1OAZA

Ige fv spe7 complexed with a recombinant thioredoxin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
122
structure length
115
Chain Sequence
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPIEESDDRRYDLVGPCKMIAPILDEILTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords THIOREDOXIN 1
publication title Antibody Multispecificity Mediated by Conformational Diversity
pubmed doi rcsb
source organism Escherichia coli
total genus 12
structure length 115
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1oazA00
3TJJA 1T8EB 4TR0A 1ZYEA 2EIOA 5KN2A 3HYPA 1EOGA 2OE3A 2A4VA 3M9JA 4PQ1A 3A2VA 2DJJA 4O92A 1EP8A 3TKSA 4ZL7A 2H1BA 4GCIA 1NM3A 1MD3A 3DGQA 1QUWA 3TUEA 2LS5A 1G7EA 1K3YA 3HA9A 4K9ZA 5F07A 2LJAA 9GSSA 2QGVA 2WJUA 2O7KA 2CT6A 2VCWA 3CSHA 4IP6A 3P90A 3KH9A 1ERTA 1KTEA 2B7KA 1JZRA 4QQ7A 2CZ3A 4WF4A 3FHKA 4E8EA 1VF2A 1GTBA 1XWAA 1OC8A 2H72A 2VCXA 2H8LA 3ED3A 3VK9A 2GSSA 2TRXA 4IQ1A 4MPFA 3FYGA 3RAZA 3NZNA 4P3YB 2J23A 1GSSA 1M2AA 4LL1B 5DQSA 3KTLA 2IFQA 3HJMA 2PPTA 4HEA2 4O32A 2CX4A 1SK2A 4PQHA 2X8CA 2LEGA 1URMA 4RQRA 3CBUA 3TKSC 4HZ4A 1V58A 2J9HA 5JWOB 3GKKA 4XS1A 3HCZA 3D21A 2MZCA 4MMMA 1R5AA 3UARA 5F06A 1XW9A 2GLRA 2FA8A 3F6FA 1WIKA 4KDYA 3SWLA 2B5EA 1BJXA 3FRCA 1EV9A 4JU5A 4WKWA 3CMIA 3ZRDA 3GRXA 5IPHA 1F2EA 2JSZA 2REMA 2V32A 2C0DA 1RQMA 4GXZA 2FGXA 1SL2B 4F9ZA 5A4UA 1MD4A 2VD0A 2GSTA 5B8AA 2GGTA 3DIEA 5A4WA 3WD6A 1THXA 4IW9A 2MBSA 1GSFA 2C8UA 2P5QA 4HU9A 1BG5A 3ISOA 1ZL9A 2JZSA 3BJ5A 2HSYA 4HUAA 1XZOA 4N11A 1HNBA 1X5CA 4TN8A 5GSTA 2CVDA 4F2IA 4XS4A 2VAFA 3ZZXA 2D2ZA 1FB0A 1XWBA 2DJ3A 1VRSD 2H1DA 3F8UA 4ECJA 1Y25A 2JADA 2EIQA 2WZ9A 1U88A 1GSYA 5DCHA 3MDKA 1OE8A 5ECKB 4V2NA 2LKUA 2VL2A 1KNGA 3O6TA 3LEFA 5IO2A 3TDGA 5J9CA 4IJIA 3VPQA 3TJGA 2H01A 2HRNA 4YH2A 1CQHA 2OJLA 1XOBA 2L59A 4NWYA 1EEJA 1WMJA 2A2SA 4JR4A 4I5QA 2N5AA 2OA7A 5KN0A 2Z9SA 3ZIJA 3IAM2 1FOVA 2X99A 5AISA 1Z3EA 3ERFA 2HRFA 5AIVA 4KNDA 2B5YA 5DALB 4WXTA 1TDIA 3BCKA 3GYKA 4HQZA 1XCCA 4TR1B 2HFDA 3EC3A 3H79A 5IMCA 4PNGA 4IJ3A 2WRTA 4POBA 4MF5A 1SK0A 4ISDA 2AHEA 5J4UA 2C3QA 4IQAA 1FO5A 3ZITA 2F3MA 2YZHA 1A2MA 3F9UA 2ZNMA 3WT2A 1V2AA 2VL2C 4TKYA 4XRAA 4RI6A 4OCEA 2GS3A 2B1KA 4Q5RA 11GSA 1LU4A 1SJ6A 4ZL8A 2CAQA 1MDKA 3HJPA 3IHQA 2OADA 3UJ1A 1OYJA 5D73A 3WGXA 4J56E 3ZYWA 4KUNA 1N2AA 4KCEA 5IMVA 2H0IA 3H4KA 3HY2A 3KM6A 5AN1A 1GTAA 1EGRA 2DJ2A 1JZWA 1K0MA 1FB6A 2ON5A 1XWGA 3HDCA 2HSHA 5KN1A 5CRDA 5LCZA 1X9WB 2NDOA 1F9MA 4MJBA 2R3XA 1X9SB 3EINA 3LGCA 3FR6A 1GNWA 3D4MA 2VLTA 2RLIA 2GQMA 2FWEA 3IAS2 1T3BA 1GWCA 1TTZA 2AB6A 3IPZA 2HXKA 3CYNA 4XS6A 3PINA 2F9SA 5G5EA 5CRGA 1A2JA 2VUPA 2VIMA 4DSRA 1T4ZA 4MH3A 4IP1A 2FLSA 3KXOA 1SKWB 2K6VA 1PL2A 4EC0A 1EEMA 3J7Yb 3F6DA 4RI7A 1Y6EA 1S3AA 3EVIA 5G30A 5DAKB 1U3IA 3LSZA 1NSWA 4LMWA 2O8VB 4N0ZA 4WEYA 4IKHA 3G7YA 3O3TA 1TRWA 1AAZA 4K0NA 1JLVA 5D8IA 2O87A 4HJMA 3F4RA 1O8XA 3FEUA 3DWVA 3A2XA 2YWMA 5D9WA 5ELAA 2L6DA 5ECSA 2RUEA 4BVXA 4DSSB 2ALBA 3WYWA 4JBBA 1YF0A 2DJ1A 2NVLA 1NW2A 3EWLA 2E2MA 5F8BA 1M2DA 2IMFA 1X5EA 4XRDA 2ES7A 1GUMA 1GTIA 5IOWA 4ML1A 3M8NA 4EDZA 4BPYA 3IC4A 4ECIA 3GFKA 4X0XA 2GVPA 2VM1A 2OKAA 1GL8A 1PRXA 1CQGA 1ZMAA 2OE0A 4AJ6A 1UA5A 4PQIA 1B9XC 3P2AA 2IPAA 1UVZA 3IDVA 3I69A 4L5LA 4BVYA 4CW9A 3M9KA 1EV4A 1USBA 5ID2A 5JWRB 5DBQA 1Z7RA 2CX3A 1GSQA 2K8SA 2VL3A 3LQ7A 3RPPA 2H71A 1GUKA 2F51A 2B1LA 3I43A 1PX6A 4KW6A 3KMNA 4D73B 3A5WA 1PD21 5EPFA 3VI7A 3IR4A 3FW2A 4O7HA 1IYHA 1WE0A 2I81A 1OKTA 5ELGA 1DUGA 4FO5A 3HKRA 1TRSA 3LYKA 4AJ7A 4BL7A 2FUG2 1MDJA 5ECIB 1F37A 1BX9A 5G2ZA 2GDRA 4IBPA 2LRNA 4GQCA 3O76A 2QKEA 4TXOA 1AXDA 3VFIA 8GSSA 2C0GA 2GSQA 1FAAA 6GSTA 1O85A 3DXBA 3NOFA 1PMTA 3FK8A 2AJQB 4WBRD 4I97A 2LJRA 4PX1A 3D5JA 3APSA 1AIUA 5IMAA 1G6WA 3KMOA 6GSUA 3UL3A 1A0FA 2H1AA 4G2EA 1VF3A 3KZQA 4IGJA 4PURA 1BQ7A 4FYCA 2H6YA 4ZBAA 2YWIA 4YQUA 1R4WA 1TW9A 1M99A 3GMFA 1NHOA 3IRAA 5CRHA 3C1SA 1ERVA 1DE2A 3KTBA 4K8MA 1GSUA 2MBTA 1B8XA 4NV5A 3C71A 2KUCA 3HVSA 2IMDA 1K0CA 3GHAA 5EL8A 1K0AA 3MNGA 4HDEA 4KAEA 1V40A 1OC9B 1FHEA 2LNTA 2VCVA 5DVBA 5D9VA 3IOSA 4OWYA 4JE1A 2YZUA 5H5SA 4HI7A 3GURA 1Q4JA 1C72A 5J41A 2R6KA 4POKA 3ME8A 2PERA 3WGEA 2NPBA 2E0QA 5HR3A 3F4TA 4PNFA 2GQLA 4PUAA 3BOAA 2LNSA 4KH7A 1E2YA 4Z7XA 2I1UA 4ACSA 1J0FA 2MMZA 3QPMA 1YZXA 14GSA 1QQ2A 1ACVA 2KLXA 1O8WA 3DEXA 1WPIA 2VLVA 3P7XA 2M72A 3CTFA 1A23A 3FKFA 3UMAA 1SL1B 1FVJA 4TR3A 4EKZA 3LXTA 2FY6A 2HLSA 2VL9A 5J3RA 1A8YA 4LLRA 1WP0A 2I4AA 2WGRA 1Z6MA 5D9XA 2FWGA 2PU9C 3KEBA 5GZZB 3LYPA 3G7JA 5KN3A 5CP1A 1O6JA 2YN1A 3AY8A 4EDYA 3GX8A 4ZB6A 3VPTA 3M3MA 3PGTA 1O73A 2FD3A 4GQFA 3IXRA 2FNOA 1YEPA 3UVHA 4ULXA 2V2GA 2WDUA 4N30A 3BD2A 4CDOA 2LQQA 1THOA 4WF5A 3L4NA 2CZ2A 4G19A 4NV2A 1YDKA 3MSZA 3UBLA 5JCGA 1HNCA 1V9WA 1YJ6A 1SJIA 1ST9A 1MTCA 4NPBA 1GP1A 2YNXA 3KIJA 1X5DA 4I2TA 3ZREA 1ZGNA 1R7HA 2OBIA 4EO3A 1TU8A 4L0UA 4ZXGA 2RUFA 2XHFA 3L9SA 5HQPA 3G9BA 5FHIA 2PUKC 2PMTA 2IMKA 1N8JA 2IL3A 3GTUB 2CA8A 3K8NA 3WGDA 4XTSA 2IWTA 2LSTA 1ERUA 2HZEB 5EVOA 3GKNA 4K2DA 13GSA 1ERWA 4NHWA 3Q19A 4OO5A 2YOIA 3EMPA 1YKAA 1PQNA 1GULA 3M0FA 2NBSA 1T00A 2XBIA 5HR2A 3J7Yk 3VWUA 4K7OA 4TXVA 5IIZA 4X43A 5DJLA 1K0BA 4YAPA 4F82A 1T7PB 4HQSA 5G31A 2FWFA 4FIWA 2L6CA 4PXOA 2PWJA 2C0EA 4TRXA 1B9YC 1B48A 2L5OA 4MP4A 5IQYA 5JWQB 3GIXA 3GH9A 3RHBA 4KB3A 2FWHA 2GZZA 2IN3A 4GF0A 3ZTLA 5G1LA 3MAKA 1XPVA 1J9BA 2IJYA 4MF7A 3UBKA 4MK3A 4L8EA 4Q5QA 4Q5NA 3TKQA 5HFIA 3W6GA 2H74A 3LXZA 2VCQA 3CRTA 3LORA 2I3YA 4TR1A 3ME7A 2LJKA 5G5FA 4QL9A 1Q98A 3SBCA 2JZTA 3ZFBA 5B8BA 1OC3A 1TI3A 3HXSA 1OKDA 4K6XA 5DQYA 2K8VA 1PKZA 3TKSE 4KE3A 3ZMLA 2VCZA 4X1UA 3UIWA 4GLTA 3C7MA 2YV9A 2FA4A 3CTGA 1GTUA 3GKXA 4V1Ap 2PVOC 3RHCA 3H1NA 2PN8A 3FZ9A 4OFMA 2MMAA 4KGIA 1BEDA 1ML6A 4ID0A 4AGSA 1QFNA 2DMMA 4GRFA 6GSYA 2DIZA 3QFAC 2C3NA 4H86A 4ECCA 4GSSA 3F3QA 3DKSA 6GSXA 1TU7A 1GSDA 2IIYA 3TJKA 4KX4A 1GUHA 1XOAA 5HR1A 2FHEA 2C4JA 3WT1A 4POLA 1TKDB 1UC7A 4NMUA 3U5RE 1ZYQB 1TK8B 4ILFA 1A2LA 3ZVJA 3TJBA 1KEBA 18GSA 2IMEA 5IMDA 3DMLA 2DBCA 1EZKA 1HD2A 1GLQA 1I5GA 3EURA 2XPEA 2KP1A 1HQOA 1W89A 2YV7A 5IOXA 5INYA 3LFLA 3GA4A 1O81A 1R26A 1ZOFA 2LV3A 3QCPA 1TRUA 3GUSA 3US3A 3Q74A 2H75A 10GSA 3L0HA 3KGKA 3FZ4A 4JR6A 1TK5B 4ZBDA 1GSEA 3QAGA 3IA1A 2EIRA 1XVQA 1QMVA 5DAKA 5ECLB 1MDIA 3UEMA 2VCTA 2JU5A 2L4QA 1SYXA 3A2WA 2GQKA 1WJKA 3GN3A 2R4VA 1SL0B 1E6BA 2A2RA 1XWKA 2DLXA 4KSMA 4POMA 3HHVA 4JRRA 4MJEA 1IYIA 1ON4A 1K0DA 4BWQA 4DSQA 1A0RP 3N9JA 4DVCA 4DSSA 1UN2A 1VF1A 3CRUA 1EGOA 1NHYA 1JLWA 1ABAA 2VOCA 1U6TA 5ENUA 3QAVA 2I9HA 5F0GA 4KCAA 5IO0A 4EL1A 2PVQA 1EWXA 1XW5A 1OVNA 2HZFA 1X9MB 1WOUA 2GSRA 3FZ5A 2DMLA 1U87A 2HNLA 2L57A 3EYTA 4L5OA 3PH9A 3GV1A 1TI1A 1DBYA 2KHPA 5IM9A 2F8FA 5B6MA 3GL3A 5CNWA 4LL4B 5L71A 1AQXA 1SYRA 4OCFA 2C1YA 5ECRB 3A3TA 1SK1A 3ERWA 4OFTA 3APQA 1QK8A 3CSJA 2N5BA 3GX0A 3U6VA 3FR9A 5A4VA 5F05A 3ZVJD 5H5RA 4HS1A 2H19A 3M1GA 3TJFA 2BJXA 3G7IA 4JZQA 3TRXA 1M2BA 2WS2A 1V98A 3JCML 2VO4A 4O5RA 5DCGA 2VM2A 2JL4A 3EMXA 1EP7A 4GTUA 5COHA 3UVTA 5J5NA 4WR4A 4BWSA 3C1RA 3IBHA 4N10A 7GSSA 4HZ2A 3NIVA 3QMXA 1PSQA 2JSYA 4ZILA 3ZLPA 3P8WA 2LQOA 2VLUA 2DC5A 2YWNA 4F0CA 1M0UA 2JZRA 2MMOA 2QC7A 3Q18A 5LD0A 16GSA 4NXIA 1TRVA 2ZUPA 2H66A 3KJYA 3H8QA 2LTKA 2H73A 2IFQB 2L4CA 3RBTA 2P0GA 3EU4A 1HYUA 1QGVA 2GT6A 4V1Ag 1XWCA 1TXXA 2BMXA 5C00A 2K9FA 2NTOA 1LBKA 4MJAA 3GH6A 1W4VA 4TW5A 3KCMA 2XPDA 3F0IA 5HFGA 4EVMA 4K7NA 4YQMA 5ECHB 5E59A 2YANA 3N5OA 2AYTA 3W8SA 2AV4A 4PUFC 1YF1A 4AF2A 4F03A 1FVKA 3W8JA 4QL7A 3QD9A 3HVXA 4K0GA 3VI5A 5DJMA 2OE1A 3RDWA 3D22A 2GTUA 2PGTA 1OC9A 3QAWA 4KSOA 1AQVA 4PGTA 3HD5A 1FW1A 1PL1A 1PGTA 2X8GA 3GL5A 2RIIA 5GSSA 1V57A 3F3RA 1FG4A 2V1MA 1PX7A 4MPGA 1LJRA 3VLNA 3Q6OA 4NAXA 1TJDA 3R2QA 4XS4B 1Z7PA 4OMVA 1PA3A 1XIYA 4ZL9A 1OAZA 1B4PA 3E3EA 2MYGA 4OD7A 5DDLA 1VGLA 2R37A 4I8BA 5B7CA 1KBNA 1F3BA 3HZ8A 4ML6A 1RK4A 5GAPD 3HZ4A 1AC1A 5ECMB 4LMVA 3DRNA 4L0WA 1K0NA 2CVKA 1XVWA 3LWAA 2M80A 1U3AA 3UAPA 3DVXA 3DYRA 2WULA 4V2MA 4GSTA 2B3SA 4MF6A 2CAIA 2YPMA 1SD9A 1TP9A 3GNJA 1GNEA 2X64A 5KEJA 1K3LA 4FYUA 4I2UA 1EOHA 3QR6A 1S3DA 2R5GA 2H76A 3LJRA 2RM6A 3GSSA 4JEDA 4HU7A 3HVVA 4IHUA 2CQ9A 4TVEA 4J57E 5CRWA 4YQVA 2O85A 2JACA 5IMZA 3BBYA 4K1FA 1DE1A 2LUSA 4MH2A 2LRCA 4N0VA 1F6MC 2TIRA 3TKRA 4RUVA 2MMNA 4MDCA 5A5KA 1GRXA 2GZPA 4CHSA 5CYYA 2HI7A 2M46A 1OE7A 1Z9HA 4HOJA 3TGZA 2ZCTA 2C80A 5CAXA 4EUYA 2YJ7A 3L9VA 3I6AA 5ECOB 1M9AA 3IV4A 3TOTA 4F0BA 2OACA 4E8HA 2E7PA 20GSA 4IELA 5ABRA 2WFCA 4KDUA 4BA7A 1A8LA 1SKSB 2F8AA 2YJHA 4AJ8A 6GSSA 1Z6NA 2O89A 4YAVA 5D9TA 3F63A 1I9DA 1AUCA 5E4WA 2N5FA 2C3TA 3F4SA 4I6XA 3QFBC 3GTUA 1YY7A 2V6KA 5DALA 3TB2A 4OO4A 5GAND 2HZEA 3ZL5A 3ZMKA 1AW9A 4IS0A 4XHMA 4MJCA 4G10A 3QDNA 1RW1A 5EY6A 3UOMA 12GSA 1GH2A 1M7TA 3DD3A 2G0FA 2E2GA 3DVWA 3OR5A 1X0RA 2OBKA 4MA9A 2B5XA 2H6XA 2VD1A 1ZZYA 2HE3A 1MEKA 1SKRB 2HYXA 2KP2A 3TCOA 3ZFLA 3S9FA 2DSAA 1TK0B 1AQWA 3C8EA 1B4QA 3CSIA 3EE2A 4WBJA 2XC2A 3HJOA 2B6MA 2H0HA 4ZB8A 1T4YA 1SENA 1G0TA 3EU3A 2B7JA 3IE3A 3D6IA 1SU9A 4FH8A 4TOPA 5ECPB 1O7UA 3BCIA 3C73A 4ZBBA 4MZBA 2ON7A 3E9JB 5IPGA 2H1GA 2DJKA 4EF0A 1GLPA 5CO3A 4GWRA 1R5PA 2V6OA 1YKCA 1DSBA 3FR3A 4XCSA 2H6ZA 2BTOT 1SJZA 5B6NA 1XBSA 3MWHA 2P5RA 5H5QA 3L78A 2CVBA 2FCHA 4FYBA 3E0UA 1WRYA 5JCWA 3CXGA 4OFNA 2V41A 3TKPA 2G2QA 3PR8A 4ZB9A 5FWGA 17GSA 6GSVA 3ERGA 4GSNA 2HT9A 2YWOA 5ID2B 3RPNA 1QXHA 2YCDA 2R2JA 19GSA 4Q5FA 2IMIA 3VWVA 3GSTA 2DJ0A 4IN0A 4RQXA 1G7OA 2XBQA 3GKMA 5LNKe 5J9BA 3QOUA 4K7IA 4KA0A 6GSWA 5G1KA 3V1WA 1XXUA 1S3CA 4WETA 1WWJA 1SD8A 1HNAA 5ECQB 4J2FA 2K18A 3FZAA 1T1VA 5AIXA 5CREA 2L5LA 3KP8A 2WB9A 4G9HA 5FT3A 4IVFA 1K0OA 1H4OA 2CV4A 1BAYA 2H30A 2H0GA 1A24A 3D0ZA 5JCUA 2AUVA 3H93A 3LG6A 1K3OA 4TXOB 5ECNB 3IK7A 4MABA 1JFUA 4DEJA 3I9V2 1ZCPA 1Z5YE 1JHBA 3KD0A 2PBJA 3APOA 1PKWA 1YQ1A 5HR0A 1G6YA 1XW6A 5D93A 2GT5A 2KOKA 3D4TA 3KH7A 1PN9A 4HJ2A 3VWWA 4MCUA 4WR5A 1YEXA 3TRPA 4EXJA 5AGYA 4KDXA 3VURA 1BYEA 4MZCA 2C0FA 1F3AA 2WCIA 2GZYA 2RM5A 2X8HA 2EC4A 1H75A 1J08A 2LRTA 5HFKA 4ECBA 3L9UA 1JZDA 1M9BA 22GSA 5C04A 4TR4A 3FY7A 1XFLA 3VWXA 4XIHA 4ZIJA 3IK9A 4V2LA 1JZOA 4NHZA 1ILOA 2AAWA 5IMFA 4D73A 4MZWA 2YP6A 2DIYA 4MLYA 2QSIA 2H70A 1TOFA 4LA1A 1VF4A 5D96A 3TRQA 3TOUA 2TRCP 3ZIVA 4EE0A 3KP9A 2P31A
chains in the Genus database with same CATH superfamily
3TJJA 1T8EB 4TR0A 1ZYEA 2EIOA 5KN2A 3HYPA 1EOGA 2OE3A 2A4VA 3M9JA 4PQ1A 3A2VA 2DJJA 4O92A 1EP8A 3TKSA 4ZL7A 2H1BA 4GCIA 1NM3A 1MD3A 3DGQA 1QUWA 3TUEA 2LS5A 1G7EA 1K3YA 3HA9A 4K9ZA 5F07A 2LJAA 9GSSA 2QGVA 2WJUA 2O7KA 2CT6A 2VCWA 3CSHA 4IP6A 3P90A 3KH9A 1ERTA 1KTEA 2B7KA 4G0IA 1JZRA 4QQ7A 2CZ3A 4WF4A 3FHKA 4E8EA 1VF2A 1GTBA 1XWAA 1OC8A 2H72A 2VCXA 2H8LA 3ED3A 3VK9A 2GSSA 2TRXA 4IQ1A 4MPFA 3FYGA 3RAZA 4PTSA 3NZNA 4P3YB 2J23A 1GSSA 1M2AA 4LL1B 5DQSA 3KTLA 2IFQA 3HJMA 2PPTA 4HEA2 4O32A 2CX4A 2DKHA 1SK2A 4PQHA 2X8CA 2LEGA 1URMA 4RQRA 2HRKA 3CBUA 3TKSC 4HZ4A 1V58A 2J9HA 5JWOB 3GKKA 4XS1A 3HCZA 3D21A 2MZCA 4MMMA 1R5AA 3UARA 5F06A 1XW9A 2GLRA 2FA8A 3F6FA 1WIKA 4KDYA 3SWLA 2B5EA 1BJXA 3FRCA 1EV9A 4JU5A 4WKWA 3CMIA 3ZRDA 3GRXA 3A5IA 5IPHA 1F2EA 2JSZA 2REMA 2V32A 2C0DA 1RQMA 4GXZA 2FGXA 1SL2B 4F9ZA 5A4UA 1MD4A 2VD0A 2GSTA 5B8AA 2GGTA 3DIEA 5A4WA 3WD6A 1THXA 4IW9A 2MBSA 1GSFA 2C8UA 2P5QA 4HU9A 1BG5A 3ISOA 1ZL9A 2JZSA 3BJ5A 2A2PA 2HSYA 4HUAA 1XZOA 4N11A 1HNBA 1X5CA 4TN8A 5GSTA 2CVDA 4F2IA 4XS4A 2VAFA 3ZZXA 4K5SA 2D2ZA 1FB0A 1XWBA 2DJ3A 1VRSD 2H1DA 3F8UA 4EIQA 4ECJA 1Y25A 2JADA 2EIQA 2WZ9A 1U88A 4Z2UA 1GSYA 5DCHA 3MDKA 1OE8A 5ECKB 4V2NA 2LKUA 2VL2A 1KNGA 3O6TA 3LEFA 5IO2A 3TDGA 5J9CA 2QA2A 4IJIA 3VPQA 3TJGA 2H01A 2HRNA 4YH2A 1CQHA 2OJLA 1XOBA 2L59A 4NWYA 1EEJA 1WMJA 2A2SA 4JR4A 4I5QA 2N5AA 2OA7A 5KN0A 2Z9SA 3ZIJA 3IAM2 1FOVA 4K5RA 2X99A 5AISA 1Z3EA 3ERFA 2HRFA 5AIVA 4KNDA 2B5YA 5DALB 4WXTA 1TDIA 3BCKA 3GYKA 4HQZA 1XCCA 4TR1B 2HFDA 3EC3A 3H79A 5IMCA 4PNGA 4IJ3A 2WRTA 4POBA 4MF5A 1SK0A 4ISDA 2AHEA 4MNNA 5J4UA 2C3QA 2X49A 4IQAA 1FO5A 3ZITA 2F3MA 2YZHA 1A2MA 3F9UA 2ZNMA 3WT2A 1V2AA 2VL2C 4TKYA 4XRAA 4RI6A 4OCEA 2GS3A 2B1KA 4Q5RA 11GSA 1LU4A 1SJ6A 4ZL8A 2CAQA 1MDKA 3HJPA 3IHQA 2OADA 3UJ1A 1OYJA 5D73A 3WGXA 4J56E 3ZYWA 4KUNA 1N2AA 4KCEA 5IMVA 2H0IA 3H4KA 3HY2A 3KM6A 5AN1A 1GTAA 1EGRA 1M3IA 2DJ2A 1JZWA 1K0MA 1FB6A 2ON5A 1XWGA 3HDCA 2HSHA 5KN1A 5CRDA 5LCZA 1X9WB 2NDOA 1F9MA 2R0PA 4MJBA 2R3XA 1X9SB 3EINA 3LGCA 3FR6A 1GNWA 3D4MA 2VLTA 2RLIA 2GQMA 2FWEA 3IAS2 1T3BA 1GWCA 1TTZA 2AB6A 3IPZA 2HXKA 3CYNA 4XS6A 3PINA 2F9SA 5G5EA 5CRGA 1A2JA 2VUPA 2VIMA 4DSRA 1T4ZA 4MH3A 4IP1A 2FLSA 3KXOA 1SKWB 2K6VA 2R0GA 1PL2A 4EC0A 1EEMA 3J7Yb 3F6DA 3CQFA 4RI7A 1Y6EA 1S3AA 3EVIA 5G30A 5DAKB 4YKGA 1U3IA 3LSZA 1NSWA 4LMWA 1FOHA 2UZ8A 2O8VB 4N0ZA 4WEYA 4IKHA 3G7YA 3O3TA 1TRWA 1AAZA 4K0NA 1JLVA 5D8IA 2O87A 4HJMA 3F4RA 1O8XA 3FEUA 3DWVA 3A2XA 2YWMA 5D9WA 5ELAA 2L6DA 5ECSA 2RUEA 4BVXA 4DSSB 2ALBA 3WYWA 4JBBA 1YF0A 2DJ1A 2NVLA 1NW2A 3EWLA 2E2MA 5F8BA 1M2DA 2IMFA 1X5EA 4XRDA 2ES7A 1GUMA 1GTIA 5IOWA 4ML1A 3M8NA 4EDZA 4BPYA 3IC4A 4ECIA 3GFKA 4X0XA 2GVPA 2VM1A 2OKAA 1GL8A 1PRXA 1CQGA 1ZMAA 2OE0A 4AJ6A 1UA5A 4PQIA 1B9XC 3P2AA 2IPAA 1UVZA 3IDVA 3I69A 4L5LA 4BVYA 4CW9A 3M9KA 1EV4A 1USBA 5ID2A 5JWRB 5DBQA 1Z7RA 2CX3A 1GSQA 2K8SA 2VL3A 3LQ7A 3RPPA 2HRAA 2H71A 1GUKA 2F51A 2B1LA 3I43A 1PX6A 4KW6A 3KMNA 4D73B 3A5WA 1PD21 5EPFA 3VI7A 3IR4A 3FW2A 4O7HA 1IYHA 1WE0A 2I81A 1OKTA 5ELGA 1DUGA 4FO5A 3HKRA 1TRSA 3LYKA 4AJ7A 4BL7A 2FUG2 1MDJA 5ECIB 1F37A 1BX9A 5G2ZA 2GDRA 4IBPA 2LRNA 4G0LA 4GQCA 3O76A 2QKEA 4TXOA 1AXDA 3VFIA 8GSSA 2C0GA 2GSQA 1FAAA 6GSTA 1O85A 3DXBA 3NOFA 1PMTA 3FK8A 2AJQB 4WBRD 4I97A 2LJRA 4PX1A 3D5JA 3APSA 1AIUA 5IMAA 1G6WA 3KMOA 6GSUA 3UL3A 1A0FA 2H1AA 4G2EA 1VF3A 3KZQA 4IGJA 4PURA 1BQ7A 3HVNA 4FYCA 2H6YA 4ZBAA 2YWIA 4YQUA 1R4WA 1TW9A 1M99A 3GMFA 1NHOA 3IRAA 5CRHA 3C1SA 1ERVA 1DE2A 3KTBA 5KOWA 4K8MA 1GSUA 4ICYA 2MBTA 1B8XA 4NV5A 3C71A 2KUCA 3HVSA 2IMDA 1K0CA 3GHAA 5EL8A 1K0AA 3MNGA 4HDEA 4KAEA 1V40A 1OC9B 1FHEA 2LNTA 2VCVA 5DVBA 5D9VA 3IOSA 4OWYA 4JE1A 2YZUA 5H5SA 4HI7A 3GURA 1Q4JA 3IC8A 1C72A 5J41A 2R6KA 4POKA 3ME8A 2PERA 3WGEA 2NPBA 2E0QA 5HR3A 3F4TA 4PNFA 2GQLA 4PUAA 3BOAA 2LNSA 4KH7A 1E2YA 4Z7XA 4YKFA 2I1UA 4ACSA 1J0FA 2MMZA 3QPMA 1YZXA 14GSA 1QQ2A 1ACVA 2KLXA 1O8WA 3DEXA 1WPIA 2VLVA 3P7XA 2M72A 3CTFA 1A23A 3FKFA 3UMAA 1SL1B 1FVJA 4TR3A 4EKZA 3LXTA 2FY6A 2HLSA 2VL9A 5J3RA 1A8YA 4LLRA 1WP0A 2I4AA 2WGRA 1Z6MA 5D9XA 4Z2RA 2FWGA 2PU9C 3KEBA 5GZZB 3LYPA 3G7JA 5KN3A 4G0KA 5CP1A 2A4HA 1O6JA 2YN1A 3AY8A 4EDYA 3GX8A 4ZB6A 3VPTA 3M3MA 3PGTA 1O73A 2FD3A 4GQFA 3IXRA 2FNOA 1YEPA 3UVHA 4ULXA 2V2GA 2WDUA 4N30A 3BD2A 4CDOA 2LQQA 1THOA 4WF5A 3L4NA 2CZ2A 4G19A 4NV2A 1YDKA 3MSZA 3UBLA 5JCGA 1HNCA 1V9WA 1YJ6A 1SJIA 1ST9A 1MTCA 4NPBA 4X4JA 1GP1A 2YNXA 3KIJA 1X5DA 4I2TA 3ZREA 1ZGNA 1R7HA 2OBIA 3FMWA 4EO3A 1TU8A 4L0UA 4USSA 4ZXGA 2RUFA 2XHFA 3L9SA 5HQPA 3G9BA 5FHIA 2PUKC 2PMTA 4A5PA 4CY8A 2IMKA 1N8JA 2IL3A 3GTUB 2CA8A 3K8NA 3WGDA 4XTSA 2IWTA 2LSTA 1ERUA 2HZEB 5EVOA 3GKNA 4K2DA 13GSA 1ERWA 4NHWA 3Q19A 4OO5A 2YOIA 3EMPA 1YKAA 1PQNA 1GULA 3M0FA 2NBSA 1T00A 2XBIA 5HR2A 3J7Yk 3VWUA 4K7OA 4Z2TA 4TXVA 5IIZA 4X43A 5DJLA 1K0BA 4YAPA 4F82A 1T7PB 4HQSA 5G31A 2FWFA 4FIWA 2L6CA 4PXOA 2PWJA 2C0EA 4TRXA 1B9YC 1B48A 2L5OA 4MP4A 5IQYA 5JWQB 3GIXA 3GH9A 3RHBA 4KB3A 2FWHA 2GZZA 2IN3A 4GF0A 3ZTLA 5G1LA 3MAKA 1XPVA 1J9BA 2IJYA 4MF7A 3UBKA 4MK3A 4L8EA 4Q5QA 4Q5NA 3TKQA 5HFIA 5KOXA 3W6GA 2H74A 3LXZA 2VCQA 3CRTA 3LORA 2I3YA 4TR1A 3ME7A 2LJKA 5G5FA 4QL9A 1Q98A 3MYDA 3SBCA 2JZTA 3ZFBA 5B8BA 1OC3A 1TI3A 3HXSA 1OKDA 4K6XA 5DQYA 2K8VA 1PKZA 4BIKA 3TKSE 4KE3A 3ZMLA 2VCZA 4X1UA 3UIWA 4GLTA 3C7MA 2YV9A 2FA4A 3CTGA 1GTUA 3GKXA 4V1Ap 2PVOC 3RHCA 3H1NA 2PN8A 3FZ9A 4OFMA 2MMAA 4KGIA 1BEDA 1ML6A 4ID0A 4AGSA 1QFNA 2DMMA 4GRFA 6GSYA 2DIZA 3QFAC 2C3NA 4H86A 4ECCA 4GSSA 3F3QA 3DKSA 6GSXA 1TU7A 1GSDA 2IIYA 3TJKA 4KX4A 1GUHA 1XOAA 5HR1A 2FHEA 2C4JA 3WT1A 4POLA 1TKDB 1UC7A 4NMUA 3U5RE 1ZYQB 1TK8B 4ILFA 1A2LA 3ZVJA 3TJBA 1KEBA 18GSA 2IMEA 5IMDA 3DMLA 2DBCA 1EZKA 1HD2A 1GLQA 1I5GA 3EURA 2XPEA 2KP1A 1HQOA 1W89A 2YV7A 5IOXA 5INYA 3LFLA 3GA4A 1O81A 1R26A 3PPUA 1ZOFA 2LV3A 3QCPA 1TRUA 3GUSA 3US3A 3Q74A 2H75A 10GSA 3EPTA 3L0HA 3KGKA 3FZ4A 4JR6A 1TK5B 4KF9A 4ZBDA 1GSEA 3QAGA 3IA1A 2EIRA 1XVQA 1QMVA 5DAKA 5ECLB 1MDIA 3UEMA 2VCTA 2JU5A 1PFOA 2L4QA 1SYXA 3A2WA 2GQKA 1WJKA 3GN3A 2R4VA 1SL0B 1E6BA 2A2RA 1XWKA 4KSMA 2DLXA 4POMA 3HHVA 4JRRA 4MJEA 1IYIA 1ON4A 1K0DA 4BWQA 4DSQA 1A0RP 3N9JA 4DVCA 4DSSA 1UN2A 1VF1A 3CRUA 1EGOA 1NHYA 1JLWA 1ABAA 2VOCA 1U6TA 5ENUA 3QAVA 2I9HA 5F0GA 4KCAA 5IO0A 4EL1A 2PVQA 1EWXA 1XW5A 1OVNA 2HZFA 1X9MB 2R0CA 1WOUA 2GSRA 3FZ5A 2DMLA 1U87A 2HNLA 2L57A 3EYTA 4L5OA 3PH9A 3GV1A 1TI1A 1DBYA 2KHPA 5IM9A 2F8FA 5B6MA 3GL3A 5CNWA 4LL4B 5L71A 1AQXA 1SYRA 4OCFA 3R3EA 2C1YA 5ECRB 3A3TA 1SK1A 3ERWA 4OFTA 3APQA 1QK8A 3CSJA 2N5BA 3GX0A 3U6VA 3FR9A 5A4VA 5F05A 3ZVJD 5H5RA 4HS1A 2H19A 3M1GA 3TJFA 2BJXA 3G7IA 4JZQA 3TRXA 1M2BA 2WS2A 1V98A 3JCML 2VO4A 4O5RA 5DCGA 2VM2A 2JL4A 5COHA 3EMXA 1EP7A 4GTUA 3UVTA 5J5NA 4WR4A 4BWSA 3C1RA 3IBHA 4N10A 7GSSA 4HZ2A 1ZYPA 3NIVA 3QMXA 1PSQA 2JSYA 4ZILA 3ZLPA 3P8WA 2LQOA 2VLUA 2DC5A 2YWNA 4F0CA 1M0UA 2JZRA 2MMOA 2QC7A 3Q18A 5LD0A 4EIPA 16GSA 4NXIA 1TRVA 2ZUPA 2H66A 3KJYA 3H8QA 2LTKA 2H73A 2IFQB 2L4CA 3RBTA 2P0GA 3EU4A 1HYUA 1QGVA 2GT6A 4V1Ag 1XWCA 1TXXA 2BMXA 5C00A 2K9FA 2NTOA 1LBKA 4MJAA 3GH6A 1W4VA 4TW5A 3KCMA 2XPDA 3F0IA 5HFGA 4EVMA 4K7NA 4YQMA 5ECHB 5E59A 2YANA 3N5OA 2AYTA 3W8SA 2AV4A 4PUFC 1YF1A 4AF2A 4F03A 1FVKA 3W8JA 4QL7A 3QD9A 3HVXA 4K0GA 3VI5A 5DJMA 2OE1A 3RDWA 3D22A 2GTUA 2PGTA 1OC9A 3QAWA 4KSOA 1AQVA 4PGTA 3HD5A 1FW1A 1PL1A 1PGTA 2X8GA 3GL5A 2RIIA 5GSSA 1V57A 3F3RA 1FG4A 2V1MA 1PX7A 4MPGA 1S3RA 1LJRA 3VLNA 3Q6OA 4NAXA 1TJDA 3R2QA 4XS4B 1Z7PA 4OMVA 1PA3A 1XIYA 4ZL9A 1OAZA 1B4PA 3E3EA 2MYGA 4OD7A 5DDLA 3MIXA 1VGLA 2R37A 4I8BA 5B7CA 1KBNA 1F3BA 3HZ8A 4ML6A 1RK4A 4FQUA 5GAPD 3HZ4A 1AC1A 5ECMB 4LMVA 3DRNA 4L0WA 1K0NA 2CVKA 1XVWA 3LWAA 2M80A 1U3AA 3UAPA 3DVXA 3DYRA 2WULA 4V2MA 4GSTA 2B3SA 4MF6A 2CAIA 2YPMA 1SD9A 1TP9A 3GNJA 1GNEA 2X64A 1PN0A 5KEJA 1K3LA 4FYUA 4I2UA 1EOHA 3QR6A 1S3DA 2R5GA 2H76A 3LJRA 2RM6A 3GSSA 4JEDA 4HU7A 3HVVA 4IHUA 2CQ9A 4TVEA 4J57E 5CRWA 4YQVA 2O85A 2JACA 5IMZA 3BBYA 4K1FA 1DE1A 2LUSA 4MH2A 2LRCA 4N0VA 1F6MC 2TIRA 3TKRA 4RUVA 2MMNA 4MDCA 1M3JA 5A5KA 1GRXA 2GZPA 4CHSA 5CYYA 2HI7A 2M46A 1OE7A 1Z9HA 4HOJA 3TGZA 2ZCTA 2C80A 5CAXA 4EUYA 2YJ7A 3L9VA 3I6AA 5ECOB 1M9AA 3IV4A 3TOTA 4F0BA 2OACA 4E8HA 2E7PA 20GSA 4IELA 5ABRA 2QA1A 2WFCA 4KDUA 3IHGA 4BA7A 1A8LA 1SKSB 2F8AA 2YJHA 4AJ8A 6GSSA 1Z6NA 2O89A 5BRTA 4YAVA 5D9TA 3F63A 1I9DA 1AUCA 5E4WA 2N5FA 2C3TA 3F4SA 4I6XA 2HSMA 3QFBC 3GTUA 1YY7A 2V6KA 1XG8A 5DALA 3TB2A 4OO4A 5GAND 2HZEA 3ZL5A 3ZMKA 1AW9A 4IS0A 4XHMA 4MJCA 4G10A 2DKIA 3QDNA 1RW1A 5EY6A 3UOMA 4K2XA 12GSA 1GH2A 1M7TA 3DD3A 2G0FA 2E2GA 3DVWA 3OR5A 1X0RA 2OBKA 4MA9A 2B5XA 2H6XA 2VD1A 1ZZYA 2HE3A 1MEKA 1SKRB 2HYXA 2KP2A 3TCOA 3ZFLA 3S9FA 2DSAA 1TK0B 1AQWA 3C8EA 1B4QA 3CSIA 3EE2A 4WBJA 2XC2A 3HJOA 2B6MA 2H0HA 4ZB8A 1T4YA 1SENA 1G0TA 3EU3A 2B7JA 3IE3A 3D6IA 1SU9A 4FH8A 4TOPA 5ECPB 1O7UA 3BCIA 3C73A 4ZBBA 4MZBA 4BVXB 2ON7A 3E9JB 5IPGA 2H1GA 2DJKA 4EF0A 1GLPA 5CO3A 4GWRA 1R5PA 2V6OA 1YKCA 1DSBA 3FR3A 4XCSA 2H6ZA 2BTOT 1SJZA 5B6NA 1XBSA 3MWHA 2P5RA 5H5QA 3L78A 2CVBA 2FCHA 4FYBA 3E0UA 4O5QA 1WRYA 5JCWA 3CXGA 4OFNA 2V41A 3TKPA 2G2QA 3PR8A 4ZB9A 5FWGA 17GSA 6GSVA 3ERGA 4BVYB 4GSNA 2HT9A 4CY6A 2YWOA 5ID2B 3RPNA 1QXHA 2YCDA 2R2JA 19GSA 4Q5FA 2IMIA 3VWVA 3GSTA 2DJ0A 4IN0A 4RQXA 1G7OA 2XBQA 3GKMA 5LNKe 5J9BA 3QOUA 4K7IA 4KA0A 6GSWA 5G1KA 3V1WA 1XXUA 1S3CA 4WETA 5BMUA 1WWJA 1SD8A 1HNAA 5ECQB 4J2FA 2K18A 3FZAA 1T1VA 5AIXA 5CREA 2L5LA 3KP8A 2WB9A 4G9HA 5FT3A 4IVFA 1K0OA 4BL7B 1H4OA 2CV4A 1BAYA 2H30A 2H0GA 1A24A 3D0ZA 5JCUA 2AUVA 3H93A 3LG6A 1K3OA 4TXOB 5ECNB 3IK7A 4MABA 1JFUA 4DEJA 3I9V2 1ZCPA 1Z5YE 1JHBA 3KD0A 2PBJA 3APOA 1PKWA 1YQ1A 5HR0A 1G6YA 1XW6A 5D93A 2GT5A 2KOKA 3D4TA 3KH7A 1PN9A 4HJ2A 3VWWA 4MCUA 4WR5A 1YEXA 3TRPA 4EXJA 5AGYA 4KDXA 3VURA 1BYEA 4MZCA 2C0FA 1F3AA 2WCIA 2GZYA 2RM5A 2X8HA 2EC4A 1H75A 1J08A 2LRTA 5HFKA 3LW9A 4ECBA 3L9UA 1ZYNA 1JZDA 1M9BA 22GSA 5C04A 4TR4A 3FY7A 1XFLA 3VWXA 4XIHA 4ZIJA 3IK9A 4V2LA 1JZOA 4NHZA 1ILOA 2AAWA 5IMFA 4D73A 4MZWA 2YP6A 2DIYA 4MLYA 2QSIA 2H70A 1TOFA 4LA1A 1VF4A 5D96A 3TRQA 3TOUA 2TRCP 2X4AA 3ZIVA 4EE0A 3KP9A 2P31A 4HSCX 4O5UA
chains in the Genus database with same CATH topology
3TJJA 1T8EB 4TR0A 1ZYEA 2EIOA 5KN2A 3HYPA 1EOGA 2OE3A 2A4VA 3M9JA 4PQ1A 3A2VA 2DJJA 4O92A 1EP8A 3TKSA 4ZL7A 2H1BA 4GCIA 1NM3A 1MD3A 3DGQA 1QUWA 3TUEA 2LS5A 1G7EA 1K3YA 3HA9A 4K9ZA 5F07A 2LJAA 9GSSA 2QGVA 2WJUA 2O7KA 2CT6A 2VCWA 3CSHA 4IP6A 3P90A 3KH9A 1ERTA 1KTEA 2B7KA 4G0IA 1JZRA 4QQ7A 2CZ3A 4WF4A 3FHKA 4E8EA 1VF2A 1GTBA 1XWAA 1OC8A 2H72A 2VCXA 2H8LA 3ED3A 3VK9A 2GSSA 2TRXA 4IQ1A 4MPFA 3FYGA 3RAZA 4PTSA 3NZNA 4P3YB 2J23A 1GSSA 1M2AA 4LL1B 5DQSA 3KTLA 2IFQA 3HJMA 2PPTA 4HEA2 4O32A 2CX4A 2DKHA 1SK2A 4PQHA 2X8CA 2LEGA 1URMA 4RQRA 2HRKA 3CBUA 3TKSC 4HZ4A 1V58A 2J9HA 5JWOB 3GKKA 4XS1A 3HCZA 3D21A 2MZCA 4MMMA 1R5AA 3UARA 5F06A 1XW9A 2GLRA 2FA8A 3F6FA 1WIKA 4KDYA 3SWLA 2B5EA 1BJXA 3FRCA 1EV9A 4JU5A 4WKWA 3CMIA 3ZRDA 3GRXA 3A5IA 5IPHA 1F2EA 2JSZA 2REMA 2V32A 2C0DA 1RQMA 4GXZA 2FGXA 1SL2B 4F9ZA 5A4UA 1MD4A 2VD0A 2GSTA 5B8AA 2GGTA 3DIEA 5A4WA 3WD6A 1THXA 4IW9A 2MBSA 1GSFA 2C8UA 2P5QA 4HU9A 1BG5A 3ISOA 1ZL9A 2JZSA 3BJ5A 2A2PA 2HSYA 4HUAA 1XZOA 4N11A 1HNBA 1X5CA 4TN8A 5GSTA 2CVDA 4F2IA 4XS4A 2VAFA 3ZZXA 4K5SA 2D2ZA 1FB0A 1XWBA 2DJ3A 1VRSD 2H1DA 3F8UA 4EIQA 4ECJA 1Y25A 2JADA 2EIQA 2WZ9A 1U88A 4Z2UA 1GSYA 5DCHA 3MDKA 1OE8A 5ECKB 4V2NA 2LKUA 2VL2A 1KNGA 3O6TA 3LEFA 5IO2A 3TDGA 5J9CA 2QA2A 4IJIA 3VPQA 3TJGA 2H01A 2HRNA 4YH2A 1CQHA 2OJLA 1XOBA 2L59A 4NWYA 1EEJA 1WMJA 2A2SA 4JR4A 4I5QA 2N5AA 2OA7A 5KN0A 2Z9SA 3ZIJA 3IAM2 1FOVA 4K5RA 2X99A 5AISA 1Z3EA 3ERFA 2HRFA 5AIVA 4KNDA 2B5YA 5DALB 4WXTA 1TDIA 3BCKA 3GYKA 4HQZA 1XCCA 4TR1B 2HFDA 3EC3A 3H79A 5IMCA 4PNGA 4IJ3A 2WRTA 4POBA 4MF5A 1SK0A 4ISDA 2AHEA 4MNNA 5J4UA 2C3QA 2X49A 4IQAA 1FO5A 3ZITA 2F3MA 2YZHA 1A2MA 3F9UA 2ZNMA 3WT2A 1V2AA 2VL2C 4TKYA 4XRAA 4RI6A 4OCEA 2GS3A 2B1KA 4Q5RA 11GSA 1LU4A 1SJ6A 4ZL8A 2CAQA 1MDKA 3HJPA 3IHQA 2OADA 3UJ1A 1OYJA 5D73A 3WGXA 4J56E 3ZYWA 4KUNA 1N2AA 4KCEA 5IMVA 2H0IA 3H4KA 3HY2A 3KM6A 5AN1A 1GTAA 1EGRA 2DJ2A 1JZWA 1K0MA 1FB6A 2ON5A 1XWGA 3HDCA 2HSHA 5KN1A 5CRDA 5LCZA 1X9WB 2NDOA 1F9MA 2R0PA 4MJBA 2R3XA 1X9SB 3EINA 3LGCA 3FR6A 1GNWA 3D4MA 2VLTA 2RLIA 2GQMA 2FWEA 3IAS2 1T3BA 1GWCA 1TTZA 2AB6A 3IPZA 2HXKA 3CYNA 4XS6A 3PINA 2F9SA 5G5EA 5CRGA 1A2JA 2VUPA 2VIMA 4DSRA 1T4ZA 4MH3A 4IP1A 2FLSA 3KXOA 1SKWB 2K6VA 2R0GA 1PL2A 4EC0A 1EEMA 3J7Yb 3F6DA 4RI7A 1Y6EA 1S3AA 3EVIA 5G30A 5DAKB 4YKGA 1U3IA 3LSZA 1NSWA 4LMWA 1FOHA 2UZ8A 2O8VB 4N0ZA 4WEYA 4IKHA 3G7YA 3O3TA 1TRWA 1AAZA 4K0NA 1JLVA 5D8IA 2O87A 4HJMA 3F4RA 1O8XA 3FEUA 3DWVA 3A2XA 2YWMA 5D9WA 5ELAA 2L6DA 5ECSA 2RUEA 4BVXA 4DSSB 2ALBA 3WYWA 4JBBA 1YF0A 2DJ1A 2NVLA 1NW2A 3EWLA 2E2MA 5F8BA 1M2DA 2IMFA 1X5EA 4XRDA 2ES7A 1GUMA 1GTIA 5IOWA 4ML1A 3M8NA 4EDZA 4BPYA 3IC4A 4ECIA 3GFKA 4X0XA 2GVPA 2VM1A 2OKAA 1GL8A 1PRXA 1CQGA 1ZMAA 2OE0A 4AJ6A 1UA5A 4PQIA 1B9XC 3P2AA 2IPAA 1UVZA 3IDVA 3I69A 4L5LA 4BVYA 4CW9A 3M9KA 1EV4A 1USBA 5ID2A 5JWRB 5DBQA 1Z7RA 2CX3A 1GSQA 2K8SA 2VL3A 3LQ7A 3RPPA 2HRAA 2H71A 1GUKA 2F51A 2B1LA 3I43A 1PX6A 4KW6A 3KMNA 4D73B 3A5WA 1PD21 5EPFA 3VI7A 3IR4A 3FW2A 4O7HA 1IYHA 1WE0A 2I81A 1OKTA 5ELGA 1DUGA 4FO5A 3HKRA 1TRSA 3LYKA 4AJ7A 4BL7A 2FUG2 1MDJA 5ECIB 1F37A 1BX9A 5G2ZA 2GDRA 4IBPA 2LRNA 4G0LA 4GQCA 3O76A 2QKEA 4TXOA 1AXDA 3VFIA 8GSSA 2C0GA 2GSQA 1FAAA 6GSTA 1O85A 3DXBA 3NOFA 1PMTA 3FK8A 2AJQB 4WBRD 4I97A 2LJRA 4PX1A 3D5JA 3APSA 1AIUA 5IMAA 1G6WA 3KMOA 6GSUA 3UL3A 1A0FA 2H1AA 4G2EA 1VF3A 3KZQA 4IGJA 4PURA 1BQ7A 4FYCA 2H6YA 4ZBAA 2YWIA 4YQUA 1R4WA 1TW9A 1M99A 3GMFA 1NHOA 3IRAA 5CRHA 3C1SA 1ERVA 1DE2A 3KTBA 5KOWA 4K8MA 1GSUA 4ICYA 2MBTA 1B8XA 4NV5A 3C71A 2KUCA 3HVSA 2IMDA 1K0CA 3GHAA 5EL8A 1K0AA 3MNGA 4HDEA 4KAEA 1V40A 1OC9B 1FHEA 2LNTA 2VCVA 5DVBA 5D9VA 3IOSA 4OWYA 4JE1A 2YZUA 5H5SA 4HI7A 3GURA 1Q4JA 3IC8A 1C72A 5J41A 2R6KA 4POKA 3ME8A 2PERA 3WGEA 2NPBA 2E0QA 5HR3A 3F4TA 4PNFA 2GQLA 4PUAA 3BOAA 2LNSA 4KH7A 1E2YA 4Z7XA 4YKFA 2I1UA 4ACSA 1J0FA 2MMZA 3QPMA 1YZXA 14GSA 1QQ2A 1ACVA 2KLXA 1O8WA 3DEXA 1WPIA 2VLVA 3P7XA 2M72A 3CTFA 1A23A 3FKFA 3UMAA 1SL1B 1FVJA 4TR3A 4EKZA 3LXTA 2FY6A 2HLSA 2VL9A 5J3RA 1A8YA 4LLRA 1WP0A 2I4AA 2WGRA 1Z6MA 5D9XA 4Z2RA 2FWGA 2PU9C 3KEBA 5GZZB 3LYPA 3G7JA 5KN3A 4G0KA 5CP1A 2A4HA 1O6JA 2YN1A 3AY8A 4EDYA 3GX8A 4ZB6A 3VPTA 3M3MA 3PGTA 1O73A 2FD3A 4GQFA 3IXRA 2FNOA 1YEPA 3UVHA 4ULXA 2V2GA 2WDUA 4N30A 3BD2A 4CDOA 2LQQA 1THOA 4WF5A 3L4NA 2CZ2A 4G19A 4NV2A 1YDKA 3MSZA 3UBLA 5JCGA 1HNCA 1V9WA 1YJ6A 1SJIA 1ST9A 1MTCA 4NPBA 4X4JA 1GP1A 2YNXA 3KIJA 1X5DA 4I2TA 3ZREA 1ZGNA 1R7HA 2OBIA 3FMWA 4EO3A 1TU8A 4L0UA 4USSA 4ZXGA 2RUFA 2XHFA 3L9SA 5HQPA 3G9BA 5FHIA 2PUKC 2PMTA 4A5PA 4CY8A 2IMKA 1N8JA 2IL3A 3GTUB 2CA8A 3K8NA 3WGDA 4XTSA 2IWTA 2LSTA 1ERUA 2HZEB 5EVOA 3GKNA 4K2DA 13GSA 1ERWA 4NHWA 3Q19A 4OO5A 2YOIA 3EMPA 1YKAA 1PQNA 1GULA 3M0FA 2NBSA 1T00A 2XBIA 5HR2A 3J7Yk 3VWUA 4K7OA 4Z2TA 4TXVA 5IIZA 4X43A 5DJLA 1K0BA 4YAPA 4F82A 1T7PB 4HQSA 5G31A 2FWFA 4FIWA 2L6CA 4PXOA 2PWJA 2C0EA 4TRXA 1B9YC 1B48A 2L5OA 4MP4A 5IQYA 5JWQB 3GIXA 3GH9A 3RHBA 4KB3A 2FWHA 2GZZA 2IN3A 4GF0A 3ZTLA 5G1LA 3MAKA 1XPVA 1J9BA 2IJYA 4MF7A 3UBKA 4MK3A 4L8EA 4Q5QA 4Q5NA 3TKQA 5HFIA 5KOXA 3W6GA 2H74A 3LXZA 2VCQA 3CRTA 3LORA 2I3YA 4TR1A 3ME7A 2LJKA 5G5FA 4QL9A 1Q98A 3MYDA 3SBCA 2JZTA 3ZFBA 5B8BA 1OC3A 1TI3A 3HXSA 1OKDA 4K6XA 5DQYA 2K8VA 1PKZA 3TKSE 4KE3A 3ZMLA 2VCZA 4X1UA 3UIWA 4GLTA 3C7MA 2YV9A 2FA4A 3CTGA 1GTUA 3GKXA 4V1Ap 2PVOC 3RHCA 3H1NA 2PN8A 3FZ9A 4OFMA 2MMAA 4KGIA 1BEDA 1ML6A 4ID0A 4AGSA 1QFNA 2DMMA 4GRFA 6GSYA 2DIZA 3QFAC 2C3NA 4H86A 4ECCA 4GSSA 3F3QA 3DKSA 6GSXA 1TU7A 1GSDA 2IIYA 3TJKA 4KX4A 1GUHA 1XOAA 5HR1A 2FHEA 2C4JA 3WT1A 4POLA 1TKDB 1UC7A 4NMUA 3U5RE 1ZYQB 1TK8B 4ILFA 1A2LA 3ZVJA 3TJBA 1KEBA 18GSA 2IMEA 5IMDA 3DMLA 2DBCA 1EZKA 1HD2A 1GLQA 1I5GA 3EURA 2XPEA 2KP1A 1HQOA 1W89A 2YV7A 5IOXA 5INYA 3LFLA 3GA4A 1O81A 1R26A 3PPUA 1ZOFA 2LV3A 3QCPA 1TRUA 3GUSA 3US3A 3Q74A 2H75A 10GSA 3EPTA 3L0HA 3KGKA 3FZ4A 4JR6A 1TK5B 4KF9A 4ZBDA 1GSEA 3QAGA 3IA1A 2EIRA 1XVQA 1QMVA 5DAKA 5ECLB 1MDIA 3UEMA 2VCTA 2JU5A 2L4QA 1SYXA 3A2WA 2GQKA 1WJKA 3GN3A 2R4VA 1SL0B 1E6BA 2A2RA 1XWKA 4KSMA 2DLXA 4POMA 3HHVA 4JRRA 4MJEA 1IYIA 1ON4A 1K0DA 4BWQA 4DSQA 1A0RP 3N9JA 4DVCA 4DSSA 1UN2A 1VF1A 3CRUA 1EGOA 1NHYA 1JLWA 1ABAA 2VOCA 1U6TA 5ENUA 3QAVA 2I9HA 5F0GA 4KCAA 5IO0A 4EL1A 2PVQA 1EWXA 1XW5A 1OVNA 2HZFA 1X9MB 2R0CA 1WOUA 2GSRA 3FZ5A 2DMLA 1U87A 2HNLA 2L57A 3EYTA 4L5OA 3PH9A 3GV1A 1TI1A 1DBYA 2KHPA 5IM9A 2F8FA 5B6MA 3GL3A 5CNWA 4LL4B 5L71A 1AQXA 1SYRA 4OCFA 3R3EA 2C1YA 5ECRB 3A3TA 1SK1A 3ERWA 4OFTA 3APQA 1QK8A 3CSJA 2N5BA 3GX0A 3U6VA 3FR9A 5A4VA 5F05A 3ZVJD 5H5RA 4HS1A 2H19A 3M1GA 3TJFA 2BJXA 3G7IA 4JZQA 3TRXA 1M2BA 2WS2A 1V98A 3JCML 2VO4A 4O5RA 5DCGA 2VM2A 2JL4A 5COHA 3EMXA 1EP7A 4GTUA 3UVTA 5J5NA 4WR4A 4BWSA 3C1RA 3IBHA 4N10A 7GSSA 4HZ2A 1ZYPA 3NIVA 3QMXA 1PSQA 2JSYA 4ZILA 3ZLPA 3P8WA 2LQOA 2VLUA 2DC5A 2YWNA 4F0CA 1M0UA 2JZRA 2MMOA 2QC7A 3Q18A 5LD0A 4EIPA 16GSA 4NXIA 1TRVA 2ZUPA 2H66A 3KJYA 3H8QA 2LTKA 2H73A 2IFQB 2L4CA 3RBTA 2P0GA 3EU4A 1HYUA 1QGVA 2GT6A 4V1Ag 1XWCA 1TXXA 2BMXA 5C00A 2K9FA 2NTOA 1LBKA 4MJAA 3GH6A 1W4VA 4TW5A 3KCMA 2XPDA 3F0IA 5HFGA 4EVMA 4K7NA 4YQMA 5ECHB 5E59A 2YANA 3N5OA 2AYTA 3W8SA 2AV4A 4PUFC 1YF1A 4AF2A 4F03A 1FVKA 3W8JA 4QL7A 3QD9A 3HVXA 4K0GA 3VI5A 5DJMA 2OE1A 3RDWA 3D22A 2GTUA 2PGTA 1OC9A 3QAWA 4KSOA 1AQVA 4PGTA 3HD5A 1FW1A 1PL1A 1PGTA 2X8GA 3GL5A 2RIIA 5GSSA 1V57A 3F3RA 1FG4A 2V1MA 1PX7A 4MPGA 1LJRA 3VLNA 3Q6OA 4NAXA 1TJDA 3R2QA 4XS4B 1Z7PA 4OMVA 1PA3A 1XIYA 4ZL9A 1OAZA 1B4PA 3E3EA 2MYGA 4OD7A 5DDLA 3MIXA 1VGLA 2R37A 4I8BA 5B7CA 1KBNA 1F3BA 3HZ8A 4ML6A 1RK4A 4FQUA 5GAPD 3HZ4A 1AC1A 5ECMB 4LMVA 3DRNA 4L0WA 1K0NA 2CVKA 1XVWA 3LWAA 2M80A 1U3AA 3UAPA 3DVXA 3DYRA 2WULA 4V2MA 4GSTA 2B3SA 4MF6A 2CAIA 2YPMA 1SD9A 1TP9A 3GNJA 1GNEA 2X64A 1PN0A 5KEJA 1K3LA 4FYUA 4I2UA 1EOHA 3QR6A 1S3DA 2R5GA 2H76A 3LJRA 2RM6A 3GSSA 4JEDA 4HU7A 3HVVA 4IHUA 2CQ9A 4TVEA 4J57E 5CRWA 4YQVA 2O85A 2JACA 5IMZA 3BBYA 4K1FA 1DE1A 2LUSA 4MH2A 2LRCA 4N0VA 1F6MC 2TIRA 3TKRA 4RUVA 2MMNA 4MDCA 5A5KA 1GRXA 2GZPA 4CHSA 5CYYA 2HI7A 2M46A 1OE7A 1Z9HA 4HOJA 3TGZA 2ZCTA 2C80A 5CAXA 4EUYA 2YJ7A 3L9VA 3I6AA 5ECOB 1M9AA 3IV4A 3TOTA 4F0BA 2OACA 4E8HA 2E7PA 20GSA 4IELA 5ABRA 2QA1A 2WFCA 4KDUA 3IHGA 4BA7A 1A8LA 1SKSB 2F8AA 2YJHA 4AJ8A 6GSSA 1Z6NA 2O89A 5BRTA 4YAVA 5D9TA 3F63A 1I9DA 1AUCA 5E4WA 2N5FA 2C3TA 3F4SA 4I6XA 2HSMA 3QFBC 3GTUA 1YY7A 2V6KA 5DALA 3TB2A 4OO4A 5GAND 2HZEA 3ZL5A 3ZMKA 1AW9A 4IS0A 4XHMA 4MJCA 4G10A 2DKIA 3QDNA 1RW1A 5EY6A 3UOMA 4K2XA 12GSA 1GH2A 1M7TA 3DD3A 2G0FA 2E2GA 3DVWA 3OR5A 1X0RA 2OBKA 4MA9A 2B5XA 2H6XA 2VD1A 1ZZYA 2HE3A 1MEKA 1SKRB 2HYXA 2KP2A 3TCOA 3ZFLA 3S9FA 2DSAA 1TK0B 1AQWA 3C8EA 1B4QA 3CSIA 3EE2A 4WBJA 2XC2A 3HJOA 2B6MA 2H0HA 4ZB8A 1T4YA 1SENA 1G0TA 3EU3A 2B7JA 3IE3A 3D6IA 1SU9A 4FH8A 4TOPA 5ECPB 1O7UA 3BCIA 3C73A 4ZBBA 4MZBA 4BVXB 2ON7A 3E9JB 5IPGA 2H1GA 2DJKA 4EF0A 1GLPA 5CO3A 4GWRA 1R5PA 2V6OA 1YKCA 1DSBA 3FR3A 4XCSA 2H6ZA 2BTOT 1SJZA 5B6NA 1XBSA 3MWHA 2P5RA 5H5QA 3L78A 2CVBA 2FCHA 4FYBA 3E0UA 4O5QA 1WRYA 5JCWA 3CXGA 4OFNA 2V41A 3TKPA 2G2QA 3PR8A 4ZB9A 5FWGA 17GSA 6GSVA 3ERGA 4BVYB 4GSNA 2HT9A 4CY6A 2YWOA 5ID2B 3RPNA 1QXHA 2YCDA 2R2JA 19GSA 4Q5FA 2IMIA 3VWVA 3GSTA 2DJ0A 4IN0A 4RQXA 1G7OA 2XBQA 3GKMA 5LNKe 5J9BA 3QOUA 4K7IA 4KA0A 6GSWA 5G1KA 3V1WA 1XXUA 1S3CA 4WETA 5BMUA 1WWJA 1SD8A 1HNAA 5ECQB 4J2FA 2K18A 3FZAA 1T1VA 5AIXA 5CREA 2L5LA 3KP8A 2WB9A 4G9HA 5FT3A 4IVFA 1K0OA 4BL7B 1H4OA 2CV4A 1BAYA 2H30A 2H0GA 1A24A 3D0ZA 5JCUA 2AUVA 3H93A 3LG6A 1K3OA 4TXOB 5ECNB 3IK7A 4MABA 1JFUA 4DEJA 3I9V2 1ZCPA 1Z5YE 1JHBA 3KD0A 2PBJA 3APOA 1PKWA 1YQ1A 5HR0A 1G6YA 1XW6A 5D93A 2GT5A 2KOKA 3D4TA 3KH7A 1PN9A 4HJ2A 3VWWA 4MCUA 4WR5A 1YEXA 3TRPA 4EXJA 5AGYA 4KDXA 3VURA 1BYEA 4MZCA 2C0FA 1F3AA 2WCIA 2GZYA 2RM5A 2X8HA 2EC4A 1H75A 1J08A 2LRTA 5HFKA 3LW9A 4ECBA 3L9UA 1ZYNA 1JZDA 1M9BA 22GSA 5C04A 4TR4A 3FY7A 1XFLA 3VWXA 4XIHA 4ZIJA 3IK9A 4V2LA 1JZOA 4NHZA 1ILOA 2AAWA 5IMFA 4D73A 4MZWA 2YP6A 2DIYA 4MLYA 2QSIA 2H70A 1TOFA 4LA1A 1VF4A 5D96A 3TRQA 3TOUA 2TRCP 2X4AA 3ZIVA 4EE0A 3KP9A 2P31A 4O5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TJJ A;  1T8E B;  4TR0 A;  1ZYE A;  2EIO A;  5KN2 A;  3HYP A;  1EOG A;  2OE3 A;  2A4V A;  3M9J A;  4PQ1 A;  3A2V A;  2DJJ A;  4O92 A;  1EP8 A;  3TKS A;  4ZL7 A;  2H1B A;  4GCI A;  1NM3 A;  1MD3 A;  3DGQ A;  1QUW A;  3TUE A;  2LS5 A;  1G7E A;  1K3Y A;  3HA9 A;  4K9Z A;  5F07 A;  2LJA A;  9GSS A;  2QGV A;  2WJU A;  2O7K A;  2CT6 A;  2VCW A;  3CSH A;  4IP6 A;  3P90 A;  3KH9 A;  1ERT A;  1KTE A;  2B7K A;  1JZR A;  4QQ7 A;  2CZ3 A;  4WF4 A;  3FHK A;  4E8E A;  1VF2 A;  1GTB A;  1XWA A;  1OC8 A;  2H72 A;  2VCX A;  2H8L A;  3ED3 A;  3VK9 A;  2GSS A;  2TRX A;  4IQ1 A;  4MPF A;  3FYG A;  3RAZ A;  3NZN A;  4P3Y B;  2J23 A;  1GSS A;  1M2A A;  4LL1 B;  5DQS A;  3KTL A;  2IFQ A;  3HJM A;  2PPT A;  4HEA 2;  4O32 A;  2CX4 A;  1SK2 A;  4PQH A;  2X8C A;  2LEG A;  1URM A;  4RQR A;  3CBU A;  3TKS C;  4HZ4 A;  1V58 A;  2J9H A;  5JWO B;  3GKK A;  4XS1 A;  3HCZ A;  3D21 A;  2MZC A;  4MMM A;  1R5A A;  3UAR A;  5F06 A;  1XW9 A;  2GLR A;  2FA8 A;  3F6F A;  1WIK A;  4KDY A;  3SWL A;  2B5E A;  1BJX A;  3FRC A;  1EV9 A;  4JU5 A;  4WKW A;  3CMI A;  3ZRD A;  3GRX A;  5IPH A;  1F2E A;  2JSZ A;  2REM A;  2V32 A;  2C0D A;  1RQM A;  4GXZ A;  2FGX A;  1SL2 B;  4F9Z A;  5A4U A;  1MD4 A;  2VD0 A;  2GST A;  5B8A A;  2GGT A;  3DIE A;  5A4W A;  3WD6 A;  1THX A;  4IW9 A;  2MBS A;  1GSF A;  2C8U A;  2P5Q A;  4HU9 A;  1BG5 A;  3ISO A;  1ZL9 A;  2JZS A;  3BJ5 A;  2HSY A;  4HUA A;  1XZO A;  4N11 A;  1HNB A;  1X5C A;  4TN8 A;  5GST A;  2CVD A;  4F2I A;  4XS4 A;  2VAF A;  3ZZX A;  2D2Z A;  1FB0 A;  1XWB A;  2DJ3 A;  1VRS D;  2H1D A;  3F8U A;  4ECJ A;  1Y25 A;  2JAD A;  2EIQ A;  2WZ9 A;  1U88 A;  1GSY A;  5DCH A;  3MDK A;  1OE8 A;  5ECK B;  4V2N A;  2LKU A;  2VL2 A;  1KNG A;  3O6T A;  3LEF A;  5IO2 A;  3TDG A;  5J9C A;  4IJI A;  3VPQ A;  3TJG A;  2H01 A;  2HRN A;  4YH2 A;  1CQH A;  2OJL A;  1XOB A;  2L59 A;  4NWY A;  1EEJ A;  1WMJ A;  2A2S A;  4JR4 A;  4I5Q A;  2N5A A;  2OA7 A;  5KN0 A;  2Z9S A;  3ZIJ A;  3IAM 2;  1FOV A;  2X99 A;  5AIS A;  1Z3E A;  3ERF A;  2HRF A;  5AIV A;  4KND A;  2B5Y A;  5DAL B;  4WXT A;  1TDI A;  3BCK A;  3GYK A;  4HQZ A;  1XCC A;  4TR1 B;  2HFD A;  3EC3 A;  3H79 A;  5IMC A;  4PNG A;  4IJ3 A;  2WRT A;  4POB A;  4MF5 A;  1SK0 A;  4ISD A;  2AHE A;  5J4U A;  2C3Q A;  4IQA A;  1FO5 A;  3ZIT A;  2F3M A;  2YZH A;  1A2M A;  3F9U A;  2ZNM A;  3WT2 A;  1V2A A;  2VL2 C;  4TKY A;  4XRA A;  4RI6 A;  4OCE A;  2GS3 A;  2B1K A;  4Q5R A;  11GS A;  1LU4 A;  1SJ6 A;  4ZL8 A;  2CAQ A;  1MDK A;  3HJP A;  3IHQ A;  2OAD A;  3UJ1 A;  1OYJ A;  5D73 A;  3WGX A;  4J56 E;  3ZYW A;  4KUN A;  1N2A A;  4KCE A;  5IMV A;  2H0I A;  3H4K A;  3HY2 A;  3KM6 A;  5AN1 A;  1GTA A;  1EGR A;  2DJ2 A;  1JZW A;  1K0M A;  1FB6 A;  2ON5 A;  1XWG A;  3HDC A;  2HSH A;  5KN1 A;  5CRD A;  5LCZ A;  1X9W B;  2NDO A;  1F9M A;  4MJB A;  2R3X A;  1X9S B;  3EIN A;  3LGC A;  3FR6 A;  1GNW A;  3D4M A;  2VLT A;  2RLI A;  2GQM A;  2FWE A;  3IAS 2;  1T3B A;  1GWC A;  1TTZ A;  2AB6 A;  3IPZ A;  2HXK A;  3CYN A;  4XS6 A;  3PIN A;  2F9S A;  5G5E A;  5CRG A;  1A2J A;  2VUP A;  2VIM A;  4DSR A;  1T4Z A;  4MH3 A;  4IP1 A;  2FLS A;  3KXO A;  1SKW B;  2K6V A;  1PL2 A;  4EC0 A;  1EEM A;  3J7Y b;  3F6D A;  4RI7 A;  1Y6E A;  1S3A A;  3EVI A;  5G30 A;  5DAK B;  1U3I A;  3LSZ A;  1NSW A;  4LMW A;  2O8V B;  4N0Z A;  4WEY A;  4IKH A;  3G7Y A;  3O3T A;  1TRW A;  1AAZ A;  4K0N A;  1JLV A;  5D8I A;  2O87 A;  4HJM A;  3F4R A;  1O8X A;  3FEU A;  3DWV A;  3A2X A;  2YWM A;  5D9W A;  5ELA A;  2L6D A;  5ECS A;  2RUE A;  4BVX A;  4DSS B;  2ALB A;  3WYW A;  4JBB A;  1YF0 A;  2DJ1 A;  2NVL A;  1NW2 A;  3EWL A;  2E2M A;  5F8B A;  1M2D A;  2IMF A;  1X5E A;  4XRD A;  2ES7 A;  1GUM A;  1GTI A;  5IOW A;  4ML1 A;  3M8N A;  4EDZ A;  4BPY A;  3IC4 A;  4ECI A;  3GFK A;  4X0X A;  2GVP A;  2VM1 A;  2OKA A;  1GL8 A;  1PRX A;  1CQG A;  1ZMA A;  2OE0 A;  4AJ6 A;  1UA5 A;  4PQI A;  1B9X C;  3P2A A;  2IPA A;  1UVZ A;  3IDV A;  3I69 A;  4L5L A;  4BVY A;  4CW9 A;  3M9K A;  1EV4 A;  1USB A;  5ID2 A;  5JWR B;  5DBQ A;  1Z7R A;  2CX3 A;  1GSQ A;  2K8S A;  2VL3 A;  3LQ7 A;  3RPP A;  2H71 A;  1GUK A;  2F51 A;  2B1L A;  3I43 A;  1PX6 A;  4KW6 A;  3KMN A;  4D73 B;  3A5W A;  1PD2 1;  5EPF A;  3VI7 A;  3IR4 A;  3FW2 A;  4O7H A;  1IYH A;  1WE0 A;  2I81 A;  1OKT A;  5ELG A;  1DUG A;  4FO5 A;  3HKR A;  1TRS A;  3LYK A;  4AJ7 A;  4BL7 A;  2FUG 2;  1MDJ A;  5ECI B;  1F37 A;  1BX9 A;  5G2Z A;  2GDR A;  4IBP A;  2LRN A;  4GQC A;  3O76 A;  2QKE A;  4TXO A;  1AXD A;  3VFI A;  8GSS A;  2C0G A;  2GSQ A;  1FAA A;  6GST A;  1O85 A;  3DXB A;  3NOF A;  1PMT A;  3FK8 A;  2AJQ B;  4WBR D;  4I97 A;  2LJR A;  4PX1 A;  3D5J A;  3APS A;  1AIU A;  5IMA A;  1G6W A;  3KMO A;  6GSU A;  3UL3 A;  1A0F A;  2H1A A;  4G2E A;  1VF3 A;  3KZQ A;  4IGJ A;  4PUR A;  1BQ7 A;  4FYC A;  2H6Y A;  4ZBA A;  2YWI A;  4YQU A;  1R4W A;  1TW9 A;  1M99 A;  3GMF A;  1NHO A;  3IRA A;  5CRH A;  3C1S A;  1ERV A;  1DE2 A;  3KTB A;  4K8M A;  1GSU A;  2MBT A;  1B8X A;  4NV5 A;  3C71 A;  2KUC A;  3HVS A;  2IMD A;  1K0C A;  3GHA A;  5EL8 A;  1K0A A;  3MNG A;  4HDE A;  4KAE A;  1V40 A;  1OC9 B;  1FHE A;  2LNT A;  2VCV A;  5DVB A;  5D9V A;  3IOS A;  4OWY A;  4JE1 A;  2YZU A;  5H5S A;  4HI7 A;  3GUR A;  1Q4J A;  1C72 A;  5J41 A;  2R6K A;  4POK A;  3ME8 A;  2PER A;  3WGE A;  2NPB A;  2E0Q A;  5HR3 A;  3F4T A;  4PNF A;  2GQL A;  4PUA A;  3BOA A;  2LNS A;  4KH7 A;  1E2Y A;  4Z7X A;  2I1U A;  4ACS A;  1J0F A;  2MMZ A;  3QPM A;  1YZX A;  14GS A;  1QQ2 A;  1ACV A;  2KLX A;  1O8W A;  3DEX A;  1WPI A;  2VLV A;  3P7X A;  2M72 A;  3CTF A;  1A23 A;  3FKF A;  3UMA A;  1SL1 B;  1FVJ A;  4TR3 A;  4EKZ A;  3LXT A;  2FY6 A;  2HLS A;  2VL9 A;  5J3R A;  1A8Y A;  4LLR A;  1WP0 A;  2I4A A;  2WGR A;  1Z6M A;  5D9X A;  2FWG A;  2PU9 C;  3KEB A;  5GZZ B;  3LYP A;  3G7J A;  5KN3 A;  5CP1 A;  1O6J A;  2YN1 A;  3AY8 A;  4EDY A;  3GX8 A;  4ZB6 A;  3VPT A;  3M3M A;  3PGT A;  1O73 A;  2FD3 A;  4GQF A;  3IXR A;  2FNO A;  1YEP A;  3UVH A;  4ULX A;  2V2G A;  2WDU A;  4N30 A;  3BD2 A;  4CDO A;  2LQQ A;  1THO A;  4WF5 A;  3L4N A;  2CZ2 A;  4G19 A;  4NV2 A;  1YDK A;  3MSZ A;  3UBL A;  5JCG A;  1HNC A;  1V9W A;  1YJ6 A;  1SJI A;  1ST9 A;  1MTC A;  4NPB A;  1GP1 A;  2YNX A;  3KIJ A;  1X5D A;  4I2T A;  3ZRE A;  1ZGN A;  1R7H A;  2OBI A;  4EO3 A;  1TU8 A;  4L0U A;  4ZXG A;  2RUF A;  2XHF A;  3L9S A;  5HQP A;  3G9B A;  5FHI A;  2PUK C;  2PMT A;  2IMK A;  1N8J A;  2IL3 A;  3GTU B;  2CA8 A;  3K8N A;  3WGD A;  4XTS A;  2IWT A;  2LST A;  1ERU A;  2HZE B;  5EVO A;  3GKN A;  4K2D A;  13GS A;  1ERW A;  4NHW A;  3Q19 A;  4OO5 A;  2YOI A;  3EMP A;  1YKA A;  1PQN A;  1GUL A;  3M0F A;  2NBS A;  1T00 A;  2XBI A;  5HR2 A;  3J7Y k;  3VWU A;  4K7O A;  4TXV A;  5IIZ A;  4X43 A;  5DJL A;  1K0B A;  4YAP A;  4F82 A;  1T7P B;  4HQS A;  5G31 A;  2FWF A;  4FIW A;  2L6C A;  4PXO A;  2PWJ A;  2C0E A;  4TRX A;  1B9Y C;  1B48 A;  2L5O A;  4MP4 A;  5IQY A;  5JWQ B;  3GIX A;  3GH9 A;  3RHB A;  4KB3 A;  2FWH A;  2GZZ A;  2IN3 A;  4GF0 A;  3ZTL A;  5G1L A;  3MAK A;  1XPV A;  1J9B A;  2IJY A;  4MF7 A;  3UBK A;  4MK3 A;  4L8E A;  4Q5Q A;  4Q5N A;  3TKQ A;  5HFI A;  3W6G A;  2H74 A;  3LXZ A;  2VCQ A;  3CRT A;  3LOR A;  2I3Y A;  4TR1 A;  3ME7 A;  2LJK A;  5G5F A;  4QL9 A;  1Q98 A;  3SBC A;  2JZT A;  3ZFB A;  5B8B A;  1OC3 A;  1TI3 A;  3HXS A;  1OKD A;  4K6X A;  5DQY A;  2K8V A;  1PKZ A;  3TKS E;  4KE3 A;  3ZML A;  2VCZ A;  4X1U A;  3UIW A;  4GLT A;  3C7M A;  2YV9 A;  2FA4 A;  3CTG A;  1GTU A;  3GKX A;  4V1A p;  2PVO C;  3RHC A;  3H1N A;  2PN8 A;  3FZ9 A;  4OFM A;  2MMA A;  4KGI A;  1BED A;  1ML6 A;  4ID0 A;  4AGS A;  1QFN A;  2DMM A;  4GRF A;  6GSY A;  2DIZ A;  3QFA C;  2C3N A;  4H86 A;  4ECC A;  4GSS A;  3F3Q A;  3DKS A;  6GSX A;  1TU7 A;  1GSD A;  2IIY A;  3TJK A;  4KX4 A;  1GUH A;  1XOA A;  5HR1 A;  2FHE A;  2C4J A;  3WT1 A;  4POL A;  1TKD B;  1UC7 A;  4NMU A;  3U5R E;  1ZYQ B;  1TK8 B;  4ILF A;  1A2L A;  3ZVJ A;  3TJB A;  1KEB A;  18GS A;  2IME A;  5IMD A;  3DML A;  2DBC A;  1EZK A;  1HD2 A;  1GLQ A;  1I5G A;  3EUR A;  2XPE A;  2KP1 A;  1HQO A;  1W89 A;  2YV7 A;  5IOX A;  5INY A;  3LFL A;  3GA4 A;  1O81 A;  1R26 A;  1ZOF A;  2LV3 A;  3QCP A;  1TRU A;  3GUS A;  3US3 A;  3Q74 A;  2H75 A;  10GS A;  3L0H A;  3KGK A;  3FZ4 A;  4JR6 A;  1TK5 B;  4ZBD A;  1GSE A;  3QAG A;  3IA1 A;  2EIR A;  1XVQ A;  1QMV A;  5DAK A;  5ECL B;  1MDI A;  3UEM A;  2VCT A;  2JU5 A;  2L4Q A;  1SYX A;  3A2W A;  2GQK A;  1WJK A;  3GN3 A;  2R4V A;  1SL0 B;  1E6B A;  2A2R A;  1XWK A;  2DLX A;  4KSM A;  4POM A;  3HHV A;  4JRR A;  4MJE A;  1IYI A;  1ON4 A;  1K0D A;  4BWQ A;  4DSQ A;  1A0R P;  3N9J A;  4DVC A;  4DSS A;  1UN2 A;  1VF1 A;  3CRU A;  1EGO A;  1NHY A;  1JLW A;  1ABA A;  2VOC A;  1U6T A;  5ENU A;  3QAV A;  2I9H A;  5F0G A;  4KCA A;  5IO0 A;  4EL1 A;  2PVQ A;  1EWX A;  1XW5 A;  1OVN A;  2HZF A;  1X9M B;  1WOU A;  2GSR A;  3FZ5 A;  2DML A;  1U87 A;  2HNL A;  2L57 A;  3EYT A;  4L5O A;  3PH9 A;  3GV1 A;  1TI1 A;  1DBY A;  2KHP A;  5IM9 A;  2F8F A;  5B6M A;  3GL3 A;  5CNW A;  4LL4 B;  5L71 A;  1AQX A;  1SYR A;  4OCF A;  2C1Y A;  5ECR B;  3A3T A;  1SK1 A;  3ERW A;  4OFT A;  3APQ A;  1QK8 A;  3CSJ A;  2N5B A;  3GX0 A;  3U6V A;  3FR9 A;  5A4V A;  5F05 A;  3ZVJ D;  5H5R A;  4HS1 A;  2H19 A;  3M1G A;  3TJF A;  2BJX A;  3G7I A;  4JZQ A;  3TRX A;  1M2B A;  2WS2 A;  1V98 A;  3JCM L;  2VO4 A;  4O5R A;  5DCG A;  2VM2 A;  2JL4 A;  3EMX A;  1EP7 A;  4GTU A;  5COH A;  3UVT A;  5J5N A;  4WR4 A;  4BWS A;  3C1R A;  3IBH A;  4N10 A;  7GSS A;  4HZ2 A;  3NIV A;  3QMX A;  1PSQ A;  2JSY A;  4ZIL A;  3ZLP A;  3P8W A;  2LQO A;  2VLU A;  2DC5 A;  2YWN A;  4F0C A;  1M0U A;  2JZR A;  2MMO A;  2QC7 A;  3Q18 A;  5LD0 A;  16GS A;  4NXI A;  1TRV A;  2ZUP A;  2H66 A;  3KJY A;  3H8Q A;  2LTK A;  2H73 A;  2IFQ B;  2L4C A;  3RBT A;  2P0G A;  3EU4 A;  1HYU A;  1QGV A;  2GT6 A;  4V1A g;  1XWC A;  1TXX A;  2BMX A;  5C00 A;  2K9F A;  2NTO A;  1LBK A;  4MJA A;  3GH6 A;  1W4V A;  4TW5 A;  3KCM A;  2XPD A;  3F0I A;  5HFG A;  4EVM A;  4K7N A;  4YQM A;  5ECH B;  5E59 A;  2YAN A;  3N5O A;  2AYT A;  3W8S A;  2AV4 A;  4PUF C;  1YF1 A;  4AF2 A;  4F03 A;  1FVK A;  3W8J A;  4QL7 A;  3QD9 A;  3HVX A;  4K0G A;  3VI5 A;  5DJM A;  2OE1 A;  3RDW A;  3D22 A;  2GTU A;  2PGT A;  1OC9 A;  3QAW A;  4KSO A;  1AQV A;  4PGT A;  3HD5 A;  1FW1 A;  1PL1 A;  1PGT A;  2X8G A;  3GL5 A;  2RII A;  5GSS A;  1V57 A;  3F3R A;  1FG4 A;  2V1M A;  1PX7 A;  4MPG A;  1LJR A;  3VLN A;  3Q6O A;  4NAX A;  1TJD A;  3R2Q A;  4XS4 B;  1Z7P A;  4OMV A;  1PA3 A;  1XIY A;  4ZL9 A;  1OAZ A;  1B4P A;  3E3E A;  2MYG A;  4OD7 A;  5DDL A;  1VGL A;  2R37 A;  4I8B A;  5B7C A;  1KBN A;  1F3B A;  3HZ8 A;  4ML6 A;  1RK4 A;  5GAP D;  3HZ4 A;  1AC1 A;  5ECM B;  4LMV A;  3DRN A;  4L0W A;  1K0N A;  2CVK A;  1XVW A;  3LWA A;  2M80 A;  1U3A A;  3UAP A;  3DVX A;  3DYR A;  2WUL A;  4V2M A;  4GST A;  2B3S A;  4MF6 A;  2CAI A;  2YPM A;  1SD9 A;  1TP9 A;  3GNJ A;  1GNE A;  2X64 A;  5KEJ A;  1K3L A;  4FYU A;  4I2U A;  1EOH A;  3QR6 A;  1S3D A;  2R5G A;  2H76 A;  3LJR A;  2RM6 A;  3GSS A;  4JED A;  4HU7 A;  3HVV A;  4IHU A;  2CQ9 A;  4TVE A;  4J57 E;  5CRW A;  4YQV A;  2O85 A;  2JAC A;  5IMZ A;  3BBY A;  4K1F A;  1DE1 A;  2LUS A;  4MH2 A;  2LRC A;  4N0V A;  1F6M C;  2TIR A;  3TKR A;  4RUV A;  2MMN A;  4MDC A;  5A5K A;  1GRX A;  2GZP A;  4CHS A;  5CYY A;  2HI7 A;  2M46 A;  1OE7 A;  1Z9H A;  4HOJ A;  3TGZ A;  2ZCT A;  2C80 A;  5CAX A;  4EUY A;  2YJ7 A;  3L9V A;  3I6A A;  5ECO B;  1M9A A;  3IV4 A;  3TOT A;  4F0B A;  2OAC A;  4E8H A;  2E7P A;  20GS A;  4IEL A;  5ABR A;  2WFC A;  4KDU A;  4BA7 A;  1A8L A;  1SKS B;  2F8A A;  2YJH A;  4AJ8 A;  6GSS A;  1Z6N A;  2O89 A;  4YAV A;  5D9T A;  3F63 A;  1I9D A;  1AUC A;  5E4W A;  2N5F A;  2C3T A;  3F4S A;  4I6X A;  3QFB C;  3GTU A;  1YY7 A;  2V6K A;  5DAL A;  3TB2 A;  4OO4 A;  5GAN D;  2HZE A;  3ZL5 A;  3ZMK A;  1AW9 A;  4IS0 A;  4XHM A;  4MJC A;  4G10 A;  3QDN A;  1RW1 A;  5EY6 A;  3UOM A;  12GS A;  1GH2 A;  1M7T A;  3DD3 A;  2G0F A;  2E2G A;  3DVW A;  3OR5 A;  1X0R A;  2OBK A;  4MA9 A;  2B5X A;  2H6X A;  2VD1 A;  1ZZY A;  2HE3 A;  1MEK A;  1SKR B;  2HYX A;  2KP2 A;  3TCO A;  3ZFL A;  3S9F A;  2DSA A;  1TK0 B;  1AQW A;  3C8E A;  1B4Q A;  3CSI A;  3EE2 A;  4WBJ A;  2XC2 A;  3HJO A;  2B6M A;  2H0H A;  4ZB8 A;  1T4Y A;  1SEN A;  1G0T A;  3EU3 A;  2B7J A;  3IE3 A;  3D6I A;  1SU9 A;  4FH8 A;  4TOP A;  5ECP B;  1O7U A;  3BCI A;  3C73 A;  4ZBB A;  4MZB A;  2ON7 A;  3E9J B;  5IPG A;  2H1G A;  2DJK A;  4EF0 A;  1GLP A;  5CO3 A;  4GWR A;  1R5P A;  2V6O A;  1YKC A;  1DSB A;  3FR3 A;  4XCS A;  2H6Z A;  2BTO T;  1SJZ A;  5B6N A;  1XBS A;  3MWH A;  2P5R A;  5H5Q A;  3L78 A;  2CVB A;  2FCH A;  4FYB A;  3E0U A;  1WRY A;  5JCW A;  3CXG A;  4OFN A;  2V41 A;  3TKP A;  2G2Q A;  3PR8 A;  4ZB9 A;  5FWG A;  17GS A;  6GSV A;  3ERG A;  4GSN A;  2HT9 A;  2YWO A;  5ID2 B;  3RPN A;  1QXH A;  2YCD A;  2R2J A;  19GS A;  4Q5F A;  2IMI A;  3VWV A;  3GST A;  2DJ0 A;  4IN0 A;  4RQX A;  1G7O A;  2XBQ A;  3GKM A;  5LNK e;  5J9B A;  3QOU A;  4K7I A;  4KA0 A;  6GSW A;  5G1K A;  3V1W A;  1XXU A;  1S3C A;  4WET A;  1WWJ A;  1SD8 A;  1HNA A;  5ECQ B;  4J2F A;  2K18 A;  3FZA A;  1T1V A;  5AIX A;  5CRE A;  2L5L A;  3KP8 A;  2WB9 A;  4G9H A;  5FT3 A;  4IVF A;  1K0O A;  1H4O A;  2CV4 A;  1BAY A;  2H30 A;  2H0G A;  1A24 A;  3D0Z A;  5JCU A;  2AUV A;  3H93 A;  3LG6 A;  1K3O A;  4TXO B;  5ECN B;  3IK7 A;  4MAB A;  1JFU A;  4DEJ A;  3I9V 2;  1ZCP A;  1Z5Y E;  1JHB A;  3KD0 A;  2PBJ A;  3APO A;  1PKW A;  1YQ1 A;  5HR0 A;  1G6Y A;  1XW6 A;  5D93 A;  2GT5 A;  2KOK A;  3D4T A;  3KH7 A;  1PN9 A;  4HJ2 A;  3VWW A;  4MCU A;  4WR5 A;  1YEX A;  3TRP A;  4EXJ A;  5AGY A;  4KDX A;  3VUR A;  1BYE A;  4MZC A;  2C0F A;  1F3A A;  2WCI A;  2GZY A;  2RM5 A;  2X8H A;  2EC4 A;  1H75 A;  1J08 A;  2LRT A;  5HFK A;  4ECB A;  3L9U A;  1JZD A;  1M9B A;  22GS A;  5C04 A;  4TR4 A;  3FY7 A;  1XFL A;  3VWX A;  4XIH A;  4ZIJ A;  3IK9 A;  4V2L A;  1JZO A;  4NHZ A;  1ILO A;  2AAW A;  5IMF A;  4D73 A;  4MZW A;  2YP6 A;  2DIY A;  4MLY A;  2QSI A;  2H70 A;  1TOF A;  4LA1 A;  1VF4 A;  5D96 A;  3TRQ A;  3TOU A;  2TRC P;  3ZIV A;  4EE0 A;  3KP9 A;  2P31 A; 
#chains in the Genus database with same CATH topology
 3TJJ A;  1T8E B;  4TR0 A;  1ZYE A;  2EIO A;  5KN2 A;  3HYP A;  1EOG A;  2OE3 A;  2A4V A;  3M9J A;  4PQ1 A;  3A2V A;  2DJJ A;  4O92 A;  1EP8 A;  3TKS A;  4ZL7 A;  2H1B A;  4GCI A;  1NM3 A;  1MD3 A;  3DGQ A;  1QUW A;  3TUE A;  2LS5 A;  1G7E A;  1K3Y A;  3HA9 A;  4K9Z A;  5F07 A;  2LJA A;  9GSS A;  2QGV A;  2WJU A;  2O7K A;  2CT6 A;  2VCW A;  3CSH A;  4IP6 A;  3P90 A;  3KH9 A;  1ERT A;  1KTE A;  2B7K A;  4G0I A;  1JZR A;  4QQ7 A;  2CZ3 A;  4WF4 A;  3FHK A;  4E8E A;  1VF2 A;  1GTB A;  1XWA A;  1OC8 A;  2H72 A;  2VCX A;  2H8L A;  3ED3 A;  3VK9 A;  2GSS A;  2TRX A;  4IQ1 A;  4MPF A;  3FYG A;  3RAZ A;  4PTS A;  3NZN A;  4P3Y B;  2J23 A;  1GSS A;  1M2A A;  4LL1 B;  5DQS A;  3KTL A;  2IFQ A;  3HJM A;  2PPT A;  4HEA 2;  4O32 A;  2CX4 A;  2DKH A;  1SK2 A;  4PQH A;  2X8C A;  2LEG A;  1URM A;  4RQR A;  2HRK A;  3CBU A;  3TKS C;  4HZ4 A;  1V58 A;  2J9H A;  5JWO B;  3GKK A;  4XS1 A;  3HCZ A;  3D21 A;  2MZC A;  4MMM A;  1R5A A;  3UAR A;  5F06 A;  1XW9 A;  2GLR A;  2FA8 A;  3F6F A;  1WIK A;  4KDY A;  3SWL A;  2B5E A;  1BJX A;  3FRC A;  1EV9 A;  4JU5 A;  4WKW A;  3CMI A;  3ZRD A;  3GRX A;  3A5I A;  5IPH A;  1F2E A;  2JSZ A;  2REM A;  2V32 A;  2C0D A;  1RQM A;  4GXZ A;  2FGX A;  1SL2 B;  4F9Z A;  5A4U A;  1MD4 A;  2VD0 A;  2GST A;  5B8A A;  2GGT A;  3DIE A;  5A4W A;  3WD6 A;  1THX A;  4IW9 A;  2MBS A;  1GSF A;  2C8U A;  2P5Q A;  4HU9 A;  1BG5 A;  3ISO A;  1ZL9 A;  2JZS A;  3BJ5 A;  2A2P A;  2HSY A;  4HUA A;  1XZO A;  4N11 A;  1HNB A;  1X5C A;  4TN8 A;  5GST A;  2CVD A;  4F2I A;  4XS4 A;  2VAF A;  3ZZX A;  4K5S A;  2D2Z A;  1FB0 A;  1XWB A;  2DJ3 A;  1VRS D;  2H1D A;  3F8U A;  4EIQ A;  4ECJ A;  1Y25 A;  2JAD A;  2EIQ A;  2WZ9 A;  1U88 A;  4Z2U A;  1GSY A;  5DCH A;  3MDK A;  1OE8 A;  5ECK B;  4V2N A;  2LKU A;  2VL2 A;  1KNG A;  3O6T A;  3LEF A;  5IO2 A;  3TDG A;  5J9C A;  2QA2 A;  4IJI A;  3VPQ A;  3TJG A;  2H01 A;  2HRN A;  4YH2 A;  1CQH A;  2OJL A;  1XOB A;  2L59 A;  4NWY A;  1EEJ A;  1WMJ A;  2A2S A;  4JR4 A;  4I5Q A;  2N5A A;  2OA7 A;  5KN0 A;  2Z9S A;  3ZIJ A;  3IAM 2;  1FOV A;  4K5R A;  2X99 A;  5AIS A;  1Z3E A;  3ERF A;  2HRF A;  5AIV A;  4KND A;  2B5Y A;  5DAL B;  4WXT A;  1TDI A;  3BCK A;  3GYK A;  4HQZ A;  1XCC A;  4TR1 B;  2HFD A;  3EC3 A;  3H79 A;  5IMC A;  4PNG A;  4IJ3 A;  2WRT A;  4POB A;  4MF5 A;  1SK0 A;  4ISD A;  2AHE A;  4MNN A;  5J4U A;  2C3Q A;  2X49 A;  4IQA A;  1FO5 A;  3ZIT A;  2F3M A;  2YZH A;  1A2M A;  3F9U A;  2ZNM A;  3WT2 A;  1V2A A;  2VL2 C;  4TKY A;  4XRA A;  4RI6 A;  4OCE A;  2GS3 A;  2B1K A;  4Q5R A;  11GS A;  1LU4 A;  1SJ6 A;  4ZL8 A;  2CAQ A;  1MDK A;  3HJP A;  3IHQ A;  2OAD A;  3UJ1 A;  1OYJ A;  5D73 A;  3WGX A;  4J56 E;  3ZYW A;  4KUN A;  1N2A A;  4KCE A;  5IMV A;  2H0I A;  3H4K A;  3HY2 A;  3KM6 A;  5AN1 A;  1GTA A;  1EGR A;  1M3I A;  2DJ2 A;  1JZW A;  1K0M A;  1FB6 A;  2ON5 A;  1XWG A;  3HDC A;  2HSH A;  5KN1 A;  5CRD A;  5LCZ A;  1X9W B;  2NDO A;  1F9M A;  2R0P A;  4MJB A;  2R3X A;  1X9S B;  3EIN A;  3LGC A;  3FR6 A;  1GNW A;  3D4M A;  2VLT A;  2RLI A;  2GQM A;  2FWE A;  3IAS 2;  1T3B A;  1GWC A;  1TTZ A;  2AB6 A;  3IPZ A;  2HXK A;  3CYN A;  4XS6 A;  3PIN A;  2F9S A;  5G5E A;  5CRG A;  1A2J A;  2VUP A;  2VIM A;  4DSR A;  1T4Z A;  4MH3 A;  4IP1 A;  2FLS A;  3KXO A;  1SKW B;  2K6V A;  2R0G A;  1PL2 A;  4EC0 A;  1EEM A;  3J7Y b;  3F6D A;  3CQF A;  4RI7 A;  1Y6E A;  1S3A A;  3EVI A;  5G30 A;  5DAK B;  4YKG A;  1U3I A;  3LSZ A;  1NSW A;  4LMW A;  1FOH A;  2UZ8 A;  2O8V B;  4N0Z A;  4WEY A;  4IKH A;  3G7Y A;  3O3T A;  1TRW A;  1AAZ A;  4K0N A;  1JLV A;  5D8I A;  2O87 A;  4HJM A;  3F4R A;  1O8X A;  3FEU A;  3DWV A;  3A2X A;  2YWM A;  5D9W A;  5ELA A;  2L6D A;  5ECS A;  2RUE A;  4BVX A;  4DSS B;  2ALB A;  3WYW A;  4JBB A;  1YF0 A;  2DJ1 A;  2NVL A;  1NW2 A;  3EWL A;  2E2M A;  5F8B A;  1M2D A;  2IMF A;  1X5E A;  4XRD A;  2ES7 A;  1GUM A;  1GTI A;  5IOW A;  4ML1 A;  3M8N A;  4EDZ A;  4BPY A;  3IC4 A;  4ECI A;  3GFK A;  4X0X A;  2GVP A;  2VM1 A;  2OKA A;  1GL8 A;  1PRX A;  1CQG A;  1ZMA A;  2OE0 A;  4AJ6 A;  1UA5 A;  4PQI A;  1B9X C;  3P2A A;  2IPA A;  1UVZ A;  3IDV A;  3I69 A;  4L5L A;  4BVY A;  4CW9 A;  3M9K A;  1EV4 A;  1USB A;  5ID2 A;  5JWR B;  5DBQ A;  1Z7R A;  2CX3 A;  1GSQ A;  2K8S A;  2VL3 A;  3LQ7 A;  3RPP A;  2HRA A;  2H71 A;  1GUK A;  2F51 A;  2B1L A;  3I43 A;  1PX6 A;  4KW6 A;  3KMN A;  4D73 B;  3A5W A;  1PD2 1;  5EPF A;  3VI7 A;  3IR4 A;  3FW2 A;  4O7H A;  1IYH A;  1WE0 A;  2I81 A;  1OKT A;  5ELG A;  1DUG A;  4FO5 A;  3HKR A;  1TRS A;  3LYK A;  4AJ7 A;  4BL7 A;  2FUG 2;  1MDJ A;  5ECI B;  1F37 A;  1BX9 A;  5G2Z A;  2GDR A;  4IBP A;  2LRN A;  4G0L A;  4GQC A;  3O76 A;  2QKE A;  4TXO A;  1AXD A;  3VFI A;  8GSS A;  2C0G A;  2GSQ A;  1FAA A;  6GST A;  1O85 A;  3DXB A;  3NOF A;  1PMT A;  3FK8 A;  2AJQ B;  4WBR D;  4I97 A;  2LJR A;  4PX1 A;  3D5J A;  3APS A;  1AIU A;  5IMA A;  1G6W A;  3KMO A;  6GSU A;  3UL3 A;  1A0F A;  2H1A A;  4G2E A;  1VF3 A;  3KZQ A;  4IGJ A;  4PUR A;  1BQ7 A;  3HVN A;  4FYC A;  2H6Y A;  4ZBA A;  2YWI A;  4YQU A;  1R4W A;  1TW9 A;  1M99 A;  3GMF A;  1NHO A;  3IRA A;  5CRH A;  3C1S A;  1ERV A;  1DE2 A;  3KTB A;  5KOW A;  4K8M A;  1GSU A;  4ICY A;  2MBT A;  1B8X A;  4NV5 A;  3C71 A;  2KUC A;  3HVS A;  2IMD A;  1K0C A;  3GHA A;  5EL8 A;  1K0A A;  3MNG A;  4HDE A;  4KAE A;  1V40 A;  1OC9 B;  1FHE A;  2LNT A;  2VCV A;  5DVB A;  5D9V A;  3IOS A;  4OWY A;  4JE1 A;  2YZU A;  5H5S A;  4HI7 A;  3GUR A;  1Q4J A;  3IC8 A;  1C72 A;  5J41 A;  2R6K A;  4POK A;  3ME8 A;  2PER A;  3WGE A;  2NPB A;  2E0Q A;  5HR3 A;  3F4T A;  4PNF A;  2GQL A;  4PUA A;  3BOA A;  2LNS A;  4KH7 A;  1E2Y A;  4Z7X A;  4YKF A;  2I1U A;  4ACS A;  1J0F A;  2MMZ A;  3QPM A;  1YZX A;  14GS A;  1QQ2 A;  1ACV A;  2KLX A;  1O8W A;  3DEX A;  1WPI A;  2VLV A;  3P7X A;  2M72 A;  3CTF A;  1A23 A;  3FKF A;  3UMA A;  1SL1 B;  1FVJ A;  4TR3 A;  4EKZ A;  3LXT A;  2FY6 A;  2HLS A;  2VL9 A;  5J3R A;  1A8Y A;  4LLR A;  1WP0 A;  2I4A A;  2WGR A;  1Z6M A;  5D9X A;  4Z2R A;  2FWG A;  2PU9 C;  3KEB A;  5GZZ B;  3LYP A;  3G7J A;  5KN3 A;  4G0K A;  5CP1 A;  2A4H A;  1O6J A;  2YN1 A;  3AY8 A;  4EDY A;  3GX8 A;  4ZB6 A;  3VPT A;  3M3M A;  3PGT A;  1O73 A;  2FD3 A;  4GQF A;  3IXR A;  2FNO A;  1YEP A;  3UVH A;  4ULX A;  2V2G A;  2WDU A;  4N30 A;  3BD2 A;  4CDO A;  2LQQ A;  1THO A;  4WF5 A;  3L4N A;  2CZ2 A;  4G19 A;  4NV2 A;  1YDK A;  3MSZ A;  3UBL A;  5JCG A;  1HNC A;  1V9W A;  1YJ6 A;  1SJI A;  1ST9 A;  1MTC A;  4NPB A;  4X4J A;  1GP1 A;  2YNX A;  3KIJ A;  1X5D A;  4I2T A;  3ZRE A;  1ZGN A;  1R7H A;  2OBI A;  3FMW A;  4EO3 A;  1TU8 A;  4L0U A;  4USS A;  4ZXG A;  2RUF A;  2XHF A;  3L9S A;  5HQP A;  3G9B A;  5FHI A;  2PUK C;  2PMT A;  4A5P A;  4CY8 A;  2IMK A;  1N8J A;  2IL3 A;  3GTU B;  2CA8 A;  3K8N A;  3WGD A;  4XTS A;  2IWT A;  2LST A;  1ERU A;  2HZE B;  5EVO A;  3GKN A;  4K2D A;  13GS A;  1ERW A;  4NHW A;  3Q19 A;  4OO5 A;  2YOI A;  3EMP A;  1YKA A;  1PQN A;  1GUL A;  3M0F A;  2NBS A;  1T00 A;  2XBI A;  5HR2 A;  3J7Y k;  3VWU A;  4K7O A;  4Z2T A;  4TXV A;  5IIZ A;  4X43 A;  5DJL A;  1K0B A;  4YAP A;  4F82 A;  1T7P B;  4HQS A;  5G31 A;  2FWF A;  4FIW A;  2L6C A;  4PXO A;  2PWJ A;  2C0E A;  4TRX A;  1B9Y C;  1B48 A;  2L5O A;  4MP4 A;  5IQY A;  5JWQ B;  3GIX A;  3GH9 A;  3RHB A;  4KB3 A;  2FWH A;  2GZZ A;  2IN3 A;  4GF0 A;  3ZTL A;  5G1L A;  3MAK A;  1XPV A;  1J9B A;  2IJY A;  4MF7 A;  3UBK A;  4MK3 A;  4L8E A;  4Q5Q A;  4Q5N A;  3TKQ A;  5HFI A;  5KOX A;  3W6G A;  2H74 A;  3LXZ A;  2VCQ A;  3CRT A;  3LOR A;  2I3Y A;  4TR1 A;  3ME7 A;  2LJK A;  5G5F A;  4QL9 A;  1Q98 A;  3MYD A;  3SBC A;  2JZT A;  3ZFB A;  5B8B A;  1OC3 A;  1TI3 A;  3HXS A;  1OKD A;  4K6X A;  5DQY A;  2K8V A;  1PKZ A;  4BIK A;  3TKS E;  4KE3 A;  3ZML A;  2VCZ A;  4X1U A;  3UIW A;  4GLT A;  3C7M A;  2YV9 A;  2FA4 A;  3CTG A;  1GTU A;  3GKX A;  4V1A p;  2PVO C;  3RHC A;  3H1N A;  2PN8 A;  3FZ9 A;  4OFM A;  2MMA A;  4KGI A;  1BED A;  1ML6 A;  4ID0 A;  4AGS A;  1QFN A;  2DMM A;  4GRF A;  6GSY A;  2DIZ A;  3QFA C;  2C3N A;  4H86 A;  4ECC A;  4GSS A;  3F3Q A;  3DKS A;  6GSX A;  1TU7 A;  1GSD A;  2IIY A;  3TJK A;  4KX4 A;  1GUH A;  1XOA A;  5HR1 A;  2FHE A;  2C4J A;  3WT1 A;  4POL A;  1TKD B;  1UC7 A;  4NMU A;  3U5R E;  1ZYQ B;  1TK8 B;  4ILF A;  1A2L A;  3ZVJ A;  3TJB A;  1KEB A;  18GS A;  2IME A;  5IMD A;  3DML A;  2DBC A;  1EZK A;  1HD2 A;  1GLQ A;  1I5G A;  3EUR A;  2XPE A;  2KP1 A;  1HQO A;  1W89 A;  2YV7 A;  5IOX A;  5INY A;  3LFL A;  3GA4 A;  1O81 A;  1R26 A;  3PPU A;  1ZOF A;  2LV3 A;  3QCP A;  1TRU A;  3GUS A;  3US3 A;  3Q74 A;  2H75 A;  10GS A;  3EPT A;  3L0H A;  3KGK A;  3FZ4 A;  4JR6 A;  1TK5 B;  4KF9 A;  4ZBD A;  1GSE A;  3QAG A;  3IA1 A;  2EIR A;  1XVQ A;  1QMV A;  5DAK A;  5ECL B;  1MDI A;  3UEM A;  2VCT A;  2JU5 A;  1PFO A;  2L4Q A;  1SYX A;  3A2W A;  2GQK A;  1WJK A;  3GN3 A;  2R4V A;  1SL0 B;  1E6B A;  2A2R A;  1XWK A;  4KSM A;  2DLX A;  4POM A;  3HHV A;  4JRR A;  4MJE A;  1IYI A;  1ON4 A;  1K0D A;  4BWQ A;  4DSQ A;  1A0R P;  3N9J A;  4DVC A;  4DSS A;  1UN2 A;  1VF1 A;  3CRU A;  1EGO A;  1NHY A;  1JLW A;  1ABA A;  2VOC A;  1U6T A;  5ENU A;  3QAV A;  2I9H A;  5F0G A;  4KCA A;  5IO0 A;  4EL1 A;  2PVQ A;  1EWX A;  1XW5 A;  1OVN A;  2HZF A;  1X9M B;  2R0C A;  1WOU A;  2GSR A;  3FZ5 A;  2DML A;  1U87 A;  2HNL A;  2L57 A;  3EYT A;  4L5O A;  3PH9 A;  3GV1 A;  1TI1 A;  1DBY A;  2KHP A;  5IM9 A;  2F8F A;  5B6M A;  3GL3 A;  5CNW A;  4LL4 B;  5L71 A;  1AQX A;  1SYR A;  4OCF A;  3R3E A;  2C1Y A;  5ECR B;  3A3T A;  1SK1 A;  3ERW A;  4OFT A;  3APQ A;  1QK8 A;  3CSJ A;  2N5B A;  3GX0 A;  3U6V A;  3FR9 A;  5A4V A;  5F05 A;  3ZVJ D;  5H5R A;  4HS1 A;  2H19 A;  3M1G A;  3TJF A;  2BJX A;  3G7I A;  4JZQ A;  3TRX A;  1M2B A;  2WS2 A;  1V98 A;  3JCM L;  2VO4 A;  4O5R A;  5DCG A;  2VM2 A;  2JL4 A;  5COH A;  3EMX A;  1EP7 A;  4GTU A;  3UVT A;  5J5N A;  4WR4 A;  4BWS A;  3C1R A;  3IBH A;  4N10 A;  7GSS A;  4HZ2 A;  1ZYP A;  3NIV A;  3QMX A;  1PSQ A;  2JSY A;  4ZIL A;  3ZLP A;  3P8W A;  2LQO A;  2VLU A;  2DC5 A;  2YWN A;  4F0C A;  1M0U A;  2JZR A;  2MMO A;  2QC7 A;  3Q18 A;  5LD0 A;  4EIP A;  16GS A;  4NXI A;  1TRV A;  2ZUP A;  2H66 A;  3KJY A;  3H8Q A;  2LTK A;  2H73 A;  2IFQ B;  2L4C A;  3RBT A;  2P0G A;  3EU4 A;  1HYU A;  1QGV A;  2GT6 A;  4V1A g;  1XWC A;  1TXX A;  2BMX A;  5C00 A;  2K9F A;  2NTO A;  1LBK A;  4MJA A;  3GH6 A;  1W4V A;  4TW5 A;  3KCM A;  2XPD A;  3F0I A;  5HFG A;  4EVM A;  4K7N A;  4YQM A;  5ECH B;  5E59 A;  2YAN A;  3N5O A;  2AYT A;  3W8S A;  2AV4 A;  4PUF C;  1YF1 A;  4AF2 A;  4F03 A;  1FVK A;  3W8J A;  4QL7 A;  3QD9 A;  3HVX A;  4K0G A;  3VI5 A;  5DJM A;  2OE1 A;  3RDW A;  3D22 A;  2GTU A;  2PGT A;  1OC9 A;  3QAW A;  4KSO A;  1AQV A;  4PGT A;  3HD5 A;  1FW1 A;  1PL1 A;  1PGT A;  2X8G A;  3GL5 A;  2RII A;  5GSS A;  1V57 A;  3F3R A;  1FG4 A;  2V1M A;  1PX7 A;  4MPG A;  1S3R A;  1LJR A;  3VLN A;  3Q6O A;  4NAX A;  1TJD A;  3R2Q A;  4XS4 B;  1Z7P A;  4OMV A;  1PA3 A;  1XIY A;  4ZL9 A;  1OAZ A;  1B4P A;  3E3E A;  2MYG A;  4OD7 A;  5DDL A;  3MIX A;  1VGL A;  2R37 A;  4I8B A;  5B7C A;  1KBN A;  1F3B A;  3HZ8 A;  4ML6 A;  1RK4 A;  4FQU A;  5GAP D;  3HZ4 A;  1AC1 A;  5ECM B;  4LMV A;  3DRN A;  4L0W A;  1K0N A;  2CVK A;  1XVW A;  3LWA A;  2M80 A;  1U3A A;  3UAP A;  3DVX A;  3DYR A;  2WUL A;  4V2M A;  4GST A;  2B3S A;  4MF6 A;  2CAI A;  2YPM A;  1SD9 A;  1TP9 A;  3GNJ A;  1GNE A;  2X64 A;  1PN0 A;  5KEJ A;  1K3L A;  4FYU A;  4I2U A;  1EOH A;  3QR6 A;  1S3D A;  2R5G A;  2H76 A;  3LJR A;  2RM6 A;  3GSS A;  4JED A;  4HU7 A;  3HVV A;  4IHU A;  2CQ9 A;  4TVE A;  4J57 E;  5CRW A;  4YQV A;  2O85 A;  2JAC A;  5IMZ A;  3BBY A;  4K1F A;  1DE1 A;  2LUS A;  4MH2 A;  2LRC A;  4N0V A;  1F6M C;  2TIR A;  3TKR A;  4RUV A;  2MMN A;  4MDC A;  1M3J A;  5A5K A;  1GRX A;  2GZP A;  4CHS A;  5CYY A;  2HI7 A;  2M46 A;  1OE7 A;  1Z9H A;  4HOJ A;  3TGZ A;  2ZCT A;  2C80 A;  5CAX A;  4EUY A;  2YJ7 A;  3L9V A;  3I6A A;  5ECO B;  1M9A A;  3IV4 A;  3TOT A;  4F0B A;  2OAC A;  4E8H A;  2E7P A;  20GS A;  4IEL A;  5ABR A;  2QA1 A;  2WFC A;  4KDU A;  3IHG A;  4BA7 A;  1A8L A;  1SKS B;  2F8A A;  2YJH A;  4AJ8 A;  6GSS A;  1Z6N A;  2O89 A;  5BRT A;  4YAV A;  5D9T A;  3F63 A;  1I9D A;  1AUC A;  5E4W A;  2N5F A;  2C3T A;  3F4S A;  4I6X A;  2HSM A;  3QFB C;  3GTU A;  1YY7 A;  2V6K A;  1XG8 A;  5DAL A;  3TB2 A;  4OO4 A;  5GAN D;  2HZE A;  3ZL5 A;  3ZMK A;  1AW9 A;  4IS0 A;  4XHM A;  4MJC A;  4G10 A;  2DKI A;  3QDN A;  1RW1 A;  5EY6 A;  3UOM A;  4K2X A;  12GS A;  1GH2 A;  1M7T A;  3DD3 A;  2G0F A;  2E2G A;  3DVW A;  3OR5 A;  1X0R A;  2OBK A;  4MA9 A;  2B5X A;  2H6X A;  2VD1 A;  1ZZY A;  2HE3 A;  1MEK A;  1SKR B;  2HYX A;  2KP2 A;  3TCO A;  3ZFL A;  3S9F A;  2DSA A;  1TK0 B;  1AQW A;  3C8E A;  1B4Q A;  3CSI A;  3EE2 A;  4WBJ A;  2XC2 A;  3HJO A;  2B6M A;  2H0H A;  4ZB8 A;  1T4Y A;  1SEN A;  1G0T A;  3EU3 A;  2B7J A;  3IE3 A;  3D6I A;  1SU9 A;  4FH8 A;  4TOP A;  5ECP B;  1O7U A;  3BCI A;  3C73 A;  4ZBB A;  4MZB A;  4BVX B;  2ON7 A;  3E9J B;  5IPG A;  2H1G A;  2DJK A;  4EF0 A;  1GLP A;  5CO3 A;  4GWR A;  1R5P A;  2V6O A;  1YKC A;  1DSB A;  3FR3 A;  4XCS A;  2H6Z A;  2BTO T;  1SJZ A;  5B6N A;  1XBS A;  3MWH A;  2P5R A;  5H5Q A;  3L78 A;  2CVB A;  2FCH A;  4FYB A;  3E0U A;  4O5Q A;  1WRY A;  5JCW A;  3CXG A;  4OFN A;  2V41 A;  3TKP A;  2G2Q A;  3PR8 A;  4ZB9 A;  5FWG A;  17GS A;  6GSV A;  3ERG A;  4BVY B;  4GSN A;  2HT9 A;  4CY6 A;  2YWO A;  5ID2 B;  3RPN A;  1QXH A;  2YCD A;  2R2J A;  19GS A;  4Q5F A;  2IMI A;  3VWV A;  3GST A;  2DJ0 A;  4IN0 A;  4RQX A;  1G7O A;  2XBQ A;  3GKM A;  5LNK e;  5J9B A;  3QOU A;  4K7I A;  4KA0 A;  6GSW A;  5G1K A;  3V1W A;  1XXU A;  1S3C A;  4WET A;  5BMU A;  1WWJ A;  1SD8 A;  1HNA A;  5ECQ B;  4J2F A;  2K18 A;  3FZA A;  1T1V A;  5AIX A;  5CRE A;  2L5L A;  3KP8 A;  2WB9 A;  4G9H A;  5FT3 A;  4IVF A;  1K0O A;  4BL7 B;  1H4O A;  2CV4 A;  1BAY A;  2H30 A;  2H0G A;  1A24 A;  3D0Z A;  5JCU A;  2AUV A;  3H93 A;  3LG6 A;  1K3O A;  4TXO B;  5ECN B;  3IK7 A;  4MAB A;  1JFU A;  4DEJ A;  3I9V 2;  1ZCP A;  1Z5Y E;  1JHB A;  3KD0 A;  2PBJ A;  3APO A;  1PKW A;  1YQ1 A;  5HR0 A;  1G6Y A;  1XW6 A;  5D93 A;  2GT5 A;  2KOK A;  3D4T A;  3KH7 A;  1PN9 A;  4HJ2 A;  3VWW A;  4MCU A;  4WR5 A;  1YEX A;  3TRP A;  4EXJ A;  5AGY A;  4KDX A;  3VUR A;  1BYE A;  4MZC A;  2C0F A;  1F3A A;  2WCI A;  2GZY A;  2RM5 A;  2X8H A;  2EC4 A;  1H75 A;  1J08 A;  2LRT A;  5HFK A;  3LW9 A;  4ECB A;  3L9U A;  1ZYN A;  1JZD A;  1M9B A;  22GS A;  5C04 A;  4TR4 A;  3FY7 A;  1XFL A;  3VWX A;  4XIH A;  4ZIJ A;  3IK9 A;  4V2L A;  1JZO A;  4NHZ A;  1ILO A;  2AAW A;  5IMF A;  4D73 A;  4MZW A;  2YP6 A;  2DIY A;  4MLY A;  2QSI A;  2H70 A;  1TOF A;  4LA1 A;  1VF4 A;  5D96 A;  3TRQ A;  3TOU A;  2TRC P;  2X4A A;  3ZIV A;  4EE0 A;  3KP9 A;  2P31 A;  4HSC X;  4O5U A; 
#chains in the Genus database with same CATH homology
 3TJJ A;  1T8E B;  4TR0 A;  1ZYE A;  2EIO A;  5KN2 A;  3HYP A;  1EOG A;  2OE3 A;  2A4V A;  3M9J A;  4PQ1 A;  3A2V A;  2DJJ A;  4O92 A;  1EP8 A;  3TKS A;  4ZL7 A;  2H1B A;  4GCI A;  1NM3 A;  1MD3 A;  3DGQ A;  1QUW A;  3TUE A;  2LS5 A;  1G7E A;  1K3Y A;  3HA9 A;  4K9Z A;  5F07 A;  2LJA A;  9GSS A;  2QGV A;  2WJU A;  2O7K A;  2CT6 A;  2VCW A;  3CSH A;  4IP6 A;  3P90 A;  3KH9 A;  1ERT A;  1KTE A;  2B7K A;  4G0I A;  1JZR A;  4QQ7 A;  2CZ3 A;  4WF4 A;  3FHK A;  4E8E A;  1VF2 A;  1GTB A;  1XWA A;  1OC8 A;  2H72 A;  2VCX A;  2H8L A;  3ED3 A;  3VK9 A;  2GSS A;  2TRX A;  4IQ1 A;  4MPF A;  3FYG A;  3RAZ A;  4PTS A;  3NZN A;  4P3Y B;  2J23 A;  1GSS A;  1M2A A;  4LL1 B;  5DQS A;  3KTL A;  2IFQ A;  3HJM A;  2PPT A;  4HEA 2;  4O32 A;  2CX4 A;  2DKH A;  1SK2 A;  4PQH A;  2X8C A;  2LEG A;  1URM A;  4RQR A;  2HRK A;  3CBU A;  3TKS C;  4HZ4 A;  1V58 A;  2J9H A;  5JWO B;  3GKK A;  4XS1 A;  3HCZ A;  3D21 A;  2MZC A;  4MMM A;  1R5A A;  3UAR A;  5F06 A;  1XW9 A;  2GLR A;  2FA8 A;  3F6F A;  1WIK A;  4KDY A;  3SWL A;  2B5E A;  1BJX A;  3FRC A;  1EV9 A;  4JU5 A;  4WKW A;  3CMI A;  3ZRD A;  3GRX A;  3A5I A;  5IPH A;  1F2E A;  2JSZ A;  2REM A;  2V32 A;  2C0D A;  1RQM A;  4GXZ A;  2FGX A;  1SL2 B;  4F9Z A;  5A4U A;  1MD4 A;  2VD0 A;  2GST A;  5B8A A;  2GGT A;  3DIE A;  5A4W A;  3WD6 A;  1THX A;  4IW9 A;  2MBS A;  1GSF A;  2C8U A;  2P5Q A;  4HU9 A;  1BG5 A;  3ISO A;  1ZL9 A;  2JZS A;  3BJ5 A;  2A2P A;  2HSY A;  4HUA A;  1XZO A;  4N11 A;  1HNB A;  1X5C A;  4TN8 A;  5GST A;  2CVD A;  4F2I A;  4XS4 A;  2VAF A;  3ZZX A;  4K5S A;  2D2Z A;  1FB0 A;  1XWB A;  2DJ3 A;  1VRS D;  2H1D A;  3F8U A;  4EIQ A;  4ECJ A;  1Y25 A;  2JAD A;  2EIQ A;  2WZ9 A;  1U88 A;  4Z2U A;  1GSY A;  5DCH A;  3MDK A;  1OE8 A;  5ECK B;  4V2N A;  2LKU A;  2VL2 A;  1KNG A;  3O6T A;  3LEF A;  5IO2 A;  3TDG A;  5J9C A;  2QA2 A;  4IJI A;  3VPQ A;  3TJG A;  2H01 A;  2HRN A;  4YH2 A;  1CQH A;  2OJL A;  1XOB A;  2L59 A;  4NWY A;  1EEJ A;  1WMJ A;  2A2S A;  4JR4 A;  4I5Q A;  2N5A A;  2OA7 A;  5KN0 A;  2Z9S A;  3ZIJ A;  3IAM 2;  1FOV A;  4K5R A;  2X99 A;  5AIS A;  1Z3E A;  3ERF A;  2HRF A;  5AIV A;  4KND A;  2B5Y A;  5DAL B;  4WXT A;  1TDI A;  3BCK A;  3GYK A;  4HQZ A;  1XCC A;  4TR1 B;  2HFD A;  3EC3 A;  3H79 A;  5IMC A;  4PNG A;  4IJ3 A;  2WRT A;  4POB A;  4MF5 A;  1SK0 A;  4ISD A;  2AHE A;  4MNN A;  5J4U A;  2C3Q A;  2X49 A;  4IQA A;  1FO5 A;  3ZIT A;  2F3M A;  2YZH A;  1A2M A;  3F9U A;  2ZNM A;  3WT2 A;  1V2A A;  2VL2 C;  4TKY A;  4XRA A;  4RI6 A;  4OCE A;  2GS3 A;  2B1K A;  4Q5R A;  11GS A;  1LU4 A;  1SJ6 A;  4ZL8 A;  2CAQ A;  1MDK A;  3HJP A;  3IHQ A;  2OAD A;  3UJ1 A;  1OYJ A;  5D73 A;  3WGX A;  4J56 E;  3ZYW A;  4KUN A;  1N2A A;  4KCE A;  5IMV A;  2H0I A;  3H4K A;  3HY2 A;  3KM6 A;  5AN1 A;  1GTA A;  1EGR A;  2DJ2 A;  1JZW A;  1K0M A;  1FB6 A;  2ON5 A;  1XWG A;  3HDC A;  2HSH A;  5KN1 A;  5CRD A;  5LCZ A;  1X9W B;  2NDO A;  1F9M A;  2R0P A;  4MJB A;  2R3X A;  1X9S B;  3EIN A;  3LGC A;  3FR6 A;  1GNW A;  3D4M A;  2VLT A;  2RLI A;  2GQM A;  2FWE A;  3IAS 2;  1T3B A;  1GWC A;  1TTZ A;  2AB6 A;  3IPZ A;  2HXK A;  3CYN A;  4XS6 A;  3PIN A;  2F9S A;  5G5E A;  5CRG A;  1A2J A;  2VUP A;  2VIM A;  4DSR A;  1T4Z A;  4MH3 A;  4IP1 A;  2FLS A;  3KXO A;  1SKW B;  2K6V A;  2R0G A;  1PL2 A;  4EC0 A;  1EEM A;  3J7Y b;  3F6D A;  4RI7 A;  1Y6E A;  1S3A A;  3EVI A;  5G30 A;  5DAK B;  4YKG A;  1U3I A;  3LSZ A;  1NSW A;  4LMW A;  1FOH A;  2UZ8 A;  2O8V B;  4N0Z A;  4WEY A;  4IKH A;  3G7Y A;  3O3T A;  1TRW A;  1AAZ A;  4K0N A;  1JLV A;  5D8I A;  2O87 A;  4HJM A;  3F4R A;  1O8X A;  3FEU A;  3DWV A;  3A2X A;  2YWM A;  5D9W A;  5ELA A;  2L6D A;  5ECS A;  2RUE A;  4BVX A;  4DSS B;  2ALB A;  3WYW A;  4JBB A;  1YF0 A;  2DJ1 A;  2NVL A;  1NW2 A;  3EWL A;  2E2M A;  5F8B A;  1M2D A;  2IMF A;  1X5E A;  4XRD A;  2ES7 A;  1GUM A;  1GTI A;  5IOW A;  4ML1 A;  3M8N A;  4EDZ A;  4BPY A;  3IC4 A;  4ECI A;  3GFK A;  4X0X A;  2GVP A;  2VM1 A;  2OKA A;  1GL8 A;  1PRX A;  1CQG A;  1ZMA A;  2OE0 A;  4AJ6 A;  1UA5 A;  4PQI A;  1B9X C;  3P2A A;  2IPA A;  1UVZ A;  3IDV A;  3I69 A;  4L5L A;  4BVY A;  4CW9 A;  3M9K A;  1EV4 A;  1USB A;  5ID2 A;  5JWR B;  5DBQ A;  1Z7R A;  2CX3 A;  1GSQ A;  2K8S A;  2VL3 A;  3LQ7 A;  3RPP A;  2HRA A;  2H71 A;  1GUK A;  2F51 A;  2B1L A;  3I43 A;  1PX6 A;  4KW6 A;  3KMN A;  4D73 B;  3A5W A;  1PD2 1;  5EPF A;  3VI7 A;  3IR4 A;  3FW2 A;  4O7H A;  1IYH A;  1WE0 A;  2I81 A;  1OKT A;  5ELG A;  1DUG A;  4FO5 A;  3HKR A;  1TRS A;  3LYK A;  4AJ7 A;  4BL7 A;  2FUG 2;  1MDJ A;  5ECI B;  1F37 A;  1BX9 A;  5G2Z A;  2GDR A;  4IBP A;  2LRN A;  4G0L A;  4GQC A;  3O76 A;  2QKE A;  4TXO A;  1AXD A;  3VFI A;  8GSS A;  2C0G A;  2GSQ A;  1FAA A;  6GST A;  1O85 A;  3DXB A;  3NOF A;  1PMT A;  3FK8 A;  2AJQ B;  4WBR D;  4I97 A;  2LJR A;  4PX1 A;  3D5J A;  3APS A;  1AIU A;  5IMA A;  1G6W A;  3KMO A;  6GSU A;  3UL3 A;  1A0F A;  2H1A A;  4G2E A;  1VF3 A;  3KZQ A;  4IGJ A;  4PUR A;  1BQ7 A;  4FYC A;  2H6Y A;  4ZBA A;  2YWI A;  4YQU A;  1R4W A;  1TW9 A;  1M99 A;  3GMF A;  1NHO A;  3IRA A;  5CRH A;  3C1S A;  1ERV A;  1DE2 A;  3KTB A;  5KOW A;  4K8M A;  1GSU A;  4ICY A;  2MBT A;  1B8X A;  4NV5 A;  3C71 A;  2KUC A;  3HVS A;  2IMD A;  1K0C A;  3GHA A;  5EL8 A;  1K0A A;  3MNG A;  4HDE A;  4KAE A;  1V40 A;  1OC9 B;  1FHE A;  2LNT A;  2VCV A;  5DVB A;  5D9V A;  3IOS A;  4OWY A;  4JE1 A;  2YZU A;  5H5S A;  4HI7 A;  3GUR A;  1Q4J A;  3IC8 A;  1C72 A;  5J41 A;  2R6K A;  4POK A;  3ME8 A;  2PER A;  3WGE A;  2NPB A;  2E0Q A;  5HR3 A;  3F4T A;  4PNF A;  2GQL A;  4PUA A;  3BOA A;  2LNS A;  4KH7 A;  1E2Y A;  4Z7X A;  4YKF A;  2I1U A;  4ACS A;  1J0F A;  2MMZ A;  3QPM A;  1YZX A;  14GS A;  1QQ2 A;  1ACV A;  2KLX A;  1O8W A;  3DEX A;  1WPI A;  2VLV A;  3P7X A;  2M72 A;  3CTF A;  1A23 A;  3FKF A;  3UMA A;  1SL1 B;  1FVJ A;  4TR3 A;  4EKZ A;  3LXT A;  2FY6 A;  2HLS A;  2VL9 A;  5J3R A;  1A8Y A;  4LLR A;  1WP0 A;  2I4A A;  2WGR A;  1Z6M A;  5D9X A;  4Z2R A;  2FWG A;  2PU9 C;  3KEB A;  5GZZ B;  3LYP A;  3G7J A;  5KN3 A;  4G0K A;  5CP1 A;  2A4H A;  1O6J A;  2YN1 A;  3AY8 A;  4EDY A;  3GX8 A;  4ZB6 A;  3VPT A;  3M3M A;  3PGT A;  1O73 A;  2FD3 A;  4GQF A;  3IXR A;  2FNO A;  1YEP A;  3UVH A;  4ULX A;  2V2G A;  2WDU A;  4N30 A;  3BD2 A;  4CDO A;  2LQQ A;  1THO A;  4WF5 A;  3L4N A;  2CZ2 A;  4G19 A;  4NV2 A;  1YDK A;  3MSZ A;  3UBL A;  5JCG A;  1HNC A;  1V9W A;  1YJ6 A;  1SJI A;  1ST9 A;  1MTC A;  4NPB A;  4X4J A;  1GP1 A;  2YNX A;  3KIJ A;  1X5D A;  4I2T A;  3ZRE A;  1ZGN A;  1R7H A;  2OBI A;  3FMW A;  4EO3 A;  1TU8 A;  4L0U A;  4USS A;  4ZXG A;  2RUF A;  2XHF A;  3L9S A;  5HQP A;  3G9B A;  5FHI A;  2PUK C;  2PMT A;  4A5P A;  4CY8 A;  2IMK A;  1N8J A;  2IL3 A;  3GTU B;  2CA8 A;  3K8N A;  3WGD A;  4XTS A;  2IWT A;  2LST A;  1ERU A;  2HZE B;  5EVO A;  3GKN A;  4K2D A;  13GS A;  1ERW A;  4NHW A;  3Q19 A;  4OO5 A;  2YOI A;  3EMP A;  1YKA A;  1PQN A;  1GUL A;  3M0F A;  2NBS A;  1T00 A;  2XBI A;  5HR2 A;  3J7Y k;  3VWU A;  4K7O A;  4Z2T A;  4TXV A;  5IIZ A;  4X43 A;  5DJL A;  1K0B A;  4YAP A;  4F82 A;  1T7P B;  4HQS A;  5G31 A;  2FWF A;  4FIW A;  2L6C A;  4PXO A;  2PWJ A;  2C0E A;  4TRX A;  1B9Y C;  1B48 A;  2L5O A;  4MP4 A;  5IQY A;  5JWQ B;  3GIX A;  3GH9 A;  3RHB A;  4KB3 A;  2FWH A;  2GZZ A;  2IN3 A;  4GF0 A;  3ZTL A;  5G1L A;  3MAK A;  1XPV A;  1J9B A;  2IJY A;  4MF7 A;  3UBK A;  4MK3 A;  4L8E A;  4Q5Q A;  4Q5N A;  3TKQ A;  5HFI A;  5KOX A;  3W6G A;  2H74 A;  3LXZ A;  2VCQ A;  3CRT A;  3LOR A;  2I3Y A;  4TR1 A;  3ME7 A;  2LJK A;  5G5F A;  4QL9 A;  1Q98 A;  3MYD A;  3SBC A;  2JZT A;  3ZFB A;  5B8B A;  1OC3 A;  1TI3 A;  3HXS A;  1OKD A;  4K6X A;  5DQY A;  2K8V A;  1PKZ A;  3TKS E;  4KE3 A;  3ZML A;  2VCZ A;  4X1U A;  3UIW A;  4GLT A;  3C7M A;  2YV9 A;  2FA4 A;  3CTG A;  1GTU A;  3GKX A;  4V1A p;  2PVO C;  3RHC A;  3H1N A;  2PN8 A;  3FZ9 A;  4OFM A;  2MMA A;  4KGI A;  1BED A;  1ML6 A;  4ID0 A;  4AGS A;  1QFN A;  2DMM A;  4GRF A;  6GSY A;  2DIZ A;  3QFA C;  2C3N A;  4H86 A;  4ECC A;  4GSS A;  3F3Q A;  3DKS A;  6GSX A;  1TU7 A;  1GSD A;  2IIY A;  3TJK A;  4KX4 A;  1GUH A;  1XOA A;  5HR1 A;  2FHE A;  2C4J A;  3WT1 A;  4POL A;  1TKD B;  1UC7 A;  4NMU A;  3U5R E;  1ZYQ B;  1TK8 B;  4ILF A;  1A2L A;  3ZVJ A;  3TJB A;  1KEB A;  18GS A;  2IME A;  5IMD A;  3DML A;  2DBC A;  1EZK A;  1HD2 A;  1GLQ A;  1I5G A;  3EUR A;  2XPE A;  2KP1 A;  1HQO A;  1W89 A;  2YV7 A;  5IOX A;  5INY A;  3LFL A;  3GA4 A;  1O81 A;  1R26 A;  3PPU A;  1ZOF A;  2LV3 A;  3QCP A;  1TRU A;  3GUS A;  3US3 A;  3Q74 A;  2H75 A;  10GS A;  3EPT A;  3L0H A;  3KGK A;  3FZ4 A;  4JR6 A;  1TK5 B;  4KF9 A;  4ZBD A;  1GSE A;  3QAG A;  3IA1 A;  2EIR A;  1XVQ A;  1QMV A;  5DAK A;  5ECL B;  1MDI A;  3UEM A;  2VCT A;  2JU5 A;  2L4Q A;  1SYX A;  3A2W A;  2GQK A;  1WJK A;  3GN3 A;  2R4V A;  1SL0 B;  1E6B A;  2A2R A;  1XWK A;  4KSM A;  2DLX A;  4POM A;  3HHV A;  4JRR A;  4MJE A;  1IYI A;  1ON4 A;  1K0D A;  4BWQ A;  4DSQ A;  1A0R P;  3N9J A;  4DVC A;  4DSS A;  1UN2 A;  1VF1 A;  3CRU A;  1EGO A;  1NHY A;  1JLW A;  1ABA A;  2VOC A;  1U6T A;  5ENU A;  3QAV A;  2I9H A;  5F0G A;  4KCA A;  5IO0 A;  4EL1 A;  2PVQ A;  1EWX A;  1XW5 A;  1OVN A;  2HZF A;  1X9M B;  2R0C A;  1WOU A;  2GSR A;  3FZ5 A;  2DML A;  1U87 A;  2HNL A;  2L57 A;  3EYT A;  4L5O A;  3PH9 A;  3GV1 A;  1TI1 A;  1DBY A;  2KHP A;  5IM9 A;  2F8F A;  5B6M A;  3GL3 A;  5CNW A;  4LL4 B;  5L71 A;  1AQX A;  1SYR A;  4OCF A;  3R3E A;  2C1Y A;  5ECR B;  3A3T A;  1SK1 A;  3ERW A;  4OFT A;  3APQ A;  1QK8 A;  3CSJ A;  2N5B A;  3GX0 A;  3U6V A;  3FR9 A;  5A4V A;  5F05 A;  3ZVJ D;  5H5R A;  4HS1 A;  2H19 A;  3M1G A;  3TJF A;  2BJX A;  3G7I A;  4JZQ A;  3TRX A;  1M2B A;  2WS2 A;  1V98 A;  3JCM L;  2VO4 A;  4O5R A;  5DCG A;  2VM2 A;  2JL4 A;  5COH A;  3EMX A;  1EP7 A;  4GTU A;  3UVT A;  5J5N A;  4WR4 A;  4BWS A;  3C1R A;  3IBH A;  4N10 A;  7GSS A;  4HZ2 A;  1ZYP A;  3NIV A;  3QMX A;  1PSQ A;  2JSY A;  4ZIL A;  3ZLP A;  3P8W A;  2LQO A;  2VLU A;  2DC5 A;  2YWN A;  4F0C A;  1M0U A;  2JZR A;  2MMO A;  2QC7 A;  3Q18 A;  5LD0 A;  4EIP A;  16GS A;  4NXI A;  1TRV A;  2ZUP A;  2H66 A;  3KJY A;  3H8Q A;  2LTK A;  2H73 A;  2IFQ B;  2L4C A;  3RBT A;  2P0G A;  3EU4 A;  1HYU A;  1QGV A;  2GT6 A;  4V1A g;  1XWC A;  1TXX A;  2BMX A;  5C00 A;  2K9F A;  2NTO A;  1LBK A;  4MJA A;  3GH6 A;  1W4V A;  4TW5 A;  3KCM A;  2XPD A;  3F0I A;  5HFG A;  4EVM A;  4K7N A;  4YQM A;  5ECH B;  5E59 A;  2YAN A;  3N5O A;  2AYT A;  3W8S A;  2AV4 A;  4PUF C;  1YF1 A;  4AF2 A;  4F03 A;  1FVK A;  3W8J A;  4QL7 A;  3QD9 A;  3HVX A;  4K0G A;  3VI5 A;  5DJM A;  2OE1 A;  3RDW A;  3D22 A;  2GTU A;  2PGT A;  1OC9 A;  3QAW A;  4KSO A;  1AQV A;  4PGT A;  3HD5 A;  1FW1 A;  1PL1 A;  1PGT A;  2X8G A;  3GL5 A;  2RII A;  5GSS A;  1V57 A;  3F3R A;  1FG4 A;  2V1M A;  1PX7 A;  4MPG A;  1LJR A;  3VLN A;  3Q6O A;  4NAX A;  1TJD A;  3R2Q A;  4XS4 B;  1Z7P A;  4OMV A;  1PA3 A;  1XIY A;  4ZL9 A;  1OAZ A;  1B4P A;  3E3E A;  2MYG A;  4OD7 A;  5DDL A;  3MIX A;  1VGL A;  2R37 A;  4I8B A;  5B7C A;  1KBN A;  1F3B A;  3HZ8 A;  4ML6 A;  1RK4 A;  4FQU A;  5GAP D;  3HZ4 A;  1AC1 A;  5ECM B;  4LMV A;  3DRN A;  4L0W A;  1K0N A;  2CVK A;  1XVW A;  3LWA A;  2M80 A;  1U3A A;  3UAP A;  3DVX A;  3DYR A;  2WUL A;  4V2M A;  4GST A;  2B3S A;  4MF6 A;  2CAI A;  2YPM A;  1SD9 A;  1TP9 A;  3GNJ A;  1GNE A;  2X64 A;  1PN0 A;  5KEJ A;  1K3L A;  4FYU A;  4I2U A;  1EOH A;  3QR6 A;  1S3D A;  2R5G A;  2H76 A;  3LJR A;  2RM6 A;  3GSS A;  4JED A;  4HU7 A;  3HVV A;  4IHU A;  2CQ9 A;  4TVE A;  4J57 E;  5CRW A;  4YQV A;  2O85 A;  2JAC A;  5IMZ A;  3BBY A;  4K1F A;  1DE1 A;  2LUS A;  4MH2 A;  2LRC A;  4N0V A;  1F6M C;  2TIR A;  3TKR A;  4RUV A;  2MMN A;  4MDC A;  5A5K A;  1GRX A;  2GZP A;  4CHS A;  5CYY A;  2HI7 A;  2M46 A;  1OE7 A;  1Z9H A;  4HOJ A;  3TGZ A;  2ZCT A;  2C80 A;  5CAX A;  4EUY A;  2YJ7 A;  3L9V A;  3I6A A;  5ECO B;  1M9A A;  3IV4 A;  3TOT A;  4F0B A;  2OAC A;  4E8H A;  2E7P A;  20GS A;  4IEL A;  5ABR A;  2QA1 A;  2WFC A;  4KDU A;  3IHG A;  4BA7 A;  1A8L A;  1SKS B;  2F8A A;  2YJH A;  4AJ8 A;  6GSS A;  1Z6N A;  2O89 A;  5BRT A;  4YAV A;  5D9T A;  3F63 A;  1I9D A;  1AUC A;  5E4W A;  2N5F A;  2C3T A;  3F4S A;  4I6X A;  2HSM A;  3QFB C;  3GTU A;  1YY7 A;  2V6K A;  5DAL A;  3TB2 A;  4OO4 A;  5GAN D;  2HZE A;  3ZL5 A;  3ZMK A;  1AW9 A;  4IS0 A;  4XHM A;  4MJC A;  4G10 A;  2DKI A;  3QDN A;  1RW1 A;  5EY6 A;  3UOM A;  4K2X A;  12GS A;  1GH2 A;  1M7T A;  3DD3 A;  2G0F A;  2E2G A;  3DVW A;  3OR5 A;  1X0R A;  2OBK A;  4MA9 A;  2B5X A;  2H6X A;  2VD1 A;  1ZZY A;  2HE3 A;  1MEK A;  1SKR B;  2HYX A;  2KP2 A;  3TCO A;  3ZFL A;  3S9F A;  2DSA A;  1TK0 B;  1AQW A;  3C8E A;  1B4Q A;  3CSI A;  3EE2 A;  4WBJ A;  2XC2 A;  3HJO A;  2B6M A;  2H0H A;  4ZB8 A;  1T4Y A;  1SEN A;  1G0T A;  3EU3 A;  2B7J A;  3IE3 A;  3D6I A;  1SU9 A;  4FH8 A;  4TOP A;  5ECP B;  1O7U A;  3BCI A;  3C73 A;  4ZBB A;  4MZB A;  4BVX B;  2ON7 A;  3E9J B;  5IPG A;  2H1G A;  2DJK A;  4EF0 A;  1GLP A;  5CO3 A;  4GWR A;  1R5P A;  2V6O A;  1YKC A;  1DSB A;  3FR3 A;  4XCS A;  2H6Z A;  2BTO T;  1SJZ A;  5B6N A;  1XBS A;  3MWH A;  2P5R A;  5H5Q A;  3L78 A;  2CVB A;  2FCH A;  4FYB A;  3E0U A;  4O5Q A;  1WRY A;  5JCW A;  3CXG A;  4OFN A;  2V41 A;  3TKP A;  2G2Q A;  3PR8 A;  4ZB9 A;  5FWG A;  17GS A;  6GSV A;  3ERG A;  4BVY B;  4GSN A;  2HT9 A;  4CY6 A;  2YWO A;  5ID2 B;  3RPN A;  1QXH A;  2YCD A;  2R2J A;  19GS A;  4Q5F A;  2IMI A;  3VWV A;  3GST A;  2DJ0 A;  4IN0 A;  4RQX A;  1G7O A;  2XBQ A;  3GKM A;  5LNK e;  5J9B A;  3QOU A;  4K7I A;  4KA0 A;  6GSW A;  5G1K A;  3V1W A;  1XXU A;  1S3C A;  4WET A;  5BMU A;  1WWJ A;  1SD8 A;  1HNA A;  5ECQ B;  4J2F A;  2K18 A;  3FZA A;  1T1V A;  5AIX A;  5CRE A;  2L5L A;  3KP8 A;  2WB9 A;  4G9H A;  5FT3 A;  4IVF A;  1K0O A;  4BL7 B;  1H4O A;  2CV4 A;  1BAY A;  2H30 A;  2H0G A;  1A24 A;  3D0Z A;  5JCU A;  2AUV A;  3H93 A;  3LG6 A;  1K3O A;  4TXO B;  5ECN B;  3IK7 A;  4MAB A;  1JFU A;  4DEJ A;  3I9V 2;  1ZCP A;  1Z5Y E;  1JHB A;  3KD0 A;  2PBJ A;  3APO A;  1PKW A;  1YQ1 A;  5HR0 A;  1G6Y A;  1XW6 A;  5D93 A;  2GT5 A;  2KOK A;  3D4T A;  3KH7 A;  1PN9 A;  4HJ2 A;  3VWW A;  4MCU A;  4WR5 A;  1YEX A;  3TRP A;  4EXJ A;  5AGY A;  4KDX A;  3VUR A;  1BYE A;  4MZC A;  2C0F A;  1F3A A;  2WCI A;  2GZY A;  2RM5 A;  2X8H A;  2EC4 A;  1H75 A;  1J08 A;  2LRT A;  5HFK A;  3LW9 A;  4ECB A;  3L9U A;  1ZYN A;  1JZD A;  1M9B A;  22GS A;  5C04 A;  4TR4 A;  3FY7 A;  1XFL A;  3VWX A;  4XIH A;  4ZIJ A;  3IK9 A;  4V2L A;  1JZO A;  4NHZ A;  1ILO A;  2AAW A;  5IMF A;  4D73 A;  4MZW A;  2YP6 A;  2DIY A;  4MLY A;  2QSI A;  2H70 A;  1TOF A;  4LA1 A;  1VF4 A;  5D96 A;  3TRQ A;  3TOU A;  2TRC P;  2X4A A;  3ZIV A;  4EE0 A;  3KP9 A;  2P31 A;  4O5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...