;  2OKA A;  5CAX A;  2JAC A;  2F51 A;  2ON5 A;  3TCO A;  5CRD A;  3P8W A;  2J9H A;  4X0X A;  2H30 A;  1PKW A;  3GUS A;  4AJ8 A;  2RM6 A;  5BRT A;  1Z6N A;  4OFM A;  4L5O A;  5C00 A;  3HD5 A;  1TKD B;  4K7I A;  2P5Q A;  2N5B A;  3Q6O A;  1M99 A;  2IMI A;  1SKR B;  3KD0 A;  1Q98 A;  1F6M C;  2GDR A;  2Z9S A;  2OJL A;  3ISO A;  5L71 A;  1YDK A;  5F05 A;  3EIN A;  2WGR A;  3GX0 A;  3FY7 A;  1JLW A;  3I43 A;  1USB A;  3CSI A;  1J9B A;  2B1K A;  4IBP A;  3EMX A;  3IA1 A;  5DJL A;  5ABR A;  3GKX A;  2YWM A;  4PQH A;  3HYP A;  3N9J A;  1G0T A;  1ZYN A;  3LFL A;  5HR3 A;  5AIX A;  4XCS A;  1SKW B;  2HE3 A;  3UAR A;  2VLU A;  2H19 A;  4LL4 B;  2X8G A;  3KH7 A;  5IOX A;  4I6X A;  3VPQ A;  1QGV A;  2OAD A;  5CNW A;  2JSZ A;  3VI5 A;  3D4M A;  2CVD A;  4LMV A;  4TN8 A;  3QD9 A;  4CY8 A;  2DIY A;  2M46 A;  3MNG A;  4HZ2 A;  1AQV A;  6GSX A;  1TW9 A;  3F9U A;  4RUV A;  4OFT A;  4MK3 A;  1T8E B;  3ZIJ A;  4K1F A;  1MDI A;  4I2U A;  3M0F A;  5ECN B;  2DBC A;  2JSY A;  3UIW A;  3DWV A;  2AYT A;  3IC4 A;  4FH8 A;  4DVC A;  1WOU A;  1ERV A;  2DIZ A;  2JZR A;  1XW5 A;  2H72 A;  2LJR A;  2HSM A;  1BQ7 A;  2VCV A;  2YP6 A;  1K0N A;  1AQW A;  2DJ2 A;  2WFC A;  2C1Y A;  2XHF A;  2GZY A;  1B9X C;  2OA7 A;  1RW1 A;  4KDU A;  3LSZ A;  1Z7R A;  4XRA A;  2FUG 2;  5FHI A;  2HRA A;  4KX4 A;  3H93 A;  1DE2 A;  2VUP A;  5D9V A;  3BCK A;  3UVH A;  2YV9 A;  3LOR A;  1QMV A;  3MDK A;  4KE3 A;  2L4Q A;  5ECQ B;  2FA8 A;  3TJF A;  2VCX A;  1ZYE A;  4X43 A;  2VCZ A;  4F2I A;  4QL9 A;  3F4T A;  3F6F A;  3LXT A;  5IOW A;  3KMO A;  1X5E A;  2R3X A;  2PN8 A;  3IBH A;  2RII A;  4G9H A;  3IAM 2;  3TRX A;  1K0B A;  1M0U A;  1GUM A;  3HZ8 A;  2DMM A;  1GNW A;  1SKS B;  3ZVJ A;  4MH2 A;  2IN3 A;  1JZR A;  4PUF C;  6GSS A;  4XIH A;  3O76 A;  5A5K A;  5INY A;  4KUN A;  3GMF A;  4XS4 B;  1V2A A;  1OAZ A;  4MDC A;  4V2M A;  2C3Q A;  5EL8 A;  1XFL A;  4KAE A;  2VL3 A;  1XWA A;  1G7E A;  2QSI A;  4JBB A;  2B6M A;  3EYT A;  2L6D A;  3LYK A;  4KSM A;  1S3A A;  1R7H A;  1K0A A;  1NM3 A;  1TDI A;  1GUH A;  4HJM A;  5DVB A;  1OE8 A;  1XPV A;  2NBS A;  1JZO A;  3PH9 A;  2YWN A;  3EC3 A;  2P31 A;  1O85 A;  4POM A;  3Q19 A;  3UL3 A;  5AGY A;  3QCP A;  3FZA A;  2JU5 A;  4TR4 A;  4GSS A;  1T00 A;  3IK7 A;  4PQI A;  6GSV A;  4BPY A;  4MNN A;  4GF0 A;  3W8S A;  3IHQ A;  1PD2 1;  4EDZ A;  1OC8 A;  1THX A;  2DJ0 A;  5KN1 A;  2V41 A;  1LJR A;  4TR0 A;  4XS4 A;  2HT9 A;  4WR4 A;  2DJ1 A;  1XBS A;  1PKZ A;  1MDK A;  5AN1 A;  1SYX A;  1HYU A;  1ZCP A;  3F3Q A;  4IS0 A;  2X64 A;  1ZOF A;  3UBL A;  4EO3 A;  4IW9 A;  5G5E A;  1FAA A;  2LJA A;  3FKF A;  5IM9 A;  1IYI A;  2K6V A;  3LYP A;  3ZMK A;  1ERT A;  2QA2 A;  1YZX A;  2GLR A;  1X9M B;  4MP4 A;  1DBY A;  1A8Y A;  2H74 A;  4O7H A;  3TKR A;  1PL1 A;  1Y25 A;  4NV2 A;  2TRC P;  4BVX A;  1GUL A;  4MCU A;  2CA8 A;  2RUE A;  3JCM L;  4BWQ A;  3V1W A;  2H0I A;  3F8U A;  1F3B A;  1UVZ A;  3F6D A;  2DSA A;  3L0H A;  2IPA A;  4GLT A;  5D93 A;  3TKQ A;  3LWA A;  5F8B A;  5J4U A;  4ML6 A;  2V6K A;  4JR6 A;  4XS1 A;  3HVV A;  4YKG A;  3R2Q A;  2D2Z A;  2HSY A;  3ZRE A;  3P7X A;  1ML6 A;  2GT6 A;  1MEK A;  3HDC A;  5J9C A;  3EPT A;  4PQ1 A;  4KGI A;  2PU9 C;  3A5W A;  5H5Q A;  3PGT A;  2C0F A;  4EKZ A;  3I6A A;  4YKF A;  1Z6M A;  4N0Z A;  3QDN A;  2YPM A;  4ZB9 A;  4I2T A;  3G7I A;  4CDO A;  4NWY A;  2KHP A;  2CQ9 A;  2LKU A;  3IK9 A;  4AJ7 A;  4EC0 A;  4LMW A;  2C80 A;  4DEJ A;  3E0U A;  3IR4 A;  4GCI A;  2OBK A;  3D22 A;  3HHV A;  5KEJ A;  1GSS A;  2B7J A;  1G6Y A;  1VF2 A;  2XBQ A;  3UVT A;  5B6M A;  3DYR A;  4ML1 A;  5DCH A;  3HCZ A;  4N0V A;  2GSQ A;  2GTU A;  4IHU A;  2FD3 A;  4PNG A;  2FY6 A;  2KP2 A;  2CT6 A;  2FNO A;  4L0W A;  5ECO B;  2A4H A;  2NVL A;  1PSQ A;  1VF1 A;  2A2P A;  1PL2 A;  1GH2 A;  3C7M A;  3GH9 A;  1A2L A;  1O8W A;  2R0G A;  1U87 A;  2KUC A;  1U6T A;  5B7C A;  3WGD A;  2M72 A;  4ZBD A;  2R37 A;  1WPI A;  3F63 A;  2C3N A;  3APO A;  3DD3 A;  2VIM A;  4K2X A;  4HOJ A;  5CRE A;  1GSE A;  1R5A A;  4OO5 A;  1NHO A;  1PGT A;  3TOT A;  4TKY A;  2OBI A;  4ECI A;  2KLX A;  1WE0 A;  1JHB A;  2V32 A;  3KEB A;  1XWG A;  3FZ9 A;  4TVE A;  5FWG A;  4PTS A;  4EXJ A;  4ZL8 A;  1ZZY A;  1FOV A;  3L4N A;  2VL2 C;  2B3S A;  2PVO C;  4F82 A;  5ENU A;  1YJ6 A;  4HQS A;  1UC7 A;  3U5R E;  3RDW A;  1K0M A;  2DML A;  2M80 A;  3ZTL A;  5JCG A;  7GSS A;  3WYW A;  1ILO A;  3C1R A;  4ACS A;  1GSY A;  4TXV A;  2CX3 A;  3MSZ A;  2TRX A;  2P5R A;  4G0K A;  4GST A;  2ZUP A;  5KOX A;  2LUS A;  2WB9 A;  4MMM A;  3DRN A;  3KGK A;  3C71 A;  1U3A A;  4OD7 A;  4I8B A;  1MDJ A;  4TW5 A;  2OE3 A;  4Z7X A;  1M7T A;  5D96 A;  5BMU A;  3QAG A;  2VLV A;  3CSH A;  2CVK A;  4ULX A;  1GTB A;  2LEG A;  4RI7 A;  3DVX A;  1WWJ A;  2WJU A;  2AV4 A;  2K18 A;  4HS1 A;  1QQ2 A;  3RPP A;  2O87 A;  3KH9 A;  1TRW A;  3DVW A;  1BYE A;  1OC3 A;  1B48 A;  3TRP A;  5C04 A;  3TKS C;  3NOF A;  1GRX A;  4JRR A;  4TOP A;  5IO0 A;  3DEX A;  8GSS A;  5CRH A;  4K0G A;  2JAD A;  4POK A;  1FVJ A;  4EIP A;  2QA1 A;  3UAP A;  3GL3 A;  3KMN A;  1R4W A;  4P3Y B;  2KP1 A;  3CRU A;  5ECK B;  1ABA A;  1X5C A;  1XOB A;  2XPD A;  4MJE A;  2VCQ A;  3IAS 2;  4RQR A;  5G1K A;  3VPT A;  4NXI A;  1XIY A;  4L5L A;  3KCM A;  1LU4 A;  1VF3 A;  2YWI A;  3PIN A;  1YEP A;  2MYG A;  3BOA A;  2GQK A;  4ECC A;  1XOA A;  4ISD A;  4J2F A;  1OKT A;  4YAP A;  1HNB A;  2B5Y A;  3GYK A;  1VRS D;  1TJD A;  4F03 A;  4WEY A;  2MMN A;  4HU7 A;  4OCF A;  1SJ6 A;  2C3T A;  4NHZ A;  1XCC A;  3HVX A;  6GST A;  3L9U A;  3A2X A;  2GSR A;  2PGT A;  3A2V A;  2H76 A;  2YV7 A;  1A23 A;  1FOH A;  2RUF A;  2WRT A;  4V1A p;  3PPU A;  4KH7 A;  1A8L A;  3ME7 A;  2AJQ B;  4DSR A;  1BG5 A;  3H1N A;  3ED3 A;  3VWX A;  5EVO A;  4OWY A;  1SD8 A;  16GS A;  3FR3 A;  4KB3 A;  3ZFB A;  3IOS A;  4PUR A;  2L57 A;  1GSD A;  4K9Z A;  1SU9 A;  2H71 A;  4FYU A;  2LRC A;  1M9B A;  2IMD A;  4H86 A;  4K5R A;  3HXS A;  2R4V A;  4O5R A;  3LXZ A;  3HZ4 A;  4YAV A;  1AQX A;  1MD3 A;  4POB A;  1TRU A;  4LLR A;  1M2D A;  5KOW A;  1NHY A;  2YN1 A;  3GKM A;  3CTF A;  3GUR A;  4IP6 A;  4LA1 A;  4N10 A;  5AIS A;  5GST A;  4IKH A;  3G9B A;  2L5O A;  3KP8 A;  4IQ1 A;  1A0F A;  1I9D A;  3OR5 A;  2G2Q A;  2CAI A;  3DXB A;  5LCZ A;  4ID0 A;  3EU4 A;  4ZB8 A;  1GP1 A;  5CO3 A;  4EVM A;  3C1S A;  3HY2 A;  2H0H A;  3GHA A;  5IMZ A;  3GFK A;  3FYG A;  3L78 A;  3QFA C;  2H1G A;  3HVS A;  5IMC A;  1B4Q A;  2MZC A;  3N5O A;  3IE3 A;  3F4S A;  4G0I A;  4G0L A;  4MPF A;  4FYC A;  3CYN A;  5COH A;  3D0Z A;  2LS5 A;  3BJ5 A;  1I5G A;  3M8N A;  5G30 A;  2KOK A;  1UN2 A;  2RLI A;  4NMU A;  4E8E A;  2V1M A;  1TU7 A;  2BMX A;  4NPB A;  1GTU A;  4AJ6 A;  1X5D A;  3A2W A;  3W8J A;  2YWO A;  6GSW A;  4HZ4 A;  1QK8 A;  5G31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...