1URMA

Human peroxiredoxin 5, c47s mutant
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
162
structure length
162
Chain Sequence
SAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGSSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXIREDOXIN 5
publication title Crystal Structure of the C47S Mutant of Human Peroxiredoxin 5
doi rcsb
source organism Homo sapiens
molecule tags Antioxidant enzyme
total genus 49
structure length 162
sequence length 162
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2003-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1urmA00
4XRDA 1EV4A 3TKRA 4QQ7A 2V2GA 5LD0A 2VLTA 2HT9A 4BVXA 1GLPA 1T4ZA 3CSJA 4OO4A 5J5NA 1J9BA 2DSAA 1OKDA 3L9VA 1EEJA 2HLSA 2ES7A 1BEDA 5HR1A 5ABRA 2C0GA 5C04A 2GLRA 4EDZA 4YQVA 1A0RP 5DCHA 5DALB 1ERVA 3IRAA 3FR6A 4IKHA 2JZRA 4MJAA 4DSSA 1X9SB 3FKFA 1GUMA 4RQXA 2H0IA 2FD3A 3HJMA 1XWAA 1GSYA 2L5OA 5EL8A 2R6KA 1AQVA 4O7HA 4JRRA 2OJLA 3VI5A 1V40A 4K0NA 4TXOB 4IGJA 1DE1A 1DUGA 3IK9A 4WR4A 4HQSA 5CNWA 2HRNA 3C71A 2K9FA 2IWTA 3UVTA 3G7JA 1JZRA 5IO2A 3F63A 3KP8A 3M3MA 2XBIA 1FB0A 1DSBA 2FLSA 1MEKA 1NHOA 4KSOA 2RIIA 2VOCA 4N0VA 4JR4A 2H1AA 3GN3A 2J23A 1AXDA 3W8SA 3FR3A 3FR9A 3EWLA 3L9UA 2VM2A 1H4OA 2DJJA 1XXUA 4J56E 3KMNA 3QAWA 1A24A 1K0OA 3TCOA 2FY6A 3OR5A 3VFIA 1OC3A 2C3TA 2GTUA 3RHCA 3LEFA 4MZWA 1FO5A 1FVJA 1M7TA 1K0CA 5C00A 3O3TA 2BMXA 4ZXGA 2WULA 4IQ1A 4Q5RA 1YEXA 2WB9A 1F37A 5IM9A 2LNSA 2B5YA 2X99A 1JZOA 1S3DA 2JL4A 4JEDA 3EYTA 1QUWA 1EV9A 1AAZA 2I4AA 3KIJA 4TVEA 2WJUA 1X5CA 1OE7A 3DGQA 1MTCA 5D9VA 4V1Ag 4HU9A 4XCSA 2V1MA 1M9BA 1UC7A 3LG6A 5G1LA 1BJXA 5HR3A 3F4TA 3TJJA 2GSSA 4CDOA 3UBLA 2V41A 2QKEA 3VLNA 1EP8A 3A5WA 3KD0A 3QPMA 2HE3A 3M0FA 4N30A 2H0HA 3SBCA 3UARA 1J08A 1M2AA 5JWOB 1ZGNA 2XBQA 2KLXA 3KMOA 2FA4A 3EURA 3ZREA 2WS2A 3TJBA 5DALA 2IJYA 2OACA 3HVXA 4WF5A 1K3OA 5IPGA 5AN1A 4KH7A 2CAIA 4TRXA 5KEJA 5B6MA 2VCWA 5ECKB 4MABA 4L8EA 3FZ4A 10GSA 2ZUPA 1T3BA 2M46A 5IOXA 4IN0A 4XRAA 4TXOA 1A8YA 3C8EA 1UN2A 3DVXA 5JCGA 3A3TA 4EF0A 2D2ZA 2RUEA 2LJAA 3GKMA 2O8VB 3HYPA 4HJ2A 2YCDA 3G9BA 1ML6A 5ELAA 2REMA 4MK3A 1RQMA 3FYGA 2I3YA 1ZYQB 1C72A 2GQKA 5A4WA 2H19A 4P3YB 1X9WB 2GSTA 2FCHA 3Q74A 3VI7A 2A4VA 1HNBA 2ALBA 3GNJA 3DD3A 2RUFA 4GWRA 3GTUB 4IS0A 3I6AA 4TR4A 2OADA 4ISDA 2FUG2 5G30A 4ZB6A 2JSZA 1FAAA 6GSXA 2LJKA 1TU8A 4LMWA 2B6MA 2FWEA 2MYGA 3ZMKA 4GSNA 5ECRB 4IJIA 2M72A 3N5OA 3HXSA 3VURA 2B7KA 4PXOA 1WRYA 2AAWA 2NPBA 1AQXA 1AIUA 3NZNA 3L78A 5JCUA 4KDXA 1WWJA 1WE0A 3CTGA 9GSSA 2HSYA 3ED3A 4NHWA 4GCIA 2F8AA 2WDUA 2IMIA 3D22A 4NAXA 1VF3A 1MD3A 4IELA 2B3SA 2DIYA 4MZCA 1A2MA 4N0ZA 5G2ZA 1QK8A 2IPAA 2FWGA 5EY6A 1YEPA 2E0QA 1X0RA 1GSUA 5ECOB 2JZTA 1U3IA 1SKSB 1R26A 1GULA 5CRWA 3VWWA 3ZIJA 3HHVA 5ECLB 2AJQB 4J57E 1OC9B 4BA7A 3TKSA 3ZITA 3BJ5A 3O76A 4GSSA 5KN2A 2DBCA 2PPTA 1K0NA 3F6FA 4FH8A 4ZL9A 1JZDA 5GAPD 2O87A 3IXRA 4KW6A 4XTSA 3H1NA 5JWQB 4ZL8A 2EIQA 4O5RA 1ZZYA 4AJ8A 3ZFBA 1ZOFA 3VPQA 1F9MA 4E8HA 4EVMA 5CREA 6GSTA 1EZKA 5HFKA 3BBYA 1HNAA 4WF4A 5LCZA 2MMOA 4EXJA 1WJKA 4WBRD 1AC1A 2YWIA 4GLTA 1PX7A 4ECCA 1A23A 2K8SA 1WP0A 3IAS2 13GSA 19GSA 1RK4A 1SYRA 1AUCA 1HYUA 2BTOT 4PNFA 2YV9A 20GSA 5GZZB 4KNDA 5IMAA 4ECBA 3PGTA 2LSTA 4HU7A 4OD7A 2ON7A 3J7Yb 2VM1A 4O32A 4V2MA 2DMMA 4MJEA 2DJ3A 2IMEA 4MPFA 2VCVA 4EC0A 1JLVA 5EVOA 2TRCP 1TXXA 4KSMA 3QR6A 2F9SA 4WETA 1NSWA 4D73B 4ML6A 4OO5A 2C4JA 3H8QA 4HDEA 3P7XA 5ECIB 1GRXA 4ZB9A 3DIEA 1HQOA 4K6XA 2YJ7A 3GH9A 3CTFA 3D21A 1RW1A 1Z7RA 1BYEA 1PN9A 3JCML 2MMZA 4POLA 3GV1A 2VCTA 4GQFA 5D8IA 1BAYA 2A2RA 2RM6A 5ENUA 18GSA 3G7IA 2OKAA 1PRXA 2ZCTA 22GSA 4PQIA 4KA0A 4G9HA 5F0GA 2XC2A 3M1GA 4IHUA 4NV5A 2B1LA 1T00A 2OE3A 2Z9SA 3LYKA 1HNCA 3I69A 2HYXA 2WCIA 3QAGA 4TN8A 1TDIA 2LRCA 3KH9A 4HUAA 2YOIA 1FW1A 3C7MA 3GHAA 2KP1A 4L5OA 1XVWA 1GSQA 2LQOA 1GTBA 1XWGA 2O7KA 1OC9A 1XIYA 5COHA 4X43A 6GSYA 4MLYA 3TDGA 3UVHA 1XWBA 2I1UA 2GQLA 1QQ2A 2CQ9A 4MA9A 2KOKA 2DJ2A 2PMTA 4NXIA 4LL1B 3WT2A 2MMNA 3RDWA 1W4VA 2LKUA 4EL1A 2HNLA 3GL5A 5IO0A 2L4QA 2PBJA 1SD8A 1G7EA 2RM5A 2YWMA 1GSDA 2OA7A 3FW2A 2YJHA 5J41A 1EEMA 1O73A 1AQWA 3CXGA 1N2AA 5D96A 1Z6NA 2HI7A 3IOSA 2JADA 4HZ4A 1BG5A 1G7OA 4K8MA 3MSZA 2AB6A 5AIVA 4YH2A 3D4MA 4F03A 1XZOA 3GYKA 2GVPA 7GSSA 4KX4A 4I5QA 2DLXA 1F6MC 3ERGA 2E7PA 3GH6A 1SKWB 3IHQA 3WT1A 2IIYA 4K1FA 2C0EA 2WGRA 2EC4A 1W89A 3BCKA 4PNGA 1BQ7A 5DQSA 4OFNA 4MDCA 3FEUA 4MF5A 5AIXA 8GSSA 4JR6A 4L5LA 4I6XA 1EGOA 4HS1A 1JHBA 3D0ZA 2VCZA 2IMKA 2GT5A 4XHMA 3GUSA 5ELGA 5IMVA 5ECMB 2WZ9A 1T1VA 4YAPA 1SL0B 3TKSC 5HR0A 5H5RA 2AV4A 4GSTA 4BWSA 4D73A 1TRUA 2VD1A 3U6VA 5ID2B 11GSA 5HR2A 3KTLA 2YNXA 2C80A 2H74A 1F2EA 3QAVA 1TI1A 1ZCPA 4Q5NA 1FHEA 6GSUA 3VWXA 3I9V2 4ACSA 3QFAC 3QFBC 3BD2A 2CX3A 3EMPA 14GSA 1U87A 3LGCA 3TOTA 3TRPA 5CRDA 4K2DA 4O92A 4WXTA 4MCUA 1T8EB 3US3A 3D5JA 2CZ3A 1K0MA 3H93A 3LQ7A 3RAZA 5CRGA 3Q18A 2LQQA 5CO3A 3A2WA 4FYBA 4IQAA 5IOWA 4XIHA 4AGSA 1XOBA 3ISOA 4QL7A 4F2IA 3QD9A 1TP9A 5CAXA 3F3QA 4ID0A 16GSA 4MP4A 3NIVA 2GZZA 4I8BA 1ON4A 3CSHA 3EE2A 2CV4A 4KDUA 3DRNA 2AUVA 4Q5FA 4X1UA 4TOPA 3TRQA 3ZMLA 5KN3A 1M2BA 1QMVA 4WKWA 5IIZA 4ULXA 3HA9A 3FY7A 2YANA 1GL8A 2VUPA 4KDYA 4EKZA 3GMFA 2H0GA 1FVKA 2YP6A 1WPIA 2RLIA 2YN1A 1EP7A 4J2FA 4YQMA 2C0FA 3LFLA 4WBJA 2CZ2A 2GZYA 1NM3A 1F3AA 3CYNA 3LXZA 1A2JA 2E2GA 4GQCA 4ML1A 4NHZA 4YAVA 1XW6A 2PN8A 2N5FA 1TRWA 1YF0A 2VL3A 4GF0A 5B8AA 2H73A 2GSQA 1ACVA 5DCGA 4RQRA 5ECQB 1XCCA 2MBSA 1WIKA 2IFQB 1GSFA 3UEMA 2CVBA 5IQYA 4L0UA 2LRNA 5A5KA 4KB3A 4EO3A 2KUCA 4G2EA 2LUSA 1PL1A 2R3XA 1XOAA 2P31A 1G6WA 1QXHA 2M80A 5AGYA 3M9JA 4OCFA 1SU9A 1K3LA 2G0FA 1OVNA 3GSSA 2H8LA 5ID2A 5HFGA 4AJ6A 3DEXA 1TJDA 1GLQA 2P0GA 4X0XA 3HVSA 1SJIA 1H75A 1URMA 2FWHA 2R2JA 3H79A 3HDCA 1YY7A 1Z9HA 3O6TA 1XW5A 4LLRA 1JZWA 2VO4A 2HZEB 3EINA 1PX6A 3HVVA 3MDKA 2L6DA 3C1SA 2H72A 1SL2B 17GSA 3S9FA 3HZ8A 1Q4JA 3GL3A 1G0TA 1VRSD 2C0DA 2JZSA 3F4RA 4MJCA 5F07A 3UJ1A 1O85A 5KN1A 3F4SA 1O7UA 4K9ZA 2H1GA 4PGTA 1XW9A 1TI3A 5F8BA 1Z3EA 4MH3A 2P5RA 4KGIA 3MWHA 6GSSA 2PVOC 5ECNB 5H5QA 3GURA 2HFDA 2L4CA 2DJ0A 1TW9A 2CT6A 1EGRA 3HY2A 1B9XC 3WYWA 4GXZA 2LV3A 1PSQA 1U3AA 5DJLA 1U6TA 2VLVA 3V1WA 1OKTA 3GA4A 3P90A 3DVWA 3FZ5A 2GQMA 1B4QA 1EOGA 1PL2A 12GSA 2H76A 3W8JA 1KEBA 4EUYA 3ZYWA 2QGVA 1LBKA 2H70A 1GTAA 1WOUA 2DC5A 4V2LA 5J4UA 4AF2A 3K8NA 1MDKA 2PWJA 1VF4A 1M0UA 2H1BA 5D9WA 4KUNA 1SJZA 3KEBA 1GTIA 4KCEA 1A8LA 1YQ1A 4CHSA 1OAZA 3Q19A 5G5EA 4PURA 1TKDB 5JWRB 1SK0A 3F9UA 1ERWA 1K3YA 1O8WA 2QSIA 3DKSA 3Q6OA 3FHKA 3TOUA 3KCMA 2FHEA 3RBTA 3IV4A 3L9SA 2C3NA 2H30A 4IJ3A 2DIZA 2IFQA 1ZYEA 3U5RE 4DEJA 3FZAA 1PKWA 1XBSA 2NDOA 1AW9A 4OMVA 4ECIA 1LU4A 3HKRA 3D6IA 3GTUA 1Z5YE 1S3CA 5DAKB 1QFNA 1B48A 5A4UA 3NOFA 1UA5A 1MD4A 1XVQA 2YZHA 2LS5A 2NBSA 2GSRA 3CRTA 2KHPA 4K7IA 4IVFA 1Q98A 1GSEA 2IL3A 3M9KA 2VD0A 1TRSA 5GSTA 2LNTA 4POBA 4G10A 3HJPA 5HFIA 2VAFA 3HCZA 3J7Yk 2F3MA 3C73A 5DJMA 4HJMA 4I97A 2HZEA 3TRXA 1JLWA 1NW2A 3GKKA 5DDLA 3ZIVA 3VPTA 2R37A 3ZRDA 4MF7A 2CA8A 4POKA 1ZMAA 4ZBDA 2X8HA 2DJ1A 3HJOA 3EVIA 1CQGA 3L0HA 3R2QA 3TKSE 3F0IA 5D93A 2VL2C 4N11A 2N5AA 4TXVA 3IR4A 4TR3A 1O8XA 3MNGA 2J9HA 2P5QA 4L0WA 1KBNA 2DMLA 4H86A 1LJRA 2FGXA 5G1KA 4JZQA 3TJGA 1B9YC 1PMTA 2V6OA 2HRFA 2YV7A 5F05A 4GTUA 5DBQA 3VWVA 1YKCA 1TRVA 2PERA 6GSVA 4V1Ap 4WEYA 1V2AA 1FB6A 1YKAA 4K7NA 5CYYA 1F3BA 2VCXA 5FT3A 4BVYA 4LA1A 4FO5A 3GIXA 2IMFA 1V58A 1X5DA 2EIRA 3BOAA 3EMXA 2BJXA 2F51A 1GUKA 1V57A 1O81A 1CQHA 1PQNA 2HZFA 1THOA 3QOUA 4DVCA 3UBKA 2X8GA 3CSIA 1OE8A 3GKNA 5ECHB 3WGEA 2DJKA 1IYHA 3E3EA 5IMCA 1TK8B 1GUHA 2JU5A 3E9JB 4MH2A 3KP9A 3FZ9A 1E6BA 1TK5B 2K18A 4PUAA 1O6JA 4EE0A 1K0AA 1IYIA 2JSYA 5B6NA 4FYUA 2H6XA 4BPYA 3LORA 1YDKA 4I2UA 5G5FA 2R5GA 1GSSA 2H66A 3APQA 1M2DA 3IK7A 2NVLA 3UOMA 3KM6A 5DAKA 3A2XA 5L71A 1GNWA 3DWVA 4ILFA 4KCAA 1FOVA 2C3QA 2L57A 4K7OA 2V32A 2XPEA 4IP6A 1USBA 3HD5A 2G2QA 2VLUA 2GT6A 5JCWA 2IN3A 1SK1A 2L5LA 1ILOA 1OC8A 4ZILA 2YPMA 3DYRA 3ERWA 4ZBBA 3QDNA 1XFLA 3UAPA 3UMAA 4JE1A 4FIWA 4WR5A 3KJYA 1Z6MA 4JU5A 5E59A 2GZPA 5B7CA 5LNKe 2CAQA 3CRUA 1JFUA 1UVZA 3UIWA 1VF2A 3WD6A 4F9ZA 4ZB8A 2XHFA 3LWAA 2MMAA 3D4TA 2VIMA 5HQPA 2H6YA 1K0DA 3TKQA 2LTKA 1I9DA 3CBUA 4G19A 3PR8A 2C1YA 4F82A 5F06A 1A2LA 2B1KA 2GGTA 2H6ZA 4IP1A 1DE2A 3KGKA 3P2AA 2LEGA 3BCIA 1SD9A 1Z7PA 2VCQA 3IAM2 4IBPA 1M9AA 1QGVA 3F6DA 5AISA 1M99A 5GSSA 3F8UA 1VGLA 4OCEA 2B5XA 4TW5A 1ERUA 4I2TA 5J9CA 2GS3A 2YWOA 3AY8A 6GSWA 3PH9A 4MF6A 3WGXA 5INYA 3C1RA 1PD21 3IPZA 2QC7A 1MDJA 2OE1A 3EC3A 1PA3A 4ZBAA 4PQHA 1WMJA 4FYCA 3IA1A 3G7YA 4TR1B 4NV2A 2PVQA 3TJFA 3VWUA 1TTZA 1U88A 3ZZXA 1K0BA 2ZNMA 1YJ6A 5E4WA 4HOJA 3GX8A 4NPBA 3MAKA 3ME8A 2YWNA 2EIOA 4MZBA 1SENA 1KTEA 4DSRA 1ST9A 1ZL9A 3TKPA 3KXOA 4GRFA 3CMIA 1XPVA 1PKZA 2K6VA 5J3RA 2ON5A 5D9TA 4BWQA 4HQZA 2VL2A 4IW9A 1N8JA 3L4NA 2L59A 2VL9A 1J0FA 4XS4B 3KH7A 4CW9A 1SL1B 1T4YA 2FWFA 3WGDA 4POMA 3GFKA 5A4VA 3FRCA 3IBHA 3E0UA 4TR0A 4JBBA 2OBKA 4AJ7A 3EU3A 3RHBA 2E2MA 4RI7A 4E8EA 4Q5QA 3LYPA 1X9MB 2OE0A 2PU9C 1R5AA 1XWCA 4LL4B 3HZ4A 1OYJA 3TB2A 2MZCA 2H1DA 5J9BA 1R4WA 3N9JA 2B7JA 2A2SA 1Y25A 1R7HA 2O89A 2WFCA 3TGZA 4HI7A 1HD2A 4QL9A 2PGTA 3ZLPA 3VK9A 1G6YA 1YF1A 3QCPA 4EDYA 3M8NA 2H75A 1ABAA 2AHEA 5IMDA 2PUKC 4OWYA 3LXTA 4OFMA 4K0GA 3A2VA 5IMZA 5GAND 4F0CA 1GNEA 5D9XA 1V98A 5FHIA 4XS6A 1S3AA 5H5SA 4LMVA 1E2YA 4HEA2 3KTBA 3UL3A 5DQYA 2AYTA 1EWXA 4YQUA 1MDIA 2H01A 2I9HA 4ECJA 1TK0B 4F0BA 3GX0A 4PX1A 3ZFLA 2X64A 1FG4A 4KAEA 2B5EA 3FK8A 1VF1A 5G31A 4BL7A 5KN0A 1SYXA 1TU7A 1XWKA 1Y6EA 3F3RA 1SK2A 4DSSB 2FNOA 1GP1A 5DVBA 4TR1A 4RI6A 4N10A 1THXA 4DSQA 1TOFA 1DBYA 1YZXA 1X5EA 3EU4A 4OFTA 2NTOA 2XPDA 2C8UA 2X8CA 4NMUA 1SKRB 4XS1A 3IDVA 2HSHA 3DXBA 3GKXA 5ECSA 2FA8A 5EPFA 3DMLA 4TKYA 2LRTA 3ME7A 5CP1A 3RPNA 3ZL5A 3IE3A 4PQ1A 3ZTLA 2JACA 4NWYA 3PINA 4XS4A 1R5PA 3APSA 2TIRA 3H4KA 5FWGA 2CVDA 4KE3A 3APOA 3LJRA 2R4VA 5CRHA 1A0FA 1ERTA 2KP2A 3GRXA 4PUFC 4MPGA 2L6CA 2CVKA 3W6GA 3SWLA 2K8VA 1PGTA 3ERFA 3QMXA 3LSZA 2GDRA 2O85A 3ZVJD 5IPHA 4V2NA 5ECPB 1GTUA 3TJKA 2F8FA 2WRTA 3RPPA 2N5BA 2IMDA 3P8WA 3I43A 4ZL7A 1B8XA 5B8BA 1B4PA 2MBTA 2I81A 3GSTA 2H71A 3TUEA 1GWCA 2OBIA 1V9WA 4MJBA 2V6KA 2HXKA 4HZ2A 1I5GA 5D73A 3IC4A 2CX4A 3ZVJA 1T7PB 4MMMA 4Z7XA 2LJRA 4RUVA 1BX9A 1NHYA 3KZQA 1EOHA 1GH2A 2TRXA 1SJ6A 1KNGA 5IMFA 2YZUA 4ZIJA
chains in the Genus database with same CATH superfamily
4XRDA 1EV4A 3TKRA 4QQ7A 2V2GA 5LD0A 2VLTA 2HT9A 4BVXA 1GLPA 1T4ZA 3CSJA 4OO4A 5J5NA 1J9BA 2DSAA 1OKDA 3L9VA 1EEJA 2HLSA 3MIXA 2ES7A 1BEDA 5HR1A 5ABRA 2C0GA 5C04A 2GLRA 4EDZA 3PPUA 4YQVA 1A0RP 5DCHA 5DALB 1ERVA 3IRAA 3FR6A 4IKHA 2JZRA 4MJAA 2DKHA 4DSSA 1X9SB 3FKFA 1GUMA 4RQXA 2H0IA 2FD3A 3HJMA 1XWAA 1GSYA 2L5OA 5EL8A 2R6KA 1AQVA 4O7HA 4JRRA 2OJLA 3VI5A 1V40A 4K0NA 4TXOB 4IGJA 1DE1A 1DUGA 3IK9A 4WR4A 4HQSA 5CNWA 2HRNA 3C71A 2K9FA 2IWTA 3UVTA 3G7JA 1JZRA 5IO2A 3F63A 3KP8A 3M3MA 2XBIA 1FB0A 1DSBA 2FLSA 1MEKA 1NHOA 4KSOA 2RIIA 2VOCA 4N0VA 4JR4A 2H1AA 3GN3A 2J23A 1AXDA 3W8SA 3FR3A 3FR9A 3EWLA 3L9UA 2VM2A 1H4OA 2DJJA 1XXUA 4J56E 3KMNA 3QAWA 1A24A 1K0OA 3TCOA 2FY6A 3OR5A 4ICYA 3VFIA 1OC3A 2C3TA 2GTUA 3RHCA 3LEFA 4MZWA 1FO5A 1FVJA 1M7TA 1K0CA 5C00A 3IC8A 3O3TA 2BMXA 2QA2A 4ZXGA 2WULA 4IQ1A 4Q5RA 1YEXA 2WB9A 1F37A 5IM9A 2LNSA 2B5YA 2X99A 1JZOA 1S3DA 2JL4A 4JEDA 3EYTA 1QUWA 1EV9A 1AAZA 2I4AA 3KIJA 4TVEA 2WJUA 1X5CA 4G0LA 1OE7A 3DGQA 1MTCA 5D9VA 4V1Ag 3EPTA 4HU9A 4XCSA 2V1MA 1M9BA 4K5RA 1UC7A 3LG6A 5G1LA 1BJXA 5HR3A 3F4TA 3TJJA 2GSSA 4CDOA 3UBLA 2V41A 2QKEA 3VLNA 1EP8A 3A5WA 3KD0A 3QPMA 2HE3A 3M0FA 4N30A 2H0HA 4G0KA 3SBCA 3UARA 1J08A 1M2AA 5JWOB 1ZGNA 2XBQA 2KLXA 3KMOA 2FA4A 3EURA 3ZREA 2WS2A 3TJBA 5DALA 2IJYA 2OACA 3HVXA 4WF5A 1K3OA 5IPGA 5AN1A 4KH7A 2CAIA 4TRXA 5KEJA 5B6MA 2VCWA 5ECKB 4MABA 4L8EA 3FZ4A 10GSA 2ZUPA 1T3BA 2M46A 5IOXA 4IN0A 4XRAA 4TXOA 1A8YA 3C8EA 1UN2A 3DVXA 5JCGA 3A3TA 4EF0A 2D2ZA 2RUEA 2LJAA 3GKMA 2O8VB 3HYPA 4HJ2A 2YCDA 3G9BA 1ML6A 5ELAA 2REMA 4MK3A 1RQMA 3FYGA 2I3YA 1ZYQB 1C72A 2GQKA 5A4WA 2H19A 4P3YB 1X9WB 2GSTA 2FCHA 3Q74A 3VI7A 2A4VA 1HNBA 2ALBA 3GNJA 3DD3A 2RUFA 4GWRA 3GTUB 4IS0A 3I6AA 4TR4A 2OADA 4ISDA 2FUG2 5G30A 4ZB6A 2JSZA 1FAAA 6GSXA 2LJKA 1TU8A 4LMWA 2B6MA 2FWEA 2MYGA 3ZMKA 4GSNA 5ECRB 4IJIA 2M72A 3N5OA 3HXSA 3VURA 2B7KA 4PXOA 1WRYA 2AAWA 2NPBA 1AQXA 1AIUA 3NZNA 3L78A 5JCUA 4KDXA 1WWJA 1WE0A 3CTGA 9GSSA 2HSYA 3ED3A 4NHWA 4GCIA 2F8AA 2WDUA 2IMIA 4YKFA 3D22A 4NAXA 1VF3A 4O5QA 1MD3A 4IELA 2B3SA 2DIYA 4MZCA 1A2MA 4N0ZA 5G2ZA 1QK8A 2IPAA 2FWGA 5EY6A 1YEPA 2E0QA 1X0RA 1GSUA 5ECOB 2JZTA 1U3IA 4PTSA 1SKSB 1R26A 2HRKA 1GULA 5CRWA 4MNNA 3VWWA 3ZIJA 3HHVA 5ECLB 2AJQB 4J57E 1OC9B 4BA7A 3TKSA 3ZITA 3BJ5A 3O76A 4GSSA 5KN2A 2DBCA 2PPTA 1K0NA 3F6FA 4FH8A 4ZL9A 1JZDA 5GAPD 2O87A 3IXRA 4KW6A 4XTSA 3H1NA 5JWQB 4ZL8A 2EIQA 4O5RA 1ZZYA 4AJ8A 1PFOA 3ZFBA 1ZOFA 3VPQA 1F9MA 4E8HA 4EVMA 5CREA 6GSTA 1EZKA 5HFKA 3BBYA 1HNAA 4WF4A 5LCZA 2MMOA 4EXJA 1WJKA 4WBRD 1AC1A 2YWIA 4GLTA 2X4AA 1PX7A 4ECCA 1A23A 2K8SA 1WP0A 3IAS2 2A4HA 13GSA 19GSA 1RK4A 1SYRA 1AUCA 1HYUA 2BTOT 4PNFA 2YV9A 20GSA 5GZZB 4KNDA 5IMAA 4ECBA 3PGTA 2LSTA 4HU7A 4OD7A 2ON7A 3J7Yb 2VM1A 4O32A 4V2MA 2DMMA 4MJEA 2DJ3A 2IMEA 4MPFA 2VCVA 4EC0A 1JLVA 5EVOA 2TRCP 1TXXA 4KSMA 3QR6A 2F9SA 4WETA 1NSWA 4D73B 4ML6A 4OO5A 2C4JA 3H8QA 4HDEA 3P7XA 5ECIB 1GRXA 4ZB9A 3DIEA 1HQOA 4K6XA 2YJ7A 3GH9A 3CTFA 3D21A 1RW1A 1Z7RA 1BYEA 1PN9A 3JCML 2MMZA 4POLA 3GV1A 2VCTA 4GQFA 5D8IA 1BAYA 2A2RA 2RM6A 5ENUA 18GSA 3G7IA 2OKAA 1PRXA 4EIQA 4K5SA 2ZCTA 22GSA 4PQIA 4KA0A 4G9HA 5F0GA 2XC2A 3M1GA 4IHUA 4NV5A 2B1LA 1T00A 2OE3A 2Z9SA 3LYKA 1HNCA 3I69A 2HYXA 2WCIA 3QAGA 4TN8A 1TDIA 2LRCA 3KH9A 4HUAA 2YOIA 1FW1A 3C7MA 3GHAA 2KP1A 4L5OA 1XVWA 1GSQA 2LQOA 1GTBA 1XWGA 2O7KA 1OC9A 1XIYA 5COHA 4X43A 6GSYA 4MLYA 3TDGA 3UVHA 1XWBA 2I1UA 2GQLA 1QQ2A 2CQ9A 4MA9A 2KOKA 2DJ2A 2PMTA 4NXIA 4LL1B 3WT2A 2MMNA 3RDWA 1W4VA 2LKUA 4EL1A 2HNLA 3GL5A 5IO0A 2L4QA 2PBJA 1SD8A 1G7EA 2RM5A 2YWMA 1GSDA 2OA7A 1M3IA 3FW2A 2YJHA 5J41A 1EEMA 1O73A 1AQWA 3CXGA 1N2AA 1Z6NA 2HI7A 3IOSA 4KF9A 5D96A 2JADA 4Z2RA 4HZ4A 1BG5A 1G7OA 4K8MA 3MSZA 2AB6A 5AIVA 4YH2A 3D4MA 4F03A 1XZOA 3GYKA 2GVPA 7GSSA 4KX4A 4I5QA 2DLXA 1F6MC 3ERGA 2E7PA 3GH6A 1SKWB 3IHQA 3WT1A 2IIYA 4K1FA 2C0EA 2WGRA 2EC4A 1W89A 3BCKA 4PNGA 1BQ7A 5DQSA 4OFNA 4MDCA 3FEUA 4MF5A 5AIXA 8GSSA 4JR6A 4L5LA 4I6XA 1EGOA 4HS1A 1JHBA 3D0ZA 2VCZA 2IMKA 2GT5A 4XHMA 3GUSA 5ELGA 5IMVA 5ECMB 2WZ9A 1T1VA 4YAPA 1SL0B 3TKSC 5HR0A 5H5RA 2AV4A 4GSTA 4BWSA 4D73A 1TRUA 2VD1A 3U6VA 5ID2B 11GSA 5HR2A 3KTLA 2YNXA 2C80A 2H74A 1F2EA 1ZYNA 3QAVA 1TI1A 1ZCPA 4Q5NA 1FHEA 4USSA 6GSUA 3VWXA 3I9V2 4ACSA 1PN0A 3QFAC 3QFBC 3BD2A 2CX3A 3EMPA 14GSA 1U87A 3LGCA 3TOTA 3TRPA 5CRDA 4K2DA 4O92A 4WXTA 4MCUA 1T8EB 3US3A 3D5JA 2CZ3A 1K0MA 3H93A 3LQ7A 4A5PA 5KOWA 3RAZA 5CRGA 3Q18A 2LQQA 5CO3A 3A2WA 4FYBA 4IQAA 5IOWA 4XIHA 4AGSA 1XOBA 3ISOA 4QL7A 4F2IA 2R0CA 3QD9A 1TP9A 5CAXA 3F3QA 4ID0A 16GSA 4MP4A 3NIVA 2GZZA 4I8BA 1ON4A 3CSHA 3EE2A 2CV4A 4KDUA 3DRNA 2AUVA 4Q5FA 4X1UA 4TOPA 3TRQA 3ZMLA 5KN3A 1M2BA 1QMVA 4WKWA 5IIZA 4ULXA 3HA9A 3FY7A 2YANA 1GL8A 2VUPA 4KDYA 4EKZA 3FMWA 3GMFA 2H0GA 1FVKA 2YP6A 1WPIA 2RLIA 2YN1A 1EP7A 4J2FA 4YQMA 2C0FA 3LFLA 4WBJA 2CZ2A 2GZYA 1NM3A 1F3AA 3CYNA 3LXZA 1A2JA 2E2GA 4GQCA 4ML1A 4NHZA 4YAVA 1XW6A 2PN8A 2N5FA 1TRWA 1YF0A 2VL3A 4GF0A 5B8AA 2H73A 2GSQA 1ACVA 5DCGA 3A5IA 4RQRA 5ECQB 1XCCA 3HVNA 2MBSA 1WIKA 2IFQB 1GSFA 3UEMA 2CVBA 4HSCX 5IQYA 4L0UA 2LRNA 5A5KA 4KB3A 4EO3A 2KUCA 4G2EA 2LUSA 1PL1A 2R3XA 1XOAA 2P31A 1G6WA 1QXHA 2M80A 5AGYA 3M9JA 4OCFA 1SU9A 1XG8A 1K3LA 2G0FA 1OVNA 3GSSA 2H8LA 5ID2A 5HFGA 4AJ6A 3DEXA 1TJDA 1GLQA 2P0GA 4X0XA 3HVSA 1SJIA 1H75A 1URMA 2FWHA 2R2JA 1M3JA 3H79A 3HDCA 1YY7A 1Z9HA 3O6TA 1XW5A 4LLRA 1JZWA 2VO4A 2HZEB 3EINA 1PX6A 3MYDA 3HVVA 3MDKA 2L6DA 3C1SA 2H72A 1SL2B 17GSA 3S9FA 4O5UA 3HZ8A 1Q4JA 3GL3A 1G0TA 1VRSD 2C0DA 2JZSA 3F4RA 4MJCA 5F07A 4FQUA 3UJ1A 1O85A 5KN1A 3F4SA 1O7UA 4K9ZA 2H1GA 4PGTA 1XW9A 1TI3A 5F8BA 1Z3EA 4MH3A 2P5RA 4KGIA 3MWHA 2QA1A 6GSSA 2PVOC 5ECNB 5H5QA 3GURA 2HFDA 2L4CA 2DJ0A 1TW9A 2CT6A 1EGRA 3HY2A 1B9XC 3WYWA 4GXZA 2LV3A 1PSQA 1U3AA 5DJLA 1U6TA 2VLVA 3V1WA 1OKTA 3GA4A 3P90A 3DVWA 3FZ5A 2GQMA 1B4QA 1EOGA 4BVYB 1PL2A 2DKIA 12GSA 2H76A 4Z2TA 3W8JA 1KEBA 4EUYA 3ZYWA 2QGVA 1LBKA 2H70A 1GTAA 1WOUA 2DC5A 4V2LA 5J4UA 4AF2A 3K8NA 1MDKA 2PWJA 1VF4A 1M0UA 2H1BA 5D9WA 4KUNA 1SJZA 3KEBA 1GTIA 4KCEA 4BIKA 1A8LA 1YQ1A 4CHSA 1OAZA 3Q19A 5G5EA 4PURA 1TKDB 5JWRB 1SK0A 3F9UA 1ERWA 1K3YA 1O8WA 2QSIA 3DKSA 3Q6OA 3FHKA 3TOUA 3KCMA 2FHEA 3RBTA 3IV4A 3L9SA 2C3NA 2H30A 4IJ3A 2DIZA 2IFQA 1ZYEA 3U5RE 4DEJA 3FZAA 1PKWA 1XBSA 2NDOA 1AW9A 4OMVA 4ECIA 1LU4A 3HKRA 3D6IA 3GTUA 1Z5YE 1S3CA 3R3EA 5DAKB 1QFNA 1B48A 5A4UA 3NOFA 1UA5A 1MD4A 1XVQA 2YZHA 2LS5A 2NBSA 2GSRA 3CRTA 2KHPA 4K7IA 4IVFA 1Q98A 1GSEA 2IL3A 3M9KA 2VD0A 1TRSA 5GSTA 2LNTA 4POBA 4G10A 3HJPA 5HFIA 2VAFA 3HCZA 2UZ8A 3J7Yk 2F3MA 3C73A 5DJMA 4HJMA 4I97A 2HZEA 3TRXA 1JLWA 1NW2A 3GKKA 5DDLA 3ZIVA 3VPTA 2R37A 3ZRDA 4MF7A 2CA8A 4POKA 1ZMAA 4ZBDA 2X8HA 2DJ1A 3HJOA 3EVIA 1CQGA 3L0HA 3R2QA 3TKSE 3F0IA 5D93A 2VL2C 4N11A 2N5AA 4TXVA 3IR4A 4TR3A 1O8XA 3MNGA 2J9HA 2P5QA 4L0WA 1KBNA 2DMLA 4H86A 1LJRA 2FGXA 5G1KA 4JZQA 3TJGA 1B9YC 1PMTA 2V6OA 1FOHA 2HRFA 2YV7A 5F05A 4GTUA 5DBQA 3VWVA 1YKCA 1TRVA 2PERA 6GSVA 4V1Ap 4WEYA 4CY6A 1V2AA 1FB6A 1YKAA 4K7NA 5CYYA 1F3BA 2VCXA 5FT3A 4BVYA 4LA1A 4FO5A 3GIXA 2IMFA 1V58A 1X5DA 2EIRA 3BOAA 4K2XA 3EMXA 2BJXA 2F51A 1GUKA 1V57A 1O81A 1CQHA 1PQNA 2HZFA 1THOA 3QOUA 4DVCA 3UBKA 2X8GA 4Z2UA 3CSIA 1OE8A 3GKNA 5ECHB 3WGEA 2DJKA 1IYHA 3E3EA 5IMCA 1TK8B 1GUHA 2JU5A 3E9JB 4MH2A 3KP9A 3FZ9A 1E6BA 1TK5B 2K18A 4PUAA 1O6JA 4EE0A 1K0AA 2R0GA 1IYIA 2JSYA 5B6NA 5BRTA 4FYUA 2H6XA 4BPYA 3LORA 1YDKA 4I2UA 5G5FA 2R5GA 1GSSA 2H66A 3APQA 1M2DA 3IK7A 2NVLA 3UOMA 3KM6A 5DAKA 3A2XA 5L71A 1GNWA 3DWVA 4ILFA 4KCAA 1FOVA 2C3QA 2L57A 4K7OA 2V32A 2XPEA 4IP6A 1USBA 3HD5A 2G2QA 2VLUA 2GT6A 5JCWA 2IN3A 1SK1A 2L5LA 1ILOA 1OC8A 4ZILA 2YPMA 3DYRA 2R0PA 3ERWA 4ZBBA 3QDNA 1XFLA 3UAPA 3UMAA 4JE1A 4FIWA 4WR5A 3KJYA 1Z6MA 4JU5A 5E59A 2GZPA 5B7CA 5LNKe 2CAQA 3CRUA 1JFUA 1UVZA 3UIWA 1VF2A 3WD6A 4F9ZA 4ZB8A 2XHFA 3LWAA 2MMAA 5BMUA 3D4TA 2VIMA 5HQPA 2H6YA 1K0DA 3TKQA 2LTKA 1I9DA 3CBUA 4G19A 3PR8A 2C1YA 4F82A 5F06A 1A2LA 2B1KA 2GGTA 2H6ZA 4IP1A 1DE2A 3KGKA 3P2AA 2LEGA 3BCIA 3LW9A 1SD9A 1Z7PA 2VCQA 3IAM2 4IBPA 1M9AA 1QGVA 3F6DA 4EIPA 5AISA 1M99A 5GSSA 3F8UA 1VGLA 4OCEA 2B5XA 4TW5A 1ERUA 4I2TA 5J9CA 2GS3A 2YWOA 3AY8A 6GSWA 3PH9A 4MF6A 3WGXA 5INYA 3C1RA 1PD21 4X4JA 4BL7B 3IPZA 2QC7A 1MDJA 2OE1A 3EC3A 1PA3A 4ZBAA 5KOXA 4PQHA 1WMJA 4FYCA 3IA1A 3G7YA 4TR1B 4NV2A 2PVQA 3TJFA 3VWUA 1TTZA 1ZYPA 1U88A 3ZZXA 1K0BA 2ZNMA 1YJ6A 5E4WA 4HOJA 3GX8A 4NPBA 3MAKA 3ME8A 2YWNA 2EIOA 4MZBA 1SENA 1KTEA 4DSRA 1ST9A 1ZL9A 3TKPA 3KXOA 4GRFA 3CMIA 1XPVA 1PKZA 2K6VA 5J3RA 2ON5A 5D9TA 4BWQA 4HQZA 2VL2A 4IW9A 1N8JA 3L4NA 2L59A 2VL9A 1J0FA 4XS4B 3KH7A 4CW9A 1SL1B 1T4YA 2FWFA 3IHGA 3WGDA 4POMA 3GFKA 5A4VA 3FRCA 3IBHA 3E0UA 4TR0A 1S3RA 4JBBA 2OBKA 4AJ7A 3EU3A 3RHBA 2E2MA 4RI7A 4E8EA 4Q5QA 3LYPA 1X9MB 2OE0A 2PU9C 1R5AA 1XWCA 4LL4B 3HZ4A 1OYJA 3TB2A 2MZCA 2H1DA 5J9BA 1R4WA 3N9JA 2B7JA 2A2SA 1Y25A 1R7HA 2O89A 2WFCA 3TGZA 4HI7A 1HD2A 4QL9A 2PGTA 3ZLPA 3VK9A 1G6YA 1YF1A 3QCPA 4EDYA 3M8NA 2H75A 1ABAA 2AHEA 5IMDA 2PUKC 4OWYA 3LXTA 4OFMA 4K0GA 3A2VA 5IMZA 2A2PA 5GAND 4F0CA 1GNEA 5D9XA 1V98A 5FHIA 4XS6A 1S3AA 5H5SA 4LMVA 1E2YA 4HEA2 3KTBA 3UL3A 4BVXB 5DQYA 2AYTA 1EWXA 4YQUA 1MDIA 2H01A 2I9HA 4ECJA 1TK0B 4F0BA 3GX0A 4PX1A 3ZFLA 2X64A 1FG4A 4KAEA 2B5EA 3FK8A 1VF1A 5G31A 4BL7A 5KN0A 1SYXA 1TU7A 1XWKA 1Y6EA 3F3RA 1SK2A 4DSSB 2FNOA 1GP1A 5DVBA 4TR1A 4RI6A 4N10A 1THXA 4DSQA 1TOFA 1DBYA 1YZXA 1X5EA 3EU4A 4OFTA 2NTOA 2XPDA 2C8UA 2X8CA 4NMUA 1SKRB 2X49A 4XS1A 3IDVA 2HSHA 3DXBA 3GKXA 5ECSA 2FA8A 5EPFA 3DMLA 4TKYA 2LRTA 3ME7A 5CP1A 3RPNA 3ZL5A 3IE3A 4PQ1A 4CY8A 3ZTLA 2JACA 4NWYA 3PINA 4XS4A 4G0IA 3CQFA 1R5PA 3APSA 2TIRA 3H4KA 5FWGA 2CVDA 4KE3A 3APOA 3LJRA 2R4VA 5CRHA 1A0FA 1ERTA 2KP2A 3GRXA 4PUFC 4MPGA 2L6CA 2CVKA 3W6GA 3SWLA 2K8VA 1PGTA 3ERFA 3QMXA 3LSZA 2GDRA 2O85A 3ZVJD 2HSMA 5IPHA 4V2NA 2HRAA 5ECPB 1GTUA 3TJKA 2F8FA 2WRTA 3RPPA 2N5BA 2IMDA 3P8WA 3I43A 4ZL7A 1B8XA 5B8BA 1B4PA 2MBTA 2I81A 3GSTA 2H71A 3TUEA 1GWCA 2OBIA 1V9WA 4MJBA 2V6KA 2HXKA 4HZ2A 1I5GA 5D73A 3IC4A 2CX4A 3ZVJA 1T7PB 4MMMA 4Z7XA 2LJRA 4RUVA 1BX9A 1NHYA 3KZQA 1EOHA 4YKGA 1GH2A 2TRXA 1SJ6A 1KNGA 5IMFA 2YZUA 4ZIJA
chains in the Genus database with same CATH topology
4XRDA 1EV4A 3TKRA 4QQ7A 2V2GA 5LD0A 2VLTA 2HT9A 4BVXA 1GLPA 1T4ZA 3CSJA 4OO4A 5J5NA 1J9BA 2DSAA 1OKDA 3L9VA 1EEJA 2HLSA 3MIXA 2ES7A 1BEDA 5HR1A 5ABRA 2C0GA 5C04A 2GLRA 4EDZA 3PPUA 4YQVA 1A0RP 5DCHA 5DALB 1ERVA 3IRAA 3FR6A 4IKHA 2JZRA 4MJAA 2DKHA 4DSSA 1X9SB 3FKFA 1GUMA 4RQXA 2H0IA 2FD3A 3HJMA 1XWAA 1GSYA 2L5OA 5EL8A 2R6KA 1AQVA 4O7HA 4JRRA 2OJLA 3VI5A 1V40A 4K0NA 4TXOB 4IGJA 1DE1A 1DUGA 3IK9A 4WR4A 4HQSA 5CNWA 2HRNA 3C71A 2K9FA 2IWTA 3UVTA 3G7JA 1JZRA 5IO2A 3F63A 3KP8A 3M3MA 2XBIA 1FB0A 1DSBA 2FLSA 1MEKA 1NHOA 4KSOA 2RIIA 2VOCA 4N0VA 4JR4A 2H1AA 3GN3A 2J23A 1AXDA 3W8SA 3FR3A 3FR9A 3EWLA 3L9UA 2VM2A 1H4OA 2DJJA 1XXUA 4J56E 3KMNA 3QAWA 1A24A 1K0OA 3TCOA 2FY6A 3OR5A 4ICYA 3VFIA 1OC3A 2C3TA 2GTUA 3RHCA 3LEFA 4MZWA 1FO5A 1FVJA 1M7TA 1K0CA 5C00A 3IC8A 3O3TA 2BMXA 2QA2A 4ZXGA 2WULA 4IQ1A 4Q5RA 1YEXA 2WB9A 1F37A 5IM9A 2LNSA 2B5YA 2X99A 1JZOA 1S3DA 2JL4A 4JEDA 3EYTA 1QUWA 1EV9A 1AAZA 2I4AA 3KIJA 4TVEA 2WJUA 1X5CA 4G0LA 1OE7A 3DGQA 1MTCA 5D9VA 4V1Ag 3EPTA 4HU9A 4XCSA 2V1MA 1M9BA 4K5RA 1UC7A 3LG6A 5G1LA 1BJXA 5HR3A 3F4TA 3TJJA 2GSSA 4CDOA 3UBLA 2V41A 2QKEA 3VLNA 1EP8A 3A5WA 3KD0A 3QPMA 2HE3A 3M0FA 4N30A 2H0HA 4G0KA 3SBCA 3UARA 1J08A 1M2AA 5JWOB 1ZGNA 2XBQA 2KLXA 3KMOA 2FA4A 3EURA 3ZREA 2WS2A 3TJBA 5DALA 2IJYA 2OACA 3HVXA 4WF5A 1K3OA 5IPGA 5AN1A 4KH7A 2CAIA 4TRXA 5KEJA 5B6MA 2VCWA 5ECKB 4MABA 4L8EA 3FZ4A 10GSA 2ZUPA 1T3BA 2M46A 5IOXA 4IN0A 4XRAA 4TXOA 1A8YA 3C8EA 1UN2A 3DVXA 5JCGA 3A3TA 4EF0A 2D2ZA 2RUEA 2LJAA 3GKMA 2O8VB 3HYPA 4HJ2A 2YCDA 3G9BA 1ML6A 5ELAA 2REMA 4MK3A 1RQMA 3FYGA 2I3YA 1ZYQB 1C72A 2GQKA 5A4WA 2H19A 4P3YB 1X9WB 2GSTA 2FCHA 3Q74A 3VI7A 2A4VA 1HNBA 2ALBA 3GNJA 3DD3A 2RUFA 4GWRA 3GTUB 4IS0A 3I6AA 4TR4A 2OADA 4ISDA 2FUG2 5G30A 4ZB6A 2JSZA 1FAAA 6GSXA 2LJKA 1TU8A 4LMWA 2B6MA 2FWEA 2MYGA 3ZMKA 4GSNA 5ECRB 4IJIA 2M72A 3N5OA 3HXSA 3VURA 2B7KA 4PXOA 1WRYA 2AAWA 2NPBA 1AQXA 1AIUA 3NZNA 3L78A 5JCUA 4KDXA 1WWJA 1WE0A 3CTGA 9GSSA 2HSYA 3ED3A 4NHWA 4GCIA 2F8AA 2WDUA 2IMIA 4YKFA 3D22A 4NAXA 1VF3A 4O5QA 1MD3A 4IELA 2B3SA 2DIYA 4MZCA 1A2MA 4N0ZA 5G2ZA 1QK8A 2IPAA 2FWGA 5EY6A 1YEPA 2E0QA 1X0RA 1GSUA 5ECOB 2JZTA 1U3IA 4PTSA 1SKSB 1R26A 2HRKA 1GULA 5CRWA 4MNNA 3VWWA 3ZIJA 3HHVA 5ECLB 2AJQB 4J57E 1OC9B 4BA7A 3TKSA 3ZITA 3BJ5A 3O76A 4GSSA 5KN2A 2DBCA 2PPTA 1K0NA 3F6FA 4FH8A 4ZL9A 1JZDA 5GAPD 2O87A 3IXRA 4KW6A 4XTSA 3H1NA 5JWQB 4ZL8A 2EIQA 4O5RA 1ZZYA 4AJ8A 3ZFBA 1ZOFA 3VPQA 1F9MA 4E8HA 4EVMA 5CREA 6GSTA 1EZKA 5HFKA 3BBYA 1HNAA 4WF4A 5LCZA 2MMOA 4EXJA 1WJKA 4WBRD 1AC1A 2YWIA 4GLTA 2X4AA 1PX7A 4ECCA 1A23A 2K8SA 1WP0A 3IAS2 2A4HA 13GSA 19GSA 1RK4A 1SYRA 1AUCA 1HYUA 2BTOT 4PNFA 2YV9A 20GSA 5GZZB 4KNDA 5IMAA 4ECBA 3PGTA 2LSTA 4HU7A 4OD7A 2ON7A 3J7Yb 2VM1A 4O32A 4V2MA 2DMMA 4MJEA 2DJ3A 2IMEA 4MPFA 2VCVA 4EC0A 1JLVA 5EVOA 2TRCP 1TXXA 4KSMA 3QR6A 2F9SA 4WETA 1NSWA 4D73B 4ML6A 4OO5A 2C4JA 3H8QA 4HDEA 3P7XA 5ECIB 1GRXA 4ZB9A 3DIEA 1HQOA 4K6XA 2YJ7A 3GH9A 3CTFA 3D21A 1RW1A 1Z7RA 1BYEA 1PN9A 3JCML 2MMZA 4POLA 3GV1A 2VCTA 4GQFA 5D8IA 1BAYA 2A2RA 2RM6A 5ENUA 18GSA 3G7IA 2OKAA 1PRXA 4EIQA 4K5SA 2ZCTA 22GSA 4PQIA 4KA0A 4G9HA 5F0GA 2XC2A 3M1GA 4IHUA 4NV5A 2B1LA 1T00A 2OE3A 2Z9SA 3LYKA 1HNCA 3I69A 2HYXA 2WCIA 3QAGA 4TN8A 1TDIA 2LRCA 3KH9A 4HUAA 2YOIA 1FW1A 3C7MA 3GHAA 2KP1A 4L5OA 1XVWA 1GSQA 2LQOA 1GTBA 1XWGA 2O7KA 1OC9A 1XIYA 5COHA 4X43A 6GSYA 4MLYA 3TDGA 3UVHA 1XWBA 2I1UA 2GQLA 1QQ2A 2CQ9A 4MA9A 2KOKA 2DJ2A 2PMTA 4NXIA 4LL1B 3WT2A 2MMNA 3RDWA 1W4VA 2LKUA 4EL1A 2HNLA 3GL5A 5IO0A 2L4QA 2PBJA 1SD8A 1G7EA 2RM5A 2YWMA 1GSDA 2OA7A 3FW2A 2YJHA 5J41A 1EEMA 1O73A 1AQWA 3CXGA 1N2AA 5D96A 1Z6NA 2HI7A 3IOSA 4KF9A 2JADA 4Z2RA 4HZ4A 1BG5A 1G7OA 4K8MA 3MSZA 2AB6A 5AIVA 4YH2A 3D4MA 4F03A 1XZOA 3GYKA 2GVPA 7GSSA 4KX4A 4I5QA 2DLXA 1F6MC 3ERGA 2E7PA 3GH6A 1SKWB 3IHQA 3WT1A 2IIYA 4K1FA 2C0EA 2WGRA 2EC4A 1W89A 3BCKA 4PNGA 1BQ7A 5DQSA 4OFNA 4MDCA 3FEUA 4MF5A 5AIXA 8GSSA 4JR6A 4L5LA 4I6XA 1EGOA 4HS1A 1JHBA 3D0ZA 2VCZA 2IMKA 2GT5A 4XHMA 3GUSA 5ELGA 5IMVA 5ECMB 2WZ9A 1T1VA 4YAPA 1SL0B 3TKSC 5HR0A 5H5RA 2AV4A 4GSTA 4BWSA 4D73A 1TRUA 2VD1A 3U6VA 5ID2B 11GSA 5HR2A 3KTLA 2YNXA 2C80A 2H74A 1F2EA 1ZYNA 3QAVA 1TI1A 1ZCPA 4Q5NA 1FHEA 4USSA 6GSUA 3VWXA 3I9V2 4ACSA 1PN0A 3QFAC 3QFBC 3BD2A 2CX3A 3EMPA 14GSA 1U87A 3LGCA 3TOTA 3TRPA 5CRDA 4K2DA 4O92A 4WXTA 4MCUA 1T8EB 3US3A 3D5JA 2CZ3A 1K0MA 3H93A 3LQ7A 4A5PA 5KOWA 3RAZA 5CRGA 3Q18A 2LQQA 5CO3A 3A2WA 4FYBA 4IQAA 5IOWA 4XIHA 4AGSA 1XOBA 3ISOA 4QL7A 4F2IA 2R0CA 3QD9A 1TP9A 5CAXA 3F3QA 4ID0A 16GSA 4MP4A 3NIVA 2GZZA 4I8BA 1ON4A 3CSHA 3EE2A 2CV4A 4KDUA 3DRNA 2AUVA 4Q5FA 4X1UA 4TOPA 3TRQA 3ZMLA 5KN3A 1M2BA 1QMVA 4WKWA 5IIZA 4ULXA 3HA9A 3FY7A 2YANA 1GL8A 2VUPA 4KDYA 4EKZA 3FMWA 3GMFA 2H0GA 1FVKA 2YP6A 1WPIA 2RLIA 2YN1A 1EP7A 4J2FA 4YQMA 2C0FA 3LFLA 4WBJA 2CZ2A 2GZYA 1NM3A 1F3AA 3CYNA 3LXZA 1A2JA 2E2GA 4GQCA 4ML1A 4NHZA 4YAVA 1XW6A 2PN8A 2N5FA 1TRWA 1YF0A 2VL3A 4GF0A 5B8AA 2H73A 2GSQA 1ACVA 5DCGA 3A5IA 4RQRA 5ECQB 1XCCA 2MBSA 1WIKA 2IFQB 1GSFA 3UEMA 2CVBA 5IQYA 4L0UA 2LRNA 5A5KA 4KB3A 4EO3A 2KUCA 4G2EA 2LUSA 1PL1A 2R3XA 1XOAA 2P31A 1G6WA 1QXHA 2M80A 5AGYA 3M9JA 4OCFA 1SU9A 1K3LA 2G0FA 1OVNA 3GSSA 2H8LA 5ID2A 5HFGA 4AJ6A 3DEXA 1TJDA 1GLQA 2P0GA 4X0XA 3HVSA 1SJIA 1H75A 1URMA 2FWHA 2R2JA 3H79A 3HDCA 1YY7A 1Z9HA 3O6TA 1XW5A 4LLRA 1JZWA 2VO4A 2HZEB 3EINA 1PX6A 3MYDA 3HVVA 3MDKA 2L6DA 3C1SA 2H72A 1SL2B 17GSA 3S9FA 4O5UA 3HZ8A 1Q4JA 3GL3A 1G0TA 1VRSD 2C0DA 2JZSA 3F4RA 4MJCA 5F07A 4FQUA 3UJ1A 1O85A 5KN1A 3F4SA 1O7UA 4K9ZA 2H1GA 4PGTA 1XW9A 1TI3A 5F8BA 1Z3EA 4MH3A 2P5RA 4KGIA 3MWHA 2QA1A 6GSSA 2PVOC 5ECNB 5H5QA 3GURA 2HFDA 2L4CA 2DJ0A 1TW9A 2CT6A 1EGRA 3HY2A 1B9XC 3WYWA 4GXZA 2LV3A 1PSQA 1U3AA 5DJLA 1U6TA 2VLVA 3V1WA 1OKTA 3GA4A 3P90A 3DVWA 3FZ5A 2GQMA 1B4QA 1EOGA 4BVYB 1PL2A 2DKIA 12GSA 2H76A 4Z2TA 3W8JA 1KEBA 4EUYA 3ZYWA 2QGVA 1LBKA 2H70A 1GTAA 1WOUA 2DC5A 4V2LA 5J4UA 4AF2A 3K8NA 1MDKA 2PWJA 1VF4A 1M0UA 2H1BA 5D9WA 4KUNA 1SJZA 3KEBA 1GTIA 4KCEA 1A8LA 1YQ1A 4CHSA 1OAZA 3Q19A 5G5EA 4PURA 1TKDB 5JWRB 1SK0A 3F9UA 1ERWA 1K3YA 1O8WA 2QSIA 3DKSA 3Q6OA 3FHKA 3TOUA 3KCMA 2FHEA 3RBTA 3IV4A 3L9SA 2C3NA 2H30A 4IJ3A 2DIZA 2IFQA 1ZYEA 3U5RE 4DEJA 3FZAA 1PKWA 1XBSA 2NDOA 1AW9A 4OMVA 4ECIA 1LU4A 3HKRA 3D6IA 3GTUA 1Z5YE 1S3CA 3R3EA 5DAKB 1QFNA 1B48A 5A4UA 3NOFA 1UA5A 1MD4A 1XVQA 2YZHA 2LS5A 2NBSA 2GSRA 3CRTA 2KHPA 4K7IA 4IVFA 1Q98A 1GSEA 2IL3A 3M9KA 2VD0A 1TRSA 5GSTA 2LNTA 4POBA 4G10A 3HJPA 5HFIA 2VAFA 3HCZA 2UZ8A 3J7Yk 2F3MA 3C73A 5DJMA 4HJMA 4I97A 2HZEA 3TRXA 1JLWA 1NW2A 3GKKA 5DDLA 3ZIVA 3VPTA 2R37A 3ZRDA 4MF7A 2CA8A 4POKA 1ZMAA 4ZBDA 2X8HA 2DJ1A 3HJOA 3EVIA 1CQGA 3L0HA 3R2QA 3TKSE 3F0IA 5D93A 2VL2C 4N11A 2N5AA 4TXVA 3IR4A 4TR3A 1O8XA 3MNGA 2J9HA 2P5QA 4L0WA 1KBNA 2DMLA 4H86A 1LJRA 2FGXA 5G1KA 4JZQA 3TJGA 1B9YC 1PMTA 2V6OA 1FOHA 2HRFA 2YV7A 5F05A 4GTUA 5DBQA 3VWVA 1YKCA 1TRVA 2PERA 6GSVA 4V1Ap 4WEYA 4CY6A 1V2AA 1FB6A 1YKAA 4K7NA 5CYYA 1F3BA 2VCXA 5FT3A 4BVYA 4LA1A 4FO5A 3GIXA 2IMFA 1V58A 1X5DA 2EIRA 3BOAA 4K2XA 3EMXA 2BJXA 2F51A 1GUKA 1V57A 1O81A 1CQHA 1PQNA 2HZFA 1THOA 3QOUA 4DVCA 3UBKA 2X8GA 4Z2UA 3CSIA 1OE8A 3GKNA 5ECHB 3WGEA 2DJKA 1IYHA 3E3EA 5IMCA 1TK8B 1GUHA 2JU5A 3E9JB 4MH2A 3KP9A 3FZ9A 1E6BA 1TK5B 2K18A 4PUAA 1O6JA 4EE0A 1K0AA 2R0GA 1IYIA 2JSYA 5B6NA 5BRTA 4FYUA 2H6XA 4BPYA 3LORA 1YDKA 4I2UA 5G5FA 2R5GA 1GSSA 2H66A 3APQA 1M2DA 3IK7A 2NVLA 3UOMA 3KM6A 5DAKA 3A2XA 5L71A 1GNWA 3DWVA 4ILFA 4KCAA 1FOVA 2C3QA 2L57A 4K7OA 2V32A 2XPEA 4IP6A 1USBA 3HD5A 2G2QA 2VLUA 2GT6A 5JCWA 2IN3A 1SK1A 2L5LA 1ILOA 1OC8A 4ZILA 2YPMA 3DYRA 2R0PA 3ERWA 4ZBBA 3QDNA 1XFLA 3UAPA 3UMAA 4JE1A 4FIWA 4WR5A 3KJYA 1Z6MA 4JU5A 5E59A 2GZPA 5B7CA 5LNKe 2CAQA 3CRUA 1JFUA 1UVZA 3UIWA 1VF2A 3WD6A 4F9ZA 4ZB8A 2XHFA 3LWAA 2MMAA 5BMUA 3D4TA 2VIMA 5HQPA 2H6YA 1K0DA 3TKQA 2LTKA 1I9DA 3CBUA 4G19A 3PR8A 2C1YA 4F82A 5F06A 1A2LA 2B1KA 2GGTA 2H6ZA 4IP1A 1DE2A 3KGKA 3P2AA 2LEGA 3BCIA 3LW9A 1SD9A 1Z7PA 2VCQA 3IAM2 4IBPA 1M9AA 1QGVA 3F6DA 4EIPA 5AISA 1M99A 5GSSA 3F8UA 1VGLA 4OCEA 2B5XA 4TW5A 1ERUA 4I2TA 5J9CA 2GS3A 2YWOA 3AY8A 6GSWA 3PH9A 4MF6A 3WGXA 5INYA 3C1RA 1PD21 4X4JA 4BL7B 3IPZA 2QC7A 1MDJA 2OE1A 3EC3A 1PA3A 4ZBAA 5KOXA 4PQHA 1WMJA 4FYCA 3IA1A 3G7YA 4TR1B 4NV2A 2PVQA 3TJFA 3VWUA 1TTZA 1ZYPA 1U88A 3ZZXA 1K0BA 2ZNMA 1YJ6A 5E4WA 4HOJA 3GX8A 4NPBA 3MAKA 3ME8A 2YWNA 2EIOA 4MZBA 1SENA 1KTEA 4DSRA 1ST9A 1ZL9A 3TKPA 3KXOA 4GRFA 3CMIA 1XPVA 1PKZA 2K6VA 5J3RA 2ON5A 5D9TA 4BWQA 4HQZA 2VL2A 4IW9A 1N8JA 3L4NA 2L59A 2VL9A 1J0FA 4XS4B 3KH7A 4CW9A 1SL1B 1T4YA 2FWFA 3IHGA 3WGDA 4POMA 3GFKA 5A4VA 3FRCA 3IBHA 3E0UA 4TR0A 4JBBA 2OBKA 4AJ7A 3EU3A 3RHBA 2E2MA 4RI7A 4E8EA 4Q5QA 3LYPA 1X9MB 2OE0A 2PU9C 1R5AA 1XWCA 4LL4B 3HZ4A 1OYJA 3TB2A 2MZCA 2H1DA 5J9BA 1R4WA 3N9JA 2B7JA 2A2SA 1Y25A 1R7HA 2O89A 2WFCA 3TGZA 4HI7A 1HD2A 4QL9A 2PGTA 3ZLPA 3VK9A 1G6YA 1YF1A 3QCPA 4EDYA 3M8NA 2H75A 1ABAA 2AHEA 5IMDA 2PUKC 4OWYA 3LXTA 4OFMA 4K0GA 3A2VA 5IMZA 2A2PA 5GAND 4F0CA 1GNEA 5D9XA 1V98A 5FHIA 4XS6A 1S3AA 5H5SA 4LMVA 1E2YA 4HEA2 3KTBA 3UL3A 4BVXB 5DQYA 2AYTA 1EWXA 4YQUA 1MDIA 2H01A 2I9HA 4ECJA 1TK0B 4F0BA 3GX0A 4PX1A 3ZFLA 2X64A 1FG4A 4KAEA 2B5EA 3FK8A 1VF1A 5G31A 4BL7A 5KN0A 1SYXA 1TU7A 1XWKA 1Y6EA 3F3RA 1SK2A 4DSSB 2FNOA 1GP1A 5DVBA 4TR1A 4RI6A 4N10A 1THXA 4DSQA 1TOFA 1DBYA 1YZXA 1X5EA 3EU4A 4OFTA 2NTOA 2XPDA 2C8UA 2X8CA 4NMUA 1SKRB 2X49A 4XS1A 3IDVA 2HSHA 3DXBA 3GKXA 5ECSA 2FA8A 5EPFA 3DMLA 4TKYA 2LRTA 3ME7A 5CP1A 3RPNA 3ZL5A 3IE3A 4PQ1A 4CY8A 3ZTLA 2JACA 4NWYA 3PINA 4XS4A 4G0IA 1R5PA 3APSA 2TIRA 3H4KA 5FWGA 2CVDA 4KE3A 3APOA 3LJRA 2R4VA 5CRHA 1A0FA 1ERTA 2KP2A 3GRXA 4PUFC 4MPGA 2L6CA 2CVKA 3W6GA 3SWLA 2K8VA 1PGTA 3ERFA 3QMXA 3LSZA 2GDRA 2O85A 3ZVJD 2HSMA 5IPHA 4V2NA 2HRAA 5ECPB 1GTUA 3TJKA 2F8FA 2WRTA 3RPPA 2N5BA 2IMDA 3P8WA 3I43A 4ZL7A 1B8XA 5B8BA 1B4PA 2MBTA 2I81A 3GSTA 2H71A 3TUEA 1GWCA 2OBIA 1V9WA 4MJBA 2V6KA 2HXKA 4HZ2A 1I5GA 5D73A 3IC4A 2CX4A 3ZVJA 1T7PB 4MMMA 4Z7XA 2LJRA 4RUVA 1BX9A 1NHYA 3KZQA 1EOHA 4YKGA 1GH2A 2TRXA 1SJ6A 1KNGA 5IMFA 2YZUA 4ZIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XRD A;  1EV4 A;  3TKR A;  4QQ7 A;  2V2G A;  5LD0 A;  2VLT A;  2HT9 A;  4BVX A;  1GLP A;  1T4Z A;  3CSJ A;  4OO4 A;  5J5N A;  1J9B A;  2DSA A;  1OKD A;  3L9V A;  1EEJ A;  2HLS A;  2ES7 A;  1BED A;  5HR1 A;  5ABR A;  2C0G A;  5C04 A;  2GLR A;  4EDZ A;  4YQV A;  1A0R P;  5DCH A;  5DAL B;  1ERV A;  3IRA A;  3FR6 A;  4IKH A;  2JZR A;  4MJA A;  4DSS A;  1X9S B;  3FKF A;  1GUM A;  4RQX A;  2H0I A;  2FD3 A;  3HJM A;  1XWA A;  1GSY A;  2L5O A;  5EL8 A;  2R6K A;  1AQV A;  4O7H A;  4JRR A;  2OJL A;  3VI5 A;  1V40 A;  4K0N A;  4TXO B;  4IGJ A;  1DE1 A;  1DUG A;  3IK9 A;  4WR4 A;  4HQS A;  5CNW A;  2HRN A;  3C71 A;  2K9F A;  2IWT A;  3UVT A;  3G7J A;  1JZR A;  5IO2 A;  3F63 A;  3KP8 A;  3M3M A;  2XBI A;  1FB0 A;  1DSB A;  2FLS A;  1MEK A;  1NHO A;  4KSO A;  2RII A;  2VOC A;  4N0V A;  4JR4 A;  2H1A A;  3GN3 A;  2J23 A;  1AXD A;  3W8S A;  3FR3 A;  3FR9 A;  3EWL A;  3L9U A;  2VM2 A;  1H4O A;  2DJJ A;  1XXU A;  4J56 E;  3KMN A;  3QAW A;  1A24 A;  1K0O A;  3TCO A;  2FY6 A;  3OR5 A;  3VFI A;  1OC3 A;  2C3T A;  2GTU A;  3RHC A;  3LEF A;  4MZW A;  1FO5 A;  1FVJ A;  1M7T A;  1K0C A;  5C00 A;  3O3T A;  2BMX A;  4ZXG A;  2WUL A;  4IQ1 A;  4Q5R A;  1YEX A;  2WB9 A;  1F37 A;  5IM9 A;  2LNS A;  2B5Y A;  2X99 A;  1JZO A;  1S3D A;  2JL4 A;  4JED A;  3EYT A;  1QUW A;  1EV9 A;  1AAZ A;  2I4A A;  3KIJ A;  4TVE A;  2WJU A;  1X5C A;  1OE7 A;  3DGQ A;  1MTC A;  5D9V A;  4V1A g;  4HU9 A;  4XCS A;  2V1M A;  1M9B A;  1UC7 A;  3LG6 A;  5G1L A;  1BJX A;  5HR3 A;  3F4T A;  3TJJ A;  2GSS A;  4CDO A;  3UBL A;  2V41 A;  2QKE A;  3VLN A;  1EP8 A;  3A5W A;  3KD0 A;  3QPM A;  2HE3 A;  3M0F A;  4N30 A;  2H0H A;  3SBC A;  3UAR A;  1J08 A;  1M2A A;  5JWO B;  1ZGN A;  2XBQ A;  2KLX A;  3KMO A;  2FA4 A;  3EUR A;  3ZRE A;  2WS2 A;  3TJB A;  5DAL A;  2IJY A;  2OAC A;  3HVX A;  4WF5 A;  1K3O A;  5IPG A;  5AN1 A;  4KH7 A;  2CAI A;  4TRX A;  5KEJ A;  5B6M A;  2VCW A;  5ECK B;  4MAB A;  4L8E A;  3FZ4 A;  10GS A;  2ZUP A;  1T3B A;  2M46 A;  5IOX A;  4IN0 A;  4XRA A;  4TXO A;  1A8Y A;  3C8E A;  1UN2 A;  3DVX A;  5JCG A;  3A3T A;  4EF0 A;  2D2Z A;  2RUE A;  2LJA A;  3GKM A;  2O8V B;  3HYP A;  4HJ2 A;  2YCD A;  3G9B A;  1ML6 A;  5ELA A;  2REM A;  4MK3 A;  1RQM A;  3FYG A;  2I3Y A;  1ZYQ B;  1C72 A;  2GQK A;  5A4W A;  2H19 A;  4P3Y B;  1X9W B;  2GST A;  2FCH A;  3Q74 A;  3VI7 A;  2A4V A;  1HNB A;  2ALB A;  3GNJ A;  3DD3 A;  2RUF A;  4GWR A;  3GTU B;  4IS0 A;  3I6A A;  4TR4 A;  2OAD A;  4ISD A;  2FUG 2;  5G30 A;  4ZB6 A;  2JSZ A;  1FAA A;  6GSX A;  2LJK A;  1TU8 A;  4LMW A;  2B6M A;  2FWE A;  2MYG A;  3ZMK A;  4GSN A;  5ECR B;  4IJI A;  2M72 A;  3N5O A;  3HXS A;  3VUR A;  2B7K A;  4PXO A;  1WRY A;  2AAW A;  2NPB A;  1AQX A;  1AIU A;  3NZN A;  3L78 A;  5JCU A;  4KDX A;  1WWJ A;  1WE0 A;  3CTG A;  9GSS A;  2HSY A;  3ED3 A;  4NHW A;  4GCI A;  2F8A A;  2WDU A;  2IMI A;  3D22 A;  4NAX A;  1VF3 A;  1MD3 A;  4IEL A;  2B3S A;  2DIY A;  4MZC A;  1A2M A;  4N0Z A;  5G2Z A;  1QK8 A;  2IPA A;  2FWG A;  5EY6 A;  1YEP A;  2E0Q A;  1X0R A;  1GSU A;  5ECO B;  2JZT A;  1U3I A;  1SKS B;  1R26 A;  1GUL A;  5CRW A;  3VWW A;  3ZIJ A;  3HHV A;  5ECL B;  2AJQ B;  4J57 E;  1OC9 B;  4BA7 A;  3TKS A;  3ZIT A;  3BJ5 A;  3O76 A;  4GSS A;  5KN2 A;  2DBC A;  2PPT A;  1K0N A;  3F6F A;  4FH8 A;  4ZL9 A;  1JZD A;  5GAP D;  2O87 A;  3IXR A;  4KW6 A;  4XTS A;  3H1N A;  5JWQ B;  4ZL8 A;  2EIQ A;  4O5R A;  1ZZY A;  4AJ8 A;  3ZFB A;  1ZOF A;  3VPQ A;  1F9M A;  4E8H A;  4EVM A;  5CRE A;  6GST A;  1EZK A;  5HFK A;  3BBY A;  1HNA A;  4WF4 A;  5LCZ A;  2MMO A;  4EXJ A;  1WJK A;  4WBR D;  1AC1 A;  2YWI A;  4GLT A;  1PX7 A;  4ECC A;  1A23 A;  2K8S A;  1WP0 A;  3IAS 2;  13GS A;  19GS A;  1RK4 A;  1SYR A;  1AUC A;  1HYU A;  2BTO T;  4PNF A;  2YV9 A;  20GS A;  5GZZ B;  4KND A;  5IMA A;  4ECB A;  3PGT A;  2LST A;  4HU7 A;  4OD7 A;  2ON7 A;  3J7Y b;  2VM1 A;  4O32 A;  4V2M A;  2DMM A;  4MJE A;  2DJ3 A;  2IME A;  4MPF A;  2VCV A;  4EC0 A;  1JLV A;  5EVO A;  2TRC P;  1TXX A;  4KSM A;  3QR6 A;  2F9S A;  4WET A;  1NSW A;  4D73 B;  4ML6 A;  4OO5 A;  2C4J A;  3H8Q A;  4HDE A;  3P7X A;  5ECI B;  1GRX A;  4ZB9 A;  3DIE A;  1HQO A;  4K6X A;  2YJ7 A;  3GH9 A;  3CTF A;  3D21 A;  1RW1 A;  1Z7R A;  1BYE A;  1PN9 A;  3JCM L;  2MMZ A;  4POL A;  3GV1 A;  2VCT A;  4GQF A;  5D8I A;  1BAY A;  2A2R A;  2RM6 A;  5ENU A;  18GS A;  3G7I A;  2OKA A;  1PRX A;  2ZCT A;  22GS A;  4PQI A;  4KA0 A;  4G9H A;  5F0G A;  2XC2 A;  3M1G A;  4IHU A;  4NV5 A;  2B1L A;  1T00 A;  2OE3 A;  2Z9S A;  3LYK A;  1HNC A;  3I69 A;  2HYX A;  2WCI A;  3QAG A;  4TN8 A;  1TDI A;  2LRC A;  3KH9 A;  4HUA A;  2YOI A;  1FW1 A;  3C7M A;  3GHA A;  2KP1 A;  4L5O A;  1XVW A;  1GSQ A;  2LQO A;  1GTB A;  1XWG A;  2O7K A;  1OC9 A;  1XIY A;  5COH A;  4X43 A;  6GSY A;  4MLY A;  3TDG A;  3UVH A;  1XWB A;  2I1U A;  2GQL A;  1QQ2 A;  2CQ9 A;  4MA9 A;  2KOK A;  2DJ2 A;  2PMT A;  4NXI A;  4LL1 B;  3WT2 A;  2MMN A;  3RDW A;  1W4V A;  2LKU A;  4EL1 A;  2HNL A;  3GL5 A;  5IO0 A;  2L4Q A;  2PBJ A;  1SD8 A;  1G7E A;  2RM5 A;  2YWM A;  1GSD A;  2OA7 A;  3FW2 A;  2YJH A;  5J41 A;  1EEM A;  1O73 A;  1AQW A;  3CXG A;  1N2A A;  5D96 A;  1Z6N A;  2HI7 A;  3IOS A;  2JAD A;  4HZ4 A;  1BG5 A;  1G7O A;  4K8M A;  3MSZ A;  2AB6 A;  5AIV A;  4YH2 A;  3D4M A;  4F03 A;  1XZO A;  3GYK A;  2GVP A;  7GSS A;  4KX4 A;  4I5Q A;  2DLX A;  1F6M C;  3ERG A;  2E7P A;  3GH6 A;  1SKW B;  3IHQ A;  3WT1 A;  2IIY A;  4K1F A;  2C0E A;  2WGR A;  2EC4 A;  1W89 A;  3BCK A;  4PNG A;  1BQ7 A;  5DQS A;  4OFN A;  4MDC A;  3FEU A;  4MF5 A;  5AIX A;  8GSS A;  4JR6 A;  4L5L A;  4I6X A;  1EGO A;  4HS1 A;  1JHB A;  3D0Z A;  2VCZ A;  2IMK A;  2GT5 A;  4XHM A;  3GUS A;  5ELG A;  5IMV A;  5ECM B;  2WZ9 A;  1T1V A;  4YAP A;  1SL0 B;  3TKS C;  5HR0 A;  5H5R A;  2AV4 A;  4GST A;  4BWS A;  4D73 A;  1TRU A;  2VD1 A;  3U6V A;  5ID2 B;  11GS A;  5HR2 A;  3KTL A;  2YNX A;  2C80 A;  2H74 A;  1F2E A;  3QAV A;  1TI1 A;  1ZCP A;  4Q5N A;  1FHE A;  6GSU A;  3VWX A;  3I9V 2;  4ACS A;  3QFA C;  3QFB C;  3BD2 A;  2CX3 A;  3EMP A;  14GS A;  1U87 A;  3LGC A;  3TOT A;  3TRP A;  5CRD A;  4K2D A;  4O92 A;  4WXT A;  4MCU A;  1T8E B;  3US3 A;  3D5J A;  2CZ3 A;  1K0M A;  3H93 A;  3LQ7 A;  3RAZ A;  5CRG A;  3Q18 A;  2LQQ A;  5CO3 A;  3A2W A;  4FYB A;  4IQA A;  5IOW A;  4XIH A;  4AGS A;  1XOB A;  3ISO A;  4QL7 A;  4F2I A;  3QD9 A;  1TP9 A;  5CAX A;  3F3Q A;  4ID0 A;  16GS A;  4MP4 A;  3NIV A;  2GZZ A;  4I8B A;  1ON4 A;  3CSH A;  3EE2 A;  2CV4 A;  4KDU A;  3DRN A;  2AUV A;  4Q5F A;  4X1U A;  4TOP A;  3TRQ A;  3ZML A;  5KN3 A;  1M2B A;  1QMV A;  4WKW A;  5IIZ A;  4ULX A;  3HA9 A;  3FY7 A;  2YAN A;  1GL8 A;  2VUP A;  4KDY A;  4EKZ A;  3GMF A;  2H0G A;  1FVK A;  2YP6 A;  1WPI A;  2RLI A;  2YN1 A;  1EP7 A;  4J2F A;  4YQM A;  2C0F A;  3LFL A;  4WBJ A;  2CZ2 A;  2GZY A;  1NM3 A;  1F3A A;  3CYN A;  3LXZ A;  1A2J A;  2E2G A;  4GQC A;  4ML1 A;  4NHZ A;  4YAV A;  1XW6 A;  2PN8 A;  2N5F A;  1TRW A;  1YF0 A;  2VL3 A;  4GF0 A;  5B8A A;  2H73 A;  2GSQ A;  1ACV A;  5DCG A;  4RQR A;  5ECQ B;  1XCC A;  2MBS A;  1WIK A;  2IFQ B;  1GSF A;  3UEM A;  2CVB A;  5IQY A;  4L0U A;  2LRN A;  5A5K A;  4KB3 A;  4EO3 A;  2KUC A;  4G2E A;  2LUS A;  1PL1 A;  2R3X A;  1XOA A;  2P31 A;  1G6W A;  1QXH A;  2M80 A;  5AGY A;  3M9J A;  4OCF A;  1SU9 A;  1K3L A;  2G0F A;  1OVN A;  3GSS A;  2H8L A;  5ID2 A;  5HFG A;  4AJ6 A;  3DEX A;  1TJD A;  1GLQ A;  2P0G A;  4X0X A;  3HVS A;  1SJI A;  1H75 A;  1URM A;  2FWH A;  2R2J A;  3H79 A;  3HDC A;  1YY7 A;  1Z9H A;  3O6T A;  1XW5 A;  4LLR A;  1JZW A;  2VO4 A;  2HZE B;  3EIN A;  1PX6 A;  3HVV A;  3MDK A;  2L6D A;  3C1S A;  2H72 A;  1SL2 B;  17GS A;  3S9F A;  3HZ8 A;  1Q4J A;  3GL3 A;  1G0T A;  1VRS D;  2C0D A;  2JZS A;  3F4R A;  4MJC A;  5F07 A;  3UJ1 A;  1O85 A;  5KN1 A;  3F4S A;  1O7U A;  4K9Z A;  2H1G A;  4PGT A;  1XW9 A;  1TI3 A;  5F8B A;  1Z3E A;  4MH3 A;  2P5R A;  4KGI A;  3MWH A;  6GSS A;  2PVO C;  5ECN B;  5H5Q A;  3GUR A;  2HFD A;  2L4C A;  2DJ0 A;  1TW9 A;  2CT6 A;  1EGR A;  3HY2 A;  1B9X C;  3WYW A;  4GXZ A;  2LV3 A;  1PSQ A;  1U3A A;  5DJL A;  1U6T A;  2VLV A;  3V1W A;  1OKT A;  3GA4 A;  3P90 A;  3DVW A;  3FZ5 A;  2GQM A;  1B4Q A;  1EOG A;  1PL2 A;  12GS A;  2H76 A;  3W8J A;  1KEB A;  4EUY A;  3ZYW A;  2QGV A;  1LBK A;  2H70 A;  1GTA A;  1WOU A;  2DC5 A;  4V2L A;  5J4U A;  4AF2 A;  3K8N A;  1MDK A;  2PWJ A;  1VF4 A;  1M0U A;  2H1B A;  5D9W A;  4KUN A;  1SJZ A;  3KEB A;  1GTI A;  4KCE A;  1A8L A;  1YQ1 A;  4CHS A;  1OAZ A;  3Q19 A;  5G5E A;  4PUR A;  1TKD B;  5JWR B;  1SK0 A;  3F9U A;  1ERW A;  1K3Y A;  1O8W A;  2QSI A;  3DKS A;  3Q6O A;  3FHK A;  3TOU A;  3KCM A;  2FHE A;  3RBT A;  3IV4 A;  3L9S A;  2C3N A;  2H30 A;  4IJ3 A;  2DIZ A;  2IFQ A;  1ZYE A;  3U5R E;  4DEJ A;  3FZA A;  1PKW A;  1XBS A;  2NDO A;  1AW9 A;  4OMV A;  4ECI A;  1LU4 A;  3HKR A;  3D6I A;  3GTU A;  1Z5Y E;  1S3C A;  5DAK B;  1QFN A;  1B48 A;  5A4U A;  3NOF A;  1UA5 A;  1MD4 A;  1XVQ A;  2YZH A;  2LS5 A;  2NBS A;  2GSR A;  3CRT A;  2KHP A;  4K7I A;  4IVF A;  1Q98 A;  1GSE A;  2IL3 A;  3M9K A;  2VD0 A;  1TRS A;  5GST A;  2LNT A;  4POB A;  4G10 A;  3HJP A;  5HFI A;  2VAF A;  3HCZ A;  3J7Y k;  2F3M A;  3C73 A;  5DJM A;  4HJM A;  4I97 A;  2HZE A;  3TRX A;  1JLW A;  1NW2 A;  3GKK A;  5DDL A;  3ZIV A;  3VPT A;  2R37 A;  3ZRD A;  4MF7 A;  2CA8 A;  4POK A;  1ZMA A;  4ZBD A;  2X8H A;  2DJ1 A;  3HJO A;  3EVI A;  1CQG A;  3L0H A;  3R2Q A;  3TKS E;  3F0I A;  5D93 A;  2VL2 C;  4N11 A;  2N5A A;  4TXV A;  3IR4 A;  4TR3 A;  1O8X A;  3MNG A;  2J9H A;  2P5Q A;  4L0W A;  1KBN A;  2DML A;  4H86 A;  1LJR A;  2FGX A;  5G1K A;  4JZQ A;  3TJG A;  1B9Y C;  1PMT A;  2V6O A;  2HRF A;  2YV7 A;  5F05 A;  4GTU A;  5DBQ A;  3VWV A;  1YKC A;  1TRV A;  2PER A;  6GSV A;  4V1A p;  4WEY A;  1V2A A;  1FB6 A;  1YKA A;  4K7N A;  5CYY A;  1F3B A;  2VCX A;  5FT3 A;  4BVY A;  4LA1 A;  4FO5 A;  3GIX A;  2IMF A;  1V58 A;  1X5D A;  2EIR A;  3BOA A;  3EMX A;  2BJX A;  2F51 A;  1GUK A;  1V57 A;  1O81 A;  1CQH A;  1PQN A;  2HZF A;  1THO A;  3QOU A;  4DVC A;  3UBK A;  2X8G A;  3CSI A;  1OE8 A;  3GKN A;  5ECH B;  3WGE A;  2DJK A;  1IYH A;  3E3E A;  5IMC A;  1TK8 B;  1GUH A;  2JU5 A;  3E9J B;  4MH2 A;  3KP9 A;  3FZ9 A;  1E6B A;  1TK5 B;  2K18 A;  4PUA A;  1O6J A;  4EE0 A;  1K0A A;  1IYI A;  2JSY A;  5B6N A;  4FYU A;  2H6X A;  4BPY A;  3LOR A;  1YDK A;  4I2U A;  5G5F A;  2R5G A;  1GSS A;  2H66 A;  3APQ A;  1M2D A;  3IK7 A;  2NVL A;  3UOM A;  3KM6 A;  5DAK A;  3A2X A;  5L71 A;  1GNW A;  3DWV A;  4ILF A;  4KCA A;  1FOV A;  2C3Q A;  2L57 A;  4K7O A;  2V32 A;  2XPE A;  4IP6 A;  1USB A;  3HD5 A;  2G2Q A;  2VLU A;  2GT6 A;  5JCW A;  2IN3 A;  1SK1 A;  2L5L A;  1ILO A;  1OC8 A;  4ZIL A;  2YPM A;  3DYR A;  3ERW A;  4ZBB A;  3QDN A;  1XFL A;  3UAP A;  3UMA A;  4JE1 A;  4FIW A;  4WR5 A;  3KJY A;  1Z6M A;  4JU5 A;  5E59 A;  2GZP A;  5B7C A;  5LNK e;  2CAQ A;  3CRU A;  1JFU A;  1UVZ A;  3UIW A;  1VF2 A;  3WD6 A;  4F9Z A;  4ZB8 A;  2XHF A;  3LWA A;  2MMA A;  3D4T A;  2VIM A;  5HQP A;  2H6Y A;  1K0D A;  3TKQ A;  2LTK A;  1I9D A;  3CBU A;  4G19 A;  3PR8 A;  2C1Y A;  4F82 A;  5F06 A;  1A2L A;  2B1K A;  2GGT A;  2H6Z A;  4IP1 A;  1DE2 A;  3KGK A;  3P2A A;  2LEG A;  3BCI A;  1SD9 A;  1Z7P A;  2VCQ A;  3IAM 2;  4IBP A;  1M9A A;  1QGV A;  3F6D A;  5AIS A;  1M99 A;  5GSS A;  3F8U A;  1VGL A;  4OCE A;  2B5X A;  4TW5 A;  1ERU A;  4I2T A;  5J9C A;  2GS3 A;  2YWO A;  3AY8 A;  6GSW A;  3PH9 A;  4MF6 A;  3WGX A;  5INY A;  3C1R A;  1PD2 1;  3IPZ A;  2QC7 A;  1MDJ A;  2OE1 A;  3EC3 A;  1PA3 A;  4ZBA A;  4PQH A;  1WMJ A;  4FYC A;  3IA1 A;  3G7Y A;  4TR1 B;  4NV2 A;  2PVQ A;  3TJF A;  3VWU A;  1TTZ A;  1U88 A;  3ZZX A;  1K0B A;  2ZNM A;  1YJ6 A;  5E4W A;  4HOJ A;  3GX8 A;  4NPB A;  3MAK A;  3ME8 A;  2YWN A;  2EIO A;  4MZB A;  1SEN A;  1KTE A;  4DSR A;  1ST9 A;  1ZL9 A;  3TKP A;  3KXO A;  4GRF A;  3CMI A;  1XPV A;  1PKZ A;  2K6V A;  5J3R A;  2ON5 A;  5D9T A;  4BWQ A;  4HQZ A;  2VL2 A;  4IW9 A;  1N8J A;  3L4N A;  2L59 A;  2VL9 A;  1J0F A;  4XS4 B;  3KH7 A;  4CW9 A;  1SL1 B;  1T4Y A;  2FWF A;  3WGD A;  4POM A;  3GFK A;  5A4V A;  3FRC A;  3IBH A;  3E0U A;  4TR0 A;  4JBB A;  2OBK A;  4AJ7 A;  3EU3 A;  3RHB A;  2E2M A;  4RI7 A;  4E8E A;  4Q5Q A;  3LYP A;  1X9M B;  2OE0 A;  2PU9 C;  1R5A A;  1XWC A;  4LL4 B;  3HZ4 A;  1OYJ A;  3TB2 A;  2MZC A;  2H1D A;  5J9B A;  1R4W A;  3N9J A;  2B7J A;  2A2S A;  1Y25 A;  1R7H A;  2O89 A;  2WFC A;  3TGZ A;  4HI7 A;  1HD2 A;  4QL9 A;  2PGT A;  3ZLP A;  3VK9 A;  1G6Y A;  1YF1 A;  3QCP A;  4EDY A;  3M8N A;  2H75 A;  1ABA A;  2AHE A;  5IMD A;  2PUK C;  4OWY A;  3LXT A;  4OFM A;  4K0G A;  3A2V A;  5IMZ A;  5GAN D;  4F0C A;  1GNE A;  5D9X A;  1V98 A;  5FHI A;  4XS6 A;  1S3A A;  5H5S A;  4LMV A;  1E2Y A;  4HEA 2;  3KTB A;  3UL3 A;  5DQY A;  2AYT A;  1EWX A;  4YQU A;  1MDI A;  2H01 A;  2I9H A;  4ECJ A;  1TK0 B;  4F0B A;  3GX0 A;  4PX1 A;  3ZFL A;  2X64 A;  1FG4 A;  4KAE A;  2B5E A;  3FK8 A;  1VF1 A;  5G31 A;  4BL7 A;  5KN0 A;  1SYX A;  1TU7 A;  1XWK A;  1Y6E A;  3F3R A;  1SK2 A;  4DSS B;  2FNO A;  1GP1 A;  5DVB A;  4TR1 A;  4RI6 A;  4N10 A;  1THX A;  4DSQ A;  1TOF A;  1DBY A;  1YZX A;  1X5E A;  3EU4 A;  4OFT A;  2NTO A;  2XPD A;  2C8U A;  2X8C A;  4NMU A;  1SKR B;  4XS1 A;  3IDV A;  2HSH A;  3DXB A;  3GKX A;  5ECS A;  2FA8 A;  5EPF A;  3DML A;  4TKY A;  2LRT A;  3ME7 A;  5CP1 A;  3RPN A;  3ZL5 A;  3IE3 A;  4PQ1 A;  3ZTL A;  2JAC A;  4NWY A;  3PIN A;  4XS4 A;  1R5P A;  3APS A;  2TIR A;  3H4K A;  5FWG A;  2CVD A;  4KE3 A;  3APO A;  3LJR A;  2R4V A;  5CRH A;  1A0F A;  1ERT A;  2KP2 A;  3GRX A;  4PUF C;  4MPG A;  2L6C A;  2CVK A;  3W6G A;  3SWL A;  2K8V A;  1PGT A;  3ERF A;  3QMX A;  3LSZ A;  2GDR A;  2O85 A;  3ZVJ D;  5IPH A;  4V2N A;  5ECP B;  1GTU A;  3TJK A;  2F8F A;  2WRT A;  3RPP A;  2N5B A;  2IMD A;  3P8W A;  3I43 A;  4ZL7 A;  1B8X A;  5B8B A;  1B4P A;  2MBT A;  2I81 A;  3GST A;  2H71 A;  3TUE A;  1GWC A;  2OBI A;  1V9W A;  4MJB A;  2V6K A;  2HXK A;  4HZ2 A;  1I5G A;  5D73 A;  3IC4 A;  2CX4 A;  3ZVJ A;  1T7P B;  4MMM A;  4Z7X A;  2LJR A;  4RUV A;  1BX9 A;  1NHY A;  3KZQ A;  1EOH A;  1GH2 A;  2TRX A;  1SJ6 A;  1KNG A;  5IMF A;  2YZU A;  4ZIJ A; 
#chains in the Genus database with same CATH topology
 4XRD A;  1EV4 A;  3TKR A;  4QQ7 A;  2V2G A;  5LD0 A;  2VLT A;  2HT9 A;  4BVX A;  1GLP A;  1T4Z A;  3CSJ A;  4OO4 A;  5J5N A;  1J9B A;  2DSA A;  1OKD A;  3L9V A;  1EEJ A;  2HLS A;  3MIX A;  2ES7 A;  1BED A;  5HR1 A;  5ABR A;  2C0G A;  5C04 A;  2GLR A;  4EDZ A;  3PPU A;  4YQV A;  1A0R P;  5DCH A;  5DAL B;  1ERV A;  3IRA A;  3FR6 A;  4IKH A;  2JZR A;  4MJA A;  2DKH A;  4DSS A;  1X9S B;  3FKF A;  1GUM A;  4RQX A;  2H0I A;  2FD3 A;  3HJM A;  1XWA A;  1GSY A;  2L5O A;  5EL8 A;  2R6K A;  1AQV A;  4O7H A;  4JRR A;  2OJL A;  3VI5 A;  1V40 A;  4K0N A;  4TXO B;  4IGJ A;  1DE1 A;  1DUG A;  3IK9 A;  4WR4 A;  4HQS A;  5CNW A;  2HRN A;  3C71 A;  2K9F A;  2IWT A;  3UVT A;  3G7J A;  1JZR A;  5IO2 A;  3F63 A;  3KP8 A;  3M3M A;  2XBI A;  1FB0 A;  1DSB A;  2FLS A;  1MEK A;  1NHO A;  4KSO A;  2RII A;  2VOC A;  4N0V A;  4JR4 A;  2H1A A;  3GN3 A;  2J23 A;  1AXD A;  3W8S A;  3FR3 A;  3FR9 A;  3EWL A;  3L9U A;  2VM2 A;  1H4O A;  2DJJ A;  1XXU A;  4J56 E;  3KMN A;  3QAW A;  1A24 A;  1K0O A;  3TCO A;  2FY6 A;  3OR5 A;  4ICY A;  3VFI A;  1OC3 A;  2C3T A;  2GTU A;  3RHC A;  3LEF A;  4MZW A;  1FO5 A;  1FVJ A;  1M7T A;  1K0C A;  5C00 A;  3IC8 A;  3O3T A;  2BMX A;  2QA2 A;  4ZXG A;  2WUL A;  4IQ1 A;  4Q5R A;  1YEX A;  2WB9 A;  1F37 A;  5IM9 A;  2LNS A;  2B5Y A;  2X99 A;  1JZO A;  1S3D A;  2JL4 A;  4JED A;  3EYT A;  1QUW A;  1EV9 A;  1AAZ A;  2I4A A;  3KIJ A;  4TVE A;  2WJU A;  1X5C A;  4G0L A;  1OE7 A;  3DGQ A;  1MTC A;  5D9V A;  4V1A g;  3EPT A;  4HU9 A;  4XCS A;  2V1M A;  1M9B A;  4K5R A;  1UC7 A;  3LG6 A;  5G1L A;  1BJX A;  5HR3 A;  3F4T A;  3TJJ A;  2GSS A;  4CDO A;  3UBL A;  2V41 A;  2QKE A;  3VLN A;  1EP8 A;  3A5W A;  3KD0 A;  3QPM A;  2HE3 A;  3M0F A;  4N30 A;  2H0H A;  4G0K A;  3SBC A;  3UAR A;  1J08 A;  1M2A A;  5JWO B;  1ZGN A;  2XBQ A;  2KLX A;  3KMO A;  2FA4 A;  3EUR A;  3ZRE A;  2WS2 A;  3TJB A;  5DAL A;  2IJY A;  2OAC A;  3HVX A;  4WF5 A;  1K3O A;  5IPG A;  5AN1 A;  4KH7 A;  2CAI A;  4TRX A;  5KEJ A;  5B6M A;  2VCW A;  5ECK B;  4MAB A;  4L8E A;  3FZ4 A;  10GS A;  2ZUP A;  1T3B A;  2M46 A;  5IOX A;  4IN0 A;  4XRA A;  4TXO A;  1A8Y A;  3C8E A;  1UN2 A;  3DVX A;  5JCG A;  3A3T A;  4EF0 A;  2D2Z A;  2RUE A;  2LJA A;  3GKM A;  2O8V B;  3HYP A;  4HJ2 A;  2YCD A;  3G9B A;  1ML6 A;  5ELA A;  2REM A;  4MK3 A;  1RQM A;  3FYG A;  2I3Y A;  1ZYQ B;  1C72 A;  2GQK A;  5A4W A;  2H19 A;  4P3Y B;  1X9W B;  2GST A;  2FCH A;  3Q74 A;  3VI7 A;  2A4V A;  1HNB A;  2ALB A;  3GNJ A;  3DD3 A;  2RUF A;  4GWR A;  3GTU B;  4IS0 A;  3I6A A;  4TR4 A;  2OAD A;  4ISD A;  2FUG 2;  5G30 A;  4ZB6 A;  2JSZ A;  1FAA A;  6GSX A;  2LJK A;  1TU8 A;  4LMW A;  2B6M A;  2FWE A;  2MYG A;  3ZMK A;  4GSN A;  5ECR B;  4IJI A;  2M72 A;  3N5O A;  3HXS A;  3VUR A;  2B7K A;  4PXO A;  1WRY A;  2AAW A;  2NPB A;  1AQX A;  1AIU A;  3NZN A;  3L78 A;  5JCU A;  4KDX A;  1WWJ A;  1WE0 A;  3CTG A;  9GSS A;  2HSY A;  3ED3 A;  4NHW A;  4GCI A;  2F8A A;  2WDU A;  2IMI A;  4YKF A;  3D22 A;  4NAX A;  1VF3 A;  4O5Q A;  1MD3 A;  4IEL A;  2B3S A;  2DIY A;  4MZC A;  1A2M A;  4N0Z A;  5G2Z A;  1QK8 A;  2IPA A;  2FWG A;  5EY6 A;  1YEP A;  2E0Q A;  1X0R A;  1GSU A;  5ECO B;  2JZT A;  1U3I A;  4PTS A;  1SKS B;  1R26 A;  2HRK A;  1GUL A;  5CRW A;  4MNN A;  3VWW A;  3ZIJ A;  3HHV A;  5ECL B;  2AJQ B;  4J57 E;  1OC9 B;  4BA7 A;  3TKS A;  3ZIT A;  3BJ5 A;  3O76 A;  4GSS A;  5KN2 A;  2DBC A;  2PPT A;  1K0N A;  3F6F A;  4FH8 A;  4ZL9 A;  1JZD A;  5GAP D;  2O87 A;  3IXR A;  4KW6 A;  4XTS A;  3H1N A;  5JWQ B;  4ZL8 A;  2EIQ A;  4O5R A;  1ZZY A;  4AJ8 A;  1PFO A;  3ZFB A;  1ZOF A;  3VPQ A;  1F9M A;  4E8H A;  4EVM A;  5CRE A;  6GST A;  1EZK A;  5HFK A;  3BBY A;  1HNA A;  4WF4 A;  5LCZ A;  2MMO A;  4EXJ A;  1WJK A;  4WBR D;  1AC1 A;  2YWI A;  4GLT A;  2X4A A;  1PX7 A;  4ECC A;  1A23 A;  2K8S A;  1WP0 A;  3IAS 2;  2A4H A;  13GS A;  19GS A;  1RK4 A;  1SYR A;  1AUC A;  1HYU A;  2BTO T;  4PNF A;  2YV9 A;  20GS A;  5GZZ B;  4KND A;  5IMA A;  4ECB A;  3PGT A;  2LST A;  4HU7 A;  4OD7 A;  2ON7 A;  3J7Y b;  2VM1 A;  4O32 A;  4V2M A;  2DMM A;  4MJE A;  2DJ3 A;  2IME A;  4MPF A;  2VCV A;  4EC0 A;  1JLV A;  5EVO A;  2TRC P;  1TXX A;  4KSM A;  3QR6 A;  2F9S A;  4WET A;  1NSW A;  4D73 B;  4ML6 A;  4OO5 A;  2C4J A;  3H8Q A;  4HDE A;  3P7X A;  5ECI B;  1GRX A;  4ZB9 A;  3DIE A;  1HQO A;  4K6X A;  2YJ7 A;  3GH9 A;  3CTF A;  3D21 A;  1RW1 A;  1Z7R A;  1BYE A;  1PN9 A;  3JCM L;  2MMZ A;  4POL A;  3GV1 A;  2VCT A;  4GQF A;  5D8I A;  1BAY A;  2A2R A;  2RM6 A;  5ENU A;  18GS A;  3G7I A;  2OKA A;  1PRX A;  4EIQ A;  4K5S A;  2ZCT A;  22GS A;  4PQI A;  4KA0 A;  4G9H A;  5F0G A;  2XC2 A;  3M1G A;  4IHU A;  4NV5 A;  2B1L A;  1T00 A;  2OE3 A;  2Z9S A;  3LYK A;  1HNC A;  3I69 A;  2HYX A;  2WCI A;  3QAG A;  4TN8 A;  1TDI A;  2LRC A;  3KH9 A;  4HUA A;  2YOI A;  1FW1 A;  3C7M A;  3GHA A;  2KP1 A;  4L5O A;  1XVW A;  1GSQ A;  2LQO A;  1GTB A;  1XWG A;  2O7K A;  1OC9 A;  1XIY A;  5COH A;  4X43 A;  6GSY A;  4MLY A;  3TDG A;  3UVH A;  1XWB A;  2I1U A;  2GQL A;  1QQ2 A;  2CQ9 A;  4MA9 A;  2KOK A;  2DJ2 A;  2PMT A;  4NXI A;  4LL1 B;  3WT2 A;  2MMN A;  3RDW A;  1W4V A;  2LKU A;  4EL1 A;  2HNL A;  3GL5 A;  5IO0 A;  2L4Q A;  2PBJ A;  1SD8 A;  1G7E A;  2RM5 A;  2YWM A;  1GSD A;  2OA7 A;  1M3I A;  3FW2 A;  2YJH A;  5J41 A;  1EEM A;  1O73 A;  1AQW A;  3CXG A;  1N2A A;  1Z6N A;  2HI7 A;  3IOS A;  4KF9 A;  5D96 A;  2JAD A;  4Z2R A;  4HZ4 A;  1BG5 A;  1G7O A;  4K8M A;  3MSZ A;  2AB6 A;  5AIV A;  4YH2 A;  3D4M A;  4F03 A;  1XZO A;  3GYK A;  2GVP A;  7GSS A;  4KX4 A;  4I5Q A;  2DLX A;  1F6M C;  3ERG A;  2E7P A;  3GH6 A;  1SKW B;  3IHQ A;  3WT1 A;  2IIY A;  4K1F A;  2C0E A;  2WGR A;  2EC4 A;  1W89 A;  3BCK A;  4PNG A;  1BQ7 A;  5DQS A;  4OFN A;  4MDC A;  3FEU A;  4MF5 A;  5AIX A;  8GSS A;  4JR6 A;  4L5L A;  4I6X A;  1EGO A;  4HS1 A;  1JHB A;  3D0Z A;  2VCZ A;  2IMK A;  2GT5 A;  4XHM A;  3GUS A;  5ELG A;  5IMV A;  5ECM B;  2WZ9 A;  1T1V A;  4YAP A;  1SL0 B;  3TKS C;  5HR0 A;  5H5R A;  2AV4 A;  4GST A;  4BWS A;  4D73 A;  1TRU A;  2VD1 A;  3U6V A;  5ID2 B;  11GS A;  5HR2 A;  3KTL A;  2YNX A;  2C80 A;  2H74 A;  1F2E A;  1ZYN A;  3QAV A;  1TI1 A;  1ZCP A;  4Q5N A;  1FHE A;  4USS A;  6GSU A;  3VWX A;  3I9V 2;  4ACS A;  1PN0 A;  3QFA C;  3QFB C;  3BD2 A;  2CX3 A;  3EMP A;  14GS A;  1U87 A;  3LGC A;  3TOT A;  3TRP A;  5CRD A;  4K2D A;  4O92 A;  4WXT A;  4MCU A;  1T8E B;  3US3 A;  3D5J A;  2CZ3 A;  1K0M A;  3H93 A;  3LQ7 A;  4A5P A;  5KOW A;  3RAZ A;  5CRG A;  3Q18 A;  2LQQ A;  5CO3 A;  3A2W A;  4FYB A;  4IQA A;  5IOW A;  4XIH A;  4AGS A;  1XOB A;  3ISO A;  4QL7 A;  4F2I A;  2R0C A;  3QD9 A;  1TP9 A;  5CAX A;  3F3Q A;  4ID0 A;  16GS A;  4MP4 A;  3NIV A;  2GZZ A;  4I8B A;  1ON4 A;  3CSH A;  3EE2 A;  2CV4 A;  4KDU A;  3DRN A;  2AUV A;  4Q5F A;  4X1U A;  4TOP A;  3TRQ A;  3ZML A;  5KN3 A;  1M2B A;  1QMV A;  4WKW A;  5IIZ A;  4ULX A;  3HA9 A;  3FY7 A;  2YAN A;  1GL8 A;  2VUP A;  4KDY A;  4EKZ A;  3FMW A;  3GMF A;  2H0G A;  1FVK A;  2YP6 A;  1WPI A;  2RLI A;  2YN1 A;  1EP7 A;  4J2F A;  4YQM A;  2C0F A;  3LFL A;  4WBJ A;  2CZ2 A;  2GZY A;  1NM3 A;  1F3A A;  3CYN A;  3LXZ A;  1A2J A;  2E2G A;  4GQC A;  4ML1 A;  4NHZ A;  4YAV A;  1XW6 A;  2PN8 A;  2N5F A;  1TRW A;  1YF0 A;  2VL3 A;  4GF0 A;  5B8A A;  2H73 A;  2GSQ A;  1ACV A;  5DCG A;  3A5I A;  4RQR A;  5ECQ B;  1XCC A;  3HVN A;  2MBS A;  1WIK A;  2IFQ B;  1GSF A;  3UEM A;  2CVB A;  4HSC X;  5IQY A;  4L0U A;  2LRN A;  5A5K A;  4KB3 A;  4EO3 A;  2KUC A;  4G2E A;  2LUS A;  1PL1 A;  2R3X A;  1XOA A;  2P31 A;  1G6W A;  1QXH A;  2M80 A;  5AGY A;  3M9J A;  4OCF A;  1SU9 A;  1XG8 A;  1K3L A;  2G0F A;  1OVN A;  3GSS A;  2H8L A;  5ID2 A;  5HFG A;  4AJ6 A;  3DEX A;  1TJD A;  1GLQ A;  2P0G A;  4X0X A;  3HVS A;  1SJI A;  1H75 A;  1URM A;  2FWH A;  2R2J A;  1M3J A;  3H79 A;  3HDC A;  1YY7 A;  1Z9H A;  3O6T A;  1XW5 A;  4LLR A;  1JZW A;  2VO4 A;  2HZE B;  3EIN A;  1PX6 A;  3MYD A;  3HVV A;  3MDK A;  2L6D A;  3C1S A;  2H72 A;  1SL2 B;  17GS A;  3S9F A;  4O5U A;  3HZ8 A;  1Q4J A;  3GL3 A;  1G0T A;  1VRS D;  2C0D A;  2JZS A;  3F4R A;  4MJC A;  5F07 A;  4FQU A;  3UJ1 A;  1O85 A;  5KN1 A;  3F4S A;  1O7U A;  4K9Z A;  2H1G A;  4PGT A;  1XW9 A;  1TI3 A;  5F8B A;  1Z3E A;  4MH3 A;  2P5R A;  4KGI A;  3MWH A;  2QA1 A;  6GSS A;  2PVO C;  5ECN B;  5H5Q A;  3GUR A;  2HFD A;  2L4C A;  2DJ0 A;  1TW9 A;  2CT6 A;  1EGR A;  3HY2 A;  1B9X C;  3WYW A;  4GXZ A;  2LV3 A;  1PSQ A;  1U3A A;  5DJL A;  1U6T A;  2VLV A;  3V1W A;  1OKT A;  3GA4 A;  3P90 A;  3DVW A;  3FZ5 A;  2GQM A;  1B4Q A;  1EOG A;  4BVY B;  1PL2 A;  2DKI A;  12GS A;  2H76 A;  4Z2T A;  3W8J A;  1KEB A;  4EUY A;  3ZYW A;  2QGV A;  1LBK A;  2H70 A;  1GTA A;  1WOU A;  2DC5 A;  4V2L A;  5J4U A;  4AF2 A;  3K8N A;  1MDK A;  2PWJ A;  1VF4 A;  1M0U A;  2H1B A;  5D9W A;  4KUN A;  1SJZ A;  3KEB A;  1GTI A;  4KCE A;  4BIK A;  1A8L A;  1YQ1 A;  4CHS A;  1OAZ A;  3Q19 A;  5G5E A;  4PUR A;  1TKD B;  5JWR B;  1SK0 A;  3F9U A;  1ERW A;  1K3Y A;  1O8W A;  2QSI A;  3DKS A;  3Q6O A;  3FHK A;  3TOU A;  3KCM A;  2FHE A;  3RBT A;  3IV4 A;  3L9S A;  2C3N A;  2H30 A;  4IJ3 A;  2DIZ A;  2IFQ A;  1ZYE A;  3U5R E;  4DEJ A;  3FZA A;  1PKW A;  1XBS A;  2NDO A;  1AW9 A;  4OMV A;  4ECI A;  1LU4 A;  3HKR A;  3D6I A;  3GTU A;  1Z5Y E;  1S3C A;  3R3E A;  5DAK B;  1QFN A;  1B48 A;  5A4U A;  3NOF A;  1UA5 A;  1MD4 A;  1XVQ A;  2YZH A;  2LS5 A;  2NBS A;  2GSR A;  3CRT A;  2KHP A;  4K7I A;  4IVF A;  1Q98 A;  1GSE A;  2IL3 A;  3M9K A;  2VD0 A;  1TRS A;  5GST A;  2LNT A;  4POB A;  4G10 A;  3HJP A;  5HFI A;  2VAF A;  3HCZ A;  2UZ8 A;  3J7Y k;  2F3M A;  3C73 A;  5DJM A;  4HJM A;  4I97 A;  2HZE A;  3TRX A;  1JLW A;  1NW2 A;  3GKK A;  5DDL A;  3ZIV A;  3VPT A;  2R37 A;  3ZRD A;  4MF7 A;  2CA8 A;  4POK A;  1ZMA A;  4ZBD A;  2X8H A;  2DJ1 A;  3HJO A;  3EVI A;  1CQG A;  3L0H A;  3R2Q A;  3TKS E;  3F0I A;  5D93 A;  2VL2 C;  4N11 A;  2N5A A;  4TXV A;  3IR4 A;  4TR3 A;  1O8X A;  3MNG A;  2J9H A;  2P5Q A;  4L0W A;  1KBN A;  2DML A;  4H86 A;  1LJR A;  2FGX A;  5G1K A;  4JZQ A;  3TJG A;  1B9Y C;  1PMT A;  2V6O A;  1FOH A;  2HRF A;  2YV7 A;  5F05 A;  4GTU A;  5DBQ A;  3VWV A;  1YKC A;  1TRV A;  2PER A;  6GSV A;  4V1A p;  4WEY A;  4CY6 A;  1V2A A;  1FB6 A;  1YKA A;  4K7N A;  5CYY A;  1F3B A;  2VCX A;  5FT3 A;  4BVY A;  4LA1 A;  4FO5 A;  3GIX A;  2IMF A;  1V58 A;  1X5D A;  2EIR A;  3BOA A;  4K2X A;  3EMX A;  2BJX A;  2F51 A;  1GUK A;  1V57 A;  1O81 A;  1CQH A;  1PQN A;  2HZF A;  1THO A;  3QOU A;  4DVC A;  3UBK A;  2X8G A;  4Z2U A;  3CSI A;  1OE8 A;  3GKN A;  5ECH B;  3WGE A;  2DJK A;  1IYH A;  3E3E A;  5IMC A;  1TK8 B;  1GUH A;  2JU5 A;  3E9J B;  4MH2 A;  3KP9 A;  3FZ9 A;  1E6B A;  1TK5 B;  2K18 A;  4PUA A;  1O6J A;  4EE0 A;  1K0A A;  2R0G A;  1IYI A;  2JSY A;  5B6N A;  5BRT A;  4FYU A;  2H6X A;  4BPY A;  3LOR A;  1YDK A;  4I2U A;  5G5F A;  2R5G A;  1GSS A;  2H66 A;  3APQ A;  1M2D A;  3IK7 A;  2NVL A;  3UOM A;  3KM6 A;  5DAK A;  3A2X A;  5L71 A;  1GNW A;  3DWV A;  4ILF A;  4KCA A;  1FOV A;  2C3Q A;  2L57 A;  4K7O A;  2V32 A;  2XPE A;  4IP6 A;  1USB A;  3HD5 A;  2G2Q A;  2VLU A;  2GT6 A;  5JCW A;  2IN3 A;  1SK1 A;  2L5L A;  1ILO A;  1OC8 A;  4ZIL A;  2YPM A;  3DYR A;  2R0P A;  3ERW A;  4ZBB A;  3QDN A;  1XFL A;  3UAP A;  3UMA A;  4JE1 A;  4FIW A;  4WR5 A;  3KJY A;  1Z6M A;  4JU5 A;  5E59 A;  2GZP A;  5B7C A;  5LNK e;  2CAQ A;  3CRU A;  1JFU A;  1UVZ A;  3UIW A;  1VF2 A;  3WD6 A;  4F9Z A;  4ZB8 A;  2XHF A;  3LWA A;  2MMA A;  5BMU A;  3D4T A;  2VIM A;  5HQP A;  2H6Y A;  1K0D A;  3TKQ A;  2LTK A;  1I9D A;  3CBU A;  4G19 A;  3PR8 A;  2C1Y A;  4F82 A;  5F06 A;  1A2L A;  2B1K A;  2GGT A;  2H6Z A;  4IP1 A;  1DE2 A;  3KGK A;  3P2A A;  2LEG A;  3BCI A;  3LW9 A;  1SD9 A;  1Z7P A;  2VCQ A;  3IAM 2;  4IBP A;  1M9A A;  1QGV A;  3F6D A;  4EIP A;  5AIS A;  1M99 A;  5GSS A;  3F8U A;  1VGL A;  4OCE A;  2B5X A;  4TW5 A;  1ERU A;  4I2T A;  5J9C A;  2GS3 A;  2YWO A;  3AY8 A;  6GSW A;  3PH9 A;  4MF6 A;  3WGX A;  5INY A;  3C1R A;  1PD2 1;  4X4J A;  4BL7 B;  3IPZ A;  2QC7 A;  1MDJ A;  2OE1 A;  3EC3 A;  1PA3 A;  4ZBA A;  5KOX A;  4PQH A;  1WMJ A;  4FYC A;  3IA1 A;  3G7Y A;  4TR1 B;  4NV2 A;  2PVQ A;  3TJF A;  3VWU A;  1TTZ A;  1ZYP A;  1U88 A;  3ZZX A;  1K0B A;  2ZNM A;  1YJ6 A;  5E4W A;  4HOJ A;  3GX8 A;  4NPB A;  3MAK A;  3ME8 A;  2YWN A;  2EIO A;  4MZB A;  1SEN A;  1KTE A;  4DSR A;  1ST9 A;  1ZL9 A;  3TKP A;  3KXO A;  4GRF A;  3CMI A;  1XPV A;  1PKZ A;  2K6V A;  5J3R A;  2ON5 A;  5D9T A;  4BWQ A;  4HQZ A;  2VL2 A;  4IW9 A;  1N8J A;  3L4N A;  2L59 A;  2VL9 A;  1J0F A;  4XS4 B;  3KH7 A;  4CW9 A;  1SL1 B;  1T4Y A;  2FWF A;  3IHG A;  3WGD A;  4POM A;  3GFK A;  5A4V A;  3FRC A;  3IBH A;  3E0U A;  4TR0 A;  1S3R A;  4JBB A;  2OBK A;  4AJ7 A;  3EU3 A;  3RHB A;  2E2M A;  4RI7 A;  4E8E A;  4Q5Q A;  3LYP A;  1X9M B;  2OE0 A;  2PU9 C;  1R5A A;  1XWC A;  4LL4 B;  3HZ4 A;  1OYJ A;  3TB2 A;  2MZC A;  2H1D A;  5J9B A;  1R4W A;  3N9J A;  2B7J A;  2A2S A;  1Y25 A;  1R7H A;  2O89 A;  2WFC A;  3TGZ A;  4HI7 A;  1HD2 A;  4QL9 A;  2PGT A;  3ZLP A;  3VK9 A;  1G6Y A;  1YF1 A;  3QCP A;  4EDY A;  3M8N A;  2H75 A;  1ABA A;  2AHE A;  5IMD A;  2PUK C;  4OWY A;  3LXT A;  4OFM A;  4K0G A;  3A2V A;  5IMZ A;  2A2P A;  5GAN D;  4F0C A;  1GNE A;  5D9X A;  1V98 A;  5FHI A;  4XS6 A;  1S3A A;  5H5S A;  4LMV A;  1E2Y A;  4HEA 2;  3KTB A;  3UL3 A;  4BVX B;  5DQY A;  2AYT A;  1EWX A;  4YQU A;  1MDI A;  2H01 A;  2I9H A;  4ECJ A;  1TK0 B;  4F0B A;  3GX0 A;  4PX1 A;  3ZFL A;  2X64 A;  1FG4 A;  4KAE A;  2B5E A;  3FK8 A;  1VF1 A;  5G31 A;  4BL7 A;  5KN0 A;  1SYX A;  1TU7 A;  1XWK A;  1Y6E A;  3F3R A;  1SK2 A;  4DSS B;  2FNO A;  1GP1 A;  5DVB A;  4TR1 A;  4RI6 A;  4N10 A;  1THX A;  4DSQ A;  1TOF A;  1DBY A;  1YZX A;  1X5E A;  3EU4 A;  4OFT A;  2NTO A;  2XPD A;  2C8U A;  2X8C A;  4NMU A;  1SKR B;  2X49 A;  4XS1 A;  3IDV A;  2HSH A;  3DXB A;  3GKX A;  5ECS A;  2FA8 A;  5EPF A;  3DML A;  4TKY A;  2LRT A;  3ME7 A;  5CP1 A;  3RPN A;  3ZL5 A;  3IE3 A;  4PQ1 A;  4CY8 A;  3ZTL A;  2JAC A;  4NWY A;  3PIN A;  4XS4 A;  4G0I A;  3CQF A;  1R5P A;  3APS A;  2TIR A;  3H4K A;  5FWG A;  2CVD A;  4KE3 A;  3APO A;  3LJR A;  2R4V A;  5CRH A;  1A0F A;  1ERT A;  2KP2 A;  3GRX A;  4PUF C;  4MPG A;  2L6C A;  2CVK A;  3W6G A;  3SWL A;  2K8V A;  1PGT A;  3ERF A;  3QMX A;  3LSZ A;  2GDR A;  2O85 A;  3ZVJ D;  2HSM A;  5IPH A;  4V2N A;  2HRA A;  5ECP B;  1GTU A;  3TJK A;  2F8F A;  2WRT A;  3RPP A;  2N5B A;  2IMD A;  3P8W A;  3I43 A;  4ZL7 A;  1B8X A;  5B8B A;  1B4P A;  2MBT A;  2I81 A;  3GST A;  2H71 A;  3TUE A;  1GWC A;  2OBI A;  1V9W A;  4MJB A;  2V6K A;  2HXK A;  4HZ2 A;  1I5G A;  5D73 A;  3IC4 A;  2CX4 A;  3ZVJ A;  1T7P B;  4MMM A;  4Z7X A;  2LJR A;  4RUV A;  1BX9 A;  1NHY A;  3KZQ A;  1EOH A;  4YKG A;  1GH2 A;  2TRX A;  1SJ6 A;  1KNG A;  5IMF A;  2YZU A;  4ZIJ A; 
#chains in the Genus database with same CATH homology
 4XRD A;  1EV4 A;  3TKR A;  4QQ7 A;  2V2G A;  5LD0 A;  2VLT A;  2HT9 A;  4BVX A;  1GLP A;  1T4Z A;  3CSJ A;  4OO4 A;  5J5N A;  1J9B A;  2DSA A;  1OKD A;  3L9V A;  1EEJ A;  2HLS A;  3MIX A;  2ES7 A;  1BED A;  5HR1 A;  5ABR A;  2C0G A;  5C04 A;  2GLR A;  4EDZ A;  3PPU A;  4YQV A;  1A0R P;  5DCH A;  5DAL B;  1ERV A;  3IRA A;  3FR6 A;  4IKH A;  2JZR A;  4MJA A;  2DKH A;  4DSS A;  1X9S B;  3FKF A;  1GUM A;  4RQX A;  2H0I A;  2FD3 A;  3HJM A;  1XWA A;  1GSY A;  2L5O A;  5EL8 A;  2R6K A;  1AQV A;  4O7H A;  4JRR A;  2OJL A;  3VI5 A;  1V40 A;  4K0N A;  4TXO B;  4IGJ A;  1DE1 A;  1DUG A;  3IK9 A;  4WR4 A;  4HQS A;  5CNW A;  2HRN A;  3C71 A;  2K9F A;  2IWT A;  3UVT A;  3G7J A;  1JZR A;  5IO2 A;  3F63 A;  3KP8 A;  3M3M A;  2XBI A;  1FB0 A;  1DSB A;  2FLS A;  1MEK A;  1NHO A;  4KSO A;  2RII A;  2VOC A;  4N0V A;  4JR4 A;  2H1A A;  3GN3 A;  2J23 A;  1AXD A;  3W8S A;  3FR3 A;  3FR9 A;  3EWL A;  3L9U A;  2VM2 A;  1H4O A;  2DJJ A;  1XXU A;  4J56 E;  3KMN A;  3QAW A;  1A24 A;  1K0O A;  3TCO A;  2FY6 A;  3OR5 A;  4ICY A;  3VFI A;  1OC3 A;  2C3T A;  2GTU A;  3RHC A;  3LEF A;  4MZW A;  1FO5 A;  1FVJ A;  1M7T A;  1K0C A;  5C00 A;  3IC8 A;  3O3T A;  2BMX A;  2QA2 A;  4ZXG A;  2WUL A;  4IQ1 A;  4Q5R A;  1YEX A;  2WB9 A;  1F37 A;  5IM9 A;  2LNS A;  2B5Y A;  2X99 A;  1JZO A;  1S3D A;  2JL4 A;  4JED A;  3EYT A;  1QUW A;  1EV9 A;  1AAZ A;  2I4A A;  3KIJ A;  4TVE A;  2WJU A;  1X5C A;  4G0L A;  1OE7 A;  3DGQ A;  1MTC A;  5D9V A;  4V1A g;  3EPT A;  4HU9 A;  4XCS A;  2V1M A;  1M9B A;  4K5R A;  1UC7 A;  3LG6 A;  5G1L A;  1BJX A;  5HR3 A;  3F4T A;  3TJJ A;  2GSS A;  4CDO A;  3UBL A;  2V41 A;  2QKE A;  3VLN A;  1EP8 A;  3A5W A;  3KD0 A;  3QPM A;  2HE3 A;  3M0F A;  4N30 A;  2H0H A;  4G0K A;  3SBC A;  3UAR A;  1J08 A;  1M2A A;  5JWO B;  1ZGN A;  2XBQ A;  2KLX A;  3KMO A;  2FA4 A;  3EUR A;  3ZRE A;  2WS2 A;  3TJB A;  5DAL A;  2IJY A;  2OAC A;  3HVX A;  4WF5 A;  1K3O A;  5IPG A;  5AN1 A;  4KH7 A;  2CAI A;  4TRX A;  5KEJ A;  5B6M A;  2VCW A;  5ECK B;  4MAB A;  4L8E A;  3FZ4 A;  10GS A;  2ZUP A;  1T3B A;  2M46 A;  5IOX A;  4IN0 A;  4XRA A;  4TXO A;  1A8Y A;  3C8E A;  1UN2 A;  3DVX A;  5JCG A;  3A3T A;  4EF0 A;  2D2Z A;  2RUE A;  2LJA A;  3GKM A;  2O8V B;  3HYP A;  4HJ2 A;  2YCD A;  3G9B A;  1ML6 A;  5ELA A;  2REM A;  4MK3 A;  1RQM A;  3FYG A;  2I3Y A;  1ZYQ B;  1C72 A;  2GQK A;  5A4W A;  2H19 A;  4P3Y B;  1X9W B;  2GST A;  2FCH A;  3Q74 A;  3VI7 A;  2A4V A;  1HNB A;  2ALB A;  3GNJ A;  3DD3 A;  2RUF A;  4GWR A;  3GTU B;  4IS0 A;  3I6A A;  4TR4 A;  2OAD A;  4ISD A;  2FUG 2;  5G30 A;  4ZB6 A;  2JSZ A;  1FAA A;  6GSX A;  2LJK A;  1TU8 A;  4LMW A;  2B6M A;  2FWE A;  2MYG A;  3ZMK A;  4GSN A;  5ECR B;  4IJI A;  2M72 A;  3N5O A;  3HXS A;  3VUR A;  2B7K A;  4PXO A;  1WRY A;  2AAW A;  2NPB A;  1AQX A;  1AIU A;  3NZN A;  3L78 A;  5JCU A;  4KDX A;  1WWJ A;  1WE0 A;  3CTG A;  9GSS A;  2HSY A;  3ED3 A;  4NHW A;  4GCI A;  2F8A A;  2WDU A;  2IMI A;  4YKF A;  3D22 A;  4NAX A;  1VF3 A;  4O5Q A;  1MD3 A;  4IEL A;  2B3S A;  2DIY A;  4MZC A;  1A2M A;  4N0Z A;  5G2Z A;  1QK8 A;  2IPA A;  2FWG A;  5EY6 A;  1YEP A;  2E0Q A;  1X0R A;  1GSU A;  5ECO B;  2JZT A;  1U3I A;  4PTS A;  1SKS B;  1R26 A;  2HRK A;  1GUL A;  5CRW A;  4MNN A;  3VWW A;  3ZIJ A;  3HHV A;  5ECL B;  2AJQ B;  4J57 E;  1OC9 B;  4BA7 A;  3TKS A;  3ZIT A;  3BJ5 A;  3O76 A;  4GSS A;  5KN2 A;  2DBC A;  2PPT A;  1K0N A;  3F6F A;  4FH8 A;  4ZL9 A;  1JZD A;  5GAP D;  2O87 A;  3IXR A;  4KW6 A;  4XTS A;  3H1N A;  5JWQ B;  4ZL8 A;  2EIQ A;  4O5R A;  1ZZY A;  4AJ8 A;  3ZFB A;  1ZOF A;  3VPQ A;  1F9M A;  4E8H A;  4EVM A;  5CRE A;  6GST A;  1EZK A;  5HFK A;  3BBY A;  1HNA A;  4WF4 A;  5LCZ A;  2MMO A;  4EXJ A;  1WJK A;  4WBR D;  1AC1 A;  2YWI A;  4GLT A;  2X4A A;  1PX7 A;  4ECC A;  1A23 A;  2K8S A;  1WP0 A;  3IAS 2;  2A4H A;  13GS A;  19GS A;  1RK4 A;  1SYR A;  1AUC A;  1HYU A;  2BTO T;  4PNF A;  2YV9 A;  20GS A;  5GZZ B;  4KND A;  5IMA A;  4ECB A;  3PGT A;  2LST A;  4HU7 A;  4OD7 A;  2ON7 A;  3J7Y b;  2VM1 A;  4O32 A;  4V2M A;  2DMM A;  4MJE A;  2DJ3 A;  2IME A;  4MPF A;  2VCV A;  4EC0 A;  1JLV A;  5EVO A;  2TRC P;  1TXX A;  4KSM A;  3QR6 A;  2F9S A;  4WET A;  1NSW A;  4D73 B;  4ML6 A;  4OO5 A;  2C4J A;  3H8Q A;  4HDE A;  3P7X A;  5ECI B;  1GRX A;  4ZB9 A;  3DIE A;  1HQO A;  4K6X A;  2YJ7 A;  3GH9 A;  3CTF A;  3D21 A;  1RW1 A;  1Z7R A;  1BYE A;  1PN9 A;  3JCM L;  2MMZ A;  4POL A;  3GV1 A;  2VCT A;  4GQF A;  5D8I A;  1BAY A;  2A2R A;  2RM6 A;  5ENU A;  18GS A;  3G7I A;  2OKA A;  1PRX A;  4EIQ A;  4K5S A;  2ZCT A;  22GS A;  4PQI A;  4KA0 A;  4G9H A;  5F0G A;  2XC2 A;  3M1G A;  4IHU A;  4NV5 A;  2B1L A;  1T00 A;  2OE3 A;  2Z9S A;  3LYK A;  1HNC A;  3I69 A;  2HYX A;  2WCI A;  3QAG A;  4TN8 A;  1TDI A;  2LRC A;  3KH9 A;  4HUA A;  2YOI A;  1FW1 A;  3C7M A;  3GHA A;  2KP1 A;  4L5O A;  1XVW A;  1GSQ A;  2LQO A;  1GTB A;  1XWG A;  2O7K A;  1OC9 A;  1XIY A;  5COH A;  4X43 A;  6GSY A;  4MLY A;  3TDG A;  3UVH A;  1XWB A;  2I1U A;  2GQL A;  1QQ2 A;  2CQ9 A;  4MA9 A;  2KOK A;  2DJ2 A;  2PMT A;  4NXI A;  4LL1 B;  3WT2 A;  2MMN A;  3RDW A;  1W4V A;  2LKU A;  4EL1 A;  2HNL A;  3GL5 A;  5IO0 A;  2L4Q A;  2PBJ A;  1SD8 A;  1G7E A;  2RM5 A;  2YWM A;  1GSD A;  2OA7 A;  3FW2 A;  2YJH A;  5J41 A;  1EEM A;  1O73 A;  1AQW A;  3CXG A;  1N2A A;  5D96 A;  1Z6N A;  2HI7 A;  3IOS A;  4KF9 A;  2JAD A;  4Z2R A;  4HZ4 A;  1BG5 A;  1G7O A;  4K8M A;  3MSZ A;  2AB6 A;  5AIV A;  4YH2 A;  3D4M A;  4F03 A;  1XZO A;  3GYK A;  2GVP A;  7GSS A;  4KX4 A;  4I5Q A;  2DLX A;  1F6M C;  3ERG A;  2E7P A;  3GH6 A;  1SKW B;  3IHQ A;  3WT1 A;  2IIY A;  4K1F A;  2C0E A;  2WGR A;  2EC4 A;  1W89 A;  3BCK A;  4PNG A;  1BQ7 A;  5DQS A;  4OFN A;  4MDC A;  3FEU A;  4MF5 A;  5AIX A;  8GSS A;  4JR6 A;  4L5L A;  4I6X A;  1EGO A;  4HS1 A;  1JHB A;  3D0Z A;  2VCZ A;  2IMK A;  2GT5 A;  4XHM A;  3GUS A;  5ELG A;  5IMV A;  5ECM B;  2WZ9 A;  1T1V A;  4YAP A;  1SL0 B;  3TKS C;  5HR0 A;  5H5R A;  2AV4 A;  4GST A;  4BWS A;  4D73 A;  1TRU A;  2VD1 A;  3U6V A;  5ID2 B;  11GS A;  5HR2 A;  3KTL A;  2YNX A;  2C80 A;  2H74 A;  1F2E A;  1ZYN A;  3QAV A;  1TI1 A;  1ZCP A;  4Q5N A;  1FHE A;  4USS A;  6GSU A;  3VWX A;  3I9V 2;  4ACS A;  1PN0 A;  3QFA C;  3QFB C;  3BD2 A;  2CX3 A;  3EMP A;  14GS A;  1U87 A;  3LGC A;  3TOT A;  3TRP A;  5CRD A;  4K2D A;  4O92 A;  4WXT A;  4MCU A;  1T8E B;  3US3 A;  3D5J A;  2CZ3 A;  1K0M A;  3H93 A;  3LQ7 A;  4A5P A;  5KOW A;  3RAZ A;  5CRG A;  3Q18 A;  2LQQ A;  5CO3 A;  3A2W A;  4FYB A;  4IQA A;  5IOW A;  4XIH A;  4AGS A;  1XOB A;  3ISO A;  4QL7 A;  4F2I A;  2R0C A;  3QD9 A;  1TP9 A;  5CAX A;  3F3Q A;  4ID0 A;  16GS A;  4MP4 A;  3NIV A;  2GZZ A;  4I8B A;  1ON4 A;  3CSH A;  3EE2 A;  2CV4 A;  4KDU A;  3DRN A;  2AUV A;  4Q5F A;  4X1U A;  4TOP A;  3TRQ A;  3ZML A;  5KN3 A;  1M2B A;  1QMV A;  4WKW A;  5IIZ A;  4ULX A;  3HA9 A;  3FY7 A;  2YAN A;  1GL8 A;  2VUP A;  4KDY A;  4EKZ A;  3FMW A;  3GMF A;  2H0G A;  1FVK A;  2YP6 A;  1WPI A;  2RLI A;  2YN1 A;  1EP7 A;  4J2F A;  4YQM A;  2C0F A;  3LFL A;  4WBJ A;  2CZ2 A;  2GZY A;  1NM3 A;  1F3A A;  3CYN A;  3LXZ A;  1A2J A;  2E2G A;  4GQC A;  4ML1 A;  4NHZ A;  4YAV A;  1XW6 A;  2PN8 A;  2N5F A;  1TRW A;  1YF0 A;  2VL3 A;  4GF0 A;  5B8A A;  2H73 A;  2GSQ A;  1ACV A;  5DCG A;  3A5I A;  4RQR A;  5ECQ B;  1XCC A;  2MBS A;  1WIK A;  2IFQ B;  1GSF A;  3UEM A;  2CVB A;  5IQY A;  4L0U A;  2LRN A;  5A5K A;  4KB3 A;  4EO3 A;  2KUC A;  4G2E A;  2LUS A;  1PL1 A;  2R3X A;  1XOA A;  2P31 A;  1G6W A;  1QXH A;  2M80 A;  5AGY A;  3M9J A;  4OCF A;  1SU9 A;  1K3L A;  2G0F A;  1OVN A;  3GSS A;  2H8L A;  5ID2 A;  5HFG A;  4AJ6 A;  3DEX A;  1TJD A;  1GLQ A;  2P0G A;  4X0X A;  3HVS A;  1SJI A;  1H75 A;  1URM A;  2FWH A;  2R2J A;  3H79 A;  3HDC A;  1YY7 A;  1Z9H A;  3O6T A;  1XW5 A;  4LLR A;  1JZW A;  2VO4 A;  2HZE B;  3EIN A;  1PX6 A;  3MYD A;  3HVV A;  3MDK A;  2L6D A;  3C1S A;  2H72 A;  1SL2 B;  17GS A;  3S9F A;  4O5U A;  3HZ8 A;  1Q4J A;  3GL3 A;  1G0T A;  1VRS D;  2C0D A;  2JZS A;  3F4R A;  4MJC A;  5F07 A;  4FQU A;  3UJ1 A;  1O85 A;  5KN1 A;  3F4S A;  1O7U A;  4K9Z A;  2H1G A;  4PGT A;  1XW9 A;  1TI3 A;  5F8B A;  1Z3E A;  4MH3 A;  2P5R A;  4KGI A;  3MWH A;  2QA1 A;  6GSS A;  2PVO C;  5ECN B;  5H5Q A;  3GUR A;  2HFD A;  2L4C A;  2DJ0 A;  1TW9 A;  2CT6 A;  1EGR A;  3HY2 A;  1B9X C;  3WYW A;  4GXZ A;  2LV3 A;  1PSQ A;  1U3A A;  5DJL A;  1U6T A;  2VLV A;  3V1W A;  1OKT A;  3GA4 A;  3P90 A;  3DVW A;  3FZ5 A;  2GQM A;  1B4Q A;  1EOG A;  4BVY B;  1PL2 A;  2DKI A;  12GS A;  2H76 A;  4Z2T A;  3W8J A;  1KEB A;  4EUY A;  3ZYW A;  2QGV A;  1LBK A;  2H70 A;  1GTA A;  1WOU A;  2DC5 A;  4V2L A;  5J4U A;  4AF2 A;  3K8N A;  1MDK A;  2PWJ A;  1VF4 A;  1M0U A;  2H1B A;  5D9W A;  4KUN A;  1SJZ A;  3KEB A;  1GTI A;  4KCE A;  1A8L A;  1YQ1 A;  4CHS A;  1OAZ A;  3Q19 A;  5G5E A;  4PUR A;  1TKD B;  5JWR B;  1SK0 A;  3F9U A;  1ERW A;  1K3Y A;  1O8W A;  2QSI A;  3DKS A;  3Q6O A;  3FHK A;  3TOU A;  3KCM A;  2FHE A;  3RBT A;  3IV4 A;  3L9S A;  2C3N A;  2H30 A;  4IJ3 A;  2DIZ A;  2IFQ A;  1ZYE A;  3U5R E;  4DEJ A;  3FZA A;  1PKW A;  1XBS A;  2NDO A;  1AW9 A;  4OMV A;  4ECI A;  1LU4 A;  3HKR A;  3D6I A;  3GTU A;  1Z5Y E;  1S3C A;  3R3E A;  5DAK B;  1QFN A;  1B48 A;  5A4U A;  3NOF A;  1UA5 A;  1MD4 A;  1XVQ A;  2YZH A;  2LS5 A;  2NBS A;  2GSR A;  3CRT A;  2KHP A;  4K7I A;  4IVF A;  1Q98 A;  1GSE A;  2IL3 A;  3M9K A;  2VD0 A;  1TRS A;  5GST A;  2LNT A;  4POB A;  4G10 A;  3HJP A;  5HFI A;  2VAF A;  3HCZ A;  2UZ8 A;  3J7Y k;  2F3M A;  3C73 A;  5DJM A;  4HJM A;  4I97 A;  2HZE A;  3TRX A;  1JLW A;  1NW2 A;  3GKK A;  5DDL A;  3ZIV A;  3VPT A;  2R37 A;  3ZRD A;  4MF7 A;  2CA8 A;  4POK A;  1ZMA A;  4ZBD A;  2X8H A;  2DJ1 A;  3HJO A;  3EVI A;  1CQG A;  3L0H A;  3R2Q A;  3TKS E;  3F0I A;  5D93 A;  2VL2 C;  4N11 A;  2N5A A;  4TXV A;  3IR4 A;  4TR3 A;  1O8X A;  3MNG A;  2J9H A;  2P5Q A;  4L0W A;  1KBN A;  2DML A;  4H86 A;  1LJR A;  2FGX A;  5G1K A;  4JZQ A;  3TJG A;  1B9Y C;  1PMT A;  2V6O A;  1FOH A;  2HRF A;  2YV7 A;  5F05 A;  4GTU A;  5DBQ A;  3VWV A;  1YKC A;  1TRV A;  2PER A;  6GSV A;  4V1A p;  4WEY A;  4CY6 A;  1V2A A;  1FB6 A;  1YKA A;  4K7N A;  5CYY A;  1F3B A;  2VCX A;  5FT3 A;  4BVY A;  4LA1 A;  4FO5 A;  3GIX A;  2IMF A;  1V58 A;  1X5D A;  2EIR A;  3BOA A;  4K2X A;  3EMX A;  2BJX A;  2F51 A;  1GUK A;  1V57 A;  1O81 A;  1CQH A;  1PQN A;  2HZF A;  1THO A;  3QOU A;  4DVC A;  3UBK A;  2X8G A;  4Z2U A;  3CSI A;  1OE8 A;  3GKN A;  5ECH B;  3WGE A;  2DJK A;  1IYH A;  3E3E A;  5IMC A;  1TK8 B;  1GUH A;  2JU5 A;  3E9J B;  4MH2 A;  3KP9 A;  3FZ9 A;  1E6B A;  1TK5 B;  2K18 A;  4PUA A;  1O6J A;  4EE0 A;  1K0A A;  2R0G A;  1IYI A;  2JSY A;  5B6N A;  5BRT A;  4FYU A;  2H6X A;  4BPY A;  3LOR A;  1YDK A;  4I2U A;  5G5F A;  2R5G A;  1GSS A;  2H66 A;  3APQ A;  1M2D A;  3IK7 A;  2NVL A;  3UOM A;  3KM6 A;  5DAK A;  3A2X A;  5L71 A;  1GNW A;  3DWV A;  4ILF A;  4KCA A;  1FOV A;  2C3Q A;  2L57 A;  4K7O A;  2V32 A;  2XPE A;  4IP6 A;  1USB A;  3HD5 A;  2G2Q A;  2VLU A;  2GT6 A;  5JCW A;  2IN3 A;  1SK1 A;  2L5L A;  1ILO A;  1OC8 A;  4ZIL A;  2YPM A;  3DYR A;  2R0P A;  3ERW A;  4ZBB A;  3QDN A;  1XFL A;  3UAP A;  3UMA A;  4JE1 A;  4FIW A;  4WR5 A;  3KJY A;  1Z6M A;  4JU5 A;  5E59 A;  2GZP A;  5B7C A;  5LNK e;  2CAQ A;  3CRU A;  1JFU A;  1UVZ A;  3UIW A;  1VF2 A;  3WD6 A;  4F9Z A;  4ZB8 A;  2XHF A;  3LWA A;  2MMA A;  5BMU A;  3D4T A;  2VIM A;  5HQP A;  2H6Y A;  1K0D A;  3TKQ A;  2LTK A;  1I9D A;  3CBU A;  4G19 A;  3PR8 A;  2C1Y A;  4F82 A;  5F06 A;  1A2L A;  2B1K A;  2GGT A;  2H6Z A;  4IP1 A;  1DE2 A;  3KGK A;  3P2A A;  2LEG A;  3BCI A;  3LW9 A;  1SD9 A;  1Z7P A;  2VCQ A;  3IAM 2;  4IBP A;  1M9A A;  1QGV A;  3F6D A;  4EIP A;  5AIS A;  1M99 A;  5GSS A;  3F8U A;  1VGL A;  4OCE A;  2B5X A;  4TW5 A;  1ERU A;  4I2T A;  5J9C A;  2GS3 A;  2YWO A;  3AY8 A;  6GSW A;  3PH9 A;  4MF6 A;  3WGX A;  5INY A;  3C1R A;  1PD2 1;  4X4J A;  4BL7 B;  3IPZ A;  2QC7 A;  1MDJ A;  2OE1 A;  3EC3 A;  1PA3 A;  4ZBA A;  5KOX A;  4PQH A;  1WMJ A;  4FYC A;  3IA1 A;  3G7Y A;  4TR1 B;  4NV2 A;  2PVQ A;  3TJF A;  3VWU A;  1TTZ A;  1ZYP A;  1U88 A;  3ZZX A;  1K0B A;  2ZNM A;  1YJ6 A;  5E4W A;  4HOJ A;  3GX8 A;  4NPB A;  3MAK A;  3ME8 A;  2YWN A;  2EIO A;  4MZB A;  1SEN A;  1KTE A;  4DSR A;  1ST9 A;  1ZL9 A;  3TKP A;  3KXO A;  4GRF A;  3CMI A;  1XPV A;  1PKZ A;  2K6V A;  5J3R A;  2ON5 A;  5D9T A;  4BWQ A;  4HQZ A;  2VL2 A;  4IW9 A;  1N8J A;  3L4N A;  2L59 A;  2VL9 A;  1J0F A;  4XS4 B;  3KH7 A;  4CW9 A;  1SL1 B;  1T4Y A;  2FWF A;  3IHG A;  3WGD A;  4POM A;  3GFK A;  5A4V A;  3FRC A;  3IBH A;  3E0U A;  4TR0 A;  4JBB A;  2OBK A;  4AJ7 A;  3EU3 A;  3RHB A;  2E2M A;  4RI7 A;  4E8E A;  4Q5Q A;  3LYP A;  1X9M B;  2OE0 A;  2PU9 C;  1R5A A;  1XWC A;  4LL4 B;  3HZ4 A;  1OYJ A;  3TB2 A;  2MZC A;  2H1D A;  5J9B A;  1R4W A;  3N9J A;  2B7J A;  2A2S A;  1Y25 A;  1R7H A;  2O89 A;  2WFC A;  3TGZ A;  4HI7 A;  1HD2 A;  4QL9 A;  2PGT A;  3ZLP A;  3VK9 A;  1G6Y A;  1YF1 A;  3QCP A;  4EDY A;  3M8N A;  2H75 A;  1ABA A;  2AHE A;  5IMD A;  2PUK C;  4OWY A;  3LXT A;  4OFM A;  4K0G A;  3A2V A;  5IMZ A;  2A2P A;  5GAN D;  4F0C A;  1GNE A;  5D9X A;  1V98 A;  5FHI A;  4XS6 A;  1S3A A;  5H5S A;  4LMV A;  1E2Y A;  4HEA 2;  3KTB A;  3UL3 A;  4BVX B;  5DQY A;  2AYT A;  1EWX A;  4YQU A;  1MDI A;  2H01 A;  2I9H A;  4ECJ A;  1TK0 B;  4F0B A;  3GX0 A;  4PX1 A;  3ZFL A;  2X64 A;  1FG4 A;  4KAE A;  2B5E A;  3FK8 A;  1VF1 A;  5G31 A;  4BL7 A;  5KN0 A;  1SYX A;  1TU7 A;  1XWK A;  1Y6E A;  3F3R A;  1SK2 A;  4DSS B;  2FNO A;  1GP1 A;  5DVB A;  4TR1 A;  4RI6 A;  4N10 A;  1THX A;  4DSQ A;  1TOF A;  1DBY A;  1YZX A;  1X5E A;  3EU4 A;  4OFT A;  2NTO A;  2XPD A;  2C8U A;  2X8C A;  4NMU A;  1SKR B;  2X49 A;  4XS1 A;  3IDV A;  2HSH A;  3DXB A;  3GKX A;  5ECS A;  2FA8 A;  5EPF A;  3DML A;  4TKY A;  2LRT A;  3ME7 A;  5CP1 A;  3RPN A;  3ZL5 A;  3IE3 A;  4PQ1 A;  4CY8 A;  3ZTL A;  2JAC A;  4NWY A;  3PIN A;  4XS4 A;  4G0I A;  1R5P A;  3APS A;  2TIR A;  3H4K A;  5FWG A;  2CVD A;  4KE3 A;  3APO A;  3LJR A;  2R4V A;  5CRH A;  1A0F A;  1ERT A;  2KP2 A;  3GRX A;  4PUF C;  4MPG A;  2L6C A;  2CVK A;  3W6G A;  3SWL A;  2K8V A;  1PGT A;  3ERF A;  3QMX A;  3LSZ A;  2GDR A;  2O85 A;  3ZVJ D;  2HSM A;  5IPH A;  4V2N A;  2HRA A;  5ECP B;  1GTU A;  3TJK A;  2F8F A;  2WRT A;  3RPP A;  2N5B A;  2IMD A;  3P8W A;  3I43 A;  4ZL7 A;  1B8X A;  5B8B A;  1B4P A;  2MBT A;  2I81 A;  3GST A;  2H71 A;  3TUE A;  1GWC A;  2OBI A;  1V9W A;  4MJB A;  2V6K A;  2HXK A;  4HZ2 A;  1I5G A;  5D73 A;  3IC4 A;  2CX4 A;  3ZVJ A;  1T7P B;  4MMM A;  4Z7X A;  2LJR A;  4RUV A;  1BX9 A;  1NHY A;  3KZQ A;  1EOH A;  4YKG A;  1GH2 A;  2TRX A;  1SJ6 A;  1KNG A;  5IMF A;  2YZU A;  4ZIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...