3KZQA

The crystal structure of the protein with unknown function from vibrio parahaemolyticus rimd 2210633
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
206
structure length
206
Chain Sequence
MNIKLYYVHDPMCSWCWGYKPTIEKLKQQLPGVIQFEYVVGGLAPDTNLPMPPEMQQKLEGIWKQIETQLGTKFNYDFWKLCTPVRSTYQSCRAVIAAGFQDSYEQMLEAIQHAYYLRAMPPHEEATHLQLAKEIGLNVQQFKNDMDGTLLEGVFQDQLSLAKSLGVNSYPSLVLQINDAYFPIEVDYLSTEPTLKLIRERIIENM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative uncharacterized protein VP2116
publication title The crystal structure of the protein with unknown function from Vibrio parahaemolyticus RIMD 2210633
rcsb
source organism Vibrio parahaemolyticus
total genus 70
structure length 206
sequence length 206
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13743 Thioredoxin_5 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3kzqA00
3DXBA 1GUKA 4MJAA 4YQMA 3GNJA 3M8NA 5A5KA 2C3TA 4OO5A 3EMXA 3QOUA 3N5OA 3VPQA 2HSHA 5AIXA 4CDOA 2VLVA 2PUKC 2GSRA 2GSSA 5GSTA 1ABAA 2XPDA 2QGVA 2L6DA 2P5RA 10GSA 4K6XA 2F9SA 22GSA 2VCXA 3BJ5A 2VL2A 5J41A 1N8JA 4TOPA 4IKHA 4D73A 3TOUA 4KE3A 4EDZA 2IMKA 3IE3A 2VCQA 1PL2A 1K0CA 3G9BA 5CRGA 1NSWA 4NPBA 6GSUA 4HU7A 3DD3A 2FHEA 4JZQA 3L9SA 3LYPA 3TKQA 4BL7A 1XFLA 2PMTA 1ZYEA 1TU8A 2QKEA 3CRTA 4WXTA 3HCZA 2X99A 2N5FA 3TKSA 1ERUA 3LJRA 4KSOA 5DCHA 1TK5B 3FR6A 4ACSA 2AYTA 4FO5A 3HA9A 2L5OA 1VF1A 5LNKe 1X5CA 2GZZA 1YF0A 4WF5A 5IMZA 2XPEA 5HR2A 4GWRA 4LL4B 4AF2A 1SU9A 2GSQA 3BOAA 3VI5A 2YNXA 3P7XA 1GSQA 2J23A 1GNEA 2FLSA 1MTCA 4K9ZA 2V6KA 3VI7A 2IN3A 5JCUA 5DVBA 5ECLB 2XC2A 2FWGA 1EP7A 2DJKA 2V32A 2GZYA 2LS5A 3ZMLA 5ECIB 4RQXA 1RQMA 1TI3A 3O76A 1U3IA 3ISOA 1AC1A 4WEYA 1W4VA 2PVOC 4MPFA 1Z7PA 3BCIA 6GSTA 3OR5A 2DJ3A 1M0UA 4QQ7A 4JR4A 3GMFA 4I2UA 4PUFC 2MMOA 2AB6A 4WF4A 2IFQB 2OKAA 4MLYA 4LMVA 4V2LA 1WIKA 4EDYA 1FAAA 4OCEA 4YQVA 1J0FA 5DQSA 4I6XA 3UOMA 4H86A 2VCTA 2MMNA 3Q19A 4LA1A 1B9YC 1FVKA 5JCGA 2VCZA 1GLPA 1AQXA 2VAFA 1PX7A 5IPGA 3HVXA 3LORA 2C4JA 2ON7A 4RUVA 3KMOA 3LXZA 3DVXA 2LNTA 4HQZA 1YF1A 2RM6A 1FB6A 3ZZXA 2MMZA 1MEKA 1HQOA 2CZ3A 4L5LA 3L78A 1T8EB 2H01A 1PL1A 3GYKA 3GV1A 1MDJA 1X0RA 4HUAA 1QMVA 5AISA 5EL8A 2H1AA 1SKSB 4EKZA 1SK2A 4IHUA 1BAYA 1R26A 1Z9HA 5GAPD 5DBQA 1WMJA 2DSAA 1VF2A 3ZFBA 3ZIJA 1UA5A 4N10A 4MF5A 4HS1A 3UVHA 2H0GA 3APQA 4KDUA 4MJCA 3S9FA 5G5EA 3VWWA 2AUVA 4ILFA 3J7Yk 5D8IA 5F06A 3HYPA 2C80A 4WR5A 3ME7A 1XWBA 2LRTA 3TJGA 5B8BA 4IQAA 3TUEA 5A4WA 1K0BA 2K6VA 2C0DA 1F37A 1PQNA 4LMWA 3ERWA 3UL3A 2YPMA 1ERVA 4IBPA 4G9HA 4ZBBA 1A2MA 4MCUA 2HNLA 1JLVA 1Z6MA 2RM5A 5DCGA 2KLXA 3KIJA 5G5FA 1F9MA 3FRCA 1R5PA 2YCDA 4X1UA 1B48A 1V58A 5B8AA 5C00A 3HJPA 3TCOA 2DMMA 2OBKA 3H1NA 5ECKB 3GL5A 1HNAA 4ID0A 5D93A 3F6FA 3H8QA 2WFCA 3G7IA 1R5AA 2WS2A 1BQ7A 1VF4A 5CRDA 1FW1A 4PQHA 3RHCA 1F2EA 2DLXA 2NBSA 5D96A 1PMTA 1SJIA 4KNDA 4QL7A 2MBTA 2G0FA 5J9BA 2WULA 2FWEA 1G6WA 1XPVA 4IN0A 4OO4A 5GSSA 3HDCA 2R5GA 5CNWA 1EV4A 9GSSA 2JSYA 4NXIA 5DAKA 3GN3A 2K8VA 1XWCA 5DAKB 1GSFA 1XOAA 1Z5YE 2OE0A 1E2YA 3UVTA 2RUEA 3IPZA 3VWUA 2H71A 2KP1A 2TRXA 3ZRDA 4KA0A 2OADA 3QAVA 4MF6A 4TR1B 1BG5A 3FHKA 3AY8A 3IR4A 2VM1A 2LTKA 4ZBDA 2CAIA 1M2BA 4MZBA 1WWJA 3DWVA 2WDUA 3GSTA 4GF0A 4K0NA 5CRHA 4WETA 2H72A 3KZQA 5IOWA 3HY2A 2V6OA 3GHAA 3U6VA 2C1YA 3UMAA 4EF0A 4NV2A 3F3QA 1Q98A 5G1LA 4KX4A 4YH2A 4FIWA 1GRXA 3DIEA 2I3YA 3ZTLA 5HQPA 3CRUA 5JWRB 4PNGA 3LSZA 1W89A 2B1LA 2HE3A 3HKRA 4MABA 1GUHA 4PXOA 2BTOT 1HNBA 5IMCA 4KB3A 5JWOB 2Z9SA 3GA4A 2H1DA 2VUPA 4XS1A 3GX8A 3WT2A 3L9VA 1XZOA 1T7PB 4I2TA 4K7IA 3US3A 3VK9A 5LCZA 1SK0A 2YANA 2VLUA 2OBIA 5JCWA 4FYBA 1WP0A 4L5OA 1DE1A 3QAGA 1KEBA 3DMLA 4K7NA 1X5EA 4LL1B 1G7EA 2N5BA 4P3YB 3W6GA 2H1GA 4V2NA 1BYEA 1UC7A 2YZHA 4GLTA 2HT9A 1B4PA 3APOA 4FYUA 2BMXA 4E8EA 4ZBAA 4AJ7A 4ZL7A 4NHZA 4OCFA 4TXVA 3TRQA 3MSZA 1USBA 2YWOA 4KDXA 5DJMA 1DUGA 2FWHA 3KH9A 5H5RA 1JZDA 3IXRA 5IPHA 2ON5A 1HYUA 4NWYA 2LEGA 2B7JA 1Y6EA 1TXXA 4ML6A 4IJIA 1NHOA 4IJ3A 4FH8A 1MDKA 2WJUA 2F8FA 4TXOA 3NOFA 1GSUA 1EOGA 3IOSA 3IAM2 3KP8A 3D0ZA 1T4YA 5IO2A 1ML6A 1TJDA 1BJXA 4KH7A 20GSA 2R4VA 1EEMA 4ZXGA 4F0BA 2PPTA 2K8SA 2FWFA 1KNGA 1XIYA 5B6MA 1TU7A 4K2DA 4X0XA 4ULXA 4I8BA 1U3AA 2NTOA 3TJFA 3CBUA 4I97A 3A2WA 3UBLA 2VM2A 3LGCA 1QK8A 2DJ1A 3G7JA 1KBNA 3GURA 5DDLA 4D73B 5L71A 3F4RA 2GT5A 4WKWA 3F63A 3G7YA 3KGKA 4OMVA 1A23A 4XHMA 3SWLA 3E9JB 16GSA 1ZCPA 1T1VA 1GSDA 5HR3A 1M7TA 2HZFA 1WRYA 3IBHA 4GSNA 2FNOA 3ERGA 2ALBA 4OFTA 4ECJA 4GQFA 1PKZA 4N0VA 1K3YA 2RUFA 1XXUA 4KCEA 4RI7A 4HQSA 1ERTA 2B5XA 5E59A 2JZRA 12GSA 4ML1A 2AHEA 2KUCA 2O7KA 1Z3EA 3MNGA 3FYGA 2NPBA 1TDIA 3GH6A 4XS4A 5J4UA 5COHA 1VF3A 5GAND 2VLTA 4ZB8A 1ST9A 3H4KA 3LQ7A 5IQYA 1XW6A 1LJRA 2AV4A 2R2JA 2B7KA 3WGDA 3D5JA 4TR4A 1JZRA 3BCKA 1GUMA 2VCWA 1URMA 3FZAA 3ZYWA 5F05A 4DSSA 3FKFA 1GSSA 2YN1A 3WGEA 1WOUA 3QFBC 2C3QA 4O7HA 3A5WA 2A2SA 3IA1A 4K8MA 4F2IA 5IMAA 1X9SB 2IPAA 3KCMA 3QAWA 1YKAA 3LYKA 5ECNB 2QC7A 3ZITA 3QFAC 4XTSA 4XCSA 4RQRA 1NHYA 2WZ9A 1R7HA 3HVVA 4PUAA 3TJJA 2PGTA 2J9HA 3ZIVA 1UVZA 2LRNA 4PQ1A 4AJ8A 3LXTA 2JZTA 4MJBA 1R4WA 2EIQA 2GS3A 1N2AA 1A8YA 4XS6A 5HR0A 5KN0A 1EGRA 4ISDA 2CZ2A 2I4AA 3APSA 1VGLA 1F3AA 1FG4A 1AAZA 2I9HA 4MMMA 2FA8A 2DBCA 3IK9A 1XWAA 2M46A 1X5DA 2HZEA 4F9ZA 2IMFA 5LD0A 2HZEB 3KXOA 4LLRA 2H70A 4BVYA 4WBRD 1XWKA 1K3LA 3P2AA 2MMAA 3W8SA 2YV9A 4G19A 5IM9A 1S3CA 3CMIA 3IC4A 2D2ZA 5H5QA 3P8WA 2L57A 5IMFA 3L4NA 4NHWA 5D9XA 1M2DA 3ZLPA 3RAZA 2H76A 2YJHA 1IYHA 2C0FA 2DMLA 1UN2A 4QL9A 2OE1A 5G30A 4IS0A 1EEJA 1AXDA 5EVOA 19GSA 3IK7A 4JRRA 2HFDA 1G6YA 2VO4A 3Q18A 4KW6A 1OC9A 2YWMA 5GZZB 4Q5NA 1OC9B 1EGOA 4PNFA 1ZMAA 6GSXA 2YOIA 3GH9A 3EU3A 4ECIA 5ECOB 1OKTA 3KEBA 4F03A 4TR0A 5KN1A 4E8HA 1F6MC 2JL4A 13GSA 2YWIA 1PKWA 2H0HA 3C8EA 4GCIA 4HZ4A 4N30A 1G0TA 3M0FA 2H30A 2CVBA 1SYXA 3CSHA 2GQKA 3HD5A 1J08A 5CYYA 1TRWA 3ZL5A 4IELA 1PN9A 1SKRB 5ABRA 4KAEA 2GVPA 4O5RA 1FO5A 4XIHA 1S3AA 2K9FA 1GL8A 1B4QA 1A0RP 1PA3A 2E2GA 1PX6A 1Z7RA 4MH3A 4GSSA 4G10A 3GSSA 1WPIA 2TIRA 3F9UA 1C72A 2H6YA 4X43A 4NMUA 4ZIJA 5G2ZA 3EE2A 5KEJA 4GQCA 5ECMB 2H75A 5ID2A 2LUSA 2E7PA 2LQOA 2L6CA 3TOTA 1TK0B 3GKKA 3M1GA 5HR1A 1ILOA 5CRWA 5ECHB 1T4ZA 1Z6NA 3DGQA 4KDYA 3WD6A 1AUCA 3ERFA 2B1KA 2AJQB 3KM6A 5DQYA 2P0GA 2RIIA 4MJEA 4K1FA 4XRAA 3FK8A 2H19A 3BD2A 1GTIA 2VD0A 3PR8A 3TJKA 3WYWA 3C7MA 4EL1A 1FB0A 1ZGNA 3EYTA 3TB2A 5E4WA 2GT6A 1GTUA 2FCHA 2P5QA 4JBBA 2HI7A 2X64A 3CYNA 2VL2C 5IMDA 3EINA 1WE0A 2GQLA 4F0CA 5A4UA 2DC5A 3Q74A 1XW9A 4ZL9A 2L59A 1O6JA 4JEDA 5ECRB 4JR6A 2HLSA 1O8WA 2GZPA 3D21A 4TN8A 4EO3A 3PH9A 1A24A 2BJXA 1QQ2A 1OKDA 3ZREA 1XW5A 2B5YA 3C1RA 3ED3A 2VD1A 2F51A 1HD2A 3F0IA 4TRXA 4Q5RA 2VCVA 4MZCA 5IO0A 1YKCA 4OFNA 3TKSE 3TKSC 3HZ8A 1K0MA 3HVSA 4AJ6A 1V98A 1XVQA 5CAXA 1U87A 1V9WA 3L9UA 3ZMKA 1SL0B 1EP8A 1MD4A 1QFNA 1BX9A 3UAPA 4CW9A 4POMA 3GFKA 2LJRA 2E2MA 3BBYA 3QPMA 1TP9A 3DYRA 2HRNA 1NW2A 4K0GA 2IJYA 1I9DA 1ACVA 3ZVJA 2REMA 2FGXA 4GSTA 4YAPA 3RPPA 2X8HA 4O32A 2DJJA 4WR4A 4IP6A 5CREA 2GGTA 1KTEA 2WGRA 3RBTA 1E6BA 1CQHA 1V2AA 1GTAA 3CTGA 4IQ1A 2AAWA 1ERWA 3F4SA 3GL3A 2JU5A 5KN3A 2CT6A 2XBIA 3A2VA 3CXGA 3ZFLA 4ZILA 3NZNA 2L5LA 1GSYA 4F82A 5IIZA 2IIYA 3EC3A 1GLQA 5F0GA 2YP6A 2ZCTA 3HXSA 4TXOB 4DSRA 1CQGA 1FHEA 1YZXA 3KJYA 4MDCA 3TKPA 4OWYA 3TRPA 2H8LA 3E3EA 4MA9A 3TKRA 1U88A 3TJBA 4TKYA 1SJZA 2CQ9A 3HZ4A 3LFLA 4HEA2 4BWSA 1QUWA 1O7UA 2GTUA 6GSVA 1PGTA 1SD8A 2R37A 2CVKA 3GX0A 5B7CA 1XWGA 3F6DA 1T00A 3RHBA 1DE2A 3K8NA 3TGZA 3TRXA 2CX3A 4MH2A 3DEXA 2F3MA 4MZWA 2L4CA 2O89A 2G2QA 5C04A 3RDWA 3D4TA 1YQ1A 2KHPA 2E0QA 5F8BA 5AGYA 1YJ6A 2CX4A 5FHIA 1JFUA 4EC0A 1PRXA 2I81A 3GKMA 2LJAA 3TDGA 2B6MA 5D9VA 3FZ9A 4DVCA 3DKSA 5AIVA 3MAKA 2WB9A 1PSQA 1XVWA 2CA8A 2EC4A 5G31A 3I69A 4OFMA 2HXKA 2X8GA 2LKUA 2LRCA 2H6XA 1O8XA 3UARA 4ECBA 3H79A 2B3SA 3F8UA 3IRAA 2VL9A 4J57E 3KD0A 1EOHA 3LEFA 5CP1A 2OJLA 3F3RA 4Q5QA 4TVEA 1ON4A 2DJ0A 4L8EA 1EZKA 4XRDA 3DVWA 4XS4B 17GSA 4PURA 2H73A 2C3NA 3L0HA 3QD9A 2TRCP 2KOKA 4EVMA 2O87A 4G2EA 4BVXA 5D73A 3VURA 2FUG2 3EMPA 3D22A 2F8AA 2IL3A 3SBCA 4IGJA 1GULA 3KP9A 4DSSB 3FZ4A 2JADA 2P31A 2PVQA 2DJ2A 5D9TA 2O85A 1GSEA 4MF7A 2R3XA 4GRFA 3PINA 2FD3A 2M72A 5ENUA 2V2GA 3O6TA 3W8JA 3IDVA 4FYCA 4K7OA 1M2AA 2K18A 2PWJA 4TW5A 3DRNA 2IFQA 3J7Yb 3KTLA 4BA7A 2XHFA 1YDKA 1O85A 3QDNA 4HZ2A 2M80A 1OC8A 1XOBA 5FT3A 3P90A 4MP4A 3HJMA 1H75A 3M3MA 4ZB6A 11GSA 4HOJA 1SL1B 3EURA 3EVIA 5ELAA 1TOFA 3ZVJD 2C8UA 1TK8B 3D6IA 1XBSA 8GSSA 3IHQA 5ECPB 3GKNA 3CTFA 1H4OA 4POBA 2PERA 1U6TA 1NM3A 4KGIA 5DALA 3H93A 5DALB 4EE0A 2CAQA 1A2LA 1OE7A 4CHSA 2IMDA 3UIWA 2A4VA 1RW1A 4NAXA 1TW9A 1M99A 14GSA 1DBYA 5D9WA 3N9JA 1B9XC 2ES7A 4N11A 1GP1A 1JZOA 5H5SA 3ME8A 1I5GA 1K3OA 1F3BA 4MK3A 4J56E 5AN1A 6GSWA 2H66A 3FR3A 2JZSA 1K0NA 5FWGA 1A0FA 2LQQA 2N5AA 2VOCA 5ECQB 1TI1A 4L0UA 2O8VB 3FEUA 3FW2A 2H6ZA 2XBQA 5HFKA 1X9MB 3VLNA 2VL3A 3Q6OA 3CSIA 3PGTA 1SK1A 1GTBA 2PBJA 1FOVA 4BPYA 4ZB9A 5INYA 3KTBA 2ZNMA 2MYGA 1QGVA 3LWAA 1SD9A 3C73A 4BWQA 3KMNA 1ZL9A 1OC3A 1SYRA 3VFIA 4L0WA 1S3DA 1GH2A 1ZZYA 2GQMA 3U5RE 2FA4A 2GDRA 3D4MA 4DEJA 1IYIA 1TTZA 2A2RA 3GRXA 3VWXA 1OAZA 5DJLA 2EIRA 4AGSA 5JWQB 2VIMA 4HI7A 2NDOA 1RK4A 1GNWA 4MPGA 2LNSA 4HJMA 3GUSA 1AIUA 4JU5A 3VWVA 5KN2A 1O81A 1SENA 1SKWB 3I43A 3MDKA 4V1Ap 5J9CA 5J3RA 1ZYQB 4GXZA 2NVLA 3MWHA 3GTUA 3IAS2 2PU9C 3GTUB 3WT1A 2JSZA 2OACA 2LSTA 2OA7A 4HDEA 4V1Ag 4ECCA 2JACA 3M9JA 2IWTA 6GSYA 3GIXA 1K0AA 4EXJA 3UBKA 4Q5FA 5J5NA 3V1WA 1AQVA 2X8CA 1QXHA 1LBKA 3HJOA 1YEPA 3VPTA 5ID2B 1YY7A 3I6AA 4KUNA 1XCCA 1OVNA 3UJ1A 2LV3A 1LU4A 2CV4A 4OD7A 1G7OA 2DIZA 4IP1A 4O92A 3NIVA 1SL2B 2WCIA 4PQIA 4Z7XA 3M9KA 2DIYA 3QCPA 4PGTA 2WRTA 3JCML 2IMIA 5IMVA 4TR1A 4KSMA 2V1MA 4WBJA 3EU4A 3CSJA 4GTUA 4DSQA 4KCAA 1O73A 2ZUPA 3R2QA 4JE1A 1ZOFA 2EIOA 2YWNA 2YV7A 1OYJA 2KP2A 1Y25A 7GSSA 1OE8A 4N0ZA 2I1UA 3HHVA 1X9WB 1DSBA 3C71A 1J9BA 1K0DA 1M9BA 2L4QA 3QMXA 3KH7A 3IV4A 2HSYA 3UEMA 2MZCA 5HFIA 2LJKA 2QSIA 4NV5A 3EWLA 2B5EA 2V41A 1THOA 1YEXA 5F07A 4ZL8A 1A8LA 1BEDA 3E0UA 1V57A 3F4TA 3O3TA 5IOXA 1MDIA 2R6KA 3LG6A 2YZUA 1AW9A 1JZWA 4RI6A 2HRFA 4IW9A 1EV9A 4YQUA 1M9AA 2H0IA 4PX1A 4EUYA 1K0OA 4POLA 1WJKA 1Q4JA 5CO3A 1JLWA 1TKDB 18GSA 3GKXA 4HU9A 1FVJA 6GSSA 1PD21 3A3TA 1JHBA 2GLRA 2RLIA 4V2MA 1VRSD 4I5QA 1TRUA 5ECSA 1THXA 2HYXA 2C0EA 5ELGA 1HNCA 3A2XA 1SJ6A 1TRVA 2YJ7A 2MBSA 2H1BA 1A2JA 2C0GA 1V40A 4POKA 5G1KA 4IVFA 1EWXA 1TRSA 1T3BA 2PN8A 2FY6A 1MD3A 3C1SA 5A4VA 2H74A 3WGXA 1B8XA 5HFGA 3RPNA 1GWCA 5EPFA 4J2FA 3I9V2 2IMEA 2GSTA 1AQWA 3FR9A 3QR6A 2OE3A 2CVDA 5EY6A 4TR3A 4YAVA 4HJ2A 3FZ5A 3FY7A 5B6NA
chains in the Genus database with same CATH superfamily
3DXBA 1GUKA 4MJAA 4YQMA 4G0IA 3GNJA 3M8NA 1PN0A 5A5KA 2C3TA 4OO5A 3EMXA 3QOUA 3N5OA 3VPQA 2HSHA 5AIXA 4CDOA 2VLVA 2PUKC 2GSRA 2GSSA 5GSTA 1ABAA 2XPDA 2X4AA 2QGVA 2L6DA 2P5RA 10GSA 4K6XA 2F9SA 22GSA 2VCXA 3BJ5A 2VL2A 5J41A 1N8JA 4TOPA 4IKHA 4D73A 3TOUA 4KE3A 4EDZA 2IMKA 3IE3A 2VCQA 1PL2A 1K0CA 3G9BA 5CRGA 5BRTA 1NSWA 4NPBA 6GSUA 4HU7A 3DD3A 2FHEA 4JZQA 3L9SA 3LYPA 3TKQA 4BL7A 1XFLA 2PMTA 1ZYEA 1TU8A 2QKEA 3CRTA 4WXTA 3HCZA 2X99A 2N5FA 3TKSA 1ERUA 3LJRA 4KSOA 5DCHA 1TK5B 3FR6A 4ACSA 2AYTA 4FO5A 3HA9A 2L5OA 1VF1A 5LNKe 1X5CA 2GZZA 1YF0A 4WF5A 5IMZA 2XPEA 5HR2A 4GWRA 2QA1A 4LL4B 4AF2A 1SU9A 2GSQA 3BOAA 3VI5A 4G0KA 2YNXA 3P7XA 1GSQA 2J23A 1GNEA 2FLSA 3EPTA 1MTCA 4K9ZA 2V6KA 3VI7A 2IN3A 1S3RA 5JCUA 5DVBA 5ECLB 2XC2A 2FWGA 1EP7A 2DJKA 2V32A 2GZYA 2LS5A 3ZMLA 5ECIB 4RQXA 1RQMA 1TI3A 3O76A 1U3IA 3ISOA 1AC1A 4WEYA 1W4VA 2PVOC 4MPFA 1Z7PA 1ZYPA 3BCIA 6GSTA 3OR5A 4ICYA 2DJ3A 1M0UA 4QQ7A 4JR4A 3GMFA 4I2UA 4PUFC 2MMOA 2AB6A 4WF4A 2IFQB 2OKAA 4MLYA 4LMVA 4V2LA 1WIKA 4EDYA 1FAAA 4OCEA 4YQVA 1J0FA 5DQSA 4I6XA 3UOMA 4H86A 2VCTA 2MMNA 3Q19A 4LA1A 1B9YC 1FVKA 2R0PA 5JCGA 2VCZA 1GLPA 1AQXA 2VAFA 1PX7A 5IPGA 3HVXA 3LORA 2C4JA 2ON7A 4RUVA 3KMOA 3LXZA 3DVXA 2LNTA 4HQZA 1YF1A 2RM6A 3LW9A 1FB6A 3ZZXA 2MMZA 1MEKA 1HQOA 2CZ3A 4L5LA 3L78A 1T8EB 2H01A 1PL1A 3GYKA 3GV1A 1MDJA 1X0RA 4HUAA 1QMVA 3R3EA 5AISA 5EL8A 2H1AA 1SKSB 4EKZA 1SK2A 4IHUA 1BAYA 1R26A 1Z9HA 5GAPD 5DBQA 1WMJA 2DSAA 1VF2A 3ZFBA 3ZIJA 1UA5A 4N10A 4MF5A 4HS1A 3UVHA 2H0GA 3APQA 2HRKA 4KDUA 4MJCA 3S9FA 5G5EA 3VWWA 2AUVA 4ILFA 3J7Yk 5D8IA 5F06A 4FQUA 3HYPA 2C80A 4WR5A 3ME7A 1XWBA 2LRTA 3TJGA 5B8BA 4IQAA 3TUEA 5A4WA 1K0BA 2K6VA 2C0DA 1F37A 1PQNA 4LMWA 3ERWA 3UL3A 2YPMA 1ERVA 4IBPA 4G9HA 4ZBBA 1A2MA 4MCUA 2HNLA 1JLVA 1Z6MA 2RM5A 5DCGA 2KLXA 3KIJA 5G5FA 1F9MA 3FRCA 1R5PA 2YCDA 4X1UA 1B48A 1V58A 5B8AA 5C00A 3HJPA 3TCOA 2DMMA 2OBKA 3H1NA 5ECKB 3GL5A 1HNAA 4ID0A 5D93A 3F6FA 3H8QA 2WFCA 3G7IA 1R5AA 2WS2A 1BQ7A 1VF4A 5CRDA 1FW1A 4PQHA 3RHCA 1F2EA 2DLXA 2R0CA 2NBSA 5D96A 1PMTA 1SJIA 4KNDA 4QL7A 2MBTA 2G0FA 5J9BA 2WULA 2FWEA 4K2XA 1G6WA 1XPVA 4IN0A 4OO4A 5GSSA 3HDCA 2R5GA 5CNWA 1EV4A 4HSCX 9GSSA 2JSYA 4NXIA 3GN3A 5DAKA 2K8VA 1XWCA 5DAKB 1GSFA 1XOAA 1Z5YE 2OE0A 1E2YA 3UVTA 2RUEA 3IPZA 3VWUA 2H71A 2KP1A 2TRXA 3ZRDA 4KA0A 2OADA 3QAVA 4MF6A 4TR1B 1BG5A 3FHKA 3AY8A 1M3IA 3IR4A 2VM1A 2LTKA 4ZBDA 2CAIA 1M2BA 4MZBA 1WWJA 3DWVA 2WDUA 3GSTA 4GF0A 4X4JA 4K0NA 5CRHA 4WETA 2H72A 3KZQA 5BMUA 5IOWA 3HY2A 2V6OA 3GHAA 4O5UA 3U6VA 2C1YA 3UMAA 4EF0A 4NV2A 3F3QA 1Q98A 5G1LA 4KX4A 4YH2A 4FIWA 1GRXA 3DIEA 2I3YA 3ZTLA 5HQPA 3CRUA 5JWRB 4PNGA 3LSZA 1W89A 2B1LA 2HE3A 3HKRA 4MABA 1GUHA 4PXOA 2BTOT 1HNBA 5IMCA 4KB3A 5JWOB 2Z9SA 3GA4A 2H1DA 2VUPA 4XS1A 4YKFA 3GX8A 3WT2A 3L9VA 1XZOA 1T7PB 4I2TA 4K7IA 3US3A 3VK9A 5LCZA 1SK0A 2YANA 2VLUA 2OBIA 5JCWA 4FYBA 1WP0A 4L5OA 1DE1A 3QAGA 1KEBA 3DMLA 4K7NA 1X5EA 4LL1B 1G7EA 2N5BA 4P3YB 3W6GA 2H1GA 4V2NA 1BYEA 1UC7A 2YZHA 4GLTA 2A2PA 2HT9A 1B4PA 3APOA 4FYUA 2BMXA 4E8EA 4ZBAA 4AJ7A 4ZL7A 4NHZA 4OCFA 4TXVA 3TRQA 3MSZA 1USBA 2YWOA 4KDXA 5DJMA 1DUGA 2FWHA 3KH9A 5H5RA 1JZDA 3IXRA 5IPHA 2ON5A 1HYUA 4NWYA 2LEGA 2B7JA 1Y6EA 1TXXA 2R0GA 4ML6A 4IJIA 1NHOA 4IJ3A 4FH8A 1MDKA 2WJUA 2F8FA 4TXOA 3NOFA 1GSUA 1EOGA 3IOSA 3IAM2 3KP8A 3D0ZA 1T4YA 5IO2A 1ML6A 1TJDA 1BJXA 4KH7A 20GSA 2R4VA 1EEMA 4ZXGA 4F0BA 2PPTA 2K8SA 2FWFA 1KNGA 1XIYA 3HVNA 5B6MA 1TU7A 4K2DA 4X0XA 4ULXA 4I8BA 1U3AA 2NTOA 3TJFA 3CBUA 4I97A 3A2WA 3UBLA 2VM2A 3LGCA 1QK8A 2DJ1A 3G7JA 2DKHA 1KBNA 3GURA 5DDLA 4D73B 5L71A 3F4RA 2GT5A 4WKWA 4MNNA 3F63A 3G7YA 3KGKA 4OMVA 1A23A 4XHMA 3SWLA 3E9JB 16GSA 1ZCPA 1T1VA 1GSDA 5HR3A 1M7TA 2HZFA 4BL7B 1WRYA 3IBHA 4GSNA 2FNOA 3ERGA 2ALBA 4OFTA 4ECJA 4GQFA 1PKZA 4N0VA 1K3YA 2RUFA 1XXUA 4KCEA 4RI7A 4HQSA 1ERTA 2B5XA 5E59A 2JZRA 12GSA 4ML1A 2AHEA 2KUCA 2O7KA 1Z3EA 3MNGA 3FYGA 2NPBA 1TDIA 3GH6A 4XS4A 5J4UA 5COHA 1VF3A 5GAND 2VLTA 4ZB8A 4G0LA 1ST9A 3H4KA 3LQ7A 5IQYA 1XW6A 1LJRA 2AV4A 2R2JA 2B7KA 3WGDA 3D5JA 4TR4A 1JZRA 3BCKA 1GUMA 2VCWA 1URMA 3FZAA 3ZYWA 5F05A 4DSSA 3FKFA 3A5IA 1GSSA 2YN1A 3WGEA 1WOUA 3QFBC 2C3QA 4O7HA 3A5WA 2A2SA 3IA1A 4K8MA 4F2IA 5IMAA 1X9SB 2IPAA 3KCMA 3QAWA 1YKAA 3LYKA 5ECNB 2QC7A 3ZITA 3QFAC 4O5QA 4XTSA 4XCSA 4RQRA 1NHYA 2WZ9A 1R7HA 3HVVA 4PUAA 3TJJA 4EIQA 2PGTA 2J9HA 3ZIVA 1UVZA 2LRNA 4PQ1A 4AJ8A 3LXTA 2JZTA 4MJBA 1R4WA 2EIQA 2GS3A 1N2AA 1A8YA 4XS6A 5HR0A 5KN0A 1EGRA 4ISDA 2CZ2A 2I4AA 3APSA 1VGLA 1F3AA 1FG4A 1AAZA 2I9HA 4MMMA 2FA8A 2DBCA 3IK9A 1XWAA 2M46A 1X5DA 4K5RA 2HZEA 2UZ8A 4F9ZA 2IMFA 5LD0A 2HZEB 3KXOA 4LLRA 2H70A 4BVYA 4WBRD 1XWKA 1K3LA 3P2AA 2MMAA 3W8SA 2YV9A 4G19A 5IM9A 1S3CA 3CMIA 3IC4A 2D2ZA 5H5QA 3P8WA 2L57A 5IMFA 3L4NA 4NHWA 5D9XA 1M2DA 3ZLPA 3RAZA 2H76A 2YJHA 1IYHA 2C0FA 2DMLA 1UN2A 4QL9A 2OE1A 5G30A 4IS0A 1EEJA 1AXDA 5EVOA 3MYDA 19GSA 3IK7A 4JRRA 2HFDA 1G6YA 2VO4A 2QA2A 3Q18A 4KW6A 4USSA 1OC9A 2YWMA 5GZZB 4Q5NA 1OC9B 1EGOA 4PNFA 1ZMAA 6GSXA 2YOIA 3GH9A 3EU3A 4ECIA 5ECOB 1OKTA 3KEBA 4F03A 4TR0A 5KN1A 4E8HA 1F6MC 2JL4A 13GSA 2YWIA 1PKWA 2H0HA 3C8EA 4GCIA 4HZ4A 4N30A 3CQFA 1G0TA 3M0FA 2H30A 2CVBA 1SYXA 3CSHA 2GQKA 3HD5A 1J08A 5CYYA 1TRWA 3ZL5A 4IELA 1PN9A 4Z2TA 3PPUA 1SKRB 5ABRA 4KAEA 2GVPA 4O5RA 1FO5A 4XIHA 1S3AA 2K9FA 1GL8A 1B4QA 1A0RP 1PA3A 2E2GA 1PX6A 1Z7RA 4MH3A 4GSSA 4G10A 3GSSA 1WPIA 2X49A 2TIRA 3F9UA 1C72A 2H6YA 4X43A 4NMUA 4ZIJA 5G2ZA 3EE2A 5KEJA 4GQCA 5ECMB 2H75A 5ID2A 2LUSA 2E7PA 2LQOA 2L6CA 3TOTA 1TK0B 3GKKA 3M1GA 5HR1A 1ILOA 5CRWA 5ECHB 1T4ZA 1Z6NA 3DGQA 4KDYA 3WD6A 1AUCA 3ERFA 2B1KA 2AJQB 3KM6A 5DQYA 2P0GA 2RIIA 4MJEA 4BIKA 4K1FA 4XRAA 3FK8A 2H19A 3MIXA 3BD2A 1GTIA 2VD0A 3PR8A 3TJKA 3WYWA 3C7MA 4EL1A 1FB0A 1ZGNA 3EYTA 3TB2A 5E4WA 2GT6A 1GTUA 2FCHA 2P5QA 4JBBA 2HI7A 2X64A 3CYNA 2VL2C 5IMDA 3EINA 1WE0A 4CY8A 2GQLA 4F0CA 3IC8A 5A4UA 2DC5A 3Q74A 1XW9A 4ZL9A 2L59A 1O6JA 4JEDA 5ECRB 4JR6A 2HLSA 1O8WA 2GZPA 3D21A 4TN8A 4EO3A 3PH9A 1A24A 2BJXA 1QQ2A 1OKDA 3ZREA 1XW5A 2B5YA 3C1RA 3ED3A 2VD1A 1FOHA 2F51A 1HD2A 3F0IA 4TRXA 4Q5RA 2VCVA 4MZCA 5IO0A 1YKCA 4OFNA 3TKSE 3TKSC 1ZYNA 3HZ8A 1K0MA 3HVSA 4AJ6A 1V98A 1XVQA 5CAXA 1U87A 1V9WA 3L9UA 3ZMKA 1SL0B 5KOWA 1EP8A 1MD4A 1QFNA 1BX9A 3UAPA 4CW9A 4POMA 3GFKA 2LJRA 2E2MA 3BBYA 3QPMA 1TP9A 3DYRA 2HRNA 1NW2A 4K0GA 2IJYA 1I9DA 1ACVA 3ZVJA 2REMA 2FGXA 4GSTA 4YAPA 3RPPA 2X8HA 4O32A 2DJJA 4WR4A 4IP6A 4PTSA 5CREA 2GGTA 1KTEA 2WGRA 3RBTA 1E6BA 1CQHA 1V2AA 1GTAA 3CTGA 4IQ1A 2AAWA 4Z2RA 1ERWA 3F4SA 3GL3A 2JU5A 5KN3A 2CT6A 2XBIA 3A2VA 3CXGA 3ZFLA 4ZILA 3NZNA 2L5LA 1GSYA 4F82A 5IIZA 2IIYA 3EC3A 1GLQA 5F0GA 2YP6A 2ZCTA 3HXSA 4TXOB 4DSRA 1CQGA 1FHEA 1YZXA 3KJYA 4MDCA 4EIPA 3TKPA 4OWYA 3TRPA 2H8LA 3E3EA 4MA9A 3TKRA 1U88A 3TJBA 4TKYA 1SJZA 2CQ9A 3HZ4A 1M3JA 3LFLA 4HEA2 4BWSA 1QUWA 1O7UA 2GTUA 6GSVA 1PGTA 1SD8A 2R37A 2CVKA 3GX0A 5B7CA 1XWGA 3F6DA 1T00A 3RHBA 1DE2A 3K8NA 3TGZA 3TRXA 2CX3A 4MH2A 3DEXA 2F3MA 4MZWA 2L4CA 2O89A 2G2QA 5C04A 3RDWA 3D4TA 1YQ1A 2KHPA 2E0QA 5F8BA 5AGYA 1YJ6A 2CX4A 5FHIA 1JFUA 4EC0A 1PRXA 2I81A 3GKMA 2LJAA 3TDGA 2B6MA 5D9VA 3FZ9A 4DVCA 3DKSA 2A4HA 5AIVA 3MAKA 2WB9A 1PSQA 1XVWA 2CA8A 2EC4A 5G31A 3I69A 4OFMA 2HXKA 2X8GA 2LKUA 2LRCA 2H6XA 1O8XA 3UARA 4ECBA 3H79A 2B3SA 3F8UA 3IRAA 2VL9A 4Z2UA 4J57E 3KD0A 1EOHA 5KOXA 3LEFA 5CP1A 2OJLA 3F3RA 4Q5QA 4TVEA 1ON4A 2DJ0A 4L8EA 1EZKA 4XRDA 3DVWA 4XS4B 17GSA 4PURA 2H73A 2C3NA 3L0HA 3QD9A 2TRCP 2KOKA 4EVMA 2O87A 4G2EA 4BVXA 5D73A 3VURA 2FUG2 3EMPA 4BVXB 3D22A 2F8AA 2IL3A 3SBCA 4IGJA 1GULA 3KP9A 4DSSB 3FZ4A 2JADA 2P31A 2PVQA 2DJ2A 5D9TA 2O85A 1GSEA 4MF7A 2R3XA 4GRFA 3PINA 2FD3A 2M72A 5ENUA 3FMWA 2V2GA 3O6TA 3W8JA 3IDVA 4FYCA 4K7OA 1M2AA 2K18A 2PWJA 4TW5A 3DRNA 2IFQA 3J7Yb 3KTLA 4BA7A 2XHFA 1YDKA 1O85A 3QDNA 4HZ2A 2M80A 1OC8A 1XOBA 5FT3A 3P90A 4MP4A 3HJMA 1H75A 3M3MA 4ZB6A 11GSA 4HOJA 1SL1B 3EURA 3EVIA 5ELAA 1TOFA 3ZVJD 2C8UA 1TK8B 3D6IA 1XBSA 8GSSA 3IHQA 5ECPB 3GKNA 4BVYB 3CTFA 1H4OA 4POBA 2PERA 1U6TA 1NM3A 4KGIA 5DALA 3H93A 5DALB 4EE0A 2CAQA 1A2LA 1OE7A 4CHSA 2IMDA 3UIWA 2A4VA 1RW1A 4NAXA 1TW9A 1M99A 14GSA 1DBYA 5D9WA 3N9JA 1B9XC 2ES7A 4N11A 1GP1A 1JZOA 5H5SA 3ME8A 1I5GA 1K3OA 1F3BA 4MK3A 4J56E 5AN1A 6GSWA 2H66A 3FR3A 2JZSA 1K0NA 5FWGA 1A0FA 2LQQA 2N5AA 2VOCA 3IHGA 5ECQB 1TI1A 4L0UA 2O8VB 3FEUA 3FW2A 2H6ZA 2XBQA 5HFKA 1X9MB 3VLNA 2VL3A 3Q6OA 3CSIA 3PGTA 1SK1A 1GTBA 2PBJA 1FOVA 4BPYA 4ZB9A 5INYA 3KTBA 2ZNMA 2MYGA 4KF9A 1QGVA 3LWAA 1SD9A 3C73A 4BWQA 3KMNA 1ZL9A 1OC3A 1SYRA 3VFIA 4L0WA 1S3DA 1GH2A 1ZZYA 2GQMA 3U5RE 2FA4A 2GDRA 3D4MA 4DEJA 1IYIA 1TTZA 2A2RA 3GRXA 3VWXA 1OAZA 5DJLA 2DKIA 4A5PA 2EIRA 4AGSA 5JWQB 2VIMA 4HI7A 2NDOA 1RK4A 1GNWA 4MPGA 2LNSA 4HJMA 3GUSA 1AIUA 4JU5A 3VWVA 5KN2A 1O81A 1SENA 1SKWB 3I43A 3MDKA 4V1Ap 5J9CA 5J3RA 1ZYQB 4YKGA 4GXZA 2NVLA 3MWHA 3GTUA 3IAS2 2PU9C 3GTUB 3WT1A 2JSZA 2OACA 2LSTA 2OA7A 4HDEA 4V1Ag 4ECCA 2JACA 3M9JA 2IWTA 6GSYA 3GIXA 1K0AA 4EXJA 4K5SA 3UBKA 4Q5FA 5J5NA 3V1WA 1AQVA 2X8CA 1QXHA 1LBKA 3HJOA 1YEPA 3VPTA 5ID2B 1YY7A 3I6AA 4KUNA 1XCCA 1OVNA 3UJ1A 2LV3A 1LU4A 2CV4A 4OD7A 1G7OA 2DIZA 4IP1A 4O92A 3NIVA 1SL2B 2WCIA 4PQIA 4Z7XA 3M9KA 2DIYA 3QCPA 4PGTA 2WRTA 3JCML 2IMIA 5IMVA 4TR1A 4KSMA 2V1MA 4WBJA 3EU4A 3CSJA 4GTUA 4DSQA 4KCAA 1O73A 2HSMA 2ZUPA 3R2QA 4JE1A 1ZOFA 2EIOA 2YWNA 2YV7A 1OYJA 2KP2A 1Y25A 7GSSA 1OE8A 1XG8A 4N0ZA 2I1UA 3HHVA 1X9WB 1DSBA 3C71A 1J9BA 1K0DA 1M9BA 2L4QA 3QMXA 3KH7A 2HRAA 3IV4A 2HSYA 3UEMA 2MZCA 5HFIA 2LJKA 2QSIA 4NV5A 3EWLA 2B5EA 2V41A 1THOA 1YEXA 5F07A 4ZL8A 1A8LA 1BEDA 3E0UA 1PFOA 1V57A 3F4TA 3O3TA 5IOXA 1MDIA 2R6KA 3LG6A 2YZUA 1AW9A 1JZWA 4RI6A 2HRFA 4IW9A 1EV9A 4YQUA 1M9AA 2H0IA 4PX1A 4EUYA 1K0OA 4POLA 1WJKA 1Q4JA 5CO3A 1JLWA 1TKDB 18GSA 3GKXA 4HU9A 1FVJA 6GSSA 1PD21 3A3TA 1JHBA 2GLRA 2RLIA 4V2MA 1VRSD 4I5QA 1TRUA 5ECSA 1THXA 2HYXA 2C0EA 5ELGA 1HNCA 3A2XA 4CY6A 1SJ6A 1TRVA 2YJ7A 2MBSA 2H1BA 1A2JA 2C0GA 1V40A 4POKA 5G1KA 4IVFA 1EWXA 1TRSA 1T3BA 2PN8A 2FY6A 1MD3A 3C1SA 5A4VA 2H74A 3WGXA 1B8XA 5HFGA 3RPNA 1GWCA 5EPFA 4J2FA 3I9V2 2IMEA 2GSTA 1AQWA 3FR9A 3QR6A 2OE3A 2CVDA 5EY6A 4TR3A 4YAVA 4HJ2A 3FZ5A 3FY7A 5B6NA
chains in the Genus database with same CATH topology
3DXBA 1GUKA 4MJAA 4YQMA 4G0IA 3GNJA 3M8NA 1PN0A 5A5KA 2C3TA 4OO5A 3EMXA 3QOUA 3N5OA 3VPQA 2HSHA 5AIXA 4CDOA 2VLVA 2PUKC 2GSRA 2GSSA 5GSTA 1ABAA 2XPDA 2X4AA 2QGVA 2L6DA 2P5RA 10GSA 4K6XA 2F9SA 22GSA 2VCXA 3BJ5A 2VL2A 5J41A 1N8JA 4TOPA 4IKHA 4D73A 3TOUA 4KE3A 4EDZA 2IMKA 3IE3A 2VCQA 1PL2A 1K0CA 3G9BA 5CRGA 5BRTA 1NSWA 4NPBA 6GSUA 4HU7A 3DD3A 2FHEA 4JZQA 3L9SA 3LYPA 3TKQA 4BL7A 1XFLA 2PMTA 1ZYEA 1TU8A 2QKEA 3CRTA 4WXTA 3HCZA 2X99A 2N5FA 3TKSA 1ERUA 3LJRA 4KSOA 5DCHA 1TK5B 3FR6A 4ACSA 2AYTA 4FO5A 3HA9A 2L5OA 1VF1A 5LNKe 1X5CA 2GZZA 1YF0A 4WF5A 5IMZA 2XPEA 5HR2A 4GWRA 2QA1A 4LL4B 4AF2A 1SU9A 2GSQA 3BOAA 3VI5A 4G0KA 2YNXA 3P7XA 1GSQA 2J23A 1GNEA 2FLSA 3EPTA 1MTCA 4K9ZA 2V6KA 3VI7A 2IN3A 5JCUA 5DVBA 5ECLB 2XC2A 2FWGA 1EP7A 2DJKA 2V32A 2GZYA 2LS5A 3ZMLA 5ECIB 4RQXA 1RQMA 1TI3A 3O76A 1U3IA 3ISOA 1AC1A 4WEYA 1W4VA 2PVOC 4MPFA 1Z7PA 1ZYPA 3BCIA 6GSTA 3OR5A 4ICYA 2DJ3A 1M0UA 4QQ7A 4JR4A 3GMFA 4I2UA 4PUFC 2MMOA 2AB6A 4WF4A 2IFQB 2OKAA 4MLYA 4LMVA 4V2LA 1WIKA 4EDYA 1FAAA 4OCEA 4YQVA 1J0FA 5DQSA 4I6XA 3UOMA 4H86A 2VCTA 2MMNA 3Q19A 4LA1A 1B9YC 1FVKA 2R0PA 5JCGA 2VCZA 1GLPA 1AQXA 2VAFA 1PX7A 5IPGA 3HVXA 3LORA 2C4JA 2ON7A 4RUVA 3KMOA 3LXZA 3DVXA 2LNTA 4HQZA 1YF1A 2RM6A 3LW9A 1FB6A 3ZZXA 2MMZA 1MEKA 1HQOA 2CZ3A 4L5LA 3L78A 1T8EB 2H01A 1PL1A 3GYKA 3GV1A 1MDJA 1X0RA 4HUAA 1QMVA 3R3EA 5AISA 5EL8A 2H1AA 1SKSB 4EKZA 1SK2A 4IHUA 1BAYA 1R26A 1Z9HA 5GAPD 5DBQA 1WMJA 2DSAA 1VF2A 3ZFBA 3ZIJA 1UA5A 4N10A 4MF5A 4HS1A 3UVHA 2H0GA 3APQA 2HRKA 4KDUA 4MJCA 3S9FA 5G5EA 3VWWA 2AUVA 4ILFA 3J7Yk 5D8IA 5F06A 4FQUA 3HYPA 2C80A 4WR5A 3ME7A 1XWBA 2LRTA 3TJGA 5B8BA 4IQAA 3TUEA 5A4WA 1K0BA 2K6VA 2C0DA 1F37A 1PQNA 4LMWA 3ERWA 3UL3A 2YPMA 1ERVA 4IBPA 4G9HA 4ZBBA 1A2MA 4MCUA 2HNLA 1JLVA 1Z6MA 2RM5A 5DCGA 2KLXA 3KIJA 5G5FA 1F9MA 3FRCA 1R5PA 2YCDA 4X1UA 1B48A 1V58A 5B8AA 5C00A 3HJPA 3TCOA 2DMMA 2OBKA 3H1NA 5ECKB 3GL5A 1HNAA 4ID0A 5D93A 3F6FA 3H8QA 2WFCA 3G7IA 1R5AA 2WS2A 1BQ7A 1VF4A 5CRDA 1FW1A 4PQHA 3RHCA 1F2EA 2DLXA 2R0CA 2NBSA 5D96A 1PMTA 1SJIA 4KNDA 4QL7A 2MBTA 2G0FA 5J9BA 2WULA 2FWEA 4K2XA 1G6WA 1XPVA 4IN0A 4OO4A 5GSSA 3HDCA 2R5GA 5CNWA 1EV4A 9GSSA 2JSYA 4NXIA 3GN3A 5DAKA 2K8VA 1XWCA 5DAKB 1GSFA 1XOAA 1Z5YE 2OE0A 1E2YA 3UVTA 2RUEA 3IPZA 3VWUA 2H71A 2KP1A 2TRXA 3ZRDA 4KA0A 2OADA 3QAVA 4MF6A 4TR1B 1BG5A 3FHKA 3AY8A 3IR4A 2VM1A 2LTKA 4ZBDA 2CAIA 1M2BA 4MZBA 1WWJA 3DWVA 2WDUA 3GSTA 4GF0A 4X4JA 4K0NA 5CRHA 4WETA 2H72A 3KZQA 5BMUA 5IOWA 3HY2A 2V6OA 3GHAA 4O5UA 3U6VA 2C1YA 3UMAA 4EF0A 4NV2A 3F3QA 1Q98A 5G1LA 4KX4A 4YH2A 4FIWA 1GRXA 3DIEA 2I3YA 3ZTLA 5HQPA 3CRUA 5JWRB 4PNGA 3LSZA 1W89A 2B1LA 2HE3A 3HKRA 4MABA 1GUHA 4PXOA 2BTOT 1HNBA 5IMCA 4KB3A 5JWOB 2Z9SA 3GA4A 2H1DA 2VUPA 4XS1A 4YKFA 3GX8A 3WT2A 3L9VA 1XZOA 1T7PB 4I2TA 4K7IA 3US3A 3VK9A 5LCZA 1SK0A 2YANA 2VLUA 2OBIA 5JCWA 4FYBA 1WP0A 4L5OA 1DE1A 3QAGA 1KEBA 3DMLA 4K7NA 1X5EA 4LL1B 1G7EA 2N5BA 4P3YB 3W6GA 2H1GA 4V2NA 1BYEA 1UC7A 2YZHA 4GLTA 2A2PA 2HT9A 1B4PA 3APOA 4FYUA 2BMXA 4E8EA 4ZBAA 4AJ7A 4ZL7A 4NHZA 4OCFA 4TXVA 3TRQA 3MSZA 1USBA 2YWOA 4KDXA 5DJMA 1DUGA 2FWHA 3KH9A 5H5RA 1JZDA 3IXRA 5IPHA 2ON5A 1HYUA 4NWYA 2LEGA 2B7JA 1Y6EA 1TXXA 2R0GA 4ML6A 4IJIA 1NHOA 4IJ3A 4FH8A 1MDKA 2WJUA 2F8FA 4TXOA 3NOFA 1GSUA 1EOGA 3IOSA 3IAM2 3KP8A 3D0ZA 1T4YA 5IO2A 1ML6A 1TJDA 1BJXA 4KH7A 20GSA 2R4VA 1EEMA 4ZXGA 4F0BA 2PPTA 2K8SA 2FWFA 1KNGA 1XIYA 5B6MA 1TU7A 4K2DA 4X0XA 4ULXA 4I8BA 1U3AA 2NTOA 3TJFA 3CBUA 4I97A 3A2WA 3UBLA 2VM2A 3LGCA 1QK8A 2DJ1A 3G7JA 2DKHA 1KBNA 3GURA 5DDLA 4D73B 5L71A 3F4RA 2GT5A 4WKWA 4MNNA 3F63A 3G7YA 3KGKA 4OMVA 1A23A 4XHMA 3SWLA 3E9JB 16GSA 1ZCPA 1T1VA 1GSDA 5HR3A 1M7TA 2HZFA 4BL7B 1WRYA 3IBHA 4GSNA 2FNOA 3ERGA 2ALBA 4OFTA 4ECJA 4GQFA 1PKZA 4N0VA 1K3YA 2RUFA 1XXUA 4KCEA 4RI7A 4HQSA 1ERTA 2B5XA 5E59A 2JZRA 12GSA 4ML1A 2AHEA 2KUCA 2O7KA 1Z3EA 3MNGA 3FYGA 2NPBA 1TDIA 3GH6A 4XS4A 5J4UA 5COHA 1VF3A 5GAND 2VLTA 4ZB8A 4G0LA 1ST9A 3H4KA 3LQ7A 5IQYA 1XW6A 1LJRA 2AV4A 2R2JA 2B7KA 3WGDA 3D5JA 4TR4A 1JZRA 3BCKA 1GUMA 2VCWA 1URMA 3FZAA 3ZYWA 5F05A 4DSSA 3FKFA 3A5IA 1GSSA 2YN1A 3WGEA 1WOUA 3QFBC 2C3QA 4O7HA 3A5WA 2A2SA 3IA1A 4K8MA 4F2IA 5IMAA 1X9SB 2IPAA 3KCMA 3QAWA 1YKAA 3LYKA 5ECNB 2QC7A 3ZITA 3QFAC 4O5QA 4XTSA 4XCSA 4RQRA 1NHYA 2WZ9A 1R7HA 3HVVA 4PUAA 3TJJA 4EIQA 2PGTA 2J9HA 3ZIVA 1UVZA 2LRNA 4PQ1A 4AJ8A 3LXTA 2JZTA 4MJBA 1R4WA 2EIQA 2GS3A 1N2AA 1A8YA 4XS6A 5HR0A 5KN0A 1EGRA 4ISDA 2CZ2A 2I4AA 3APSA 1VGLA 1F3AA 1FG4A 1AAZA 2I9HA 4MMMA 2FA8A 2DBCA 3IK9A 1XWAA 2M46A 1X5DA 4K5RA 2HZEA 2UZ8A 4F9ZA 2IMFA 5LD0A 2HZEB 3KXOA 4LLRA 2H70A 4BVYA 4WBRD 1XWKA 1K3LA 3P2AA 2MMAA 3W8SA 2YV9A 4G19A 5IM9A 1S3CA 3CMIA 3IC4A 2D2ZA 5H5QA 3P8WA 2L57A 5IMFA 3L4NA 4NHWA 5D9XA 1M2DA 3ZLPA 3RAZA 2H76A 2YJHA 1IYHA 2C0FA 2DMLA 1UN2A 4QL9A 2OE1A 5G30A 4IS0A 1EEJA 1AXDA 5EVOA 3MYDA 19GSA 3IK7A 4JRRA 2HFDA 1G6YA 2VO4A 2QA2A 3Q18A 4KW6A 4USSA 1OC9A 2YWMA 5GZZB 4Q5NA 1OC9B 1EGOA 4PNFA 1ZMAA 6GSXA 2YOIA 3GH9A 3EU3A 4ECIA 5ECOB 1OKTA 3KEBA 4F03A 4TR0A 5KN1A 4E8HA 1F6MC 2JL4A 13GSA 2YWIA 1PKWA 2H0HA 3C8EA 4GCIA 4HZ4A 4N30A 1G0TA 3M0FA 2H30A 2CVBA 1SYXA 3CSHA 2GQKA 3HD5A 1J08A 5CYYA 1TRWA 3ZL5A 4IELA 1PN9A 4Z2TA 3PPUA 1SKRB 5ABRA 4KAEA 2GVPA 4O5RA 1FO5A 4XIHA 1S3AA 2K9FA 1GL8A 1B4QA 1A0RP 1PA3A 2E2GA 1PX6A 1Z7RA 4MH3A 4GSSA 4G10A 3GSSA 1WPIA 2X49A 2TIRA 3F9UA 1C72A 2H6YA 4X43A 4NMUA 4ZIJA 5G2ZA 3EE2A 5KEJA 4GQCA 5ECMB 2H75A 5ID2A 2LUSA 2E7PA 2LQOA 2L6CA 3TOTA 1TK0B 3GKKA 3M1GA 5HR1A 1ILOA 5CRWA 5ECHB 1T4ZA 1Z6NA 3DGQA 4KDYA 3WD6A 1AUCA 3ERFA 2B1KA 2AJQB 3KM6A 5DQYA 2P0GA 2RIIA 4MJEA 4K1FA 4XRAA 3FK8A 2H19A 3MIXA 3BD2A 1GTIA 2VD0A 3PR8A 3TJKA 3WYWA 3C7MA 4EL1A 1FB0A 1ZGNA 3EYTA 3TB2A 5E4WA 2GT6A 1GTUA 2FCHA 2P5QA 4JBBA 2HI7A 2X64A 3CYNA 2VL2C 5IMDA 3EINA 1WE0A 4CY8A 2GQLA 4F0CA 3IC8A 5A4UA 2DC5A 3Q74A 1XW9A 4ZL9A 2L59A 1O6JA 4JEDA 5ECRB 4JR6A 2HLSA 1O8WA 2GZPA 3D21A 4TN8A 4EO3A 3PH9A 1A24A 2BJXA 1QQ2A 1OKDA 3ZREA 1XW5A 2B5YA 3C1RA 3ED3A 2VD1A 1FOHA 2F51A 1HD2A 3F0IA 4TRXA 4Q5RA 2VCVA 4MZCA 5IO0A 1YKCA 4OFNA 3TKSE 3TKSC 1ZYNA 3HZ8A 1K0MA 3HVSA 4AJ6A 1V98A 1XVQA 5CAXA 1U87A 1V9WA 3L9UA 3ZMKA 1SL0B 5KOWA 1EP8A 1MD4A 1QFNA 1BX9A 3UAPA 4CW9A 4POMA 3GFKA 2LJRA 2E2MA 3BBYA 3QPMA 1TP9A 3DYRA 2HRNA 1NW2A 4K0GA 2IJYA 1I9DA 1ACVA 3ZVJA 2REMA 2FGXA 4GSTA 4YAPA 3RPPA 2X8HA 4O32A 2DJJA 4WR4A 4IP6A 4PTSA 5CREA 2GGTA 1KTEA 2WGRA 3RBTA 1E6BA 1CQHA 1V2AA 1GTAA 3CTGA 4IQ1A 2AAWA 4Z2RA 1ERWA 3F4SA 3GL3A 2JU5A 5KN3A 2CT6A 2XBIA 3A2VA 3CXGA 3ZFLA 4ZILA 3NZNA 2L5LA 1GSYA 4F82A 5IIZA 2IIYA 3EC3A 1GLQA 5F0GA 2YP6A 2ZCTA 3HXSA 4TXOB 4DSRA 1CQGA 1FHEA 1YZXA 3KJYA 4MDCA 4EIPA 3TKPA 4OWYA 3TRPA 2H8LA 3E3EA 4MA9A 3TKRA 1U88A 3TJBA 4TKYA 1SJZA 2CQ9A 3HZ4A 3LFLA 4HEA2 4BWSA 1QUWA 1O7UA 2GTUA 6GSVA 1PGTA 1SD8A 2R37A 2CVKA 3GX0A 5B7CA 1XWGA 3F6DA 1T00A 3RHBA 1DE2A 3K8NA 3TGZA 3TRXA 2CX3A 4MH2A 3DEXA 2F3MA 4MZWA 2L4CA 2O89A 2G2QA 5C04A 3RDWA 3D4TA 1YQ1A 2KHPA 2E0QA 5F8BA 5AGYA 1YJ6A 2CX4A 5FHIA 1JFUA 4EC0A 1PRXA 2I81A 3GKMA 2LJAA 3TDGA 2B6MA 5D9VA 3FZ9A 4DVCA 3DKSA 2A4HA 5AIVA 3MAKA 2WB9A 1PSQA 1XVWA 2CA8A 2EC4A 5G31A 3I69A 4OFMA 2HXKA 2X8GA 2LKUA 2LRCA 2H6XA 1O8XA 3UARA 4ECBA 3H79A 2B3SA 3F8UA 3IRAA 2VL9A 4Z2UA 4J57E 3KD0A 1EOHA 5KOXA 3LEFA 5CP1A 2OJLA 3F3RA 4Q5QA 4TVEA 1ON4A 2DJ0A 4L8EA 1EZKA 4XRDA 3DVWA 4XS4B 17GSA 4PURA 2H73A 2C3NA 3L0HA 3QD9A 2TRCP 2KOKA 4EVMA 2O87A 4G2EA 4BVXA 5D73A 3VURA 2FUG2 3EMPA 4BVXB 3D22A 2F8AA 2IL3A 3SBCA 4IGJA 1GULA 3KP9A 4DSSB 3FZ4A 2JADA 2P31A 2PVQA 2DJ2A 5D9TA 2O85A 1GSEA 4MF7A 2R3XA 4GRFA 3PINA 2FD3A 2M72A 5ENUA 3FMWA 2V2GA 3O6TA 3W8JA 3IDVA 4FYCA 4K7OA 1M2AA 2K18A 2PWJA 4TW5A 3DRNA 2IFQA 3J7Yb 3KTLA 4BA7A 2XHFA 1YDKA 1O85A 3QDNA 4HZ2A 2M80A 1OC8A 1XOBA 5FT3A 3P90A 4MP4A 3HJMA 1H75A 3M3MA 4ZB6A 11GSA 4HOJA 1SL1B 3EURA 3EVIA 5ELAA 1TOFA 3ZVJD 2C8UA 1TK8B 3D6IA 1XBSA 8GSSA 3IHQA 5ECPB 3GKNA 4BVYB 3CTFA 1H4OA 4POBA 2PERA 1U6TA 1NM3A 4KGIA 5DALA 3H93A 5DALB 4EE0A 2CAQA 1A2LA 1OE7A 4CHSA 2IMDA 3UIWA 2A4VA 1RW1A 4NAXA 1TW9A 1M99A 14GSA 1DBYA 5D9WA 3N9JA 1B9XC 2ES7A 4N11A 1GP1A 1JZOA 5H5SA 3ME8A 1I5GA 1K3OA 1F3BA 4MK3A 4J56E 5AN1A 6GSWA 2H66A 3FR3A 2JZSA 1K0NA 5FWGA 1A0FA 2LQQA 2N5AA 2VOCA 3IHGA 5ECQB 1TI1A 4L0UA 2O8VB 3FEUA 3FW2A 2H6ZA 2XBQA 5HFKA 1X9MB 3VLNA 2VL3A 3Q6OA 3CSIA 3PGTA 1SK1A 1GTBA 2PBJA 1FOVA 4BPYA 4ZB9A 5INYA 3KTBA 2ZNMA 2MYGA 4KF9A 1QGVA 3LWAA 1SD9A 3C73A 4BWQA 3KMNA 1ZL9A 1OC3A 1SYRA 3VFIA 4L0WA 1S3DA 1GH2A 1ZZYA 2GQMA 3U5RE 2FA4A 2GDRA 3D4MA 4DEJA 1IYIA 1TTZA 2A2RA 3GRXA 3VWXA 1OAZA 5DJLA 2DKIA 4A5PA 2EIRA 4AGSA 5JWQB 2VIMA 4HI7A 2NDOA 1RK4A 1GNWA 4MPGA 2LNSA 4HJMA 3GUSA 1AIUA 4JU5A 3VWVA 5KN2A 1O81A 1SENA 1SKWB 3I43A 3MDKA 4V1Ap 5J9CA 5J3RA 1ZYQB 4YKGA 4GXZA 2NVLA 3MWHA 3GTUA 3IAS2 2PU9C 3GTUB 3WT1A 2JSZA 2OACA 2LSTA 2OA7A 4HDEA 4V1Ag 4ECCA 2JACA 3M9JA 2IWTA 6GSYA 3GIXA 1K0AA 4EXJA 4K5SA 3UBKA 4Q5FA 5J5NA 3V1WA 1AQVA 2X8CA 1QXHA 1LBKA 3HJOA 1YEPA 3VPTA 5ID2B 1YY7A 3I6AA 4KUNA 1XCCA 1OVNA 3UJ1A 2LV3A 1LU4A 2CV4A 4OD7A 1G7OA 2DIZA 4IP1A 4O92A 3NIVA 1SL2B 2WCIA 4PQIA 4Z7XA 3M9KA 2DIYA 3QCPA 4PGTA 2WRTA 3JCML 2IMIA 5IMVA 4TR1A 4KSMA 2V1MA 4WBJA 3EU4A 3CSJA 4GTUA 4DSQA 4KCAA 1O73A 2HSMA 2ZUPA 3R2QA 4JE1A 1ZOFA 2EIOA 2YWNA 2YV7A 1OYJA 2KP2A 1Y25A 7GSSA 1OE8A 4N0ZA 2I1UA 3HHVA 1X9WB 1DSBA 3C71A 1J9BA 1K0DA 1M9BA 2L4QA 3QMXA 3KH7A 2HRAA 3IV4A 2HSYA 3UEMA 2MZCA 5HFIA 2LJKA 2QSIA 4NV5A 3EWLA 2B5EA 2V41A 1THOA 1YEXA 5F07A 4ZL8A 1A8LA 1BEDA 3E0UA 1V57A 3F4TA 3O3TA 5IOXA 1MDIA 2R6KA 3LG6A 2YZUA 1AW9A 1JZWA 4RI6A 2HRFA 4IW9A 1EV9A 4YQUA 1M9AA 2H0IA 4PX1A 4EUYA 1K0OA 4POLA 1WJKA 1Q4JA 5CO3A 1JLWA 1TKDB 18GSA 3GKXA 4HU9A 1FVJA 6GSSA 1PD21 3A3TA 1JHBA 2GLRA 2RLIA 4V2MA 1VRSD 4I5QA 1TRUA 5ECSA 1THXA 2HYXA 2C0EA 5ELGA 1HNCA 3A2XA 4CY6A 1SJ6A 1TRVA 2YJ7A 2MBSA 2H1BA 1A2JA 2C0GA 1V40A 4POKA 5G1KA 4IVFA 1EWXA 1TRSA 1T3BA 2PN8A 2FY6A 1MD3A 3C1SA 5A4VA 2H74A 3WGXA 1B8XA 5HFGA 3RPNA 1GWCA 5EPFA 4J2FA 3I9V2 2IMEA 2GSTA 1AQWA 3FR9A 3QR6A 2OE3A 2CVDA 5EY6A 4TR3A 4YAVA 4HJ2A 3FZ5A 3FY7A 5B6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXB A;  1GUK A;  4MJA A;  4YQM A;  3GNJ A;  3M8N A;  5A5K A;  2C3T A;  4OO5 A;  3EMX A;  3QOU A;  3N5O A;  3VPQ A;  2HSH A;  5AIX A;  4CDO A;  2VLV A;  2PUK C;  2GSR A;  2GSS A;  5GST A;  1ABA A;  2XPD A;  2QGV A;  2L6D A;  2P5R A;  10GS A;  4K6X A;  2F9S A;  22GS A;  2VCX A;  3BJ5 A;  2VL2 A;  5J41 A;  1N8J A;  4TOP A;  4IKH A;  4D73 A;  3TOU A;  4KE3 A;  4EDZ A;  2IMK A;  3IE3 A;  2VCQ A;  1PL2 A;  1K0C A;  3G9B A;  5CRG A;  1NSW A;  4NPB A;  6GSU A;  4HU7 A;  3DD3 A;  2FHE A;  4JZQ A;  3L9S A;  3LYP A;  3TKQ A;  4BL7 A;  1XFL A;  2PMT A;  1ZYE A;  1TU8 A;  2QKE A;  3CRT A;  4WXT A;  3HCZ A;  2X99 A;  2N5F A;  3TKS A;  1ERU A;  3LJR A;  4KSO A;  5DCH A;  1TK5 B;  3FR6 A;  4ACS A;  2AYT A;  4FO5 A;  3HA9 A;  2L5O A;  1VF1 A;  5LNK e;  1X5C A;  2GZZ A;  1YF0 A;  4WF5 A;  5IMZ A;  2XPE A;  5HR2 A;  4GWR A;  4LL4 B;  4AF2 A;  1SU9 A;  2GSQ A;  3BOA A;  3VI5 A;  2YNX A;  3P7X A;  1GSQ A;  2J23 A;  1GNE A;  2FLS A;  1MTC A;  4K9Z A;  2V6K A;  3VI7 A;  2IN3 A;  5JCU A;  5DVB A;  5ECL B;  2XC2 A;  2FWG A;  1EP7 A;  2DJK A;  2V32 A;  2GZY A;  2LS5 A;  3ZML A;  5ECI B;  4RQX A;  1RQM A;  1TI3 A;  3O76 A;  1U3I A;  3ISO A;  1AC1 A;  4WEY A;  1W4V A;  2PVO C;  4MPF A;  1Z7P A;  3BCI A;  6GST A;  3OR5 A;  2DJ3 A;  1M0U A;  4QQ7 A;  4JR4 A;  3GMF A;  4I2U A;  4PUF C;  2MMO A;  2AB6 A;  4WF4 A;  2IFQ B;  2OKA A;  4MLY A;  4LMV A;  4V2L A;  1WIK A;  4EDY A;  1FAA A;  4OCE A;  4YQV A;  1J0F A;  5DQS A;  4I6X A;  3UOM A;  4H86 A;  2VCT A;  2MMN A;  3Q19 A;  4LA1 A;  1B9Y C;  1FVK A;  5JCG A;  2VCZ A;  1GLP A;  1AQX A;  2VAF A;  1PX7 A;  5IPG A;  3HVX A;  3LOR A;  2C4J A;  2ON7 A;  4RUV A;  3KMO A;  3LXZ A;  3DVX A;  2LNT A;  4HQZ A;  1YF1 A;  2RM6 A;  1FB6 A;  3ZZX A;  2MMZ A;  1MEK A;  1HQO A;  2CZ3 A;  4L5L A;  3L78 A;  1T8E B;  2H01 A;  1PL1 A;  3GYK A;  3GV1 A;  1MDJ A;  1X0R A;  4HUA A;  1QMV A;  5AIS A;  5EL8 A;  2H1A A;  1SKS B;  4EKZ A;  1SK2 A;  4IHU A;  1BAY A;  1R26 A;  1Z9H A;  5GAP D;  5DBQ A;  1WMJ A;  2DSA A;  1VF2 A;  3ZFB A;  3ZIJ A;  1UA5 A;  4N10 A;  4MF5 A;  4HS1 A;  3UVH A;  2H0G A;  3APQ A;  4KDU A;  4MJC A;  3S9F A;  5G5E A;  3VWW A;  2AUV A;  4ILF A;  3J7Y k;  5D8I A;  5F06 A;  3HYP A;  2C80 A;  4WR5 A;  3ME7 A;  1XWB A;  2LRT A;  3TJG A;  5B8B A;  4IQA A;  3TUE A;  5A4W A;  1K0B A;  2K6V A;  2C0D A;  1F37 A;  1PQN A;  4LMW A;  3ERW A;  3UL3 A;  2YPM A;  1ERV A;  4IBP A;  4G9H A;  4ZBB A;  1A2M A;  4MCU A;  2HNL A;  1JLV A;  1Z6M A;  2RM5 A;  5DCG A;  2KLX A;  3KIJ A;  5G5F A;  1F9M A;  3FRC A;  1R5P A;  2YCD A;  4X1U A;  1B48 A;  1V58 A;  5B8A A;  5C00 A;  3HJP A;  3TCO A;  2DMM A;  2OBK A;  3H1N A;  5ECK B;  3GL5 A;  1HNA A;  4ID0 A;  5D93 A;  3F6F A;  3H8Q A;  2WFC A;  3G7I A;  1R5A A;  2WS2 A;  1BQ7 A;  1VF4 A;  5CRD A;  1FW1 A;  4PQH A;  3RHC A;  1F2E A;  2DLX A;  2NBS A;  5D96 A;  1PMT A;  1SJI A;  4KND A;  4QL7 A;  2MBT A;  2G0F A;  5J9B A;  2WUL A;  2FWE A;  1G6W A;  1XPV A;  4IN0 A;  4OO4 A;  5GSS A;  3HDC A;  2R5G A;  5CNW A;  1EV4 A;  9GSS A;  2JSY A;  4NXI A;  5DAK A;  3GN3 A;  2K8V A;  1XWC A;  5DAK B;  1GSF A;  1XOA A;  1Z5Y E;  2OE0 A;  1E2Y A;  3UVT A;  2RUE A;  3IPZ A;  3VWU A;  2H71 A;  2KP1 A;  2TRX A;  3ZRD A;  4KA0 A;  2OAD A;  3QAV A;  4MF6 A;  4TR1 B;  1BG5 A;  3FHK A;  3AY8 A;  3IR4 A;  2VM1 A;  2LTK A;  4ZBD A;  2CAI A;  1M2B A;  4MZB A;  1WWJ A;  3DWV A;  2WDU A;  3GST A;  4GF0 A;  4K0N A;  5CRH A;  4WET A;  2H72 A;  3KZQ A;  5IOW A;  3HY2 A;  2V6O A;  3GHA A;  3U6V A;  2C1Y A;  3UMA A;  4EF0 A;  4NV2 A;  3F3Q A;  1Q98 A;  5G1L A;  4KX4 A;  4YH2 A;  4FIW A;  1GRX A;  3DIE A;  2I3Y A;  3ZTL A;  5HQP A;  3CRU A;  5JWR B;  4PNG A;  3LSZ A;  1W89 A;  2B1L A;  2HE3 A;  3HKR A;  4MAB A;  1GUH A;  4PXO A;  2BTO T;  1HNB A;  5IMC A;  4KB3 A;  5JWO B;  2Z9S A;  3GA4 A;  2H1D A;  2VUP A;  4XS1 A;  3GX8 A;  3WT2 A;  3L9V A;  1XZO A;  1T7P B;  4I2T A;  4K7I A;  3US3 A;  3VK9 A;  5LCZ A;  1SK0 A;  2YAN A;  2VLU A;  2OBI A;  5JCW A;  4FYB A;  1WP0 A;  4L5O A;  1DE1 A;  3QAG A;  1KEB A;  3DML A;  4K7N A;  1X5E A;  4LL1 B;  1G7E A;  2N5B A;  4P3Y B;  3W6G A;  2H1G A;  4V2N A;  1BYE A;  1UC7 A;  2YZH A;  4GLT A;  2HT9 A;  1B4P A;  3APO A;  4FYU A;  2BMX A;  4E8E A;  4ZBA A;  4AJ7 A;  4ZL7 A;  4NHZ A;  4OCF A;  4TXV A;  3TRQ A;  3MSZ A;  1USB A;  2YWO A;  4KDX A;  5DJM A;  1DUG A;  2FWH A;  3KH9 A;  5H5R A;  1JZD A;  3IXR A;  5IPH A;  2ON5 A;  1HYU A;  4NWY A;  2LEG A;  2B7J A;  1Y6E A;  1TXX A;  4ML6 A;  4IJI A;  1NHO A;  4IJ3 A;  4FH8 A;  1MDK A;  2WJU A;  2F8F A;  4TXO A;  3NOF A;  1GSU A;  1EOG A;  3IOS A;  3IAM 2;  3KP8 A;  3D0Z A;  1T4Y A;  5IO2 A;  1ML6 A;  1TJD A;  1BJX A;  4KH7 A;  20GS A;  2R4V A;  1EEM A;  4ZXG A;  4F0B A;  2PPT A;  2K8S A;  2FWF A;  1KNG A;  1XIY A;  5B6M A;  1TU7 A;  4K2D A;  4X0X A;  4ULX A;  4I8B A;  1U3A A;  2NTO A;  3TJF A;  3CBU A;  4I97 A;  3A2W A;  3UBL A;  2VM2 A;  3LGC A;  1QK8 A;  2DJ1 A;  3G7J A;  1KBN A;  3GUR A;  5DDL A;  4D73 B;  5L71 A;  3F4R A;  2GT5 A;  4WKW A;  3F63 A;  3G7Y A;  3KGK A;  4OMV A;  1A23 A;  4XHM A;  3SWL A;  3E9J B;  16GS A;  1ZCP A;  1T1V A;  1GSD A;  5HR3 A;  1M7T A;  2HZF A;  1WRY A;  3IBH A;  4GSN A;  2FNO A;  3ERG A;  2ALB A;  4OFT A;  4ECJ A;  4GQF A;  1PKZ A;  4N0V A;  1K3Y A;  2RUF A;  1XXU A;  4KCE A;  4RI7 A;  4HQS A;  1ERT A;  2B5X A;  5E59 A;  2JZR A;  12GS A;  4ML1 A;  2AHE A;  2KUC A;  2O7K A;  1Z3E A;  3MNG A;  3FYG A;  2NPB A;  1TDI A;  3GH6 A;  4XS4 A;  5J4U A;  5COH A;  1VF3 A;  5GAN D;  2VLT A;  4ZB8 A;  1ST9 A;  3H4K A;  3LQ7 A;  5IQY A;  1XW6 A;  1LJR A;  2AV4 A;  2R2J A;  2B7K A;  3WGD A;  3D5J A;  4TR4 A;  1JZR A;  3BCK A;  1GUM A;  2VCW A;  1URM A;  3FZA A;  3ZYW A;  5F05 A;  4DSS A;  3FKF A;  1GSS A;  2YN1 A;  3WGE A;  1WOU A;  3QFB C;  2C3Q A;  4O7H A;  3A5W A;  2A2S A;  3IA1 A;  4K8M A;  4F2I A;  5IMA A;  1X9S B;  2IPA A;  3KCM A;  3QAW A;  1YKA A;  3LYK A;  5ECN B;  2QC7 A;  3ZIT A;  3QFA C;  4XTS A;  4XCS A;  4RQR A;  1NHY A;  2WZ9 A;  1R7H A;  3HVV A;  4PUA A;  3TJJ A;  2PGT A;  2J9H A;  3ZIV A;  1UVZ A;  2LRN A;  4PQ1 A;  4AJ8 A;  3LXT A;  2JZT A;  4MJB A;  1R4W A;  2EIQ A;  2GS3 A;  1N2A A;  1A8Y A;  4XS6 A;  5HR0 A;  5KN0 A;  1EGR A;  4ISD A;  2CZ2 A;  2I4A A;  3APS A;  1VGL A;  1F3A A;  1FG4 A;  1AAZ A;  2I9H A;  4MMM A;  2FA8 A;  2DBC A;  3IK9 A;  1XWA A;  2M46 A;  1X5D A;  2HZE A;  4F9Z A;  2IMF A;  5LD0 A;  2HZE B;  3KXO A;  4LLR A;  2H70 A;  4BVY A;  4WBR D;  1XWK A;  1K3L A;  3P2A A;  2MMA A;  3W8S A;  2YV9 A;  4G19 A;  5IM9 A;  1S3C A;  3CMI A;  3IC4 A;  2D2Z A;  5H5Q A;  3P8W A;  2L57 A;  5IMF A;  3L4N A;  4NHW A;  5D9X A;  1M2D A;  3ZLP A;  3RAZ A;  2H76 A;  2YJH A;  1IYH A;  2C0F A;  2DML A;  1UN2 A;  4QL9 A;  2OE1 A;  5G30 A;  4IS0 A;  1EEJ A;  1AXD A;  5EVO A;  19GS A;  3IK7 A;  4JRR A;  2HFD A;  1G6Y A;  2VO4 A;  3Q18 A;  4KW6 A;  1OC9 A;  2YWM A;  5GZZ B;  4Q5N A;  1OC9 B;  1EGO A;  4PNF A;  1ZMA A;  6GSX A;  2YOI A;  3GH9 A;  3EU3 A;  4ECI A;  5ECO B;  1OKT A;  3KEB A;  4F03 A;  4TR0 A;  5KN1 A;  4E8H A;  1F6M C;  2JL4 A;  13GS A;  2YWI A;  1PKW A;  2H0H A;  3C8E A;  4GCI A;  4HZ4 A;  4N30 A;  1G0T A;  3M0F A;  2H30 A;  2CVB A;  1SYX A;  3CSH A;  2GQK A;  3HD5 A;  1J08 A;  5CYY A;  1TRW A;  3ZL5 A;  4IEL A;  1PN9 A;  1SKR B;  5ABR A;  4KAE A;  2GVP A;  4O5R A;  1FO5 A;  4XIH A;  1S3A A;  2K9F A;  1GL8 A;  1B4Q A;  1A0R P;  1PA3 A;  2E2G A;  1PX6 A;  1Z7R A;  4MH3 A;  4GSS A;  4G10 A;  3GSS A;  1WPI A;  2TIR A;  3F9U A;  1C72 A;  2H6Y A;  4X43 A;  4NMU A;  4ZIJ A;  5G2Z A;  3EE2 A;  5KEJ A;  4GQC A;  5ECM B;  2H75 A;  5ID2 A;  2LUS A;  2E7P A;  2LQO A;  2L6C A;  3TOT A;  1TK0 B;  3GKK A;  3M1G A;  5HR1 A;  1ILO A;  5CRW A;  5ECH B;  1T4Z A;  1Z6N A;  3DGQ A;  4KDY A;  3WD6 A;  1AUC A;  3ERF A;  2B1K A;  2AJQ B;  3KM6 A;  5DQY A;  2P0G A;  2RII A;  4MJE A;  4K1F A;  4XRA A;  3FK8 A;  2H19 A;  3BD2 A;  1GTI A;  2VD0 A;  3PR8 A;  3TJK A;  3WYW A;  3C7M A;  4EL1 A;  1FB0 A;  1ZGN A;  3EYT A;  3TB2 A;  5E4W A;  2GT6 A;  1GTU A;  2FCH A;  2P5Q A;  4JBB A;  2HI7 A;  2X64 A;  3CYN A;  2VL2 C;  5IMD A;  3EIN A;  1WE0 A;  2GQL A;  4F0C A;  5A4U A;  2DC5 A;  3Q74 A;  1XW9 A;  4ZL9 A;  2L59 A;  1O6J A;  4JED A;  5ECR B;  4JR6 A;  2HLS A;  1O8W A;  2GZP A;  3D21 A;  4TN8 A;  4EO3 A;  3PH9 A;  1A24 A;  2BJX A;  1QQ2 A;  1OKD A;  3ZRE A;  1XW5 A;  2B5Y A;  3C1R A;  3ED3 A;  2VD1 A;  2F51 A;  1HD2 A;  3F0I A;  4TRX A;  4Q5R A;  2VCV A;  4MZC A;  5IO0 A;  1YKC A;  4OFN A;  3TKS E;  3TKS C;  3HZ8 A;  1K0M A;  3HVS A;  4AJ6 A;  1V98 A;  1XVQ A;  5CAX A;  1U87 A;  1V9W A;  3L9U A;  3ZMK A;  1SL0 B;  1EP8 A;  1MD4 A;  1QFN A;  1BX9 A;  3UAP A;  4CW9 A;  4POM A;  3GFK A;  2LJR A;  2E2M A;  3BBY A;  3QPM A;  1TP9 A;  3DYR A;  2HRN A;  1NW2 A;  4K0G A;  2IJY A;  1I9D A;  1ACV A;  3ZVJ A;  2REM A;  2FGX A;  4GST A;  4YAP A;  3RPP A;  2X8H A;  4O32 A;  2DJJ A;  4WR4 A;  4IP6 A;  5CRE A;  2GGT A;  1KTE A;  2WGR A;  3RBT A;  1E6B A;  1CQH A;  1V2A A;  1GTA A;  3CTG A;  4IQ1 A;  2AAW A;  1ERW A;  3F4S A;  3GL3 A;  2JU5 A;  5KN3 A;  2CT6 A;  2XBI A;  3A2V A;  3CXG A;  3ZFL A;  4ZIL A;  3NZN A;  2L5L A;  1GSY A;  4F82 A;  5IIZ A;  2IIY A;  3EC3 A;  1GLQ A;  5F0G A;  2YP6 A;  2ZCT A;  3HXS A;  4TXO B;  4DSR A;  1CQG A;  1FHE A;  1YZX A;  3KJY A;  4MDC A;  3TKP A;  4OWY A;  3TRP A;  2H8L A;  3E3E A;  4MA9 A;  3TKR A;  1U88 A;  3TJB A;  4TKY A;  1SJZ A;  2CQ9 A;  3HZ4 A;  3LFL A;  4HEA 2;  4BWS A;  1QUW A;  1O7U A;  2GTU A;  6GSV A;  1PGT A;  1SD8 A;  2R37 A;  2CVK A;  3GX0 A;  5B7C A;  1XWG A;  3F6D A;  1T00 A;  3RHB A;  1DE2 A;  3K8N A;  3TGZ A;  3TRX A;  2CX3 A;  4MH2 A;  3DEX A;  2F3M A;  4MZW A;  2L4C A;  2O89 A;  2G2Q A;  5C04 A;  3RDW A;  3D4T A;  1YQ1 A;  2KHP A;  2E0Q A;  5F8B A;  5AGY A;  1YJ6 A;  2CX4 A;  5FHI A;  1JFU A;  4EC0 A;  1PRX A;  2I81 A;  3GKM A;  2LJA A;  3TDG A;  2B6M A;  5D9V A;  3FZ9 A;  4DVC A;  3DKS A;  5AIV A;  3MAK A;  2WB9 A;  1PSQ A;  1XVW A;  2CA8 A;  2EC4 A;  5G31 A;  3I69 A;  4OFM A;  2HXK A;  2X8G A;  2LKU A;  2LRC A;  2H6X A;  1O8X A;  3UAR A;  4ECB A;  3H79 A;  2B3S A;  3F8U A;  3IRA A;  2VL9 A;  4J57 E;  3KD0 A;  1EOH A;  3LEF A;  5CP1 A;  2OJL A;  3F3R A;  4Q5Q A;  4TVE A;  1ON4 A;  2DJ0 A;  4L8E A;  1EZK A;  4XRD A;  3DVW A;  4XS4 B;  17GS A;  4PUR A;  2H73 A;  2C3N A;  3L0H A;  3QD9 A;  2TRC P;  2KOK A;  4EVM A;  2O87 A;  4G2E A;  4BVX A;  5D73 A;  3VUR A;  2FUG 2;  3EMP A;  3D22 A;  2F8A A;  2IL3 A;  3SBC A;  4IGJ A;  1GUL A;  3KP9 A;  4DSS B;  3FZ4 A;  2JAD A;  2P31 A;  2PVQ A;  2DJ2 A;  5D9T A;  2O85 A;  1GSE A;  4MF7 A;  2R3X A;  4GRF A;  3PIN A;  2FD3 A;  2M72 A;  5ENU A;  2V2G A;  3O6T A;  3W8J A;  3IDV A;  4FYC A;  4K7O A;  1M2A A;  2K18 A;  2PWJ A;  4TW5 A;  3DRN A;  2IFQ A;  3J7Y b;  3KTL A;  4BA7 A;  2XHF A;  1YDK A;  1O85 A;  3QDN A;  4HZ2 A;  2M80 A;  1OC8 A;  1XOB A;  5FT3 A;  3P90 A;  4MP4 A;  3HJM A;  1H75 A;  3M3M A;  4ZB6 A;  11GS A;  4HOJ A;  1SL1 B;  3EUR A;  3EVI A;  5ELA A;  1TOF A;  3ZVJ D;  2C8U A;  1TK8 B;  3D6I A;  1XBS A;  8GSS A;  3IHQ A;  5ECP B;  3GKN A;  3CTF A;  1H4O A;  4POB A;  2PER A;  1U6T A;  1NM3 A;  4KGI A;  5DAL A;  3H93 A;  5DAL B;  4EE0 A;  2CAQ A;  1A2L A;  1OE7 A;  4CHS A;  2IMD A;  3UIW A;  2A4V A;  1RW1 A;  4NAX A;  1TW9 A;  1M99 A;  14GS A;  1DBY A;  5D9W A;  3N9J A;  1B9X C;  2ES7 A;  4N11 A;  1GP1 A;  1JZO A;  5H5S A;  3ME8 A;  1I5G A;  1K3O A;  1F3B A;  4MK3 A;  4J56 E;  5AN1 A;  6GSW A;  2H66 A;  3FR3 A;  2JZS A;  1K0N A;  5FWG A;  1A0F A;  2LQQ A;  2N5A A;  2VOC A;  5ECQ B;  1TI1 A;  4L0U A;  2O8V B;  3FEU A;  3FW2 A;  2H6Z A;  2XBQ A;  5HFK A;  1X9M B;  3VLN A;  2VL3 A;  3Q6O A;  3CSI A;  3PGT A;  1SK1 A;  1GTB A;  2PBJ A;  1FOV A;  4BPY A;  4ZB9 A;  5INY A;  3KTB A;  2ZNM A;  2MYG A;  1QGV A;  3LWA A;  1SD9 A;  3C73 A;  4BWQ A;  3KMN A;  1ZL9 A;  1OC3 A;  1SYR A;  3VFI A;  4L0W A;  1S3D A;  1GH2 A;  1ZZY A;  2GQM A;  3U5R E;  2FA4 A;  2GDR A;  3D4M A;  4DEJ A;  1IYI A;  1TTZ A;  2A2R A;  3GRX A;  3VWX A;  1OAZ A;  5DJL A;  2EIR A;  4AGS A;  5JWQ B;  2VIM A;  4HI7 A;  2NDO A;  1RK4 A;  1GNW A;  4MPG A;  2LNS A;  4HJM A;  3GUS A;  1AIU A;  4JU5 A;  3VWV A;  5KN2 A;  1O81 A;  1SEN A;  1SKW B;  3I43 A;  3MDK A;  4V1A p;  5J9C A;  5J3R A;  1ZYQ B;  4GXZ A;  2NVL A;  3MWH A;  3GTU A;  3IAS 2;  2PU9 C;  3GTU B;  3WT1 A;  2JSZ A;  2OAC A;  2LST A;  2OA7 A;  4HDE A;  4V1A g;  4ECC A;  2JAC A;  3M9J A;  2IWT A;  6GSY A;  3GIX A;  1K0A A;  4EXJ A;  3UBK A;  4Q5F A;  5J5N A;  3V1W A;  1AQV A;  2X8C A;  1QXH A;  1LBK A;  3HJO A;  1YEP A;  3VPT A;  5ID2 B;  1YY7 A;  3I6A A;  4KUN A;  1XCC A;  1OVN A;  3UJ1 A;  2LV3 A;  1LU4 A;  2CV4 A;  4OD7 A;  1G7O A;  2DIZ A;  4IP1 A;  4O92 A;  3NIV A;  1SL2 B;  2WCI A;  4PQI A;  4Z7X A;  3M9K A;  2DIY A;  3QCP A;  4PGT A;  2WRT A;  3JCM L;  2IMI A;  5IMV A;  4TR1 A;  4KSM A;  2V1M A;  4WBJ A;  3EU4 A;  3CSJ A;  4GTU A;  4DSQ A;  4KCA A;  1O73 A;  2ZUP A;  3R2Q A;  4JE1 A;  1ZOF A;  2EIO A;  2YWN A;  2YV7 A;  1OYJ A;  2KP2 A;  1Y25 A;  7GSS A;  1OE8 A;  4N0Z A;  2I1U A;  3HHV A;  1X9W B;  1DSB A;  3C71 A;  1J9B A;  1K0D A;  1M9B A;  2L4Q A;  3QMX A;  3KH7 A;  3IV4 A;  2HSY A;  3UEM A;  2MZC A;  5HFI A;  2LJK A;  2QSI A;  4NV5 A;  3EWL A;  2B5E A;  2V41 A;  1THO A;  1YEX A;  5F07 A;  4ZL8 A;  1A8L A;  1BED A;  3E0U A;  1V57 A;  3F4T A;  3O3T A;  5IOX A;  1MDI A;  2R6K A;  3LG6 A;  2YZU A;  1AW9 A;  1JZW A;  4RI6 A;  2HRF A;  4IW9 A;  1EV9 A;  4YQU A;  1M9A A;  2H0I A;  4PX1 A;  4EUY A;  1K0O A;  4POL A;  1WJK A;  1Q4J A;  5CO3 A;  1JLW A;  1TKD B;  18GS A;  3GKX A;  4HU9 A;  1FVJ A;  6GSS A;  1PD2 1;  3A3T A;  1JHB A;  2GLR A;  2RLI A;  4V2M A;  1VRS D;  4I5Q A;  1TRU A;  5ECS A;  1THX A;  2HYX A;  2C0E A;  5ELG A;  1HNC A;  3A2X A;  1SJ6 A;  1TRV A;  2YJ7 A;  2MBS A;  2H1B A;  1A2J A;  2C0G A;  1V40 A;  4POK A;  5G1K A;  4IVF A;  1EWX A;  1TRS A;  1T3B A;  2PN8 A;  2FY6 A;  1MD3 A;  3C1S A;  5A4V A;  2H74 A;  3WGX A;  1B8X A;  5HFG A;  3RPN A;  1GWC A;  5EPF A;  4J2F A;  3I9V 2;  2IME A;  2GST A;  1AQW A;  3FR9 A;  3QR6 A;  2OE3 A;  2CVD A;  5EY6 A;  4TR3 A;  4YAV A;  4HJ2 A;  3FZ5 A;  3FY7 A;  5B6N A; 
#chains in the Genus database with same CATH topology
 3DXB A;  1GUK A;  4MJA A;  4YQM A;  4G0I A;  3GNJ A;  3M8N A;  1PN0 A;  5A5K A;  2C3T A;  4OO5 A;  3EMX A;  3QOU A;  3N5O A;  3VPQ A;  2HSH A;  5AIX A;  4CDO A;  2VLV A;  2PUK C;  2GSR A;  2GSS A;  5GST A;  1ABA A;  2XPD A;  2X4A A;  2QGV A;  2L6D A;  2P5R A;  10GS A;  4K6X A;  2F9S A;  22GS A;  2VCX A;  3BJ5 A;  2VL2 A;  5J41 A;  1N8J A;  4TOP A;  4IKH A;  4D73 A;  3TOU A;  4KE3 A;  4EDZ A;  2IMK A;  3IE3 A;  2VCQ A;  1PL2 A;  1K0C A;  3G9B A;  5CRG A;  5BRT A;  1NSW A;  4NPB A;  6GSU A;  4HU7 A;  3DD3 A;  2FHE A;  4JZQ A;  3L9S A;  3LYP A;  3TKQ A;  4BL7 A;  1XFL A;  2PMT A;  1ZYE A;  1TU8 A;  2QKE A;  3CRT A;  4WXT A;  3HCZ A;  2X99 A;  2N5F A;  3TKS A;  1ERU A;  3LJR A;  4KSO A;  5DCH A;  1TK5 B;  3FR6 A;  4ACS A;  2AYT A;  4FO5 A;  3HA9 A;  2L5O A;  1VF1 A;  5LNK e;  1X5C A;  2GZZ A;  1YF0 A;  4WF5 A;  5IMZ A;  2XPE A;  5HR2 A;  4GWR A;  2QA1 A;  4LL4 B;  4AF2 A;  1SU9 A;  2GSQ A;  3BOA A;  3VI5 A;  4G0K A;  2YNX A;  3P7X A;  1GSQ A;  2J23 A;  1GNE A;  2FLS A;  3EPT A;  1MTC A;  4K9Z A;  2V6K A;  3VI7 A;  2IN3 A;  1S3R A;  5JCU A;  5DVB A;  5ECL B;  2XC2 A;  2FWG A;  1EP7 A;  2DJK A;  2V32 A;  2GZY A;  2LS5 A;  3ZML A;  5ECI B;  4RQX A;  1RQM A;  1TI3 A;  3O76 A;  1U3I A;  3ISO A;  1AC1 A;  4WEY A;  1W4V A;  2PVO C;  4MPF A;  1Z7P A;  1ZYP A;  3BCI A;  6GST A;  3OR5 A;  4ICY A;  2DJ3 A;  1M0U A;  4QQ7 A;  4JR4 A;  3GMF A;  4I2U A;  4PUF C;  2MMO A;  2AB6 A;  4WF4 A;  2IFQ B;  2OKA A;  4MLY A;  4LMV A;  4V2L A;  1WIK A;  4EDY A;  1FAA A;  4OCE A;  4YQV A;  1J0F A;  5DQS A;  4I6X A;  3UOM A;  4H86 A;  2VCT A;  2MMN A;  3Q19 A;  4LA1 A;  1B9Y C;  1FVK A;  2R0P A;  5JCG A;  2VCZ A;  1GLP A;  1AQX A;  2VAF A;  1PX7 A;  5IPG A;  3HVX A;  3LOR A;  2C4J A;  2ON7 A;  4RUV A;  3KMO A;  3LXZ A;  3DVX A;  2LNT A;  4HQZ A;  1YF1 A;  2RM6 A;  3LW9 A;  1FB6 A;  3ZZX A;  2MMZ A;  1MEK A;  1HQO A;  2CZ3 A;  4L5L A;  3L78 A;  1T8E B;  2H01 A;  1PL1 A;  3GYK A;  3GV1 A;  1MDJ A;  1X0R A;  4HUA A;  1QMV A;  3R3E A;  5AIS A;  5EL8 A;  2H1A A;  1SKS B;  4EKZ A;  1SK2 A;  4IHU A;  1BAY A;  1R26 A;  1Z9H A;  5GAP D;  5DBQ A;  1WMJ A;  2DSA A;  1VF2 A;  3ZFB A;  3ZIJ A;  1UA5 A;  4N10 A;  4MF5 A;  4HS1 A;  3UVH A;  2H0G A;  3APQ A;  2HRK A;  4KDU A;  4MJC A;  3S9F A;  5G5E A;  3VWW A;  2AUV A;  4ILF A;  3J7Y k;  5D8I A;  5F06 A;  4FQU A;  3HYP A;  2C80 A;  4WR5 A;  3ME7 A;  1XWB A;  2LRT A;  3TJG A;  5B8B A;  4IQA A;  3TUE A;  5A4W A;  1K0B A;  2K6V A;  2C0D A;  1F37 A;  1PQN A;  4LMW A;  3ERW A;  3UL3 A;  2YPM A;  1ERV A;  4IBP A;  4G9H A;  4ZBB A;  1A2M A;  4MCU A;  2HNL A;  1JLV A;  1Z6M A;  2RM5 A;  5DCG A;  2KLX A;  3KIJ A;  5G5F A;  1F9M A;  3FRC A;  1R5P A;  2YCD A;  4X1U A;  1B48 A;  1V58 A;  5B8A A;  5C00 A;  3HJP A;  3TCO A;  2DMM A;  2OBK A;  3H1N A;  5ECK B;  3GL5 A;  1HNA A;  4ID0 A;  5D93 A;  3F6F A;  3H8Q A;  2WFC A;  3G7I A;  1R5A A;  2WS2 A;  1BQ7 A;  1VF4 A;  5CRD A;  1FW1 A;  4PQH A;  3RHC A;  1F2E A;  2DLX A;  2R0C A;  2NBS A;  5D96 A;  1PMT A;  1SJI A;  4KND A;  4QL7 A;  2MBT A;  2G0F A;  5J9B A;  2WUL A;  2FWE A;  4K2X A;  1G6W A;  1XPV A;  4IN0 A;  4OO4 A;  5GSS A;  3HDC A;  2R5G A;  5CNW A;  1EV4 A;  4HSC X;  9GSS A;  2JSY A;  4NXI A;  3GN3 A;  5DAK A;  2K8V A;  1XWC A;  5DAK B;  1GSF A;  1XOA A;  1Z5Y E;  2OE0 A;  1E2Y A;  3UVT A;  2RUE A;  3IPZ A;  3VWU A;  2H71 A;  2KP1 A;  2TRX A;  3ZRD A;  4KA0 A;  2OAD A;  3QAV A;  4MF6 A;  4TR1 B;  1BG5 A;  3FHK A;  3AY8 A;  1M3I A;  3IR4 A;  2VM1 A;  2LTK A;  4ZBD A;  2CAI A;  1M2B A;  4MZB A;  1WWJ A;  3DWV A;  2WDU A;  3GST A;  4GF0 A;  4X4J A;  4K0N A;  5CRH A;  4WET A;  2H72 A;  3KZQ A;  5BMU A;  5IOW A;  3HY2 A;  2V6O A;  3GHA A;  4O5U A;  3U6V A;  2C1Y A;  3UMA A;  4EF0 A;  4NV2 A;  3F3Q A;  1Q98 A;  5G1L A;  4KX4 A;  4YH2 A;  4FIW A;  1GRX A;  3DIE A;  2I3Y A;  3ZTL A;  5HQP A;  3CRU A;  5JWR B;  4PNG A;  3LSZ A;  1W89 A;  2B1L A;  2HE3 A;  3HKR A;  4MAB A;  1GUH A;  4PXO A;  2BTO T;  1HNB A;  5IMC A;  4KB3 A;  5JWO B;  2Z9S A;  3GA4 A;  2H1D A;  2VUP A;  4XS1 A;  4YKF A;  3GX8 A;  3WT2 A;  3L9V A;  1XZO A;  1T7P B;  4I2T A;  4K7I A;  3US3 A;  3VK9 A;  5LCZ A;  1SK0 A;  2YAN A;  2VLU A;  2OBI A;  5JCW A;  4FYB A;  1WP0 A;  4L5O A;  1DE1 A;  3QAG A;  1KEB A;  3DML A;  4K7N A;  1X5E A;  4LL1 B;  1G7E A;  2N5B A;  4P3Y B;  3W6G A;  2H1G A;  4V2N A;  1BYE A;  1UC7 A;  2YZH A;  4GLT A;  2A2P A;  2HT9 A;  1B4P A;  3APO A;  4FYU A;  2BMX A;  4E8E A;  4ZBA A;  4AJ7 A;  4ZL7 A;  4NHZ A;  4OCF A;  4TXV A;  3TRQ A;  3MSZ A;  1USB A;  2YWO A;  4KDX A;  5DJM A;  1DUG A;  2FWH A;  3KH9 A;  5H5R A;  1JZD A;  3IXR A;  5IPH A;  2ON5 A;  1HYU A;  4NWY A;  2LEG A;  2B7J A;  1Y6E A;  1TXX A;  2R0G A;  4ML6 A;  4IJI A;  1NHO A;  4IJ3 A;  4FH8 A;  1MDK A;  2WJU A;  2F8F A;  4TXO A;  3NOF A;  1GSU A;  1EOG A;  3IOS A;  3IAM 2;  3KP8 A;  3D0Z A;  1T4Y A;  5IO2 A;  1ML6 A;  1TJD A;  1BJX A;  4KH7 A;  20GS A;  2R4V A;  1EEM A;  4ZXG A;  4F0B A;  2PPT A;  2K8S A;  2FWF A;  1KNG A;  1XIY A;  3HVN A;  5B6M A;  1TU7 A;  4K2D A;  4X0X A;  4ULX A;  4I8B A;  1U3A A;  2NTO A;  3TJF A;  3CBU A;  4I97 A;  3A2W A;  3UBL A;  2VM2 A;  3LGC A;  1QK8 A;  2DJ1 A;  3G7J A;  2DKH A;  1KBN A;  3GUR A;  5DDL A;  4D73 B;  5L71 A;  3F4R A;  2GT5 A;  4WKW A;  4MNN A;  3F63 A;  3G7Y A;  3KGK A;  4OMV A;  1A23 A;  4XHM A;  3SWL A;  3E9J B;  16GS A;  1ZCP A;  1T1V A;  1GSD A;  5HR3 A;  1M7T A;  2HZF A;  4BL7 B;  1WRY A;  3IBH A;  4GSN A;  2FNO A;  3ERG A;  2ALB A;  4OFT A;  4ECJ A;  4GQF A;  1PKZ A;  4N0V A;  1K3Y A;  2RUF A;  1XXU A;  4KCE A;  4RI7 A;  4HQS A;  1ERT A;  2B5X A;  5E59 A;  2JZR A;  12GS A;  4ML1 A;  2AHE A;  2KUC A;  2O7K A;  1Z3E A;  3MNG A;  3FYG A;  2NPB A;  1TDI A;  3GH6 A;  4XS4 A;  5J4U A;  5COH A;  1VF3 A;  5GAN D;  2VLT A;  4ZB8 A;  4G0L A;  1ST9 A;  3H4K A;  3LQ7 A;  5IQY A;  1XW6 A;  1LJR A;  2AV4 A;  2R2J A;  2B7K A;  3WGD A;  3D5J A;  4TR4 A;  1JZR A;  3BCK A;  1GUM A;  2VCW A;  1URM A;  3FZA A;  3ZYW A;  5F05 A;  4DSS A;  3FKF A;  3A5I A;  1GSS A;  2YN1 A;  3WGE A;  1WOU A;  3QFB C;  2C3Q A;  4O7H A;  3A5W A;  2A2S A;  3IA1 A;  4K8M A;  4F2I A;  5IMA A;  1X9S B;  2IPA A;  3KCM A;  3QAW A;  1YKA A;  3LYK A;  5ECN B;  2QC7 A;  3ZIT A;  3QFA C;  4O5Q A;  4XTS A;  4XCS A;  4RQR A;  1NHY A;  2WZ9 A;  1R7H A;  3HVV A;  4PUA A;  3TJJ A;  4EIQ A;  2PGT A;  2J9H A;  3ZIV A;  1UVZ A;  2LRN A;  4PQ1 A;  4AJ8 A;  3LXT A;  2JZT A;  4MJB A;  1R4W A;  2EIQ A;  2GS3 A;  1N2A A;  1A8Y A;  4XS6 A;  5HR0 A;  5KN0 A;  1EGR A;  4ISD A;  2CZ2 A;  2I4A A;  3APS A;  1VGL A;  1F3A A;  1FG4 A;  1AAZ A;  2I9H A;  4MMM A;  2FA8 A;  2DBC A;  3IK9 A;  1XWA A;  2M46 A;  1X5D A;  4K5R A;  2HZE A;  2UZ8 A;  4F9Z A;  2IMF A;  5LD0 A;  2HZE B;  3KXO A;  4LLR A;  2H70 A;  4BVY A;  4WBR D;  1XWK A;  1K3L A;  3P2A A;  2MMA A;  3W8S A;  2YV9 A;  4G19 A;  5IM9 A;  1S3C A;  3CMI A;  3IC4 A;  2D2Z A;  5H5Q A;  3P8W A;  2L57 A;  5IMF A;  3L4N A;  4NHW A;  5D9X A;  1M2D A;  3ZLP A;  3RAZ A;  2H76 A;  2YJH A;  1IYH A;  2C0F A;  2DML A;  1UN2 A;  4QL9 A;  2OE1 A;  5G30 A;  4IS0 A;  1EEJ A;  1AXD A;  5EVO A;  3MYD A;  19GS A;  3IK7 A;  4JRR A;  2HFD A;  1G6Y A;  2VO4 A;  2QA2 A;  3Q18 A;  4KW6 A;  4USS A;  1OC9 A;  2YWM A;  5GZZ B;  4Q5N A;  1OC9 B;  1EGO A;  4PNF A;  1ZMA A;  6GSX A;  2YOI A;  3GH9 A;  3EU3 A;  4ECI A;  5ECO B;  1OKT A;  3KEB A;  4F03 A;  4TR0 A;  5KN1 A;  4E8H A;  1F6M C;  2JL4 A;  13GS A;  2YWI A;  1PKW A;  2H0H A;  3C8E A;  4GCI A;  4HZ4 A;  4N30 A;  3CQF A;  1G0T A;  3M0F A;  2H30 A;  2CVB A;  1SYX A;  3CSH A;  2GQK A;  3HD5 A;  1J08 A;  5CYY A;  1TRW A;  3ZL5 A;  4IEL A;  1PN9 A;  4Z2T A;  3PPU A;  1SKR B;  5ABR A;  4KAE A;  2GVP A;  4O5R A;  1FO5 A;  4XIH A;  1S3A A;  2K9F A;  1GL8 A;  1B4Q A;  1A0R P;  1PA3 A;  2E2G A;  1PX6 A;  1Z7R A;  4MH3 A;  4GSS A;  4G10 A;  3GSS A;  1WPI A;  2X49 A;  2TIR A;  3F9U A;  1C72 A;  2H6Y A;  4X43 A;  4NMU A;  4ZIJ A;  5G2Z A;  3EE2 A;  5KEJ A;  4GQC A;  5ECM B;  2H75 A;  5ID2 A;  2LUS A;  2E7P A;  2LQO A;  2L6C A;  3TOT A;  1TK0 B;  3GKK A;  3M1G A;  5HR1 A;  1ILO A;  5CRW A;  5ECH B;  1T4Z A;  1Z6N A;  3DGQ A;  4KDY A;  3WD6 A;  1AUC A;  3ERF A;  2B1K A;  2AJQ B;  3KM6 A;  5DQY A;  2P0G A;  2RII A;  4MJE A;  4BIK A;  4K1F A;  4XRA A;  3FK8 A;  2H19 A;  3MIX A;  3BD2 A;  1GTI A;  2VD0 A;  3PR8 A;  3TJK A;  3WYW A;  3C7M A;  4EL1 A;  1FB0 A;  1ZGN A;  3EYT A;  3TB2 A;  5E4W A;  2GT6 A;  1GTU A;  2FCH A;  2P5Q A;  4JBB A;  2HI7 A;  2X64 A;  3CYN A;  2VL2 C;  5IMD A;  3EIN A;  1WE0 A;  4CY8 A;  2GQL A;  4F0C A;  3IC8 A;  5A4U A;  2DC5 A;  3Q74 A;  1XW9 A;  4ZL9 A;  2L59 A;  1O6J A;  4JED A;  5ECR B;  4JR6 A;  2HLS A;  1O8W A;  2GZP A;  3D21 A;  4TN8 A;  4EO3 A;  3PH9 A;  1A24 A;  2BJX A;  1QQ2 A;  1OKD A;  3ZRE A;  1XW5 A;  2B5Y A;  3C1R A;  3ED3 A;  2VD1 A;  1FOH A;  2F51 A;  1HD2 A;  3F0I A;  4TRX A;  4Q5R A;  2VCV A;  4MZC A;  5IO0 A;  1YKC A;  4OFN A;  3TKS E;  3TKS C;  1ZYN A;  3HZ8 A;  1K0M A;  3HVS A;  4AJ6 A;  1V98 A;  1XVQ A;  5CAX A;  1U87 A;  1V9W A;  3L9U A;  3ZMK A;  1SL0 B;  5KOW A;  1EP8 A;  1MD4 A;  1QFN A;  1BX9 A;  3UAP A;  4CW9 A;  4POM A;  3GFK A;  2LJR A;  2E2M A;  3BBY A;  3QPM A;  1TP9 A;  3DYR A;  2HRN A;  1NW2 A;  4K0G A;  2IJY A;  1I9D A;  1ACV A;  3ZVJ A;  2REM A;  2FGX A;  4GST A;  4YAP A;  3RPP A;  2X8H A;  4O32 A;  2DJJ A;  4WR4 A;  4IP6 A;  4PTS A;  5CRE A;  2GGT A;  1KTE A;  2WGR A;  3RBT A;  1E6B A;  1CQH A;  1V2A A;  1GTA A;  3CTG A;  4IQ1 A;  2AAW A;  4Z2R A;  1ERW A;  3F4S A;  3GL3 A;  2JU5 A;  5KN3 A;  2CT6 A;  2XBI A;  3A2V A;  3CXG A;  3ZFL A;  4ZIL A;  3NZN A;  2L5L A;  1GSY A;  4F82 A;  5IIZ A;  2IIY A;  3EC3 A;  1GLQ A;  5F0G A;  2YP6 A;  2ZCT A;  3HXS A;  4TXO B;  4DSR A;  1CQG A;  1FHE A;  1YZX A;  3KJY A;  4MDC A;  4EIP A;  3TKP A;  4OWY A;  3TRP A;  2H8L A;  3E3E A;  4MA9 A;  3TKR A;  1U88 A;  3TJB A;  4TKY A;  1SJZ A;  2CQ9 A;  3HZ4 A;  1M3J A;  3LFL A;  4HEA 2;  4BWS A;  1QUW A;  1O7U A;  2GTU A;  6GSV A;  1PGT A;  1SD8 A;  2R37 A;  2CVK A;  3GX0 A;  5B7C A;  1XWG A;  3F6D A;  1T00 A;  3RHB A;  1DE2 A;  3K8N A;  3TGZ A;  3TRX A;  2CX3 A;  4MH2 A;  3DEX A;  2F3M A;  4MZW A;  2L4C A;  2O89 A;  2G2Q A;  5C04 A;  3RDW A;  3D4T A;  1YQ1 A;  2KHP A;  2E0Q A;  5F8B A;  5AGY A;  1YJ6 A;  2CX4 A;  5FHI A;  1JFU A;  4EC0 A;  1PRX A;  2I81 A;  3GKM A;  2LJA A;  3TDG A;  2B6M A;  5D9V A;  3FZ9 A;  4DVC A;  3DKS A;  2A4H A;  5AIV A;  3MAK A;  2WB9 A;  1PSQ A;  1XVW A;  2CA8 A;  2EC4 A;  5G31 A;  3I69 A;  4OFM A;  2HXK A;  2X8G A;  2LKU A;  2LRC A;  2H6X A;  1O8X A;  3UAR A;  4ECB A;  3H79 A;  2B3S A;  3F8U A;  3IRA A;  2VL9 A;  4Z2U A;  4J57 E;  3KD0 A;  1EOH A;  5KOX A;  3LEF A;  5CP1 A;  2OJL A;  3F3R A;  4Q5Q A;  4TVE A;  1ON4 A;  2DJ0 A;  4L8E A;  1EZK A;  4XRD A;  3DVW A;  4XS4 B;  17GS A;  4PUR A;  2H73 A;  2C3N A;  3L0H A;  3QD9 A;  2TRC P;  2KOK A;  4EVM A;  2O87 A;  4G2E A;  4BVX A;  5D73 A;  3VUR A;  2FUG 2;  3EMP A;  4BVX B;  3D22 A;  2F8A A;  2IL3 A;  3SBC A;  4IGJ A;  1GUL A;  3KP9 A;  4DSS B;  3FZ4 A;  2JAD A;  2P31 A;  2PVQ A;  2DJ2 A;  5D9T A;  2O85 A;  1GSE A;  4MF7 A;  2R3X A;  4GRF A;  3PIN A;  2FD3 A;  2M72 A;  5ENU A;  3FMW A;  2V2G A;  3O6T A;  3W8J A;  3IDV A;  4FYC A;  4K7O A;  1M2A A;  2K18 A;  2PWJ A;  4TW5 A;  3DRN A;  2IFQ A;  3J7Y b;  3KTL A;  4BA7 A;  2XHF A;  1YDK A;  1O85 A;  3QDN A;  4HZ2 A;  2M80 A;  1OC8 A;  1XOB A;  5FT3 A;  3P90 A;  4MP4 A;  3HJM A;  1H75 A;  3M3M A;  4ZB6 A;  11GS A;  4HOJ A;  1SL1 B;  3EUR A;  3EVI A;  5ELA A;  1TOF A;  3ZVJ D;  2C8U A;  1TK8 B;  3D6I A;  1XBS A;  8GSS A;  3IHQ A;  5ECP B;  3GKN A;  4BVY B;  3CTF A;  1H4O A;  4POB A;  2PER A;  1U6T A;  1NM3 A;  4KGI A;  5DAL A;  3H93 A;  5DAL B;  4EE0 A;  2CAQ A;  1A2L A;  1OE7 A;  4CHS A;  2IMD A;  3UIW A;  2A4V A;  1RW1 A;  4NAX A;  1TW9 A;  1M99 A;  14GS A;  1DBY A;  5D9W A;  3N9J A;  1B9X C;  2ES7 A;  4N11 A;  1GP1 A;  1JZO A;  5H5S A;  3ME8 A;  1I5G A;  1K3O A;  1F3B A;  4MK3 A;  4J56 E;  5AN1 A;  6GSW A;  2H66 A;  3FR3 A;  2JZS A;  1K0N A;  5FWG A;  1A0F A;  2LQQ A;  2N5A A;  2VOC A;  3IHG A;  5ECQ B;  1TI1 A;  4L0U A;  2O8V B;  3FEU A;  3FW2 A;  2H6Z A;  2XBQ A;  5HFK A;  1X9M B;  3VLN A;  2VL3 A;  3Q6O A;  3CSI A;  3PGT A;  1SK1 A;  1GTB A;  2PBJ A;  1FOV A;  4BPY A;  4ZB9 A;  5INY A;  3KTB A;  2ZNM A;  2MYG A;  4KF9 A;  1QGV A;  3LWA A;  1SD9 A;  3C73 A;  4BWQ A;  3KMN A;  1ZL9 A;  1OC3 A;  1SYR A;  3VFI A;  4L0W A;  1S3D A;  1GH2 A;  1ZZY A;  2GQM A;  3U5R E;  2FA4 A;  2GDR A;  3D4M A;  4DEJ A;  1IYI A;  1TTZ A;  2A2R A;  3GRX A;  3VWX A;  1OAZ A;  5DJL A;  2DKI A;  4A5P A;  2EIR A;  4AGS A;  5JWQ B;  2VIM A;  4HI7 A;  2NDO A;  1RK4 A;  1GNW A;  4MPG A;  2LNS A;  4HJM A;  3GUS A;  1AIU A;  4JU5 A;  3VWV A;  5KN2 A;  1O81 A;  1SEN A;  1SKW B;  3I43 A;  3MDK A;  4V1A p;  5J9C A;  5J3R A;  1ZYQ B;  4YKG A;  4GXZ A;  2NVL A;  3MWH A;  3GTU A;  3IAS 2;  2PU9 C;  3GTU B;  3WT1 A;  2JSZ A;  2OAC A;  2LST A;  2OA7 A;  4HDE A;  4V1A g;  4ECC A;  2JAC A;  3M9J A;  2IWT A;  6GSY A;  3GIX A;  1K0A A;  4EXJ A;  4K5S A;  3UBK A;  4Q5F A;  5J5N A;  3V1W A;  1AQV A;  2X8C A;  1QXH A;  1LBK A;  3HJO A;  1YEP A;  3VPT A;  5ID2 B;  1YY7 A;  3I6A A;  4KUN A;  1XCC A;  1OVN A;  3UJ1 A;  2LV3 A;  1LU4 A;  2CV4 A;  4OD7 A;  1G7O A;  2DIZ A;  4IP1 A;  4O92 A;  3NIV A;  1SL2 B;  2WCI A;  4PQI A;  4Z7X A;  3M9K A;  2DIY A;  3QCP A;  4PGT A;  2WRT A;  3JCM L;  2IMI A;  5IMV A;  4TR1 A;  4KSM A;  2V1M A;  4WBJ A;  3EU4 A;  3CSJ A;  4GTU A;  4DSQ A;  4KCA A;  1O73 A;  2HSM A;  2ZUP A;  3R2Q A;  4JE1 A;  1ZOF A;  2EIO A;  2YWN A;  2YV7 A;  1OYJ A;  2KP2 A;  1Y25 A;  7GSS A;  1OE8 A;  1XG8 A;  4N0Z A;  2I1U A;  3HHV A;  1X9W B;  1DSB A;  3C71 A;  1J9B A;  1K0D A;  1M9B A;  2L4Q A;  3QMX A;  3KH7 A;  2HRA A;  3IV4 A;  2HSY A;  3UEM A;  2MZC A;  5HFI A;  2LJK A;  2QSI A;  4NV5 A;  3EWL A;  2B5E A;  2V41 A;  1THO A;  1YEX A;  5F07 A;  4ZL8 A;  1A8L A;  1BED A;  3E0U A;  1PFO A;  1V57 A;  3F4T A;  3O3T A;  5IOX A;  1MDI A;  2R6K A;  3LG6 A;  2YZU A;  1AW9 A;  1JZW A;  4RI6 A;  2HRF A;  4IW9 A;  1EV9 A;  4YQU A;  1M9A A;  2H0I A;  4PX1 A;  4EUY A;  1K0O A;  4POL A;  1WJK A;  1Q4J A;  5CO3 A;  1JLW A;  1TKD B;  18GS A;  3GKX A;  4HU9 A;  1FVJ A;  6GSS A;  1PD2 1;  3A3T A;  1JHB A;  2GLR A;  2RLI A;  4V2M A;  1VRS D;  4I5Q A;  1TRU A;  5ECS A;  1THX A;  2HYX A;  2C0E A;  5ELG A;  1HNC A;  3A2X A;  4CY6 A;  1SJ6 A;  1TRV A;  2YJ7 A;  2MBS A;  2H1B A;  1A2J A;  2C0G A;  1V40 A;  4POK A;  5G1K A;  4IVF A;  1EWX A;  1TRS A;  1T3B A;  2PN8 A;  2FY6 A;  1MD3 A;  3C1S A;  5A4V A;  2H74 A;  3WGX A;  1B8X A;  5HFG A;  3RPN A;  1GWC A;  5EPF A;  4J2F A;  3I9V 2;  2IME A;  2GST A;  1AQW A;  3FR9 A;  3QR6 A;  2OE3 A;  2CVD A;  5EY6 A;  4TR3 A;  4YAV A;  4HJ2 A;  3FZ5 A;  3FY7 A;  5B6N A; 
#chains in the Genus database with same CATH homology
 3DXB A;  1GUK A;  4MJA A;  4YQM A;  4G0I A;  3GNJ A;  3M8N A;  1PN0 A;  5A5K A;  2C3T A;  4OO5 A;  3EMX A;  3QOU A;  3N5O A;  3VPQ A;  2HSH A;  5AIX A;  4CDO A;  2VLV A;  2PUK C;  2GSR A;  2GSS A;  5GST A;  1ABA A;  2XPD A;  2X4A A;  2QGV A;  2L6D A;  2P5R A;  10GS A;  4K6X A;  2F9S A;  22GS A;  2VCX A;  3BJ5 A;  2VL2 A;  5J41 A;  1N8J A;  4TOP A;  4IKH A;  4D73 A;  3TOU A;  4KE3 A;  4EDZ A;  2IMK A;  3IE3 A;  2VCQ A;  1PL2 A;  1K0C A;  3G9B A;  5CRG A;  5BRT A;  1NSW A;  4NPB A;  6GSU A;  4HU7 A;  3DD3 A;  2FHE A;  4JZQ A;  3L9S A;  3LYP A;  3TKQ A;  4BL7 A;  1XFL A;  2PMT A;  1ZYE A;  1TU8 A;  2QKE A;  3CRT A;  4WXT A;  3HCZ A;  2X99 A;  2N5F A;  3TKS A;  1ERU A;  3LJR A;  4KSO A;  5DCH A;  1TK5 B;  3FR6 A;  4ACS A;  2AYT A;  4FO5 A;  3HA9 A;  2L5O A;  1VF1 A;  5LNK e;  1X5C A;  2GZZ A;  1YF0 A;  4WF5 A;  5IMZ A;  2XPE A;  5HR2 A;  4GWR A;  2QA1 A;  4LL4 B;  4AF2 A;  1SU9 A;  2GSQ A;  3BOA A;  3VI5 A;  4G0K A;  2YNX A;  3P7X A;  1GSQ A;  2J23 A;  1GNE A;  2FLS A;  3EPT A;  1MTC A;  4K9Z A;  2V6K A;  3VI7 A;  2IN3 A;  5JCU A;  5DVB A;  5ECL B;  2XC2 A;  2FWG A;  1EP7 A;  2DJK A;  2V32 A;  2GZY A;  2LS5 A;  3ZML A;  5ECI B;  4RQX A;  1RQM A;  1TI3 A;  3O76 A;  1U3I A;  3ISO A;  1AC1 A;  4WEY A;  1W4V A;  2PVO C;  4MPF A;  1Z7P A;  1ZYP A;  3BCI A;  6GST A;  3OR5 A;  4ICY A;  2DJ3 A;  1M0U A;  4QQ7 A;  4JR4 A;  3GMF A;  4I2U A;  4PUF C;  2MMO A;  2AB6 A;  4WF4 A;  2IFQ B;  2OKA A;  4MLY A;  4LMV A;  4V2L A;  1WIK A;  4EDY A;  1FAA A;  4OCE A;  4YQV A;  1J0F A;  5DQS A;  4I6X A;  3UOM A;  4H86 A;  2VCT A;  2MMN A;  3Q19 A;  4LA1 A;  1B9Y C;  1FVK A;  2R0P A;  5JCG A;  2VCZ A;  1GLP A;  1AQX A;  2VAF A;  1PX7 A;  5IPG A;  3HVX A;  3LOR A;  2C4J A;  2ON7 A;  4RUV A;  3KMO A;  3LXZ A;  3DVX A;  2LNT A;  4HQZ A;  1YF1 A;  2RM6 A;  3LW9 A;  1FB6 A;  3ZZX A;  2MMZ A;  1MEK A;  1HQO A;  2CZ3 A;  4L5L A;  3L78 A;  1T8E B;  2H01 A;  1PL1 A;  3GYK A;  3GV1 A;  1MDJ A;  1X0R A;  4HUA A;  1QMV A;  3R3E A;  5AIS A;  5EL8 A;  2H1A A;  1SKS B;  4EKZ A;  1SK2 A;  4IHU A;  1BAY A;  1R26 A;  1Z9H A;  5GAP D;  5DBQ A;  1WMJ A;  2DSA A;  1VF2 A;  3ZFB A;  3ZIJ A;  1UA5 A;  4N10 A;  4MF5 A;  4HS1 A;  3UVH A;  2H0G A;  3APQ A;  2HRK A;  4KDU A;  4MJC A;  3S9F A;  5G5E A;  3VWW A;  2AUV A;  4ILF A;  3J7Y k;  5D8I A;  5F06 A;  4FQU A;  3HYP A;  2C80 A;  4WR5 A;  3ME7 A;  1XWB A;  2LRT A;  3TJG A;  5B8B A;  4IQA A;  3TUE A;  5A4W A;  1K0B A;  2K6V A;  2C0D A;  1F37 A;  1PQN A;  4LMW A;  3ERW A;  3UL3 A;  2YPM A;  1ERV A;  4IBP A;  4G9H A;  4ZBB A;  1A2M A;  4MCU A;  2HNL A;  1JLV A;  1Z6M A;  2RM5 A;  5DCG A;  2KLX A;  3KIJ A;  5G5F A;  1F9M A;  3FRC A;  1R5P A;  2YCD A;  4X1U A;  1B48 A;  1V58 A;  5B8A A;  5C00 A;  3HJP A;  3TCO A;  2DMM A;  2OBK A;  3H1N A;  5ECK B;  3GL5 A;  1HNA A;  4ID0 A;  5D93 A;  3F6F A;  3H8Q A;  2WFC A;  3G7I A;  1R5A A;  2WS2 A;  1BQ7 A;  1VF4 A;  5CRD A;  1FW1 A;  4PQH A;  3RHC A;  1F2E A;  2DLX A;  2R0C A;  2NBS A;  5D96 A;  1PMT A;  1SJI A;  4KND A;  4QL7 A;  2MBT A;  2G0F A;  5J9B A;  2WUL A;  2FWE A;  4K2X A;  1G6W A;  1XPV A;  4IN0 A;  4OO4 A;  5GSS A;  3HDC A;  2R5G A;  5CNW A;  1EV4 A;  9GSS A;  2JSY A;  4NXI A;  3GN3 A;  5DAK A;  2K8V A;  1XWC A;  5DAK B;  1GSF A;  1XOA A;  1Z5Y E;  2OE0 A;  1E2Y A;  3UVT A;  2RUE A;  3IPZ A;  3VWU A;  2H71 A;  2KP1 A;  2TRX A;  3ZRD A;  4KA0 A;  2OAD A;  3QAV A;  4MF6 A;  4TR1 B;  1BG5 A;  3FHK A;  3AY8 A;  3IR4 A;  2VM1 A;  2LTK A;  4ZBD A;  2CAI A;  1M2B A;  4MZB A;  1WWJ A;  3DWV A;  2WDU A;  3GST A;  4GF0 A;  4X4J A;  4K0N A;  5CRH A;  4WET A;  2H72 A;  3KZQ A;  5BMU A;  5IOW A;  3HY2 A;  2V6O A;  3GHA A;  4O5U A;  3U6V A;  2C1Y A;  3UMA A;  4EF0 A;  4NV2 A;  3F3Q A;  1Q98 A;  5G1L A;  4KX4 A;  4YH2 A;  4FIW A;  1GRX A;  3DIE A;  2I3Y A;  3ZTL A;  5HQP A;  3CRU A;  5JWR B;  4PNG A;  3LSZ A;  1W89 A;  2B1L A;  2HE3 A;  3HKR A;  4MAB A;  1GUH A;  4PXO A;  2BTO T;  1HNB A;  5IMC A;  4KB3 A;  5JWO B;  2Z9S A;  3GA4 A;  2H1D A;  2VUP A;  4XS1 A;  4YKF A;  3GX8 A;  3WT2 A;  3L9V A;  1XZO A;  1T7P B;  4I2T A;  4K7I A;  3US3 A;  3VK9 A;  5LCZ A;  1SK0 A;  2YAN A;  2VLU A;  2OBI A;  5JCW A;  4FYB A;  1WP0 A;  4L5O A;  1DE1 A;  3QAG A;  1KEB A;  3DML A;  4K7N A;  1X5E A;  4LL1 B;  1G7E A;  2N5B A;  4P3Y B;  3W6G A;  2H1G A;  4V2N A;  1BYE A;  1UC7 A;  2YZH A;  4GLT A;  2A2P A;  2HT9 A;  1B4P A;  3APO A;  4FYU A;  2BMX A;  4E8E A;  4ZBA A;  4AJ7 A;  4ZL7 A;  4NHZ A;  4OCF A;  4TXV A;  3TRQ A;  3MSZ A;  1USB A;  2YWO A;  4KDX A;  5DJM A;  1DUG A;  2FWH A;  3KH9 A;  5H5R A;  1JZD A;  3IXR A;  5IPH A;  2ON5 A;  1HYU A;  4NWY A;  2LEG A;  2B7J A;  1Y6E A;  1TXX A;  2R0G A;  4ML6 A;  4IJI A;  1NHO A;  4IJ3 A;  4FH8 A;  1MDK A;  2WJU A;  2F8F A;  4TXO A;  3NOF A;  1GSU A;  1EOG A;  3IOS A;  3IAM 2;  3KP8 A;  3D0Z A;  1T4Y A;  5IO2 A;  1ML6 A;  1TJD A;  1BJX A;  4KH7 A;  20GS A;  2R4V A;  1EEM A;  4ZXG A;  4F0B A;  2PPT A;  2K8S A;  2FWF A;  1KNG A;  1XIY A;  5B6M A;  1TU7 A;  4K2D A;  4X0X A;  4ULX A;  4I8B A;  1U3A A;  2NTO A;  3TJF A;  3CBU A;  4I97 A;  3A2W A;  3UBL A;  2VM2 A;  3LGC A;  1QK8 A;  2DJ1 A;  3G7J A;  2DKH A;  1KBN A;  3GUR A;  5DDL A;  4D73 B;  5L71 A;  3F4R A;  2GT5 A;  4WKW A;  4MNN A;  3F63 A;  3G7Y A;  3KGK A;  4OMV A;  1A23 A;  4XHM A;  3SWL A;  3E9J B;  16GS A;  1ZCP A;  1T1V A;  1GSD A;  5HR3 A;  1M7T A;  2HZF A;  4BL7 B;  1WRY A;  3IBH A;  4GSN A;  2FNO A;  3ERG A;  2ALB A;  4OFT A;  4ECJ A;  4GQF A;  1PKZ A;  4N0V A;  1K3Y A;  2RUF A;  1XXU A;  4KCE A;  4RI7 A;  4HQS A;  1ERT A;  2B5X A;  5E59 A;  2JZR A;  12GS A;  4ML1 A;  2AHE A;  2KUC A;  2O7K A;  1Z3E A;  3MNG A;  3FYG A;  2NPB A;  1TDI A;  3GH6 A;  4XS4 A;  5J4U A;  5COH A;  1VF3 A;  5GAN D;  2VLT A;  4ZB8 A;  4G0L A;  1ST9 A;  3H4K A;  3LQ7 A;  5IQY A;  1XW6 A;  1LJR A;  2AV4 A;  2R2J A;  2B7K A;  3WGD A;  3D5J A;  4TR4 A;  1JZR A;  3BCK A;  1GUM A;  2VCW A;  1URM A;  3FZA A;  3ZYW A;  5F05 A;  4DSS A;  3FKF A;  3A5I A;  1GSS A;  2YN1 A;  3WGE A;  1WOU A;  3QFB C;  2C3Q A;  4O7H A;  3A5W A;  2A2S A;  3IA1 A;  4K8M A;  4F2I A;  5IMA A;  1X9S B;  2IPA A;  3KCM A;  3QAW A;  1YKA A;  3LYK A;  5ECN B;  2QC7 A;  3ZIT A;  3QFA C;  4O5Q A;  4XTS A;  4XCS A;  4RQR A;  1NHY A;  2WZ9 A;  1R7H A;  3HVV A;  4PUA A;  3TJJ A;  4EIQ A;  2PGT A;  2J9H A;  3ZIV A;  1UVZ A;  2LRN A;  4PQ1 A;  4AJ8 A;  3LXT A;  2JZT A;  4MJB A;  1R4W A;  2EIQ A;  2GS3 A;  1N2A A;  1A8Y A;  4XS6 A;  5HR0 A;  5KN0 A;  1EGR A;  4ISD A;  2CZ2 A;  2I4A A;  3APS A;  1VGL A;  1F3A A;  1FG4 A;  1AAZ A;  2I9H A;  4MMM A;  2FA8 A;  2DBC A;  3IK9 A;  1XWA A;  2M46 A;  1X5D A;  4K5R A;  2HZE A;  2UZ8 A;  4F9Z A;  2IMF A;  5LD0 A;  2HZE B;  3KXO A;  4LLR A;  2H70 A;  4BVY A;  4WBR D;  1XWK A;  1K3L A;  3P2A A;  2MMA A;  3W8S A;  2YV9 A;  4G19 A;  5IM9 A;  1S3C A;  3CMI A;  3IC4 A;  2D2Z A;  5H5Q A;  3P8W A;  2L57 A;  5IMF A;  3L4N A;  4NHW A;  5D9X A;  1M2D A;  3ZLP A;  3RAZ A;  2H76 A;  2YJH A;  1IYH A;  2C0F A;  2DML A;  1UN2 A;  4QL9 A;  2OE1 A;  5G30 A;  4IS0 A;  1EEJ A;  1AXD A;  5EVO A;  3MYD A;  19GS A;  3IK7 A;  4JRR A;  2HFD A;  1G6Y A;  2VO4 A;  2QA2 A;  3Q18 A;  4KW6 A;  4USS A;  1OC9 A;  2YWM A;  5GZZ B;  4Q5N A;  1OC9 B;  1EGO A;  4PNF A;  1ZMA A;  6GSX A;  2YOI A;  3GH9 A;  3EU3 A;  4ECI A;  5ECO B;  1OKT A;  3KEB A;  4F03 A;  4TR0 A;  5KN1 A;  4E8H A;  1F6M C;  2JL4 A;  13GS A;  2YWI A;  1PKW A;  2H0H A;  3C8E A;  4GCI A;  4HZ4 A;  4N30 A;  1G0T A;  3M0F A;  2H30 A;  2CVB A;  1SYX A;  3CSH A;  2GQK A;  3HD5 A;  1J08 A;  5CYY A;  1TRW A;  3ZL5 A;  4IEL A;  1PN9 A;  4Z2T A;  3PPU A;  1SKR B;  5ABR A;  4KAE A;  2GVP A;  4O5R A;  1FO5 A;  4XIH A;  1S3A A;  2K9F A;  1GL8 A;  1B4Q A;  1A0R P;  1PA3 A;  2E2G A;  1PX6 A;  1Z7R A;  4MH3 A;  4GSS A;  4G10 A;  3GSS A;  1WPI A;  2X49 A;  2TIR A;  3F9U A;  1C72 A;  2H6Y A;  4X43 A;  4NMU A;  4ZIJ A;  5G2Z A;  3EE2 A;  5KEJ A;  4GQC A;  5ECM B;  2H75 A;  5ID2 A;  2LUS A;  2E7P A;  2LQO A;  2L6C A;  3TOT A;  1TK0 B;  3GKK A;  3M1G A;  5HR1 A;  1ILO A;  5CRW A;  5ECH B;  1T4Z A;  1Z6N A;  3DGQ A;  4KDY A;  3WD6 A;  1AUC A;  3ERF A;  2B1K A;  2AJQ B;  3KM6 A;  5DQY A;  2P0G A;  2RII A;  4MJE A;  4K1F A;  4XRA A;  3FK8 A;  2H19 A;  3MIX A;  3BD2 A;  1GTI A;  2VD0 A;  3PR8 A;  3TJK A;  3WYW A;  3C7M A;  4EL1 A;  1FB0 A;  1ZGN A;  3EYT A;  3TB2 A;  5E4W A;  2GT6 A;  1GTU A;  2FCH A;  2P5Q A;  4JBB A;  2HI7 A;  2X64 A;  3CYN A;  2VL2 C;  5IMD A;  3EIN A;  1WE0 A;  4CY8 A;  2GQL A;  4F0C A;  3IC8 A;  5A4U A;  2DC5 A;  3Q74 A;  1XW9 A;  4ZL9 A;  2L59 A;  1O6J A;  4JED A;  5ECR B;  4JR6 A;  2HLS A;  1O8W A;  2GZP A;  3D21 A;  4TN8 A;  4EO3 A;  3PH9 A;  1A24 A;  2BJX A;  1QQ2 A;  1OKD A;  3ZRE A;  1XW5 A;  2B5Y A;  3C1R A;  3ED3 A;  2VD1 A;  1FOH A;  2F51 A;  1HD2 A;  3F0I A;  4TRX A;  4Q5R A;  2VCV A;  4MZC A;  5IO0 A;  1YKC A;  4OFN A;  3TKS E;  3TKS C;  1ZYN A;  3HZ8 A;  1K0M A;  3HVS A;  4AJ6 A;  1V98 A;  1XVQ A;  5CAX A;  1U87 A;  1V9W A;  3L9U A;  3ZMK A;  1SL0 B;  5KOW A;  1EP8 A;  1MD4 A;  1QFN A;  1BX9 A;  3UAP A;  4CW9 A;  4POM A;  3GFK A;  2LJR A;  2E2M A;  3BBY A;  3QPM A;  1TP9 A;  3DYR A;  2HRN A;  1NW2 A;  4K0G A;  2IJY A;  1I9D A;  1ACV A;  3ZVJ A;  2REM A;  2FGX A;  4GST A;  4YAP A;  3RPP A;  2X8H A;  4O32 A;  2DJJ A;  4WR4 A;  4IP6 A;  4PTS A;  5CRE A;  2GGT A;  1KTE A;  2WGR A;  3RBT A;  1E6B A;  1CQH A;  1V2A A;  1GTA A;  3CTG A;  4IQ1 A;  2AAW A;  4Z2R A;  1ERW A;  3F4S A;  3GL3 A;  2JU5 A;  5KN3 A;  2CT6 A;  2XBI A;  3A2V A;  3CXG A;  3ZFL A;  4ZIL A;  3NZN A;  2L5L A;  1GSY A;  4F82 A;  5IIZ A;  2IIY A;  3EC3 A;  1GLQ A;  5F0G A;  2YP6 A;  2ZCT A;  3HXS A;  4TXO B;  4DSR A;  1CQG A;  1FHE A;  1YZX A;  3KJY A;  4MDC A;  4EIP A;  3TKP A;  4OWY A;  3TRP A;  2H8L A;  3E3E A;  4MA9 A;  3TKR A;  1U88 A;  3TJB A;  4TKY A;  1SJZ A;  2CQ9 A;  3HZ4 A;  3LFL A;  4HEA 2;  4BWS A;  1QUW A;  1O7U A;  2GTU A;  6GSV A;  1PGT A;  1SD8 A;  2R37 A;  2CVK A;  3GX0 A;  5B7C A;  1XWG A;  3F6D A;  1T00 A;  3RHB A;  1DE2 A;  3K8N A;  3TGZ A;  3TRX A;  2CX3 A;  4MH2 A;  3DEX A;  2F3M A;  4MZW A;  2L4C A;  2O89 A;  2G2Q A;  5C04 A;  3RDW A;  3D4T A;  1YQ1 A;  2KHP A;  2E0Q A;  5F8B A;  5AGY A;  1YJ6 A;  2CX4 A;  5FHI A;  1JFU A;  4EC0 A;  1PRX A;  2I81 A;  3GKM A;  2LJA A;  3TDG A;  2B6M A;  5D9V A;  3FZ9 A;  4DVC A;  3DKS A;  2A4H A;  5AIV A;  3MAK A;  2WB9 A;  1PSQ A;  1XVW A;  2CA8 A;  2EC4 A;  5G31 A;  3I69 A;  4OFM A;  2HXK A;  2X8G A;  2LKU A;  2LRC A;  2H6X A;  1O8X A;  3UAR A;  4ECB A;  3H79 A;  2B3S A;  3F8U A;  3IRA A;  2VL9 A;  4Z2U A;  4J57 E;  3KD0 A;  1EOH A;  5KOX A;  3LEF A;  5CP1 A;  2OJL A;  3F3R A;  4Q5Q A;  4TVE A;  1ON4 A;  2DJ0 A;  4L8E A;  1EZK A;  4XRD A;  3DVW A;  4XS4 B;  17GS A;  4PUR A;  2H73 A;  2C3N A;  3L0H A;  3QD9 A;  2TRC P;  2KOK A;  4EVM A;  2O87 A;  4G2E A;  4BVX A;  5D73 A;  3VUR A;  2FUG 2;  3EMP A;  4BVX B;  3D22 A;  2F8A A;  2IL3 A;  3SBC A;  4IGJ A;  1GUL A;  3KP9 A;  4DSS B;  3FZ4 A;  2JAD A;  2P31 A;  2PVQ A;  2DJ2 A;  5D9T A;  2O85 A;  1GSE A;  4MF7 A;  2R3X A;  4GRF A;  3PIN A;  2FD3 A;  2M72 A;  5ENU A;  3FMW A;  2V2G A;  3O6T A;  3W8J A;  3IDV A;  4FYC A;  4K7O A;  1M2A A;  2K18 A;  2PWJ A;  4TW5 A;  3DRN A;  2IFQ A;  3J7Y b;  3KTL A;  4BA7 A;  2XHF A;  1YDK A;  1O85 A;  3QDN A;  4HZ2 A;  2M80 A;  1OC8 A;  1XOB A;  5FT3 A;  3P90 A;  4MP4 A;  3HJM A;  1H75 A;  3M3M A;  4ZB6 A;  11GS A;  4HOJ A;  1SL1 B;  3EUR A;  3EVI A;  5ELA A;  1TOF A;  3ZVJ D;  2C8U A;  1TK8 B;  3D6I A;  1XBS A;  8GSS A;  3IHQ A;  5ECP B;  3GKN A;  4BVY B;  3CTF A;  1H4O A;  4POB A;  2PER A;  1U6T A;  1NM3 A;  4KGI A;  5DAL A;  3H93 A;  5DAL B;  4EE0 A;  2CAQ A;  1A2L A;  1OE7 A;  4CHS A;  2IMD A;  3UIW A;  2A4V A;  1RW1 A;  4NAX A;  1TW9 A;  1M99 A;  14GS A;  1DBY A;  5D9W A;  3N9J A;  1B9X C;  2ES7 A;  4N11 A;  1GP1 A;  1JZO A;  5H5S A;  3ME8 A;  1I5G A;  1K3O A;  1F3B A;  4MK3 A;  4J56 E;  5AN1 A;  6GSW A;  2H66 A;  3FR3 A;  2JZS A;  1K0N A;  5FWG A;  1A0F A;  2LQQ A;  2N5A A;  2VOC A;  3IHG A;  5ECQ B;  1TI1 A;  4L0U A;  2O8V B;  3FEU A;  3FW2 A;  2H6Z A;  2XBQ A;  5HFK A;  1X9M B;  3VLN A;  2VL3 A;  3Q6O A;  3CSI A;  3PGT A;  1SK1 A;  1GTB A;  2PBJ A;  1FOV A;  4BPY A;  4ZB9 A;  5INY A;  3KTB A;  2ZNM A;  2MYG A;  4KF9 A;  1QGV A;  3LWA A;  1SD9 A;  3C73 A;  4BWQ A;  3KMN A;  1ZL9 A;  1OC3 A;  1SYR A;  3VFI A;  4L0W A;  1S3D A;  1GH2 A;  1ZZY A;  2GQM A;  3U5R E;  2FA4 A;  2GDR A;  3D4M A;  4DEJ A;  1IYI A;  1TTZ A;  2A2R A;  3GRX A;  3VWX A;  1OAZ A;  5DJL A;  2DKI A;  4A5P A;  2EIR A;  4AGS A;  5JWQ B;  2VIM A;  4HI7 A;  2NDO A;  1RK4 A;  1GNW A;  4MPG A;  2LNS A;  4HJM A;  3GUS A;  1AIU A;  4JU5 A;  3VWV A;  5KN2 A;  1O81 A;  1SEN A;  1SKW B;  3I43 A;  3MDK A;  4V1A p;  5J9C A;  5J3R A;  1ZYQ B;  4YKG A;  4GXZ A;  2NVL A;  3MWH A;  3GTU A;  3IAS 2;  2PU9 C;  3GTU B;  3WT1 A;  2JSZ A;  2OAC A;  2LST A;  2OA7 A;  4HDE A;  4V1A g;  4ECC A;  2JAC A;  3M9J A;  2IWT A;  6GSY A;  3GIX A;  1K0A A;  4EXJ A;  4K5S A;  3UBK A;  4Q5F A;  5J5N A;  3V1W A;  1AQV A;  2X8C A;  1QXH A;  1LBK A;  3HJO A;  1YEP A;  3VPT A;  5ID2 B;  1YY7 A;  3I6A A;  4KUN A;  1XCC A;  1OVN A;  3UJ1 A;  2LV3 A;  1LU4 A;  2CV4 A;  4OD7 A;  1G7O A;  2DIZ A;  4IP1 A;  4O92 A;  3NIV A;  1SL2 B;  2WCI A;  4PQI A;  4Z7X A;  3M9K A;  2DIY A;  3QCP A;  4PGT A;  2WRT A;  3JCM L;  2IMI A;  5IMV A;  4TR1 A;  4KSM A;  2V1M A;  4WBJ A;  3EU4 A;  3CSJ A;  4GTU A;  4DSQ A;  4KCA A;  1O73 A;  2HSM A;  2ZUP A;  3R2Q A;  4JE1 A;  1ZOF A;  2EIO A;  2YWN A;  2YV7 A;  1OYJ A;  2KP2 A;  1Y25 A;  7GSS A;  1OE8 A;  4N0Z A;  2I1U A;  3HHV A;  1X9W B;  1DSB A;  3C71 A;  1J9B A;  1K0D A;  1M9B A;  2L4Q A;  3QMX A;  3KH7 A;  2HRA A;  3IV4 A;  2HSY A;  3UEM A;  2MZC A;  5HFI A;  2LJK A;  2QSI A;  4NV5 A;  3EWL A;  2B5E A;  2V41 A;  1THO A;  1YEX A;  5F07 A;  4ZL8 A;  1A8L A;  1BED A;  3E0U A;  1V57 A;  3F4T A;  3O3T A;  5IOX A;  1MDI A;  2R6K A;  3LG6 A;  2YZU A;  1AW9 A;  1JZW A;  4RI6 A;  2HRF A;  4IW9 A;  1EV9 A;  4YQU A;  1M9A A;  2H0I A;  4PX1 A;  4EUY A;  1K0O A;  4POL A;  1WJK A;  1Q4J A;  5CO3 A;  1JLW A;  1TKD B;  18GS A;  3GKX A;  4HU9 A;  1FVJ A;  6GSS A;  1PD2 1;  3A3T A;  1JHB A;  2GLR A;  2RLI A;  4V2M A;  1VRS D;  4I5Q A;  1TRU A;  5ECS A;  1THX A;  2HYX A;  2C0E A;  5ELG A;  1HNC A;  3A2X A;  4CY6 A;  1SJ6 A;  1TRV A;  2YJ7 A;  2MBS A;  2H1B A;  1A2J A;  2C0G A;  1V40 A;  4POK A;  5G1K A;  4IVF A;  1EWX A;  1TRS A;  1T3B A;  2PN8 A;  2FY6 A;  1MD3 A;  3C1S A;  5A4V A;  2H74 A;  3WGX A;  1B8X A;  5HFG A;  3RPN A;  1GWC A;  5EPF A;  4J2F A;  3I9V 2;  2IME A;  2GST A;  1AQW A;  3FR9 A;  3QR6 A;  2OE3 A;  2CVD A;  5EY6 A;  4TR3 A;  4YAV A;  4HJ2 A;  3FZ5 A;  3FY7 A;  5B6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...