1URMA

Human peroxiredoxin 5, c47s mutant
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
162
structure length
162
Chain Sequence
SAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGSSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antioxidant enzyme
molecule keywords PEROXIREDOXIN 5
publication title Crystal Structure of the C47S Mutant of Human Peroxiredoxin 5
doi rcsb
source organism Homo sapiens
total genus 49
structure length 162
sequence length 162
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2003-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1urmA00
1C72A 2LJKA 1V2AA 4AJ6A 1WRYA 3TKSE 1FAAA 1YDKA 5JCUA 1GSYA 2YPMA 3PGTA 3R2QA 4ECBA 3ZFLA 4IKHA 4MABA 3RPNA 3C73A 5JCGA 1XCCA 5HFGA 2YV7A 5HQPA 2EIRA 2VCVA 4OCFA 3A2VA 3TRPA 1R7HA 1F37A 3FHKA 3CBUA 3VI7A 4PNGA 3QAGA 1TI1A 4XS4B 4F03A 4F2IA 2LRCA 1FW1A 1R5PA 2CX4A 2HSYA 4OFTA 4K6XA 3GFKA 2IMKA 2PPTA 4IHUA 3TKSA 4TW5A 3KCMA 2LKUA 3GIXA 2FNOA 5DCGA 4IN0A 1A2LA 3H8QA 2C1YA 2HFDA 1YZXA 5AIVA 1MDKA 3BCKA 3A2XA 1R4WA 3AY8A 4X43A 2MBSA 3EURA 2CT6A 3DXBA 3QDNA 1NHOA 4KAEA 4GXZA 4ZB9A 2WDUA 1U3IA 3F63A 2C3NA 1BEDA 2GT5A 4XS1A 4IGJA 3EU3A 4EC0A 3I6AA 5IOXA 3BOAA 4K7IA 4MJBA 5D9XA 3TJJA 1X9MB 4HZ2A 2E7PA 4I5QA 1K0DA 4V1Ag 3US3A 3KXOA 4EVMA 2CA8A 3EMXA 4F82A 6GSWA 4PXOA 4V1Ap 4OD7A 4KSMA 2C0DA 2WS2A 3O76A 3IR4A 4JRRA 3UARA 5KN3A 1BG5A 2R3XA 3F6FA 2X64A 3Q18A 5CYYA 3VPTA 4G19A 1T4YA 1FHEA 1O81A 5IMCA 1F6MC 3O3TA 3GH9A 2YOIA 4TR4A 1GP1A 5DJLA 1OVNA 4CHSA 3L0HA 4AGSA 3HXSA 4FYBA 1VF2A 2CVDA 1A23A 3MAKA 3DEXA 2LNTA 5JWRB 4BVYA 1SKRB 3GRXA 3EYTA 1EGRA 3VFIA 3QFAC 2VLUA 4QQ7A 4WEYA 3ZFBA 3QMXA 1YEPA 2IPAA 3TJFA 1TW9A 2DBCA 5ECRB 3KTBA 4OO4A 3N5OA 2CVBA 1Z6MA 1TDIA 2B5XA 5D93A 5KN1A 4HJ2A 2VLTA 4JU5A 4LMWA 2B6MA 6GSXA 1ILOA 2V2GA 3GKMA 3Q74A 2H6XA 2LJAA 3KZQA 2BTOT 3FW2A 4XCSA 2F8AA 2BJXA 2YZUA 2YWNA 4Q5FA 3IXRA 2GZZA 22GSA 2LQQA 2OBKA 1O7UA 1FG4A 1X5EA 3ZREA 2C4JA 3ZVJD 1OC9A 1ACVA 4PQIA 3TKPA 2L59A 1FB6A 1PD21 3TRQA 3S9FA 5C04A 3I9V2 2I9HA 3D4MA 4OFNA 1SK0A 2QC7A 2I3YA 2NVLA 2MZCA 2K8SA 4WETA 3F9UA 1GTIA 4DSRA 2O89A 2GTUA 2EC4A 5ABRA 5GZZB 1SL1B 3IAM2 3E0UA 3HZ4A 1QMVA 1XWAA 3EC3A 1JLWA 8GSSA 3M0FA 1EEMA 1SD8A 2WZ9A 2R2JA 3TKQA 3RBTA 2AAWA 4MP4A 5E4WA 1V57A 1AQWA 1ERVA 4MMMA 3ZZXA 4TRXA 2FCHA 4F0BA 4RI6A 3GX8A 16GSA 1Y25A 2GZYA 3GSSA 3QAWA 3WGEA 3MSZA 2PN8A 3ZMKA 4RUVA 1E2YA 2G0FA 4EO3A 4JEDA 2DJ2A 4E8HA 3UBLA 3WYWA 4N0VA 2C0EA 2HZEB 2MYGA 1MTCA 3A3TA 1K3YA 4H86A 4MDCA 3IV4A 4OWYA 4E8EA 17GSA 5F0GA 11GSA 4P3YB 4I97A 4TVEA 2K18A 3ZITA 3GKKA 2A4VA 2YANA 1HNCA 2F9SA 2M80A 2H19A 5CAXA 3G7IA 4AF2A 4L0WA 1SK2A 5F07A 1NM3A 5B6NA 3PR8A 3ZMLA 1ERUA 3C1RA 1TTZA 1O8XA 1RK4A 4Q5QA 1WJKA 3GH6A 1UC7A 2AUVA 1IYIA 3I69A 3MNGA 3CYNA 3LXZA 1CQHA 2X8HA 4KA0A 1IYHA 3GX0A 4F9ZA 1GH2A 1O8WA 1FOVA 5GAPD 1M99A 2DJ1A 5ECLB 2X8GA 1GULA 4LL1B 2YCDA 2IWTA 1MDIA 1SK1A 4MF7A 1S3CA 3F4SA 5A4WA 1M9BA 2C3QA 2L6DA 2FA8A 2GQLA 3HDCA 2C0FA 1TU7A 4HQZA 4LA1A 3G9BA 4IJIA 2HT9A 4NMUA 1THOA 3EVIA 4FYUA 3HYPA 3F4RA 2X8CA 2J9HA 1PSQA 4GQFA 4ECIA 2JZTA 2JSZA 3FZ9A 1T7PB 1LU4A 1WIKA 2NBSA 2R37A 2FY6A 3P8WA 4KDXA 2VLVA 2O8VB 3GL3A 4QL9A 4BA7A 4MJAA 5LCZA 2F3MA 1TRSA 2HNLA 5D73A 1X0RA 1Q4JA 2L4CA 4XS4A 2CZ3A 1M2DA 1BJXA 2P5QA 2OE1A 2IFQB 2F51A 4GQCA 3FRCA 2L57A 4XIHA 5AN1A 3UIWA 2E0QA 5DJMA 1XWBA 3VLNA 3K8NA 5COHA 3TCOA 5IOWA 3E3EA 3LWAA 1T8EB 5CRHA 3DWVA 2L5LA 1EV9A 1XVQA 2HRFA 5B7CA 3QR6A 4DSSB 1Z6NA 3DVXA 4ML1A 2C8UA 1A8LA 4JBBA 3EINA 1EZKA 4HDEA 2VO4A 3FY7A 1USBA 1K0BA 3HD5A 1VF4A 4IS0A 1WP0A 4MJEA 2H1GA 1V98A 2KP2A 4LMVA 4OO5A 1SYRA 5DVBA 12GSA 1TJDA 3PINA 2IN3A 3IA1A 3EWLA 2JL4A 1M0UA 3SBCA 3ZL5A 2WCIA 3KMOA 2YP6A 4TR0A 1GSUA 4PQ1A 4EUYA 1T00A 5IMFA 2LRNA 5A4UA 4ZL8A 1FO5A 3CSIA 1EP8A 5J41A 4GSSA 2AYTA 1GWCA 2H0GA 2OADA 4WF4A 2K8VA 4WR5A 2V41A 2V1MA 4G2EA 4MA9A 2CVKA 2VOCA 2OA7A 6GSSA 3ZIVA 2ON5A 1XWGA 3F6DA 3WT1A 3Q19A 3TOUA 3C1SA 3C7MA 3UL3A 1DUGA 2X99A 1G7OA 4KB3A 1U87A 2GT6A 2IIYA 4NWYA 2B1KA 1GUHA 1QQ2A 4XTSA 4EDZA 3L9SA 3A5WA 5ECPB 1OYJA 2FHEA 3LSZA 2I81A 1J9BA 1R5AA 4F0CA 1ZMAA 4MF5A 1GNWA 4BL7A 3KEBA 1FB0A 2JZSA 1Q98A 19GSA 2AHEA 3ZVJA 3GA4A 2B1LA 2XC2A 2XPDA 2RM6A 3NIVA 6GSYA 1AW9A 1LBKA 3CRTA 2GSQA 3KTLA 3DMLA 2TRXA 4FYCA 2EIOA 4V2NA 2QKEA 1JZDA 3OR5A 2B7JA 2IMIA 3CTGA 4YQUA 4O92A 1T1VA 5B8BA 3HVSA 3IDVA 1QXHA 4MPGA 5D96A 2L4QA 1K0CA 4QL7A 5AGYA 2YN1A 3WGDA 2YJHA 4KCEA 3LEFA 3EU4A 1O6JA 4YH2A 3WT2A 4X1UA 4J2FA 1T4ZA 4TKYA 4I2TA 1TRVA 1H75A 2CZ2A 6GSUA 4Q5RA 2DC5A 4JZQA 3L78A 3CTFA 5DQSA 4DVCA 1AXDA 4MZBA 3IE3A 2LUSA 2R5GA 3VK9A 1GSEA 2C0GA 3BBYA 1QFNA 2J23A 1Y6EA 2GSRA 3FZ5A 4J57E 3M3MA 2IMEA 5JCWA 1MD3A 1QGVA 4KUNA 3C71A 5ENUA 13GSA 1YY7A 3M9KA 1A0RP 2I1UA 2GLRA 2PU9C 4J56E 1EEJA 3FR3A 3C8EA 1HD2A 5JWOB 1K3OA 2MMOA 3P7XA 1Z5YE 3H79A 5DCHA 3TKSC 5B6MA 1SL2B 2HZEA 2H71A 2XHFA 3H4KA 1F3AA 5D8IA 4WF5A 3GMFA 4JR4A 1DBYA 2R4VA 2GVPA 4XHMA 1Z7PA 1Z3EA 2HLSA 2VCQA 2H76A 1Z7RA 4WBRD 3FR9A 2IMFA 3VURA 1GNEA 4L5OA 3QCPA 2RIIA 5D9WA 5EY6A 3KD0A 1X5DA 2DJ0A 4O32A 4RQXA 3P2AA 3L9UA 2KLXA 3GKXA 3UVTA 3D22A 3TRXA 4MJCA 2WFCA 1B48A 5A4VA 2GDRA 3QFBC 1R26A 2H01A 4KW6A 1EOGA 2C3TA 2FUG2 1XW6A 1ST9A 4ZBBA 1URMA 4GTUA 5CNWA 4N10A 1ERTA 3KH9A 3ZLPA 5DDLA 3D4TA 3MWHA 4YQVA 1UA5A 4ZB6A 3IK9A 1AAZA 1ERWA 1UN2A 1TXXA 3QD9A 4HEA2 3KM6A 2N5BA 5CRWA 2XBIA 4O5RA 1XPVA 2OE3A 4MH2A 5KN0A 1GSDA 2B5YA 4GCIA 1SKWB 1ON4A 1PL1A 4K1FA 1O85A 2NTOA 5IMVA 2FWGA 1YEXA 2NPBA 1XOBA 3LFLA 1A8YA 2GQMA 4PUFC 4TN8A 1G6YA 3GHAA 4N11A 2ON7A 3VWXA 18GSA 3QPMA 3GYKA 2PVQA 3IK7A 3FYGA 1THXA 4HUAA 2CAQA 4NV2A 3WGXA 2H70A 2C80A 1TKDB 3TKRA 1XW9A 2WJUA 5G5FA 1J08A 5D9TA 2H1BA 3D0ZA 1XVWA 1SYXA 3NZNA 1SKSB 2HYXA 2XBQA 2M46A 1M9AA 5IPGA 1W4VA 4I8BA 2VL2A 4HU7A 1B4PA 2YV9A 5DBQA 1KEBA 2IFQA 2FD3A 4V2MA 1TRUA 2LJRA 5FHIA 2VIMA 2HE3A 3HA9A 1XBSA 5ECSA 3M9JA 4NPBA 4GSTA 1CQGA 1JZRA 3GKNA 2H1AA 4D73B 2NDOA 3FKFA 1XWKA 3ZIJA 2REMA 1S3AA 2B5EA 3L4NA 3IC4A 3WD6A 3FR6A 3CRUA 4DSSA 3U5RE 4KDYA 5FWGA 2KP1A 2H6ZA 3LG6A 3G7YA 3HJOA 1N2AA 5GSSA 4EDYA 4OFMA 4K7OA 3U6VA 2KHPA 5JWQB 2PWJA 4PNFA 5DAKB 2ZNMA 2OKAA 10GSA 3LYPA 4ISDA 4EL1A 3BD2A 1GTUA 2FWFA 3HY2A 3W8SA 4ZXGA 5HR0A 1G6WA 2BMXA 2HI7A 2PVOC 4IVFA 1X9SB 4X0XA 2HRNA 4EE0A 3CSJA 1LJRA 1XWCA 2AB6A 2B7KA 2VCXA 5GSTA 3TOTA 1ZZYA 2L5OA 5IO2A 4JR6A 1ML6A 3A2WA 2CV4A 1BX9A 3ISOA 5ECHB 1TI3A 1AQXA 1U3AA 20GSA 4HI7A 6GSVA 1GSQA 2MMZA 4KSOA 3UJ1A 1H4OA 3LORA 1HYUA 3GTUB 2PERA 4MH3A 4HU9A 3KH7A 3HJPA 2KOKA 4ECCA 3DKSA 2GQKA 1A24A 3J7Yb 1GSSA 3F0IA 4K0GA 4OCEA 5GAND 2GSSA 4IP1A 1GLQA 4HQSA 2V32A 1JZOA 4POKA 4FIWA 1XXUA 3ERWA 2V6OA 3IHQA 1BQ7A 3UOMA 5J4UA 3DYRA 1GRXA 5ECKB 5H5QA 5AIXA 4KE3A 4FH8A 1BAYA 3IPZA 2JADA 2LRTA 3UVHA 1YKAA 2ZCTA 1PMTA 1SD9A 1OAZA 1SL0B 1EWXA 1TOFA 4IELA 1GSFA 2GGTA 2DSAA 1GUKA 2MMAA 2H6YA 3HKRA 2FLSA 2VL3A 2H30A 1GUMA 2O7KA 2B3SA 3KP9A 3TJBA 1Z9HA 5LNKe 1PX7A 1K0OA 2RLIA 4LLRA 3TJGA 1YF1A 1MEKA 4ZL9A 1K0NA 5CRDA 3UAPA 2H72A 1JHBA 4KCAA 2QSIA 3HJMA 4TOPA 4GF0A 1PKWA 4IQAA 2YZHA 4BWQA 4WBJA 4BWSA 1NHYA 4NHWA 3HVVA 1XOAA 3LGCA 4POBA 1I9DA 4ZILA 3IOSA 1ZCPA 2DLXA 2VCTA 2VM2A 2JSYA 4GSNA 4WKWA 4ECJA 2O85A 4Z7XA 3GV1A 2TRCP 2ALBA 5IQYA 1F2EA 5G1KA 4NV5A 1A0FA 2DIYA 5ECOB 3MDKA 4POLA 2YWIA 4AJ8A 1GTAA 2VD0A 1SU9A 2OJLA 3P90A 1GTBA 4MLYA 1K3LA 5HR2A 2H0IA 7GSSA 2VCZA 1XZOA 5ID2B 1B4QA 1RQMA 4N30A 1FVJA 4KH7A 1TK0B 1J0FA 2OACA 2CAIA 1F9MA 5G1LA 4EXJA 5IPHA 1EOHA 14GSA 4ZBAA 2D2ZA 2H74A 4PX1A 3VWVA 2FGXA 3LYKA 4K9ZA 1VGLA 4ULXA 2YWMA 3QAVA 4N0ZA 1GL8A 1WWJA 3FZ4A 3PH9A 5AISA 3L9VA 5EVOA 1BYEA 1WE0A 4NXIA 3HHVA 4TXOB 3ME7A 3HVXA 1WOUA 2LEGA 1G0TA 4L8EA 5HFKA 1S3DA 1MD4A 3I43A 2CQ9A 2GSTA 4TR1B 2A2RA 2GZPA 1PGTA 1E6BA 5DALB 1OKTA 1G7EA 4HZ4A 4GWRA 2Z9SA 1YQ1A 1HQOA 1OE7A 5IMDA 1U6TA 1O73A 1ZL9A 4K7NA 1YKCA 2A2SA 4V2LA 1VF3A 3M1GA 4ILFA 4RI7A 1SJIA 5G30A 5B8AA 1B9YC 5INYA 4MF6A 3SWLA 4TR3A 5A5KA 1M7TA 4K2DA 1V9WA 2JZRA 4ZIJA 3ERGA 1HNAA 3IBHA 3APQA 1PX6A 3KMNA 5G2ZA 6GSTA 1MDJA 3ERFA 3J7Yk 5FT3A 4Q5NA 5HFIA 3G7JA 1TP9A 2I4AA 5DQYA 4CDOA 4JE1A 3Q6OA 3GNJA 4YQMA 1AQVA 2IL3A 1I5GA 2N5AA 4G9HA 5L71A 4K0NA 4ML6A 2LQOA 3F3QA 5ELAA 1XW5A 4KGIA 1OE8A 2QGVA 3DRNA 2VCWA 2JU5A 5C00A 2IMDA 4GRFA 2E2MA 1PN9A 3F4TA 1WMJA 2XPEA 3RHCA 3TJKA 4D73A 2DJJA 2DMMA 2VD1A 4EKZA 1ZGNA 3UMAA 3CMIA 2DMLA 2H1DA 2PUKC 2H75A 5KEJA 2JACA 1V58A 3N9JA 1DE1A 1SJ6A 1EV4A 4HOJA 5IM9A 1KNGA 4BPYA 3NOFA 1DE2A 5G31A 3EE2A 5IO0A 5IIZA 2DJ3A 4YAVA 1B9XC 1SJZA 5F06A 5H5SA 5DAKA 3KIJA 4HJMA 4L0UA 1WPIA 2G2QA 3EMPA 1VRSD 3LQ7A 5ECNB 2CX3A 3LJRA 3APSA 3TDGA 2GS3A 2HSHA 4XS6A 4O7HA 4KNDA 3RAZA 2RUEA 3VPQA 4EF0A 1JFUA 3ZYWA 4ID0A 2ES7A 1K0AA 1A2JA 2H66A 3IRAA 3V1WA 5CO3A 1OC3A 3QOUA 1KTEA 5CP1A 1RW1A 2V6KA 5EL8A 3CSHA 4FO5A 1EGOA 3GTUA 3ED3A 3HCZA 4YAPA 1PQNA 2FWEA 5J9BA 1U88A 2PMTA 2ZUPA 2RUFA 3KGKA 2OE0A 2F8FA 4I6XA 5IMZA 1PL2A 9GSSA 2MMNA 3TB2A 1YF0A 3CXGA 5F05A 4MK3A 2H73A 1PRXA 2AV4A 3JCML 3ME8A 5ELGA 1KBNA 1M2BA 5CREA 2H8LA 2VL9A 1GLPA 2DJKA 3D5JA 1QUWA 2N5FA 1HNBA 5HR3A 3RHBA 2YJ7A 1SENA 2YWOA 4XRDA 4G10A 1ZOFA 1B8XA 1OC9B 2HXKA 4KDUA 3TUEA 5LD0A 3BCIA 4PQHA 4CW9A 4MPFA 1T3BA 3W6GA 4AJ7A 5J9CA 4NAXA 1JLVA 3E9JB 3DVWA 1FVKA 3GURA 3BJ5A 1AUCA 3KJYA 4POMA 2LNSA 4ZB8A 4OMVA 1TK8B 3F8UA 4MZWA 5HR1A 3GN3A 1QK8A 4XRAA 1N8JA 2EIQA 3LXTA 4PGTA 5G5EA 2M72A 3VWWA 3TGZA 4DEJA 2AJQB 3VI5A 1ZYQB 3KP8A 3UBKA 2LTKA 3M8NA 5F8BA 3APOA 3H93A 4IP6A 1F3BA 2RM5A 4PUAA 1W89A 3UEMA 4IJ3A 2YNXA 3F3RA 3GL5A 2R6KA 1X5CA 3W8JA 4WR4A 4IW9A 2H0HA 2FWHA 2LV3A 2VL2C 3IAS2 5KN2A 3FEUA 5EPFA 4IQ1A 4NHZA 4LL4B 3H1NA 5J3RA 2FA4A 1VF1A 4GLTA 2MBTA 5ECIB 1NSWA 2HZFA 2L6CA 3D21A 1XFLA 1X9WB 2P0GA 2KUCA 5ID2A 4K8MA 1PKZA 5E59A 2P5RA 1M2AA 4L5LA 2VM1A 5ECQB 2PBJA 1YJ6A 3GUSA 1A2MA 5IMAA 2K6VA 4TXVA 5ECMB 3O6TA 2WRTA 5H5RA 1UVZA 4ACSA 4KX4A 2LS5A 5D9VA 5J5NA 2OBIA 4BVXA 1XIYA 1OC8A 4MZCA 4WXTA 1DSBA 3ZTLA 2VAFA 4MCUA 3DD3A 1K0MA 2IJYA 1AIUA 4PURA 3D6IA 1NW2A 2LSTA 3FK8A 4DSQA 3GSTA 1TRWA 4ZL7A 4TXOA 2WB9A 4RQRA 2E2GA 1OKDA 1TK5B 1TU8A 1JZWA 3ZRDA 1EP7A 2WGRA 4ZBDA 2O87A 4TR1A 2TIRA 1AC1A 3VWUA 2DIZA 2WULA 3HZ8A 1ZYEA 4I2UA 5DALA 5CRGA 2P31A 3RDWA 2PGTA 2VUPA 2K9FA 4HS1A 1ABAA 3DGQA 1PA3A 3DIEA 1V40A 3FZAA 4IBPA 3RPPA
chains in the Genus database with same CATH superfamily
1C72A 2LJKA 1V2AA 4AJ6A 1WRYA 3TKSE 1FAAA 1YDKA 5JCUA 1GSYA 2DKHA 2YPMA 3PGTA 3R2QA 4ECBA 3ZFLA 4IKHA 4MABA 3RPNA 3C73A 5JCGA 1XCCA 5HFGA 2YV7A 5HQPA 2EIRA 2VCVA 4OCFA 3A2VA 3TRPA 1R7HA 1F37A 3FHKA 3CBUA 3VI7A 4PNGA 3QAGA 1TI1A 4XS4B 4F03A 4F2IA 2LRCA 1FW1A 1R5PA 2CX4A 2HSYA 4OFTA 4K6XA 3GFKA 2IMKA 2PPTA 4IHUA 3TKSA 4TW5A 3KCMA 2LKUA 3GIXA 2FNOA 5DCGA 4IN0A 1A2LA 3H8QA 2C1YA 2HFDA 1YZXA 5AIVA 1MDKA 4Z2UA 3BCKA 3A2XA 1R4WA 3AY8A 4X43A 2MBSA 3EURA 2CT6A 3DXBA 3QDNA 1NHOA 4KAEA 4GXZA 4ZB9A 2WDUA 1U3IA 2DKIA 3F63A 2C3NA 1BEDA 2GT5A 4XS1A 4IGJA 2UZ8A 3EU3A 4EC0A 3I6AA 5IOXA 3BOAA 4K7IA 4MJBA 5D9XA 1ZYNA 3TJJA 1X9MB 4HZ2A 2E7PA 4I5QA 1K0DA 4V1Ag 3US3A 3KXOA 4EVMA 3EPTA 2CA8A 3EMXA 4F82A 6GSWA 4PXOA 4V1Ap 4OD7A 4KSMA 2C0DA 2WS2A 3O76A 3IR4A 4JRRA 3UARA 5KN3A 1BG5A 2R3XA 3F6FA 2X64A 3Q18A 1FOHA 5CYYA 3VPTA 4G19A 1T4YA 1FHEA 1O81A 5IMCA 1F6MC 3O3TA 3GH9A 2A2PA 2YOIA 4TR4A 1GP1A 5DJLA 1OVNA 4CHSA 3L0HA 4AGSA 3HXSA 4FYBA 1VF2A 2CVDA 1A23A 3MAKA 3DEXA 2LNTA 5JWRB 4BVYA 1SKRB 3GRXA 3EYTA 1EGRA 3VFIA 3QFAC 2VLUA 4QQ7A 4WEYA 3ZFBA 3QMXA 1YEPA 2IPAA 3TJFA 1TW9A 2DBCA 4BL7B 5ECRB 4Z2RA 3KTBA 4OO4A 1PFOA 3N5OA 2CVBA 1Z6MA 1TDIA 2B5XA 5D93A 5KN1A 4HJ2A 2VLTA 4JU5A 4LMWA 2B6MA 6GSXA 1ILOA 2V2GA 3GKMA 3Q74A 2H6XA 2LJAA 3KZQA 2BTOT 3FW2A 4XCSA 2F8AA 2BJXA 2YZUA 2YWNA 4Q5FA 3IXRA 2GZZA 22GSA 2LQQA 2OBKA 1O7UA 1FG4A 1X5EA 3ZREA 2C4JA 3ZVJD 1OC9A 1ACVA 4PQIA 3TKPA 2L59A 1FB6A 1PD21 3TRQA 4G0KA 3S9FA 5C04A 3I9V2 2I9HA 3D4MA 4OFNA 1SK0A 2QC7A 2I3YA 2NVLA 2MZCA 2K8SA 4WETA 3F9UA 1GTIA 4DSRA 2O89A 2GTUA 2EC4A 5ABRA 5GZZB 1SL1B 3IAM2 3E0UA 3HZ4A 1QMVA 1XWAA 3EC3A 1JLWA 8GSSA 3M0FA 1EEMA 1SD8A 2WZ9A 2R2JA 3TKQA 3RBTA 2AAWA 4MP4A 5E4WA 1V57A 1AQWA 1ERVA 4MMMA 3ZZXA 4TRXA 2FCHA 4F0BA 4RI6A 3GX8A 16GSA 1Y25A 2GZYA 3GSSA 3QAWA 3WGEA 3MSZA 2PN8A 3ZMKA 4RUVA 1E2YA 2G0FA 4EO3A 4JEDA 2DJ2A 4E8HA 3UBLA 3WYWA 4N0VA 2C0EA 2HZEB 5KOWA 2MYGA 1MTCA 3A3TA 1K3YA 4H86A 4MDCA 3IV4A 4OWYA 4E8EA 17GSA 5F0GA 11GSA 4P3YB 4I97A 4TVEA 2K18A 3ZITA 3GKKA 2A4VA 2YANA 4USSA 1HNCA 2F9SA 2M80A 2H19A 5CAXA 3G7IA 4AF2A 4L0WA 1SK2A 5F07A 1NM3A 5B6NA 3PR8A 3ZMLA 1ERUA 3C1RA 1TTZA 1O8XA 1RK4A 4Q5QA 1WJKA 3GH6A 1UC7A 2AUVA 1IYIA 3I69A 3MNGA 3CYNA 3LXZA 1CQHA 2X8HA 4KA0A 1IYHA 3GX0A 4F9ZA 1GH2A 1O8WA 1FOVA 5GAPD 1M99A 2DJ1A 5ECLB 2X8GA 1GULA 4LL1B 2YCDA 2IWTA 1MDIA 1SK1A 4MF7A 1S3CA 3F4SA 5A4WA 1M9BA 2C3QA 2L6DA 2FA8A 2GQLA 3HDCA 4EIQA 2C0FA 1TU7A 4HQZA 4LA1A 3G9BA 4IJIA 2HT9A 4NMUA 1THOA 3EVIA 4FYUA 3HYPA 3F4RA 2X8CA 2J9HA 1PSQA 2R0PA 4O5QA 4GQFA 4ECIA 2JZTA 2JSZA 3FZ9A 1T7PB 1LU4A 1WIKA 2NBSA 2R37A 2FY6A 3P8WA 4KDXA 2VLVA 2O8VB 3GL3A 4QL9A 4BA7A 4MJAA 5LCZA 2F3MA 1TRSA 2HNLA 5D73A 1X0RA 1Q4JA 2L4CA 4XS4A 2CZ3A 1M2DA 1BJXA 2P5QA 2OE1A 2IFQB 2F51A 4GQCA 3FRCA 2L57A 4XIHA 5AN1A 3UIWA 2E0QA 5DJMA 3MYDA 1XWBA 3VLNA 3K8NA 5COHA 3TCOA 5IOWA 3E3EA 3LWAA 1T8EB 5CRHA 3FMWA 3DWVA 2L5LA 1EV9A 1XVQA 2HRFA 5B7CA 3QR6A 4DSSB 1Z6NA 3DVXA 4ML1A 2C8UA 1A8LA 4JBBA 3EINA 1EZKA 4HDEA 2VO4A 3FY7A 1USBA 1K0BA 5KOXA 3HD5A 1VF4A 4IS0A 1WP0A 4MJEA 2H1GA 1V98A 2KP2A 4LMVA 4OO5A 1SYRA 5DVBA 12GSA 1TJDA 3PINA 2IN3A 3IA1A 3EWLA 2JL4A 1M0UA 3SBCA 3ZL5A 2WCIA 1M3IA 3KMOA 2YP6A 4TR0A 1GSUA 4PQ1A 4EUYA 1T00A 5IMFA 2LRNA 5A4UA 4ZL8A 1FO5A 3CSIA 1EP8A 5J41A 4GSSA 2AYTA 1S3RA 1GWCA 2H0GA 2OADA 4WF4A 2K8VA 4WR5A 2V41A 2V1MA 4G2EA 4MA9A 2CVKA 4HSCX 2VOCA 2OA7A 6GSSA 3ZIVA 2ON5A 1XWGA 3F6DA 3WT1A 3Q19A 3TOUA 3C1SA 3C7MA 3UL3A 1DUGA 2X99A 1G7OA 4KB3A 1U87A 2GT6A 2IIYA 4NWYA 2B1KA 1GUHA 1QQ2A 4XTSA 4EDZA 3L9SA 3A5WA 5ECPB 1OYJA 2FHEA 3LSZA 2I81A 1J9BA 1R5AA 4F0CA 1ZMAA 4MF5A 1GNWA 4BL7A 3KEBA 1FB0A 2JZSA 5BRTA 2X4AA 1Q98A 19GSA 2AHEA 3ZVJA 3GA4A 2B1LA 2XC2A 2XPDA 2RM6A 3NIVA 6GSYA 1AW9A 1LBKA 3CRTA 2GSQA 3KTLA 3DMLA 2TRXA 4FYCA 2EIOA 4V2NA 2QKEA 1JZDA 3OR5A 1ZYPA 2B7JA 2IMIA 3CTGA 4YQUA 4O92A 1T1VA 5B8BA 3HVSA 3IDVA 1QXHA 4MPGA 5D96A 2L4QA 1K0CA 4QL7A 5AGYA 2YN1A 3WGDA 2YJHA 4KCEA 3LEFA 3EU4A 1O6JA 4YH2A 3WT2A 4X1UA 3HVNA 4J2FA 1T4ZA 4TKYA 4I2TA 1TRVA 3A5IA 1H75A 2CZ2A 6GSUA 4Q5RA 2DC5A 4JZQA 3L78A 3CTFA 5DQSA 4DVCA 1AXDA 4MZBA 3IE3A 2LUSA 2R5GA 3VK9A 1GSEA 2C0GA 3BBYA 1QFNA 2J23A 1Y6EA 2GSRA 3FZ5A 4J57E 3M3MA 2IMEA 5JCWA 1MD3A 1QGVA 4KUNA 3C71A 5ENUA 13GSA 1YY7A 3M9KA 1A0RP 2I1UA 2GLRA 2PU9C 4J56E 2R0GA 1EEJA 3FR3A 3C8EA 1HD2A 5JWOB 1K3OA 2MMOA 3P7XA 1Z5YE 3H79A 5DCHA 3TKSC 5B6MA 1SL2B 2HZEA 2H71A 2XHFA 3H4KA 1F3AA 5D8IA 4WF5A 3GMFA 4JR4A 1DBYA 2R4VA 2GVPA 4XHMA 1Z7PA 1Z3EA 2HLSA 2VCQA 2H76A 1Z7RA 4WBRD 3FR9A 2IMFA 3VURA 1GNEA 4L5OA 3QCPA 2RIIA 5D9WA 5EY6A 3KD0A 4K5RA 1X5DA 2DJ0A 4O32A 4RQXA 3P2AA 3L9UA 2KLXA 3GKXA 3UVTA 3D22A 3TRXA 4MJCA 2WFCA 1B48A 5A4VA 2GDRA 3QFBC 1R26A 2H01A 4KW6A 1EOGA 2C3TA 2FUG2 1XW6A 1ST9A 4ZBBA 1URMA 4GTUA 5CNWA 4N10A 1ERTA 3KH9A 3ZLPA 5DDLA 3D4TA 3MWHA 4YQVA 1UA5A 4ZB6A 3IK9A 1AAZA 1ERWA 1UN2A 1TXXA 3QD9A 4HEA2 3KM6A 2N5BA 5CRWA 2XBIA 4O5RA 1XPVA 2OE3A 4MH2A 5KN0A 1GSDA 2B5YA 4GCIA 1SKWB 1ON4A 1PL1A 4K1FA 1O85A 2NTOA 5IMVA 2FWGA 1YEXA 2NPBA 1XOBA 3LFLA 1A8YA 2GQMA 4PUFC 4TN8A 1G6YA 3GHAA 4N11A 2ON7A 3VWXA 18GSA 3QPMA 3GYKA 2PVQA 3IK7A 3FYGA 1THXA 4HUAA 2CAQA 4NV2A 3WGXA 2H70A 2C80A 1TKDB 3TKRA 1XW9A 2WJUA 5G5FA 1J08A 5D9TA 2H1BA 3D0ZA 1XVWA 1SYXA 3NZNA 1SKSB 2HYXA 2XBQA 2M46A 1M9AA 5IPGA 1W4VA 4I8BA 2A4HA 2VL2A 4HU7A 1B4PA 2YV9A 5DBQA 1KEBA 2IFQA 2FD3A 4V2MA 1TRUA 2HSMA 2LJRA 5FHIA 2VIMA 2HE3A 3HA9A 1XBSA 5ECSA 3M9JA 4NPBA 4GSTA 1CQGA 1JZRA 3GKNA 2H1AA 4D73B 2NDOA 3FKFA 1XWKA 3ZIJA 2REMA 1S3AA 1PN0A 2B5EA 3L4NA 3IC4A 3WD6A 3FR6A 4YKGA 3CRUA 4DSSA 3U5RE 4KDYA 5FWGA 2KP1A 2H6ZA 3LG6A 3G7YA 3HJOA 4EIPA 1N2AA 4BIKA 5GSSA 4EDYA 4OFMA 4K7OA 3U6VA 2KHPA 5JWQB 4PTSA 2PWJA 4PNFA 5DAKB 2ZNMA 2OKAA 10GSA 3LYPA 4ISDA 4EL1A 3BD2A 1GTUA 2FWFA 3HY2A 3W8SA 4ZXGA 5HR0A 1G6WA 2BMXA 2HI7A 2PVOC 4IVFA 1X9SB 4X0XA 2HRNA 4EE0A 3CSJA 1LJRA 1XWCA 2AB6A 2B7KA 2VCXA 5GSTA 3TOTA 1ZZYA 2L5OA 5IO2A 4JR6A 1ML6A 3A2WA 2CV4A 1BX9A 3ISOA 5ECHB 1TI3A 2R0CA 1AQXA 1U3AA 20GSA 4HI7A 6GSVA 1GSQA 2MMZA 4KSOA 3UJ1A 1H4OA 3LORA 4CY8A 1HYUA 3GTUB 3R3EA 2PERA 4MH3A 4HU9A 3KH7A 3HJPA 2KOKA 4ECCA 3DKSA 2GQKA 3IC8A 1A24A 3J7Yb 1GSSA 3F0IA 4K0GA 4OCEA 5GAND 2GSSA 4IP1A 4K2XA 1GLQA 4HQSA 2V32A 1JZOA 4POKA 4FIWA 1XXUA 3ERWA 2V6OA 3IHQA 4X4JA 1BQ7A 3UOMA 5J4UA 1M3JA 3DYRA 1GRXA 5ECKB 5H5QA 5AIXA 4KE3A 4FH8A 1BAYA 3IPZA 2JADA 2LRTA 3UVHA 1YKAA 2ZCTA 1PMTA 1SD9A 1OAZA 1SL0B 1EWXA 1TOFA 4IELA 1GSFA 2GGTA 2DSAA 1GUKA 2MMAA 2H6YA 3HKRA 2FLSA 2VL3A 2H30A 1GUMA 2O7KA 2B3SA 3KP9A 3TJBA 1Z9HA 5LNKe 1PX7A 1K0OA 2RLIA 4LLRA 4A5PA 3TJGA 1YF1A 1MEKA 4ZL9A 1K0NA 5CRDA 3UAPA 2H72A 1JHBA 4KCAA 2QSIA 3HJMA 4TOPA 4GF0A 1PKWA 4IQAA 2YZHA 4BWQA 4WBJA 4BWSA 1NHYA 4NHWA 3HVVA 1XOAA 3LGCA 4POBA 1I9DA 4ZILA 3IOSA 1ZCPA 2DLXA 2VCTA 2VM2A 2JSYA 4GSNA 4WKWA 4ECJA 2O85A 4Z7XA 3GV1A 2TRCP 2ALBA 5IQYA 1F2EA 5G1KA 4NV5A 1A0FA 2DIYA 5ECOB 3MDKA 4POLA 2YWIA 4AJ8A 1GTAA 4ICYA 2VD0A 1SU9A 2OJLA 3P90A 1GTBA 4MLYA 1K3LA 4FQUA 5HR2A 2H0IA 7GSSA 4O5UA 2VCZA 1XZOA 5ID2B 1B4QA 1RQMA 4N30A 1FVJA 4KH7A 1TK0B 1J0FA 2OACA 2CAIA 1F9MA 5G1LA 4EXJA 5IPHA 1EOHA 14GSA 4ZBAA 2D2ZA 2H74A 4PX1A 3IHGA 3VWVA 2FGXA 3LYKA 2X49A 3LW9A 4K9ZA 4KF9A 4BVXB 1VGLA 4ULXA 2YWMA 3QAVA 4N0ZA 1GL8A 1WWJA 3FZ4A 3PH9A 5AISA 3L9VA 5EVOA 1BYEA 4G0IA 1WE0A 4NXIA 3HHVA 4TXOB 3ME7A 3HVXA 1WOUA 2LEGA 1G0TA 4L8EA 5HFKA 1S3DA 1MD4A 3I43A 2CQ9A 2GSTA 4TR1B 2A2RA 2GZPA 1PGTA 1E6BA 5DALB 1OKTA 1G7EA 4HZ4A 4GWRA 2Z9SA 1YQ1A 1HQOA 1OE7A 5IMDA 1U6TA 1O73A 1ZL9A 4K7NA 1YKCA 2A2SA 4V2LA 1VF3A 3M1GA 4ILFA 4RI7A 1SJIA 5G30A 5B8AA 1B9YC 5INYA 4MF6A 3SWLA 4TR3A 5A5KA 1M7TA 4K2DA 1V9WA 2JZRA 4ZIJA 3ERGA 1HNAA 3IBHA 3APQA 1PX6A 3KMNA 5G2ZA 6GSTA 1MDJA 3ERFA 3J7Yk 5FT3A 4Q5NA 5HFIA 3G7JA 1TP9A 2I4AA 5DQYA 4CDOA 4JE1A 3Q6OA 3GNJA 4YQMA 1AQVA 2IL3A 1I5GA 2N5AA 4G9HA 5L71A 4K0NA 1XG8A 2QA2A 4ML6A 2LQOA 3F3QA 5ELAA 1XW5A 4KGIA 1OE8A 2QGVA 3DRNA 2VCWA 2JU5A 5C00A 2IMDA 4GRFA 2E2MA 1PN9A 3F4TA 1WMJA 2XPEA 3RHCA 3TJKA 4D73A 2DJJA 2DMMA 2VD1A 4EKZA 1ZGNA 3UMAA 3CMIA 2DMLA 2H1DA 2PUKC 2H75A 5KEJA 2JACA 1V58A 3N9JA 1DE1A 1SJ6A 1EV4A 4HOJA 5IM9A 1KNGA 4BPYA 3NOFA 1DE2A 5G31A 4YKFA 3EE2A 5IO0A 5IIZA 2DJ3A 4YAVA 1B9XC 1SJZA 5F06A 5H5SA 5DAKA 3KIJA 4HJMA 4L0UA 1WPIA 2G2QA 3EMPA 1VRSD 3LQ7A 5ECNB 2CX3A 3LJRA 3APSA 3TDGA 2GS3A 2HSHA 4XS6A 4O7HA 4KNDA 3RAZA 2RUEA 3VPQA 4EF0A 1JFUA 3ZYWA 4ID0A 2ES7A 1K0AA 1A2JA 2H66A 3IRAA 3V1WA 5CO3A 1OC3A 3QOUA 4BVYB 1KTEA 5CP1A 1RW1A 2V6KA 5EL8A 3MIXA 3CSHA 4FO5A 3PPUA 1EGOA 3GTUA 3ED3A 3HCZA 4YAPA 1PQNA 2FWEA 5J9BA 1U88A 2PMTA 2ZUPA 2RUFA 3KGKA 2OE0A 3CQFA 2F8FA 4I6XA 5IMZA 1PL2A 9GSSA 2MMNA 3TB2A 1YF0A 3CXGA 5F05A 4MK3A 2H73A 1PRXA 2AV4A 3JCML 3ME8A 5ELGA 4MNNA 1KBNA 1M2BA 5CREA 2H8LA 2VL9A 1GLPA 2DJKA 3D5JA 1QUWA 2N5FA 1HNBA 5HR3A 3RHBA 2YJ7A 1SENA 2YWOA 4XRDA 4G10A 1ZOFA 4G0LA 1B8XA 1OC9B 2HXKA 4KDUA 3TUEA 4K5SA 5LD0A 3BCIA 4PQHA 4CW9A 4MPFA 1T3BA 3W6GA 4AJ7A 5J9CA 4NAXA 1JLVA 3E9JB 3DVWA 1FVKA 3GURA 3BJ5A 1AUCA 3KJYA 4POMA 2LNSA 4ZB8A 4OMVA 1TK8B 3F8UA 4MZWA 5HR1A 3GN3A 1QK8A 4XRAA 1N8JA 2EIQA 3LXTA 4PGTA 5G5EA 2M72A 3VWWA 3TGZA 4DEJA 2AJQB 3VI5A 1ZYQB 3KP8A 3UBKA 2LTKA 3M8NA 5F8BA 2QA1A 3APOA 3H93A 4IP6A 1F3BA 2RM5A 4PUAA 1W89A 3UEMA 4IJ3A 2YNXA 3F3RA 3GL5A 2R6KA 1X5CA 3W8JA 4WR4A 4IW9A 2H0HA 2FWHA 2LV3A 2VL2C 3IAS2 5KN2A 3FEUA 5EPFA 4IQ1A 4NHZA 4LL4B 3H1NA 5J3RA 2FA4A 1VF1A 4GLTA 2MBTA 5ECIB 1NSWA 5BMUA 2HZFA 2L6CA 3D21A 1XFLA 1X9WB 2P0GA 2KUCA 5ID2A 4K8MA 1PKZA 5E59A 2P5RA 1M2AA 4L5LA 2VM1A 5ECQB 2PBJA 1YJ6A 3GUSA 1A2MA 5IMAA 2K6VA 4TXVA 5ECMB 3O6TA 2WRTA 5H5RA 2HRKA 1UVZA 4ACSA 4KX4A 2LS5A 5D9VA 5J5NA 2OBIA 4BVXA 1XIYA 1OC8A 4CY6A 4MZCA 4WXTA 1DSBA 3ZTLA 2HRAA 4MCUA 2VAFA 3DD3A 1K0MA 4Z2TA 2IJYA 1AIUA 4PURA 3D6IA 1NW2A 2LSTA 3FK8A 4DSQA 3GSTA 1TRWA 4ZL7A 4TXOA 2WB9A 4RQRA 2E2GA 1OKDA 1TK5B 1TU8A 1JZWA 3ZRDA 1EP7A 2WGRA 4ZBDA 2O87A 4TR1A 2TIRA 1AC1A 3VWUA 2DIZA 2WULA 3HZ8A 1ZYEA 4I2UA 5DALA 5CRGA 2P31A 3RDWA 2PGTA 2VUPA 2K9FA 4HS1A 1ABAA 3DGQA 1PA3A 3DIEA 1V40A 3FZAA 4IBPA 3RPPA
chains in the Genus database with same CATH topology
1C72A 2LJKA 1V2AA 4AJ6A 1WRYA 3TKSE 1FAAA 1YDKA 5JCUA 1GSYA 2DKHA 2YPMA 3PGTA 3R2QA 4ECBA 3ZFLA 4IKHA 4MABA 3RPNA 3C73A 5JCGA 1XCCA 5HFGA 2YV7A 5HQPA 2EIRA 2VCVA 4OCFA 3A2VA 3TRPA 1R7HA 1F37A 3FHKA 3CBUA 3VI7A 4PNGA 3QAGA 1TI1A 4XS4B 4F03A 4F2IA 2LRCA 1FW1A 1R5PA 2CX4A 2HSYA 4OFTA 4K6XA 3GFKA 2IMKA 2PPTA 4IHUA 3TKSA 4TW5A 3KCMA 2LKUA 3GIXA 2FNOA 5DCGA 4IN0A 1A2LA 3H8QA 2C1YA 2HFDA 1YZXA 5AIVA 1MDKA 4Z2UA 3BCKA 3A2XA 1R4WA 3AY8A 4X43A 2MBSA 3EURA 2CT6A 3DXBA 3QDNA 1NHOA 4KAEA 4GXZA 4ZB9A 2WDUA 1U3IA 2DKIA 3F63A 2C3NA 1BEDA 2GT5A 4XS1A 4IGJA 2UZ8A 3EU3A 4EC0A 3I6AA 5IOXA 3BOAA 4K7IA 4MJBA 5D9XA 1ZYNA 3TJJA 1X9MB 4HZ2A 2E7PA 4I5QA 1K0DA 4V1Ag 3US3A 3KXOA 4EVMA 3EPTA 2CA8A 3EMXA 4F82A 6GSWA 4PXOA 4V1Ap 4OD7A 4KSMA 2C0DA 2WS2A 3O76A 3IR4A 4JRRA 3UARA 5KN3A 1BG5A 2R3XA 3F6FA 2X64A 3Q18A 1FOHA 5CYYA 3VPTA 4G19A 1T4YA 1FHEA 1O81A 5IMCA 1F6MC 3O3TA 3GH9A 2A2PA 2YOIA 4TR4A 1GP1A 5DJLA 1OVNA 4CHSA 3L0HA 4AGSA 3HXSA 4FYBA 1VF2A 2CVDA 1A23A 3MAKA 3DEXA 2LNTA 5JWRB 4BVYA 1SKRB 3GRXA 3EYTA 1EGRA 3VFIA 3QFAC 2VLUA 4QQ7A 4WEYA 3ZFBA 3QMXA 1YEPA 2IPAA 3TJFA 1TW9A 2DBCA 4BL7B 5ECRB 4Z2RA 3KTBA 4OO4A 3N5OA 2CVBA 1Z6MA 1TDIA 2B5XA 5D93A 5KN1A 4HJ2A 2VLTA 4JU5A 4LMWA 2B6MA 6GSXA 1ILOA 2V2GA 3GKMA 3Q74A 2H6XA 2LJAA 3KZQA 2BTOT 3FW2A 4XCSA 2F8AA 2BJXA 2YZUA 2YWNA 4Q5FA 3IXRA 2GZZA 22GSA 2LQQA 2OBKA 1O7UA 1FG4A 1X5EA 3ZREA 2C4JA 3ZVJD 1OC9A 1ACVA 4PQIA 3TKPA 2L59A 1FB6A 1PD21 3TRQA 4G0KA 3S9FA 5C04A 3I9V2 2I9HA 3D4MA 4OFNA 1SK0A 2QC7A 2I3YA 2NVLA 2MZCA 2K8SA 4WETA 3F9UA 1GTIA 4DSRA 2O89A 2GTUA 2EC4A 5ABRA 5GZZB 1SL1B 3IAM2 3E0UA 3HZ4A 1QMVA 1XWAA 3EC3A 1JLWA 8GSSA 3M0FA 1EEMA 1SD8A 2WZ9A 2R2JA 3TKQA 3RBTA 2AAWA 4MP4A 5E4WA 1V57A 1AQWA 1ERVA 4MMMA 3ZZXA 4TRXA 2FCHA 4F0BA 4RI6A 3GX8A 16GSA 1Y25A 2GZYA 3GSSA 3QAWA 3WGEA 3MSZA 2PN8A 3ZMKA 4RUVA 1E2YA 2G0FA 4EO3A 4JEDA 2DJ2A 4E8HA 3UBLA 3WYWA 4N0VA 2C0EA 2HZEB 5KOWA 2MYGA 1MTCA 3A3TA 1K3YA 4H86A 4MDCA 3IV4A 4OWYA 4E8EA 17GSA 5F0GA 11GSA 4P3YB 4I97A 4TVEA 2K18A 3ZITA 3GKKA 2A4VA 2YANA 4USSA 1HNCA 2F9SA 2M80A 2H19A 5CAXA 3G7IA 4AF2A 4L0WA 1SK2A 5F07A 1NM3A 5B6NA 3PR8A 3ZMLA 1ERUA 3C1RA 1TTZA 1O8XA 1RK4A 4Q5QA 1WJKA 3GH6A 1UC7A 2AUVA 1IYIA 3I69A 3MNGA 3CYNA 3LXZA 1CQHA 2X8HA 4KA0A 1IYHA 3GX0A 4F9ZA 1GH2A 1O8WA 1FOVA 5GAPD 1M99A 2DJ1A 5ECLB 2X8GA 1GULA 4LL1B 2YCDA 2IWTA 1MDIA 1SK1A 4MF7A 1S3CA 3F4SA 5A4WA 1M9BA 2C3QA 2L6DA 2FA8A 2GQLA 3HDCA 4EIQA 2C0FA 1TU7A 4HQZA 4LA1A 3G9BA 4IJIA 2HT9A 4NMUA 1THOA 3EVIA 4FYUA 3HYPA 3F4RA 2X8CA 2J9HA 1PSQA 2R0PA 4O5QA 4GQFA 4ECIA 2JZTA 2JSZA 3FZ9A 1T7PB 1LU4A 1WIKA 2NBSA 2R37A 2FY6A 3P8WA 4KDXA 2VLVA 2O8VB 3GL3A 4QL9A 4BA7A 4MJAA 5LCZA 2F3MA 1TRSA 2HNLA 5D73A 1X0RA 1Q4JA 2L4CA 4XS4A 2CZ3A 1M2DA 1BJXA 2P5QA 2OE1A 2IFQB 2F51A 4GQCA 3FRCA 2L57A 4XIHA 5AN1A 3UIWA 2E0QA 5DJMA 3MYDA 1XWBA 3VLNA 3K8NA 5COHA 3TCOA 5IOWA 3E3EA 3LWAA 1T8EB 5CRHA 3FMWA 3DWVA 2L5LA 1EV9A 1XVQA 2HRFA 5B7CA 3QR6A 4DSSB 1Z6NA 3DVXA 4ML1A 2C8UA 1A8LA 4JBBA 3EINA 1EZKA 4HDEA 2VO4A 3FY7A 1USBA 1K0BA 5KOXA 3HD5A 1VF4A 4IS0A 1WP0A 4MJEA 2H1GA 1V98A 2KP2A 4LMVA 4OO5A 1SYRA 5DVBA 12GSA 1TJDA 3PINA 2IN3A 3IA1A 3EWLA 2JL4A 1M0UA 3SBCA 3ZL5A 2WCIA 3KMOA 2YP6A 4TR0A 1GSUA 4PQ1A 4EUYA 1T00A 5IMFA 2LRNA 5A4UA 4ZL8A 1FO5A 3CSIA 1EP8A 5J41A 4GSSA 2AYTA 1GWCA 2H0GA 2OADA 4WF4A 2K8VA 4WR5A 2V41A 2V1MA 4G2EA 4MA9A 2CVKA 2VOCA 2OA7A 6GSSA 3ZIVA 2ON5A 1XWGA 3F6DA 3WT1A 3Q19A 3TOUA 3C1SA 3C7MA 3UL3A 1DUGA 2X99A 1G7OA 4KB3A 1U87A 2GT6A 2IIYA 4NWYA 2B1KA 1GUHA 1QQ2A 4XTSA 4EDZA 3L9SA 3A5WA 5ECPB 1OYJA 2FHEA 3LSZA 2I81A 1J9BA 1R5AA 4F0CA 1ZMAA 4MF5A 1GNWA 4BL7A 3KEBA 1FB0A 2JZSA 5BRTA 2X4AA 1Q98A 19GSA 2AHEA 3ZVJA 3GA4A 2B1LA 2XC2A 2XPDA 2RM6A 3NIVA 6GSYA 1AW9A 1LBKA 3CRTA 2GSQA 3KTLA 3DMLA 2TRXA 4FYCA 2EIOA 4V2NA 2QKEA 1JZDA 3OR5A 1ZYPA 2B7JA 2IMIA 3CTGA 4YQUA 4O92A 1T1VA 5B8BA 3HVSA 3IDVA 1QXHA 4MPGA 5D96A 2L4QA 1K0CA 4QL7A 5AGYA 2YN1A 3WGDA 2YJHA 4KCEA 3LEFA 3EU4A 1O6JA 4YH2A 3WT2A 4X1UA 4J2FA 1T4ZA 4TKYA 4I2TA 1TRVA 3A5IA 1H75A 2CZ2A 6GSUA 4Q5RA 2DC5A 4JZQA 3L78A 3CTFA 5DQSA 4DVCA 1AXDA 4MZBA 3IE3A 2LUSA 2R5GA 3VK9A 1GSEA 2C0GA 3BBYA 1QFNA 2J23A 1Y6EA 2GSRA 3FZ5A 4J57E 3M3MA 2IMEA 5JCWA 1MD3A 1QGVA 4KUNA 3C71A 5ENUA 13GSA 1YY7A 3M9KA 1A0RP 2I1UA 2GLRA 2PU9C 4J56E 2R0GA 1EEJA 3FR3A 3C8EA 1HD2A 5JWOB 1K3OA 2MMOA 3P7XA 1Z5YE 3H79A 5DCHA 3TKSC 5B6MA 1SL2B 2HZEA 2H71A 2XHFA 3H4KA 1F3AA 5D8IA 4WF5A 3GMFA 4JR4A 1DBYA 2R4VA 2GVPA 4XHMA 1Z7PA 1Z3EA 2HLSA 2VCQA 2H76A 1Z7RA 4WBRD 3FR9A 2IMFA 3VURA 1GNEA 4L5OA 3QCPA 2RIIA 5D9WA 5EY6A 3KD0A 4K5RA 1X5DA 2DJ0A 4O32A 4RQXA 3P2AA 3L9UA 2KLXA 3GKXA 3UVTA 3D22A 3TRXA 4MJCA 2WFCA 1B48A 5A4VA 2GDRA 3QFBC 1R26A 2H01A 4KW6A 1EOGA 2C3TA 2FUG2 1XW6A 1ST9A 4ZBBA 1URMA 4GTUA 5CNWA 4N10A 1ERTA 3KH9A 3ZLPA 5DDLA 3D4TA 3MWHA 4YQVA 1UA5A 4ZB6A 3IK9A 1AAZA 1ERWA 1UN2A 1TXXA 3QD9A 4HEA2 3KM6A 2N5BA 5CRWA 2XBIA 4O5RA 1XPVA 2OE3A 4MH2A 5KN0A 1GSDA 2B5YA 4GCIA 1SKWB 1ON4A 1PL1A 4K1FA 1O85A 2NTOA 5IMVA 2FWGA 1YEXA 2NPBA 1XOBA 3LFLA 1A8YA 2GQMA 4PUFC 4TN8A 1G6YA 3GHAA 4N11A 2ON7A 3VWXA 18GSA 3QPMA 3GYKA 2PVQA 3IK7A 3FYGA 1THXA 4HUAA 2CAQA 4NV2A 3WGXA 2H70A 2C80A 1TKDB 3TKRA 1XW9A 2WJUA 5G5FA 1J08A 5D9TA 2H1BA 3D0ZA 1XVWA 1SYXA 3NZNA 1SKSB 2HYXA 2XBQA 2M46A 1M9AA 5IPGA 1W4VA 4I8BA 2A4HA 2VL2A 4HU7A 1B4PA 2YV9A 5DBQA 1KEBA 2IFQA 2FD3A 4V2MA 1TRUA 2HSMA 2LJRA 5FHIA 2VIMA 2HE3A 3HA9A 1XBSA 5ECSA 3M9JA 4NPBA 4GSTA 1CQGA 1JZRA 3GKNA 2H1AA 4D73B 2NDOA 3FKFA 1XWKA 3ZIJA 2REMA 1S3AA 1PN0A 2B5EA 3L4NA 3IC4A 3WD6A 3FR6A 4YKGA 3CRUA 4DSSA 3U5RE 4KDYA 5FWGA 2KP1A 2H6ZA 3LG6A 3G7YA 3HJOA 4EIPA 1N2AA 5GSSA 4EDYA 4OFMA 4K7OA 3U6VA 2KHPA 5JWQB 4PTSA 2PWJA 4PNFA 5DAKB 2ZNMA 2OKAA 10GSA 3LYPA 4ISDA 4EL1A 3BD2A 1GTUA 2FWFA 3HY2A 3W8SA 4ZXGA 5HR0A 1G6WA 2BMXA 2HI7A 2PVOC 4IVFA 1X9SB 4X0XA 2HRNA 4EE0A 3CSJA 1LJRA 1XWCA 2AB6A 2B7KA 2VCXA 5GSTA 3TOTA 1ZZYA 2L5OA 5IO2A 4JR6A 1ML6A 3A2WA 2CV4A 1BX9A 3ISOA 5ECHB 1TI3A 2R0CA 1AQXA 1U3AA 20GSA 4HI7A 6GSVA 1GSQA 2MMZA 4KSOA 3UJ1A 1H4OA 3LORA 4CY8A 1HYUA 3GTUB 3R3EA 2PERA 4MH3A 4HU9A 3KH7A 3HJPA 2KOKA 4ECCA 3DKSA 2GQKA 3IC8A 1A24A 3J7Yb 1GSSA 3F0IA 4K0GA 4OCEA 5GAND 2GSSA 4IP1A 4K2XA 1GLQA 4HQSA 2V32A 1JZOA 4POKA 4FIWA 1XXUA 3ERWA 2V6OA 3IHQA 4X4JA 1BQ7A 3UOMA 5J4UA 3DYRA 1GRXA 5ECKB 5H5QA 5AIXA 4KE3A 4FH8A 1BAYA 3IPZA 2JADA 2LRTA 3UVHA 1YKAA 2ZCTA 1PMTA 1SD9A 1OAZA 1SL0B 1EWXA 1TOFA 4IELA 1GSFA 2GGTA 2DSAA 1GUKA 2MMAA 2H6YA 3HKRA 2FLSA 2VL3A 2H30A 1GUMA 2O7KA 2B3SA 3KP9A 3TJBA 1Z9HA 5LNKe 1PX7A 1K0OA 2RLIA 4LLRA 4A5PA 3TJGA 1YF1A 1MEKA 4ZL9A 1K0NA 5CRDA 3UAPA 2H72A 1JHBA 4KCAA 2QSIA 3HJMA 4TOPA 4GF0A 1PKWA 4IQAA 2YZHA 4BWQA 4WBJA 4BWSA 1NHYA 4NHWA 3HVVA 1XOAA 3LGCA 4POBA 1I9DA 4ZILA 3IOSA 1ZCPA 2DLXA 2VCTA 2VM2A 2JSYA 4GSNA 4WKWA 4ECJA 2O85A 4Z7XA 3GV1A 2TRCP 2ALBA 5IQYA 1F2EA 5G1KA 4NV5A 1A0FA 2DIYA 5ECOB 3MDKA 4POLA 2YWIA 4AJ8A 1GTAA 4ICYA 2VD0A 1SU9A 2OJLA 3P90A 1GTBA 4MLYA 1K3LA 4FQUA 5HR2A 2H0IA 7GSSA 4O5UA 2VCZA 1XZOA 5ID2B 1B4QA 1RQMA 4N30A 1FVJA 4KH7A 1TK0B 1J0FA 2OACA 2CAIA 1F9MA 5G1LA 4EXJA 5IPHA 1EOHA 14GSA 4ZBAA 2D2ZA 2H74A 4PX1A 3IHGA 3VWVA 2FGXA 3LYKA 2X49A 3LW9A 4K9ZA 4KF9A 4BVXB 1VGLA 4ULXA 2YWMA 3QAVA 4N0ZA 1GL8A 1WWJA 3FZ4A 3PH9A 5AISA 3L9VA 5EVOA 1BYEA 4G0IA 1WE0A 4NXIA 3HHVA 4TXOB 3ME7A 3HVXA 1WOUA 2LEGA 1G0TA 4L8EA 5HFKA 1S3DA 1MD4A 3I43A 2CQ9A 2GSTA 4TR1B 2A2RA 2GZPA 1PGTA 1E6BA 5DALB 1OKTA 1G7EA 4HZ4A 4GWRA 2Z9SA 1YQ1A 1HQOA 1OE7A 5IMDA 1U6TA 1O73A 1ZL9A 4K7NA 1YKCA 2A2SA 4V2LA 1VF3A 3M1GA 4ILFA 4RI7A 1SJIA 5G30A 5B8AA 1B9YC 5INYA 4MF6A 3SWLA 4TR3A 5A5KA 1M7TA 4K2DA 1V9WA 2JZRA 4ZIJA 3ERGA 1HNAA 3IBHA 3APQA 1PX6A 3KMNA 5G2ZA 6GSTA 1MDJA 3ERFA 3J7Yk 5FT3A 4Q5NA 5HFIA 3G7JA 1TP9A 2I4AA 5DQYA 4CDOA 4JE1A 3Q6OA 3GNJA 4YQMA 1AQVA 2IL3A 1I5GA 2N5AA 4G9HA 5L71A 4K0NA 2QA2A 4ML6A 2LQOA 3F3QA 5ELAA 1XW5A 4KGIA 1OE8A 2QGVA 3DRNA 2VCWA 2JU5A 5C00A 2IMDA 4GRFA 2E2MA 1PN9A 3F4TA 1WMJA 2XPEA 3RHCA 3TJKA 4D73A 2DJJA 2DMMA 2VD1A 4EKZA 1ZGNA 3UMAA 3CMIA 2DMLA 2H1DA 2PUKC 2H75A 5KEJA 2JACA 1V58A 3N9JA 1DE1A 1SJ6A 1EV4A 4HOJA 5IM9A 1KNGA 4BPYA 3NOFA 1DE2A 5G31A 4YKFA 3EE2A 5IO0A 5IIZA 2DJ3A 4YAVA 1B9XC 1SJZA 5F06A 5H5SA 5DAKA 3KIJA 4HJMA 4L0UA 1WPIA 2G2QA 3EMPA 1VRSD 3LQ7A 5ECNB 2CX3A 3LJRA 3APSA 3TDGA 2GS3A 2HSHA 4XS6A 4O7HA 4KNDA 3RAZA 2RUEA 3VPQA 4EF0A 1JFUA 3ZYWA 4ID0A 2ES7A 1K0AA 1A2JA 2H66A 3IRAA 3V1WA 5CO3A 1OC3A 3QOUA 4BVYB 1KTEA 5CP1A 1RW1A 2V6KA 5EL8A 3MIXA 3CSHA 4FO5A 3PPUA 1EGOA 3GTUA 3ED3A 3HCZA 4YAPA 1PQNA 2FWEA 5J9BA 1U88A 2PMTA 2ZUPA 2RUFA 3KGKA 2OE0A 2F8FA 4I6XA 5IMZA 1PL2A 9GSSA 2MMNA 3TB2A 1YF0A 3CXGA 5F05A 4MK3A 2H73A 1PRXA 2AV4A 3JCML 3ME8A 5ELGA 4MNNA 1KBNA 1M2BA 5CREA 2H8LA 2VL9A 1GLPA 2DJKA 3D5JA 1QUWA 2N5FA 1HNBA 5HR3A 3RHBA 2YJ7A 1SENA 2YWOA 4XRDA 4G10A 1ZOFA 4G0LA 1B8XA 1OC9B 2HXKA 4KDUA 3TUEA 4K5SA 5LD0A 3BCIA 4PQHA 4CW9A 4MPFA 1T3BA 3W6GA 4AJ7A 5J9CA 4NAXA 1JLVA 3E9JB 3DVWA 1FVKA 3GURA 3BJ5A 1AUCA 3KJYA 4POMA 2LNSA 4ZB8A 4OMVA 1TK8B 3F8UA 4MZWA 5HR1A 3GN3A 1QK8A 4XRAA 1N8JA 2EIQA 3LXTA 4PGTA 5G5EA 2M72A 3VWWA 3TGZA 4DEJA 2AJQB 3VI5A 1ZYQB 3KP8A 3UBKA 2LTKA 3M8NA 5F8BA 2QA1A 3APOA 3H93A 4IP6A 1F3BA 2RM5A 4PUAA 1W89A 3UEMA 4IJ3A 2YNXA 3F3RA 3GL5A 2R6KA 1X5CA 3W8JA 4WR4A 4IW9A 2H0HA 2FWHA 2LV3A 2VL2C 3IAS2 5KN2A 3FEUA 5EPFA 4IQ1A 4NHZA 4LL4B 3H1NA 5J3RA 2FA4A 1VF1A 4GLTA 2MBTA 5ECIB 1NSWA 5BMUA 2HZFA 2L6CA 3D21A 1XFLA 1X9WB 2P0GA 2KUCA 5ID2A 4K8MA 1PKZA 5E59A 2P5RA 1M2AA 4L5LA 2VM1A 5ECQB 2PBJA 1YJ6A 3GUSA 1A2MA 5IMAA 2K6VA 4TXVA 5ECMB 3O6TA 2WRTA 5H5RA 2HRKA 1UVZA 4ACSA 4KX4A 2LS5A 5D9VA 5J5NA 2OBIA 4BVXA 1XIYA 1OC8A 4CY6A 4MZCA 4WXTA 1DSBA 3ZTLA 2HRAA 4MCUA 2VAFA 3DD3A 1K0MA 4Z2TA 2IJYA 1AIUA 4PURA 3D6IA 1NW2A 2LSTA 3FK8A 4DSQA 3GSTA 1TRWA 4ZL7A 4TXOA 2WB9A 4RQRA 2E2GA 1OKDA 1TK5B 1TU8A 1JZWA 3ZRDA 1EP7A 2WGRA 4ZBDA 2O87A 4TR1A 2TIRA 1AC1A 3VWUA 2DIZA 2WULA 3HZ8A 1ZYEA 4I2UA 5DALA 5CRGA 2P31A 3RDWA 2PGTA 2VUPA 2K9FA 4HS1A 1ABAA 3DGQA 1PA3A 3DIEA 1V40A 3FZAA 4IBPA 3RPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C72 A;  2LJK A;  1V2A A;  4AJ6 A;  1WRY A;  3TKS E;  1FAA A;  1YDK A;  5JCU A;  1GSY A;  2YPM A;  3PGT A;  3R2Q A;  4ECB A;  3ZFL A;  4IKH A;  4MAB A;  3RPN A;  3C73 A;  5JCG A;  1XCC A;  5HFG A;  2YV7 A;  5HQP A;  2EIR A;  2VCV A;  4OCF A;  3A2V A;  3TRP A;  1R7H A;  1F37 A;  3FHK A;  3CBU A;  3VI7 A;  4PNG A;  3QAG A;  1TI1 A;  4XS4 B;  4F03 A;  4F2I A;  2LRC A;  1FW1 A;  1R5P A;  2CX4 A;  2HSY A;  4OFT A;  4K6X A;  3GFK A;  2IMK A;  2PPT A;  4IHU A;  3TKS A;  4TW5 A;  3KCM A;  2LKU A;  3GIX A;  2FNO A;  5DCG A;  4IN0 A;  1A2L A;  3H8Q A;  2C1Y A;  2HFD A;  1YZX A;  5AIV A;  1MDK A;  3BCK A;  3A2X A;  1R4W A;  3AY8 A;  4X43 A;  2MBS A;  3EUR A;  2CT6 A;  3DXB A;  3QDN A;  1NHO A;  4KAE A;  4GXZ A;  4ZB9 A;  2WDU A;  1U3I A;  3F63 A;  2C3N A;  1BED A;  2GT5 A;  4XS1 A;  4IGJ A;  3EU3 A;  4EC0 A;  3I6A A;  5IOX A;  3BOA A;  4K7I A;  4MJB A;  5D9X A;  3TJJ A;  1X9M B;  4HZ2 A;  2E7P A;  4I5Q A;  1K0D A;  4V1A g;  3US3 A;  3KXO A;  4EVM A;  2CA8 A;  3EMX A;  4F82 A;  6GSW A;  4PXO A;  4V1A p;  4OD7 A;  4KSM A;  2C0D A;  2WS2 A;  3O76 A;  3IR4 A;  4JRR A;  3UAR A;  5KN3 A;  1BG5 A;  2R3X A;  3F6F A;  2X64 A;  3Q18 A;  5CYY A;  3VPT A;  4G19 A;  1T4Y A;  1FHE A;  1O81 A;  5IMC A;  1F6M C;  3O3T A;  3GH9 A;  2YOI A;  4TR4 A;  1GP1 A;  5DJL A;  1OVN A;  4CHS A;  3L0H A;  4AGS A;  3HXS A;  4FYB A;  1VF2 A;  2CVD A;  1A23 A;  3MAK A;  3DEX A;  2LNT A;  5JWR B;  4BVY A;  1SKR B;  3GRX A;  3EYT A;  1EGR A;  3VFI A;  3QFA C;  2VLU A;  4QQ7 A;  4WEY A;  3ZFB A;  3QMX A;  1YEP A;  2IPA A;  3TJF A;  1TW9 A;  2DBC A;  5ECR B;  3KTB A;  4OO4 A;  3N5O A;  2CVB A;  1Z6M A;  1TDI A;  2B5X A;  5D93 A;  5KN1 A;  4HJ2 A;  2VLT A;  4JU5 A;  4LMW A;  2B6M A;  6GSX A;  1ILO A;  2V2G A;  3GKM A;  3Q74 A;  2H6X A;  2LJA A;  3KZQ A;  2BTO T;  3FW2 A;  4XCS A;  2F8A A;  2BJX A;  2YZU A;  2YWN A;  4Q5F A;  3IXR A;  2GZZ A;  22GS A;  2LQQ A;  2OBK A;  1O7U A;  1FG4 A;  1X5E A;  3ZRE A;  2C4J A;  3ZVJ D;  1OC9 A;  1ACV A;  4PQI A;  3TKP A;  2L59 A;  1FB6 A;  1PD2 1;  3TRQ A;  3S9F A;  5C04 A;  3I9V 2;  2I9H A;  3D4M A;  4OFN A;  1SK0 A;  2QC7 A;  2I3Y A;  2NVL A;  2MZC A;  2K8S A;  4WET A;  3F9U A;  1GTI A;  4DSR A;  2O89 A;  2GTU A;  2EC4 A;  5ABR A;  5GZZ B;  1SL1 B;  3IAM 2;  3E0U A;  3HZ4 A;  1QMV A;  1XWA A;  3EC3 A;  1JLW A;  8GSS A;  3M0F A;  1EEM A;  1SD8 A;  2WZ9 A;  2R2J A;  3TKQ A;  3RBT A;  2AAW A;  4MP4 A;  5E4W A;  1V57 A;  1AQW A;  1ERV A;  4MMM A;  3ZZX A;  4TRX A;  2FCH A;  4F0B A;  4RI6 A;  3GX8 A;  16GS A;  1Y25 A;  2GZY A;  3GSS A;  3QAW A;  3WGE A;  3MSZ A;  2PN8 A;  3ZMK A;  4RUV A;  1E2Y A;  2G0F A;  4EO3 A;  4JED A;  2DJ2 A;  4E8H A;  3UBL A;  3WYW A;  4N0V A;  2C0E A;  2HZE B;  2MYG A;  1MTC A;  3A3T A;  1K3Y A;  4H86 A;  4MDC A;  3IV4 A;  4OWY A;  4E8E A;  17GS A;  5F0G A;  11GS A;  4P3Y B;  4I97 A;  4TVE A;  2K18 A;  3ZIT A;  3GKK A;  2A4V A;  2YAN A;  1HNC A;  2F9S A;  2M80 A;  2H19 A;  5CAX A;  3G7I A;  4AF2 A;  4L0W A;  1SK2 A;  5F07 A;  1NM3 A;  5B6N A;  3PR8 A;  3ZML A;  1ERU A;  3C1R A;  1TTZ A;  1O8X A;  1RK4 A;  4Q5Q A;  1WJK A;  3GH6 A;  1UC7 A;  2AUV A;  1IYI A;  3I69 A;  3MNG A;  3CYN A;  3LXZ A;  1CQH A;  2X8H A;  4KA0 A;  1IYH A;  3GX0 A;  4F9Z A;  1GH2 A;  1O8W A;  1FOV A;  5GAP D;  1M99 A;  2DJ1 A;  5ECL B;  2X8G A;  1GUL A;  4LL1 B;  2YCD A;  2IWT A;  1MDI A;  1SK1 A;  4MF7 A;  1S3C A;  3F4S A;  5A4W A;  1M9B A;  2C3Q A;  2L6D A;  2FA8 A;  2GQL A;  3HDC A;  2C0F A;  1TU7 A;  4HQZ A;  4LA1 A;  3G9B A;  4IJI A;  2HT9 A;  4NMU A;  1THO A;  3EVI A;  4FYU A;  3HYP A;  3F4R A;  2X8C A;  2J9H A;  1PSQ A;  4GQF A;  4ECI A;  2JZT A;  2JSZ A;  3FZ9 A;  1T7P B;  1LU4 A;  1WIK A;  2NBS A;  2R37 A;  2FY6 A;  3P8W A;  4KDX A;  2VLV A;  2O8V B;  3GL3 A;  4QL9 A;  4BA7 A;  4MJA A;  5LCZ A;  2F3M A;  1TRS A;  2HNL A;  5D73 A;  1X0R A;  1Q4J A;  2L4C A;  4XS4 A;  2CZ3 A;  1M2D A;  1BJX A;  2P5Q A;  2OE1 A;  2IFQ B;  2F51 A;  4GQC A;  3FRC A;  2L57 A;  4XIH A;  5AN1 A;  3UIW A;  2E0Q A;  5DJM A;  1XWB A;  3VLN A;  3K8N A;  5COH A;  3TCO A;  5IOW A;  3E3E A;  3LWA A;  1T8E B;  5CRH A;  3DWV A;  2L5L A;  1EV9 A;  1XVQ A;  2HRF A;  5B7C A;  3QR6 A;  4DSS B;  1Z6N A;  3DVX A;  4ML1 A;  2C8U A;  1A8L A;  4JBB A;  3EIN A;  1EZK A;  4HDE A;  2VO4 A;  3FY7 A;  1USB A;  1K0B A;  3HD5 A;  1VF4 A;  4IS0 A;  1WP0 A;  4MJE A;  2H1G A;  1V98 A;  2KP2 A;  4LMV A;  4OO5 A;  1SYR A;  5DVB A;  12GS A;  1TJD A;  3PIN A;  2IN3 A;  3IA1 A;  3EWL A;  2JL4 A;  1M0U A;  3SBC A;  3ZL5 A;  2WCI A;  3KMO A;  2YP6 A;  4TR0 A;  1GSU A;  4PQ1 A;  4EUY A;  1T00 A;  5IMF A;  2LRN A;  5A4U A;  4ZL8 A;  1FO5 A;  3CSI A;  1EP8 A;  5J41 A;  4GSS A;  2AYT A;  1GWC A;  2H0G A;  2OAD A;  4WF4 A;  2K8V A;  4WR5 A;  2V41 A;  2V1M A;  4G2E A;  4MA9 A;  2CVK A;  2VOC A;  2OA7 A;  6GSS A;  3ZIV A;  2ON5 A;  1XWG A;  3F6D A;  3WT1 A;  3Q19 A;  3TOU A;  3C1S A;  3C7M A;  3UL3 A;  1DUG A;  2X99 A;  1G7O A;  4KB3 A;  1U87 A;  2GT6 A;  2IIY A;  4NWY A;  2B1K A;  1GUH A;  1QQ2 A;  4XTS A;  4EDZ A;  3L9S A;  3A5W A;  5ECP B;  1OYJ A;  2FHE A;  3LSZ A;  2I81 A;  1J9B A;  1R5A A;  4F0C A;  1ZMA A;  4MF5 A;  1GNW A;  4BL7 A;  3KEB A;  1FB0 A;  2JZS A;  1Q98 A;  19GS A;  2AHE A;  3ZVJ A;  3GA4 A;  2B1L A;  2XC2 A;  2XPD A;  2RM6 A;  3NIV A;  6GSY A;  1AW9 A;  1LBK A;  3CRT A;  2GSQ A;  3KTL A;  3DML A;  2TRX A;  4FYC A;  2EIO A;  4V2N A;  2QKE A;  1JZD A;  3OR5 A;  2B7J A;  2IMI A;  3CTG A;  4YQU A;  4O92 A;  1T1V A;  5B8B A;  3HVS A;  3IDV A;  1QXH A;  4MPG A;  5D96 A;  2L4Q A;  1K0C A;  4QL7 A;  5AGY A;  2YN1 A;  3WGD A;  2YJH A;  4KCE A;  3LEF A;  3EU4 A;  1O6J A;  4YH2 A;  3WT2 A;  4X1U A;  4J2F A;  1T4Z A;  4TKY A;  4I2T A;  1TRV A;  1H75 A;  2CZ2 A;  6GSU A;  4Q5R A;  2DC5 A;  4JZQ A;  3L78 A;  3CTF A;  5DQS A;  4DVC A;  1AXD A;  4MZB A;  3IE3 A;  2LUS A;  2R5G A;  3VK9 A;  1GSE A;  2C0G A;  3BBY A;  1QFN A;  2J23 A;  1Y6E A;  2GSR A;  3FZ5 A;  4J57 E;  3M3M A;  2IME A;  5JCW A;  1MD3 A;  1QGV A;  4KUN A;  3C71 A;  5ENU A;  13GS A;  1YY7 A;  3M9K A;  1A0R P;  2I1U A;  2GLR A;  2PU9 C;  4J56 E;  1EEJ A;  3FR3 A;  3C8E A;  1HD2 A;  5JWO B;  1K3O A;  2MMO A;  3P7X A;  1Z5Y E;  3H79 A;  5DCH A;  3TKS C;  5B6M A;  1SL2 B;  2HZE A;  2H71 A;  2XHF A;  3H4K A;  1F3A A;  5D8I A;  4WF5 A;  3GMF A;  4JR4 A;  1DBY A;  2R4V A;  2GVP A;  4XHM A;  1Z7P A;  1Z3E A;  2HLS A;  2VCQ A;  2H76 A;  1Z7R A;  4WBR D;  3FR9 A;  2IMF A;  3VUR A;  1GNE A;  4L5O A;  3QCP A;  2RII A;  5D9W A;  5EY6 A;  3KD0 A;  1X5D A;  2DJ0 A;  4O32 A;  4RQX A;  3P2A A;  3L9U A;  2KLX A;  3GKX A;  3UVT A;  3D22 A;  3TRX A;  4MJC A;  2WFC A;  1B48 A;  5A4V A;  2GDR A;  3QFB C;  1R26 A;  2H01 A;  4KW6 A;  1EOG A;  2C3T A;  2FUG 2;  1XW6 A;  1ST9 A;  4ZBB A;  1URM A;  4GTU A;  5CNW A;  4N10 A;  1ERT A;  3KH9 A;  3ZLP A;  5DDL A;  3D4T A;  3MWH A;  4YQV A;  1UA5 A;  4ZB6 A;  3IK9 A;  1AAZ A;  1ERW A;  1UN2 A;  1TXX A;  3QD9 A;  4HEA 2;  3KM6 A;  2N5B A;  5CRW A;  2XBI A;  4O5R A;  1XPV A;  2OE3 A;  4MH2 A;  5KN0 A;  1GSD A;  2B5Y A;  4GCI A;  1SKW B;  1ON4 A;  1PL1 A;  4K1F A;  1O85 A;  2NTO A;  5IMV A;  2FWG A;  1YEX A;  2NPB A;  1XOB A;  3LFL A;  1A8Y A;  2GQM A;  4PUF C;  4TN8 A;  1G6Y A;  3GHA A;  4N11 A;  2ON7 A;  3VWX A;  18GS A;  3QPM A;  3GYK A;  2PVQ A;  3IK7 A;  3FYG A;  1THX A;  4HUA A;  2CAQ A;  4NV2 A;  3WGX A;  2H70 A;  2C80 A;  1TKD B;  3TKR A;  1XW9 A;  2WJU A;  5G5F A;  1J08 A;  5D9T A;  2H1B A;  3D0Z A;  1XVW A;  1SYX A;  3NZN A;  1SKS B;  2HYX A;  2XBQ A;  2M46 A;  1M9A A;  5IPG A;  1W4V A;  4I8B A;  2VL2 A;  4HU7 A;  1B4P A;  2YV9 A;  5DBQ A;  1KEB A;  2IFQ A;  2FD3 A;  4V2M A;  1TRU A;  2LJR A;  5FHI A;  2VIM A;  2HE3 A;  3HA9 A;  1XBS A;  5ECS A;  3M9J A;  4NPB A;  4GST A;  1CQG A;  1JZR A;  3GKN A;  2H1A A;  4D73 B;  2NDO A;  3FKF A;  1XWK A;  3ZIJ A;  2REM A;  1S3A A;  2B5E A;  3L4N A;  3IC4 A;  3WD6 A;  3FR6 A;  3CRU A;  4DSS A;  3U5R E;  4KDY A;  5FWG A;  2KP1 A;  2H6Z A;  3LG6 A;  3G7Y A;  3HJO A;  1N2A A;  5GSS A;  4EDY A;  4OFM A;  4K7O A;  3U6V A;  2KHP A;  5JWQ B;  2PWJ A;  4PNF A;  5DAK B;  2ZNM A;  2OKA A;  10GS A;  3LYP A;  4ISD A;  4EL1 A;  3BD2 A;  1GTU A;  2FWF A;  3HY2 A;  3W8S A;  4ZXG A;  5HR0 A;  1G6W A;  2BMX A;  2HI7 A;  2PVO C;  4IVF A;  1X9S B;  4X0X A;  2HRN A;  4EE0 A;  3CSJ A;  1LJR A;  1XWC A;  2AB6 A;  2B7K A;  2VCX A;  5GST A;  3TOT A;  1ZZY A;  2L5O A;  5IO2 A;  4JR6 A;  1ML6 A;  3A2W A;  2CV4 A;  1BX9 A;  3ISO A;  5ECH B;  1TI3 A;  1AQX A;  1U3A A;  20GS A;  4HI7 A;  6GSV A;  1GSQ A;  2MMZ A;  4KSO A;  3UJ1 A;  1H4O A;  3LOR A;  1HYU A;  3GTU B;  2PER A;  4MH3 A;  4HU9 A;  3KH7 A;  3HJP A;  2KOK A;  4ECC A;  3DKS A;  2GQK A;  1A24 A;  3J7Y b;  1GSS A;  3F0I A;  4K0G A;  4OCE A;  5GAN D;  2GSS A;  4IP1 A;  1GLQ A;  4HQS A;  2V32 A;  1JZO A;  4POK A;  4FIW A;  1XXU A;  3ERW A;  2V6O A;  3IHQ A;  1BQ7 A;  3UOM A;  5J4U A;  3DYR A;  1GRX A;  5ECK B;  5H5Q A;  5AIX A;  4KE3 A;  4FH8 A;  1BAY A;  3IPZ A;  2JAD A;  2LRT A;  3UVH A;  1YKA A;  2ZCT A;  1PMT A;  1SD9 A;  1OAZ A;  1SL0 B;  1EWX A;  1TOF A;  4IEL A;  1GSF A;  2GGT A;  2DSA A;  1GUK A;  2MMA A;  2H6Y A;  3HKR A;  2FLS A;  2VL3 A;  2H30 A;  1GUM A;  2O7K A;  2B3S A;  3KP9 A;  3TJB A;  1Z9H A;  5LNK e;  1PX7 A;  1K0O A;  2RLI A;  4LLR A;  3TJG A;  1YF1 A;  1MEK A;  4ZL9 A;  1K0N A;  5CRD A;  3UAP A;  2H72 A;  1JHB A;  4KCA A;  2QSI A;  3HJM A;  4TOP A;  4GF0 A;  1PKW A;  4IQA A;  2YZH A;  4BWQ A;  4WBJ A;  4BWS A;  1NHY A;  4NHW A;  3HVV A;  1XOA A;  3LGC A;  4POB A;  1I9D A;  4ZIL A;  3IOS A;  1ZCP A;  2DLX A;  2VCT A;  2VM2 A;  2JSY A;  4GSN A;  4WKW A;  4ECJ A;  2O85 A;  4Z7X A;  3GV1 A;  2TRC P;  2ALB A;  5IQY A;  1F2E A;  5G1K A;  4NV5 A;  1A0F A;  2DIY A;  5ECO B;  3MDK A;  4POL A;  2YWI A;  4AJ8 A;  1GTA A;  2VD0 A;  1SU9 A;  2OJL A;  3P90 A;  1GTB A;  4MLY A;  1K3L A;  5HR2 A;  2H0I A;  7GSS A;  2VCZ A;  1XZO A;  5ID2 B;  1B4Q A;  1RQM A;  4N30 A;  1FVJ A;  4KH7 A;  1TK0 B;  1J0F A;  2OAC A;  2CAI A;  1F9M A;  5G1L A;  4EXJ A;  5IPH A;  1EOH A;  14GS A;  4ZBA A;  2D2Z A;  2H74 A;  4PX1 A;  3VWV A;  2FGX A;  3LYK A;  4K9Z A;  1VGL A;  4ULX A;  2YWM A;  3QAV A;  4N0Z A;  1GL8 A;  1WWJ A;  3FZ4 A;  3PH9 A;  5AIS A;  3L9V A;  5EVO A;  1BYE A;  1WE0 A;  4NXI A;  3HHV A;  4TXO B;  3ME7 A;  3HVX A;  1WOU A;  2LEG A;  1G0T A;  4L8E A;  5HFK A;  1S3D A;  1MD4 A;  3I43 A;  2CQ9 A;  2GST A;  4TR1 B;  2A2R A;  2GZP A;  1PGT A;  1E6B A;  5DAL B;  1OKT A;  1G7E A;  4HZ4 A;  4GWR A;  2Z9S A;  1YQ1 A;  1HQO A;  1OE7 A;  5IMD A;  1U6T A;  1O73 A;  1ZL9 A;  4K7N A;  1YKC A;  2A2S A;  4V2L A;  1VF3 A;  3M1G A;  4ILF A;  4RI7 A;  1SJI A;  5G30 A;  5B8A A;  1B9Y C;  5INY A;  4MF6 A;  3SWL A;  4TR3 A;  5A5K A;  1M7T A;  4K2D A;  1V9W A;  2JZR A;  4ZIJ A;  3ERG A;  1HNA A;  3IBH A;  3APQ A;  1PX6 A;  3KMN A;  5G2Z A;  6GST A;  1MDJ A;  3ERF A;  3J7Y k;  5FT3 A;  4Q5N A;  5HFI A;  3G7J A;  1TP9 A;  2I4A A;  5DQY A;  4CDO A;  4JE1 A;  3Q6O A;  3GNJ A;  4YQM A;  1AQV A;  2IL3 A;  1I5G A;  2N5A A;  4G9H A;  5L71 A;  4K0N A;  4ML6 A;  2LQO A;  3F3Q A;  5ELA A;  1XW5 A;  4KGI A;  1OE8 A;  2QGV A;  3DRN A;  2VCW A;  2JU5 A;  5C00 A;  2IMD A;  4GRF A;  2E2M A;  1PN9 A;  3F4T A;  1WMJ A;  2XPE A;  3RHC A;  3TJK A;  4D73 A;  2DJJ A;  2DMM A;  2VD1 A;  4EKZ A;  1ZGN A;  3UMA A;  3CMI A;  2DML A;  2H1D A;  2PUK C;  2H75 A;  5KEJ A;  2JAC A;  1V58 A;  3N9J A;  1DE1 A;  1SJ6 A;  1EV4 A;  4HOJ A;  5IM9 A;  1KNG A;  4BPY A;  3NOF A;  1DE2 A;  5G31 A;  3EE2 A;  5IO0 A;  5IIZ A;  2DJ3 A;  4YAV A;  1B9X C;  1SJZ A;  5F06 A;  5H5S A;  5DAK A;  3KIJ A;  4HJM A;  4L0U A;  1WPI A;  2G2Q A;  3EMP A;  1VRS D;  3LQ7 A;  5ECN B;  2CX3 A;  3LJR A;  3APS A;  3TDG A;  2GS3 A;  2HSH A;  4XS6 A;  4O7H A;  4KND A;  3RAZ A;  2RUE A;  3VPQ A;  4EF0 A;  1JFU A;  3ZYW A;  4ID0 A;  2ES7 A;  1K0A A;  1A2J A;  2H66 A;  3IRA A;  3V1W A;  5CO3 A;  1OC3 A;  3QOU A;  1KTE A;  5CP1 A;  1RW1 A;  2V6K A;  5EL8 A;  3CSH A;  4FO5 A;  1EGO A;  3GTU A;  3ED3 A;  3HCZ A;  4YAP A;  1PQN A;  2FWE A;  5J9B A;  1U88 A;  2PMT A;  2ZUP A;  2RUF A;  3KGK A;  2OE0 A;  2F8F A;  4I6X A;  5IMZ A;  1PL2 A;  9GSS A;  2MMN A;  3TB2 A;  1YF0 A;  3CXG A;  5F05 A;  4MK3 A;  2H73 A;  1PRX A;  2AV4 A;  3JCM L;  3ME8 A;  5ELG A;  1KBN A;  1M2B A;  5CRE A;  2H8L A;  2VL9 A;  1GLP A;  2DJK A;  3D5J A;  1QUW A;  2N5F A;  1HNB A;  5HR3 A;  3RHB A;  2YJ7 A;  1SEN A;  2YWO A;  4XRD A;  4G10 A;  1ZOF A;  1B8X A;  1OC9 B;  2HXK A;  4KDU A;  3TUE A;  5LD0 A;  3BCI A;  4PQH A;  4CW9 A;  4MPF A;  1T3B A;  3W6G A;  4AJ7 A;  5J9C A;  4NAX A;  1JLV A;  3E9J B;  3DVW A;  1FVK A;  3GUR A;  3BJ5 A;  1AUC A;  3KJY A;  4POM A;  2LNS A;  4ZB8 A;  4OMV A;  1TK8 B;  3F8U A;  4MZW A;  5HR1 A;  3GN3 A;  1QK8 A;  4XRA A;  1N8J A;  2EIQ A;  3LXT A;  4PGT A;  5G5E A;  2M72 A;  3VWW A;  3TGZ A;  4DEJ A;  2AJQ B;  3VI5 A;  1ZYQ B;  3KP8 A;  3UBK A;  2LTK A;  3M8N A;  5F8B A;  3APO A;  3H93 A;  4IP6 A;  1F3B A;  2RM5 A;  4PUA A;  1W89 A;  3UEM A;  4IJ3 A;  2YNX A;  3F3R A;  3GL5 A;  2R6K A;  1X5C A;  3W8J A;  4WR4 A;  4IW9 A;  2H0H A;  2FWH A;  2LV3 A;  2VL2 C;  3IAS 2;  5KN2 A;  3FEU A;  5EPF A;  4IQ1 A;  4NHZ A;  4LL4 B;  3H1N A;  5J3R A;  2FA4 A;  1VF1 A;  4GLT A;  2MBT A;  5ECI B;  1NSW A;  2HZF A;  2L6C A;  3D21 A;  1XFL A;  1X9W B;  2P0G A;  2KUC A;  5ID2 A;  4K8M A;  1PKZ A;  5E59 A;  2P5R A;  1M2A A;  4L5L A;  2VM1 A;  5ECQ B;  2PBJ A;  1YJ6 A;  3GUS A;  1A2M A;  5IMA A;  2K6V A;  4TXV A;  5ECM B;  3O6T A;  2WRT A;  5H5R A;  1UVZ A;  4ACS A;  4KX4 A;  2LS5 A;  5D9V A;  5J5N A;  2OBI A;  4BVX A;  1XIY A;  1OC8 A;  4MZC A;  4WXT A;  1DSB A;  3ZTL A;  2VAF A;  4MCU A;  3DD3 A;  1K0M A;  2IJY A;  1AIU A;  4PUR A;  3D6I A;  1NW2 A;  2LST A;  3FK8 A;  4DSQ A;  3GST A;  1TRW A;  4ZL7 A;  4TXO A;  2WB9 A;  4RQR A;  2E2G A;  1OKD A;  1TK5 B;  1TU8 A;  1JZW A;  3ZRD A;  1EP7 A;  2WGR A;  4ZBD A;  2O87 A;  4TR1 A;  2TIR A;  1AC1 A;  3VWU A;  2DIZ A;  2WUL A;  3HZ8 A;  1ZYE A;  4I2U A;  5DAL A;  5CRG A;  2P31 A;  3RDW A;  2PGT A;  2VUP A;  2K9F A;  4HS1 A;  1ABA A;  3DGQ A;  1PA3 A;  3DIE A;  1V40 A;  3FZA A;  4IBP A;  3RPP A; 
#chains in the Genus database with same CATH topology
 1C72 A;  2LJK A;  1V2A A;  4AJ6 A;  1WRY A;  3TKS E;  1FAA A;  1YDK A;  5JCU A;  1GSY A;  2DKH A;  2YPM A;  3PGT A;  3R2Q A;  4ECB A;  3ZFL A;  4IKH A;  4MAB A;  3RPN A;  3C73 A;  5JCG A;  1XCC A;  5HFG A;  2YV7 A;  5HQP A;  2EIR A;  2VCV A;  4OCF A;  3A2V A;  3TRP A;  1R7H A;  1F37 A;  3FHK A;  3CBU A;  3VI7 A;  4PNG A;  3QAG A;  1TI1 A;  4XS4 B;  4F03 A;  4F2I A;  2LRC A;  1FW1 A;  1R5P A;  2CX4 A;  2HSY A;  4OFT A;  4K6X A;  3GFK A;  2IMK A;  2PPT A;  4IHU A;  3TKS A;  4TW5 A;  3KCM A;  2LKU A;  3GIX A;  2FNO A;  5DCG A;  4IN0 A;  1A2L A;  3H8Q A;  2C1Y A;  2HFD A;  1YZX A;  5AIV A;  1MDK A;  4Z2U A;  3BCK A;  3A2X A;  1R4W A;  3AY8 A;  4X43 A;  2MBS A;  3EUR A;  2CT6 A;  3DXB A;  3QDN A;  1NHO A;  4KAE A;  4GXZ A;  4ZB9 A;  2WDU A;  1U3I A;  2DKI A;  3F63 A;  2C3N A;  1BED A;  2GT5 A;  4XS1 A;  4IGJ A;  2UZ8 A;  3EU3 A;  4EC0 A;  3I6A A;  5IOX A;  3BOA A;  4K7I A;  4MJB A;  5D9X A;  1ZYN A;  3TJJ A;  1X9M B;  4HZ2 A;  2E7P A;  4I5Q A;  1K0D A;  4V1A g;  3US3 A;  3KXO A;  4EVM A;  3EPT A;  2CA8 A;  3EMX A;  4F82 A;  6GSW A;  4PXO A;  4V1A p;  4OD7 A;  4KSM A;  2C0D A;  2WS2 A;  3O76 A;  3IR4 A;  4JRR A;  3UAR A;  5KN3 A;  1BG5 A;  2R3X A;  3F6F A;  2X64 A;  3Q18 A;  1FOH A;  5CYY A;  3VPT A;  4G19 A;  1T4Y A;  1FHE A;  1O81 A;  5IMC A;  1F6M C;  3O3T A;  3GH9 A;  2A2P A;  2YOI A;  4TR4 A;  1GP1 A;  5DJL A;  1OVN A;  4CHS A;  3L0H A;  4AGS A;  3HXS A;  4FYB A;  1VF2 A;  2CVD A;  1A23 A;  3MAK A;  3DEX A;  2LNT A;  5JWR B;  4BVY A;  1SKR B;  3GRX A;  3EYT A;  1EGR A;  3VFI A;  3QFA C;  2VLU A;  4QQ7 A;  4WEY A;  3ZFB A;  3QMX A;  1YEP A;  2IPA A;  3TJF A;  1TW9 A;  2DBC A;  4BL7 B;  5ECR B;  4Z2R A;  3KTB A;  4OO4 A;  1PFO A;  3N5O A;  2CVB A;  1Z6M A;  1TDI A;  2B5X A;  5D93 A;  5KN1 A;  4HJ2 A;  2VLT A;  4JU5 A;  4LMW A;  2B6M A;  6GSX A;  1ILO A;  2V2G A;  3GKM A;  3Q74 A;  2H6X A;  2LJA A;  3KZQ A;  2BTO T;  3FW2 A;  4XCS A;  2F8A A;  2BJX A;  2YZU A;  2YWN A;  4Q5F A;  3IXR A;  2GZZ A;  22GS A;  2LQQ A;  2OBK A;  1O7U A;  1FG4 A;  1X5E A;  3ZRE A;  2C4J A;  3ZVJ D;  1OC9 A;  1ACV A;  4PQI A;  3TKP A;  2L59 A;  1FB6 A;  1PD2 1;  3TRQ A;  4G0K A;  3S9F A;  5C04 A;  3I9V 2;  2I9H A;  3D4M A;  4OFN A;  1SK0 A;  2QC7 A;  2I3Y A;  2NVL A;  2MZC A;  2K8S A;  4WET A;  3F9U A;  1GTI A;  4DSR A;  2O89 A;  2GTU A;  2EC4 A;  5ABR A;  5GZZ B;  1SL1 B;  3IAM 2;  3E0U A;  3HZ4 A;  1QMV A;  1XWA A;  3EC3 A;  1JLW A;  8GSS A;  3M0F A;  1EEM A;  1SD8 A;  2WZ9 A;  2R2J A;  3TKQ A;  3RBT A;  2AAW A;  4MP4 A;  5E4W A;  1V57 A;  1AQW A;  1ERV A;  4MMM A;  3ZZX A;  4TRX A;  2FCH A;  4F0B A;  4RI6 A;  3GX8 A;  16GS A;  1Y25 A;  2GZY A;  3GSS A;  3QAW A;  3WGE A;  3MSZ A;  2PN8 A;  3ZMK A;  4RUV A;  1E2Y A;  2G0F A;  4EO3 A;  4JED A;  2DJ2 A;  4E8H A;  3UBL A;  3WYW A;  4N0V A;  2C0E A;  2HZE B;  5KOW A;  2MYG A;  1MTC A;  3A3T A;  1K3Y A;  4H86 A;  4MDC A;  3IV4 A;  4OWY A;  4E8E A;  17GS A;  5F0G A;  11GS A;  4P3Y B;  4I97 A;  4TVE A;  2K18 A;  3ZIT A;  3GKK A;  2A4V A;  2YAN A;  4USS A;  1HNC A;  2F9S A;  2M80 A;  2H19 A;  5CAX A;  3G7I A;  4AF2 A;  4L0W A;  1SK2 A;  5F07 A;  1NM3 A;  5B6N A;  3PR8 A;  3ZML A;  1ERU A;  3C1R A;  1TTZ A;  1O8X A;  1RK4 A;  4Q5Q A;  1WJK A;  3GH6 A;  1UC7 A;  2AUV A;  1IYI A;  3I69 A;  3MNG A;  3CYN A;  3LXZ A;  1CQH A;  2X8H A;  4KA0 A;  1IYH A;  3GX0 A;  4F9Z A;  1GH2 A;  1O8W A;  1FOV A;  5GAP D;  1M99 A;  2DJ1 A;  5ECL B;  2X8G A;  1GUL A;  4LL1 B;  2YCD A;  2IWT A;  1MDI A;  1SK1 A;  4MF7 A;  1S3C A;  3F4S A;  5A4W A;  1M9B A;  2C3Q A;  2L6D A;  2FA8 A;  2GQL A;  3HDC A;  4EIQ A;  2C0F A;  1TU7 A;  4HQZ A;  4LA1 A;  3G9B A;  4IJI A;  2HT9 A;  4NMU A;  1THO A;  3EVI A;  4FYU A;  3HYP A;  3F4R A;  2X8C A;  2J9H A;  1PSQ A;  2R0P A;  4O5Q A;  4GQF A;  4ECI A;  2JZT A;  2JSZ A;  3FZ9 A;  1T7P B;  1LU4 A;  1WIK A;  2NBS A;  2R37 A;  2FY6 A;  3P8W A;  4KDX A;  2VLV A;  2O8V B;  3GL3 A;  4QL9 A;  4BA7 A;  4MJA A;  5LCZ A;  2F3M A;  1TRS A;  2HNL A;  5D73 A;  1X0R A;  1Q4J A;  2L4C A;  4XS4 A;  2CZ3 A;  1M2D A;  1BJX A;  2P5Q A;  2OE1 A;  2IFQ B;  2F51 A;  4GQC A;  3FRC A;  2L57 A;  4XIH A;  5AN1 A;  3UIW A;  2E0Q A;  5DJM A;  3MYD A;  1XWB A;  3VLN A;  3K8N A;  5COH A;  3TCO A;  5IOW A;  3E3E A;  3LWA A;  1T8E B;  5CRH A;  3FMW A;  3DWV A;  2L5L A;  1EV9 A;  1XVQ A;  2HRF A;  5B7C A;  3QR6 A;  4DSS B;  1Z6N A;  3DVX A;  4ML1 A;  2C8U A;  1A8L A;  4JBB A;  3EIN A;  1EZK A;  4HDE A;  2VO4 A;  3FY7 A;  1USB A;  1K0B A;  5KOX A;  3HD5 A;  1VF4 A;  4IS0 A;  1WP0 A;  4MJE A;  2H1G A;  1V98 A;  2KP2 A;  4LMV A;  4OO5 A;  1SYR A;  5DVB A;  12GS A;  1TJD A;  3PIN A;  2IN3 A;  3IA1 A;  3EWL A;  2JL4 A;  1M0U A;  3SBC A;  3ZL5 A;  2WCI A;  1M3I A;  3KMO A;  2YP6 A;  4TR0 A;  1GSU A;  4PQ1 A;  4EUY A;  1T00 A;  5IMF A;  2LRN A;  5A4U A;  4ZL8 A;  1FO5 A;  3CSI A;  1EP8 A;  5J41 A;  4GSS A;  2AYT A;  1S3R A;  1GWC A;  2H0G A;  2OAD A;  4WF4 A;  2K8V A;  4WR5 A;  2V41 A;  2V1M A;  4G2E A;  4MA9 A;  2CVK A;  4HSC X;  2VOC A;  2OA7 A;  6GSS A;  3ZIV A;  2ON5 A;  1XWG A;  3F6D A;  3WT1 A;  3Q19 A;  3TOU A;  3C1S A;  3C7M A;  3UL3 A;  1DUG A;  2X99 A;  1G7O A;  4KB3 A;  1U87 A;  2GT6 A;  2IIY A;  4NWY A;  2B1K A;  1GUH A;  1QQ2 A;  4XTS A;  4EDZ A;  3L9S A;  3A5W A;  5ECP B;  1OYJ A;  2FHE A;  3LSZ A;  2I81 A;  1J9B A;  1R5A A;  4F0C A;  1ZMA A;  4MF5 A;  1GNW A;  4BL7 A;  3KEB A;  1FB0 A;  2JZS A;  5BRT A;  2X4A A;  1Q98 A;  19GS A;  2AHE A;  3ZVJ A;  3GA4 A;  2B1L A;  2XC2 A;  2XPD A;  2RM6 A;  3NIV A;  6GSY A;  1AW9 A;  1LBK A;  3CRT A;  2GSQ A;  3KTL A;  3DML A;  2TRX A;  4FYC A;  2EIO A;  4V2N A;  2QKE A;  1JZD A;  3OR5 A;  1ZYP A;  2B7J A;  2IMI A;  3CTG A;  4YQU A;  4O92 A;  1T1V A;  5B8B A;  3HVS A;  3IDV A;  1QXH A;  4MPG A;  5D96 A;  2L4Q A;  1K0C A;  4QL7 A;  5AGY A;  2YN1 A;  3WGD A;  2YJH A;  4KCE A;  3LEF A;  3EU4 A;  1O6J A;  4YH2 A;  3WT2 A;  4X1U A;  3HVN A;  4J2F A;  1T4Z A;  4TKY A;  4I2T A;  1TRV A;  3A5I A;  1H75 A;  2CZ2 A;  6GSU A;  4Q5R A;  2DC5 A;  4JZQ A;  3L78 A;  3CTF A;  5DQS A;  4DVC A;  1AXD A;  4MZB A;  3IE3 A;  2LUS A;  2R5G A;  3VK9 A;  1GSE A;  2C0G A;  3BBY A;  1QFN A;  2J23 A;  1Y6E A;  2GSR A;  3FZ5 A;  4J57 E;  3M3M A;  2IME A;  5JCW A;  1MD3 A;  1QGV A;  4KUN A;  3C71 A;  5ENU A;  13GS A;  1YY7 A;  3M9K A;  1A0R P;  2I1U A;  2GLR A;  2PU9 C;  4J56 E;  2R0G A;  1EEJ A;  3FR3 A;  3C8E A;  1HD2 A;  5JWO B;  1K3O A;  2MMO A;  3P7X A;  1Z5Y E;  3H79 A;  5DCH A;  3TKS C;  5B6M A;  1SL2 B;  2HZE A;  2H71 A;  2XHF A;  3H4K A;  1F3A A;  5D8I A;  4WF5 A;  3GMF A;  4JR4 A;  1DBY A;  2R4V A;  2GVP A;  4XHM A;  1Z7P A;  1Z3E A;  2HLS A;  2VCQ A;  2H76 A;  1Z7R A;  4WBR D;  3FR9 A;  2IMF A;  3VUR A;  1GNE A;  4L5O A;  3QCP A;  2RII A;  5D9W A;  5EY6 A;  3KD0 A;  4K5R A;  1X5D A;  2DJ0 A;  4O32 A;  4RQX A;  3P2A A;  3L9U A;  2KLX A;  3GKX A;  3UVT A;  3D22 A;  3TRX A;  4MJC A;  2WFC A;  1B48 A;  5A4V A;  2GDR A;  3QFB C;  1R26 A;  2H01 A;  4KW6 A;  1EOG A;  2C3T A;  2FUG 2;  1XW6 A;  1ST9 A;  4ZBB A;  1URM A;  4GTU A;  5CNW A;  4N10 A;  1ERT A;  3KH9 A;  3ZLP A;  5DDL A;  3D4T A;  3MWH A;  4YQV A;  1UA5 A;  4ZB6 A;  3IK9 A;  1AAZ A;  1ERW A;  1UN2 A;  1TXX A;  3QD9 A;  4HEA 2;  3KM6 A;  2N5B A;  5CRW A;  2XBI A;  4O5R A;  1XPV A;  2OE3 A;  4MH2 A;  5KN0 A;  1GSD A;  2B5Y A;  4GCI A;  1SKW B;  1ON4 A;  1PL1 A;  4K1F A;  1O85 A;  2NTO A;  5IMV A;  2FWG A;  1YEX A;  2NPB A;  1XOB A;  3LFL A;  1A8Y A;  2GQM A;  4PUF C;  4TN8 A;  1G6Y A;  3GHA A;  4N11 A;  2ON7 A;  3VWX A;  18GS A;  3QPM A;  3GYK A;  2PVQ A;  3IK7 A;  3FYG A;  1THX A;  4HUA A;  2CAQ A;  4NV2 A;  3WGX A;  2H70 A;  2C80 A;  1TKD B;  3TKR A;  1XW9 A;  2WJU A;  5G5F A;  1J08 A;  5D9T A;  2H1B A;  3D0Z A;  1XVW A;  1SYX A;  3NZN A;  1SKS B;  2HYX A;  2XBQ A;  2M46 A;  1M9A A;  5IPG A;  1W4V A;  4I8B A;  2A4H A;  2VL2 A;  4HU7 A;  1B4P A;  2YV9 A;  5DBQ A;  1KEB A;  2IFQ A;  2FD3 A;  4V2M A;  1TRU A;  2HSM A;  2LJR A;  5FHI A;  2VIM A;  2HE3 A;  3HA9 A;  1XBS A;  5ECS A;  3M9J A;  4NPB A;  4GST A;  1CQG A;  1JZR A;  3GKN A;  2H1A A;  4D73 B;  2NDO A;  3FKF A;  1XWK A;  3ZIJ A;  2REM A;  1S3A A;  1PN0 A;  2B5E A;  3L4N A;  3IC4 A;  3WD6 A;  3FR6 A;  4YKG A;  3CRU A;  4DSS A;  3U5R E;  4KDY A;  5FWG A;  2KP1 A;  2H6Z A;  3LG6 A;  3G7Y A;  3HJO A;  4EIP A;  1N2A A;  4BIK A;  5GSS A;  4EDY A;  4OFM A;  4K7O A;  3U6V A;  2KHP A;  5JWQ B;  4PTS A;  2PWJ A;  4PNF A;  5DAK B;  2ZNM A;  2OKA A;  10GS A;  3LYP A;  4ISD A;  4EL1 A;  3BD2 A;  1GTU A;  2FWF A;  3HY2 A;  3W8S A;  4ZXG A;  5HR0 A;  1G6W A;  2BMX A;  2HI7 A;  2PVO C;  4IVF A;  1X9S B;  4X0X A;  2HRN A;  4EE0 A;  3CSJ A;  1LJR A;  1XWC A;  2AB6 A;  2B7K A;  2VCX A;  5GST A;  3TOT A;  1ZZY A;  2L5O A;  5IO2 A;  4JR6 A;  1ML6 A;  3A2W A;  2CV4 A;  1BX9 A;  3ISO A;  5ECH B;  1TI3 A;  2R0C A;  1AQX A;  1U3A A;  20GS A;  4HI7 A;  6GSV A;  1GSQ A;  2MMZ A;  4KSO A;  3UJ1 A;  1H4O A;  3LOR A;  4CY8 A;  1HYU A;  3GTU B;  3R3E A;  2PER A;  4MH3 A;  4HU9 A;  3KH7 A;  3HJP A;  2KOK A;  4ECC A;  3DKS A;  2GQK A;  3IC8 A;  1A24 A;  3J7Y b;  1GSS A;  3F0I A;  4K0G A;  4OCE A;  5GAN D;  2GSS A;  4IP1 A;  4K2X A;  1GLQ A;  4HQS A;  2V32 A;  1JZO A;  4POK A;  4FIW A;  1XXU A;  3ERW A;  2V6O A;  3IHQ A;  4X4J A;  1BQ7 A;  3UOM A;  5J4U A;  1M3J A;  3DYR A;  1GRX A;  5ECK B;  5H5Q A;  5AIX A;  4KE3 A;  4FH8 A;  1BAY A;  3IPZ A;  2JAD A;  2LRT A;  3UVH A;  1YKA A;  2ZCT A;  1PMT A;  1SD9 A;  1OAZ A;  1SL0 B;  1EWX A;  1TOF A;  4IEL A;  1GSF A;  2GGT A;  2DSA A;  1GUK A;  2MMA A;  2H6Y A;  3HKR A;  2FLS A;  2VL3 A;  2H30 A;  1GUM A;  2O7K A;  2B3S A;  3KP9 A;  3TJB A;  1Z9H A;  5LNK e;  1PX7 A;  1K0O A;  2RLI A;  4LLR A;  4A5P A;  3TJG A;  1YF1 A;  1MEK A;  4ZL9 A;  1K0N A;  5CRD A;  3UAP A;  2H72 A;  1JHB A;  4KCA A;  2QSI A;  3HJM A;  4TOP A;  4GF0 A;  1PKW A;  4IQA A;  2YZH A;  4BWQ A;  4WBJ A;  4BWS A;  1NHY A;  4NHW A;  3HVV A;  1XOA A;  3LGC A;  4POB A;  1I9D A;  4ZIL A;  3IOS A;  1ZCP A;  2DLX A;  2VCT A;  2VM2 A;  2JSY A;  4GSN A;  4WKW A;  4ECJ A;  2O85 A;  4Z7X A;  3GV1 A;  2TRC P;  2ALB A;  5IQY A;  1F2E A;  5G1K A;  4NV5 A;  1A0F A;  2DIY A;  5ECO B;  3MDK A;  4POL A;  2YWI A;  4AJ8 A;  1GTA A;  4ICY A;  2VD0 A;  1SU9 A;  2OJL A;  3P90 A;  1GTB A;  4MLY A;  1K3L A;  4FQU A;  5HR2 A;  2H0I A;  7GSS A;  4O5U A;  2VCZ A;  1XZO A;  5ID2 B;  1B4Q A;  1RQM A;  4N30 A;  1FVJ A;  4KH7 A;  1TK0 B;  1J0F A;  2OAC A;  2CAI A;  1F9M A;  5G1L A;  4EXJ A;  5IPH A;  1EOH A;  14GS A;  4ZBA A;  2D2Z A;  2H74 A;  4PX1 A;  3IHG A;  3VWV A;  2FGX A;  3LYK A;  2X49 A;  3LW9 A;  4K9Z A;  4KF9 A;  4BVX B;  1VGL A;  4ULX A;  2YWM A;  3QAV A;  4N0Z A;  1GL8 A;  1WWJ A;  3FZ4 A;  3PH9 A;  5AIS A;  3L9V A;  5EVO A;  1BYE A;  4G0I A;  1WE0 A;  4NXI A;  3HHV A;  4TXO B;  3ME7 A;  3HVX A;  1WOU A;  2LEG A;  1G0T A;  4L8E A;  5HFK A;  1S3D A;  1MD4 A;  3I43 A;  2CQ9 A;  2GST A;  4TR1 B;  2A2R A;  2GZP A;  1PGT A;  1E6B A;  5DAL B;  1OKT A;  1G7E A;  4HZ4 A;  4GWR A;  2Z9S A;  1YQ1 A;  1HQO A;  1OE7 A;  5IMD A;  1U6T A;  1O73 A;  1ZL9 A;  4K7N A;  1YKC A;  2A2S A;  4V2L A;  1VF3 A;  3M1G A;  4ILF A;  4RI7 A;  1SJI A;  5G30 A;  5B8A A;  1B9Y C;  5INY A;  4MF6 A;  3SWL A;  4TR3 A;  5A5K A;  1M7T A;  4K2D A;  1V9W A;  2JZR A;  4ZIJ A;  3ERG A;  1HNA A;  3IBH A;  3APQ A;  1PX6 A;  3KMN A;  5G2Z A;  6GST A;  1MDJ A;  3ERF A;  3J7Y k;  5FT3 A;  4Q5N A;  5HFI A;  3G7J A;  1TP9 A;  2I4A A;  5DQY A;  4CDO A;  4JE1 A;  3Q6O A;  3GNJ A;  4YQM A;  1AQV A;  2IL3 A;  1I5G A;  2N5A A;  4G9H A;  5L71 A;  4K0N A;  1XG8 A;  2QA2 A;  4ML6 A;  2LQO A;  3F3Q A;  5ELA A;  1XW5 A;  4KGI A;  1OE8 A;  2QGV A;  3DRN A;  2VCW A;  2JU5 A;  5C00 A;  2IMD A;  4GRF A;  2E2M A;  1PN9 A;  3F4T A;  1WMJ A;  2XPE A;  3RHC A;  3TJK A;  4D73 A;  2DJJ A;  2DMM A;  2VD1 A;  4EKZ A;  1ZGN A;  3UMA A;  3CMI A;  2DML A;  2H1D A;  2PUK C;  2H75 A;  5KEJ A;  2JAC A;  1V58 A;  3N9J A;  1DE1 A;  1SJ6 A;  1EV4 A;  4HOJ A;  5IM9 A;  1KNG A;  4BPY A;  3NOF A;  1DE2 A;  5G31 A;  4YKF A;  3EE2 A;  5IO0 A;  5IIZ A;  2DJ3 A;  4YAV A;  1B9X C;  1SJZ A;  5F06 A;  5H5S A;  5DAK A;  3KIJ A;  4HJM A;  4L0U A;  1WPI A;  2G2Q A;  3EMP A;  1VRS D;  3LQ7 A;  5ECN B;  2CX3 A;  3LJR A;  3APS A;  3TDG A;  2GS3 A;  2HSH A;  4XS6 A;  4O7H A;  4KND A;  3RAZ A;  2RUE A;  3VPQ A;  4EF0 A;  1JFU A;  3ZYW A;  4ID0 A;  2ES7 A;  1K0A A;  1A2J A;  2H66 A;  3IRA A;  3V1W A;  5CO3 A;  1OC3 A;  3QOU A;  4BVY B;  1KTE A;  5CP1 A;  1RW1 A;  2V6K A;  5EL8 A;  3MIX A;  3CSH A;  4FO5 A;  3PPU A;  1EGO A;  3GTU A;  3ED3 A;  3HCZ A;  4YAP A;  1PQN A;  2FWE A;  5J9B A;  1U88 A;  2PMT A;  2ZUP A;  2RUF A;  3KGK A;  2OE0 A;  3CQF A;  2F8F A;  4I6X A;  5IMZ A;  1PL2 A;  9GSS A;  2MMN A;  3TB2 A;  1YF0 A;  3CXG A;  5F05 A;  4MK3 A;  2H73 A;  1PRX A;  2AV4 A;  3JCM L;  3ME8 A;  5ELG A;  4MNN A;  1KBN A;  1M2B A;  5CRE A;  2H8L A;  2VL9 A;  1GLP A;  2DJK A;  3D5J A;  1QUW A;  2N5F A;  1HNB A;  5HR3 A;  3RHB A;  2YJ7 A;  1SEN A;  2YWO A;  4XRD A;  4G10 A;  1ZOF A;  4G0L A;  1B8X A;  1OC9 B;  2HXK A;  4KDU A;  3TUE A;  4K5S A;  5LD0 A;  3BCI A;  4PQH A;  4CW9 A;  4MPF A;  1T3B A;  3W6G A;  4AJ7 A;  5J9C A;  4NAX A;  1JLV A;  3E9J B;  3DVW A;  1FVK A;  3GUR A;  3BJ5 A;  1AUC A;  3KJY A;  4POM A;  2LNS A;  4ZB8 A;  4OMV A;  1TK8 B;  3F8U A;  4MZW A;  5HR1 A;  3GN3 A;  1QK8 A;  4XRA A;  1N8J A;  2EIQ A;  3LXT A;  4PGT A;  5G5E A;  2M72 A;  3VWW A;  3TGZ A;  4DEJ A;  2AJQ B;  3VI5 A;  1ZYQ B;  3KP8 A;  3UBK A;  2LTK A;  3M8N A;  5F8B A;  2QA1 A;  3APO A;  3H93 A;  4IP6 A;  1F3B A;  2RM5 A;  4PUA A;  1W89 A;  3UEM A;  4IJ3 A;  2YNX A;  3F3R A;  3GL5 A;  2R6K A;  1X5C A;  3W8J A;  4WR4 A;  4IW9 A;  2H0H A;  2FWH A;  2LV3 A;  2VL2 C;  3IAS 2;  5KN2 A;  3FEU A;  5EPF A;  4IQ1 A;  4NHZ A;  4LL4 B;  3H1N A;  5J3R A;  2FA4 A;  1VF1 A;  4GLT A;  2MBT A;  5ECI B;  1NSW A;  5BMU A;  2HZF A;  2L6C A;  3D21 A;  1XFL A;  1X9W B;  2P0G A;  2KUC A;  5ID2 A;  4K8M A;  1PKZ A;  5E59 A;  2P5R A;  1M2A A;  4L5L A;  2VM1 A;  5ECQ B;  2PBJ A;  1YJ6 A;  3GUS A;  1A2M A;  5IMA A;  2K6V A;  4TXV A;  5ECM B;  3O6T A;  2WRT A;  5H5R A;  2HRK A;  1UVZ A;  4ACS A;  4KX4 A;  2LS5 A;  5D9V A;  5J5N A;  2OBI A;  4BVX A;  1XIY A;  1OC8 A;  4CY6 A;  4MZC A;  4WXT A;  1DSB A;  3ZTL A;  2HRA A;  4MCU A;  2VAF A;  3DD3 A;  1K0M A;  4Z2T A;  2IJY A;  1AIU A;  4PUR A;  3D6I A;  1NW2 A;  2LST A;  3FK8 A;  4DSQ A;  3GST A;  1TRW A;  4ZL7 A;  4TXO A;  2WB9 A;  4RQR A;  2E2G A;  1OKD A;  1TK5 B;  1TU8 A;  1JZW A;  3ZRD A;  1EP7 A;  2WGR A;  4ZBD A;  2O87 A;  4TR1 A;  2TIR A;  1AC1 A;  3VWU A;  2DIZ A;  2WUL A;  3HZ8 A;  1ZYE A;  4I2U A;  5DAL A;  5CRG A;  2P31 A;  3RDW A;  2PGT A;  2VUP A;  2K9F A;  4HS1 A;  1ABA A;  3DGQ A;  1PA3 A;  3DIE A;  1V40 A;  3FZA A;  4IBP A;  3RPP A; 
#chains in the Genus database with same CATH homology
 1C72 A;  2LJK A;  1V2A A;  4AJ6 A;  1WRY A;  3TKS E;  1FAA A;  1YDK A;  5JCU A;  1GSY A;  2DKH A;  2YPM A;  3PGT A;  3R2Q A;  4ECB A;  3ZFL A;  4IKH A;  4MAB A;  3RPN A;  3C73 A;  5JCG A;  1XCC A;  5HFG A;  2YV7 A;  5HQP A;  2EIR A;  2VCV A;  4OCF A;  3A2V A;  3TRP A;  1R7H A;  1F37 A;  3FHK A;  3CBU A;  3VI7 A;  4PNG A;  3QAG A;  1TI1 A;  4XS4 B;  4F03 A;  4F2I A;  2LRC A;  1FW1 A;  1R5P A;  2CX4 A;  2HSY A;  4OFT A;  4K6X A;  3GFK A;  2IMK A;  2PPT A;  4IHU A;  3TKS A;  4TW5 A;  3KCM A;  2LKU A;  3GIX A;  2FNO A;  5DCG A;  4IN0 A;  1A2L A;  3H8Q A;  2C1Y A;  2HFD A;  1YZX A;  5AIV A;  1MDK A;  4Z2U A;  3BCK A;  3A2X A;  1R4W A;  3AY8 A;  4X43 A;  2MBS A;  3EUR A;  2CT6 A;  3DXB A;  3QDN A;  1NHO A;  4KAE A;  4GXZ A;  4ZB9 A;  2WDU A;  1U3I A;  2DKI A;  3F63 A;  2C3N A;  1BED A;  2GT5 A;  4XS1 A;  4IGJ A;  2UZ8 A;  3EU3 A;  4EC0 A;  3I6A A;  5IOX A;  3BOA A;  4K7I A;  4MJB A;  5D9X A;  1ZYN A;  3TJJ A;  1X9M B;  4HZ2 A;  2E7P A;  4I5Q A;  1K0D A;  4V1A g;  3US3 A;  3KXO A;  4EVM A;  3EPT A;  2CA8 A;  3EMX A;  4F82 A;  6GSW A;  4PXO A;  4V1A p;  4OD7 A;  4KSM A;  2C0D A;  2WS2 A;  3O76 A;  3IR4 A;  4JRR A;  3UAR A;  5KN3 A;  1BG5 A;  2R3X A;  3F6F A;  2X64 A;  3Q18 A;  1FOH A;  5CYY A;  3VPT A;  4G19 A;  1T4Y A;  1FHE A;  1O81 A;  5IMC A;  1F6M C;  3O3T A;  3GH9 A;  2A2P A;  2YOI A;  4TR4 A;  1GP1 A;  5DJL A;  1OVN A;  4CHS A;  3L0H A;  4AGS A;  3HXS A;  4FYB A;  1VF2 A;  2CVD A;  1A23 A;  3MAK A;  3DEX A;  2LNT A;  5JWR B;  4BVY A;  1SKR B;  3GRX A;  3EYT A;  1EGR A;  3VFI A;  3QFA C;  2VLU A;  4QQ7 A;  4WEY A;  3ZFB A;  3QMX A;  1YEP A;  2IPA A;  3TJF A;  1TW9 A;  2DBC A;  4BL7 B;  5ECR B;  4Z2R A;  3KTB A;  4OO4 A;  3N5O A;  2CVB A;  1Z6M A;  1TDI A;  2B5X A;  5D93 A;  5KN1 A;  4HJ2 A;  2VLT A;  4JU5 A;  4LMW A;  2B6M A;  6GSX A;  1ILO A;  2V2G A;  3GKM A;  3Q74 A;  2H6X A;  2LJA A;  3KZQ A;  2BTO T;  3FW2 A;  4XCS A;  2F8A A;  2BJX A;  2YZU A;  2YWN A;  4Q5F A;  3IXR A;  2GZZ A;  22GS A;  2LQQ A;  2OBK A;  1O7U A;  1FG4 A;  1X5E A;  3ZRE A;  2C4J A;  3ZVJ D;  1OC9 A;  1ACV A;  4PQI A;  3TKP A;  2L59 A;  1FB6 A;  1PD2 1;  3TRQ A;  4G0K A;  3S9F A;  5C04 A;  3I9V 2;  2I9H A;  3D4M A;  4OFN A;  1SK0 A;  2QC7 A;  2I3Y A;  2NVL A;  2MZC A;  2K8S A;  4WET A;  3F9U A;  1GTI A;  4DSR A;  2O89 A;  2GTU A;  2EC4 A;  5ABR A;  5GZZ B;  1SL1 B;  3IAM 2;  3E0U A;  3HZ4 A;  1QMV A;  1XWA A;  3EC3 A;  1JLW A;  8GSS A;  3M0F A;  1EEM A;  1SD8 A;  2WZ9 A;  2R2J A;  3TKQ A;  3RBT A;  2AAW A;  4MP4 A;  5E4W A;  1V57 A;  1AQW A;  1ERV A;  4MMM A;  3ZZX A;  4TRX A;  2FCH A;  4F0B A;  4RI6 A;  3GX8 A;  16GS A;  1Y25 A;  2GZY A;  3GSS A;  3QAW A;  3WGE A;  3MSZ A;  2PN8 A;  3ZMK A;  4RUV A;  1E2Y A;  2G0F A;  4EO3 A;  4JED A;  2DJ2 A;  4E8H A;  3UBL A;  3WYW A;  4N0V A;  2C0E A;  2HZE B;  5KOW A;  2MYG A;  1MTC A;  3A3T A;  1K3Y A;  4H86 A;  4MDC A;  3IV4 A;  4OWY A;  4E8E A;  17GS A;  5F0G A;  11GS A;  4P3Y B;  4I97 A;  4TVE A;  2K18 A;  3ZIT A;  3GKK A;  2A4V A;  2YAN A;  4USS A;  1HNC A;  2F9S A;  2M80 A;  2H19 A;  5CAX A;  3G7I A;  4AF2 A;  4L0W A;  1SK2 A;  5F07 A;  1NM3 A;  5B6N A;  3PR8 A;  3ZML A;  1ERU A;  3C1R A;  1TTZ A;  1O8X A;  1RK4 A;  4Q5Q A;  1WJK A;  3GH6 A;  1UC7 A;  2AUV A;  1IYI A;  3I69 A;  3MNG A;  3CYN A;  3LXZ A;  1CQH A;  2X8H A;  4KA0 A;  1IYH A;  3GX0 A;  4F9Z A;  1GH2 A;  1O8W A;  1FOV A;  5GAP D;  1M99 A;  2DJ1 A;  5ECL B;  2X8G A;  1GUL A;  4LL1 B;  2YCD A;  2IWT A;  1MDI A;  1SK1 A;  4MF7 A;  1S3C A;  3F4S A;  5A4W A;  1M9B A;  2C3Q A;  2L6D A;  2FA8 A;  2GQL A;  3HDC A;  4EIQ A;  2C0F A;  1TU7 A;  4HQZ A;  4LA1 A;  3G9B A;  4IJI A;  2HT9 A;  4NMU A;  1THO A;  3EVI A;  4FYU A;  3HYP A;  3F4R A;  2X8C A;  2J9H A;  1PSQ A;  2R0P A;  4O5Q A;  4GQF A;  4ECI A;  2JZT A;  2JSZ A;  3FZ9 A;  1T7P B;  1LU4 A;  1WIK A;  2NBS A;  2R37 A;  2FY6 A;  3P8W A;  4KDX A;  2VLV A;  2O8V B;  3GL3 A;  4QL9 A;  4BA7 A;  4MJA A;  5LCZ A;  2F3M A;  1TRS A;  2HNL A;  5D73 A;  1X0R A;  1Q4J A;  2L4C A;  4XS4 A;  2CZ3 A;  1M2D A;  1BJX A;  2P5Q A;  2OE1 A;  2IFQ B;  2F51 A;  4GQC A;  3FRC A;  2L57 A;  4XIH A;  5AN1 A;  3UIW A;  2E0Q A;  5DJM A;  3MYD A;  1XWB A;  3VLN A;  3K8N A;  5COH A;  3TCO A;  5IOW A;  3E3E A;  3LWA A;  1T8E B;  5CRH A;  3FMW A;  3DWV A;  2L5L A;  1EV9 A;  1XVQ A;  2HRF A;  5B7C A;  3QR6 A;  4DSS B;  1Z6N A;  3DVX A;  4ML1 A;  2C8U A;  1A8L A;  4JBB A;  3EIN A;  1EZK A;  4HDE A;  2VO4 A;  3FY7 A;  1USB A;  1K0B A;  5KOX A;  3HD5 A;  1VF4 A;  4IS0 A;  1WP0 A;  4MJE A;  2H1G A;  1V98 A;  2KP2 A;  4LMV A;  4OO5 A;  1SYR A;  5DVB A;  12GS A;  1TJD A;  3PIN A;  2IN3 A;  3IA1 A;  3EWL A;  2JL4 A;  1M0U A;  3SBC A;  3ZL5 A;  2WCI A;  3KMO A;  2YP6 A;  4TR0 A;  1GSU A;  4PQ1 A;  4EUY A;  1T00 A;  5IMF A;  2LRN A;  5A4U A;  4ZL8 A;  1FO5 A;  3CSI A;  1EP8 A;  5J41 A;  4GSS A;  2AYT A;  1GWC A;  2H0G A;  2OAD A;  4WF4 A;  2K8V A;  4WR5 A;  2V41 A;  2V1M A;  4G2E A;  4MA9 A;  2CVK A;  2VOC A;  2OA7 A;  6GSS A;  3ZIV A;  2ON5 A;  1XWG A;  3F6D A;  3WT1 A;  3Q19 A;  3TOU A;  3C1S A;  3C7M A;  3UL3 A;  1DUG A;  2X99 A;  1G7O A;  4KB3 A;  1U87 A;  2GT6 A;  2IIY A;  4NWY A;  2B1K A;  1GUH A;  1QQ2 A;  4XTS A;  4EDZ A;  3L9S A;  3A5W A;  5ECP B;  1OYJ A;  2FHE A;  3LSZ A;  2I81 A;  1J9B A;  1R5A A;  4F0C A;  1ZMA A;  4MF5 A;  1GNW A;  4BL7 A;  3KEB A;  1FB0 A;  2JZS A;  5BRT A;  2X4A A;  1Q98 A;  19GS A;  2AHE A;  3ZVJ A;  3GA4 A;  2B1L A;  2XC2 A;  2XPD A;  2RM6 A;  3NIV A;  6GSY A;  1AW9 A;  1LBK A;  3CRT A;  2GSQ A;  3KTL A;  3DML A;  2TRX A;  4FYC A;  2EIO A;  4V2N A;  2QKE A;  1JZD A;  3OR5 A;  1ZYP A;  2B7J A;  2IMI A;  3CTG A;  4YQU A;  4O92 A;  1T1V A;  5B8B A;  3HVS A;  3IDV A;  1QXH A;  4MPG A;  5D96 A;  2L4Q A;  1K0C A;  4QL7 A;  5AGY A;  2YN1 A;  3WGD A;  2YJH A;  4KCE A;  3LEF A;  3EU4 A;  1O6J A;  4YH2 A;  3WT2 A;  4X1U A;  4J2F A;  1T4Z A;  4TKY A;  4I2T A;  1TRV A;  3A5I A;  1H75 A;  2CZ2 A;  6GSU A;  4Q5R A;  2DC5 A;  4JZQ A;  3L78 A;  3CTF A;  5DQS A;  4DVC A;  1AXD A;  4MZB A;  3IE3 A;  2LUS A;  2R5G A;  3VK9 A;  1GSE A;  2C0G A;  3BBY A;  1QFN A;  2J23 A;  1Y6E A;  2GSR A;  3FZ5 A;  4J57 E;  3M3M A;  2IME A;  5JCW A;  1MD3 A;  1QGV A;  4KUN A;  3C71 A;  5ENU A;  13GS A;  1YY7 A;  3M9K A;  1A0R P;  2I1U A;  2GLR A;  2PU9 C;  4J56 E;  2R0G A;  1EEJ A;  3FR3 A;  3C8E A;  1HD2 A;  5JWO B;  1K3O A;  2MMO A;  3P7X A;  1Z5Y E;  3H79 A;  5DCH A;  3TKS C;  5B6M A;  1SL2 B;  2HZE A;  2H71 A;  2XHF A;  3H4K A;  1F3A A;  5D8I A;  4WF5 A;  3GMF A;  4JR4 A;  1DBY A;  2R4V A;  2GVP A;  4XHM A;  1Z7P A;  1Z3E A;  2HLS A;  2VCQ A;  2H76 A;  1Z7R A;  4WBR D;  3FR9 A;  2IMF A;  3VUR A;  1GNE A;  4L5O A;  3QCP A;  2RII A;  5D9W A;  5EY6 A;  3KD0 A;  4K5R A;  1X5D A;  2DJ0 A;  4O32 A;  4RQX A;  3P2A A;  3L9U A;  2KLX A;  3GKX A;  3UVT A;  3D22 A;  3TRX A;  4MJC A;  2WFC A;  1B48 A;  5A4V A;  2GDR A;  3QFB C;  1R26 A;  2H01 A;  4KW6 A;  1EOG A;  2C3T A;  2FUG 2;  1XW6 A;  1ST9 A;  4ZBB A;  1URM A;  4GTU A;  5CNW A;  4N10 A;  1ERT A;  3KH9 A;  3ZLP A;  5DDL A;  3D4T A;  3MWH A;  4YQV A;  1UA5 A;  4ZB6 A;  3IK9 A;  1AAZ A;  1ERW A;  1UN2 A;  1TXX A;  3QD9 A;  4HEA 2;  3KM6 A;  2N5B A;  5CRW A;  2XBI A;  4O5R A;  1XPV A;  2OE3 A;  4MH2 A;  5KN0 A;  1GSD A;  2B5Y A;  4GCI A;  1SKW B;  1ON4 A;  1PL1 A;  4K1F A;  1O85 A;  2NTO A;  5IMV A;  2FWG A;  1YEX A;  2NPB A;  1XOB A;  3LFL A;  1A8Y A;  2GQM A;  4PUF C;  4TN8 A;  1G6Y A;  3GHA A;  4N11 A;  2ON7 A;  3VWX A;  18GS A;  3QPM A;  3GYK A;  2PVQ A;  3IK7 A;  3FYG A;  1THX A;  4HUA A;  2CAQ A;  4NV2 A;  3WGX A;  2H70 A;  2C80 A;  1TKD B;  3TKR A;  1XW9 A;  2WJU A;  5G5F A;  1J08 A;  5D9T A;  2H1B A;  3D0Z A;  1XVW A;  1SYX A;  3NZN A;  1SKS B;  2HYX A;  2XBQ A;  2M46 A;  1M9A A;  5IPG A;  1W4V A;  4I8B A;  2A4H A;  2VL2 A;  4HU7 A;  1B4P A;  2YV9 A;  5DBQ A;  1KEB A;  2IFQ A;  2FD3 A;  4V2M A;  1TRU A;  2HSM A;  2LJR A;  5FHI A;  2VIM A;  2HE3 A;  3HA9 A;  1XBS A;  5ECS A;  3M9J A;  4NPB A;  4GST A;  1CQG A;  1JZR A;  3GKN A;  2H1A A;  4D73 B;  2NDO A;  3FKF A;  1XWK A;  3ZIJ A;  2REM A;  1S3A A;  1PN0 A;  2B5E A;  3L4N A;  3IC4 A;  3WD6 A;  3FR6 A;  4YKG A;  3CRU A;  4DSS A;  3U5R E;  4KDY A;  5FWG A;  2KP1 A;  2H6Z A;  3LG6 A;  3G7Y A;  3HJO A;  4EIP A;  1N2A A;  5GSS A;  4EDY A;  4OFM A;  4K7O A;  3U6V A;  2KHP A;  5JWQ B;  4PTS A;  2PWJ A;  4PNF A;  5DAK B;  2ZNM A;  2OKA A;  10GS A;  3LYP A;  4ISD A;  4EL1 A;  3BD2 A;  1GTU A;  2FWF A;  3HY2 A;  3W8S A;  4ZXG A;  5HR0 A;  1G6W A;  2BMX A;  2HI7 A;  2PVO C;  4IVF A;  1X9S B;  4X0X A;  2HRN A;  4EE0 A;  3CSJ A;  1LJR A;  1XWC A;  2AB6 A;  2B7K A;  2VCX A;  5GST A;  3TOT A;  1ZZY A;  2L5O A;  5IO2 A;  4JR6 A;  1ML6 A;  3A2W A;  2CV4 A;  1BX9 A;  3ISO A;  5ECH B;  1TI3 A;  2R0C A;  1AQX A;  1U3A A;  20GS A;  4HI7 A;  6GSV A;  1GSQ A;  2MMZ A;  4KSO A;  3UJ1 A;  1H4O A;  3LOR A;  4CY8 A;  1HYU A;  3GTU B;  3R3E A;  2PER A;  4MH3 A;  4HU9 A;  3KH7 A;  3HJP A;  2KOK A;  4ECC A;  3DKS A;  2GQK A;  3IC8 A;  1A24 A;  3J7Y b;  1GSS A;  3F0I A;  4K0G A;  4OCE A;  5GAN D;  2GSS A;  4IP1 A;  4K2X A;  1GLQ A;  4HQS A;  2V32 A;  1JZO A;  4POK A;  4FIW A;  1XXU A;  3ERW A;  2V6O A;  3IHQ A;  4X4J A;  1BQ7 A;  3UOM A;  5J4U A;  3DYR A;  1GRX A;  5ECK B;  5H5Q A;  5AIX A;  4KE3 A;  4FH8 A;  1BAY A;  3IPZ A;  2JAD A;  2LRT A;  3UVH A;  1YKA A;  2ZCT A;  1PMT A;  1SD9 A;  1OAZ A;  1SL0 B;  1EWX A;  1TOF A;  4IEL A;  1GSF A;  2GGT A;  2DSA A;  1GUK A;  2MMA A;  2H6Y A;  3HKR A;  2FLS A;  2VL3 A;  2H30 A;  1GUM A;  2O7K A;  2B3S A;  3KP9 A;  3TJB A;  1Z9H A;  5LNK e;  1PX7 A;  1K0O A;  2RLI A;  4LLR A;  4A5P A;  3TJG A;  1YF1 A;  1MEK A;  4ZL9 A;  1K0N A;  5CRD A;  3UAP A;  2H72 A;  1JHB A;  4KCA A;  2QSI A;  3HJM A;  4TOP A;  4GF0 A;  1PKW A;  4IQA A;  2YZH A;  4BWQ A;  4WBJ A;  4BWS A;  1NHY A;  4NHW A;  3HVV A;  1XOA A;  3LGC A;  4POB A;  1I9D A;  4ZIL A;  3IOS A;  1ZCP A;  2DLX A;  2VCT A;  2VM2 A;  2JSY A;  4GSN A;  4WKW A;  4ECJ A;  2O85 A;  4Z7X A;  3GV1 A;  2TRC P;  2ALB A;  5IQY A;  1F2E A;  5G1K A;  4NV5 A;  1A0F A;  2DIY A;  5ECO B;  3MDK A;  4POL A;  2YWI A;  4AJ8 A;  1GTA A;  4ICY A;  2VD0 A;  1SU9 A;  2OJL A;  3P90 A;  1GTB A;  4MLY A;  1K3L A;  4FQU A;  5HR2 A;  2H0I A;  7GSS A;  4O5U A;  2VCZ A;  1XZO A;  5ID2 B;  1B4Q A;  1RQM A;  4N30 A;  1FVJ A;  4KH7 A;  1TK0 B;  1J0F A;  2OAC A;  2CAI A;  1F9M A;  5G1L A;  4EXJ A;  5IPH A;  1EOH A;  14GS A;  4ZBA A;  2D2Z A;  2H74 A;  4PX1 A;  3IHG A;  3VWV A;  2FGX A;  3LYK A;  2X49 A;  3LW9 A;  4K9Z A;  4KF9 A;  4BVX B;  1VGL A;  4ULX A;  2YWM A;  3QAV A;  4N0Z A;  1GL8 A;  1WWJ A;  3FZ4 A;  3PH9 A;  5AIS A;  3L9V A;  5EVO A;  1BYE A;  4G0I A;  1WE0 A;  4NXI A;  3HHV A;  4TXO B;  3ME7 A;  3HVX A;  1WOU A;  2LEG A;  1G0T A;  4L8E A;  5HFK A;  1S3D A;  1MD4 A;  3I43 A;  2CQ9 A;  2GST A;  4TR1 B;  2A2R A;  2GZP A;  1PGT A;  1E6B A;  5DAL B;  1OKT A;  1G7E A;  4HZ4 A;  4GWR A;  2Z9S A;  1YQ1 A;  1HQO A;  1OE7 A;  5IMD A;  1U6T A;  1O73 A;  1ZL9 A;  4K7N A;  1YKC A;  2A2S A;  4V2L A;  1VF3 A;  3M1G A;  4ILF A;  4RI7 A;  1SJI A;  5G30 A;  5B8A A;  1B9Y C;  5INY A;  4MF6 A;  3SWL A;  4TR3 A;  5A5K A;  1M7T A;  4K2D A;  1V9W A;  2JZR A;  4ZIJ A;  3ERG A;  1HNA A;  3IBH A;  3APQ A;  1PX6 A;  3KMN A;  5G2Z A;  6GST A;  1MDJ A;  3ERF A;  3J7Y k;  5FT3 A;  4Q5N A;  5HFI A;  3G7J A;  1TP9 A;  2I4A A;  5DQY A;  4CDO A;  4JE1 A;  3Q6O A;  3GNJ A;  4YQM A;  1AQV A;  2IL3 A;  1I5G A;  2N5A A;  4G9H A;  5L71 A;  4K0N A;  2QA2 A;  4ML6 A;  2LQO A;  3F3Q A;  5ELA A;  1XW5 A;  4KGI A;  1OE8 A;  2QGV A;  3DRN A;  2VCW A;  2JU5 A;  5C00 A;  2IMD A;  4GRF A;  2E2M A;  1PN9 A;  3F4T A;  1WMJ A;  2XPE A;  3RHC A;  3TJK A;  4D73 A;  2DJJ A;  2DMM A;  2VD1 A;  4EKZ A;  1ZGN A;  3UMA A;  3CMI A;  2DML A;  2H1D A;  2PUK C;  2H75 A;  5KEJ A;  2JAC A;  1V58 A;  3N9J A;  1DE1 A;  1SJ6 A;  1EV4 A;  4HOJ A;  5IM9 A;  1KNG A;  4BPY A;  3NOF A;  1DE2 A;  5G31 A;  4YKF A;  3EE2 A;  5IO0 A;  5IIZ A;  2DJ3 A;  4YAV A;  1B9X C;  1SJZ A;  5F06 A;  5H5S A;  5DAK A;  3KIJ A;  4HJM A;  4L0U A;  1WPI A;  2G2Q A;  3EMP A;  1VRS D;  3LQ7 A;  5ECN B;  2CX3 A;  3LJR A;  3APS A;  3TDG A;  2GS3 A;  2HSH A;  4XS6 A;  4O7H A;  4KND A;  3RAZ A;  2RUE A;  3VPQ A;  4EF0 A;  1JFU A;  3ZYW A;  4ID0 A;  2ES7 A;  1K0A A;  1A2J A;  2H66 A;  3IRA A;  3V1W A;  5CO3 A;  1OC3 A;  3QOU A;  4BVY B;  1KTE A;  5CP1 A;  1RW1 A;  2V6K A;  5EL8 A;  3MIX A;  3CSH A;  4FO5 A;  3PPU A;  1EGO A;  3GTU A;  3ED3 A;  3HCZ A;  4YAP A;  1PQN A;  2FWE A;  5J9B A;  1U88 A;  2PMT A;  2ZUP A;  2RUF A;  3KGK A;  2OE0 A;  2F8F A;  4I6X A;  5IMZ A;  1PL2 A;  9GSS A;  2MMN A;  3TB2 A;  1YF0 A;  3CXG A;  5F05 A;  4MK3 A;  2H73 A;  1PRX A;  2AV4 A;  3JCM L;  3ME8 A;  5ELG A;  4MNN A;  1KBN A;  1M2B A;  5CRE A;  2H8L A;  2VL9 A;  1GLP A;  2DJK A;  3D5J A;  1QUW A;  2N5F A;  1HNB A;  5HR3 A;  3RHB A;  2YJ7 A;  1SEN A;  2YWO A;  4XRD A;  4G10 A;  1ZOF A;  4G0L A;  1B8X A;  1OC9 B;  2HXK A;  4KDU A;  3TUE A;  4K5S A;  5LD0 A;  3BCI A;  4PQH A;  4CW9 A;  4MPF A;  1T3B A;  3W6G A;  4AJ7 A;  5J9C A;  4NAX A;  1JLV A;  3E9J B;  3DVW A;  1FVK A;  3GUR A;  3BJ5 A;  1AUC A;  3KJY A;  4POM A;  2LNS A;  4ZB8 A;  4OMV A;  1TK8 B;  3F8U A;  4MZW A;  5HR1 A;  3GN3 A;  1QK8 A;  4XRA A;  1N8J A;  2EIQ A;  3LXT A;  4PGT A;  5G5E A;  2M72 A;  3VWW A;  3TGZ A;  4DEJ A;  2AJQ B;  3VI5 A;  1ZYQ B;  3KP8 A;  3UBK A;  2LTK A;  3M8N A;  5F8B A;  2QA1 A;  3APO A;  3H93 A;  4IP6 A;  1F3B A;  2RM5 A;  4PUA A;  1W89 A;  3UEM A;  4IJ3 A;  2YNX A;  3F3R A;  3GL5 A;  2R6K A;  1X5C A;  3W8J A;  4WR4 A;  4IW9 A;  2H0H A;  2FWH A;  2LV3 A;  2VL2 C;  3IAS 2;  5KN2 A;  3FEU A;  5EPF A;  4IQ1 A;  4NHZ A;  4LL4 B;  3H1N A;  5J3R A;  2FA4 A;  1VF1 A;  4GLT A;  2MBT A;  5ECI B;  1NSW A;  5BMU A;  2HZF A;  2L6C A;  3D21 A;  1XFL A;  1X9W B;  2P0G A;  2KUC A;  5ID2 A;  4K8M A;  1PKZ A;  5E59 A;  2P5R A;  1M2A A;  4L5L A;  2VM1 A;  5ECQ B;  2PBJ A;  1YJ6 A;  3GUS A;  1A2M A;  5IMA A;  2K6V A;  4TXV A;  5ECM B;  3O6T A;  2WRT A;  5H5R A;  2HRK A;  1UVZ A;  4ACS A;  4KX4 A;  2LS5 A;  5D9V A;  5J5N A;  2OBI A;  4BVX A;  1XIY A;  1OC8 A;  4CY6 A;  4MZC A;  4WXT A;  1DSB A;  3ZTL A;  2HRA A;  4MCU A;  2VAF A;  3DD3 A;  1K0M A;  4Z2T A;  2IJY A;  1AIU A;  4PUR A;  3D6I A;  1NW2 A;  2LST A;  3FK8 A;  4DSQ A;  3GST A;  1TRW A;  4ZL7 A;  4TXO A;  2WB9 A;  4RQR A;  2E2G A;  1OKD A;  1TK5 B;  1TU8 A;  1JZW A;  3ZRD A;  1EP7 A;  2WGR A;  4ZBD A;  2O87 A;  4TR1 A;  2TIR A;  1AC1 A;  3VWU A;  2DIZ A;  2WUL A;  3HZ8 A;  1ZYE A;  4I2U A;  5DAL A;  5CRG A;  2P31 A;  3RDW A;  2PGT A;  2VUP A;  2K9F A;  4HS1 A;  1ABA A;  3DGQ A;  1PA3 A;  3DIE A;  1V40 A;  3FZA A;  4IBP A;  3RPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...