1OAZA

Ige fv spe7 complexed with a recombinant thioredoxin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
122
structure length
115
Chain Sequence
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPIEESDDRRYDLVGPCKMIAPILDEILTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN 1
publication title Antibody Multispecificity Mediated by Conformational Diversity
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system
total genus 12
structure length 115
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1oazA00
4XS4A 3Q74A 4WF5A 2IN3A 4ZB9A 4D73B 1TRSA 1GTAA 2F8AA 2XBQA 3UEMA 4IBPA 3KTLA 5DJLA 2WB9A 3HD5A 3F0IA 3W8JA 2X64A 2B5YA 4LMVA 3GN3A 3HHVA 5ECPB 2WGRA 1GL8A 2HYXA 1EZKA 4GTUA 1O81A 5E59A 1DE2A 1TRVA 1BG5A 3EINA 2VCZA 2WULA 4TXVA 4OCFA 2GQMA 5JWOB 1O7UA 3GUSA 4EUYA 1QXHA 4L0UA 2BJXA 3NOFA 1FG4A 2QSIA 3DEXA 5B6NA 2B5XA 2LS5A 4N30A 3VWUA 3P7XA 2LRCA 3IOSA 2YCDA 2GSTA 5DALB 2H6XA 3GX0A 3UL3A 5LCZA 2PN8A 4KB3A 3ERFA 4YQMA 3EMXA 4F2IA 3FZ9A 3GKNA 12GSA 1URMA 3L4NA 2CX3A 4Z7XA 2IFQB 3P90A 4RQRA 1SD9A 5IIZA 5AN1A 1XWKA 2CZ2A 3IXRA 4X0XA 2H19A 4JEDA 4O32A 3GKMA 2CVDA 1S3AA 1V98A 4J56E 3TRPA 3TCOA 5KN3A 3EURA 4F0BA 2YZHA 2YWOA 3D5JA 1N8JA 4FYCA 4AF2A 2IIYA 4CW9A 2H8LA 5ECRB 4KSOA 3DD3A 3FR6A 4H86A 1UC7A 4I8BA 4DVCA 3KM6A 5IO2A 3Q19A 5JCGA 5ECLB 5J9BA 1QFNA 1RQMA 2K8SA 4N0ZA 3DKSA 1XBSA 2VLTA 2H6ZA 2JSZA 4TVEA 1ACVA 2C0EA 4FIWA 3FY7A 3EU4A 4I2TA 4BL7A 2I4AA 2WJUA 3LWAA 2DJ0A 3FZ5A 2JL4A 3ZVJD 5IQYA 3GH9A 5IMFA 4ZIJA 3HYPA 4IP6A 1GSUA 5J3RA 5HR0A 2C0DA 1GWCA 3APSA 3D22A 2FWGA 2MBTA 1SK2A 2FWFA 1GH2A 4N11A 5D9VA 2H74A 3IV4A 1VGLA 1B48A 1PX6A 2P0GA 3KP9A 4LLRA 1JZRA 3LSZA 2GZYA 4X1UA 2QC7A 5JWQB 3M8NA 1XXUA 4IQ1A 4PNFA 1XWAA 5AIVA 4FH8A 1U3AA 5A4VA 2FLSA 3UJ1A 1PGTA 1U88A 3UIWA 4PQHA 1MDKA 5KN0A 1SL2B 2J23A 2HZEA 5IOWA 1O6JA 2XC2A 2X8GA 1GULA 1KEBA 1PD21 3GKKA 2R3XA 3ZRDA 5A5KA 1B4PA 3ZTLA 2MYGA 2VL2A 3IAM2 1JZDA 1T3BA 2LUSA 4LMWA 5ECSA 4IELA 5AISA 4AJ8A 3GSTA 1GLPA 1PSQA 4HS1A 3WT1A 1VF1A 5ECIB 3NIVA 9GSSA 1MTCA 4K1FA 1NSWA 1S3DA 2WCIA 2AHEA 4LA1A 5DCGA 2C8UA 1TU8A 4KH7A 2H0HA 16GSA 2LRTA 4MPFA 3BBYA 1QK8A 1EP8A 1F3AA 1J0FA 5CRWA 2E2MA 2FGXA 4IQAA 1BX9A 3QAGA 4TR4A 4ILFA 3M3MA 3G9BA 1AW9A 1DE1A 2ALBA 2PWJA 2H75A 5IMAA 5JWRB 4QL9A 4XCSA 1TDIA 3LQ7A 4OWYA 1TXXA 4FYUA 5B6MA 2DC5A 3ZMLA 1Z5YE 1R5AA 3VWVA 2F8FA 2OACA 5DQSA 4RI6A 2GSQA 3C7MA 2KLXA 2JACA 2GZZA 3A2WA 1BYEA 2NDOA 1SL0B 1T4YA 3FRCA 2CVBA 4MPGA 1OC9B 3GRXA 5C04A 2R37A 1XCCA 2YJ7A 1F6MC 2C0GA 2C1YA 2JZTA 3GH6A 4EVMA 1XW5A 1PL2A 1XOBA 1Z6NA 3D6IA 1WOUA 3F6FA 4D73A 5DJMA 3IK7A 1WWJA 2CV4A 4KW6A 2K6VA 3C8EA 5CRGA 3F3QA 2ZUPA 1ERVA 3F9UA 2C0FA 2VO4A 1I5GA 2O85A 3FR3A 4ISDA 4EDZA 4XIHA 1GP1A 1EGOA 2PU9C 1Y6EA 1XWBA 1X5CA 1G7OA 3ZFBA 3ERGA 1YF0A 2O7KA 4ECJA 3IPZA 4XS6A 4HOJA 5JCWA 4WETA 2N5BA 3DWVA 1X9WB 1FOVA 6GSWA 2RLIA 5DALA 3GA4A 3KD0A 5L71A 5KN2A 1MDIA 4QL7A 2RUEA 2JSYA 1GSSA 2VAFA 1XWGA 1IYHA 2IFQA 5G31A 3WD6A 2DMLA 3VWXA 5IMCA 2C4JA 3G7IA 2GSSA 3DVXA 4O7HA 3ISOA 5FHIA 4MZBA 2E2GA 2PERA 4POLA 1HD2A 3KCMA 4K0NA 1K3YA 3H1NA 4FO5A 5CREA 5A4WA 1WMJA 1X5EA 3L9SA 3H4KA 3QR6A 4GSNA 4HZ4A 1O8WA 4Q5NA 2K18A 2LJAA 3ZITA 3TKQA 2LNSA 3A3TA 3DIEA 3Q18A 2C80A 5F8BA 3C71A 1GRXA 2CT6A 2B5EA 3HJOA 4IS0A 3M0FA 4ZL7A 1OKDA 4JU5A 1U6TA 1PQNA 2YP6A 1VRSD 1TI1A 2PMTA 4V1Ap 2MBSA 1EOHA 3FK8A 1A2MA 1B4QA 1OC3A 5IPGA 1GSDA 2OA7A 1JHBA 3KP8A 4GSTA 1YKAA 2H0GA 3EWLA 2JZSA 5CNWA 3VK9A 1QMVA 2Z9SA 1TJDA 1VF3A 3TJJA 1PN9A 4HU7A 4TKYA 1U87A 3F63A 2QGVA 2IMKA 3ZLPA 4EC0A 1GNWA 2IPAA 1GTIA 5ECQB 4RUVA 4JRRA 2AV4A 1SKRB 2F3MA 3G7JA 4POKA 5DCHA 1TRUA 4EL1A 2H71A 4TN8A 3QDNA 3QAVA 2GVPA 2YNXA 1TTZA 2XBIA 2DLXA 1FB6A 5IMVA 1Z7PA 4OO5A 3HY2A 2I3YA 4KCEA 3UOMA 5G1LA 2V1MA 4NHWA 2IWTA 5LD0A 3FZ4A 1TW9A 1EGRA 2FCHA 2P5RA 3APOA 4PNGA 3D4MA 2YANA 3C1RA 4JZQA 1CQGA 1E2YA 4NXIA 3RAZA 1GSYA 1R26A 2H0IA 2CAQA 4KUNA 1WJKA 2L5LA 3TKSC 2XPDA 2KUCA 1GUHA 2CA8A 1R7HA 4N10A 5DQYA 1O85A 3TKSA 2VD1A 1A0FA 3CXGA 3ME7A 1HYUA 2H1AA 3GL3A 1WIKA 1CQHA 5DAKA 2LKUA 2QKEA 4PX1A 4MJBA 6GSVA 3MAKA 2P5QA 1PX7A 1ZGNA 2PPTA 1TKDB 2B6MA 4YH2A 2FA4A 1XVQA 3BOAA 2JZRA 1Q98A 3CSIA 1GUMA 1IYIA 3EYTA 3CRTA 1V2AA 4NV2A 1M2DA 2EIRA 3CTGA 4IVFA 4IP1A 4IGJA 2FHEA 3QPMA 3IDVA 1OKTA 3G7YA 4PQIA 2PVOC 1J9BA 3CBUA 4XRAA 4ZB8A 1OC9A 1T4ZA 3F4SA 4HI7A 4FYBA 4KA0A 4NMUA 3W6GA 5D93A 2VM2A 1MDJA 1TI3A 4KAEA 5EY6A 2N5AA 4EKZA 2IMIA 2CQ9A 3H8QA 2B1KA 1EP7A 5F05A 1X5DA 3APQA 1WPIA 1A2JA 1TOFA 2M46A 5ELAA 2GDRA 2V6KA 2MMOA 5J9CA 3MWHA 5D96A 4EO3A 4L5LA 2H1DA 3UARA 5HFIA 3UVTA 5ECOB 2HE3A 4KX4A 3UVHA 3FW2A 2HLSA 2GT6A 4ML6A 3QOUA 4K6XA 3K8NA 5ENUA 4ML1A 4HU9A 3TDGA 3VI7A 1AQWA 1YY7A 1DUGA 1A0RP 4GQCA 3TOTA 1LJRA 5IO0A 5B7CA 2OJLA 4DSSB 3HA9A 4MZCA 2JU5A 2WZ9A 3S9FA 3U5RE 4MF6A 4WBJA 1LU4A 1TRWA 1M7TA 3FEUA 3J7Yk 1DBYA 1AXDA 2DMMA 3CRUA 1XWCA 2NPBA 4HQZA 4KSMA 2VCVA 2NTOA 2YV7A 4POMA 1HNBA 2VLVA 2TRCP 4F9ZA 3U6VA 3ZL5A 3GL5A 1YEPA 3IBHA 5KN1A 5D9WA 1K0OA 4GSSA 3MSZA 2L5OA 4K2DA 2BTOT 22GSA 5DBQA 2VL2C 4L8EA 3ZVJA 3J7Yb 2L6CA 1R4WA 3WGDA 3GX8A 4WEYA 3TRQA 2HXKA 3TKSE 5ECMB 2MMZA 1ERTA 4K7OA 3F3RA 4PUFC 2CAIA 4HJ2A 11GSA 1K3OA 3FKFA 2H30A 4YAPA 1F3BA 5CO3A 5ECKB 3W8SA 3DVWA 3EE2A 3I9V2 2L6DA 3O76A 3I6AA 4JBBA 3ZMKA 1XW9A 4I2UA 1YJ6A 1K0AA 1EV9A 1GLQA 1XFLA 3GTUB 3E9JB 1SK0A 5DAKB 5J41A 1ZOFA 1GUKA 4OFMA 4BVXA 1XVWA 1FAAA 2M72A 1FO5A 4Q5FA 1HQOA 2R4VA 4J57E 1BQ7A 1E6BA 4WR4A 5JCUA 2A2SA 1ML6A 4HUAA 4KNDA 3ME8A 4XHMA 3TKPA 5HR2A 1QQ2A 4ZBBA 2ON7A 2AB6A 1KTEA 4PUAA 1OYJA 4EF0A 5B8AA 2MMAA 2VLUA 5DDLA 4TR1B 2HZFA 4KGIA 1ZZYA 3FR9A 2VUPA 2C3TA 4TXOA 1RK4A 2B3SA 2AYTA 4ZB6A 2VL9A 1PKZA 1YZXA 2LTKA 4XTSA 2TRXA 3BJ5A 2VCXA 4X43A 1F2EA 6GSTA 4PXOA 4ECBA 3QCPA 1ZCPA 2AAWA 1SYRA 3D21A 1A24A 5C00A 4GWRA 1HNAA 1MD3A 1M99A 4RI7A 2X8HA 3KMOA 1ZYEA 1JFUA 2HNLA 2ZCTA 3ED3A 4MJCA 3LYPA 2X99A 4ULXA 1EV4A 2LRNA 4I97A 4OD7A 2L57A 2HFDA 4MK3A 2LNTA 3LXZA 19GSA 2F9SA 2DSAA 4MJAA 5G2ZA 4Q5RA 2WFCA 5D9TA 4PGTA 1SKSB 2CX4A 1M0UA 1TK5B 3GHAA 4ID0A 3ZIJA 4HEA2 3LGCA 3L0HA 4TW5A 4HJMA 3IR4A 1EEMA 1USBA 1VF2A 2PGTA 3TGZA 3EC3A 4K7IA 2VL3A 1GSFA 3FYGA 2GTUA 4F0CA 5AGYA 6GSUA 5DVBA 3CTFA 3O6TA 2O87A 3UAPA 2TIRA 1BJXA 3WT2A 1K0NA 3IA1A 4KDXA 4F82A 2BMXA 4GLTA 3ZREA 4V2MA 3IAS2 5AIXA 5D9XA 2HSYA 3EU3A 2OBIA 1T00A 2VCQA 2YWIA 3IHQA 5HFGA 4V1Ag 1V58A 4HZ2A 4TR0A 2FUG2 4DSRA 3GKXA 3TJFA 1AIUA 5GAND 2V32A 2GZPA 1M9AA 3OR5A 2L59A 2EIQA 3TOUA 6GSSA 3MDKA 1Z7RA 1Z3EA 1K0DA 3KJYA 3GYKA 2YJHA 1X9MB 2V2GA 3LORA 5IMZA 1G6YA 5G5EA 2VIMA 3SWLA 4MJEA 5FWGA 3QD9A 2DJ1A 3MNGA 4IJ3A 1PRXA 3HDCA 4DSSA 2AJQB 4PQ1A 13GSA 2GLRA 3PR8A 5GSTA 4IN0A 1T1VA 3KZQA 5KEJA 4IKHA 1NW2A 1SENA 1H4OA 4MH2A 2FY6A 3GV1A 4LL4B 4G2EA 2IMEA 4MH3A 1N2AA 4QQ7A 3IC4A 2L4QA 5EPFA 2JADA 1QUWA 1KNGA 2FD3A 1YEXA 1Y25A 6GSYA 1THXA 2XHFA 2YWNA 2D2ZA 5GZZB 4LL1B 4ACSA 4EE0A 3GSSA 4GCIA 5GAPD 1V9WA 4WR5A 5GSSA 3HKRA 4TXOB 1AUCA 4NHZA 5D8IA 3BCKA 3QMXA 1Z6MA 3LJRA 3F8UA 2WRTA 1OE8A 4OFNA 4RQXA 4J2FA 3TRXA 1A8YA 2LQQA 5ABRA 3IE3A 4WXTA 1S3CA 1OC8A 4TOPA 1O73A 1AC1A 1X0RA 5E4WA 3GTUA 1OVNA 1PA3A 2IMFA 3GURA 3L78A 3KEBA 3CSJA 4E8EA 1FVJA 1NHYA 1JZWA 2HSHA 3H79A 3I43A 1BAYA 5H5QA 4NPBA 3DGQA 1SD8A 4BWQA 1ERWA 2B7JA 4O92A 2H76A 2YZUA 1B8XA 3TKRA 2K8VA 3KIJA 1ZYQB 3ERWA 1FVKA 1ABAA 1W89A 3ZZXA 2O89A 4TR1A 7GSSA 1TP9A 2H01A 4AGSA 3DMLA 3E0UA 2DIZA 3DRNA 5LNKe 3I69A 5G1KA 1VF4A 4F03A 4BVYA 2H66A 2G2QA 2LV3A 4KE3A 4IJIA 2X8CA 4KDUA 1U3IA 5IPHA 1FW1A 4HDEA 3V1WA 3D0ZA 4DSQA 5J4UA 2IL3A 3KH9A 5CRHA 18GSA 1B9YC 2M80A 5CAXA 4ECCA 2V41A 1UA5A 1LBKA 2GGTA 2H1GA 2RM5A 4Q5QA 1XIYA 4ZXGA 1UN2A 1GTUA 2WDUA 3LYKA 3TUEA 2OE0A 4BPYA 5ID2B 4TRXA 1B9XC 1JZOA 3ZYWA 2B1LA 2FNOA 2OE3A 3GFKA 3O3TA 3A5WA 2ZNMA 3WYWA 1XW6A 2L4CA 4E8HA 5CRDA 4JR6A 2VM1A 1OAZA 4KCAA 2KOKA 1T7PB 4PURA 3M9JA 1GTBA 4POBA 4ZBAA 4MA9A 1SU9A 1K0MA 2YWMA 3AY8A 4L0WA 5ECHB 3UBLA 1HNCA 4AJ7A 4ZBDA 1EWXA 3P8WA 2XPEA 5CYYA 3HXSA 3HVXA 3FHKA 3CYNA 1YDKA 2VCTA 4YAVA 2GT5A 1SK1A 20GSA 4GQFA 2VD0A 3VPTA 2YV9A 4MP4A 1JLVA 3F6DA 3HVSA 3TJKA 2DJ2A 3FZAA 3BCIA 2FWEA 2LEGA 1A23A 3IRAA 2R2JA 3KXOA 4K0GA 3VPQA 4JR4A 4ZILA 5D73A 3SBCA 3VLNA 1M2AA 2KHPA 1YQ1A 4K9ZA 4WKWA 5G30A 1K0BA 2FA8A 2PBJA 1C72A 4OO4A 2A4VA 4GRFA 1WE0A 4XS4B 1ZMAA 2C3NA 4XRDA 4MMMA 3VURA 2VOCA 1V40A 2ES7A 5HR1A 1AAZA 2F51A 4BA7A 3DYRA 2O8VB 2DJKA 5A4UA 2LJKA 3LG6A 1M2BA 2V6OA 1MEKA 2NVLA 3F4TA 4TR3A 3NZNA 3RDWA 17GSA 3P2AA 2YPMA 4I5QA 5EL8A 3C1SA 1JLWA 5F06A 1NM3A 3IK9A 2PVQA 3QFBC 2DBCA 4GXZA 2LJRA 2R5GA 3CMIA 5CP1A 2VCWA 3ZIVA 3GMFA 3BD2A 3QFAC 1SKWB 1SJIA 1XZOA 2NBSA 3L9UA 4NAXA 1K3LA 2I81A 1J08A 2OBKA 1TU7A 4OFTA 5IM9A 4CHSA 2G0FA 4JE1A 3CSHA 3KH7A 4V2NA 1GNEA 1GSQA 3EMPA 2I9HA 3PH9A 1BEDA 1F9MA 1O8XA 1AQVA 1QGVA 3TJBA 1ZL9A 1GSEA 4BWSA 4MLYA 2OKAA 1V57A 1W4VA 2GQLA 2H72A 1ST9A 4XS1A 4V2LA 3VI5A 1DSBA 3KGKA 2H6YA 2LQOA 1EEJA 3HZ8A 5COHA 3RPNA 3JCML 3DXBA 4ZL8A 2KP2A 1K0CA 3R2QA 1NHOA 1WRYA 5EVOA 4EXJA 4K8MA 2I1UA 2J9HA 2A2RA 4IHUA 2EC4A 1PKWA 1XPVA 2GQKA 4G9HA 3HCZA 2C3QA 1TK8B 2E0QA 3Q6OA 3N9JA 3VFIA 2WS2A 3US3A 3N5OA 3F4RA 4NV5A 1SJZA 1R5PA 2DIYA 4MCUA 1WP0A 2CVKA 1RW1A 1H75A 2IJYA 4WF4A 4MZWA 2RUFA 4KDYA 3RPPA 3UMAA 5INYA 1G6WA 2LSTA 4P3YB 3VWWA 2IMDA 1ILOA 4YQUA 1YKCA 2REMA 3PGTA 4G19A 4EDYA 8GSSA 1PL1A 5FT3A 3TB2A 4NWYA 5J5NA 1EOGA 5IOXA 2E7PA 4AJ6A 3A2VA 1ERUA 2H1BA 3EVIA 3UBKA 1Z9HA 3HJMA 2GSRA 2P31A 3QAWA 1YF1A 4MABA 3ZFLA 4MF5A 1ON4A 2H73A 2MZCA 2HI7A 4I6XA 3RHBA 3GIXA 2ON5A 3WGEA 10GSA 1FHEA 1XOAA 4DEJA 3WGXA 2CZ3A 5ID2A 2RM6A 5ELGA 5F0GA 4YQVA 1A2LA 1A8LA 5HQPA 1PMTA 2HZEB 4G10A 3TJGA 2HRFA 2GS3A 5B8BA 1THOA 4ZL9A 3LFLA 4N0VA 5H5SA 1G7EA 2DJJA 1G0TA 1SYXA 6GSXA 4HQSA 5F07A 2YN1A 2R6KA 3H93A 3D4TA 3LXTA 2KP1A 1SJ6A 1M9BA 1I9DA 1OE7A 1FB0A 4GF0A 4WBRD 2MMNA 2HRNA 2RIIA 3KMNA 1TK0B 2YOIA 1X9SB 1T8EB 4L5OA 1Q4JA 1KBNA 4MF7A 5H5RA 2OE1A 2B7KA 2H70A 3E3EA 5HR3A 4MDCA 3RBTA 3LEFA 3C73A 3HZ4A 5ECNB 5HFKA 1AQXA 3PINA 2OADA 3HVVA 2FWHA 2N5FA 2DJ3A 4O5RA 4IW9A 4OMVA 4OCEA 3KTBA 1MD4A 2K9FA 3GNJA 5G5FA 3M9KA 4CDOA 1UVZA 3L9VA 4K7NA 1F37A 2PUKC 2HT9A 3M1GA 3A2XA 3RHCA 4ECIA 2EIOA 3HJPA 14GSA 5IMDA 2AUVA 1SL1B
chains in the Genus database with same CATH superfamily
4X4JA 4XS4A 3Q74A 4WF5A 2IN3A 4ZB9A 4D73B 1TRSA 1GTAA 2F8AA 2XBQA 3UEMA 4IBPA 3KTLA 5DJLA 2WB9A 3HD5A 3F0IA 3W8JA 2X64A 2B5YA 4LMVA 3GN3A 3HHVA 5ECPB 2WGRA 1GL8A 2HYXA 1EZKA 4GTUA 1O81A 5E59A 1DE2A 1TRVA 1BG5A 3EINA 2VCZA 2WULA 4TXVA 4OCFA 2GQMA 5JWOB 1O7UA 3GUSA 4EUYA 1QXHA 4L0UA 2BJXA 3NOFA 1FG4A 2QSIA 3DEXA 5B6NA 2B5XA 2LS5A 4N30A 3VWUA 3P7XA 2LRCA 3IOSA 2YCDA 2GSTA 5DALB 2H6XA 3GX0A 3UL3A 5LCZA 2PN8A 4KB3A 3ERFA 4YQMA 3EMXA 4F2IA 3FZ9A 3GKNA 12GSA 1URMA 3L4NA 2CX3A 4Z7XA 2IFQB 3P90A 4RQRA 1SD9A 5IIZA 5AN1A 1XWKA 2CZ2A 3IXRA 4X0XA 2H19A 4JEDA 4O32A 3GKMA 2CVDA 1S3AA 1V98A 4J56E 3TRPA 3TCOA 5KN3A 3EURA 4F0BA 2YZHA 2YWOA 3D5JA 1N8JA 4FYCA 4AF2A 2IIYA 4CW9A 2H8LA 5ECRB 4KSOA 3DD3A 3FR6A 4H86A 1UC7A 4I8BA 4DVCA 3KM6A 3FMWA 5IO2A 3Q19A 5JCGA 5ECLB 5J9BA 1QFNA 1RQMA 2K8SA 4N0ZA 3DKSA 1XBSA 2VLTA 3MIXA 2H6ZA 2JSZA 4CY6A 4TVEA 1ACVA 2C0EA 4FIWA 3FY7A 3EU4A 4I2TA 4BL7A 2I4AA 2WJUA 3LWAA 2DJ0A 3FZ5A 2JL4A 3ZVJD 5IQYA 3GH9A 3MYDA 5IMFA 4ZIJA 3HYPA 4IP6A 1GSUA 5J3RA 5HR0A 2C0DA 1GWCA 3APSA 3D22A 2FWGA 2MBTA 1SK2A 2FWFA 1GH2A 4N11A 5D9VA 2H74A 3IV4A 1VGLA 1B48A 1PX6A 2P0GA 1M3IA 3KP9A 4LLRA 1JZRA 3LSZA 2GZYA 4X1UA 2QC7A 5JWQB 4BIKA 3M8NA 1XXUA 4IQ1A 4PNFA 1XWAA 5AIVA 4FH8A 1U3AA 5A4VA 2FLSA 3UJ1A 1PGTA 1U88A 3UIWA 4PQHA 1MDKA 5KN0A 1SL2B 2J23A 2HZEA 5IOWA 1O6JA 2XC2A 2X8GA 1GULA 1KEBA 1PD21 3GKKA 2R3XA 3ZRDA 5A5KA 1B4PA 3ZTLA 2MYGA 2VL2A 3IAM2 1JZDA 1T3BA 2LUSA 4LMWA 5ECSA 4IELA 5AISA 4AJ8A 3GSTA 1GLPA 1PSQA 4HS1A 3WT1A 1VF1A 5ECIB 3NIVA 9GSSA 1MTCA 4K1FA 1NSWA 1S3DA 2WCIA 2AHEA 4LA1A 5DCGA 2C8UA 1TU8A 4KH7A 2H0HA 16GSA 2LRTA 4MPFA 3BBYA 1QK8A 1EP8A 1F3AA 1J0FA 5CRWA 2E2MA 2FGXA 4IQAA 1BX9A 3QAGA 4TR4A 4ILFA 3M3MA 3G9BA 1AW9A 1DE1A 2ALBA 2PWJA 2H75A 5IMAA 5JWRB 4QL9A 4XCSA 1TDIA 3LQ7A 4OWYA 1TXXA 4FYUA 5B6MA 2DC5A 3ZMLA 1Z5YE 1R5AA 3VWVA 2F8FA 2OACA 5DQSA 4RI6A 2GSQA 3C7MA 2KLXA 4Z2TA 2JACA 2GZZA 3A2WA 1BYEA 2NDOA 1SL0B 1T4YA 3FRCA 2CVBA 4MPGA 1OC9B 3GRXA 5C04A 2R37A 1XCCA 2YJ7A 1F6MC 2C0GA 2C1YA 2JZTA 3GH6A 4EVMA 4EIQA 1XW5A 1PL2A 1XOBA 1Z6NA 3D6IA 1WOUA 3F6FA 4D73A 5DJMA 3IK7A 1WWJA 2CV4A 4KW6A 2K6VA 3C8EA 5CRGA 3F3QA 2ZUPA 1ERVA 3F9UA 2C0FA 2VO4A 1I5GA 2O85A 3FR3A 4ISDA 4EDZA 4XIHA 1GP1A 1EGOA 2PU9C 1Y6EA 1XWBA 1X5CA 1G7OA 3ZFBA 3ERGA 1YF0A 2O7KA 4ECJA 3IPZA 4XS6A 4HOJA 5JCWA 4WETA 2N5BA 3DWVA 4KF9A 1X9WB 1FOVA 6GSWA 2RLIA 5DALA 3GA4A 3KD0A 5L71A 5KN2A 1MDIA 4QL7A 2RUEA 2JSYA 1GSSA 2VAFA 1XWGA 1IYHA 2IFQA 5G31A 3WD6A 2DMLA 3VWXA 5IMCA 2C4JA 3G7IA 2GSSA 2X49A 3DVXA 4O7HA 4Z2RA 3ISOA 5FHIA 4MZBA 2E2GA 2PERA 4POLA 1HD2A 3KCMA 4K0NA 1K3YA 3H1NA 4FO5A 5CREA 5A4WA 1WMJA 1X5EA 3L9SA 3H4KA 3QR6A 4GSNA 4HZ4A 1O8WA 4Q5NA 1XG8A 2K18A 2LJAA 3ZITA 3TKQA 2LNSA 3A3TA 3DIEA 3Q18A 2C80A 5F8BA 3C71A 1GRXA 2CT6A 2B5EA 3HJOA 4IS0A 3M0FA 4ZL7A 1OKDA 4JU5A 1U6TA 1PQNA 2YP6A 1VRSD 1TI1A 2PMTA 4V1Ap 2MBSA 1EOHA 3FK8A 1A2MA 1B4QA 5KOWA 1OC3A 5IPGA 1GSDA 2OA7A 1JHBA 3KP8A 4GSTA 1YKAA 2H0GA 3EWLA 2JZSA 5CNWA 3VK9A 1QMVA 2Z9SA 1TJDA 1VF3A 3TJJA 1PN9A 4HU7A 4TKYA 1U87A 3F63A 2QGVA 2IMKA 3ZLPA 4EC0A 1GNWA 2IPAA 1GTIA 5ECQB 4RUVA 4JRRA 2AV4A 1SKRB 2F3MA 3G7JA 4POKA 5DCHA 1TRUA 4EL1A 2H71A 4TN8A 3QDNA 4BVXB 4YKGA 4PTSA 3QAVA 2GVPA 2YNXA 1TTZA 2XBIA 2DLXA 1FB6A 5IMVA 1Z7PA 4OO5A 3HY2A 2I3YA 4KCEA 3UOMA 5G1LA 2V1MA 4NHWA 2IWTA 5LD0A 3FZ4A 1TW9A 1EGRA 2FCHA 2P5RA 3APOA 4PNGA 3D4MA 2YANA 3C1RA 4JZQA 1CQGA 1E2YA 4NXIA 3RAZA 1GSYA 1R26A 2H0IA 2CAQA 4KUNA 1WJKA 2L5LA 3TKSC 2XPDA 2KUCA 1GUHA 2CA8A 1R7HA 4N10A 5DQYA 5KOXA 1O85A 3TKSA 2VD1A 1A0FA 3CXGA 3ME7A 1HYUA 2H1AA 3GL3A 1WIKA 1CQHA 5DAKA 2LKUA 2QKEA 4PX1A 4MJBA 6GSVA 3MAKA 2P5QA 1PX7A 1ZGNA 2PPTA 1TKDB 2B6MA 4YH2A 2FA4A 1XVQA 3BOAA 2JZRA 1Q98A 3CSIA 1GUMA 1IYIA 3EYTA 3CRTA 1V2AA 4NV2A 1M2DA 2EIRA 3CTGA 4IVFA 4IP1A 4IGJA 2FHEA 3QPMA 3IDVA 1OKTA 3G7YA 4PQIA 2PVOC 1J9BA 3CBUA 4XRAA 4ZB8A 3A5IA 1OC9A 1T4ZA 3F4SA 4HI7A 4FYBA 4KA0A 4NMUA 3W6GA 5D93A 2VM2A 1MDJA 1TI3A 4KAEA 2QA2A 5EY6A 2N5AA 4G0IA 4EKZA 2IMIA 2CQ9A 3H8QA 2B1KA 1EP7A 5F05A 1X5DA 3APQA 1WPIA 1A2JA 1TOFA 2M46A 5ELAA 2GDRA 2V6KA 2MMOA 5J9CA 4O5QA 3MWHA 5D96A 4EO3A 4L5LA 4EIPA 2H1DA 3UARA 5HFIA 3UVTA 5ECOB 2HE3A 4KX4A 3UVHA 3FW2A 2HLSA 2GT6A 4ML6A 3QOUA 4YKFA 4K6XA 3K8NA 5ENUA 4ML1A 4HU9A 3TDGA 3VI7A 1AQWA 1YY7A 1DUGA 1A0RP 4GQCA 3TOTA 1LJRA 5IO0A 5B7CA 2OJLA 4DSSB 3HA9A 4MZCA 2JU5A 2WZ9A 3S9FA 3U5RE 4MF6A 4WBJA 1LU4A 1S3RA 1TRWA 1M7TA 3FEUA 3J7Yk 2R0CA 1DBYA 1AXDA 2DMMA 3CRUA 1XWCA 2NPBA 4HQZA 4KSMA 2VCVA 2NTOA 2YV7A 4POMA 1HNBA 2VLVA 2TRCP 4F9ZA 3U6VA 3ZL5A 4K2XA 3GL5A 1YEPA 3IBHA 5KN1A 5D9WA 1K0OA 4GSSA 3MSZA 2L5OA 4K2DA 2BTOT 22GSA 5DBQA 4CY8A 2VL2C 4L8EA 2A2PA 3ZVJA 3J7Yb 2L6CA 1R4WA 3WGDA 3GX8A 4WEYA 3TRQA 2HXKA 3TKSE 5ECMB 2MMZA 1ERTA 4HSCX 4K7OA 3F3RA 4PUFC 2CAIA 4HJ2A 11GSA 1K3OA 3FKFA 2H30A 4YAPA 1F3BA 5CO3A 5ECKB 3W8SA 3DVWA 3EE2A 3I9V2 2L6DA 3O76A 3I6AA 4JBBA 3ZMKA 1XW9A 4I2UA 1YJ6A 1K0AA 1EV9A 1GLQA 1XFLA 3GTUB 3E9JB 1SK0A 5DAKB 5BMUA 5J41A 1ZOFA 1GUKA 4OFMA 4BVXA 1XVWA 1FAAA 2M72A 1FO5A 4Q5FA 1ZYNA 1HQOA 2R4VA 4J57E 1BQ7A 1E6BA 4WR4A 5JCUA 2A2SA 1ML6A 3PPUA 4HUAA 4KNDA 3ME8A 4XHMA 3TKPA 5HR2A 1QQ2A 4ZBBA 2ON7A 2AB6A 1KTEA 4PUAA 1OYJA 2HRKA 4EF0A 5B8AA 2MMAA 2X4AA 4K5RA 2VLUA 5DDLA 4TR1B 2HZFA 4KGIA 1ZZYA 3FR9A 2VUPA 2C3TA 4TXOA 1RK4A 2B3SA 4Z2UA 2AYTA 4ZB6A 2VL9A 1PKZA 1YZXA 2LTKA 4XTSA 2TRXA 3BJ5A 3HVNA 2VCXA 4X43A 1F2EA 6GSTA 4PXOA 4ECBA 3QCPA 1ZCPA 2AAWA 4G0KA 1SYRA 3D21A 1A24A 5C00A 4GWRA 1HNAA 1MD3A 1M99A 4RI7A 2X8HA 3KMOA 1ZYEA 1JFUA 2HNLA 2ZCTA 3ED3A 4MJCA 3LYPA 2X99A 4ULXA 1EV4A 2LRNA 4I97A 4OD7A 2L57A 2HFDA 4MK3A 2LNTA 3LXZA 19GSA 2F9SA 2DSAA 4MJAA 5G2ZA 5BRTA 4Q5RA 2WFCA 5D9TA 4PGTA 3IHGA 1SKSB 4A5PA 2CX4A 1M0UA 1TK5B 3GHAA 4ID0A 3ZIJA 4HEA2 3LGCA 3L0HA 4TW5A 4HJMA 3IR4A 1EEMA 1USBA 1VF2A 2PGTA 3TGZA 3EC3A 4K7IA 2VL3A 1GSFA 3FYGA 2GTUA 4F0CA 5AGYA 6GSUA 5DVBA 3CTFA 3O6TA 2O87A 3UAPA 2TIRA 1BJXA 3WT2A 1K0NA 3IA1A 4KDXA 4F82A 2BMXA 4GLTA 3ZREA 4V2MA 3IAS2 5AIXA 5D9XA 2HSYA 3EU3A 2OBIA 1T00A 2VCQA 2YWIA 3IHQA 5HFGA 4V1Ag 1V58A 4HZ2A 4TR0A 2FUG2 4DSRA 3GKXA 3TJFA 1AIUA 2DKHA 5GAND 1ZYPA 2V32A 2GZPA 1M9AA 3OR5A 2L59A 2EIQA 3TOUA 6GSSA 4O5UA 3MDKA 1Z7RA 1Z3EA 1K0DA 3KJYA 4G0LA 3GYKA 2YJHA 1X9MB 2V2GA 3LORA 5IMZA 1G6YA 5G5EA 2VIMA 3SWLA 4MJEA 5FWGA 3QD9A 2DJ1A 3MNGA 4IJ3A 1PRXA 3HDCA 4DSSA 2AJQB 4PQ1A 13GSA 2GLRA 3PR8A 5GSTA 4IN0A 1T1VA 3KZQA 5KEJA 4IKHA 1NW2A 1SENA 1H4OA 2UZ8A 4MH2A 2FY6A 3GV1A 4LL4B 4G2EA 2IMEA 4MH3A 1N2AA 4QQ7A 3IC4A 2L4QA 5EPFA 2JADA 1QUWA 1KNGA 2FD3A 1YEXA 1Y25A 6GSYA 1THXA 2XHFA 2YWNA 2D2ZA 2HSMA 5GZZB 4LL1B 4ACSA 4EE0A 3GSSA 4GCIA 5GAPD 1V9WA 4WR5A 5GSSA 3HKRA 4TXOB 2QA1A 1AUCA 4NHZA 5D8IA 3BCKA 3QMXA 1Z6MA 3LJRA 3F8UA 2WRTA 1OE8A 4OFNA 4RQXA 4J2FA 3TRXA 1A8YA 2LQQA 5ABRA 3IE3A 4WXTA 1S3CA 1OC8A 4TOPA 1O73A 1AC1A 1X0RA 5E4WA 3GTUA 1OVNA 1PA3A 2IMFA 3GURA 3L78A 3KEBA 3CSJA 4E8EA 4USSA 2R0PA 1FVJA 1NHYA 1JZWA 2HSHA 3H79A 3I43A 1BAYA 5H5QA 4NPBA 3DGQA 1SD8A 4BWQA 1ERWA 2B7JA 4O92A 2H76A 2YZUA 1B8XA 3TKRA 2K8VA 2A4HA 3KIJA 1ZYQB 3ERWA 1FVKA 1ABAA 1W89A 3ZZXA 2O89A 4TR1A 7GSSA 1TP9A 2H01A 4AGSA 3DMLA 3E0UA 2DIZA 3DRNA 5LNKe 3I69A 5G1KA 1VF4A 4F03A 4BVYA 2H66A 2G2QA 2LV3A 4KE3A 4IJIA 2X8CA 4KDUA 1U3IA 5IPHA 1FW1A 4HDEA 3V1WA 3D0ZA 4DSQA 5J4UA 2IL3A 3KH9A 5CRHA 18GSA 1B9YC 2M80A 5CAXA 4ECCA 2V41A 1UA5A 1LBKA 2GGTA 2H1GA 3LW9A 2RM5A 4Q5QA 1XIYA 4ZXGA 1UN2A 1GTUA 2WDUA 3LYKA 3TUEA 2OE0A 4BPYA 5ID2B 4TRXA 1B9XC 1JZOA 3ZYWA 2B1LA 2FNOA 2OE3A 3GFKA 3O3TA 3A5WA 2ZNMA 3WYWA 1XW6A 2L4CA 4E8HA 5CRDA 4JR6A 2VM1A 1OAZA 4KCAA 2KOKA 1T7PB 4PURA 3M9JA 1GTBA 4POBA 4ZBAA 4MA9A 1SU9A 1K0MA 2YWMA 3AY8A 4L0WA 5ECHB 3UBLA 1HNCA 4AJ7A 4ZBDA 1EWXA 3P8WA 2XPEA 5CYYA 3HXSA 3HVXA 3FHKA 3CYNA 1YDKA 2VCTA 4YAVA 2GT5A 1SK1A 4K5SA 20GSA 4GQFA 2VD0A 3VPTA 2YV9A 4MP4A 1JLVA 3F6DA 3HVSA 3TJKA 2DJ2A 3FZAA 3BCIA 4FQUA 2FWEA 2LEGA 1A23A 2R0GA 3IRAA 2R2JA 3KXOA 4K0GA 3VPQA 4JR4A 4ZILA 5D73A 3SBCA 3VLNA 1M2AA 2KHPA 1YQ1A 4K9ZA 4WKWA 5G30A 1K0BA 2FA8A 2PBJA 1C72A 4OO4A 2A4VA 4GRFA 1WE0A 4XS4B 1ZMAA 2C3NA 4XRDA 4MMMA 3VURA 2VOCA 1V40A 2ES7A 5HR1A 1AAZA 2F51A 4BA7A 3DYRA 2O8VB 2DJKA 1M3JA 5A4UA 2LJKA 3LG6A 1M2BA 2V6OA 1MEKA 2NVLA 3F4TA 4TR3A 3NZNA 3CQFA 3RDWA 17GSA 3P2AA 2YPMA 4I5QA 5EL8A 3C1SA 1JLWA 5F06A 1NM3A 3IK9A 2PVQA 3QFBC 2DBCA 4GXZA 2LJRA 2R5GA 3IC8A 3CMIA 5CP1A 2VCWA 3ZIVA 3GMFA 3BD2A 3QFAC 1SKWB 1SJIA 1XZOA 2NBSA 3L9UA 4NAXA 1K3LA 2I81A 1J08A 2OBKA 1TU7A 4OFTA 5IM9A 4CHSA 2G0FA 4JE1A 2DKIA 3CSHA 3KH7A 4V2NA 1GNEA 1GSQA 4BVYB 3EMPA 2I9HA 3PH9A 1BEDA 1F9MA 1O8XA 1AQVA 1QGVA 3TJBA 1ZL9A 1GSEA 4BWSA 4MLYA 2OKAA 1V57A 1W4VA 2GQLA 2H72A 1ST9A 4XS1A 4V2LA 3VI5A 1PFOA 1DSBA 3KGKA 2H6YA 2LQOA 1EEJA 3HZ8A 5COHA 3RPNA 3JCML 2HRAA 3DXBA 4ZL8A 2KP2A 1K0CA 3R2QA 1NHOA 1WRYA 5EVOA 4EXJA 3R3EA 2I1UA 4K8MA 2J9HA 2A2RA 4IHUA 2EC4A 1PKWA 1XPVA 2GQKA 4G9HA 3HCZA 2C3QA 1TK8B 2E0QA 3Q6OA 3N9JA 3VFIA 2WS2A 3US3A 1PN0A 3N5OA 3F4RA 4NV5A 1SJZA 1R5PA 2DIYA 4MCUA 4BL7B 1WP0A 2CVKA 1RW1A 1H75A 2IJYA 4WF4A 4MZWA 2RUFA 4KDYA 3RPPA 3UMAA 5INYA 1G6WA 2LSTA 4P3YB 3VWWA 2IMDA 1ILOA 4YQUA 1YKCA 2REMA 3PGTA 4G19A 4EDYA 8GSSA 1PL1A 5FT3A 3TB2A 4NWYA 5J5NA 1EOGA 5IOXA 2E7PA 4AJ6A 3A2VA 1ERUA 2H1BA 3EVIA 3UBKA 1Z9HA 3HJMA 2GSRA 2P31A 3QAWA 1YF1A 4MABA 3ZFLA 4MF5A 1ON4A 2H73A 2MZCA 1FOHA 2HI7A 4I6XA 3RHBA 3GIXA 2ON5A 3WGEA 10GSA 1FHEA 1XOAA 4DEJA 3WGXA 2CZ3A 5ID2A 2RM6A 5ELGA 5F0GA 4YQVA 1A2LA 1A8LA 5HQPA 1PMTA 2HZEB 4G10A 3TJGA 3EPTA 2HRFA 4MNNA 2GS3A 5B8BA 1THOA 4ZL9A 4ICYA 3LFLA 4N0VA 5H5SA 1G7EA 2DJJA 1G0TA 1SYXA 6GSXA 4HQSA 5F07A 2YN1A 2R6KA 3H93A 3D4TA 3LXTA 2KP1A 1SJ6A 1M9BA 1I9DA 1OE7A 1FB0A 4GF0A 4WBRD 2MMNA 2HRNA 2RIIA 3KMNA 1TK0B 2YOIA 1X9SB 1T8EB 4L5OA 1Q4JA 1KBNA 4MF7A 5H5RA 2OE1A 2B7KA 2H70A 3E3EA 5HR3A 4MDCA 3RBTA 3LEFA 3C73A 3HZ4A 5ECNB 5HFKA 1AQXA 3PINA 2OADA 3HVVA 2FWHA 2N5FA 2DJ3A 4O5RA 4IW9A 4OMVA 4OCEA 3KTBA 1MD4A 2K9FA 3GNJA 5G5FA 3M9KA 4CDOA 1UVZA 3L9VA 4K7NA 1F37A 2PUKC 2HT9A 3M1GA 3A2XA 3RHCA 4ECIA 2EIOA 3HJPA 14GSA 5IMDA 2AUVA 1SL1B
chains in the Genus database with same CATH topology
4X4JA 4XS4A 3Q74A 4WF5A 2IN3A 4ZB9A 4D73B 1TRSA 1GTAA 2F8AA 2XBQA 3UEMA 4IBPA 3KTLA 5DJLA 2WB9A 3HD5A 3F0IA 3W8JA 2X64A 2B5YA 4LMVA 3GN3A 3HHVA 5ECPB 2WGRA 1GL8A 2HYXA 1EZKA 4GTUA 1O81A 5E59A 1DE2A 1TRVA 1BG5A 3EINA 2VCZA 2WULA 4TXVA 4OCFA 2GQMA 5JWOB 1O7UA 3GUSA 4EUYA 1QXHA 4L0UA 2BJXA 3NOFA 1FG4A 2QSIA 3DEXA 5B6NA 2B5XA 2LS5A 4N30A 3VWUA 3P7XA 2LRCA 3IOSA 2YCDA 2GSTA 5DALB 2H6XA 3GX0A 3UL3A 5LCZA 2PN8A 4KB3A 3ERFA 4YQMA 3EMXA 4F2IA 3FZ9A 3GKNA 12GSA 1URMA 3L4NA 2CX3A 4Z7XA 2IFQB 3P90A 4RQRA 1SD9A 5IIZA 5AN1A 1XWKA 2CZ2A 3IXRA 4X0XA 2H19A 4JEDA 4O32A 3GKMA 2CVDA 1S3AA 1V98A 4J56E 3TRPA 3TCOA 5KN3A 3EURA 4F0BA 2YZHA 2YWOA 3D5JA 1N8JA 4FYCA 4AF2A 2IIYA 4CW9A 2H8LA 5ECRB 4KSOA 3DD3A 3FR6A 4H86A 1UC7A 4I8BA 4DVCA 3KM6A 3FMWA 5IO2A 3Q19A 5JCGA 5ECLB 5J9BA 1QFNA 1RQMA 2K8SA 4N0ZA 3DKSA 1XBSA 2VLTA 3MIXA 2H6ZA 2JSZA 4CY6A 4TVEA 1ACVA 2C0EA 4FIWA 3FY7A 3EU4A 4I2TA 4BL7A 2I4AA 2WJUA 3LWAA 2DJ0A 3FZ5A 2JL4A 3ZVJD 5IQYA 3GH9A 3MYDA 5IMFA 4ZIJA 3HYPA 4IP6A 1GSUA 5J3RA 5HR0A 2C0DA 1GWCA 3APSA 3D22A 2FWGA 2MBTA 1SK2A 2FWFA 1GH2A 4N11A 5D9VA 2H74A 3IV4A 1VGLA 1B48A 1PX6A 2P0GA 3KP9A 4LLRA 1JZRA 3LSZA 2GZYA 4X1UA 2QC7A 5JWQB 3M8NA 1XXUA 4IQ1A 4PNFA 1XWAA 5AIVA 4FH8A 1U3AA 5A4VA 2FLSA 3UJ1A 1PGTA 1U88A 3UIWA 4PQHA 1MDKA 5KN0A 1SL2B 2J23A 2HZEA 5IOWA 1O6JA 2XC2A 2X8GA 1GULA 1KEBA 1PD21 3GKKA 2R3XA 3ZRDA 5A5KA 1B4PA 3ZTLA 2MYGA 2VL2A 3IAM2 1JZDA 1T3BA 2LUSA 4LMWA 5ECSA 4IELA 5AISA 4AJ8A 3GSTA 1GLPA 1PSQA 4HS1A 3WT1A 1VF1A 5ECIB 3NIVA 9GSSA 1MTCA 4K1FA 1NSWA 1S3DA 2WCIA 2AHEA 4LA1A 5DCGA 2C8UA 1TU8A 4KH7A 2H0HA 16GSA 2LRTA 4MPFA 3BBYA 1QK8A 1EP8A 1F3AA 1J0FA 5CRWA 2E2MA 2FGXA 4IQAA 1BX9A 3QAGA 4TR4A 4ILFA 3M3MA 3G9BA 1AW9A 1DE1A 2ALBA 2PWJA 2H75A 5IMAA 5JWRB 4QL9A 4XCSA 1TDIA 3LQ7A 4OWYA 1TXXA 4FYUA 5B6MA 2DC5A 3ZMLA 1Z5YE 1R5AA 3VWVA 2F8FA 2OACA 5DQSA 4RI6A 2GSQA 3C7MA 2KLXA 4Z2TA 2JACA 2GZZA 3A2WA 1BYEA 2NDOA 1SL0B 1T4YA 3FRCA 2CVBA 4MPGA 1OC9B 3GRXA 5C04A 2R37A 1XCCA 2YJ7A 1F6MC 2C0GA 2C1YA 2JZTA 3GH6A 4EVMA 4EIQA 1XW5A 1PL2A 1XOBA 1Z6NA 3D6IA 1WOUA 3F6FA 4D73A 5DJMA 3IK7A 1WWJA 2CV4A 4KW6A 2K6VA 3C8EA 5CRGA 3F3QA 2ZUPA 1ERVA 3F9UA 2C0FA 2VO4A 1I5GA 2O85A 3FR3A 4ISDA 4EDZA 4XIHA 1GP1A 1EGOA 2PU9C 1Y6EA 1XWBA 1X5CA 1G7OA 3ZFBA 3ERGA 1YF0A 2O7KA 4ECJA 3IPZA 4XS6A 4HOJA 5JCWA 4WETA 2N5BA 3DWVA 4KF9A 1X9WB 1FOVA 6GSWA 2RLIA 5DALA 3GA4A 3KD0A 5L71A 5KN2A 1MDIA 4QL7A 2RUEA 2JSYA 1GSSA 2VAFA 1XWGA 1IYHA 2IFQA 5G31A 3WD6A 2DMLA 3VWXA 5IMCA 2C4JA 3G7IA 2GSSA 2X49A 3DVXA 4O7HA 4Z2RA 3ISOA 5FHIA 4MZBA 2E2GA 2PERA 4POLA 1HD2A 3KCMA 4K0NA 1K3YA 3H1NA 4FO5A 5CREA 5A4WA 1WMJA 1X5EA 3L9SA 3H4KA 3QR6A 4GSNA 4HZ4A 1O8WA 4Q5NA 2K18A 2LJAA 3ZITA 3TKQA 2LNSA 3A3TA 3DIEA 3Q18A 2C80A 5F8BA 3C71A 1GRXA 2CT6A 2B5EA 3HJOA 4IS0A 3M0FA 4ZL7A 1OKDA 4JU5A 1U6TA 1PQNA 2YP6A 1VRSD 1TI1A 2PMTA 4V1Ap 2MBSA 1EOHA 3FK8A 1A2MA 1B4QA 5KOWA 1OC3A 5IPGA 1GSDA 2OA7A 1JHBA 3KP8A 4GSTA 1YKAA 2H0GA 3EWLA 2JZSA 5CNWA 3VK9A 1QMVA 2Z9SA 1TJDA 1VF3A 3TJJA 1PN9A 4HU7A 4TKYA 1U87A 3F63A 2QGVA 2IMKA 3ZLPA 4EC0A 1GNWA 2IPAA 1GTIA 5ECQB 4RUVA 4JRRA 2AV4A 1SKRB 2F3MA 3G7JA 4POKA 5DCHA 1TRUA 4EL1A 2H71A 4TN8A 3QDNA 4BVXB 4YKGA 4PTSA 3QAVA 2GVPA 2YNXA 1TTZA 2XBIA 2DLXA 1FB6A 5IMVA 1Z7PA 4OO5A 3HY2A 2I3YA 4KCEA 3UOMA 5G1LA 2V1MA 4NHWA 2IWTA 5LD0A 3FZ4A 1TW9A 1EGRA 2FCHA 2P5RA 3APOA 4PNGA 3D4MA 2YANA 3C1RA 4JZQA 1CQGA 1E2YA 4NXIA 3RAZA 1GSYA 1R26A 2H0IA 2CAQA 4KUNA 1WJKA 2L5LA 3TKSC 2XPDA 2KUCA 1GUHA 2CA8A 1R7HA 4N10A 5DQYA 5KOXA 1O85A 3TKSA 2VD1A 1A0FA 3CXGA 3ME7A 1HYUA 2H1AA 3GL3A 1WIKA 1CQHA 5DAKA 2LKUA 2QKEA 4PX1A 4MJBA 6GSVA 3MAKA 2P5QA 1PX7A 1ZGNA 2PPTA 1TKDB 2B6MA 4YH2A 2FA4A 1XVQA 3BOAA 2JZRA 1Q98A 3CSIA 1GUMA 1IYIA 3EYTA 3CRTA 1V2AA 4NV2A 1M2DA 2EIRA 3CTGA 4IVFA 4IP1A 4IGJA 2FHEA 3QPMA 3IDVA 1OKTA 3G7YA 4PQIA 2PVOC 1J9BA 3CBUA 4XRAA 4ZB8A 3A5IA 1OC9A 1T4ZA 3F4SA 4HI7A 4FYBA 4KA0A 4NMUA 3W6GA 5D93A 2VM2A 1MDJA 1TI3A 4KAEA 2QA2A 5EY6A 2N5AA 4G0IA 4EKZA 2IMIA 2CQ9A 3H8QA 2B1KA 1EP7A 5F05A 1X5DA 3APQA 1WPIA 1A2JA 1TOFA 2M46A 5ELAA 2GDRA 2V6KA 2MMOA 5J9CA 4O5QA 3MWHA 5D96A 4EO3A 4L5LA 4EIPA 2H1DA 3UARA 5HFIA 3UVTA 5ECOB 2HE3A 4KX4A 3UVHA 3FW2A 2HLSA 2GT6A 4ML6A 3QOUA 4YKFA 4K6XA 3K8NA 5ENUA 4ML1A 4HU9A 3TDGA 3VI7A 1AQWA 1YY7A 1DUGA 1A0RP 4GQCA 3TOTA 1LJRA 5IO0A 5B7CA 2OJLA 4DSSB 3HA9A 4MZCA 2JU5A 2WZ9A 3S9FA 3U5RE 4MF6A 4WBJA 1LU4A 1TRWA 1M7TA 3FEUA 3J7Yk 2R0CA 1DBYA 1AXDA 2DMMA 3CRUA 1XWCA 2NPBA 4HQZA 4KSMA 2VCVA 2NTOA 2YV7A 4POMA 1HNBA 2VLVA 2TRCP 4F9ZA 3U6VA 3ZL5A 4K2XA 3GL5A 1YEPA 3IBHA 5KN1A 5D9WA 1K0OA 4GSSA 3MSZA 2L5OA 4K2DA 2BTOT 22GSA 5DBQA 4CY8A 2VL2C 4L8EA 2A2PA 3ZVJA 3J7Yb 2L6CA 1R4WA 3WGDA 3GX8A 4WEYA 3TRQA 2HXKA 3TKSE 5ECMB 2MMZA 1ERTA 4K7OA 3F3RA 4PUFC 2CAIA 4HJ2A 11GSA 1K3OA 3FKFA 2H30A 4YAPA 1F3BA 5CO3A 5ECKB 3W8SA 3DVWA 3EE2A 3I9V2 2L6DA 3O76A 3I6AA 4JBBA 3ZMKA 1XW9A 4I2UA 1YJ6A 1K0AA 1EV9A 1GLQA 1XFLA 3GTUB 3E9JB 1SK0A 5DAKB 5BMUA 5J41A 1ZOFA 1GUKA 4OFMA 4BVXA 1XVWA 1FAAA 2M72A 1FO5A 4Q5FA 1ZYNA 1HQOA 2R4VA 4J57E 1BQ7A 1E6BA 4WR4A 5JCUA 2A2SA 1ML6A 3PPUA 4HUAA 4KNDA 3ME8A 4XHMA 3TKPA 5HR2A 1QQ2A 4ZBBA 2ON7A 2AB6A 1KTEA 4PUAA 1OYJA 2HRKA 4EF0A 5B8AA 2MMAA 2X4AA 4K5RA 2VLUA 5DDLA 4TR1B 2HZFA 4KGIA 1ZZYA 3FR9A 2VUPA 2C3TA 4TXOA 1RK4A 2B3SA 4Z2UA 2AYTA 4ZB6A 2VL9A 1PKZA 1YZXA 2LTKA 4XTSA 2TRXA 3BJ5A 2VCXA 4X43A 1F2EA 6GSTA 4PXOA 4ECBA 3QCPA 1ZCPA 2AAWA 4G0KA 1SYRA 3D21A 1A24A 5C00A 4GWRA 1HNAA 1MD3A 1M99A 4RI7A 2X8HA 3KMOA 1ZYEA 1JFUA 2HNLA 2ZCTA 3ED3A 4MJCA 3LYPA 2X99A 4ULXA 1EV4A 2LRNA 4I97A 4OD7A 2L57A 2HFDA 4MK3A 2LNTA 3LXZA 19GSA 2F9SA 2DSAA 4MJAA 5G2ZA 5BRTA 4Q5RA 2WFCA 5D9TA 4PGTA 3IHGA 1SKSB 4A5PA 2CX4A 1M0UA 1TK5B 3GHAA 4ID0A 3ZIJA 4HEA2 3LGCA 3L0HA 4TW5A 4HJMA 3IR4A 1EEMA 1USBA 1VF2A 2PGTA 3TGZA 3EC3A 4K7IA 2VL3A 1GSFA 3FYGA 2GTUA 4F0CA 5AGYA 6GSUA 5DVBA 3CTFA 3O6TA 2O87A 3UAPA 2TIRA 1BJXA 3WT2A 1K0NA 3IA1A 4KDXA 4F82A 2BMXA 4GLTA 3ZREA 4V2MA 3IAS2 5AIXA 5D9XA 2HSYA 3EU3A 2OBIA 1T00A 2VCQA 2YWIA 3IHQA 5HFGA 4V1Ag 1V58A 4HZ2A 4TR0A 2FUG2 4DSRA 3GKXA 3TJFA 1AIUA 2DKHA 5GAND 1ZYPA 2V32A 2GZPA 1M9AA 3OR5A 2L59A 2EIQA 3TOUA 6GSSA 4O5UA 3MDKA 1Z7RA 1Z3EA 1K0DA 3KJYA 4G0LA 3GYKA 2YJHA 1X9MB 2V2GA 3LORA 5IMZA 1G6YA 5G5EA 2VIMA 3SWLA 4MJEA 5FWGA 3QD9A 2DJ1A 3MNGA 4IJ3A 1PRXA 3HDCA 4DSSA 2AJQB 4PQ1A 13GSA 2GLRA 3PR8A 5GSTA 4IN0A 1T1VA 3KZQA 5KEJA 4IKHA 1NW2A 1SENA 1H4OA 2UZ8A 4MH2A 2FY6A 3GV1A 4LL4B 4G2EA 2IMEA 4MH3A 1N2AA 4QQ7A 3IC4A 2L4QA 5EPFA 2JADA 1QUWA 1KNGA 2FD3A 1YEXA 1Y25A 6GSYA 1THXA 2XHFA 2YWNA 2D2ZA 2HSMA 5GZZB 4LL1B 4ACSA 4EE0A 3GSSA 4GCIA 5GAPD 1V9WA 4WR5A 5GSSA 3HKRA 4TXOB 2QA1A 1AUCA 4NHZA 5D8IA 3BCKA 3QMXA 1Z6MA 3LJRA 3F8UA 2WRTA 1OE8A 4OFNA 4RQXA 4J2FA 3TRXA 1A8YA 2LQQA 5ABRA 3IE3A 4WXTA 1S3CA 1OC8A 4TOPA 1O73A 1AC1A 1X0RA 5E4WA 3GTUA 1OVNA 1PA3A 2IMFA 3GURA 3L78A 3KEBA 3CSJA 4E8EA 4USSA 2R0PA 1FVJA 1NHYA 1JZWA 2HSHA 3H79A 3I43A 1BAYA 5H5QA 4NPBA 3DGQA 1SD8A 4BWQA 1ERWA 2B7JA 4O92A 2H76A 2YZUA 1B8XA 3TKRA 2K8VA 2A4HA 3KIJA 1ZYQB 3ERWA 1FVKA 1ABAA 1W89A 3ZZXA 2O89A 4TR1A 7GSSA 1TP9A 2H01A 4AGSA 3DMLA 3E0UA 2DIZA 3DRNA 5LNKe 3I69A 5G1KA 1VF4A 4F03A 4BVYA 2H66A 2G2QA 2LV3A 4KE3A 4IJIA 2X8CA 4KDUA 1U3IA 5IPHA 1FW1A 4HDEA 3V1WA 3D0ZA 4DSQA 5J4UA 2IL3A 3KH9A 5CRHA 18GSA 1B9YC 2M80A 5CAXA 4ECCA 2V41A 1UA5A 1LBKA 2GGTA 2H1GA 3LW9A 2RM5A 4Q5QA 1XIYA 4ZXGA 1UN2A 1GTUA 2WDUA 3LYKA 3TUEA 2OE0A 4BPYA 5ID2B 4TRXA 1B9XC 1JZOA 3ZYWA 2B1LA 2FNOA 2OE3A 3GFKA 3O3TA 3A5WA 2ZNMA 3WYWA 1XW6A 2L4CA 4E8HA 5CRDA 4JR6A 2VM1A 1OAZA 4KCAA 2KOKA 1T7PB 4PURA 3M9JA 1GTBA 4POBA 4ZBAA 4MA9A 1SU9A 1K0MA 2YWMA 3AY8A 4L0WA 5ECHB 3UBLA 1HNCA 4AJ7A 4ZBDA 1EWXA 3P8WA 2XPEA 5CYYA 3HXSA 3HVXA 3FHKA 3CYNA 1YDKA 2VCTA 4YAVA 2GT5A 1SK1A 4K5SA 20GSA 4GQFA 2VD0A 3VPTA 2YV9A 4MP4A 1JLVA 3F6DA 3HVSA 3TJKA 2DJ2A 3FZAA 3BCIA 4FQUA 2FWEA 2LEGA 1A23A 2R0GA 3IRAA 2R2JA 3KXOA 4K0GA 3VPQA 4JR4A 4ZILA 5D73A 3SBCA 3VLNA 1M2AA 2KHPA 1YQ1A 4K9ZA 4WKWA 5G30A 1K0BA 2FA8A 2PBJA 1C72A 4OO4A 2A4VA 4GRFA 1WE0A 4XS4B 1ZMAA 2C3NA 4XRDA 4MMMA 3VURA 2VOCA 1V40A 2ES7A 5HR1A 1AAZA 2F51A 4BA7A 3DYRA 2O8VB 2DJKA 5A4UA 2LJKA 3LG6A 1M2BA 2V6OA 1MEKA 2NVLA 3F4TA 4TR3A 3NZNA 3RDWA 17GSA 3P2AA 2YPMA 4I5QA 5EL8A 3C1SA 1JLWA 5F06A 1NM3A 3IK9A 2PVQA 3QFBC 2DBCA 4GXZA 2LJRA 2R5GA 3IC8A 3CMIA 5CP1A 2VCWA 3ZIVA 3GMFA 3BD2A 3QFAC 1SKWB 1SJIA 1XZOA 2NBSA 3L9UA 4NAXA 1K3LA 2I81A 1J08A 2OBKA 1TU7A 4OFTA 5IM9A 4CHSA 2G0FA 4JE1A 2DKIA 3CSHA 3KH7A 4V2NA 1GNEA 1GSQA 4BVYB 3EMPA 2I9HA 3PH9A 1BEDA 1F9MA 1O8XA 1AQVA 1QGVA 3TJBA 1ZL9A 1GSEA 4BWSA 4MLYA 2OKAA 1V57A 1W4VA 2GQLA 2H72A 1ST9A 4XS1A 4V2LA 3VI5A 1DSBA 3KGKA 2H6YA 2LQOA 1EEJA 3HZ8A 5COHA 3RPNA 3JCML 2HRAA 3DXBA 4ZL8A 2KP2A 1K0CA 3R2QA 1NHOA 1WRYA 5EVOA 4EXJA 3R3EA 2I1UA 4K8MA 2J9HA 2A2RA 4IHUA 2EC4A 1PKWA 1XPVA 2GQKA 4G9HA 3HCZA 2C3QA 1TK8B 2E0QA 3Q6OA 3N9JA 3VFIA 2WS2A 3US3A 1PN0A 3N5OA 3F4RA 4NV5A 1SJZA 1R5PA 2DIYA 4MCUA 4BL7B 1WP0A 2CVKA 1RW1A 1H75A 2IJYA 4WF4A 4MZWA 2RUFA 4KDYA 3RPPA 3UMAA 5INYA 1G6WA 2LSTA 4P3YB 3VWWA 2IMDA 1ILOA 4YQUA 1YKCA 2REMA 3PGTA 4G19A 4EDYA 8GSSA 1PL1A 5FT3A 3TB2A 4NWYA 5J5NA 1EOGA 5IOXA 2E7PA 4AJ6A 3A2VA 1ERUA 2H1BA 3EVIA 3UBKA 1Z9HA 3HJMA 2GSRA 2P31A 3QAWA 1YF1A 4MABA 3ZFLA 4MF5A 1ON4A 2H73A 2MZCA 1FOHA 2HI7A 4I6XA 3RHBA 3GIXA 2ON5A 3WGEA 10GSA 1FHEA 1XOAA 4DEJA 3WGXA 2CZ3A 5ID2A 2RM6A 5ELGA 5F0GA 4YQVA 1A2LA 1A8LA 5HQPA 1PMTA 2HZEB 4G10A 3TJGA 3EPTA 2HRFA 4MNNA 2GS3A 5B8BA 1THOA 4ZL9A 4ICYA 3LFLA 4N0VA 5H5SA 1G7EA 2DJJA 1G0TA 1SYXA 6GSXA 4HQSA 5F07A 2YN1A 2R6KA 3H93A 3D4TA 3LXTA 2KP1A 1SJ6A 1M9BA 1I9DA 1OE7A 1FB0A 4GF0A 4WBRD 2MMNA 2HRNA 2RIIA 3KMNA 1TK0B 2YOIA 1X9SB 1T8EB 4L5OA 1Q4JA 1KBNA 4MF7A 5H5RA 2OE1A 2B7KA 2H70A 3E3EA 5HR3A 4MDCA 3RBTA 3LEFA 3C73A 3HZ4A 5ECNB 5HFKA 1AQXA 3PINA 2OADA 3HVVA 2FWHA 2N5FA 2DJ3A 4O5RA 4IW9A 4OMVA 4OCEA 3KTBA 1MD4A 2K9FA 3GNJA 5G5FA 3M9KA 4CDOA 1UVZA 3L9VA 4K7NA 1F37A 2PUKC 2HT9A 3M1GA 3A2XA 3RHCA 4ECIA 2EIOA 3HJPA 14GSA 5IMDA 2AUVA 1SL1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XS4 A;  3Q74 A;  4WF5 A;  2IN3 A;  4ZB9 A;  4D73 B;  1TRS A;  1GTA A;  2F8A A;  2XBQ A;  3UEM A;  4IBP A;  3KTL A;  5DJL A;  2WB9 A;  3HD5 A;  3F0I A;  3W8J A;  2X64 A;  2B5Y A;  4LMV A;  3GN3 A;  3HHV A;  5ECP B;  2WGR A;  1GL8 A;  2HYX A;  1EZK A;  4GTU A;  1O81 A;  5E59 A;  1DE2 A;  1TRV A;  1BG5 A;  3EIN A;  2VCZ A;  2WUL A;  4TXV A;  4OCF A;  2GQM A;  5JWO B;  1O7U A;  3GUS A;  4EUY A;  1QXH A;  4L0U A;  2BJX A;  3NOF A;  1FG4 A;  2QSI A;  3DEX A;  5B6N A;  2B5X A;  2LS5 A;  4N30 A;  3VWU A;  3P7X A;  2LRC A;  3IOS A;  2YCD A;  2GST A;  5DAL B;  2H6X A;  3GX0 A;  3UL3 A;  5LCZ A;  2PN8 A;  4KB3 A;  3ERF A;  4YQM A;  3EMX A;  4F2I A;  3FZ9 A;  3GKN A;  12GS A;  1URM A;  3L4N A;  2CX3 A;  4Z7X A;  2IFQ B;  3P90 A;  4RQR A;  1SD9 A;  5IIZ A;  5AN1 A;  1XWK A;  2CZ2 A;  3IXR A;  4X0X A;  2H19 A;  4JED A;  4O32 A;  3GKM A;  2CVD A;  1S3A A;  1V98 A;  4J56 E;  3TRP A;  3TCO A;  5KN3 A;  3EUR A;  4F0B A;  2YZH A;  2YWO A;  3D5J A;  1N8J A;  4FYC A;  4AF2 A;  2IIY A;  4CW9 A;  2H8L A;  5ECR B;  4KSO A;  3DD3 A;  3FR6 A;  4H86 A;  1UC7 A;  4I8B A;  4DVC A;  3KM6 A;  5IO2 A;  3Q19 A;  5JCG A;  5ECL B;  5J9B A;  1QFN A;  1RQM A;  2K8S A;  4N0Z A;  3DKS A;  1XBS A;  2VLT A;  2H6Z A;  2JSZ A;  4TVE A;  1ACV A;  2C0E A;  4FIW A;  3FY7 A;  3EU4 A;  4I2T A;  4BL7 A;  2I4A A;  2WJU A;  3LWA A;  2DJ0 A;  3FZ5 A;  2JL4 A;  3ZVJ D;  5IQY A;  3GH9 A;  5IMF A;  4ZIJ A;  3HYP A;  4IP6 A;  1GSU A;  5J3R A;  5HR0 A;  2C0D A;  1GWC A;  3APS A;  3D22 A;  2FWG A;  2MBT A;  1SK2 A;  2FWF A;  1GH2 A;  4N11 A;  5D9V A;  2H74 A;  3IV4 A;  1VGL A;  1B48 A;  1PX6 A;  2P0G A;  3KP9 A;  4LLR A;  1JZR A;  3LSZ A;  2GZY A;  4X1U A;  2QC7 A;  5JWQ B;  3M8N A;  1XXU A;  4IQ1 A;  4PNF A;  1XWA A;  5AIV A;  4FH8 A;  1U3A A;  5A4V A;  2FLS A;  3UJ1 A;  1PGT A;  1U88 A;  3UIW A;  4PQH A;  1MDK A;  5KN0 A;  1SL2 B;  2J23 A;  2HZE A;  5IOW A;  1O6J A;  2XC2 A;  2X8G A;  1GUL A;  1KEB A;  1PD2 1;  3GKK A;  2R3X A;  3ZRD A;  5A5K A;  1B4P A;  3ZTL A;  2MYG A;  2VL2 A;  3IAM 2;  1JZD A;  1T3B A;  2LUS A;  4LMW A;  5ECS A;  4IEL A;  5AIS A;  4AJ8 A;  3GST A;  1GLP A;  1PSQ A;  4HS1 A;  3WT1 A;  1VF1 A;  5ECI B;  3NIV A;  9GSS A;  1MTC A;  4K1F A;  1NSW A;  1S3D A;  2WCI A;  2AHE A;  4LA1 A;  5DCG A;  2C8U A;  1TU8 A;  4KH7 A;  2H0H A;  16GS A;  2LRT A;  4MPF A;  3BBY A;  1QK8 A;  1EP8 A;  1F3A A;  1J0F A;  5CRW A;  2E2M A;  2FGX A;  4IQA A;  1BX9 A;  3QAG A;  4TR4 A;  4ILF A;  3M3M A;  3G9B A;  1AW9 A;  1DE1 A;  2ALB A;  2PWJ A;  2H75 A;  5IMA A;  5JWR B;  4QL9 A;  4XCS A;  1TDI A;  3LQ7 A;  4OWY A;  1TXX A;  4FYU A;  5B6M A;  2DC5 A;  3ZML A;  1Z5Y E;  1R5A A;  3VWV A;  2F8F A;  2OAC A;  5DQS A;  4RI6 A;  2GSQ A;  3C7M A;  2KLX A;  2JAC A;  2GZZ A;  3A2W A;  1BYE A;  2NDO A;  1SL0 B;  1T4Y A;  3FRC A;  2CVB A;  4MPG A;  1OC9 B;  3GRX A;  5C04 A;  2R37 A;  1XCC A;  2YJ7 A;  1F6M C;  2C0G A;  2C1Y A;  2JZT A;  3GH6 A;  4EVM A;  1XW5 A;  1PL2 A;  1XOB A;  1Z6N A;  3D6I A;  1WOU A;  3F6F A;  4D73 A;  5DJM A;  3IK7 A;  1WWJ A;  2CV4 A;  4KW6 A;  2K6V A;  3C8E A;  5CRG A;  3F3Q A;  2ZUP A;  1ERV A;  3F9U A;  2C0F A;  2VO4 A;  1I5G A;  2O85 A;  3FR3 A;  4ISD A;  4EDZ A;  4XIH A;  1GP1 A;  1EGO A;  2PU9 C;  1Y6E A;  1XWB A;  1X5C A;  1G7O A;  3ZFB A;  3ERG A;  1YF0 A;  2O7K A;  4ECJ A;  3IPZ A;  4XS6 A;  4HOJ A;  5JCW A;  4WET A;  2N5B A;  3DWV A;  1X9W B;  1FOV A;  6GSW A;  2RLI A;  5DAL A;  3GA4 A;  3KD0 A;  5L71 A;  5KN2 A;  1MDI A;  4QL7 A;  2RUE A;  2JSY A;  1GSS A;  2VAF A;  1XWG A;  1IYH A;  2IFQ A;  5G31 A;  3WD6 A;  2DML A;  3VWX A;  5IMC A;  2C4J A;  3G7I A;  2GSS A;  3DVX A;  4O7H A;  3ISO A;  5FHI A;  4MZB A;  2E2G A;  2PER A;  4POL A;  1HD2 A;  3KCM A;  4K0N A;  1K3Y A;  3H1N A;  4FO5 A;  5CRE A;  5A4W A;  1WMJ A;  1X5E A;  3L9S A;  3H4K A;  3QR6 A;  4GSN A;  4HZ4 A;  1O8W A;  4Q5N A;  2K18 A;  2LJA A;  3ZIT A;  3TKQ A;  2LNS A;  3A3T A;  3DIE A;  3Q18 A;  2C80 A;  5F8B A;  3C71 A;  1GRX A;  2CT6 A;  2B5E A;  3HJO A;  4IS0 A;  3M0F A;  4ZL7 A;  1OKD A;  4JU5 A;  1U6T A;  1PQN A;  2YP6 A;  1VRS D;  1TI1 A;  2PMT A;  4V1A p;  2MBS A;  1EOH A;  3FK8 A;  1A2M A;  1B4Q A;  1OC3 A;  5IPG A;  1GSD A;  2OA7 A;  1JHB A;  3KP8 A;  4GST A;  1YKA A;  2H0G A;  3EWL A;  2JZS A;  5CNW A;  3VK9 A;  1QMV A;  2Z9S A;  1TJD A;  1VF3 A;  3TJJ A;  1PN9 A;  4HU7 A;  4TKY A;  1U87 A;  3F63 A;  2QGV A;  2IMK A;  3ZLP A;  4EC0 A;  1GNW A;  2IPA A;  1GTI A;  5ECQ B;  4RUV A;  4JRR A;  2AV4 A;  1SKR B;  2F3M A;  3G7J A;  4POK A;  5DCH A;  1TRU A;  4EL1 A;  2H71 A;  4TN8 A;  3QDN A;  3QAV A;  2GVP A;  2YNX A;  1TTZ A;  2XBI A;  2DLX A;  1FB6 A;  5IMV A;  1Z7P A;  4OO5 A;  3HY2 A;  2I3Y A;  4KCE A;  3UOM A;  5G1L A;  2V1M A;  4NHW A;  2IWT A;  5LD0 A;  3FZ4 A;  1TW9 A;  1EGR A;  2FCH A;  2P5R A;  3APO A;  4PNG A;  3D4M A;  2YAN A;  3C1R A;  4JZQ A;  1CQG A;  1E2Y A;  4NXI A;  3RAZ A;  1GSY A;  1R26 A;  2H0I A;  2CAQ A;  4KUN A;  1WJK A;  2L5L A;  3TKS C;  2XPD A;  2KUC A;  1GUH A;  2CA8 A;  1R7H A;  4N10 A;  5DQY A;  1O85 A;  3TKS A;  2VD1 A;  1A0F A;  3CXG A;  3ME7 A;  1HYU A;  2H1A A;  3GL3 A;  1WIK A;  1CQH A;  5DAK A;  2LKU A;  2QKE A;  4PX1 A;  4MJB A;  6GSV A;  3MAK A;  2P5Q A;  1PX7 A;  1ZGN A;  2PPT A;  1TKD B;  2B6M A;  4YH2 A;  2FA4 A;  1XVQ A;  3BOA A;  2JZR A;  1Q98 A;  3CSI A;  1GUM A;  1IYI A;  3EYT A;  3CRT A;  1V2A A;  4NV2 A;  1M2D A;  2EIR A;  3CTG A;  4IVF A;  4IP1 A;  4IGJ A;  2FHE A;  3QPM A;  3IDV A;  1OKT A;  3G7Y A;  4PQI A;  2PVO C;  1J9B A;  3CBU A;  4XRA A;  4ZB8 A;  1OC9 A;  1T4Z A;  3F4S A;  4HI7 A;  4FYB A;  4KA0 A;  4NMU A;  3W6G A;  5D93 A;  2VM2 A;  1MDJ A;  1TI3 A;  4KAE A;  5EY6 A;  2N5A A;  4EKZ A;  2IMI A;  2CQ9 A;  3H8Q A;  2B1K A;  1EP7 A;  5F05 A;  1X5D A;  3APQ A;  1WPI A;  1A2J A;  1TOF A;  2M46 A;  5ELA A;  2GDR A;  2V6K A;  2MMO A;  5J9C A;  3MWH A;  5D96 A;  4EO3 A;  4L5L A;  2H1D A;  3UAR A;  5HFI A;  3UVT A;  5ECO B;  2HE3 A;  4KX4 A;  3UVH A;  3FW2 A;  2HLS A;  2GT6 A;  4ML6 A;  3QOU A;  4K6X A;  3K8N A;  5ENU A;  4ML1 A;  4HU9 A;  3TDG A;  3VI7 A;  1AQW A;  1YY7 A;  1DUG A;  1A0R P;  4GQC A;  3TOT A;  1LJR A;  5IO0 A;  5B7C A;  2OJL A;  4DSS B;  3HA9 A;  4MZC A;  2JU5 A;  2WZ9 A;  3S9F A;  3U5R E;  4MF6 A;  4WBJ A;  1LU4 A;  1TRW A;  1M7T A;  3FEU A;  3J7Y k;  1DBY A;  1AXD A;  2DMM A;  3CRU A;  1XWC A;  2NPB A;  4HQZ A;  4KSM A;  2VCV A;  2NTO A;  2YV7 A;  4POM A;  1HNB A;  2VLV A;  2TRC P;  4F9Z A;  3U6V A;  3ZL5 A;  3GL5 A;  1YEP A;  3IBH A;  5KN1 A;  5D9W A;  1K0O A;  4GSS A;  3MSZ A;  2L5O A;  4K2D A;  2BTO T;  22GS A;  5DBQ A;  2VL2 C;  4L8E A;  3ZVJ A;  3J7Y b;  2L6C A;  1R4W A;  3WGD A;  3GX8 A;  4WEY A;  3TRQ A;  2HXK A;  3TKS E;  5ECM B;  2MMZ A;  1ERT A;  4K7O A;  3F3R A;  4PUF C;  2CAI A;  4HJ2 A;  11GS A;  1K3O A;  3FKF A;  2H30 A;  4YAP A;  1F3B A;  5CO3 A;  5ECK B;  3W8S A;  3DVW A;  3EE2 A;  3I9V 2;  2L6D A;  3O76 A;  3I6A A;  4JBB A;  3ZMK A;  1XW9 A;  4I2U A;  1YJ6 A;  1K0A A;  1EV9 A;  1GLQ A;  1XFL A;  3GTU B;  3E9J B;  1SK0 A;  5DAK B;  5J41 A;  1ZOF A;  1GUK A;  4OFM A;  4BVX A;  1XVW A;  1FAA A;  2M72 A;  1FO5 A;  4Q5F A;  1HQO A;  2R4V A;  4J57 E;  1BQ7 A;  1E6B A;  4WR4 A;  5JCU A;  2A2S A;  1ML6 A;  4HUA A;  4KND A;  3ME8 A;  4XHM A;  3TKP A;  5HR2 A;  1QQ2 A;  4ZBB A;  2ON7 A;  2AB6 A;  1KTE A;  4PUA A;  1OYJ A;  4EF0 A;  5B8A A;  2MMA A;  2VLU A;  5DDL A;  4TR1 B;  2HZF A;  4KGI A;  1ZZY A;  3FR9 A;  2VUP A;  2C3T A;  4TXO A;  1RK4 A;  2B3S A;  2AYT A;  4ZB6 A;  2VL9 A;  1PKZ A;  1YZX A;  2LTK A;  4XTS A;  2TRX A;  3BJ5 A;  2VCX A;  4X43 A;  1F2E A;  6GST A;  4PXO A;  4ECB A;  3QCP A;  1ZCP A;  2AAW A;  1SYR A;  3D21 A;  1A24 A;  5C00 A;  4GWR A;  1HNA A;  1MD3 A;  1M99 A;  4RI7 A;  2X8H A;  3KMO A;  1ZYE A;  1JFU A;  2HNL A;  2ZCT A;  3ED3 A;  4MJC A;  3LYP A;  2X99 A;  4ULX A;  1EV4 A;  2LRN A;  4I97 A;  4OD7 A;  2L57 A;  2HFD A;  4MK3 A;  2LNT A;  3LXZ A;  19GS A;  2F9S A;  2DSA A;  4MJA A;  5G2Z A;  4Q5R A;  2WFC A;  5D9T A;  4PGT A;  1SKS B;  2CX4 A;  1M0U A;  1TK5 B;  3GHA A;  4ID0 A;  3ZIJ A;  4HEA 2;  3LGC A;  3L0H A;  4TW5 A;  4HJM A;  3IR4 A;  1EEM A;  1USB A;  1VF2 A;  2PGT A;  3TGZ A;  3EC3 A;  4K7I A;  2VL3 A;  1GSF A;  3FYG A;  2GTU A;  4F0C A;  5AGY A;  6GSU A;  5DVB A;  3CTF A;  3O6T A;  2O87 A;  3UAP A;  2TIR A;  1BJX A;  3WT2 A;  1K0N A;  3IA1 A;  4KDX A;  4F82 A;  2BMX A;  4GLT A;  3ZRE A;  4V2M A;  3IAS 2;  5AIX A;  5D9X A;  2HSY A;  3EU3 A;  2OBI A;  1T00 A;  2VCQ A;  2YWI A;  3IHQ A;  5HFG A;  4V1A g;  1V58 A;  4HZ2 A;  4TR0 A;  2FUG 2;  4DSR A;  3GKX A;  3TJF A;  1AIU A;  5GAN D;  2V32 A;  2GZP A;  1M9A A;  3OR5 A;  2L59 A;  2EIQ A;  3TOU A;  6GSS A;  3MDK A;  1Z7R A;  1Z3E A;  1K0D A;  3KJY A;  3GYK A;  2YJH A;  1X9M B;  2V2G A;  3LOR A;  5IMZ A;  1G6Y A;  5G5E A;  2VIM A;  3SWL A;  4MJE A;  5FWG A;  3QD9 A;  2DJ1 A;  3MNG A;  4IJ3 A;  1PRX A;  3HDC A;  4DSS A;  2AJQ B;  4PQ1 A;  13GS A;  2GLR A;  3PR8 A;  5GST A;  4IN0 A;  1T1V A;  3KZQ A;  5KEJ A;  4IKH A;  1NW2 A;  1SEN A;  1H4O A;  4MH2 A;  2FY6 A;  3GV1 A;  4LL4 B;  4G2E A;  2IME A;  4MH3 A;  1N2A A;  4QQ7 A;  3IC4 A;  2L4Q A;  5EPF A;  2JAD A;  1QUW A;  1KNG A;  2FD3 A;  1YEX A;  1Y25 A;  6GSY A;  1THX A;  2XHF A;  2YWN A;  2D2Z A;  5GZZ B;  4LL1 B;  4ACS A;  4EE0 A;  3GSS A;  4GCI A;  5GAP D;  1V9W A;  4WR5 A;  5GSS A;  3HKR A;  4TXO B;  1AUC A;  4NHZ A;  5D8I A;  3BCK A;  3QMX A;  1Z6M A;  3LJR A;  3F8U A;  2WRT A;  1OE8 A;  4OFN A;  4RQX A;  4J2F A;  3TRX A;  1A8Y A;  2LQQ A;  5ABR A;  3IE3 A;  4WXT A;  1S3C A;  1OC8 A;  4TOP A;  1O73 A;  1AC1 A;  1X0R A;  5E4W A;  3GTU A;  1OVN A;  1PA3 A;  2IMF A;  3GUR A;  3L78 A;  3KEB A;  3CSJ A;  4E8E A;  1FVJ A;  1NHY A;  1JZW A;  2HSH A;  3H79 A;  3I43 A;  1BAY A;  5H5Q A;  4NPB A;  3DGQ A;  1SD8 A;  4BWQ A;  1ERW A;  2B7J A;  4O92 A;  2H76 A;  2YZU A;  1B8X A;  3TKR A;  2K8V A;  3KIJ A;  1ZYQ B;  3ERW A;  1FVK A;  1ABA A;  1W89 A;  3ZZX A;  2O89 A;  4TR1 A;  7GSS A;  1TP9 A;  2H01 A;  4AGS A;  3DML A;  3E0U A;  2DIZ A;  3DRN A;  5LNK e;  3I69 A;  5G1K A;  1VF4 A;  4F03 A;  4BVY A;  2H66 A;  2G2Q A;  2LV3 A;  4KE3 A;  4IJI A;  2X8C A;  4KDU A;  1U3I A;  5IPH A;  1FW1 A;  4HDE A;  3V1W A;  3D0Z A;  4DSQ A;  5J4U A;  2IL3 A;  3KH9 A;  5CRH A;  18GS A;  1B9Y C;  2M80 A;  5CAX A;  4ECC A;  2V41 A;  1UA5 A;  1LBK A;  2GGT A;  2H1G A;  2RM5 A;  4Q5Q A;  1XIY A;  4ZXG A;  1UN2 A;  1GTU A;  2WDU A;  3LYK A;  3TUE A;  2OE0 A;  4BPY A;  5ID2 B;  4TRX A;  1B9X C;  1JZO A;  3ZYW A;  2B1L A;  2FNO A;  2OE3 A;  3GFK A;  3O3T A;  3A5W A;  2ZNM A;  3WYW A;  1XW6 A;  2L4C A;  4E8H A;  5CRD A;  4JR6 A;  2VM1 A;  1OAZ A;  4KCA A;  2KOK A;  1T7P B;  4PUR A;  3M9J A;  1GTB A;  4POB A;  4ZBA A;  4MA9 A;  1SU9 A;  1K0M A;  2YWM A;  3AY8 A;  4L0W A;  5ECH B;  3UBL A;  1HNC A;  4AJ7 A;  4ZBD A;  1EWX A;  3P8W A;  2XPE A;  5CYY A;  3HXS A;  3HVX A;  3FHK A;  3CYN A;  1YDK A;  2VCT A;  4YAV A;  2GT5 A;  1SK1 A;  20GS A;  4GQF A;  2VD0 A;  3VPT A;  2YV9 A;  4MP4 A;  1JLV A;  3F6D A;  3HVS A;  3TJK A;  2DJ2 A;  3FZA A;  3BCI A;  2FWE A;  2LEG A;  1A23 A;  3IRA A;  2R2J A;  3KXO A;  4K0G A;  3VPQ A;  4JR4 A;  4ZIL A;  5D73 A;  3SBC A;  3VLN A;  1M2A A;  2KHP A;  1YQ1 A;  4K9Z A;  4WKW A;  5G30 A;  1K0B A;  2FA8 A;  2PBJ A;  1C72 A;  4OO4 A;  2A4V A;  4GRF A;  1WE0 A;  4XS4 B;  1ZMA A;  2C3N A;  4XRD A;  4MMM A;  3VUR A;  2VOC A;  1V40 A;  2ES7 A;  5HR1 A;  1AAZ A;  2F51 A;  4BA7 A;  3DYR A;  2O8V B;  2DJK A;  5A4U A;  2LJK A;  3LG6 A;  1M2B A;  2V6O A;  1MEK A;  2NVL A;  3F4T A;  4TR3 A;  3NZN A;  3RDW A;  17GS A;  3P2A A;  2YPM A;  4I5Q A;  5EL8 A;  3C1S A;  1JLW A;  5F06 A;  1NM3 A;  3IK9 A;  2PVQ A;  3QFB C;  2DBC A;  4GXZ A;  2LJR A;  2R5G A;  3CMI A;  5CP1 A;  2VCW A;  3ZIV A;  3GMF A;  3BD2 A;  3QFA C;  1SKW B;  1SJI A;  1XZO A;  2NBS A;  3L9U A;  4NAX A;  1K3L A;  2I81 A;  1J08 A;  2OBK A;  1TU7 A;  4OFT A;  5IM9 A;  4CHS A;  2G0F A;  4JE1 A;  3CSH A;  3KH7 A;  4V2N A;  1GNE A;  1GSQ A;  3EMP A;  2I9H A;  3PH9 A;  1BED A;  1F9M A;  1O8X A;  1AQV A;  1QGV A;  3TJB A;  1ZL9 A;  1GSE A;  4BWS A;  4MLY A;  2OKA A;  1V57 A;  1W4V A;  2GQL A;  2H72 A;  1ST9 A;  4XS1 A;  4V2L A;  3VI5 A;  1DSB A;  3KGK A;  2H6Y A;  2LQO A;  1EEJ A;  3HZ8 A;  5COH A;  3RPN A;  3JCM L;  3DXB A;  4ZL8 A;  2KP2 A;  1K0C A;  3R2Q A;  1NHO A;  1WRY A;  5EVO A;  4EXJ A;  4K8M A;  2I1U A;  2J9H A;  2A2R A;  4IHU A;  2EC4 A;  1PKW A;  1XPV A;  2GQK A;  4G9H A;  3HCZ A;  2C3Q A;  1TK8 B;  2E0Q A;  3Q6O A;  3N9J A;  3VFI A;  2WS2 A;  3US3 A;  3N5O A;  3F4R A;  4NV5 A;  1SJZ A;  1R5P A;  2DIY A;  4MCU A;  1WP0 A;  2CVK A;  1RW1 A;  1H75 A;  2IJY A;  4WF4 A;  4MZW A;  2RUF A;  4KDY A;  3RPP A;  3UMA A;  5INY A;  1G6W A;  2LST A;  4P3Y B;  3VWW A;  2IMD A;  1ILO A;  4YQU A;  1YKC A;  2REM A;  3PGT A;  4G19 A;  4EDY A;  8GSS A;  1PL1 A;  5FT3 A;  3TB2 A;  4NWY A;  5J5N A;  1EOG A;  5IOX A;  2E7P A;  4AJ6 A;  3A2V A;  1ERU A;  2H1B A;  3EVI A;  3UBK A;  1Z9H A;  3HJM A;  2GSR A;  2P31 A;  3QAW A;  1YF1 A;  4MAB A;  3ZFL A;  4MF5 A;  1ON4 A;  2H73 A;  2MZC A;  2HI7 A;  4I6X A;  3RHB A;  3GIX A;  2ON5 A;  3WGE A;  10GS A;  1FHE A;  1XOA A;  4DEJ A;  3WGX A;  2CZ3 A;  5ID2 A;  2RM6 A;  5ELG A;  5F0G A;  4YQV A;  1A2L A;  1A8L A;  5HQP A;  1PMT A;  2HZE B;  4G10 A;  3TJG A;  2HRF A;  2GS3 A;  5B8B A;  1THO A;  4ZL9 A;  3LFL A;  4N0V A;  5H5S A;  1G7E A;  2DJJ A;  1G0T A;  1SYX A;  6GSX A;  4HQS A;  5F07 A;  2YN1 A;  2R6K A;  3H93 A;  3D4T A;  3LXT A;  2KP1 A;  1SJ6 A;  1M9B A;  1I9D A;  1OE7 A;  1FB0 A;  4GF0 A;  4WBR D;  2MMN A;  2HRN A;  2RII A;  3KMN A;  1TK0 B;  2YOI A;  1X9S B;  1T8E B;  4L5O A;  1Q4J A;  1KBN A;  4MF7 A;  5H5R A;  2OE1 A;  2B7K A;  2H70 A;  3E3E A;  5HR3 A;  4MDC A;  3RBT A;  3LEF A;  3C73 A;  3HZ4 A;  5ECN B;  5HFK A;  1AQX A;  3PIN A;  2OAD A;  3HVV A;  2FWH A;  2N5F A;  2DJ3 A;  4O5R A;  4IW9 A;  4OMV A;  4OCE A;  3KTB A;  1MD4 A;  2K9F A;  3GNJ A;  5G5F A;  3M9K A;  4CDO A;  1UVZ A;  3L9V A;  4K7N A;  1F37 A;  2PUK C;  2HT9 A;  3M1G A;  3A2X A;  3RHC A;  4ECI A;  2EIO A;  3HJP A;  14GS A;  5IMD A;  2AUV A;  1SL1 B; 
#chains in the Genus database with same CATH topology
 4X4J A;  4XS4 A;  3Q74 A;  4WF5 A;  2IN3 A;  4ZB9 A;  4D73 B;  1TRS A;  1GTA A;  2F8A A;  2XBQ A;  3UEM A;  4IBP A;  3KTL A;  5DJL A;  2WB9 A;  3HD5 A;  3F0I A;  3W8J A;  2X64 A;  2B5Y A;  4LMV A;  3GN3 A;  3HHV A;  5ECP B;  2WGR A;  1GL8 A;  2HYX A;  1EZK A;  4GTU A;  1O81 A;  5E59 A;  1DE2 A;  1TRV A;  1BG5 A;  3EIN A;  2VCZ A;  2WUL A;  4TXV A;  4OCF A;  2GQM A;  5JWO B;  1O7U A;  3GUS A;  4EUY A;  1QXH A;  4L0U A;  2BJX A;  3NOF A;  1FG4 A;  2QSI A;  3DEX A;  5B6N A;  2B5X A;  2LS5 A;  4N30 A;  3VWU A;  3P7X A;  2LRC A;  3IOS A;  2YCD A;  2GST A;  5DAL B;  2H6X A;  3GX0 A;  3UL3 A;  5LCZ A;  2PN8 A;  4KB3 A;  3ERF A;  4YQM A;  3EMX A;  4F2I A;  3FZ9 A;  3GKN A;  12GS A;  1URM A;  3L4N A;  2CX3 A;  4Z7X A;  2IFQ B;  3P90 A;  4RQR A;  1SD9 A;  5IIZ A;  5AN1 A;  1XWK A;  2CZ2 A;  3IXR A;  4X0X A;  2H19 A;  4JED A;  4O32 A;  3GKM A;  2CVD A;  1S3A A;  1V98 A;  4J56 E;  3TRP A;  3TCO A;  5KN3 A;  3EUR A;  4F0B A;  2YZH A;  2YWO A;  3D5J A;  1N8J A;  4FYC A;  4AF2 A;  2IIY A;  4CW9 A;  2H8L A;  5ECR B;  4KSO A;  3DD3 A;  3FR6 A;  4H86 A;  1UC7 A;  4I8B A;  4DVC A;  3KM6 A;  3FMW A;  5IO2 A;  3Q19 A;  5JCG A;  5ECL B;  5J9B A;  1QFN A;  1RQM A;  2K8S A;  4N0Z A;  3DKS A;  1XBS A;  2VLT A;  3MIX A;  2H6Z A;  2JSZ A;  4CY6 A;  4TVE A;  1ACV A;  2C0E A;  4FIW A;  3FY7 A;  3EU4 A;  4I2T A;  4BL7 A;  2I4A A;  2WJU A;  3LWA A;  2DJ0 A;  3FZ5 A;  2JL4 A;  3ZVJ D;  5IQY A;  3GH9 A;  3MYD A;  5IMF A;  4ZIJ A;  3HYP A;  4IP6 A;  1GSU A;  5J3R A;  5HR0 A;  2C0D A;  1GWC A;  3APS A;  3D22 A;  2FWG A;  2MBT A;  1SK2 A;  2FWF A;  1GH2 A;  4N11 A;  5D9V A;  2H74 A;  3IV4 A;  1VGL A;  1B48 A;  1PX6 A;  2P0G A;  1M3I A;  3KP9 A;  4LLR A;  1JZR A;  3LSZ A;  2GZY A;  4X1U A;  2QC7 A;  5JWQ B;  4BIK A;  3M8N A;  1XXU A;  4IQ1 A;  4PNF A;  1XWA A;  5AIV A;  4FH8 A;  1U3A A;  5A4V A;  2FLS A;  3UJ1 A;  1PGT A;  1U88 A;  3UIW A;  4PQH A;  1MDK A;  5KN0 A;  1SL2 B;  2J23 A;  2HZE A;  5IOW A;  1O6J A;  2XC2 A;  2X8G A;  1GUL A;  1KEB A;  1PD2 1;  3GKK A;  2R3X A;  3ZRD A;  5A5K A;  1B4P A;  3ZTL A;  2MYG A;  2VL2 A;  3IAM 2;  1JZD A;  1T3B A;  2LUS A;  4LMW A;  5ECS A;  4IEL A;  5AIS A;  4AJ8 A;  3GST A;  1GLP A;  1PSQ A;  4HS1 A;  3WT1 A;  1VF1 A;  5ECI B;  3NIV A;  9GSS A;  1MTC A;  4K1F A;  1NSW A;  1S3D A;  2WCI A;  2AHE A;  4LA1 A;  5DCG A;  2C8U A;  1TU8 A;  4KH7 A;  2H0H A;  16GS A;  2LRT A;  4MPF A;  3BBY A;  1QK8 A;  1EP8 A;  1F3A A;  1J0F A;  5CRW A;  2E2M A;  2FGX A;  4IQA A;  1BX9 A;  3QAG A;  4TR4 A;  4ILF A;  3M3M A;  3G9B A;  1AW9 A;  1DE1 A;  2ALB A;  2PWJ A;  2H75 A;  5IMA A;  5JWR B;  4QL9 A;  4XCS A;  1TDI A;  3LQ7 A;  4OWY A;  1TXX A;  4FYU A;  5B6M A;  2DC5 A;  3ZML A;  1Z5Y E;  1R5A A;  3VWV A;  2F8F A;  2OAC A;  5DQS A;  4RI6 A;  2GSQ A;  3C7M A;  2KLX A;  4Z2T A;  2JAC A;  2GZZ A;  3A2W A;  1BYE A;  2NDO A;  1SL0 B;  1T4Y A;  3FRC A;  2CVB A;  4MPG A;  1OC9 B;  3GRX A;  5C04 A;  2R37 A;  1XCC A;  2YJ7 A;  1F6M C;  2C0G A;  2C1Y A;  2JZT A;  3GH6 A;  4EVM A;  4EIQ A;  1XW5 A;  1PL2 A;  1XOB A;  1Z6N A;  3D6I A;  1WOU A;  3F6F A;  4D73 A;  5DJM A;  3IK7 A;  1WWJ A;  2CV4 A;  4KW6 A;  2K6V A;  3C8E A;  5CRG A;  3F3Q A;  2ZUP A;  1ERV A;  3F9U A;  2C0F A;  2VO4 A;  1I5G A;  2O85 A;  3FR3 A;  4ISD A;  4EDZ A;  4XIH A;  1GP1 A;  1EGO A;  2PU9 C;  1Y6E A;  1XWB A;  1X5C A;  1G7O A;  3ZFB A;  3ERG A;  1YF0 A;  2O7K A;  4ECJ A;  3IPZ A;  4XS6 A;  4HOJ A;  5JCW A;  4WET A;  2N5B A;  3DWV A;  4KF9 A;  1X9W B;  1FOV A;  6GSW A;  2RLI A;  5DAL A;  3GA4 A;  3KD0 A;  5L71 A;  5KN2 A;  1MDI A;  4QL7 A;  2RUE A;  2JSY A;  1GSS A;  2VAF A;  1XWG A;  1IYH A;  2IFQ A;  5G31 A;  3WD6 A;  2DML A;  3VWX A;  5IMC A;  2C4J A;  3G7I A;  2GSS A;  2X49 A;  3DVX A;  4O7H A;  4Z2R A;  3ISO A;  5FHI A;  4MZB A;  2E2G A;  2PER A;  4POL A;  1HD2 A;  3KCM A;  4K0N A;  1K3Y A;  3H1N A;  4FO5 A;  5CRE A;  5A4W A;  1WMJ A;  1X5E A;  3L9S A;  3H4K A;  3QR6 A;  4GSN A;  4HZ4 A;  1O8W A;  4Q5N A;  1XG8 A;  2K18 A;  2LJA A;  3ZIT A;  3TKQ A;  2LNS A;  3A3T A;  3DIE A;  3Q18 A;  2C80 A;  5F8B A;  3C71 A;  1GRX A;  2CT6 A;  2B5E A;  3HJO A;  4IS0 A;  3M0F A;  4ZL7 A;  1OKD A;  4JU5 A;  1U6T A;  1PQN A;  2YP6 A;  1VRS D;  1TI1 A;  2PMT A;  4V1A p;  2MBS A;  1EOH A;  3FK8 A;  1A2M A;  1B4Q A;  5KOW A;  1OC3 A;  5IPG A;  1GSD A;  2OA7 A;  1JHB A;  3KP8 A;  4GST A;  1YKA A;  2H0G A;  3EWL A;  2JZS A;  5CNW A;  3VK9 A;  1QMV A;  2Z9S A;  1TJD A;  1VF3 A;  3TJJ A;  1PN9 A;  4HU7 A;  4TKY A;  1U87 A;  3F63 A;  2QGV A;  2IMK A;  3ZLP A;  4EC0 A;  1GNW A;  2IPA A;  1GTI A;  5ECQ B;  4RUV A;  4JRR A;  2AV4 A;  1SKR B;  2F3M A;  3G7J A;  4POK A;  5DCH A;  1TRU A;  4EL1 A;  2H71 A;  4TN8 A;  3QDN A;  4BVX B;  4YKG A;  4PTS A;  3QAV A;  2GVP A;  2YNX A;  1TTZ A;  2XBI A;  2DLX A;  1FB6 A;  5IMV A;  1Z7P A;  4OO5 A;  3HY2 A;  2I3Y A;  4KCE A;  3UOM A;  5G1L A;  2V1M A;  4NHW A;  2IWT A;  5LD0 A;  3FZ4 A;  1TW9 A;  1EGR A;  2FCH A;  2P5R A;  3APO A;  4PNG A;  3D4M A;  2YAN A;  3C1R A;  4JZQ A;  1CQG A;  1E2Y A;  4NXI A;  3RAZ A;  1GSY A;  1R26 A;  2H0I A;  2CAQ A;  4KUN A;  1WJK A;  2L5L A;  3TKS C;  2XPD A;  2KUC A;  1GUH A;  2CA8 A;  1R7H A;  4N10 A;  5DQY A;  5KOX A;  1O85 A;  3TKS A;  2VD1 A;  1A0F A;  3CXG A;  3ME7 A;  1HYU A;  2H1A A;  3GL3 A;  1WIK A;  1CQH A;  5DAK A;  2LKU A;  2QKE A;  4PX1 A;  4MJB A;  6GSV A;  3MAK A;  2P5Q A;  1PX7 A;  1ZGN A;  2PPT A;  1TKD B;  2B6M A;  4YH2 A;  2FA4 A;  1XVQ A;  3BOA A;  2JZR A;  1Q98 A;  3CSI A;  1GUM A;  1IYI A;  3EYT A;  3CRT A;  1V2A A;  4NV2 A;  1M2D A;  2EIR A;  3CTG A;  4IVF A;  4IP1 A;  4IGJ A;  2FHE A;  3QPM A;  3IDV A;  1OKT A;  3G7Y A;  4PQI A;  2PVO C;  1J9B A;  3CBU A;  4XRA A;  4ZB8 A;  3A5I A;  1OC9 A;  1T4Z A;  3F4S A;  4HI7 A;  4FYB A;  4KA0 A;  4NMU A;  3W6G A;  5D93 A;  2VM2 A;  1MDJ A;  1TI3 A;  4KAE A;  2QA2 A;  5EY6 A;  2N5A A;  4G0I A;  4EKZ A;  2IMI A;  2CQ9 A;  3H8Q A;  2B1K A;  1EP7 A;  5F05 A;  1X5D A;  3APQ A;  1WPI A;  1A2J A;  1TOF A;  2M46 A;  5ELA A;  2GDR A;  2V6K A;  2MMO A;  5J9C A;  4O5Q A;  3MWH A;  5D96 A;  4EO3 A;  4L5L A;  4EIP A;  2H1D A;  3UAR A;  5HFI A;  3UVT A;  5ECO B;  2HE3 A;  4KX4 A;  3UVH A;  3FW2 A;  2HLS A;  2GT6 A;  4ML6 A;  3QOU A;  4YKF A;  4K6X A;  3K8N A;  5ENU A;  4ML1 A;  4HU9 A;  3TDG A;  3VI7 A;  1AQW A;  1YY7 A;  1DUG A;  1A0R P;  4GQC A;  3TOT A;  1LJR A;  5IO0 A;  5B7C A;  2OJL A;  4DSS B;  3HA9 A;  4MZC A;  2JU5 A;  2WZ9 A;  3S9F A;  3U5R E;  4MF6 A;  4WBJ A;  1LU4 A;  1S3R A;  1TRW A;  1M7T A;  3FEU A;  3J7Y k;  2R0C A;  1DBY A;  1AXD A;  2DMM A;  3CRU A;  1XWC A;  2NPB A;  4HQZ A;  4KSM A;  2VCV A;  2NTO A;  2YV7 A;  4POM A;  1HNB A;  2VLV A;  2TRC P;  4F9Z A;  3U6V A;  3ZL5 A;  4K2X A;  3GL5 A;  1YEP A;  3IBH A;  5KN1 A;  5D9W A;  1K0O A;  4GSS A;  3MSZ A;  2L5O A;  4K2D A;  2BTO T;  22GS A;  5DBQ A;  4CY8 A;  2VL2 C;  4L8E A;  2A2P A;  3ZVJ A;  3J7Y b;  2L6C A;  1R4W A;  3WGD A;  3GX8 A;  4WEY A;  3TRQ A;  2HXK A;  3TKS E;  5ECM B;  2MMZ A;  1ERT A;  4HSC X;  4K7O A;  3F3R A;  4PUF C;  2CAI A;  4HJ2 A;  11GS A;  1K3O A;  3FKF A;  2H30 A;  4YAP A;  1F3B A;  5CO3 A;  5ECK B;  3W8S A;  3DVW A;  3EE2 A;  3I9V 2;  2L6D A;  3O76 A;  3I6A A;  4JBB A;  3ZMK A;  1XW9 A;  4I2U A;  1YJ6 A;  1K0A A;  1EV9 A;  1GLQ A;  1XFL A;  3GTU B;  3E9J B;  1SK0 A;  5DAK B;  5BMU A;  5J41 A;  1ZOF A;  1GUK A;  4OFM A;  4BVX A;  1XVW A;  1FAA A;  2M72 A;  1FO5 A;  4Q5F A;  1ZYN A;  1HQO A;  2R4V A;  4J57 E;  1BQ7 A;  1E6B A;  4WR4 A;  5JCU A;  2A2S A;  1ML6 A;  3PPU A;  4HUA A;  4KND A;  3ME8 A;  4XHM A;  3TKP A;  5HR2 A;  1QQ2 A;  4ZBB A;  2ON7 A;  2AB6 A;  1KTE A;  4PUA A;  1OYJ A;  2HRK A;  4EF0 A;  5B8A A;  2MMA A;  2X4A A;  4K5R A;  2VLU A;  5DDL A;  4TR1 B;  2HZF A;  4KGI A;  1ZZY A;  3FR9 A;  2VUP A;  2C3T A;  4TXO A;  1RK4 A;  2B3S A;  4Z2U A;  2AYT A;  4ZB6 A;  2VL9 A;  1PKZ A;  1YZX A;  2LTK A;  4XTS A;  2TRX A;  3BJ5 A;  3HVN A;  2VCX A;  4X43 A;  1F2E A;  6GST A;  4PXO A;  4ECB A;  3QCP A;  1ZCP A;  2AAW A;  4G0K A;  1SYR A;  3D21 A;  1A24 A;  5C00 A;  4GWR A;  1HNA A;  1MD3 A;  1M99 A;  4RI7 A;  2X8H A;  3KMO A;  1ZYE A;  1JFU A;  2HNL A;  2ZCT A;  3ED3 A;  4MJC A;  3LYP A;  2X99 A;  4ULX A;  1EV4 A;  2LRN A;  4I97 A;  4OD7 A;  2L57 A;  2HFD A;  4MK3 A;  2LNT A;  3LXZ A;  19GS A;  2F9S A;  2DSA A;  4MJA A;  5G2Z A;  5BRT A;  4Q5R A;  2WFC A;  5D9T A;  4PGT A;  3IHG A;  1SKS B;  4A5P A;  2CX4 A;  1M0U A;  1TK5 B;  3GHA A;  4ID0 A;  3ZIJ A;  4HEA 2;  3LGC A;  3L0H A;  4TW5 A;  4HJM A;  3IR4 A;  1EEM A;  1USB A;  1VF2 A;  2PGT A;  3TGZ A;  3EC3 A;  4K7I A;  2VL3 A;  1GSF A;  3FYG A;  2GTU A;  4F0C A;  5AGY A;  6GSU A;  5DVB A;  3CTF A;  3O6T A;  2O87 A;  3UAP A;  2TIR A;  1BJX A;  3WT2 A;  1K0N A;  3IA1 A;  4KDX A;  4F82 A;  2BMX A;  4GLT A;  3ZRE A;  4V2M A;  3IAS 2;  5AIX A;  5D9X A;  2HSY A;  3EU3 A;  2OBI A;  1T00 A;  2VCQ A;  2YWI A;  3IHQ A;  5HFG A;  4V1A g;  1V58 A;  4HZ2 A;  4TR0 A;  2FUG 2;  4DSR A;  3GKX A;  3TJF A;  1AIU A;  2DKH A;  5GAN D;  1ZYP A;  2V32 A;  2GZP A;  1M9A A;  3OR5 A;  2L59 A;  2EIQ A;  3TOU A;  6GSS A;  4O5U A;  3MDK A;  1Z7R A;  1Z3E A;  1K0D A;  3KJY A;  4G0L A;  3GYK A;  2YJH A;  1X9M B;  2V2G A;  3LOR A;  5IMZ A;  1G6Y A;  5G5E A;  2VIM A;  3SWL A;  4MJE A;  5FWG A;  3QD9 A;  2DJ1 A;  3MNG A;  4IJ3 A;  1PRX A;  3HDC A;  4DSS A;  2AJQ B;  4PQ1 A;  13GS A;  2GLR A;  3PR8 A;  5GST A;  4IN0 A;  1T1V A;  3KZQ A;  5KEJ A;  4IKH A;  1NW2 A;  1SEN A;  1H4O A;  2UZ8 A;  4MH2 A;  2FY6 A;  3GV1 A;  4LL4 B;  4G2E A;  2IME A;  4MH3 A;  1N2A A;  4QQ7 A;  3IC4 A;  2L4Q A;  5EPF A;  2JAD A;  1QUW A;  1KNG A;  2FD3 A;  1YEX A;  1Y25 A;  6GSY A;  1THX A;  2XHF A;  2YWN A;  2D2Z A;  2HSM A;  5GZZ B;  4LL1 B;  4ACS A;  4EE0 A;  3GSS A;  4GCI A;  5GAP D;  1V9W A;  4WR5 A;  5GSS A;  3HKR A;  4TXO B;  2QA1 A;  1AUC A;  4NHZ A;  5D8I A;  3BCK A;  3QMX A;  1Z6M A;  3LJR A;  3F8U A;  2WRT A;  1OE8 A;  4OFN A;  4RQX A;  4J2F A;  3TRX A;  1A8Y A;  2LQQ A;  5ABR A;  3IE3 A;  4WXT A;  1S3C A;  1OC8 A;  4TOP A;  1O73 A;  1AC1 A;  1X0R A;  5E4W A;  3GTU A;  1OVN A;  1PA3 A;  2IMF A;  3GUR A;  3L78 A;  3KEB A;  3CSJ A;  4E8E A;  4USS A;  2R0P A;  1FVJ A;  1NHY A;  1JZW A;  2HSH A;  3H79 A;  3I43 A;  1BAY A;  5H5Q A;  4NPB A;  3DGQ A;  1SD8 A;  4BWQ A;  1ERW A;  2B7J A;  4O92 A;  2H76 A;  2YZU A;  1B8X A;  3TKR A;  2K8V A;  2A4H A;  3KIJ A;  1ZYQ B;  3ERW A;  1FVK A;  1ABA A;  1W89 A;  3ZZX A;  2O89 A;  4TR1 A;  7GSS A;  1TP9 A;  2H01 A;  4AGS A;  3DML A;  3E0U A;  2DIZ A;  3DRN A;  5LNK e;  3I69 A;  5G1K A;  1VF4 A;  4F03 A;  4BVY A;  2H66 A;  2G2Q A;  2LV3 A;  4KE3 A;  4IJI A;  2X8C A;  4KDU A;  1U3I A;  5IPH A;  1FW1 A;  4HDE A;  3V1W A;  3D0Z A;  4DSQ A;  5J4U A;  2IL3 A;  3KH9 A;  5CRH A;  18GS A;  1B9Y C;  2M80 A;  5CAX A;  4ECC A;  2V41 A;  1UA5 A;  1LBK A;  2GGT A;  2H1G A;  3LW9 A;  2RM5 A;  4Q5Q A;  1XIY A;  4ZXG A;  1UN2 A;  1GTU A;  2WDU A;  3LYK A;  3TUE A;  2OE0 A;  4BPY A;  5ID2 B;  4TRX A;  1B9X C;  1JZO A;  3ZYW A;  2B1L A;  2FNO A;  2OE3 A;  3GFK A;  3O3T A;  3A5W A;  2ZNM A;  3WYW A;  1XW6 A;  2L4C A;  4E8H A;  5CRD A;  4JR6 A;  2VM1 A;  1OAZ A;  4KCA A;  2KOK A;  1T7P B;  4PUR A;  3M9J A;  1GTB A;  4POB A;  4ZBA A;  4MA9 A;  1SU9 A;  1K0M A;  2YWM A;  3AY8 A;  4L0W A;  5ECH B;  3UBL A;  1HNC A;  4AJ7 A;  4ZBD A;  1EWX A;  3P8W A;  2XPE A;  5CYY A;  3HXS A;  3HVX A;  3FHK A;  3CYN A;  1YDK A;  2VCT A;  4YAV A;  2GT5 A;  1SK1 A;  4K5S A;  20GS A;  4GQF A;  2VD0 A;  3VPT A;  2YV9 A;  4MP4 A;  1JLV A;  3F6D A;  3HVS A;  3TJK A;  2DJ2 A;  3FZA A;  3BCI A;  4FQU A;  2FWE A;  2LEG A;  1A23 A;  2R0G A;  3IRA A;  2R2J A;  3KXO A;  4K0G A;  3VPQ A;  4JR4 A;  4ZIL A;  5D73 A;  3SBC A;  3VLN A;  1M2A A;  2KHP A;  1YQ1 A;  4K9Z A;  4WKW A;  5G30 A;  1K0B A;  2FA8 A;  2PBJ A;  1C72 A;  4OO4 A;  2A4V A;  4GRF A;  1WE0 A;  4XS4 B;  1ZMA A;  2C3N A;  4XRD A;  4MMM A;  3VUR A;  2VOC A;  1V40 A;  2ES7 A;  5HR1 A;  1AAZ A;  2F51 A;  4BA7 A;  3DYR A;  2O8V B;  2DJK A;  1M3J A;  5A4U A;  2LJK A;  3LG6 A;  1M2B A;  2V6O A;  1MEK A;  2NVL A;  3F4T A;  4TR3 A;  3NZN A;  3CQF A;  3RDW A;  17GS A;  3P2A A;  2YPM A;  4I5Q A;  5EL8 A;  3C1S A;  1JLW A;  5F06 A;  1NM3 A;  3IK9 A;  2PVQ A;  3QFB C;  2DBC A;  4GXZ A;  2LJR A;  2R5G A;  3IC8 A;  3CMI A;  5CP1 A;  2VCW A;  3ZIV A;  3GMF A;  3BD2 A;  3QFA C;  1SKW B;  1SJI A;  1XZO A;  2NBS A;  3L9U A;  4NAX A;  1K3L A;  2I81 A;  1J08 A;  2OBK A;  1TU7 A;  4OFT A;  5IM9 A;  4CHS A;  2G0F A;  4JE1 A;  2DKI A;  3CSH A;  3KH7 A;  4V2N A;  1GNE A;  1GSQ A;  4BVY B;  3EMP A;  2I9H A;  3PH9 A;  1BED A;  1F9M A;  1O8X A;  1AQV A;  1QGV A;  3TJB A;  1ZL9 A;  1GSE A;  4BWS A;  4MLY A;  2OKA A;  1V57 A;  1W4V A;  2GQL A;  2H72 A;  1ST9 A;  4XS1 A;  4V2L A;  3VI5 A;  1PFO A;  1DSB A;  3KGK A;  2H6Y A;  2LQO A;  1EEJ A;  3HZ8 A;  5COH A;  3RPN A;  3JCM L;  2HRA A;  3DXB A;  4ZL8 A;  2KP2 A;  1K0C A;  3R2Q A;  1NHO A;  1WRY A;  5EVO A;  4EXJ A;  3R3E A;  2I1U A;  4K8M A;  2J9H A;  2A2R A;  4IHU A;  2EC4 A;  1PKW A;  1XPV A;  2GQK A;  4G9H A;  3HCZ A;  2C3Q A;  1TK8 B;  2E0Q A;  3Q6O A;  3N9J A;  3VFI A;  2WS2 A;  3US3 A;  1PN0 A;  3N5O A;  3F4R A;  4NV5 A;  1SJZ A;  1R5P A;  2DIY A;  4MCU A;  4BL7 B;  1WP0 A;  2CVK A;  1RW1 A;  1H75 A;  2IJY A;  4WF4 A;  4MZW A;  2RUF A;  4KDY A;  3RPP A;  3UMA A;  5INY A;  1G6W A;  2LST A;  4P3Y B;  3VWW A;  2IMD A;  1ILO A;  4YQU A;  1YKC A;  2REM A;  3PGT A;  4G19 A;  4EDY A;  8GSS A;  1PL1 A;  5FT3 A;  3TB2 A;  4NWY A;  5J5N A;  1EOG A;  5IOX A;  2E7P A;  4AJ6 A;  3A2V A;  1ERU A;  2H1B A;  3EVI A;  3UBK A;  1Z9H A;  3HJM A;  2GSR A;  2P31 A;  3QAW A;  1YF1 A;  4MAB A;  3ZFL A;  4MF5 A;  1ON4 A;  2H73 A;  2MZC A;  1FOH A;  2HI7 A;  4I6X A;  3RHB A;  3GIX A;  2ON5 A;  3WGE A;  10GS A;  1FHE A;  1XOA A;  4DEJ A;  3WGX A;  2CZ3 A;  5ID2 A;  2RM6 A;  5ELG A;  5F0G A;  4YQV A;  1A2L A;  1A8L A;  5HQP A;  1PMT A;  2HZE B;  4G10 A;  3TJG A;  3EPT A;  2HRF A;  4MNN A;  2GS3 A;  5B8B A;  1THO A;  4ZL9 A;  4ICY A;  3LFL A;  4N0V A;  5H5S A;  1G7E A;  2DJJ A;  1G0T A;  1SYX A;  6GSX A;  4HQS A;  5F07 A;  2YN1 A;  2R6K A;  3H93 A;  3D4T A;  3LXT A;  2KP1 A;  1SJ6 A;  1M9B A;  1I9D A;  1OE7 A;  1FB0 A;  4GF0 A;  4WBR D;  2MMN A;  2HRN A;  2RII A;  3KMN A;  1TK0 B;  2YOI A;  1X9S B;  1T8E B;  4L5O A;  1Q4J A;  1KBN A;  4MF7 A;  5H5R A;  2OE1 A;  2B7K A;  2H70 A;  3E3E A;  5HR3 A;  4MDC A;  3RBT A;  3LEF A;  3C73 A;  3HZ4 A;  5ECN B;  5HFK A;  1AQX A;  3PIN A;  2OAD A;  3HVV A;  2FWH A;  2N5F A;  2DJ3 A;  4O5R A;  4IW9 A;  4OMV A;  4OCE A;  3KTB A;  1MD4 A;  2K9F A;  3GNJ A;  5G5F A;  3M9K A;  4CDO A;  1UVZ A;  3L9V A;  4K7N A;  1F37 A;  2PUK C;  2HT9 A;  3M1G A;  3A2X A;  3RHC A;  4ECI A;  2EIO A;  3HJP A;  14GS A;  5IMD A;  2AUV A;  1SL1 B; 
#chains in the Genus database with same CATH homology
 4X4J A;  4XS4 A;  3Q74 A;  4WF5 A;  2IN3 A;  4ZB9 A;  4D73 B;  1TRS A;  1GTA A;  2F8A A;  2XBQ A;  3UEM A;  4IBP A;  3KTL A;  5DJL A;  2WB9 A;  3HD5 A;  3F0I A;  3W8J A;  2X64 A;  2B5Y A;  4LMV A;  3GN3 A;  3HHV A;  5ECP B;  2WGR A;  1GL8 A;  2HYX A;  1EZK A;  4GTU A;  1O81 A;  5E59 A;  1DE2 A;  1TRV A;  1BG5 A;  3EIN A;  2VCZ A;  2WUL A;  4TXV A;  4OCF A;  2GQM A;  5JWO B;  1O7U A;  3GUS A;  4EUY A;  1QXH A;  4L0U A;  2BJX A;  3NOF A;  1FG4 A;  2QSI A;  3DEX A;  5B6N A;  2B5X A;  2LS5 A;  4N30 A;  3VWU A;  3P7X A;  2LRC A;  3IOS A;  2YCD A;  2GST A;  5DAL B;  2H6X A;  3GX0 A;  3UL3 A;  5LCZ A;  2PN8 A;  4KB3 A;  3ERF A;  4YQM A;  3EMX A;  4F2I A;  3FZ9 A;  3GKN A;  12GS A;  1URM A;  3L4N A;  2CX3 A;  4Z7X A;  2IFQ B;  3P90 A;  4RQR A;  1SD9 A;  5IIZ A;  5AN1 A;  1XWK A;  2CZ2 A;  3IXR A;  4X0X A;  2H19 A;  4JED A;  4O32 A;  3GKM A;  2CVD A;  1S3A A;  1V98 A;  4J56 E;  3TRP A;  3TCO A;  5KN3 A;  3EUR A;  4F0B A;  2YZH A;  2YWO A;  3D5J A;  1N8J A;  4FYC A;  4AF2 A;  2IIY A;  4CW9 A;  2H8L A;  5ECR B;  4KSO A;  3DD3 A;  3FR6 A;  4H86 A;  1UC7 A;  4I8B A;  4DVC A;  3KM6 A;  3FMW A;  5IO2 A;  3Q19 A;  5JCG A;  5ECL B;  5J9B A;  1QFN A;  1RQM A;  2K8S A;  4N0Z A;  3DKS A;  1XBS A;  2VLT A;  3MIX A;  2H6Z A;  2JSZ A;  4CY6 A;  4TVE A;  1ACV A;  2C0E A;  4FIW A;  3FY7 A;  3EU4 A;  4I2T A;  4BL7 A;  2I4A A;  2WJU A;  3LWA A;  2DJ0 A;  3FZ5 A;  2JL4 A;  3ZVJ D;  5IQY A;  3GH9 A;  3MYD A;  5IMF A;  4ZIJ A;  3HYP A;  4IP6 A;  1GSU A;  5J3R A;  5HR0 A;  2C0D A;  1GWC A;  3APS A;  3D22 A;  2FWG A;  2MBT A;  1SK2 A;  2FWF A;  1GH2 A;  4N11 A;  5D9V A;  2H74 A;  3IV4 A;  1VGL A;  1B48 A;  1PX6 A;  2P0G A;  3KP9 A;  4LLR A;  1JZR A;  3LSZ A;  2GZY A;  4X1U A;  2QC7 A;  5JWQ B;  3M8N A;  1XXU A;  4IQ1 A;  4PNF A;  1XWA A;  5AIV A;  4FH8 A;  1U3A A;  5A4V A;  2FLS A;  3UJ1 A;  1PGT A;  1U88 A;  3UIW A;  4PQH A;  1MDK A;  5KN0 A;  1SL2 B;  2J23 A;  2HZE A;  5IOW A;  1O6J A;  2XC2 A;  2X8G A;  1GUL A;  1KEB A;  1PD2 1;  3GKK A;  2R3X A;  3ZRD A;  5A5K A;  1B4P A;  3ZTL A;  2MYG A;  2VL2 A;  3IAM 2;  1JZD A;  1T3B A;  2LUS A;  4LMW A;  5ECS A;  4IEL A;  5AIS A;  4AJ8 A;  3GST A;  1GLP A;  1PSQ A;  4HS1 A;  3WT1 A;  1VF1 A;  5ECI B;  3NIV A;  9GSS A;  1MTC A;  4K1F A;  1NSW A;  1S3D A;  2WCI A;  2AHE A;  4LA1 A;  5DCG A;  2C8U A;  1TU8 A;  4KH7 A;  2H0H A;  16GS A;  2LRT A;  4MPF A;  3BBY A;  1QK8 A;  1EP8 A;  1F3A A;  1J0F A;  5CRW A;  2E2M A;  2FGX A;  4IQA A;  1BX9 A;  3QAG A;  4TR4 A;  4ILF A;  3M3M A;  3G9B A;  1AW9 A;  1DE1 A;  2ALB A;  2PWJ A;  2H75 A;  5IMA A;  5JWR B;  4QL9 A;  4XCS A;  1TDI A;  3LQ7 A;  4OWY A;  1TXX A;  4FYU A;  5B6M A;  2DC5 A;  3ZML A;  1Z5Y E;  1R5A A;  3VWV A;  2F8F A;  2OAC A;  5DQS A;  4RI6 A;  2GSQ A;  3C7M A;  2KLX A;  4Z2T A;  2JAC A;  2GZZ A;  3A2W A;  1BYE A;  2NDO A;  1SL0 B;  1T4Y A;  3FRC A;  2CVB A;  4MPG A;  1OC9 B;  3GRX A;  5C04 A;  2R37 A;  1XCC A;  2YJ7 A;  1F6M C;  2C0G A;  2C1Y A;  2JZT A;  3GH6 A;  4EVM A;  4EIQ A;  1XW5 A;  1PL2 A;  1XOB A;  1Z6N A;  3D6I A;  1WOU A;  3F6F A;  4D73 A;  5DJM A;  3IK7 A;  1WWJ A;  2CV4 A;  4KW6 A;  2K6V A;  3C8E A;  5CRG A;  3F3Q A;  2ZUP A;  1ERV A;  3F9U A;  2C0F A;  2VO4 A;  1I5G A;  2O85 A;  3FR3 A;  4ISD A;  4EDZ A;  4XIH A;  1GP1 A;  1EGO A;  2PU9 C;  1Y6E A;  1XWB A;  1X5C A;  1G7O A;  3ZFB A;  3ERG A;  1YF0 A;  2O7K A;  4ECJ A;  3IPZ A;  4XS6 A;  4HOJ A;  5JCW A;  4WET A;  2N5B A;  3DWV A;  4KF9 A;  1X9W B;  1FOV A;  6GSW A;  2RLI A;  5DAL A;  3GA4 A;  3KD0 A;  5L71 A;  5KN2 A;  1MDI A;  4QL7 A;  2RUE A;  2JSY A;  1GSS A;  2VAF A;  1XWG A;  1IYH A;  2IFQ A;  5G31 A;  3WD6 A;  2DML A;  3VWX A;  5IMC A;  2C4J A;  3G7I A;  2GSS A;  2X49 A;  3DVX A;  4O7H A;  4Z2R A;  3ISO A;  5FHI A;  4MZB A;  2E2G A;  2PER A;  4POL A;  1HD2 A;  3KCM A;  4K0N A;  1K3Y A;  3H1N A;  4FO5 A;  5CRE A;  5A4W A;  1WMJ A;  1X5E A;  3L9S A;  3H4K A;  3QR6 A;  4GSN A;  4HZ4 A;  1O8W A;  4Q5N A;  2K18 A;  2LJA A;  3ZIT A;  3TKQ A;  2LNS A;  3A3T A;  3DIE A;  3Q18 A;  2C80 A;  5F8B A;  3C71 A;  1GRX A;  2CT6 A;  2B5E A;  3HJO A;  4IS0 A;  3M0F A;  4ZL7 A;  1OKD A;  4JU5 A;  1U6T A;  1PQN A;  2YP6 A;  1VRS D;  1TI1 A;  2PMT A;  4V1A p;  2MBS A;  1EOH A;  3FK8 A;  1A2M A;  1B4Q A;  5KOW A;  1OC3 A;  5IPG A;  1GSD A;  2OA7 A;  1JHB A;  3KP8 A;  4GST A;  1YKA A;  2H0G A;  3EWL A;  2JZS A;  5CNW A;  3VK9 A;  1QMV A;  2Z9S A;  1TJD A;  1VF3 A;  3TJJ A;  1PN9 A;  4HU7 A;  4TKY A;  1U87 A;  3F63 A;  2QGV A;  2IMK A;  3ZLP A;  4EC0 A;  1GNW A;  2IPA A;  1GTI A;  5ECQ B;  4RUV A;  4JRR A;  2AV4 A;  1SKR B;  2F3M A;  3G7J A;  4POK A;  5DCH A;  1TRU A;  4EL1 A;  2H71 A;  4TN8 A;  3QDN A;  4BVX B;  4YKG A;  4PTS A;  3QAV A;  2GVP A;  2YNX A;  1TTZ A;  2XBI A;  2DLX A;  1FB6 A;  5IMV A;  1Z7P A;  4OO5 A;  3HY2 A;  2I3Y A;  4KCE A;  3UOM A;  5G1L A;  2V1M A;  4NHW A;  2IWT A;  5LD0 A;  3FZ4 A;  1TW9 A;  1EGR A;  2FCH A;  2P5R A;  3APO A;  4PNG A;  3D4M A;  2YAN A;  3C1R A;  4JZQ A;  1CQG A;  1E2Y A;  4NXI A;  3RAZ A;  1GSY A;  1R26 A;  2H0I A;  2CAQ A;  4KUN A;  1WJK A;  2L5L A;  3TKS C;  2XPD A;  2KUC A;  1GUH A;  2CA8 A;  1R7H A;  4N10 A;  5DQY A;  5KOX A;  1O85 A;  3TKS A;  2VD1 A;  1A0F A;  3CXG A;  3ME7 A;  1HYU A;  2H1A A;  3GL3 A;  1WIK A;  1CQH A;  5DAK A;  2LKU A;  2QKE A;  4PX1 A;  4MJB A;  6GSV A;  3MAK A;  2P5Q A;  1PX7 A;  1ZGN A;  2PPT A;  1TKD B;  2B6M A;  4YH2 A;  2FA4 A;  1XVQ A;  3BOA A;  2JZR A;  1Q98 A;  3CSI A;  1GUM A;  1IYI A;  3EYT A;  3CRT A;  1V2A A;  4NV2 A;  1M2D A;  2EIR A;  3CTG A;  4IVF A;  4IP1 A;  4IGJ A;  2FHE A;  3QPM A;  3IDV A;  1OKT A;  3G7Y A;  4PQI A;  2PVO C;  1J9B A;  3CBU A;  4XRA A;  4ZB8 A;  3A5I A;  1OC9 A;  1T4Z A;  3F4S A;  4HI7 A;  4FYB A;  4KA0 A;  4NMU A;  3W6G A;  5D93 A;  2VM2 A;  1MDJ A;  1TI3 A;  4KAE A;  2QA2 A;  5EY6 A;  2N5A A;  4G0I A;  4EKZ A;  2IMI A;  2CQ9 A;  3H8Q A;  2B1K A;  1EP7 A;  5F05 A;  1X5D A;  3APQ A;  1WPI A;  1A2J A;  1TOF A;  2M46 A;  5ELA A;  2GDR A;  2V6K A;  2MMO A;  5J9C A;  4O5Q A;  3MWH A;  5D96 A;  4EO3 A;  4L5L A;  4EIP A;  2H1D A;  3UAR A;  5HFI A;  3UVT A;  5ECO B;  2HE3 A;  4KX4 A;  3UVH A;  3FW2 A;  2HLS A;  2GT6 A;  4ML6 A;  3QOU A;  4YKF A;  4K6X A;  3K8N A;  5ENU A;  4ML1 A;  4HU9 A;  3TDG A;  3VI7 A;  1AQW A;  1YY7 A;  1DUG A;  1A0R P;  4GQC A;  3TOT A;  1LJR A;  5IO0 A;  5B7C A;  2OJL A;  4DSS B;  3HA9 A;  4MZC A;  2JU5 A;  2WZ9 A;  3S9F A;  3U5R E;  4MF6 A;  4WBJ A;  1LU4 A;  1TRW A;  1M7T A;  3FEU A;  3J7Y k;  2R0C A;  1DBY A;  1AXD A;  2DMM A;  3CRU A;  1XWC A;  2NPB A;  4HQZ A;  4KSM A;  2VCV A;  2NTO A;  2YV7 A;  4POM A;  1HNB A;  2VLV A;  2TRC P;  4F9Z A;  3U6V A;  3ZL5 A;  4K2X A;  3GL5 A;  1YEP A;  3IBH A;  5KN1 A;  5D9W A;  1K0O A;  4GSS A;  3MSZ A;  2L5O A;  4K2D A;  2BTO T;  22GS A;  5DBQ A;  4CY8 A;  2VL2 C;  4L8E A;  2A2P A;  3ZVJ A;  3J7Y b;  2L6C A;  1R4W A;  3WGD A;  3GX8 A;  4WEY A;  3TRQ A;  2HXK A;  3TKS E;  5ECM B;  2MMZ A;  1ERT A;  4K7O A;  3F3R A;  4PUF C;  2CAI A;  4HJ2 A;  11GS A;  1K3O A;  3FKF A;  2H30 A;  4YAP A;  1F3B A;  5CO3 A;  5ECK B;  3W8S A;  3DVW A;  3EE2 A;  3I9V 2;  2L6D A;  3O76 A;  3I6A A;  4JBB A;  3ZMK A;  1XW9 A;  4I2U A;  1YJ6 A;  1K0A A;  1EV9 A;  1GLQ A;  1XFL A;  3GTU B;  3E9J B;  1SK0 A;  5DAK B;  5BMU A;  5J41 A;  1ZOF A;  1GUK A;  4OFM A;  4BVX A;  1XVW A;  1FAA A;  2M72 A;  1FO5 A;  4Q5F A;  1ZYN A;  1HQO A;  2R4V A;  4J57 E;  1BQ7 A;  1E6B A;  4WR4 A;  5JCU A;  2A2S A;  1ML6 A;  3PPU A;  4HUA A;  4KND A;  3ME8 A;  4XHM A;  3TKP A;  5HR2 A;  1QQ2 A;  4ZBB A;  2ON7 A;  2AB6 A;  1KTE A;  4PUA A;  1OYJ A;  2HRK A;  4EF0 A;  5B8A A;  2MMA A;  2X4A A;  4K5R A;  2VLU A;  5DDL A;  4TR1 B;  2HZF A;  4KGI A;  1ZZY A;  3FR9 A;  2VUP A;  2C3T A;  4TXO A;  1RK4 A;  2B3S A;  4Z2U A;  2AYT A;  4ZB6 A;  2VL9 A;  1PKZ A;  1YZX A;  2LTK A;  4XTS A;  2TRX A;  3BJ5 A;  2VCX A;  4X43 A;  1F2E A;  6GST A;  4PXO A;  4ECB A;  3QCP A;  1ZCP A;  2AAW A;  4G0K A;  1SYR A;  3D21 A;  1A24 A;  5C00 A;  4GWR A;  1HNA A;  1MD3 A;  1M99 A;  4RI7 A;  2X8H A;  3KMO A;  1ZYE A;  1JFU A;  2HNL A;  2ZCT A;  3ED3 A;  4MJC A;  3LYP A;  2X99 A;  4ULX A;  1EV4 A;  2LRN A;  4I97 A;  4OD7 A;  2L57 A;  2HFD A;  4MK3 A;  2LNT A;  3LXZ A;  19GS A;  2F9S A;  2DSA A;  4MJA A;  5G2Z A;  5BRT A;  4Q5R A;  2WFC A;  5D9T A;  4PGT A;  3IHG A;  1SKS B;  4A5P A;  2CX4 A;  1M0U A;  1TK5 B;  3GHA A;  4ID0 A;  3ZIJ A;  4HEA 2;  3LGC A;  3L0H A;  4TW5 A;  4HJM A;  3IR4 A;  1EEM A;  1USB A;  1VF2 A;  2PGT A;  3TGZ A;  3EC3 A;  4K7I A;  2VL3 A;  1GSF A;  3FYG A;  2GTU A;  4F0C A;  5AGY A;  6GSU A;  5DVB A;  3CTF A;  3O6T A;  2O87 A;  3UAP A;  2TIR A;  1BJX A;  3WT2 A;  1K0N A;  3IA1 A;  4KDX A;  4F82 A;  2BMX A;  4GLT A;  3ZRE A;  4V2M A;  3IAS 2;  5AIX A;  5D9X A;  2HSY A;  3EU3 A;  2OBI A;  1T00 A;  2VCQ A;  2YWI A;  3IHQ A;  5HFG A;  4V1A g;  1V58 A;  4HZ2 A;  4TR0 A;  2FUG 2;  4DSR A;  3GKX A;  3TJF A;  1AIU A;  2DKH A;  5GAN D;  1ZYP A;  2V32 A;  2GZP A;  1M9A A;  3OR5 A;  2L59 A;  2EIQ A;  3TOU A;  6GSS A;  4O5U A;  3MDK A;  1Z7R A;  1Z3E A;  1K0D A;  3KJY A;  4G0L A;  3GYK A;  2YJH A;  1X9M B;  2V2G A;  3LOR A;  5IMZ A;  1G6Y A;  5G5E A;  2VIM A;  3SWL A;  4MJE A;  5FWG A;  3QD9 A;  2DJ1 A;  3MNG A;  4IJ3 A;  1PRX A;  3HDC A;  4DSS A;  2AJQ B;  4PQ1 A;  13GS A;  2GLR A;  3PR8 A;  5GST A;  4IN0 A;  1T1V A;  3KZQ A;  5KEJ A;  4IKH A;  1NW2 A;  1SEN A;  1H4O A;  2UZ8 A;  4MH2 A;  2FY6 A;  3GV1 A;  4LL4 B;  4G2E A;  2IME A;  4MH3 A;  1N2A A;  4QQ7 A;  3IC4 A;  2L4Q A;  5EPF A;  2JAD A;  1QUW A;  1KNG A;  2FD3 A;  1YEX A;  1Y25 A;  6GSY A;  1THX A;  2XHF A;  2YWN A;  2D2Z A;  2HSM A;  5GZZ B;  4LL1 B;  4ACS A;  4EE0 A;  3GSS A;  4GCI A;  5GAP D;  1V9W A;  4WR5 A;  5GSS A;  3HKR A;  4TXO B;  2QA1 A;  1AUC A;  4NHZ A;  5D8I A;  3BCK A;  3QMX A;  1Z6M A;  3LJR A;  3F8U A;  2WRT A;  1OE8 A;  4OFN A;  4RQX A;  4J2F A;  3TRX A;  1A8Y A;  2LQQ A;  5ABR A;  3IE3 A;  4WXT A;  1S3C A;  1OC8 A;  4TOP A;  1O73 A;  1AC1 A;  1X0R A;  5E4W A;  3GTU A;  1OVN A;  1PA3 A;  2IMF A;  3GUR A;  3L78 A;  3KEB A;  3CSJ A;  4E8E A;  4USS A;  2R0P A;  1FVJ A;  1NHY A;  1JZW A;  2HSH A;  3H79 A;  3I43 A;  1BAY A;  5H5Q A;  4NPB A;  3DGQ A;  1SD8 A;  4BWQ A;  1ERW A;  2B7J A;  4O92 A;  2H76 A;  2YZU A;  1B8X A;  3TKR A;  2K8V A;  2A4H A;  3KIJ A;  1ZYQ B;  3ERW A;  1FVK A;  1ABA A;  1W89 A;  3ZZX A;  2O89 A;  4TR1 A;  7GSS A;  1TP9 A;  2H01 A;  4AGS A;  3DML A;  3E0U A;  2DIZ A;  3DRN A;  5LNK e;  3I69 A;  5G1K A;  1VF4 A;  4F03 A;  4BVY A;  2H66 A;  2G2Q A;  2LV3 A;  4KE3 A;  4IJI A;  2X8C A;  4KDU A;  1U3I A;  5IPH A;  1FW1 A;  4HDE A;  3V1W A;  3D0Z A;  4DSQ A;  5J4U A;  2IL3 A;  3KH9 A;  5CRH A;  18GS A;  1B9Y C;  2M80 A;  5CAX A;  4ECC A;  2V41 A;  1UA5 A;  1LBK A;  2GGT A;  2H1G A;  3LW9 A;  2RM5 A;  4Q5Q A;  1XIY A;  4ZXG A;  1UN2 A;  1GTU A;  2WDU A;  3LYK A;  3TUE A;  2OE0 A;  4BPY A;  5ID2 B;  4TRX A;  1B9X C;  1JZO A;  3ZYW A;  2B1L A;  2FNO A;  2OE3 A;  3GFK A;  3O3T A;  3A5W A;  2ZNM A;  3WYW A;  1XW6 A;  2L4C A;  4E8H A;  5CRD A;  4JR6 A;  2VM1 A;  1OAZ A;  4KCA A;  2KOK A;  1T7P B;  4PUR A;  3M9J A;  1GTB A;  4POB A;  4ZBA A;  4MA9 A;  1SU9 A;  1K0M A;  2YWM A;  3AY8 A;  4L0W A;  5ECH B;  3UBL A;  1HNC A;  4AJ7 A;  4ZBD A;  1EWX A;  3P8W A;  2XPE A;  5CYY A;  3HXS A;  3HVX A;  3FHK A;  3CYN A;  1YDK A;  2VCT A;  4YAV A;  2GT5 A;  1SK1 A;  4K5S A;  20GS A;  4GQF A;  2VD0 A;  3VPT A;  2YV9 A;  4MP4 A;  1JLV A;  3F6D A;  3HVS A;  3TJK A;  2DJ2 A;  3FZA A;  3BCI A;  4FQU A;  2FWE A;  2LEG A;  1A23 A;  2R0G A;  3IRA A;  2R2J A;  3KXO A;  4K0G A;  3VPQ A;  4JR4 A;  4ZIL A;  5D73 A;  3SBC A;  3VLN A;  1M2A A;  2KHP A;  1YQ1 A;  4K9Z A;  4WKW A;  5G30 A;  1K0B A;  2FA8 A;  2PBJ A;  1C72 A;  4OO4 A;  2A4V A;  4GRF A;  1WE0 A;  4XS4 B;  1ZMA A;  2C3N A;  4XRD A;  4MMM A;  3VUR A;  2VOC A;  1V40 A;  2ES7 A;  5HR1 A;  1AAZ A;  2F51 A;  4BA7 A;  3DYR A;  2O8V B;  2DJK A;  5A4U A;  2LJK A;  3LG6 A;  1M2B A;  2V6O A;  1MEK A;  2NVL A;  3F4T A;  4TR3 A;  3NZN A;  3RDW A;  17GS A;  3P2A A;  2YPM A;  4I5Q A;  5EL8 A;  3C1S A;  1JLW A;  5F06 A;  1NM3 A;  3IK9 A;  2PVQ A;  3QFB C;  2DBC A;  4GXZ A;  2LJR A;  2R5G A;  3IC8 A;  3CMI A;  5CP1 A;  2VCW A;  3ZIV A;  3GMF A;  3BD2 A;  3QFA C;  1SKW B;  1SJI A;  1XZO A;  2NBS A;  3L9U A;  4NAX A;  1K3L A;  2I81 A;  1J08 A;  2OBK A;  1TU7 A;  4OFT A;  5IM9 A;  4CHS A;  2G0F A;  4JE1 A;  2DKI A;  3CSH A;  3KH7 A;  4V2N A;  1GNE A;  1GSQ A;  4BVY B;  3EMP A;  2I9H A;  3PH9 A;  1BED A;  1F9M A;  1O8X A;  1AQV A;  1QGV A;  3TJB A;  1ZL9 A;  1GSE A;  4BWS A;  4MLY A;  2OKA A;  1V57 A;  1W4V A;  2GQL A;  2H72 A;  1ST9 A;  4XS1 A;  4V2L A;  3VI5 A;  1DSB A;  3KGK A;  2H6Y A;  2LQO A;  1EEJ A;  3HZ8 A;  5COH A;  3RPN A;  3JCM L;  2HRA A;  3DXB A;  4ZL8 A;  2KP2 A;  1K0C A;  3R2Q A;  1NHO A;  1WRY A;  5EVO A;  4EXJ A;  3R3E A;  2I1U A;  4K8M A;  2J9H A;  2A2R A;  4IHU A;  2EC4 A;  1PKW A;  1XPV A;  2GQK A;  4G9H A;  3HCZ A;  2C3Q A;  1TK8 B;  2E0Q A;  3Q6O A;  3N9J A;  3VFI A;  2WS2 A;  3US3 A;  1PN0 A;  3N5O A;  3F4R A;  4NV5 A;  1SJZ A;  1R5P A;  2DIY A;  4MCU A;  4BL7 B;  1WP0 A;  2CVK A;  1RW1 A;  1H75 A;  2IJY A;  4WF4 A;  4MZW A;  2RUF A;  4KDY A;  3RPP A;  3UMA A;  5INY A;  1G6W A;  2LST A;  4P3Y B;  3VWW A;  2IMD A;  1ILO A;  4YQU A;  1YKC A;  2REM A;  3PGT A;  4G19 A;  4EDY A;  8GSS A;  1PL1 A;  5FT3 A;  3TB2 A;  4NWY A;  5J5N A;  1EOG A;  5IOX A;  2E7P A;  4AJ6 A;  3A2V A;  1ERU A;  2H1B A;  3EVI A;  3UBK A;  1Z9H A;  3HJM A;  2GSR A;  2P31 A;  3QAW A;  1YF1 A;  4MAB A;  3ZFL A;  4MF5 A;  1ON4 A;  2H73 A;  2MZC A;  1FOH A;  2HI7 A;  4I6X A;  3RHB A;  3GIX A;  2ON5 A;  3WGE A;  10GS A;  1FHE A;  1XOA A;  4DEJ A;  3WGX A;  2CZ3 A;  5ID2 A;  2RM6 A;  5ELG A;  5F0G A;  4YQV A;  1A2L A;  1A8L A;  5HQP A;  1PMT A;  2HZE B;  4G10 A;  3TJG A;  3EPT A;  2HRF A;  4MNN A;  2GS3 A;  5B8B A;  1THO A;  4ZL9 A;  4ICY A;  3LFL A;  4N0V A;  5H5S A;  1G7E A;  2DJJ A;  1G0T A;  1SYX A;  6GSX A;  4HQS A;  5F07 A;  2YN1 A;  2R6K A;  3H93 A;  3D4T A;  3LXT A;  2KP1 A;  1SJ6 A;  1M9B A;  1I9D A;  1OE7 A;  1FB0 A;  4GF0 A;  4WBR D;  2MMN A;  2HRN A;  2RII A;  3KMN A;  1TK0 B;  2YOI A;  1X9S B;  1T8E B;  4L5O A;  1Q4J A;  1KBN A;  4MF7 A;  5H5R A;  2OE1 A;  2B7K A;  2H70 A;  3E3E A;  5HR3 A;  4MDC A;  3RBT A;  3LEF A;  3C73 A;  3HZ4 A;  5ECN B;  5HFK A;  1AQX A;  3PIN A;  2OAD A;  3HVV A;  2FWH A;  2N5F A;  2DJ3 A;  4O5R A;  4IW9 A;  4OMV A;  4OCE A;  3KTB A;  1MD4 A;  2K9F A;  3GNJ A;  5G5F A;  3M9K A;  4CDO A;  1UVZ A;  3L9V A;  4K7N A;  1F37 A;  2PUK C;  2HT9 A;  3M1G A;  3A2X A;  3RHC A;  4ECI A;  2EIO A;  3HJP A;  14GS A;  5IMD A;  2AUV A;  1SL1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...