3D21A

Crystal structure of a poplar wild-type thioredoxin h, pttrxh4
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
111
structure length
111
Chain Sequence
GNVHLITTKERWDQKLSEASRDGKIVLANFSARWCGPCKQIAPYYIELSENYPSLMFLVIDVDELSDFSASWEIKATPTFFFLRDGQQVDKLVGANKPELHKKITAILDSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin H-type
publication title An Atypical Catalytic Mechanism Involving Three Cysteines of Thioredoxin.
pubmed doi rcsb
source organism Populus trichocarpa x populus deltoides
total genus 32
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3d21A00
3D22A 2AHEA 2F51A 1M2BA 4V2MA 2ZCTA 3DVXA 4E8EA 4QL7A 4MZWA 3LORA 4TKYA 4V2NA 3ZIVA 2XHFA 2LQOA 4Q5FA 1WRYA 3KMNA 2H1AA 1OE8A 4MF7A 3ZFBA 2F8FA 14GSA 2CVDA 2YWOA 1E2YA 13GSA 3EU3A 5J9CA 3WGDA 2OA7A 4GSNA 2H19A 1UC7A 1ILOA 2YWIA 3C73A 1J08A 3GIXA 1GP1A 4AJ8A 2H01A 3Q18A 2NVLA 3CRUA 1EEJA 2IMKA 1YEXA 1THOA 2NPBA 4MK3A 2CAIA 3LYPA 4KH7A 2JZSA 2TRCP 1CQGA 4DSSA 3QD9A 4KNDA 3LYKA 3FY7A 2KLXA 5D93A 1JFUA 4EXJA 3VWVA 4D73A 3GX8A 3H4KA 1XOAA 1GL8A 2C1YA 3US3A 4EVMA 1A2MA 1K3OA 5JWQB 2DJ3A 1SENA 3UAPA 4N11A 1HNBA 1GULA 4NPBA 4IGJA 3FR3A 3GHAA 1O8WA 1XIYA 5ECSA 3F3QA 1GTAA 3GSSA 3GMFA 1ERUA 3UJ1A 1BG5A 1ERTA 2LRNA 1B4QA 1ZL9A 3KD0A 2HSYA 2CX3A 2GVPA 2E2GA 1FAAA 3DRNA 2X8GA 1AIUA 2WGRA 3HDCA 11GSA 3TKSA 10GSA 2HI7A 4XRDA 4ZXGA 2YANA 4IS0A 5IMZA 3M9KA 4WF4A 18GSA 2WRTA 5FWGA 2D2ZA 3GV1A 2LS5A 5CRHA 1F3AA 5KN3A 1G6YA 3QCPA 5FT3A 2H72A 1OC3A 4HQSA 1AW9A 3IE3A 2OADA 2IIYA 3QDNA 2LNSA 2JZTA 5GAND 3UBKA 4TR4A 2GGTA 3A2WA 4EC0A 1M0UA 5E4WA 1USBA 1GUMA 2L4QA 2VCQA 1V40A 3ZLPA 2GSSA 5L71A 1K0MA 2VOCA 2LNTA 2YCDA 4O92A 2CQ9A 4RQXA 2XBIA 5IMDA 4TN8A 1TU7A 1PRXA 4G19A 3DVWA 4HU7A 3FR6A 4MLYA 2NBSA 1KTEA 3TJBA 3H93A 1V2AA 1ERVA 4K7OA 3TKSC 2HFDA 1K0DA 1ML6A 3HVVA 5CRGA 4GCIA 12GSA 1ZYEA 6GSYA 1B4PA 2IMDA 3E0UA 5HR2A 3TKRA 3KH9A 2DSAA 2AYTA 2L6CA 2YN1A 3M0FA 4ZBAA 3W8JA 1TI1A 2OBIA 1Q98A 2YJ7A 1GSDA 5DJMA 3DYRA 5AIXA 4J57E 1XZOA 2GSQA 2YV7A 3P2AA 3E3EA 3BD2A 3F8UA 5A4WA 1FW1A 5C00A 5ABRA 3N5OA 3C71A 1XOBA 2KP2A 4L5LA 2FY6A 2O87A 1HD2A 3IDVA 1QFNA 1HQOA 2RLIA 1SYXA 1EP8A 1O81A 2IPAA 2C3NA 5CP1A 2HXKA 4AJ7A 1Q4JA 5IQYA 2CZ2A 2I4AA 2OBKA 1X5DA 1BAYA 2R3XA 4EL1A 4ZB9A 1GSSA 2KOKA 4YQVA 4OWYA 4L0UA 1TOFA 3TOUA 3AY8A 4TXVA 3ME7A 3M9JA 1F3BA 3TCOA 2AAWA 1ERWA 5HR0A 3GH6A 4MJBA 4TVEA 3GX0A 4RI7A 3HY2A 3P8WA 4X0XA 3P7XA 2F3MA 4WXTA 2R6KA 2AUVA 1VF1A 4DSQA 3H1NA 1URMA 2YWNA 5F05A 5JCWA 2DLXA 1NW2A 1TK5B 2GT6A 2JZRA 2HSHA 3GL5A 5DCHA 2DMLA 3QAVA 4NAXA 1EV4A 2DJ0A 1XBSA 2O85A 1JLWA 4PGTA 4PQIA 1Y6EA 3PINA 1PQNA 4Q5RA 2TRXA 1EP7A 3QAWA 3WT2A 2E7PA 1MD3A 4YH2A 1M2AA 2JSZA 3FZ9A 2PGTA 1TKDB 4F9ZA 2GQKA 4K9ZA 5ECQB 3KXOA 3QFAC 1U3IA 5J4UA 2O89A 1BYEA 4ECBA 2F8AA 2QSIA 1FB0A 1F6MC 2EIQA 1FO5A 4ZB8A 5J41A 1S3CA 2VUPA 1S3AA 3PGTA 1VRSD 3G7IA 4K2DA 3NZNA 4G2EA 5D8IA 3DEXA 1R26A 3F4SA 4KDYA 4LLRA 2REMA 2H6XA 2B3SA 3VWXA 1PX7A 1DE1A 2WCIA 4XHMA 3VWUA 1TW9A 5EPFA 2PVOC 4TRXA 4MP4A 1XW9A 4Q5QA 4LMWA 2K9FA 3L0HA 4O32A 3Q6OA 1X5CA 5F06A 1G6WA 4IJIA 1WMJA 2OE0A 3ISOA 2FLSA 1I5GA 4WBRD 3HVSA 4J2FA 2JU5A 1YZXA 5J5NA 1ZGNA 2VO4A 2YPMA 3TDGA 4IELA 3DMLA 1MEKA 3W8SA 4BA7A 1SD8A 3CXGA 5HR1A 1DSBA 4KDUA 1ST9A 1TDIA 1F2EA 1ABAA 2IL3A 2HE3A 1LBKA 1EGRA 4KCAA 4IVFA 3EURA 1B9XC 2A2RA 2DC5A 2H8LA 2DMMA 3QFBC 2F9SA 4L8EA 2KP1A 3KGKA 4DVCA 1MD4A 4IBPA 3TGZA 1IYIA 4ZBDA 3TKQA 3IHQA 2LSTA 5ELGA 2L5LA 2O8VB 4GF0A 5H5SA 3I6AA 3MNGA 1NM3A 2YZUA 3DIEA 1J9BA 4K7NA 4WR5A 4RI6A 2WFCA 1RW1A 1FG4A 5ECIB 1EOGA 3ZRDA 3RHCA 1UVZA 2I1UA 1XVWA 1AC1A 5JWOB 3IK9A 3TJJA 4F0CA 3GKMA 3UOMA 6GSUA 3DGQA 4RQRA 3EC3A 5F07A 3EU4A 1Z9HA 3HVXA 2GLRA 4TR0A 2GZYA 3L78A 2YOIA 2BTOT 4L0WA 3EVIA 2LJRA 4H86A 1N8JA 3EE2A 5IOXA 2FNOA 4CHSA 3UBLA 1QUWA 3KP9A 4I2TA 3KTLA 5LCZA 1SYRA 4TW5A 3CSHA 3KM6A 5ENUA 1R5PA 5ECLB 2V6KA 4TXOB 1FVKA 5ECKB 2VCVA 2IMIA 2JL4A 2NDOA 4ECIA 2WS2A 5F8BA 4IP6A 2LRCA 1QMVA 4BWQA 2LUSA 1JZRA 1YF0A 1THXA 2YP6A 4HJMA 4IJ3A 2L57A 4MABA 1H75A 5B6NA 2FWGA 1EWXA 1MDKA 4X43A 1T1VA 2CAQA 3ZTLA 3TJKA 3C7MA 4MH2A 3GTUB 3MAKA 4ZL9A 5ECNB 4NHWA 4ZL7A 5IO0A 19GSA 4PQ1A 2DJJA 3LWAA 1T4ZA 2R4VA 4FYBA 5KN2A 1X9SB 5ID2B 1X9WB 3KMOA 2DIYA 2V41A 5EVOA 1W89A 4QL9A 1ZMAA 4TR1B 2HZFA 2BMXA 5G1LA 5GSTA 3FR9A 3BBYA 3IBHA 4PXOA 5DAKB 3ZVJA 3FZAA 2EIRA 3IPZA 2JADA 3D5JA 2AJQB 1V9WA 2C3QA 4MZBA 3HYPA 2MMOA 1TRSA 1V57A 4N30A 1M9AA 3KEBA 1K3LA 2NTOA 4WEYA 5B8AA 3HHVA 2GSTA 5IMAA 2H0IA 1YF1A 3G9BA 4KUNA 3UL3A 3BJ5A 1U88A 3TJFA 4KW6A 1FOVA 3SWLA 5KEJA 5ECOB 2VD1A 4HI7A 1YY7A 1VF3A 1OE7A 4HQZA 1XFLA 4GLTA 4POKA 1A0RP 3A5WA 1EEMA 3TRPA 4CDOA 2IMFA 3PH9A 3FK8A 4TXOA 3V1WA 4MF5A 2VCZA 4ZILA 2QC7A 2VLUA 3HJPA 1PSQA 5AIVA 1SK1A 5B7CA 3RDWA 4V1Ag 3D21A 2H76A 1E6BA 5C04A 2IJYA 2C0FA 2WULA 2BJXA 3TUEA 3VPTA 2K8VA 1TTZA 3O6TA 1QK8A 2G0FA 2GTUA 5HFIA 3M1GA 1KEBA 3VWWA 5IM9A 1CQHA 2LKUA 2P5RA 1XWKA 2DIZA 2H70A 3GURA 1Z7RA 5DCGA 2B6MA 3GTUA 3GYKA 1XWAA 3WYWA 4FYCA 4MJEA 1U87A 2RUFA 22GSA 1R4WA 3QR6A 3L4NA 1ZZYA 4F82A 4LA1A 1C72A 1WOUA 5ID2A 3PR8A 4F03A 3WT1A 4L5OA 4Q5NA 3APQA 2JACA 4TR1A 1TJDA 3LFLA 4GSSA 1JLVA 5DALB 5G31A 5IOWA 3FYGA 3ED3A 2MBSA 2HZEA 3LQ7A 5DAKA 2PWJA 16GSA 1NSWA 4JR6A 2M72A 3D4TA 1EGOA 1I9DA 2N5BA 4ZIJA 1VF2A 3NOFA 3UARA 5DQSA 3W6GA 2C0EA 2CVBA 3RHBA 1GRXA 1AQXA 3KTBA 1K0AA 3HJMA 3TKSE 5D9XA 3IC4A 1XWBA 1K0OA 1GLPA 1SK0A 5D73A 1AQVA 3ERWA 3MWHA 4ML1A 2VIMA 3ME8A 2PUKC 2OKAA 4BPYA 5ECMB 3F9UA 1TRWA 1PGTA 1OYJA 3D6IA 5J9BA 4K1FA 4GSTA 5DDLA 2CT6A 5COHA 3CMIA 1T7PB 4ML6A 3RAZA 2K8SA 4HJ2A 1T4YA 2OACA 4XS6A 2GS3A 4HS1A 3EMXA 1YDKA 5ECPB 4QQ7A 4N10A 1WP0A 2VM1A 2B5EA 2P5QA 1O6JA 3F6FA 5IPGA 2OJLA 3ERFA 1A8LA 1TU8A 2FGXA 1K0NA 2PVQA 2MZCA 2H30A 2ZNMA 3A2VA 5D9VA 4OCEA 2VLTA 4BL7A 3J7Yb 4HUAA 1M2DA 1SJZA 1WWJA 3A2XA 4XRAA 3WGEA 2GQMA 3IV4A 1EOHA 3U5RE 1OC8A 4PUAA 3IR4A 5G5FA 5A5KA 3TRXA 2ALBA 2CX4A 3ERGA 3H8QA 1YJ6A 3KIJA 3GA4A 4XIHA 3ZYWA 4EKZA 2J9HA 3HXSA 3LJRA 4NHZA 2KHPA 1FVJA 1V98A 3NIVA 5DBQA 5GSSA 1SKWB 9GSSA 2K18A 3UIWA 2JSYA 1BJXA 3HA9A 1FHEA 1R7HA 4PQHA 4P3YB 2YWMA 1XVQA 2QGVA 5DALA 2FCHA 6GSVA 2R2JA 4JRRA 4KDXA 1RQMA 4PNGA 1SL1B 1GUKA 3LGCA 1ZCPA 4IQAA 4EDZA 4JU5A 2FWFA 5HR3A 4OFMA 1G7OA 5LD0A 4KX4A 5IMVA 4WF5A 4HZ2A 1WPIA 3UMAA 3LG6A 4JBBA 1TXXA 2LRTA 5G5EA 4MH3A 1BQ7A 1F9MA 2GDRA 1Z5YE 4ECCA 4GXZA 2GSRA 1B9YC 1AAZA 3EYTA 3ZVJD 1SL0B 1QQ2A 3H79A 1N2AA 2GZPA 2RM6A 2QKEA 1ACVA 1TRVA 1GSUA 1GSQA 2Z9SA 1GSEA 2IMEA 2VM2A 1X9MB 3CBUA 3KZQA 4YQMA 4XTSA 2XPDA 4IHUA 4MCUA 4KCEA 2TIRA 2CA8A 3OR5A 3VFIA 1W4VA 4BVXA 3J7Yk 4I2UA 5H5RA 2YV9A 4DSRA 2DBCA 1SK2A 4GRFA 3FHKA 3Q74A 2FA4A 3GL3A 1BEDA 3F3RA 4MPFA 3KCMA 3ZFLA 3QPMA 5GAPD 4OD7A 3R2QA 4GQCA 5HFGA 3ZMLA 4EUYA 4NV5A 3LSZA 1BX9A 3S9FA 4EO3A 6GSTA 4YAVA 1TK0B 3FW2A 3D0ZA 4KA0A 1VGLA 3HKRA 4K0NA 1XWCA 5CNWA 2M46A 4EDYA 5JWRB 3L9SA 4KAEA 4ISDA 5AISA 4MA9A 5D9TA 5EY6A 2O7KA 1GSYA 3DXBA 3DKSA 5HFKA 3I43A 2HLSA 5IPHA 5AN1A 3Q19A 2R37A 3HZ4A 4TOPA 4G9HA 2B7JA 3GH9A 2DJKA 1DBYA 3G7YA 3VI7A 4GQFA 2HT9A 2C0GA 3C1RA 1M9BA 3FRCA 1GTBA 4ECJA 1MDJA 2MBTA 3KP8A 1H4OA 3VURA 3TB2A 2B5XA 3IAM2 1JZDA 2P0GA 3ZL5A 1T00A 3F63A 1GH2A 1JHBA 4AGSA 1XW6A 4I5QA 5DVBA 5KN0A 2HNLA 4Z7XA 3VI5A 5ECRB 4YAPA 1YEPA 1PL2A 1G0TA 1XPVA 2EIOA 2L4CA 2ZUPA 3VPQA 5IIZA 2WB9A 1HYUA 4OFTA 3MDKA 1R5AA 2H75A 5A4VA 5IO2A 1SJIA 4MJCA 1YKAA 3L9UA 3IAS2 4G10A 3BCKA 1RK4A 4HEA2 5B8BA 3LXTA 1O73A 3CYNA 1ZOFA 1K0CA 2FWHA 1SL2B 1O8XA 2HZEB 20GSA 4NXIA 1OKTA 3F0IA 3WD6A 4N0VA 4BVYA 2MMAA 4WBJA 1GTIA 4ZL8A 1PD21 1OVNA 2V6OA 3L9VA 3D4MA 1XW5A 4KSOA 1UN2A 4V1Ap 6GSSA 2J23A 3F6DA 1A2JA 2GZZA 2DJ2A 1TRUA 1DE2A 5CYYA 3I69A 1DUGA 1ZYQB 3QAGA 1MDIA 4LL4B 3O76A 3GKNA 2C4JA 1NHOA 3TRQA 1JZWA 2B7KA 4OO4A 2H1DA 2L5OA 4NMUA 2M80A 1X0RA 3U6VA 4WKWA 3F4RA 1O85A 3GFKA 4YQUA 5KN1A 3HCZA 2LJKA 3O3TA 1SU9A 1GNWA 2H6ZA 4X1UA 2PERA 2LEGA 1GTUA 4HZ4A 1GUHA 2CV4A 4K8MA 2FD3A 2B1KA 2IWTA 5H5QA 3F4TA 2VCWA 1AQWA 4JEDA 3CTFA 2P31A 3IXRA 1SD9A 2B1LA 4KB3A 1FB6A 1GNEA 1AUCA 2FWEA 2A4VA 3LXZA 1PKWA 1EV9A 1PA3A 3IK7A 1M7TA 2B5YA 4NWYA 2KUCA 2VL3A 1X5EA 2XBQA 1J0FA 4POMA 1XXUA 1JZOA 8GSSA 3SBCA 2LQQA 5CRDA 2L59A 3M3MA 2VL9A 3G7JA 1MTCA 2E2MA 3IRAA 1Z6NA 5D96A 4EE0A 2I81A 5DQYA 2PN8A 3CSJA 1A24A 3BCIA 2ES7A 4KGIA 4POBA 2N5AA 1VF4A 4HU9A 6GSXA 2WDUA 1A0FA 5B6MA 2IFQB 6GSWA 2I3YA 4K6XA 4E8HA 2R5GA 2N5FA 2C80A 2HYXA 1YKCA 4MZCA 5CRWA 1PMTA 3FZ5A 2X8HA 2XPEA 2YNXA 5A4UA 3UEMA 4PNFA 4I97A 2ON7A 1S3DA 4O7HA 5J3RA 3GRXA 2K6VA 4F0BA 4N0ZA 2H1GA 2CVKA 4ACSA 5JCUA 2HRFA 1ON4A 4PX1A 4MDCA 3GKXA 2ON5A 1SJ6A 3BOAA 4F2IA 4OFNA 1OAZA 3TJGA 3UVHA 17GSA 3TKPA 1M99A 1WIKA 1GSFA 3KJYA 1HNAA 3FEUA 2PBJA 1KNGA 4FH8A 4K7IA 5GZZB 4PURA 2C0DA 4IKHA 1U3AA 2V1MA 2V32A 3HJOA 3RBTA 2MYGA 4K0GA 1A23A 3MSZA 1WE0A 2E0QA 2GQLA 5HQPA 4XS4B 2MMZA 1OKDA 1TP9A 2CZ3A 4FIWA 4ULXA 4TR3A 2HRNA 2I9HA 2FHEA 3TOTA 1U6TA 2RM5A 1T8EB 1Z3EA 1PL1A 1GWCA 1HNCA 5ELAA 5EL8A 2X64A 3HD5A 4JR4A 4OMVA 3C8EA 3QOUA 2XC2A 5E59A 4ZBBA 2H0GA 4JE1A 3EMPA 2VD0A 2LJAA 3CRTA 4MF6A 1UA5A 3HZ8A 3GSTA 1NHYA 2AB6A 5JCGA 4J56E 4POLA 3GN3A 2H66A 4GTUA 3ZMKA 1TI3A 1Z6MA 5G30A 3LEFA 1XCCA 1PKZA 4CW9A 3GUSA 1O7UA 4V2LA 3RPNA 3EWLA 3KH7A 2H74A 3ZREA 1OC9B 1G7EA 1XWGA 3VLNA 3ZIJA 1B48A 2H6YA 1EZKA 5CO3A 4FO5A 1LU4A 4LL1B 4PUFC 4I8BA 2V2GA 2H0HA 3GNJA 2X8CA 1A2LA 3I9V2 2YJHA 3UVTA 2VL2A 5FHIA 3N9JA 5CAXA 4HOJA 5INYA 1YQ1A 1GLQA 4AJ6A 3ZZXA 1QXHA 2WZ9A 1A8YA 2A2SA 4MMMA 2IFQA 4KSMA 3EINA 5LNKe 1PN9A 4XS1A 3ZITA 3APOA 3CTGA 4XCSA 3IA1A 2YZHA 4MPGA 2H1BA 3QMXA 4AF2A 3VK9A 1Z7PA 1Y25A 1LJRA 1B8XA 2VAFA 2MMNA 4LMVA 1V58A 2VLVA 4HDEA 4IN0A 3CSIA 2FUG2 2PPTA 3DWVA 1KBNA 1PX6A 3RPPA 4OCFA 1AXDA 5D9WA 4DSSB 3M8NA 2G2QA 2RIIA 4ILFA 1K3YA 2VL2C 3E9JB 3DD3A 5G2ZA 4D73B 2FA8A 1IYHA 2OE1A 4XS4A 4NV2A 5IMCA 4ZB6A 2LV3A 4KE3A 2VCXA 4JZQA 2C3TA 2LTKA 4IP1A 2PMTA 5AGYA 1T3BA 5ECHB 4ID0A 4WETA 3WGXA 7GSSA 1F37A 3A3TA 3GKKA 1TK8B 5G1KA 1QGVA 2GT5A 2WJUA 2DJ1A 2L6DA 4DEJA 3APSA 3C1SA 2EC4A 3JCML 4EF0A 2C8UA 4FYUA 4IQ1A 4OO5A 5F0GA 4BWSA 2H71A 2RUEA 2H73A 4O5RA 4IW9A 3P90A 5IMFA 2PU9C 2OE3A 4I6XA 5DJLA 1SKRB 4RUVA 1SKSB 3IOSA 2IN3A 2VCTA 1OC9A 2X99A 1WJKA 3FZ4A 4MJAA 3FKFA 1K0BA 4GWRA 5CREA 3K8NA 2AV4A 4WR4A
chains in the Genus database with same CATH superfamily
3D22A 2AHEA 2F51A 1M2BA 4V2MA 2ZCTA 3DVXA 4E8EA 4QL7A 4MZWA 3LORA 4TKYA 4V2NA 3ZIVA 2XHFA 2LQOA 4Q5FA 1WRYA 3KMNA 2H1AA 1OE8A 4MF7A 3ZFBA 2F8FA 14GSA 2CVDA 2YWOA 1E2YA 13GSA 3EU3A 5J9CA 3WGDA 2OA7A 4GSNA 2H19A 1UC7A 1ILOA 2YWIA 3C73A 1J08A 3GIXA 1GP1A 3MIXA 4AJ8A 2H01A 3Q18A 2NVLA 3CRUA 1EEJA 2IMKA 1YEXA 1THOA 2NPBA 4MK3A 4MNNA 2CAIA 3LYPA 4KH7A 2JZSA 2TRCP 1CQGA 4DSSA 3QD9A 4KNDA 3LYKA 3FY7A 2KLXA 5D93A 1JFUA 4EXJA 3VWVA 4D73A 3GX8A 3H4KA 1XOAA 1GL8A 2C1YA 3US3A 4EVMA 1A2MA 1K3OA 5JWQB 2DJ3A 1SENA 3UAPA 4N11A 1HNBA 1GULA 4NPBA 1ZYPA 4IGJA 3FR3A 3GHAA 1O8WA 1XIYA 5ECSA 3F3QA 1GTAA 3GSSA 3GMFA 1ERUA 3UJ1A 1BG5A 1ERTA 2LRNA 1B4QA 1ZL9A 3KD0A 2HSYA 2CX3A 2GVPA 2E2GA 1FAAA 3DRNA 2X8GA 1AIUA 1PN0A 2WGRA 3HDCA 11GSA 3TKSA 10GSA 2HI7A 4XRDA 4ZXGA 2YANA 4IS0A 5IMZA 3M9KA 4WF4A 18GSA 2WRTA 5FWGA 2D2ZA 3GV1A 2LS5A 5CRHA 1F3AA 5KN3A 1G6YA 3QCPA 5FT3A 2H72A 1OC3A 4HQSA 1AW9A 3IE3A 2OADA 2IIYA 3QDNA 2LNSA 2JZTA 5GAND 3UBKA 4TR4A 2GGTA 3A2WA 4EC0A 1M0UA 5E4WA 1USBA 1GUMA 2L4QA 2VCQA 1V40A 3ZLPA 2GSSA 5L71A 1K0MA 2VOCA 5BRTA 2LNTA 2YCDA 4O92A 2CQ9A 4RQXA 3CQFA 2XBIA 5IMDA 4TN8A 1TU7A 1PRXA 4G19A 3DVWA 4HU7A 3FR6A 4MLYA 2NBSA 1KTEA 3TJBA 3H93A 1V2AA 1ERVA 4K7OA 3TKSC 2HFDA 1K0DA 1S3RA 1ML6A 3HVVA 5CRGA 4GCIA 12GSA 1ZYEA 6GSYA 1B4PA 2IMDA 3E0UA 5HR2A 3TKRA 3KH9A 2DSAA 3HVNA 2AYTA 2L6CA 2YN1A 3M0FA 4ZBAA 3W8JA 4ICYA 1TI1A 2OBIA 1Q98A 2YJ7A 1GSDA 5DJMA 3DYRA 5AIXA 4J57E 1XZOA 2GSQA 2YV7A 3P2AA 3E3EA 3BD2A 3F8UA 5A4WA 1FW1A 5C00A 5ABRA 3N5OA 3C71A 1XOBA 2KP2A 4L5LA 2FY6A 2O87A 1HD2A 3IDVA 1QFNA 1HQOA 2RLIA 1SYXA 1EP8A 1O81A 2IPAA 2C3NA 5CP1A 2HXKA 4AJ7A 1Q4JA 5IQYA 2CZ2A 2I4AA 2OBKA 1X5DA 1BAYA 2R3XA 4EL1A 4ZB9A 1GSSA 2KOKA 4YQVA 4OWYA 4FQUA 4L0UA 1TOFA 3TOUA 3AY8A 4TXVA 3ME7A 3M9JA 1F3BA 3TCOA 2AAWA 1ERWA 5HR0A 3GH6A 4MJBA 4TVEA 3GX0A 4RI7A 3HY2A 3P8WA 4X0XA 3P7XA 2F3MA 4WXTA 2R6KA 2AUVA 1VF1A 4DSQA 3H1NA 1URMA 2YWNA 5F05A 5JCWA 2DLXA 4KF9A 1NW2A 1TK5B 2GT6A 2JZRA 2HSHA 3GL5A 5DCHA 3LW9A 2DMLA 3QAVA 4EIQA 4NAXA 1EV4A 2DJ0A 1XBSA 2O85A 1JLWA 4PGTA 4PQIA 1Y6EA 3PINA 1PQNA 4Q5RA 2TRXA 1EP7A 3QAWA 3WT2A 2E7PA 1MD3A 4YH2A 1M2AA 2JSZA 3FZ9A 2PGTA 1TKDB 4F9ZA 2GQKA 4K9ZA 5ECQB 3KXOA 3QFAC 1U3IA 5J4UA 2O89A 1BYEA 4ECBA 2F8AA 2QSIA 1FB0A 1F6MC 2EIQA 1FO5A 4ZB8A 5J41A 4USSA 1S3CA 2VUPA 1S3AA 3PGTA 1VRSD 3G7IA 4K2DA 3NZNA 4G2EA 5D8IA 3DEXA 1R26A 3F4SA 4KDYA 4LLRA 2REMA 2H6XA 4EIPA 2B3SA 3VWXA 1PX7A 1DE1A 2WCIA 4K5RA 4XHMA 3VWUA 1TW9A 5EPFA 2PVOC 4TRXA 4MP4A 1XW9A 4Q5QA 4LMWA 2K9FA 3L0HA 4O32A 3Q6OA 1X5CA 5F06A 1G6WA 4IJIA 1WMJA 2OE0A 3ISOA 3R3EA 2FLSA 1I5GA 4WBRD 3HVSA 4J2FA 2JU5A 1YZXA 5J5NA 1ZGNA 2VO4A 2YPMA 3TDGA 4IELA 3DMLA 1MEKA 3W8SA 4BA7A 1SD8A 3CXGA 5HR1A 1DSBA 4KDUA 1ST9A 1TDIA 1F2EA 1ABAA 2IL3A 2HE3A 1LBKA 1EGRA 4KCAA 4YKFA 4IVFA 3EURA 1B9XC 2A2RA 2DC5A 2H8LA 2DMMA 4CY6A 3QFBC 5BMUA 2F9SA 4L8EA 2KP1A 3KGKA 4PTSA 4DVCA 1MD4A 4IBPA 3TGZA 1IYIA 4ZBDA 3TKQA 3IHQA 2LSTA 2L5LA 2O8VB 5ELGA 4GF0A 5H5SA 3I6AA 3MNGA 1NM3A 2YZUA 2UZ8A 3DIEA 1J9BA 4K7NA 4WR5A 4RI6A 2WFCA 1RW1A 1FG4A 5ECIB 1EOGA 3ZRDA 3RHCA 1UVZA 2I1UA 1XVWA 1AC1A 5JWOB 3IK9A 3TJJA 4F0CA 3GKMA 3UOMA 6GSUA 3DGQA 4RQRA 3EC3A 5F07A 3EU4A 1Z9HA 3HVXA 2GLRA 4TR0A 2GZYA 3L78A 2YOIA 2BTOT 4L0WA 3EVIA 2LJRA 4H86A 1N8JA 3EE2A 5IOXA 2FNOA 4CHSA 3UBLA 1QUWA 3KP9A 4I2TA 3KTLA 5LCZA 1SYRA 4BIKA 4TW5A 3CSHA 3KM6A 5ENUA 3PPUA 1R5PA 5ECLB 2V6KA 4TXOB 1FVKA 5ECKB 2VCVA 2IMIA 2JL4A 2NDOA 4ECIA 2WS2A 3IC8A 4IP6A 5F8BA 2LRCA 1QMVA 4BWQA 2LUSA 1JZRA 1YF0A 1THXA 2YP6A 4HJMA 4IJ3A 2L57A 4MABA 2QA2A 1H75A 5B6NA 2FWGA 1EWXA 1MDKA 4X43A 1T1VA 2CAQA 3ZTLA 3TJKA 3C7MA 4MH2A 3GTUB 3MAKA 4ZL9A 5ECNB 4NHWA 4ZL7A 5IO0A 19GSA 4PQ1A 2DJJA 3LWAA 1T4ZA 2R4VA 4FYBA 5KN2A 1X9SB 5ID2B 1X9WB 3KMOA 2DIYA 2V41A 5EVOA 1W89A 4QL9A 1ZMAA 4TR1B 2HZFA 2BMXA 5G1LA 4G0IA 5GSTA 3FR9A 3BBYA 3IBHA 4PXOA 5DAKB 3ZVJA 3FZAA 2EIRA 3IPZA 2JADA 4K5SA 3D5JA 2AJQB 1V9WA 2C3QA 4MZBA 3HYPA 2MMOA 1TRSA 1V57A 4N30A 1M9AA 3KEBA 1K3LA 2NTOA 4WEYA 2R0CA 3IHGA 5B8AA 3HHVA 2GSTA 5IMAA 2H0IA 1YF1A 3G9BA 4KUNA 3UL3A 3BJ5A 1U88A 3TJFA 4KW6A 3A5IA 1FOVA 3SWLA 5KOWA 5KEJA 5ECOB 2VD1A 4HI7A 1YY7A 1VF3A 1OE7A 4HQZA 1XFLA 4GLTA 4POKA 1A0RP 3A5WA 1EEMA 3TRPA 4CDOA 2IMFA 3PH9A 3FK8A 2X49A 4TXOA 3V1WA 4Z2TA 4MF5A 2VCZA 4ZILA 2QC7A 2VLUA 3HJPA 1PSQA 5AIVA 1SK1A 5B7CA 3RDWA 4V1Ag 3D21A 2H76A 1E6BA 5C04A 4HSCX 2IJYA 2C0FA 2WULA 2BJXA 3TUEA 3VPTA 2K8VA 1TTZA 3O6TA 1QK8A 2G0FA 2GTUA 5HFIA 3M1GA 1KEBA 3VWWA 5IM9A 1CQHA 2LKUA 2P5RA 1XWKA 2DIZA 2H70A 3GURA 1Z7RA 5DCGA 2B6MA 3GTUA 3GYKA 1XWAA 3WYWA 1M3IA 4FYCA 4MJEA 1U87A 2RUFA 22GSA 1R4WA 3QR6A 3L4NA 1ZZYA 4F82A 4LA1A 1C72A 1WOUA 5ID2A 3PR8A 4F03A 3WT1A 4L5OA 4Q5NA 3APQA 2JACA 4TR1A 1TJDA 3LFLA 4GSSA 1JLVA 5DALB 5G31A 5IOWA 3FYGA 3ED3A 2MBSA 2HZEA 3LQ7A 5DAKA 2PWJA 16GSA 1NSWA 4X4JA 4JR6A 2M72A 3D4TA 1EGOA 1I9DA 2N5BA 4ZIJA 1VF2A 3NOFA 3UARA 5DQSA 3W6GA 2C0EA 3FMWA 2CVBA 3RHBA 1GRXA 1AQXA 3KTBA 1K0AA 3HJMA 3TKSE 5D9XA 3IC4A 1XWBA 1K0OA 1GLPA 1SK0A 5D73A 1AQVA 3ERWA 3MWHA 4ML1A 2VIMA 3ME8A 2PUKC 2OKAA 4BPYA 5ECMB 3F9UA 1TRWA 1PGTA 1OYJA 3D6IA 5J9BA 4K1FA 4GSTA 5DDLA 2CT6A 5COHA 3CMIA 1T7PB 4ML6A 3RAZA 2K8SA 3MYDA 4HJ2A 1T4YA 2OACA 4XS6A 2GS3A 4HS1A 3EMXA 1YDKA 5ECPB 4QQ7A 4N10A 1WP0A 4O5QA 2VM1A 2B5EA 2P5QA 4O5UA 1O6JA 3F6FA 5IPGA 2OJLA 3ERFA 1A8LA 1TU8A 2FGXA 1K0NA 2PVQA 2MZCA 2H30A 2ZNMA 3A2VA 5D9VA 4OCEA 2VLTA 4BL7A 3J7Yb 4HUAA 1M2DA 1SJZA 1WWJA 3A2XA 4XRAA 3WGEA 2GQMA 3IV4A 1EOHA 3U5RE 1OC8A 4PUAA 1PFOA 3IR4A 5G5FA 5A5KA 3TRXA 2ALBA 2CX4A 3ERGA 3H8QA 1YJ6A 3KIJA 3GA4A 4XIHA 3ZYWA 4EKZA 2DKIA 2J9HA 3HXSA 3LJRA 4NHZA 2KHPA 1FVJA 1V98A 3NIVA 5DBQA 5GSSA 1SKWB 9GSSA 2K18A 3UIWA 2JSYA 1BJXA 3HA9A 1FHEA 1R7HA 4PQHA 4P3YB 2YWMA 1XVQA 2QGVA 5DALA 2FCHA 6GSVA 2R2JA 4JRRA 4KDXA 1RQMA 4PNGA 1SL1B 1GUKA 3LGCA 1ZCPA 4IQAA 4EDZA 4JU5A 2FWFA 5HR3A 4OFMA 2X4AA 1G7OA 5LD0A 4KX4A 5IMVA 4WF5A 4HZ2A 1WPIA 3UMAA 3LG6A 4JBBA 1TXXA 2LRTA 5G5EA 4MH3A 1BQ7A 1F9MA 2GDRA 1Z5YE 4K2XA 4GXZA 4ECCA 2GSRA 1B9YC 1AAZA 3EYTA 3ZVJD 1SL0B 1QQ2A 3H79A 1N2AA 2GZPA 2RM6A 2QKEA 4BVYB 1ACVA 1TRVA 1GSUA 1GSQA 2Z9SA 1GSEA 2IMEA 2VM2A 1X9MB 3CBUA 3KZQA 4Z2UA 4YQMA 4XTSA 2XPDA 4IHUA 4MCUA 4KCEA 2TIRA 2CA8A 3OR5A 3VFIA 1W4VA 4BVXA 3J7Yk 4I2UA 5H5RA 2YV9A 4DSRA 2DBCA 1SK2A 4GRFA 3FHKA 3Q74A 2FA4A 3GL3A 1BEDA 3F3RA 4MPFA 3KCMA 3ZFLA 3QPMA 5GAPD 4OD7A 3R2QA 4GQCA 2R0GA 5HFGA 3ZMLA 4EUYA 4NV5A 3LSZA 1BX9A 3S9FA 4EO3A 6GSTA 4YAVA 4CY8A 1TK0B 3FW2A 3D0ZA 4KA0A 1VGLA 3HKRA 4K0NA 1XWCA 5CNWA 2M46A 4EDYA 5JWRB 3L9SA 4KAEA 4ISDA 5AISA 2HRAA 4MA9A 5D9TA 5EY6A 2O7KA 1GSYA 3DXBA 3DKSA 5HFKA 3I43A 2HLSA 5IPHA 5AN1A 3Q19A 2R37A 3HZ4A 4TOPA 4G9HA 2B7JA 3GH9A 2DJKA 1DBYA 3G7YA 3VI7A 4GQFA 2HT9A 2C0GA 3C1RA 4A5PA 1M9BA 3FRCA 1GTBA 4G0KA 4ECJA 1MDJA 2MBTA 3KP8A 1H4OA 3VURA 3TB2A 2B5XA 3IAM2 1JZDA 2P0GA 3ZL5A 1T00A 3F63A 1GH2A 1JHBA 4AGSA 1XW6A 4I5QA 5DVBA 5KN0A 2HNLA 4Z7XA 1FOHA 3VI5A 5ECRB 4YAPA 1YEPA 1PL2A 1G0TA 1XPVA 2EIOA 2L4CA 2ZUPA 3VPQA 5IIZA 2WB9A 1HYUA 4OFTA 3MDKA 1R5AA 2H75A 5A4VA 5IO2A 1SJIA 4MJCA 1YKAA 3L9UA 3IAS2 4G10A 3BCKA 1RK4A 4HEA2 5B8BA 3LXTA 1O73A 3CYNA 1ZOFA 1K0CA 2FWHA 1SL2B 1O8XA 2R0PA 2HZEB 20GSA 4NXIA 1OKTA 3F0IA 3WD6A 4N0VA 4BVYA 2MMAA 3EPTA 4WBJA 1GTIA 4ZL8A 1PD21 1OVNA 2V6OA 3L9VA 3D4MA 1XW5A 4KSOA 1UN2A 4V1Ap 6GSSA 2J23A 3F6DA 1A2JA 2GZZA 2DJ2A 1TRUA 1DE2A 5CYYA 3I69A 1DUGA 1ZYQB 3QAGA 1MDIA 2A2PA 4LL4B 3O76A 3GKNA 2C4JA 1NHOA 3TRQA 1JZWA 2B7KA 4OO4A 2H1DA 2HRKA 2L5OA 4NMUA 1XG8A 2M80A 1X0RA 3U6VA 4WKWA 3F4RA 1O85A 3GFKA 4YQUA 5KN1A 3HCZA 2LJKA 3O3TA 1SU9A 1GNWA 2H6ZA 4X1UA 2PERA 2LEGA 1GTUA 4HZ4A 1GUHA 2CV4A 4K8MA 2FD3A 2B1KA 2IWTA 5H5QA 3F4TA 2VCWA 1AQWA 4JEDA 3CTFA 2P31A 3IXRA 1SD9A 2B1LA 4KB3A 1FB6A 1GNEA 1AUCA 2FWEA 2A4VA 3LXZA 1PKWA 4BL7B 1EV9A 1PA3A 3IK7A 1M7TA 2B5YA 4NWYA 2KUCA 2VL3A 1X5EA 2XBQA 1J0FA 4POMA 1XXUA 1JZOA 8GSSA 3SBCA 2LQQA 5CRDA 2L59A 3M3MA 2VL9A 3G7JA 1MTCA 2E2MA 3IRAA 1Z6NA 5D96A 4EE0A 2I81A 5DQYA 4G0LA 2PN8A 3CSJA 1A24A 3BCIA 2ES7A 4KGIA 4POBA 2N5AA 1VF4A 4HU9A 6GSXA 2WDUA 1A0FA 5B6MA 2IFQB 6GSWA 2I3YA 4K6XA 4E8HA 2R5GA 2N5FA 2C80A 2HYXA 1YKCA 4MZCA 5CRWA 1PMTA 3FZ5A 2X8HA 2XPEA 2YNXA 2DKHA 5A4UA 3UEMA 4PNFA 4Z2RA 2HSMA 4I97A 2ON7A 1S3DA 4O7HA 5J3RA 3GRXA 2K6VA 4F0BA 4N0ZA 2H1GA 2CVKA 4ACSA 5JCUA 2HRFA 1ON4A 4PX1A 4MDCA 3GKXA 2ON5A 1SJ6A 3BOAA 4F2IA 4OFNA 1OAZA 3TJGA 3UVHA 17GSA 3TKPA 1M99A 1WIKA 1GSFA 3KJYA 1HNAA 3FEUA 2PBJA 1KNGA 4FH8A 4K7IA 5GZZB 4PURA 2C0DA 4IKHA 1U3AA 2V1MA 2V32A 3HJOA 3RBTA 2MYGA 4K0GA 1A23A 3MSZA 1WE0A 2E0QA 2GQLA 5HQPA 4XS4B 2MMZA 1OKDA 1TP9A 2CZ3A 4FIWA 4ULXA 4TR3A 2HRNA 2I9HA 2FHEA 3TOTA 1U6TA 2RM5A 1T8EB 1Z3EA 1PL1A 1GWCA 1HNCA 5ELAA 5EL8A 2X64A 3HD5A 4JR4A 4OMVA 3C8EA 3QOUA 2XC2A 5E59A 1ZYNA 4ZBBA 2H0GA 4JE1A 4BVXB 3EMPA 2VD0A 2LJAA 3CRTA 4MF6A 1UA5A 3HZ8A 3GSTA 1NHYA 2AB6A 5JCGA 4J56E 4POLA 3GN3A 2H66A 4GTUA 3ZMKA 1TI3A 1Z6MA 5G30A 4YKGA 3LEFA 1XCCA 1PKZA 4CW9A 2QA1A 1O7UA 3GUSA 4V2LA 3RPNA 3EWLA 3KH7A 2H74A 3ZREA 1OC9B 1G7EA 1XWGA 3VLNA 3ZIJA 1B48A 2H6YA 1EZKA 5CO3A 4FO5A 1LU4A 4LL1B 4PUFC 4I8BA 2V2GA 2H0HA 3GNJA 2X8CA 1A2LA 3I9V2 2YJHA 3UVTA 2VL2A 5FHIA 3N9JA 5CAXA 4HOJA 5INYA 1YQ1A 1GLQA 4AJ6A 3ZZXA 1QXHA 2WZ9A 1A8YA 2A2SA 4MMMA 2IFQA 4KSMA 3EINA 5LNKe 1PN9A 4XS1A 3ZITA 3APOA 3CTGA 4XCSA 3IA1A 2YZHA 4MPGA 2H1BA 3QMXA 4AF2A 3VK9A 1Z7PA 1Y25A 1LJRA 1B8XA 2VAFA 2MMNA 4LMVA 1V58A 2VLVA 4HDEA 4IN0A 3CSIA 2FUG2 2PPTA 3DWVA 1KBNA 1PX6A 3RPPA 4OCFA 1AXDA 5D9WA 4DSSB 3M8NA 2G2QA 2RIIA 4ILFA 1K3YA 2VL2C 3E9JB 3DD3A 5G2ZA 4D73B 2FA8A 1IYHA 2OE1A 4XS4A 4NV2A 5IMCA 4ZB6A 2LV3A 4KE3A 2VCXA 4JZQA 2C3TA 2LTKA 4IP1A 2PMTA 5AGYA 1M3JA 1T3BA 5ECHB 4ID0A 4WETA 3WGXA 7GSSA 1F37A 3A3TA 3GKKA 1TK8B 5G1KA 1QGVA 2GT5A 2WJUA 2DJ1A 2L6DA 4DEJA 3APSA 3C1SA 2EC4A 3JCML 4EF0A 2C8UA 4FYUA 2A4HA 4IQ1A 4OO5A 5F0GA 4BWSA 2H71A 2RUEA 2H73A 4O5RA 4IW9A 3P90A 5IMFA 2PU9C 2OE3A 4I6XA 5DJLA 1SKRB 4RUVA 1SKSB 3IOSA 2IN3A 2VCTA 1OC9A 2X99A 1WJKA 3FZ4A 4MJAA 5KOXA 3FKFA 1K0BA 4GWRA 5CREA 3K8NA 2AV4A 4WR4A
chains in the Genus database with same CATH topology
3D22A 2AHEA 2F51A 1M2BA 4V2MA 2ZCTA 3DVXA 4E8EA 4QL7A 4MZWA 3LORA 4TKYA 4V2NA 3ZIVA 2XHFA 2LQOA 4Q5FA 1WRYA 3KMNA 2H1AA 1OE8A 4MF7A 3ZFBA 2F8FA 14GSA 2CVDA 2YWOA 1E2YA 13GSA 3EU3A 5J9CA 3WGDA 2OA7A 4GSNA 2H19A 1UC7A 1ILOA 2YWIA 3C73A 1J08A 3GIXA 1GP1A 3MIXA 4AJ8A 2H01A 3Q18A 2NVLA 3CRUA 1EEJA 2IMKA 1YEXA 1THOA 2NPBA 4MK3A 4MNNA 2CAIA 3LYPA 4KH7A 2JZSA 2TRCP 1CQGA 4DSSA 3QD9A 4KNDA 3LYKA 3FY7A 2KLXA 5D93A 1JFUA 4EXJA 3VWVA 4D73A 3GX8A 3H4KA 1XOAA 1GL8A 2C1YA 3US3A 4EVMA 1A2MA 1K3OA 5JWQB 2DJ3A 1SENA 3UAPA 4N11A 1HNBA 1GULA 4NPBA 1ZYPA 4IGJA 3FR3A 3GHAA 1O8WA 1XIYA 5ECSA 3F3QA 1GTAA 3GSSA 3GMFA 1ERUA 3UJ1A 1BG5A 1ERTA 2LRNA 1B4QA 1ZL9A 3KD0A 2HSYA 2CX3A 2GVPA 2E2GA 1FAAA 3DRNA 2X8GA 1AIUA 1PN0A 2WGRA 3HDCA 11GSA 3TKSA 10GSA 2HI7A 4XRDA 4ZXGA 2YANA 4IS0A 5IMZA 3M9KA 4WF4A 18GSA 2WRTA 5FWGA 2D2ZA 3GV1A 2LS5A 5CRHA 1F3AA 5KN3A 1G6YA 3QCPA 5FT3A 2H72A 1OC3A 4HQSA 1AW9A 3IE3A 2OADA 2IIYA 3QDNA 2LNSA 2JZTA 5GAND 3UBKA 4TR4A 2GGTA 3A2WA 4EC0A 1M0UA 5E4WA 1USBA 1GUMA 2L4QA 2VCQA 1V40A 3ZLPA 2GSSA 5L71A 1K0MA 2VOCA 5BRTA 2LNTA 2YCDA 4O92A 2CQ9A 4RQXA 2XBIA 5IMDA 4TN8A 1TU7A 1PRXA 4G19A 3DVWA 4HU7A 3FR6A 4MLYA 2NBSA 1KTEA 3TJBA 3H93A 1V2AA 1ERVA 4K7OA 3TKSC 2HFDA 1K0DA 1ML6A 3HVVA 5CRGA 4GCIA 12GSA 1ZYEA 6GSYA 1B4PA 2IMDA 3E0UA 5HR2A 3TKRA 3KH9A 2DSAA 2AYTA 2L6CA 2YN1A 3M0FA 4ZBAA 3W8JA 4ICYA 1TI1A 2OBIA 1Q98A 2YJ7A 1GSDA 5DJMA 3DYRA 5AIXA 4J57E 1XZOA 2GSQA 2YV7A 3P2AA 3E3EA 3BD2A 3F8UA 5A4WA 1FW1A 5C00A 5ABRA 3N5OA 3C71A 1XOBA 2KP2A 4L5LA 2FY6A 2O87A 1HD2A 3IDVA 1QFNA 1HQOA 2RLIA 1SYXA 1EP8A 1O81A 2IPAA 2C3NA 5CP1A 2HXKA 4AJ7A 1Q4JA 5IQYA 2CZ2A 2I4AA 2OBKA 1X5DA 1BAYA 2R3XA 4EL1A 4ZB9A 1GSSA 2KOKA 4YQVA 4OWYA 4FQUA 4L0UA 1TOFA 3TOUA 3AY8A 4TXVA 3ME7A 3M9JA 1F3BA 3TCOA 2AAWA 1ERWA 5HR0A 3GH6A 4MJBA 4TVEA 3GX0A 4RI7A 3HY2A 3P8WA 4X0XA 3P7XA 2F3MA 4WXTA 2R6KA 2AUVA 1VF1A 4DSQA 3H1NA 1URMA 2YWNA 5F05A 5JCWA 2DLXA 4KF9A 1NW2A 1TK5B 2GT6A 2JZRA 2HSHA 3GL5A 5DCHA 3LW9A 2DMLA 3QAVA 4EIQA 4NAXA 1EV4A 2DJ0A 1XBSA 2O85A 1JLWA 4PGTA 4PQIA 1Y6EA 3PINA 1PQNA 4Q5RA 2TRXA 1EP7A 3QAWA 3WT2A 2E7PA 1MD3A 4YH2A 1M2AA 2JSZA 3FZ9A 2PGTA 1TKDB 4F9ZA 2GQKA 4K9ZA 5ECQB 3KXOA 3QFAC 1U3IA 5J4UA 2O89A 1BYEA 4ECBA 2F8AA 2QSIA 1FB0A 1F6MC 2EIQA 1FO5A 4ZB8A 5J41A 4USSA 1S3CA 2VUPA 1S3AA 3PGTA 1VRSD 3G7IA 4K2DA 3NZNA 4G2EA 5D8IA 3DEXA 1R26A 3F4SA 4KDYA 4LLRA 2REMA 2H6XA 4EIPA 2B3SA 3VWXA 1PX7A 1DE1A 2WCIA 4K5RA 4XHMA 3VWUA 1TW9A 5EPFA 2PVOC 4TRXA 4MP4A 1XW9A 4Q5QA 4LMWA 2K9FA 3L0HA 4O32A 3Q6OA 1X5CA 5F06A 1G6WA 4IJIA 1WMJA 2OE0A 3ISOA 3R3EA 2FLSA 1I5GA 4WBRD 3HVSA 4J2FA 2JU5A 1YZXA 5J5NA 1ZGNA 2VO4A 2YPMA 3TDGA 4IELA 3DMLA 1MEKA 3W8SA 4BA7A 1SD8A 3CXGA 5HR1A 1DSBA 4KDUA 1ST9A 1TDIA 1F2EA 1ABAA 2IL3A 2HE3A 1LBKA 1EGRA 4KCAA 4YKFA 4IVFA 3EURA 1B9XC 2A2RA 2DC5A 2H8LA 2DMMA 4CY6A 3QFBC 5BMUA 2F9SA 4L8EA 2KP1A 3KGKA 4PTSA 4DVCA 1MD4A 4IBPA 3TGZA 1IYIA 4ZBDA 3TKQA 3IHQA 2LSTA 2L5LA 2O8VB 5ELGA 4GF0A 5H5SA 3I6AA 3MNGA 1NM3A 2YZUA 2UZ8A 3DIEA 1J9BA 4K7NA 4WR5A 4RI6A 2WFCA 1RW1A 1FG4A 5ECIB 1EOGA 3ZRDA 3RHCA 1UVZA 2I1UA 1XVWA 1AC1A 5JWOB 3IK9A 3TJJA 4F0CA 3GKMA 3UOMA 6GSUA 3DGQA 4RQRA 3EC3A 5F07A 3EU4A 1Z9HA 3HVXA 2GLRA 4TR0A 2GZYA 3L78A 2YOIA 2BTOT 4L0WA 3EVIA 2LJRA 4H86A 1N8JA 3EE2A 5IOXA 2FNOA 4CHSA 3UBLA 1QUWA 3KP9A 4I2TA 3KTLA 5LCZA 1SYRA 4TW5A 3CSHA 3KM6A 5ENUA 3PPUA 1R5PA 5ECLB 2V6KA 4TXOB 1FVKA 5ECKB 2VCVA 2IMIA 2JL4A 2NDOA 4ECIA 2WS2A 3IC8A 4IP6A 5F8BA 2LRCA 1QMVA 4BWQA 2LUSA 1JZRA 1YF0A 1THXA 2YP6A 4HJMA 4IJ3A 2L57A 4MABA 2QA2A 1H75A 5B6NA 2FWGA 1EWXA 1MDKA 4X43A 1T1VA 2CAQA 3ZTLA 3TJKA 3C7MA 4MH2A 3GTUB 3MAKA 4ZL9A 5ECNB 4NHWA 4ZL7A 5IO0A 19GSA 4PQ1A 2DJJA 3LWAA 1T4ZA 2R4VA 4FYBA 5KN2A 1X9SB 5ID2B 1X9WB 3KMOA 2DIYA 2V41A 5EVOA 1W89A 4QL9A 1ZMAA 4TR1B 2HZFA 2BMXA 5G1LA 4G0IA 5GSTA 3FR9A 3BBYA 3IBHA 4PXOA 5DAKB 3ZVJA 3FZAA 2EIRA 3IPZA 2JADA 4K5SA 3D5JA 2AJQB 1V9WA 2C3QA 4MZBA 3HYPA 2MMOA 1TRSA 1V57A 4N30A 1M9AA 3KEBA 1K3LA 2NTOA 4WEYA 2R0CA 3IHGA 5B8AA 3HHVA 2GSTA 5IMAA 2H0IA 1YF1A 3G9BA 4KUNA 3UL3A 3BJ5A 1U88A 3TJFA 4KW6A 3A5IA 1FOVA 3SWLA 5KOWA 5KEJA 5ECOB 2VD1A 4HI7A 1YY7A 1VF3A 1OE7A 4HQZA 1XFLA 4GLTA 4POKA 1A0RP 3A5WA 1EEMA 3TRPA 4CDOA 2IMFA 3PH9A 3FK8A 2X49A 4TXOA 3V1WA 4Z2TA 4MF5A 2VCZA 4ZILA 2QC7A 2VLUA 3HJPA 1PSQA 5AIVA 1SK1A 5B7CA 3RDWA 4V1Ag 3D21A 2H76A 1E6BA 5C04A 2IJYA 2C0FA 2WULA 2BJXA 3TUEA 3VPTA 2K8VA 1TTZA 3O6TA 1QK8A 2G0FA 2GTUA 5HFIA 3M1GA 1KEBA 3VWWA 5IM9A 1CQHA 2LKUA 2P5RA 1XWKA 2DIZA 2H70A 3GURA 1Z7RA 5DCGA 2B6MA 3GTUA 3GYKA 1XWAA 3WYWA 4FYCA 4MJEA 1U87A 2RUFA 22GSA 1R4WA 3QR6A 3L4NA 1ZZYA 4F82A 4LA1A 1C72A 1WOUA 5ID2A 3PR8A 4F03A 3WT1A 4L5OA 4Q5NA 3APQA 2JACA 4TR1A 1TJDA 3LFLA 4GSSA 1JLVA 5DALB 5G31A 5IOWA 3FYGA 3ED3A 2MBSA 2HZEA 3LQ7A 5DAKA 2PWJA 16GSA 1NSWA 4X4JA 4JR6A 2M72A 3D4TA 1EGOA 1I9DA 2N5BA 4ZIJA 1VF2A 3NOFA 3UARA 5DQSA 3W6GA 2C0EA 3FMWA 2CVBA 3RHBA 1GRXA 1AQXA 3KTBA 1K0AA 3HJMA 3TKSE 5D9XA 3IC4A 1XWBA 1K0OA 1GLPA 1SK0A 5D73A 1AQVA 3ERWA 3MWHA 4ML1A 2VIMA 3ME8A 2PUKC 2OKAA 4BPYA 5ECMB 3F9UA 1TRWA 1PGTA 1OYJA 3D6IA 5J9BA 4K1FA 4GSTA 5DDLA 2CT6A 5COHA 3CMIA 1T7PB 4ML6A 3RAZA 2K8SA 3MYDA 4HJ2A 1T4YA 2OACA 4XS6A 2GS3A 4HS1A 3EMXA 1YDKA 5ECPB 4QQ7A 4N10A 1WP0A 4O5QA 2VM1A 2B5EA 2P5QA 4O5UA 1O6JA 3F6FA 5IPGA 2OJLA 3ERFA 1A8LA 1TU8A 2FGXA 1K0NA 2PVQA 2MZCA 2H30A 2ZNMA 3A2VA 5D9VA 4OCEA 2VLTA 4BL7A 3J7Yb 4HUAA 1M2DA 1SJZA 1WWJA 3A2XA 4XRAA 3WGEA 2GQMA 3IV4A 1EOHA 3U5RE 1OC8A 4PUAA 3IR4A 5G5FA 5A5KA 3TRXA 2ALBA 2CX4A 3ERGA 3H8QA 1YJ6A 3KIJA 3GA4A 4XIHA 3ZYWA 4EKZA 2DKIA 2J9HA 3HXSA 3LJRA 4NHZA 2KHPA 1FVJA 1V98A 3NIVA 5DBQA 5GSSA 1SKWB 9GSSA 2K18A 3UIWA 2JSYA 1BJXA 3HA9A 1FHEA 1R7HA 4PQHA 4P3YB 2YWMA 1XVQA 2QGVA 5DALA 2FCHA 6GSVA 2R2JA 4JRRA 4KDXA 1RQMA 4PNGA 1SL1B 1GUKA 3LGCA 1ZCPA 4IQAA 4EDZA 4JU5A 2FWFA 5HR3A 4OFMA 2X4AA 1G7OA 5LD0A 4KX4A 5IMVA 4WF5A 4HZ2A 1WPIA 3UMAA 3LG6A 4JBBA 1TXXA 2LRTA 5G5EA 4MH3A 1BQ7A 1F9MA 2GDRA 1Z5YE 4K2XA 4GXZA 4ECCA 2GSRA 1B9YC 1AAZA 3EYTA 3ZVJD 1SL0B 1QQ2A 3H79A 1N2AA 2GZPA 2RM6A 2QKEA 4BVYB 1ACVA 1TRVA 1GSUA 1GSQA 2Z9SA 1GSEA 2IMEA 2VM2A 1X9MB 3CBUA 3KZQA 4Z2UA 4YQMA 4XTSA 2XPDA 4IHUA 4MCUA 4KCEA 2TIRA 2CA8A 3OR5A 3VFIA 1W4VA 4BVXA 3J7Yk 4I2UA 5H5RA 2YV9A 4DSRA 2DBCA 1SK2A 4GRFA 3FHKA 3Q74A 2FA4A 3GL3A 1BEDA 3F3RA 4MPFA 3KCMA 3ZFLA 3QPMA 5GAPD 4OD7A 3R2QA 4GQCA 2R0GA 5HFGA 3ZMLA 4EUYA 4NV5A 3LSZA 1BX9A 3S9FA 4EO3A 6GSTA 4YAVA 4CY8A 1TK0B 3FW2A 3D0ZA 4KA0A 1VGLA 3HKRA 4K0NA 1XWCA 5CNWA 2M46A 4EDYA 5JWRB 3L9SA 4KAEA 4ISDA 5AISA 2HRAA 4MA9A 5D9TA 5EY6A 2O7KA 1GSYA 3DXBA 3DKSA 5HFKA 3I43A 2HLSA 5IPHA 5AN1A 3Q19A 2R37A 3HZ4A 4TOPA 4G9HA 2B7JA 3GH9A 2DJKA 1DBYA 3G7YA 3VI7A 4GQFA 2HT9A 2C0GA 3C1RA 4A5PA 1M9BA 3FRCA 1GTBA 4G0KA 4ECJA 1MDJA 2MBTA 3KP8A 1H4OA 3VURA 3TB2A 2B5XA 3IAM2 1JZDA 2P0GA 3ZL5A 1T00A 3F63A 1GH2A 1JHBA 4AGSA 1XW6A 4I5QA 5DVBA 5KN0A 2HNLA 4Z7XA 1FOHA 3VI5A 5ECRB 4YAPA 1YEPA 1PL2A 1G0TA 1XPVA 2EIOA 2L4CA 2ZUPA 3VPQA 5IIZA 2WB9A 1HYUA 4OFTA 3MDKA 1R5AA 2H75A 5A4VA 5IO2A 1SJIA 4MJCA 1YKAA 3L9UA 3IAS2 4G10A 3BCKA 1RK4A 4HEA2 5B8BA 3LXTA 1O73A 3CYNA 1ZOFA 1K0CA 2FWHA 1SL2B 1O8XA 2R0PA 2HZEB 20GSA 4NXIA 1OKTA 3F0IA 3WD6A 4N0VA 4BVYA 2MMAA 3EPTA 4WBJA 1GTIA 4ZL8A 1PD21 1OVNA 2V6OA 3L9VA 3D4MA 1XW5A 4KSOA 1UN2A 4V1Ap 6GSSA 2J23A 3F6DA 1A2JA 2GZZA 2DJ2A 1TRUA 1DE2A 5CYYA 3I69A 1DUGA 1ZYQB 3QAGA 1MDIA 2A2PA 4LL4B 3O76A 3GKNA 2C4JA 1NHOA 3TRQA 1JZWA 2B7KA 4OO4A 2H1DA 2HRKA 2L5OA 4NMUA 2M80A 1X0RA 3U6VA 4WKWA 3F4RA 1O85A 3GFKA 4YQUA 5KN1A 3HCZA 2LJKA 3O3TA 1SU9A 1GNWA 2H6ZA 4X1UA 2PERA 2LEGA 1GTUA 4HZ4A 1GUHA 2CV4A 4K8MA 2FD3A 2B1KA 2IWTA 5H5QA 3F4TA 2VCWA 1AQWA 4JEDA 3CTFA 2P31A 3IXRA 1SD9A 2B1LA 4KB3A 1FB6A 1GNEA 1AUCA 2FWEA 2A4VA 3LXZA 1PKWA 4BL7B 1EV9A 1PA3A 3IK7A 1M7TA 2B5YA 4NWYA 2KUCA 2VL3A 1X5EA 2XBQA 1J0FA 4POMA 1XXUA 1JZOA 8GSSA 3SBCA 2LQQA 5CRDA 2L59A 3M3MA 2VL9A 3G7JA 1MTCA 2E2MA 3IRAA 1Z6NA 5D96A 4EE0A 2I81A 5DQYA 4G0LA 2PN8A 3CSJA 1A24A 3BCIA 2ES7A 4KGIA 4POBA 2N5AA 1VF4A 4HU9A 6GSXA 2WDUA 1A0FA 5B6MA 2IFQB 6GSWA 2I3YA 4K6XA 4E8HA 2R5GA 2N5FA 2C80A 2HYXA 1YKCA 4MZCA 5CRWA 1PMTA 3FZ5A 2X8HA 2XPEA 2YNXA 2DKHA 5A4UA 3UEMA 4PNFA 4Z2RA 2HSMA 4I97A 2ON7A 1S3DA 4O7HA 5J3RA 3GRXA 2K6VA 4F0BA 4N0ZA 2H1GA 2CVKA 4ACSA 5JCUA 2HRFA 1ON4A 4PX1A 4MDCA 3GKXA 2ON5A 1SJ6A 3BOAA 4F2IA 4OFNA 1OAZA 3TJGA 3UVHA 17GSA 3TKPA 1M99A 1WIKA 1GSFA 3KJYA 1HNAA 3FEUA 2PBJA 1KNGA 4FH8A 4K7IA 5GZZB 4PURA 2C0DA 4IKHA 1U3AA 2V1MA 2V32A 3HJOA 3RBTA 2MYGA 4K0GA 1A23A 3MSZA 1WE0A 2E0QA 2GQLA 5HQPA 4XS4B 2MMZA 1OKDA 1TP9A 2CZ3A 4FIWA 4ULXA 4TR3A 2HRNA 2I9HA 2FHEA 3TOTA 1U6TA 2RM5A 1T8EB 1Z3EA 1PL1A 1GWCA 1HNCA 5ELAA 5EL8A 2X64A 3HD5A 4JR4A 4OMVA 3C8EA 3QOUA 2XC2A 5E59A 1ZYNA 4ZBBA 2H0GA 4JE1A 4BVXB 3EMPA 2VD0A 2LJAA 3CRTA 4MF6A 1UA5A 3HZ8A 3GSTA 1NHYA 2AB6A 5JCGA 4J56E 4POLA 3GN3A 2H66A 4GTUA 3ZMKA 1TI3A 1Z6MA 5G30A 4YKGA 3LEFA 1XCCA 1PKZA 4CW9A 2QA1A 1O7UA 3GUSA 4V2LA 3RPNA 3EWLA 3KH7A 2H74A 3ZREA 1OC9B 1G7EA 1XWGA 3VLNA 3ZIJA 1B48A 2H6YA 1EZKA 5CO3A 4FO5A 1LU4A 4LL1B 4PUFC 4I8BA 2V2GA 2H0HA 3GNJA 2X8CA 1A2LA 3I9V2 2YJHA 3UVTA 2VL2A 5FHIA 3N9JA 5CAXA 4HOJA 5INYA 1YQ1A 1GLQA 4AJ6A 3ZZXA 1QXHA 2WZ9A 1A8YA 2A2SA 4MMMA 2IFQA 4KSMA 3EINA 5LNKe 1PN9A 4XS1A 3ZITA 3APOA 3CTGA 4XCSA 3IA1A 2YZHA 4MPGA 2H1BA 3QMXA 4AF2A 3VK9A 1Z7PA 1Y25A 1LJRA 1B8XA 2VAFA 2MMNA 4LMVA 1V58A 2VLVA 4HDEA 4IN0A 3CSIA 2FUG2 2PPTA 3DWVA 1KBNA 1PX6A 3RPPA 4OCFA 1AXDA 5D9WA 4DSSB 3M8NA 2G2QA 2RIIA 4ILFA 1K3YA 2VL2C 3E9JB 3DD3A 5G2ZA 4D73B 2FA8A 1IYHA 2OE1A 4XS4A 4NV2A 5IMCA 4ZB6A 2LV3A 4KE3A 2VCXA 4JZQA 2C3TA 2LTKA 4IP1A 2PMTA 5AGYA 1T3BA 5ECHB 4ID0A 4WETA 3WGXA 7GSSA 1F37A 3A3TA 3GKKA 1TK8B 5G1KA 1QGVA 2GT5A 2WJUA 2DJ1A 2L6DA 4DEJA 3APSA 3C1SA 2EC4A 3JCML 4EF0A 2C8UA 4FYUA 2A4HA 4IQ1A 4OO5A 5F0GA 4BWSA 2H71A 2RUEA 2H73A 4O5RA 4IW9A 3P90A 5IMFA 2PU9C 2OE3A 4I6XA 5DJLA 1SKRB 4RUVA 1SKSB 3IOSA 2IN3A 2VCTA 1OC9A 2X99A 1WJKA 3FZ4A 4MJAA 5KOXA 3FKFA 1K0BA 4GWRA 5CREA 3K8NA 2AV4A 4WR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D22 A;  2AHE A;  2F51 A;  1M2B A;  4V2M A;  2ZCT A;  3DVX A;  4E8E A;  4QL7 A;  4MZW A;  3LOR A;  4TKY A;  4V2N A;  3ZIV A;  2XHF A;  2LQO A;  4Q5F A;  1WRY A;  3KMN A;  2H1A A;  1OE8 A;  4MF7 A;  3ZFB A;  2F8F A;  14GS A;  2CVD A;  2YWO A;  1E2Y A;  13GS A;  3EU3 A;  5J9C A;  3WGD A;  2OA7 A;  4GSN A;  2H19 A;  1UC7 A;  1ILO A;  2YWI A;  3C73 A;  1J08 A;  3GIX A;  1GP1 A;  4AJ8 A;  2H01 A;  3Q18 A;  2NVL A;  3CRU A;  1EEJ A;  2IMK A;  1YEX A;  1THO A;  2NPB A;  4MK3 A;  2CAI A;  3LYP A;  4KH7 A;  2JZS A;  2TRC P;  1CQG A;  4DSS A;  3QD9 A;  4KND A;  3LYK A;  3FY7 A;  2KLX A;  5D93 A;  1JFU A;  4EXJ A;  3VWV A;  4D73 A;  3GX8 A;  3H4K A;  1XOA A;  1GL8 A;  2C1Y A;  3US3 A;  4EVM A;  1A2M A;  1K3O A;  5JWQ B;  2DJ3 A;  1SEN A;  3UAP A;  4N11 A;  1HNB A;  1GUL A;  4NPB A;  4IGJ A;  3FR3 A;  3GHA A;  1O8W A;  1XIY A;  5ECS A;  3F3Q A;  1GTA A;  3GSS A;  3GMF A;  1ERU A;  3UJ1 A;  1BG5 A;  1ERT A;  2LRN A;  1B4Q A;  1ZL9 A;  3KD0 A;  2HSY A;  2CX3 A;  2GVP A;  2E2G A;  1FAA A;  3DRN A;  2X8G A;  1AIU A;  2WGR A;  3HDC A;  11GS A;  3TKS A;  10GS A;  2HI7 A;  4XRD A;  4ZXG A;  2YAN A;  4IS0 A;  5IMZ A;  3M9K A;  4WF4 A;  18GS A;  2WRT A;  5FWG A;  2D2Z A;  3GV1 A;  2LS5 A;  5CRH A;  1F3A A;  5KN3 A;  1G6Y A;  3QCP A;  5FT3 A;  2H72 A;  1OC3 A;  4HQS A;  1AW9 A;  3IE3 A;  2OAD A;  2IIY A;  3QDN A;  2LNS A;  2JZT A;  5GAN D;  3UBK A;  4TR4 A;  2GGT A;  3A2W A;  4EC0 A;  1M0U A;  5E4W A;  1USB A;  1GUM A;  2L4Q A;  2VCQ A;  1V40 A;  3ZLP A;  2GSS A;  5L71 A;  1K0M A;  2VOC A;  2LNT A;  2YCD A;  4O92 A;  2CQ9 A;  4RQX A;  2XBI A;  5IMD A;  4TN8 A;  1TU7 A;  1PRX A;  4G19 A;  3DVW A;  4HU7 A;  3FR6 A;  4MLY A;  2NBS A;  1KTE A;  3TJB A;  3H93 A;  1V2A A;  1ERV A;  4K7O A;  3TKS C;  2HFD A;  1K0D A;  1ML6 A;  3HVV A;  5CRG A;  4GCI A;  12GS A;  1ZYE A;  6GSY A;  1B4P A;  2IMD A;  3E0U A;  5HR2 A;  3TKR A;  3KH9 A;  2DSA A;  2AYT A;  2L6C A;  2YN1 A;  3M0F A;  4ZBA A;  3W8J A;  1TI1 A;  2OBI A;  1Q98 A;  2YJ7 A;  1GSD A;  5DJM A;  3DYR A;  5AIX A;  4J57 E;  1XZO A;  2GSQ A;  2YV7 A;  3P2A A;  3E3E A;  3BD2 A;  3F8U A;  5A4W A;  1FW1 A;  5C00 A;  5ABR A;  3N5O A;  3C71 A;  1XOB A;  2KP2 A;  4L5L A;  2FY6 A;  2O87 A;  1HD2 A;  3IDV A;  1QFN A;  1HQO A;  2RLI A;  1SYX A;  1EP8 A;  1O81 A;  2IPA A;  2C3N A;  5CP1 A;  2HXK A;  4AJ7 A;  1Q4J A;  5IQY A;  2CZ2 A;  2I4A A;  2OBK A;  1X5D A;  1BAY A;  2R3X A;  4EL1 A;  4ZB9 A;  1GSS A;  2KOK A;  4YQV A;  4OWY A;  4L0U A;  1TOF A;  3TOU A;  3AY8 A;  4TXV A;  3ME7 A;  3M9J A;  1F3B A;  3TCO A;  2AAW A;  1ERW A;  5HR0 A;  3GH6 A;  4MJB A;  4TVE A;  3GX0 A;  4RI7 A;  3HY2 A;  3P8W A;  4X0X A;  3P7X A;  2F3M A;  4WXT A;  2R6K A;  2AUV A;  1VF1 A;  4DSQ A;  3H1N A;  1URM A;  2YWN A;  5F05 A;  5JCW A;  2DLX A;  1NW2 A;  1TK5 B;  2GT6 A;  2JZR A;  2HSH A;  3GL5 A;  5DCH A;  2DML A;  3QAV A;  4NAX A;  1EV4 A;  2DJ0 A;  1XBS A;  2O85 A;  1JLW A;  4PGT A;  4PQI A;  1Y6E A;  3PIN A;  1PQN A;  4Q5R A;  2TRX A;  1EP7 A;  3QAW A;  3WT2 A;  2E7P A;  1MD3 A;  4YH2 A;  1M2A A;  2JSZ A;  3FZ9 A;  2PGT A;  1TKD B;  4F9Z A;  2GQK A;  4K9Z A;  5ECQ B;  3KXO A;  3QFA C;  1U3I A;  5J4U A;  2O89 A;  1BYE A;  4ECB A;  2F8A A;  2QSI A;  1FB0 A;  1F6M C;  2EIQ A;  1FO5 A;  4ZB8 A;  5J41 A;  1S3C A;  2VUP A;  1S3A A;  3PGT A;  1VRS D;  3G7I A;  4K2D A;  3NZN A;  4G2E A;  5D8I A;  3DEX A;  1R26 A;  3F4S A;  4KDY A;  4LLR A;  2REM A;  2H6X A;  2B3S A;  3VWX A;  1PX7 A;  1DE1 A;  2WCI A;  4XHM A;  3VWU A;  1TW9 A;  5EPF A;  2PVO C;  4TRX A;  4MP4 A;  1XW9 A;  4Q5Q A;  4LMW A;  2K9F A;  3L0H A;  4O32 A;  3Q6O A;  1X5C A;  5F06 A;  1G6W A;  4IJI A;  1WMJ A;  2OE0 A;  3ISO A;  2FLS A;  1I5G A;  4WBR D;  3HVS A;  4J2F A;  2JU5 A;  1YZX A;  5J5N A;  1ZGN A;  2VO4 A;  2YPM A;  3TDG A;  4IEL A;  3DML A;  1MEK A;  3W8S A;  4BA7 A;  1SD8 A;  3CXG A;  5HR1 A;  1DSB A;  4KDU A;  1ST9 A;  1TDI A;  1F2E A;  1ABA A;  2IL3 A;  2HE3 A;  1LBK A;  1EGR A;  4KCA A;  4IVF A;  3EUR A;  1B9X C;  2A2R A;  2DC5 A;  2H8L A;  2DMM A;  3QFB C;  2F9S A;  4L8E A;  2KP1 A;  3KGK A;  4DVC A;  1MD4 A;  4IBP A;  3TGZ A;  1IYI A;  4ZBD A;  3TKQ A;  3IHQ A;  2LST A;  5ELG A;  2L5L A;  2O8V B;  4GF0 A;  5H5S A;  3I6A A;  3MNG A;  1NM3 A;  2YZU A;  3DIE A;  1J9B A;  4K7N A;  4WR5 A;  4RI6 A;  2WFC A;  1RW1 A;  1FG4 A;  5ECI B;  1EOG A;  3ZRD A;  3RHC A;  1UVZ A;  2I1U A;  1XVW A;  1AC1 A;  5JWO B;  3IK9 A;  3TJJ A;  4F0C A;  3GKM A;  3UOM A;  6GSU A;  3DGQ A;  4RQR A;  3EC3 A;  5F07 A;  3EU4 A;  1Z9H A;  3HVX A;  2GLR A;  4TR0 A;  2GZY A;  3L78 A;  2YOI A;  2BTO T;  4L0W A;  3EVI A;  2LJR A;  4H86 A;  1N8J A;  3EE2 A;  5IOX A;  2FNO A;  4CHS A;  3UBL A;  1QUW A;  3KP9 A;  4I2T A;  3KTL A;  5LCZ A;  1SYR A;  4TW5 A;  3CSH A;  3KM6 A;  5ENU A;  1R5P A;  5ECL B;  2V6K A;  4TXO B;  1FVK A;  5ECK B;  2VCV A;  2IMI A;  2JL4 A;  2NDO A;  4ECI A;  2WS2 A;  5F8B A;  4IP6 A;  2LRC A;  1QMV A;  4BWQ A;  2LUS A;  1JZR A;  1YF0 A;  1THX A;  2YP6 A;  4HJM A;  4IJ3 A;  2L57 A;  4MAB A;  1H75 A;  5B6N A;  2FWG A;  1EWX A;  1MDK A;  4X43 A;  1T1V A;  2CAQ A;  3ZTL A;  3TJK A;  3C7M A;  4MH2 A;  3GTU B;  3MAK A;  4ZL9 A;  5ECN B;  4NHW A;  4ZL7 A;  5IO0 A;  19GS A;  4PQ1 A;  2DJJ A;  3LWA A;  1T4Z A;  2R4V A;  4FYB A;  5KN2 A;  1X9S B;  5ID2 B;  1X9W B;  3KMO A;  2DIY A;  2V41 A;  5EVO A;  1W89 A;  4QL9 A;  1ZMA A;  4TR1 B;  2HZF A;  2BMX A;  5G1L A;  5GST A;  3FR9 A;  3BBY A;  3IBH A;  4PXO A;  5DAK B;  3ZVJ A;  3FZA A;  2EIR A;  3IPZ A;  2JAD A;  3D5J A;  2AJQ B;  1V9W A;  2C3Q A;  4MZB A;  3HYP A;  2MMO A;  1TRS A;  1V57 A;  4N30 A;  1M9A A;  3KEB A;  1K3L A;  2NTO A;  4WEY A;  5B8A A;  3HHV A;  2GST A;  5IMA A;  2H0I A;  1YF1 A;  3G9B A;  4KUN A;  3UL3 A;  3BJ5 A;  1U88 A;  3TJF A;  4KW6 A;  1FOV A;  3SWL A;  5KEJ A;  5ECO B;  2VD1 A;  4HI7 A;  1YY7 A;  1VF3 A;  1OE7 A;  4HQZ A;  1XFL A;  4GLT A;  4POK A;  1A0R P;  3A5W A;  1EEM A;  3TRP A;  4CDO A;  2IMF A;  3PH9 A;  3FK8 A;  4TXO A;  3V1W A;  4MF5 A;  2VCZ A;  4ZIL A;  2QC7 A;  2VLU A;  3HJP A;  1PSQ A;  5AIV A;  1SK1 A;  5B7C A;  3RDW A;  4V1A g;  3D21 A;  2H76 A;  1E6B A;  5C04 A;  2IJY A;  2C0F A;  2WUL A;  2BJX A;  3TUE A;  3VPT A;  2K8V A;  1TTZ A;  3O6T A;  1QK8 A;  2G0F A;  2GTU A;  5HFI A;  3M1G A;  1KEB A;  3VWW A;  5IM9 A;  1CQH A;  2LKU A;  2P5R A;  1XWK A;  2DIZ A;  2H70 A;  3GUR A;  1Z7R A;  5DCG A;  2B6M A;  3GTU A;  3GYK A;  1XWA A;  3WYW A;  4FYC A;  4MJE A;  1U87 A;  2RUF A;  22GS A;  1R4W A;  3QR6 A;  3L4N A;  1ZZY A;  4F82 A;  4LA1 A;  1C72 A;  1WOU A;  5ID2 A;  3PR8 A;  4F03 A;  3WT1 A;  4L5O A;  4Q5N A;  3APQ A;  2JAC A;  4TR1 A;  1TJD A;  3LFL A;  4GSS A;  1JLV A;  5DAL B;  5G31 A;  5IOW A;  3FYG A;  3ED3 A;  2MBS A;  2HZE A;  3LQ7 A;  5DAK A;  2PWJ A;  16GS A;  1NSW A;  4JR6 A;  2M72 A;  3D4T A;  1EGO A;  1I9D A;  2N5B A;  4ZIJ A;  1VF2 A;  3NOF A;  3UAR A;  5DQS A;  3W6G A;  2C0E A;  2CVB A;  3RHB A;  1GRX A;  1AQX A;  3KTB A;  1K0A A;  3HJM A;  3TKS E;  5D9X A;  3IC4 A;  1XWB A;  1K0O A;  1GLP A;  1SK0 A;  5D73 A;  1AQV A;  3ERW A;  3MWH A;  4ML1 A;  2VIM A;  3ME8 A;  2PUK C;  2OKA A;  4BPY A;  5ECM B;  3F9U A;  1TRW A;  1PGT A;  1OYJ A;  3D6I A;  5J9B A;  4K1F A;  4GST A;  5DDL A;  2CT6 A;  5COH A;  3CMI A;  1T7P B;  4ML6 A;  3RAZ A;  2K8S A;  4HJ2 A;  1T4Y A;  2OAC A;  4XS6 A;  2GS3 A;  4HS1 A;  3EMX A;  1YDK A;  5ECP B;  4QQ7 A;  4N10 A;  1WP0 A;  2VM1 A;  2B5E A;  2P5Q A;  1O6J A;  3F6F A;  5IPG A;  2OJL A;  3ERF A;  1A8L A;  1TU8 A;  2FGX A;  1K0N A;  2PVQ A;  2MZC A;  2H30 A;  2ZNM A;  3A2V A;  5D9V A;  4OCE A;  2VLT A;  4BL7 A;  3J7Y b;  4HUA A;  1M2D A;  1SJZ A;  1WWJ A;  3A2X A;  4XRA A;  3WGE A;  2GQM A;  3IV4 A;  1EOH A;  3U5R E;  1OC8 A;  4PUA A;  3IR4 A;  5G5F A;  5A5K A;  3TRX A;  2ALB A;  2CX4 A;  3ERG A;  3H8Q A;  1YJ6 A;  3KIJ A;  3GA4 A;  4XIH A;  3ZYW A;  4EKZ A;  2J9H A;  3HXS A;  3LJR A;  4NHZ A;  2KHP A;  1FVJ A;  1V98 A;  3NIV A;  5DBQ A;  5GSS A;  1SKW B;  9GSS A;  2K18 A;  3UIW A;  2JSY A;  1BJX A;  3HA9 A;  1FHE A;  1R7H A;  4PQH A;  4P3Y B;  2YWM A;  1XVQ A;  2QGV A;  5DAL A;  2FCH A;  6GSV A;  2R2J A;  4JRR A;  4KDX A;  1RQM A;  4PNG A;  1SL1 B;  1GUK A;  3LGC A;  1ZCP A;  4IQA A;  4EDZ A;  4JU5 A;  2FWF A;  5HR3 A;  4OFM A;  1G7O A;  5LD0 A;  4KX4 A;  5IMV A;  4WF5 A;  4HZ2 A;  1WPI A;  3UMA A;  3LG6 A;  4JBB A;  1TXX A;  2LRT A;  5G5E A;  4MH3 A;  1BQ7 A;  1F9M A;  2GDR A;  1Z5Y E;  4ECC A;  4GXZ A;  2GSR A;  1B9Y C;  1AAZ A;  3EYT A;  3ZVJ D;  1SL0 B;  1QQ2 A;  3H79 A;  1N2A A;  2GZP A;  2RM6 A;  2QKE A;  1ACV A;  1TRV A;  1GSU A;  1GSQ A;  2Z9S A;  1GSE A;  2IME A;  2VM2 A;  1X9M B;  3CBU A;  3KZQ A;  4YQM A;  4XTS A;  2XPD A;  4IHU A;  4MCU A;  4KCE A;  2TIR A;  2CA8 A;  3OR5 A;  3VFI A;  1W4V A;  4BVX A;  3J7Y k;  4I2U A;  5H5R A;  2YV9 A;  4DSR A;  2DBC A;  1SK2 A;  4GRF A;  3FHK A;  3Q74 A;  2FA4 A;  3GL3 A;  1BED A;  3F3R A;  4MPF A;  3KCM A;  3ZFL A;  3QPM A;  5GAP D;  4OD7 A;  3R2Q A;  4GQC A;  5HFG A;  3ZML A;  4EUY A;  4NV5 A;  3LSZ A;  1BX9 A;  3S9F A;  4EO3 A;  6GST A;  4YAV A;  1TK0 B;  3FW2 A;  3D0Z A;  4KA0 A;  1VGL A;  3HKR A;  4K0N A;  1XWC A;  5CNW A;  2M46 A;  4EDY A;  5JWR B;  3L9S A;  4KAE A;  4ISD A;  5AIS A;  4MA9 A;  5D9T A;  5EY6 A;  2O7K A;  1GSY A;  3DXB A;  3DKS A;  5HFK A;  3I43 A;  2HLS A;  5IPH A;  5AN1 A;  3Q19 A;  2R37 A;  3HZ4 A;  4TOP A;  4G9H A;  2B7J A;  3GH9 A;  2DJK A;  1DBY A;  3G7Y A;  3VI7 A;  4GQF A;  2HT9 A;  2C0G A;  3C1R A;  1M9B A;  3FRC A;  1GTB A;  4ECJ A;  1MDJ A;  2MBT A;  3KP8 A;  1H4O A;  3VUR A;  3TB2 A;  2B5X A;  3IAM 2;  1JZD A;  2P0G A;  3ZL5 A;  1T00 A;  3F63 A;  1GH2 A;  1JHB A;  4AGS A;  1XW6 A;  4I5Q A;  5DVB A;  5KN0 A;  2HNL A;  4Z7X A;  3VI5 A;  5ECR B;  4YAP A;  1YEP A;  1PL2 A;  1G0T A;  1XPV A;  2EIO A;  2L4C A;  2ZUP A;  3VPQ A;  5IIZ A;  2WB9 A;  1HYU A;  4OFT A;  3MDK A;  1R5A A;  2H75 A;  5A4V A;  5IO2 A;  1SJI A;  4MJC A;  1YKA A;  3L9U A;  3IAS 2;  4G10 A;  3BCK A;  1RK4 A;  4HEA 2;  5B8B A;  3LXT A;  1O73 A;  3CYN A;  1ZOF A;  1K0C A;  2FWH A;  1SL2 B;  1O8X A;  2HZE B;  20GS A;  4NXI A;  1OKT A;  3F0I A;  3WD6 A;  4N0V A;  4BVY A;  2MMA A;  4WBJ A;  1GTI A;  4ZL8 A;  1PD2 1;  1OVN A;  2V6O A;  3L9V A;  3D4M A;  1XW5 A;  4KSO A;  1UN2 A;  4V1A p;  6GSS A;  2J23 A;  3F6D A;  1A2J A;  2GZZ A;  2DJ2 A;  1TRU A;  1DE2 A;  5CYY A;  3I69 A;  1DUG A;  1ZYQ B;  3QAG A;  1MDI A;  4LL4 B;  3O76 A;  3GKN A;  2C4J A;  1NHO A;  3TRQ A;  1JZW A;  2B7K A;  4OO4 A;  2H1D A;  2L5O A;  4NMU A;  2M80 A;  1X0R A;  3U6V A;  4WKW A;  3F4R A;  1O85 A;  3GFK A;  4YQU A;  5KN1 A;  3HCZ A;  2LJK A;  3O3T A;  1SU9 A;  1GNW A;  2H6Z A;  4X1U A;  2PER A;  2LEG A;  1GTU A;  4HZ4 A;  1GUH A;  2CV4 A;  4K8M A;  2FD3 A;  2B1K A;  2IWT A;  5H5Q A;  3F4T A;  2VCW A;  1AQW A;  4JED A;  3CTF A;  2P31 A;  3IXR A;  1SD9 A;  2B1L A;  4KB3 A;  1FB6 A;  1GNE A;  1AUC A;  2FWE A;  2A4V A;  3LXZ A;  1PKW A;  1EV9 A;  1PA3 A;  3IK7 A;  1M7T A;  2B5Y A;  4NWY A;  2KUC A;  2VL3 A;  1X5E A;  2XBQ A;  1J0F A;  4POM A;  1XXU A;  1JZO A;  8GSS A;  3SBC A;  2LQQ A;  5CRD A;  2L59 A;  3M3M A;  2VL9 A;  3G7J A;  1MTC A;  2E2M A;  3IRA A;  1Z6N A;  5D96 A;  4EE0 A;  2I81 A;  5DQY A;  2PN8 A;  3CSJ A;  1A24 A;  3BCI A;  2ES7 A;  4KGI A;  4POB A;  2N5A A;  1VF4 A;  4HU9 A;  6GSX A;  2WDU A;  1A0F A;  5B6M A;  2IFQ B;  6GSW A;  2I3Y A;  4K6X A;  4E8H A;  2R5G A;  2N5F A;  2C80 A;  2HYX A;  1YKC A;  4MZC A;  5CRW A;  1PMT A;  3FZ5 A;  2X8H A;  2XPE A;  2YNX A;  5A4U A;  3UEM A;  4PNF A;  4I97 A;  2ON7 A;  1S3D A;  4O7H A;  5J3R A;  3GRX A;  2K6V A;  4F0B A;  4N0Z A;  2H1G A;  2CVK A;  4ACS A;  5JCU A;  2HRF A;  1ON4 A;  4PX1 A;  4MDC A;  3GKX A;  2ON5 A;  1SJ6 A;  3BOA A;  4F2I A;  4OFN A;  1OAZ A;  3TJG A;  3UVH A;  17GS A;  3TKP A;  1M99 A;  1WIK A;  1GSF A;  3KJY A;  1HNA A;  3FEU A;  2PBJ A;  1KNG A;  4FH8 A;  4K7I A;  5GZZ B;  4PUR A;  2C0D A;  4IKH A;  1U3A A;  2V1M A;  2V32 A;  3HJO A;  3RBT A;  2MYG A;  4K0G A;  1A23 A;  3MSZ A;  1WE0 A;  2E0Q A;  2GQL A;  5HQP A;  4XS4 B;  2MMZ A;  1OKD A;  1TP9 A;  2CZ3 A;  4FIW A;  4ULX A;  4TR3 A;  2HRN A;  2I9H A;  2FHE A;  3TOT A;  1U6T A;  2RM5 A;  1T8E B;  1Z3E A;  1PL1 A;  1GWC A;  1HNC A;  5ELA A;  5EL8 A;  2X64 A;  3HD5 A;  4JR4 A;  4OMV A;  3C8E A;  3QOU A;  2XC2 A;  5E59 A;  4ZBB A;  2H0G A;  4JE1 A;  3EMP A;  2VD0 A;  2LJA A;  3CRT A;  4MF6 A;  1UA5 A;  3HZ8 A;  3GST A;  1NHY A;  2AB6 A;  5JCG A;  4J56 E;  4POL A;  3GN3 A;  2H66 A;  4GTU A;  3ZMK A;  1TI3 A;  1Z6M A;  5G30 A;  3LEF A;  1XCC A;  1PKZ A;  4CW9 A;  3GUS A;  1O7U A;  4V2L A;  3RPN A;  3EWL A;  3KH7 A;  2H74 A;  3ZRE A;  1OC9 B;  1G7E A;  1XWG A;  3VLN A;  3ZIJ A;  1B48 A;  2H6Y A;  1EZK A;  5CO3 A;  4FO5 A;  1LU4 A;  4LL1 B;  4PUF C;  4I8B A;  2V2G A;  2H0H A;  3GNJ A;  2X8C A;  1A2L A;  3I9V 2;  2YJH A;  3UVT A;  2VL2 A;  5FHI A;  3N9J A;  5CAX A;  4HOJ A;  5INY A;  1YQ1 A;  1GLQ A;  4AJ6 A;  3ZZX A;  1QXH A;  2WZ9 A;  1A8Y A;  2A2S A;  4MMM A;  2IFQ A;  4KSM A;  3EIN A;  5LNK e;  1PN9 A;  4XS1 A;  3ZIT A;  3APO A;  3CTG A;  4XCS A;  3IA1 A;  2YZH A;  4MPG A;  2H1B A;  3QMX A;  4AF2 A;  3VK9 A;  1Z7P A;  1Y25 A;  1LJR A;  1B8X A;  2VAF A;  2MMN A;  4LMV A;  1V58 A;  2VLV A;  4HDE A;  4IN0 A;  3CSI A;  2FUG 2;  2PPT A;  3DWV A;  1KBN A;  1PX6 A;  3RPP A;  4OCF A;  1AXD A;  5D9W A;  4DSS B;  3M8N A;  2G2Q A;  2RII A;  4ILF A;  1K3Y A;  2VL2 C;  3E9J B;  3DD3 A;  5G2Z A;  4D73 B;  2FA8 A;  1IYH A;  2OE1 A;  4XS4 A;  4NV2 A;  5IMC A;  4ZB6 A;  2LV3 A;  4KE3 A;  2VCX A;  4JZQ A;  2C3T A;  2LTK A;  4IP1 A;  2PMT A;  5AGY A;  1T3B A;  5ECH B;  4ID0 A;  4WET A;  3WGX A;  7GSS A;  1F37 A;  3A3T A;  3GKK A;  1TK8 B;  5G1K A;  1QGV A;  2GT5 A;  2WJU A;  2DJ1 A;  2L6D A;  4DEJ A;  3APS A;  3C1S A;  2EC4 A;  3JCM L;  4EF0 A;  2C8U A;  4FYU A;  4IQ1 A;  4OO5 A;  5F0G A;  4BWS A;  2H71 A;  2RUE A;  2H73 A;  4O5R A;  4IW9 A;  3P90 A;  5IMF A;  2PU9 C;  2OE3 A;  4I6X A;  5DJL A;  1SKR B;  4RUV A;  1SKS B;  3IOS A;  2IN3 A;  2VCT A;  1OC9 A;  2X99 A;  1WJK A;  3FZ4 A;  4MJA A;  3FKF A;  1K0B A;  4GWR A;  5CRE A;  3K8N A;  2AV4 A;  4WR4 A; 
#chains in the Genus database with same CATH topology
 3D22 A;  2AHE A;  2F51 A;  1M2B A;  4V2M A;  2ZCT A;  3DVX A;  4E8E A;  4QL7 A;  4MZW A;  3LOR A;  4TKY A;  4V2N A;  3ZIV A;  2XHF A;  2LQO A;  4Q5F A;  1WRY A;  3KMN A;  2H1A A;  1OE8 A;  4MF7 A;  3ZFB A;  2F8F A;  14GS A;  2CVD A;  2YWO A;  1E2Y A;  13GS A;  3EU3 A;  5J9C A;  3WGD A;  2OA7 A;  4GSN A;  2H19 A;  1UC7 A;  1ILO A;  2YWI A;  3C73 A;  1J08 A;  3GIX A;  1GP1 A;  3MIX A;  4AJ8 A;  2H01 A;  3Q18 A;  2NVL A;  3CRU A;  1EEJ A;  2IMK A;  1YEX A;  1THO A;  2NPB A;  4MK3 A;  4MNN A;  2CAI A;  3LYP A;  4KH7 A;  2JZS A;  2TRC P;  1CQG A;  4DSS A;  3QD9 A;  4KND A;  3LYK A;  3FY7 A;  2KLX A;  5D93 A;  1JFU A;  4EXJ A;  3VWV A;  4D73 A;  3GX8 A;  3H4K A;  1XOA A;  1GL8 A;  2C1Y A;  3US3 A;  4EVM A;  1A2M A;  1K3O A;  5JWQ B;  2DJ3 A;  1SEN A;  3UAP A;  4N11 A;  1HNB A;  1GUL A;  4NPB A;  1ZYP A;  4IGJ A;  3FR3 A;  3GHA A;  1O8W A;  1XIY A;  5ECS A;  3F3Q A;  1GTA A;  3GSS A;  3GMF A;  1ERU A;  3UJ1 A;  1BG5 A;  1ERT A;  2LRN A;  1B4Q A;  1ZL9 A;  3KD0 A;  2HSY A;  2CX3 A;  2GVP A;  2E2G A;  1FAA A;  3DRN A;  2X8G A;  1AIU A;  1PN0 A;  2WGR A;  3HDC A;  11GS A;  3TKS A;  10GS A;  2HI7 A;  4XRD A;  4ZXG A;  2YAN A;  4IS0 A;  5IMZ A;  3M9K A;  4WF4 A;  18GS A;  2WRT A;  5FWG A;  2D2Z A;  3GV1 A;  2LS5 A;  5CRH A;  1F3A A;  5KN3 A;  1G6Y A;  3QCP A;  5FT3 A;  2H72 A;  1OC3 A;  4HQS A;  1AW9 A;  3IE3 A;  2OAD A;  2IIY A;  3QDN A;  2LNS A;  2JZT A;  5GAN D;  3UBK A;  4TR4 A;  2GGT A;  3A2W A;  4EC0 A;  1M0U A;  5E4W A;  1USB A;  1GUM A;  2L4Q A;  2VCQ A;  1V40 A;  3ZLP A;  2GSS A;  5L71 A;  1K0M A;  2VOC A;  5BRT A;  2LNT A;  2YCD A;  4O92 A;  2CQ9 A;  4RQX A;  3CQF A;  2XBI A;  5IMD A;  4TN8 A;  1TU7 A;  1PRX A;  4G19 A;  3DVW A;  4HU7 A;  3FR6 A;  4MLY A;  2NBS A;  1KTE A;  3TJB A;  3H93 A;  1V2A A;  1ERV A;  4K7O A;  3TKS C;  2HFD A;  1K0D A;  1S3R A;  1ML6 A;  3HVV A;  5CRG A;  4GCI A;  12GS A;  1ZYE A;  6GSY A;  1B4P A;  2IMD A;  3E0U A;  5HR2 A;  3TKR A;  3KH9 A;  2DSA A;  3HVN A;  2AYT A;  2L6C A;  2YN1 A;  3M0F A;  4ZBA A;  3W8J A;  4ICY A;  1TI1 A;  2OBI A;  1Q98 A;  2YJ7 A;  1GSD A;  5DJM A;  3DYR A;  5AIX A;  4J57 E;  1XZO A;  2GSQ A;  2YV7 A;  3P2A A;  3E3E A;  3BD2 A;  3F8U A;  5A4W A;  1FW1 A;  5C00 A;  5ABR A;  3N5O A;  3C71 A;  1XOB A;  2KP2 A;  4L5L A;  2FY6 A;  2O87 A;  1HD2 A;  3IDV A;  1QFN A;  1HQO A;  2RLI A;  1SYX A;  1EP8 A;  1O81 A;  2IPA A;  2C3N A;  5CP1 A;  2HXK A;  4AJ7 A;  1Q4J A;  5IQY A;  2CZ2 A;  2I4A A;  2OBK A;  1X5D A;  1BAY A;  2R3X A;  4EL1 A;  4ZB9 A;  1GSS A;  2KOK A;  4YQV A;  4OWY A;  4FQU A;  4L0U A;  1TOF A;  3TOU A;  3AY8 A;  4TXV A;  3ME7 A;  3M9J A;  1F3B A;  3TCO A;  2AAW A;  1ERW A;  5HR0 A;  3GH6 A;  4MJB A;  4TVE A;  3GX0 A;  4RI7 A;  3HY2 A;  3P8W A;  4X0X A;  3P7X A;  2F3M A;  4WXT A;  2R6K A;  2AUV A;  1VF1 A;  4DSQ A;  3H1N A;  1URM A;  2YWN A;  5F05 A;  5JCW A;  2DLX A;  4KF9 A;  1NW2 A;  1TK5 B;  2GT6 A;  2JZR A;  2HSH A;  3GL5 A;  5DCH A;  3LW9 A;  2DML A;  3QAV A;  4EIQ A;  4NAX A;  1EV4 A;  2DJ0 A;  1XBS A;  2O85 A;  1JLW A;  4PGT A;  4PQI A;  1Y6E A;  3PIN A;  1PQN A;  4Q5R A;  2TRX A;  1EP7 A;  3QAW A;  3WT2 A;  2E7P A;  1MD3 A;  4YH2 A;  1M2A A;  2JSZ A;  3FZ9 A;  2PGT A;  1TKD B;  4F9Z A;  2GQK A;  4K9Z A;  5ECQ B;  3KXO A;  3QFA C;  1U3I A;  5J4U A;  2O89 A;  1BYE A;  4ECB A;  2F8A A;  2QSI A;  1FB0 A;  1F6M C;  2EIQ A;  1FO5 A;  4ZB8 A;  5J41 A;  4USS A;  1S3C A;  2VUP A;  1S3A A;  3PGT A;  1VRS D;  3G7I A;  4K2D A;  3NZN A;  4G2E A;  5D8I A;  3DEX A;  1R26 A;  3F4S A;  4KDY A;  4LLR A;  2REM A;  2H6X A;  4EIP A;  2B3S A;  3VWX A;  1PX7 A;  1DE1 A;  2WCI A;  4K5R A;  4XHM A;  3VWU A;  1TW9 A;  5EPF A;  2PVO C;  4TRX A;  4MP4 A;  1XW9 A;  4Q5Q A;  4LMW A;  2K9F A;  3L0H A;  4O32 A;  3Q6O A;  1X5C A;  5F06 A;  1G6W A;  4IJI A;  1WMJ A;  2OE0 A;  3ISO A;  3R3E A;  2FLS A;  1I5G A;  4WBR D;  3HVS A;  4J2F A;  2JU5 A;  1YZX A;  5J5N A;  1ZGN A;  2VO4 A;  2YPM A;  3TDG A;  4IEL A;  3DML A;  1MEK A;  3W8S A;  4BA7 A;  1SD8 A;  3CXG A;  5HR1 A;  1DSB A;  4KDU A;  1ST9 A;  1TDI A;  1F2E A;  1ABA A;  2IL3 A;  2HE3 A;  1LBK A;  1EGR A;  4KCA A;  4YKF A;  4IVF A;  3EUR A;  1B9X C;  2A2R A;  2DC5 A;  2H8L A;  2DMM A;  4CY6 A;  3QFB C;  5BMU A;  2F9S A;  4L8E A;  2KP1 A;  3KGK A;  4PTS A;  4DVC A;  1MD4 A;  4IBP A;  3TGZ A;  1IYI A;  4ZBD A;  3TKQ A;  3IHQ A;  2LST A;  2L5L A;  2O8V B;  5ELG A;  4GF0 A;  5H5S A;  3I6A A;  3MNG A;  1NM3 A;  2YZU A;  2UZ8 A;  3DIE A;  1J9B A;  4K7N A;  4WR5 A;  4RI6 A;  2WFC A;  1RW1 A;  1FG4 A;  5ECI B;  1EOG A;  3ZRD A;  3RHC A;  1UVZ A;  2I1U A;  1XVW A;  1AC1 A;  5JWO B;  3IK9 A;  3TJJ A;  4F0C A;  3GKM A;  3UOM A;  6GSU A;  3DGQ A;  4RQR A;  3EC3 A;  5F07 A;  3EU4 A;  1Z9H A;  3HVX A;  2GLR A;  4TR0 A;  2GZY A;  3L78 A;  2YOI A;  2BTO T;  4L0W A;  3EVI A;  2LJR A;  4H86 A;  1N8J A;  3EE2 A;  5IOX A;  2FNO A;  4CHS A;  3UBL A;  1QUW A;  3KP9 A;  4I2T A;  3KTL A;  5LCZ A;  1SYR A;  4BIK A;  4TW5 A;  3CSH A;  3KM6 A;  5ENU A;  3PPU A;  1R5P A;  5ECL B;  2V6K A;  4TXO B;  1FVK A;  5ECK B;  2VCV A;  2IMI A;  2JL4 A;  2NDO A;  4ECI A;  2WS2 A;  3IC8 A;  4IP6 A;  5F8B A;  2LRC A;  1QMV A;  4BWQ A;  2LUS A;  1JZR A;  1YF0 A;  1THX A;  2YP6 A;  4HJM A;  4IJ3 A;  2L57 A;  4MAB A;  2QA2 A;  1H75 A;  5B6N A;  2FWG A;  1EWX A;  1MDK A;  4X43 A;  1T1V A;  2CAQ A;  3ZTL A;  3TJK A;  3C7M A;  4MH2 A;  3GTU B;  3MAK A;  4ZL9 A;  5ECN B;  4NHW A;  4ZL7 A;  5IO0 A;  19GS A;  4PQ1 A;  2DJJ A;  3LWA A;  1T4Z A;  2R4V A;  4FYB A;  5KN2 A;  1X9S B;  5ID2 B;  1X9W B;  3KMO A;  2DIY A;  2V41 A;  5EVO A;  1W89 A;  4QL9 A;  1ZMA A;  4TR1 B;  2HZF A;  2BMX A;  5G1L A;  4G0I A;  5GST A;  3FR9 A;  3BBY A;  3IBH A;  4PXO A;  5DAK B;  3ZVJ A;  3FZA A;  2EIR A;  3IPZ A;  2JAD A;  4K5S A;  3D5J A;  2AJQ B;  1V9W A;  2C3Q A;  4MZB A;  3HYP A;  2MMO A;  1TRS A;  1V57 A;  4N30 A;  1M9A A;  3KEB A;  1K3L A;  2NTO A;  4WEY A;  2R0C A;  3IHG A;  5B8A A;  3HHV A;  2GST A;  5IMA A;  2H0I A;  1YF1 A;  3G9B A;  4KUN A;  3UL3 A;  3BJ5 A;  1U88 A;  3TJF A;  4KW6 A;  3A5I A;  1FOV A;  3SWL A;  5KOW A;  5KEJ A;  5ECO B;  2VD1 A;  4HI7 A;  1YY7 A;  1VF3 A;  1OE7 A;  4HQZ A;  1XFL A;  4GLT A;  4POK A;  1A0R P;  3A5W A;  1EEM A;  3TRP A;  4CDO A;  2IMF A;  3PH9 A;  3FK8 A;  2X49 A;  4TXO A;  3V1W A;  4Z2T A;  4MF5 A;  2VCZ A;  4ZIL A;  2QC7 A;  2VLU A;  3HJP A;  1PSQ A;  5AIV A;  1SK1 A;  5B7C A;  3RDW A;  4V1A g;  3D21 A;  2H76 A;  1E6B A;  5C04 A;  4HSC X;  2IJY A;  2C0F A;  2WUL A;  2BJX A;  3TUE A;  3VPT A;  2K8V A;  1TTZ A;  3O6T A;  1QK8 A;  2G0F A;  2GTU A;  5HFI A;  3M1G A;  1KEB A;  3VWW A;  5IM9 A;  1CQH A;  2LKU A;  2P5R A;  1XWK A;  2DIZ A;  2H70 A;  3GUR A;  1Z7R A;  5DCG A;  2B6M A;  3GTU A;  3GYK A;  1XWA A;  3WYW A;  1M3I A;  4FYC A;  4MJE A;  1U87 A;  2RUF A;  22GS A;  1R4W A;  3QR6 A;  3L4N A;  1ZZY A;  4F82 A;  4LA1 A;  1C72 A;  1WOU A;  5ID2 A;  3PR8 A;  4F03 A;  3WT1 A;  4L5O A;  4Q5N A;  3APQ A;  2JAC A;  4TR1 A;  1TJD A;  3LFL A;  4GSS A;  1JLV A;  5DAL B;  5G31 A;  5IOW A;  3FYG A;  3ED3 A;  2MBS A;  2HZE A;  3LQ7 A;  5DAK A;  2PWJ A;  16GS A;  1NSW A;  4X4J A;  4JR6 A;  2M72 A;  3D4T A;  1EGO A;  1I9D A;  2N5B A;  4ZIJ A;  1VF2 A;  3NOF A;  3UAR A;  5DQS A;  3W6G A;  2C0E A;  3FMW A;  2CVB A;  3RHB A;  1GRX A;  1AQX A;  3KTB A;  1K0A A;  3HJM A;  3TKS E;  5D9X A;  3IC4 A;  1XWB A;  1K0O A;  1GLP A;  1SK0 A;  5D73 A;  1AQV A;  3ERW A;  3MWH A;  4ML1 A;  2VIM A;  3ME8 A;  2PUK C;  2OKA A;  4BPY A;  5ECM B;  3F9U A;  1TRW A;  1PGT A;  1OYJ A;  3D6I A;  5J9B A;  4K1F A;  4GST A;  5DDL A;  2CT6 A;  5COH A;  3CMI A;  1T7P B;  4ML6 A;  3RAZ A;  2K8S A;  3MYD A;  4HJ2 A;  1T4Y A;  2OAC A;  4XS6 A;  2GS3 A;  4HS1 A;  3EMX A;  1YDK A;  5ECP B;  4QQ7 A;  4N10 A;  1WP0 A;  4O5Q A;  2VM1 A;  2B5E A;  2P5Q A;  4O5U A;  1O6J A;  3F6F A;  5IPG A;  2OJL A;  3ERF A;  1A8L A;  1TU8 A;  2FGX A;  1K0N A;  2PVQ A;  2MZC A;  2H30 A;  2ZNM A;  3A2V A;  5D9V A;  4OCE A;  2VLT A;  4BL7 A;  3J7Y b;  4HUA A;  1M2D A;  1SJZ A;  1WWJ A;  3A2X A;  4XRA A;  3WGE A;  2GQM A;  3IV4 A;  1EOH A;  3U5R E;  1OC8 A;  4PUA A;  1PFO A;  3IR4 A;  5G5F A;  5A5K A;  3TRX A;  2ALB A;  2CX4 A;  3ERG A;  3H8Q A;  1YJ6 A;  3KIJ A;  3GA4 A;  4XIH A;  3ZYW A;  4EKZ A;  2DKI A;  2J9H A;  3HXS A;  3LJR A;  4NHZ A;  2KHP A;  1FVJ A;  1V98 A;  3NIV A;  5DBQ A;  5GSS A;  1SKW B;  9GSS A;  2K18 A;  3UIW A;  2JSY A;  1BJX A;  3HA9 A;  1FHE A;  1R7H A;  4PQH A;  4P3Y B;  2YWM A;  1XVQ A;  2QGV A;  5DAL A;  2FCH A;  6GSV A;  2R2J A;  4JRR A;  4KDX A;  1RQM A;  4PNG A;  1SL1 B;  1GUK A;  3LGC A;  1ZCP A;  4IQA A;  4EDZ A;  4JU5 A;  2FWF A;  5HR3 A;  4OFM A;  2X4A A;  1G7O A;  5LD0 A;  4KX4 A;  5IMV A;  4WF5 A;  4HZ2 A;  1WPI A;  3UMA A;  3LG6 A;  4JBB A;  1TXX A;  2LRT A;  5G5E A;  4MH3 A;  1BQ7 A;  1F9M A;  2GDR A;  1Z5Y E;  4K2X A;  4GXZ A;  4ECC A;  2GSR A;  1B9Y C;  1AAZ A;  3EYT A;  3ZVJ D;  1SL0 B;  1QQ2 A;  3H79 A;  1N2A A;  2GZP A;  2RM6 A;  2QKE A;  4BVY B;  1ACV A;  1TRV A;  1GSU A;  1GSQ A;  2Z9S A;  1GSE A;  2IME A;  2VM2 A;  1X9M B;  3CBU A;  3KZQ A;  4Z2U A;  4YQM A;  4XTS A;  2XPD A;  4IHU A;  4MCU A;  4KCE A;  2TIR A;  2CA8 A;  3OR5 A;  3VFI A;  1W4V A;  4BVX A;  3J7Y k;  4I2U A;  5H5R A;  2YV9 A;  4DSR A;  2DBC A;  1SK2 A;  4GRF A;  3FHK A;  3Q74 A;  2FA4 A;  3GL3 A;  1BED A;  3F3R A;  4MPF A;  3KCM A;  3ZFL A;  3QPM A;  5GAP D;  4OD7 A;  3R2Q A;  4GQC A;  2R0G A;  5HFG A;  3ZML A;  4EUY A;  4NV5 A;  3LSZ A;  1BX9 A;  3S9F A;  4EO3 A;  6GST A;  4YAV A;  4CY8 A;  1TK0 B;  3FW2 A;  3D0Z A;  4KA0 A;  1VGL A;  3HKR A;  4K0N A;  1XWC A;  5CNW A;  2M46 A;  4EDY A;  5JWR B;  3L9S A;  4KAE A;  4ISD A;  5AIS A;  2HRA A;  4MA9 A;  5D9T A;  5EY6 A;  2O7K A;  1GSY A;  3DXB A;  3DKS A;  5HFK A;  3I43 A;  2HLS A;  5IPH A;  5AN1 A;  3Q19 A;  2R37 A;  3HZ4 A;  4TOP A;  4G9H A;  2B7J A;  3GH9 A;  2DJK A;  1DBY A;  3G7Y A;  3VI7 A;  4GQF A;  2HT9 A;  2C0G A;  3C1R A;  4A5P A;  1M9B A;  3FRC A;  1GTB A;  4G0K A;  4ECJ A;  1MDJ A;  2MBT A;  3KP8 A;  1H4O A;  3VUR A;  3TB2 A;  2B5X A;  3IAM 2;  1JZD A;  2P0G A;  3ZL5 A;  1T00 A;  3F63 A;  1GH2 A;  1JHB A;  4AGS A;  1XW6 A;  4I5Q A;  5DVB A;  5KN0 A;  2HNL A;  4Z7X A;  1FOH A;  3VI5 A;  5ECR B;  4YAP A;  1YEP A;  1PL2 A;  1G0T A;  1XPV A;  2EIO A;  2L4C A;  2ZUP A;  3VPQ A;  5IIZ A;  2WB9 A;  1HYU A;  4OFT A;  3MDK A;  1R5A A;  2H75 A;  5A4V A;  5IO2 A;  1SJI A;  4MJC A;  1YKA A;  3L9U A;  3IAS 2;  4G10 A;  3BCK A;  1RK4 A;  4HEA 2;  5B8B A;  3LXT A;  1O73 A;  3CYN A;  1ZOF A;  1K0C A;  2FWH A;  1SL2 B;  1O8X A;  2R0P A;  2HZE B;  20GS A;  4NXI A;  1OKT A;  3F0I A;  3WD6 A;  4N0V A;  4BVY A;  2MMA A;  3EPT A;  4WBJ A;  1GTI A;  4ZL8 A;  1PD2 1;  1OVN A;  2V6O A;  3L9V A;  3D4M A;  1XW5 A;  4KSO A;  1UN2 A;  4V1A p;  6GSS A;  2J23 A;  3F6D A;  1A2J A;  2GZZ A;  2DJ2 A;  1TRU A;  1DE2 A;  5CYY A;  3I69 A;  1DUG A;  1ZYQ B;  3QAG A;  1MDI A;  2A2P A;  4LL4 B;  3O76 A;  3GKN A;  2C4J A;  1NHO A;  3TRQ A;  1JZW A;  2B7K A;  4OO4 A;  2H1D A;  2HRK A;  2L5O A;  4NMU A;  1XG8 A;  2M80 A;  1X0R A;  3U6V A;  4WKW A;  3F4R A;  1O85 A;  3GFK A;  4YQU A;  5KN1 A;  3HCZ A;  2LJK A;  3O3T A;  1SU9 A;  1GNW A;  2H6Z A;  4X1U A;  2PER A;  2LEG A;  1GTU A;  4HZ4 A;  1GUH A;  2CV4 A;  4K8M A;  2FD3 A;  2B1K A;  2IWT A;  5H5Q A;  3F4T A;  2VCW A;  1AQW A;  4JED A;  3CTF A;  2P31 A;  3IXR A;  1SD9 A;  2B1L A;  4KB3 A;  1FB6 A;  1GNE A;  1AUC A;  2FWE A;  2A4V A;  3LXZ A;  1PKW A;  4BL7 B;  1EV9 A;  1PA3 A;  3IK7 A;  1M7T A;  2B5Y A;  4NWY A;  2KUC A;  2VL3 A;  1X5E A;  2XBQ A;  1J0F A;  4POM A;  1XXU A;  1JZO A;  8GSS A;  3SBC A;  2LQQ A;  5CRD A;  2L59 A;  3M3M A;  2VL9 A;  3G7J A;  1MTC A;  2E2M A;  3IRA A;  1Z6N A;  5D96 A;  4EE0 A;  2I81 A;  5DQY A;  4G0L A;  2PN8 A;  3CSJ A;  1A24 A;  3BCI A;  2ES7 A;  4KGI A;  4POB A;  2N5A A;  1VF4 A;  4HU9 A;  6GSX A;  2WDU A;  1A0F A;  5B6M A;  2IFQ B;  6GSW A;  2I3Y A;  4K6X A;  4E8H A;  2R5G A;  2N5F A;  2C80 A;  2HYX A;  1YKC A;  4MZC A;  5CRW A;  1PMT A;  3FZ5 A;  2X8H A;  2XPE A;  2YNX A;  2DKH A;  5A4U A;  3UEM A;  4PNF A;  4Z2R A;  2HSM A;  4I97 A;  2ON7 A;  1S3D A;  4O7H A;  5J3R A;  3GRX A;  2K6V A;  4F0B A;  4N0Z A;  2H1G A;  2CVK A;  4ACS A;  5JCU A;  2HRF A;  1ON4 A;  4PX1 A;  4MDC A;  3GKX A;  2ON5 A;  1SJ6 A;  3BOA A;  4F2I A;  4OFN A;  1OAZ A;  3TJG A;  3UVH A;  17GS A;  3TKP A;  1M99 A;  1WIK A;  1GSF A;  3KJY A;  1HNA A;  3FEU A;  2PBJ A;  1KNG A;  4FH8 A;  4K7I A;  5GZZ B;  4PUR A;  2C0D A;  4IKH A;  1U3A A;  2V1M A;  2V32 A;  3HJO A;  3RBT A;  2MYG A;  4K0G A;  1A23 A;  3MSZ A;  1WE0 A;  2E0Q A;  2GQL A;  5HQP A;  4XS4 B;  2MMZ A;  1OKD A;  1TP9 A;  2CZ3 A;  4FIW A;  4ULX A;  4TR3 A;  2HRN A;  2I9H A;  2FHE A;  3TOT A;  1U6T A;  2RM5 A;  1T8E B;  1Z3E A;  1PL1 A;  1GWC A;  1HNC A;  5ELA A;  5EL8 A;  2X64 A;  3HD5 A;  4JR4 A;  4OMV A;  3C8E A;  3QOU A;  2XC2 A;  5E59 A;  1ZYN A;  4ZBB A;  2H0G A;  4JE1 A;  4BVX B;  3EMP A;  2VD0 A;  2LJA A;  3CRT A;  4MF6 A;  1UA5 A;  3HZ8 A;  3GST A;  1NHY A;  2AB6 A;  5JCG A;  4J56 E;  4POL A;  3GN3 A;  2H66 A;  4GTU A;  3ZMK A;  1TI3 A;  1Z6M A;  5G30 A;  4YKG A;  3LEF A;  1XCC A;  1PKZ A;  4CW9 A;  2QA1 A;  1O7U A;  3GUS A;  4V2L A;  3RPN A;  3EWL A;  3KH7 A;  2H74 A;  3ZRE A;  1OC9 B;  1G7E A;  1XWG A;  3VLN A;  3ZIJ A;  1B48 A;  2H6Y A;  1EZK A;  5CO3 A;  4FO5 A;  1LU4 A;  4LL1 B;  4PUF C;  4I8B A;  2V2G A;  2H0H A;  3GNJ A;  2X8C A;  1A2L A;  3I9V 2;  2YJH A;  3UVT A;  2VL2 A;  5FHI A;  3N9J A;  5CAX A;  4HOJ A;  5INY A;  1YQ1 A;  1GLQ A;  4AJ6 A;  3ZZX A;  1QXH A;  2WZ9 A;  1A8Y A;  2A2S A;  4MMM A;  2IFQ A;  4KSM A;  3EIN A;  5LNK e;  1PN9 A;  4XS1 A;  3ZIT A;  3APO A;  3CTG A;  4XCS A;  3IA1 A;  2YZH A;  4MPG A;  2H1B A;  3QMX A;  4AF2 A;  3VK9 A;  1Z7P A;  1Y25 A;  1LJR A;  1B8X A;  2VAF A;  2MMN A;  4LMV A;  1V58 A;  2VLV A;  4HDE A;  4IN0 A;  3CSI A;  2FUG 2;  2PPT A;  3DWV A;  1KBN A;  1PX6 A;  3RPP A;  4OCF A;  1AXD A;  5D9W A;  4DSS B;  3M8N A;  2G2Q A;  2RII A;  4ILF A;  1K3Y A;  2VL2 C;  3E9J B;  3DD3 A;  5G2Z A;  4D73 B;  2FA8 A;  1IYH A;  2OE1 A;  4XS4 A;  4NV2 A;  5IMC A;  4ZB6 A;  2LV3 A;  4KE3 A;  2VCX A;  4JZQ A;  2C3T A;  2LTK A;  4IP1 A;  2PMT A;  5AGY A;  1M3J A;  1T3B A;  5ECH B;  4ID0 A;  4WET A;  3WGX A;  7GSS A;  1F37 A;  3A3T A;  3GKK A;  1TK8 B;  5G1K A;  1QGV A;  2GT5 A;  2WJU A;  2DJ1 A;  2L6D A;  4DEJ A;  3APS A;  3C1S A;  2EC4 A;  3JCM L;  4EF0 A;  2C8U A;  4FYU A;  2A4H A;  4IQ1 A;  4OO5 A;  5F0G A;  4BWS A;  2H71 A;  2RUE A;  2H73 A;  4O5R A;  4IW9 A;  3P90 A;  5IMF A;  2PU9 C;  2OE3 A;  4I6X A;  5DJL A;  1SKR B;  4RUV A;  1SKS B;  3IOS A;  2IN3 A;  2VCT A;  1OC9 A;  2X99 A;  1WJK A;  3FZ4 A;  4MJA A;  5KOX A;  3FKF A;  1K0B A;  4GWR A;  5CRE A;  3K8N A;  2AV4 A;  4WR4 A; 
#chains in the Genus database with same CATH homology
 3D22 A;  2AHE A;  2F51 A;  1M2B A;  4V2M A;  2ZCT A;  3DVX A;  4E8E A;  4QL7 A;  4MZW A;  3LOR A;  4TKY A;  4V2N A;  3ZIV A;  2XHF A;  2LQO A;  4Q5F A;  1WRY A;  3KMN A;  2H1A A;  1OE8 A;  4MF7 A;  3ZFB A;  2F8F A;  14GS A;  2CVD A;  2YWO A;  1E2Y A;  13GS A;  3EU3 A;  5J9C A;  3WGD A;  2OA7 A;  4GSN A;  2H19 A;  1UC7 A;  1ILO A;  2YWI A;  3C73 A;  1J08 A;  3GIX A;  1GP1 A;  3MIX A;  4AJ8 A;  2H01 A;  3Q18 A;  2NVL A;  3CRU A;  1EEJ A;  2IMK A;  1YEX A;  1THO A;  2NPB A;  4MK3 A;  4MNN A;  2CAI A;  3LYP A;  4KH7 A;  2JZS A;  2TRC P;  1CQG A;  4DSS A;  3QD9 A;  4KND A;  3LYK A;  3FY7 A;  2KLX A;  5D93 A;  1JFU A;  4EXJ A;  3VWV A;  4D73 A;  3GX8 A;  3H4K A;  1XOA A;  1GL8 A;  2C1Y A;  3US3 A;  4EVM A;  1A2M A;  1K3O A;  5JWQ B;  2DJ3 A;  1SEN A;  3UAP A;  4N11 A;  1HNB A;  1GUL A;  4NPB A;  1ZYP A;  4IGJ A;  3FR3 A;  3GHA A;  1O8W A;  1XIY A;  5ECS A;  3F3Q A;  1GTA A;  3GSS A;  3GMF A;  1ERU A;  3UJ1 A;  1BG5 A;  1ERT A;  2LRN A;  1B4Q A;  1ZL9 A;  3KD0 A;  2HSY A;  2CX3 A;  2GVP A;  2E2G A;  1FAA A;  3DRN A;  2X8G A;  1AIU A;  1PN0 A;  2WGR A;  3HDC A;  11GS A;  3TKS A;  10GS A;  2HI7 A;  4XRD A;  4ZXG A;  2YAN A;  4IS0 A;  5IMZ A;  3M9K A;  4WF4 A;  18GS A;  2WRT A;  5FWG A;  2D2Z A;  3GV1 A;  2LS5 A;  5CRH A;  1F3A A;  5KN3 A;  1G6Y A;  3QCP A;  5FT3 A;  2H72 A;  1OC3 A;  4HQS A;  1AW9 A;  3IE3 A;  2OAD A;  2IIY A;  3QDN A;  2LNS A;  2JZT A;  5GAN D;  3UBK A;  4TR4 A;  2GGT A;  3A2W A;  4EC0 A;  1M0U A;  5E4W A;  1USB A;  1GUM A;  2L4Q A;  2VCQ A;  1V40 A;  3ZLP A;  2GSS A;  5L71 A;  1K0M A;  2VOC A;  5BRT A;  2LNT A;  2YCD A;  4O92 A;  2CQ9 A;  4RQX A;  2XBI A;  5IMD A;  4TN8 A;  1TU7 A;  1PRX A;  4G19 A;  3DVW A;  4HU7 A;  3FR6 A;  4MLY A;  2NBS A;  1KTE A;  3TJB A;  3H93 A;  1V2A A;  1ERV A;  4K7O A;  3TKS C;  2HFD A;  1K0D A;  1ML6 A;  3HVV A;  5CRG A;  4GCI A;  12GS A;  1ZYE A;  6GSY A;  1B4P A;  2IMD A;  3E0U A;  5HR2 A;  3TKR A;  3KH9 A;  2DSA A;  2AYT A;  2L6C A;  2YN1 A;  3M0F A;  4ZBA A;  3W8J A;  4ICY A;  1TI1 A;  2OBI A;  1Q98 A;  2YJ7 A;  1GSD A;  5DJM A;  3DYR A;  5AIX A;  4J57 E;  1XZO A;  2GSQ A;  2YV7 A;  3P2A A;  3E3E A;  3BD2 A;  3F8U A;  5A4W A;  1FW1 A;  5C00 A;  5ABR A;  3N5O A;  3C71 A;  1XOB A;  2KP2 A;  4L5L A;  2FY6 A;  2O87 A;  1HD2 A;  3IDV A;  1QFN A;  1HQO A;  2RLI A;  1SYX A;  1EP8 A;  1O81 A;  2IPA A;  2C3N A;  5CP1 A;  2HXK A;  4AJ7 A;  1Q4J A;  5IQY A;  2CZ2 A;  2I4A A;  2OBK A;  1X5D A;  1BAY A;  2R3X A;  4EL1 A;  4ZB9 A;  1GSS A;  2KOK A;  4YQV A;  4OWY A;  4FQU A;  4L0U A;  1TOF A;  3TOU A;  3AY8 A;  4TXV A;  3ME7 A;  3M9J A;  1F3B A;  3TCO A;  2AAW A;  1ERW A;  5HR0 A;  3GH6 A;  4MJB A;  4TVE A;  3GX0 A;  4RI7 A;  3HY2 A;  3P8W A;  4X0X A;  3P7X A;  2F3M A;  4WXT A;  2R6K A;  2AUV A;  1VF1 A;  4DSQ A;  3H1N A;  1URM A;  2YWN A;  5F05 A;  5JCW A;  2DLX A;  4KF9 A;  1NW2 A;  1TK5 B;  2GT6 A;  2JZR A;  2HSH A;  3GL5 A;  5DCH A;  3LW9 A;  2DML A;  3QAV A;  4EIQ A;  4NAX A;  1EV4 A;  2DJ0 A;  1XBS A;  2O85 A;  1JLW A;  4PGT A;  4PQI A;  1Y6E A;  3PIN A;  1PQN A;  4Q5R A;  2TRX A;  1EP7 A;  3QAW A;  3WT2 A;  2E7P A;  1MD3 A;  4YH2 A;  1M2A A;  2JSZ A;  3FZ9 A;  2PGT A;  1TKD B;  4F9Z A;  2GQK A;  4K9Z A;  5ECQ B;  3KXO A;  3QFA C;  1U3I A;  5J4U A;  2O89 A;  1BYE A;  4ECB A;  2F8A A;  2QSI A;  1FB0 A;  1F6M C;  2EIQ A;  1FO5 A;  4ZB8 A;  5J41 A;  4USS A;  1S3C A;  2VUP A;  1S3A A;  3PGT A;  1VRS D;  3G7I A;  4K2D A;  3NZN A;  4G2E A;  5D8I A;  3DEX A;  1R26 A;  3F4S A;  4KDY A;  4LLR A;  2REM A;  2H6X A;  4EIP A;  2B3S A;  3VWX A;  1PX7 A;  1DE1 A;  2WCI A;  4K5R A;  4XHM A;  3VWU A;  1TW9 A;  5EPF A;  2PVO C;  4TRX A;  4MP4 A;  1XW9 A;  4Q5Q A;  4LMW A;  2K9F A;  3L0H A;  4O32 A;  3Q6O A;  1X5C A;  5F06 A;  1G6W A;  4IJI A;  1WMJ A;  2OE0 A;  3ISO A;  3R3E A;  2FLS A;  1I5G A;  4WBR D;  3HVS A;  4J2F A;  2JU5 A;  1YZX A;  5J5N A;  1ZGN A;  2VO4 A;  2YPM A;  3TDG A;  4IEL A;  3DML A;  1MEK A;  3W8S A;  4BA7 A;  1SD8 A;  3CXG A;  5HR1 A;  1DSB A;  4KDU A;  1ST9 A;  1TDI A;  1F2E A;  1ABA A;  2IL3 A;  2HE3 A;  1LBK A;  1EGR A;  4KCA A;  4YKF A;  4IVF A;  3EUR A;  1B9X C;  2A2R A;  2DC5 A;  2H8L A;  2DMM A;  4CY6 A;  3QFB C;  5BMU A;  2F9S A;  4L8E A;  2KP1 A;  3KGK A;  4PTS A;  4DVC A;  1MD4 A;  4IBP A;  3TGZ A;  1IYI A;  4ZBD A;  3TKQ A;  3IHQ A;  2LST A;  2L5L A;  2O8V B;  5ELG A;  4GF0 A;  5H5S A;  3I6A A;  3MNG A;  1NM3 A;  2YZU A;  2UZ8 A;  3DIE A;  1J9B A;  4K7N A;  4WR5 A;  4RI6 A;  2WFC A;  1RW1 A;  1FG4 A;  5ECI B;  1EOG A;  3ZRD A;  3RHC A;  1UVZ A;  2I1U A;  1XVW A;  1AC1 A;  5JWO B;  3IK9 A;  3TJJ A;  4F0C A;  3GKM A;  3UOM A;  6GSU A;  3DGQ A;  4RQR A;  3EC3 A;  5F07 A;  3EU4 A;  1Z9H A;  3HVX A;  2GLR A;  4TR0 A;  2GZY A;  3L78 A;  2YOI A;  2BTO T;  4L0W A;  3EVI A;  2LJR A;  4H86 A;  1N8J A;  3EE2 A;  5IOX A;  2FNO A;  4CHS A;  3UBL A;  1QUW A;  3KP9 A;  4I2T A;  3KTL A;  5LCZ A;  1SYR A;  4TW5 A;  3CSH A;  3KM6 A;  5ENU A;  3PPU A;  1R5P A;  5ECL B;  2V6K A;  4TXO B;  1FVK A;  5ECK B;  2VCV A;  2IMI A;  2JL4 A;  2NDO A;  4ECI A;  2WS2 A;  3IC8 A;  4IP6 A;  5F8B A;  2LRC A;  1QMV A;  4BWQ A;  2LUS A;  1JZR A;  1YF0 A;  1THX A;  2YP6 A;  4HJM A;  4IJ3 A;  2L57 A;  4MAB A;  2QA2 A;  1H75 A;  5B6N A;  2FWG A;  1EWX A;  1MDK A;  4X43 A;  1T1V A;  2CAQ A;  3ZTL A;  3TJK A;  3C7M A;  4MH2 A;  3GTU B;  3MAK A;  4ZL9 A;  5ECN B;  4NHW A;  4ZL7 A;  5IO0 A;  19GS A;  4PQ1 A;  2DJJ A;  3LWA A;  1T4Z A;  2R4V A;  4FYB A;  5KN2 A;  1X9S B;  5ID2 B;  1X9W B;  3KMO A;  2DIY A;  2V41 A;  5EVO A;  1W89 A;  4QL9 A;  1ZMA A;  4TR1 B;  2HZF A;  2BMX A;  5G1L A;  4G0I A;  5GST A;  3FR9 A;  3BBY A;  3IBH A;  4PXO A;  5DAK B;  3ZVJ A;  3FZA A;  2EIR A;  3IPZ A;  2JAD A;  4K5S A;  3D5J A;  2AJQ B;  1V9W A;  2C3Q A;  4MZB A;  3HYP A;  2MMO A;  1TRS A;  1V57 A;  4N30 A;  1M9A A;  3KEB A;  1K3L A;  2NTO A;  4WEY A;  2R0C A;  3IHG A;  5B8A A;  3HHV A;  2GST A;  5IMA A;  2H0I A;  1YF1 A;  3G9B A;  4KUN A;  3UL3 A;  3BJ5 A;  1U88 A;  3TJF A;  4KW6 A;  3A5I A;  1FOV A;  3SWL A;  5KOW A;  5KEJ A;  5ECO B;  2VD1 A;  4HI7 A;  1YY7 A;  1VF3 A;  1OE7 A;  4HQZ A;  1XFL A;  4GLT A;  4POK A;  1A0R P;  3A5W A;  1EEM A;  3TRP A;  4CDO A;  2IMF A;  3PH9 A;  3FK8 A;  2X49 A;  4TXO A;  3V1W A;  4Z2T A;  4MF5 A;  2VCZ A;  4ZIL A;  2QC7 A;  2VLU A;  3HJP A;  1PSQ A;  5AIV A;  1SK1 A;  5B7C A;  3RDW A;  4V1A g;  3D21 A;  2H76 A;  1E6B A;  5C04 A;  2IJY A;  2C0F A;  2WUL A;  2BJX A;  3TUE A;  3VPT A;  2K8V A;  1TTZ A;  3O6T A;  1QK8 A;  2G0F A;  2GTU A;  5HFI A;  3M1G A;  1KEB A;  3VWW A;  5IM9 A;  1CQH A;  2LKU A;  2P5R A;  1XWK A;  2DIZ A;  2H70 A;  3GUR A;  1Z7R A;  5DCG A;  2B6M A;  3GTU A;  3GYK A;  1XWA A;  3WYW A;  4FYC A;  4MJE A;  1U87 A;  2RUF A;  22GS A;  1R4W A;  3QR6 A;  3L4N A;  1ZZY A;  4F82 A;  4LA1 A;  1C72 A;  1WOU A;  5ID2 A;  3PR8 A;  4F03 A;  3WT1 A;  4L5O A;  4Q5N A;  3APQ A;  2JAC A;  4TR1 A;  1TJD A;  3LFL A;  4GSS A;  1JLV A;  5DAL B;  5G31 A;  5IOW A;  3FYG A;  3ED3 A;  2MBS A;  2HZE A;  3LQ7 A;  5DAK A;  2PWJ A;  16GS A;  1NSW A;  4X4J A;  4JR6 A;  2M72 A;  3D4T A;  1EGO A;  1I9D A;  2N5B A;  4ZIJ A;  1VF2 A;  3NOF A;  3UAR A;  5DQS A;  3W6G A;  2C0E A;  3FMW A;  2CVB A;  3RHB A;  1GRX A;  1AQX A;  3KTB A;  1K0A A;  3HJM A;  3TKS E;  5D9X A;  3IC4 A;  1XWB A;  1K0O A;  1GLP A;  1SK0 A;  5D73 A;  1AQV A;  3ERW A;  3MWH A;  4ML1 A;  2VIM A;  3ME8 A;  2PUK C;  2OKA A;  4BPY A;  5ECM B;  3F9U A;  1TRW A;  1PGT A;  1OYJ A;  3D6I A;  5J9B A;  4K1F A;  4GST A;  5DDL A;  2CT6 A;  5COH A;  3CMI A;  1T7P B;  4ML6 A;  3RAZ A;  2K8S A;  3MYD A;  4HJ2 A;  1T4Y A;  2OAC A;  4XS6 A;  2GS3 A;  4HS1 A;  3EMX A;  1YDK A;  5ECP B;  4QQ7 A;  4N10 A;  1WP0 A;  4O5Q A;  2VM1 A;  2B5E A;  2P5Q A;  4O5U A;  1O6J A;  3F6F A;  5IPG A;  2OJL A;  3ERF A;  1A8L A;  1TU8 A;  2FGX A;  1K0N A;  2PVQ A;  2MZC A;  2H30 A;  2ZNM A;  3A2V A;  5D9V A;  4OCE A;  2VLT A;  4BL7 A;  3J7Y b;  4HUA A;  1M2D A;  1SJZ A;  1WWJ A;  3A2X A;  4XRA A;  3WGE A;  2GQM A;  3IV4 A;  1EOH A;  3U5R E;  1OC8 A;  4PUA A;  3IR4 A;  5G5F A;  5A5K A;  3TRX A;  2ALB A;  2CX4 A;  3ERG A;  3H8Q A;  1YJ6 A;  3KIJ A;  3GA4 A;  4XIH A;  3ZYW A;  4EKZ A;  2DKI A;  2J9H A;  3HXS A;  3LJR A;  4NHZ A;  2KHP A;  1FVJ A;  1V98 A;  3NIV A;  5DBQ A;  5GSS A;  1SKW B;  9GSS A;  2K18 A;  3UIW A;  2JSY A;  1BJX A;  3HA9 A;  1FHE A;  1R7H A;  4PQH A;  4P3Y B;  2YWM A;  1XVQ A;  2QGV A;  5DAL A;  2FCH A;  6GSV A;  2R2J A;  4JRR A;  4KDX A;  1RQM A;  4PNG A;  1SL1 B;  1GUK A;  3LGC A;  1ZCP A;  4IQA A;  4EDZ A;  4JU5 A;  2FWF A;  5HR3 A;  4OFM A;  2X4A A;  1G7O A;  5LD0 A;  4KX4 A;  5IMV A;  4WF5 A;  4HZ2 A;  1WPI A;  3UMA A;  3LG6 A;  4JBB A;  1TXX A;  2LRT A;  5G5E A;  4MH3 A;  1BQ7 A;  1F9M A;  2GDR A;  1Z5Y E;  4K2X A;  4GXZ A;  4ECC A;  2GSR A;  1B9Y C;  1AAZ A;  3EYT A;  3ZVJ D;  1SL0 B;  1QQ2 A;  3H79 A;  1N2A A;  2GZP A;  2RM6 A;  2QKE A;  4BVY B;  1ACV A;  1TRV A;  1GSU A;  1GSQ A;  2Z9S A;  1GSE A;  2IME A;  2VM2 A;  1X9M B;  3CBU A;  3KZQ A;  4Z2U A;  4YQM A;  4XTS A;  2XPD A;  4IHU A;  4MCU A;  4KCE A;  2TIR A;  2CA8 A;  3OR5 A;  3VFI A;  1W4V A;  4BVX A;  3J7Y k;  4I2U A;  5H5R A;  2YV9 A;  4DSR A;  2DBC A;  1SK2 A;  4GRF A;  3FHK A;  3Q74 A;  2FA4 A;  3GL3 A;  1BED A;  3F3R A;  4MPF A;  3KCM A;  3ZFL A;  3QPM A;  5GAP D;  4OD7 A;  3R2Q A;  4GQC A;  2R0G A;  5HFG A;  3ZML A;  4EUY A;  4NV5 A;  3LSZ A;  1BX9 A;  3S9F A;  4EO3 A;  6GST A;  4YAV A;  4CY8 A;  1TK0 B;  3FW2 A;  3D0Z A;  4KA0 A;  1VGL A;  3HKR A;  4K0N A;  1XWC A;  5CNW A;  2M46 A;  4EDY A;  5JWR B;  3L9S A;  4KAE A;  4ISD A;  5AIS A;  2HRA A;  4MA9 A;  5D9T A;  5EY6 A;  2O7K A;  1GSY A;  3DXB A;  3DKS A;  5HFK A;  3I43 A;  2HLS A;  5IPH A;  5AN1 A;  3Q19 A;  2R37 A;  3HZ4 A;  4TOP A;  4G9H A;  2B7J A;  3GH9 A;  2DJK A;  1DBY A;  3G7Y A;  3VI7 A;  4GQF A;  2HT9 A;  2C0G A;  3C1R A;  4A5P A;  1M9B A;  3FRC A;  1GTB A;  4G0K A;  4ECJ A;  1MDJ A;  2MBT A;  3KP8 A;  1H4O A;  3VUR A;  3TB2 A;  2B5X A;  3IAM 2;  1JZD A;  2P0G A;  3ZL5 A;  1T00 A;  3F63 A;  1GH2 A;  1JHB A;  4AGS A;  1XW6 A;  4I5Q A;  5DVB A;  5KN0 A;  2HNL A;  4Z7X A;  1FOH A;  3VI5 A;  5ECR B;  4YAP A;  1YEP A;  1PL2 A;  1G0T A;  1XPV A;  2EIO A;  2L4C A;  2ZUP A;  3VPQ A;  5IIZ A;  2WB9 A;  1HYU A;  4OFT A;  3MDK A;  1R5A A;  2H75 A;  5A4V A;  5IO2 A;  1SJI A;  4MJC A;  1YKA A;  3L9U A;  3IAS 2;  4G10 A;  3BCK A;  1RK4 A;  4HEA 2;  5B8B A;  3LXT A;  1O73 A;  3CYN A;  1ZOF A;  1K0C A;  2FWH A;  1SL2 B;  1O8X A;  2R0P A;  2HZE B;  20GS A;  4NXI A;  1OKT A;  3F0I A;  3WD6 A;  4N0V A;  4BVY A;  2MMA A;  3EPT A;  4WBJ A;  1GTI A;  4ZL8 A;  1PD2 1;  1OVN A;  2V6O A;  3L9V A;  3D4M A;  1XW5 A;  4KSO A;  1UN2 A;  4V1A p;  6GSS A;  2J23 A;  3F6D A;  1A2J A;  2GZZ A;  2DJ2 A;  1TRU A;  1DE2 A;  5CYY A;  3I69 A;  1DUG A;  1ZYQ B;  3QAG A;  1MDI A;  2A2P A;  4LL4 B;  3O76 A;  3GKN A;  2C4J A;  1NHO A;  3TRQ A;  1JZW A;  2B7K A;  4OO4 A;  2H1D A;  2HRK A;  2L5O A;  4NMU A;  2M80 A;  1X0R A;  3U6V A;  4WKW A;  3F4R A;  1O85 A;  3GFK A;  4YQU A;  5KN1 A;  3HCZ A;  2LJK A;  3O3T A;  1SU9 A;  1GNW A;  2H6Z A;  4X1U A;  2PER A;  2LEG A;  1GTU A;  4HZ4 A;  1GUH A;  2CV4 A;  4K8M A;  2FD3 A;  2B1K A;  2IWT A;  5H5Q A;  3F4T A;  2VCW A;  1AQW A;  4JED A;  3CTF A;  2P31 A;  3IXR A;  1SD9 A;  2B1L A;  4KB3 A;  1FB6 A;  1GNE A;  1AUC A;  2FWE A;  2A4V A;  3LXZ A;  1PKW A;  4BL7 B;  1EV9 A;  1PA3 A;  3IK7 A;  1M7T A;  2B5Y A;  4NWY A;  2KUC A;  2VL3 A;  1X5E A;  2XBQ A;  1J0F A;  4POM A;  1XXU A;  1JZO A;  8GSS A;  3SBC A;  2LQQ A;  5CRD A;  2L59 A;  3M3M A;  2VL9 A;  3G7J A;  1MTC A;  2E2M A;  3IRA A;  1Z6N A;  5D96 A;  4EE0 A;  2I81 A;  5DQY A;  4G0L A;  2PN8 A;  3CSJ A;  1A24 A;  3BCI A;  2ES7 A;  4KGI A;  4POB A;  2N5A A;  1VF4 A;  4HU9 A;  6GSX A;  2WDU A;  1A0F A;  5B6M A;  2IFQ B;  6GSW A;  2I3Y A;  4K6X A;  4E8H A;  2R5G A;  2N5F A;  2C80 A;  2HYX A;  1YKC A;  4MZC A;  5CRW A;  1PMT A;  3FZ5 A;  2X8H A;  2XPE A;  2YNX A;  2DKH A;  5A4U A;  3UEM A;  4PNF A;  4Z2R A;  2HSM A;  4I97 A;  2ON7 A;  1S3D A;  4O7H A;  5J3R A;  3GRX A;  2K6V A;  4F0B A;  4N0Z A;  2H1G A;  2CVK A;  4ACS A;  5JCU A;  2HRF A;  1ON4 A;  4PX1 A;  4MDC A;  3GKX A;  2ON5 A;  1SJ6 A;  3BOA A;  4F2I A;  4OFN A;  1OAZ A;  3TJG A;  3UVH A;  17GS A;  3TKP A;  1M99 A;  1WIK A;  1GSF A;  3KJY A;  1HNA A;  3FEU A;  2PBJ A;  1KNG A;  4FH8 A;  4K7I A;  5GZZ B;  4PUR A;  2C0D A;  4IKH A;  1U3A A;  2V1M A;  2V32 A;  3HJO A;  3RBT A;  2MYG A;  4K0G A;  1A23 A;  3MSZ A;  1WE0 A;  2E0Q A;  2GQL A;  5HQP A;  4XS4 B;  2MMZ A;  1OKD A;  1TP9 A;  2CZ3 A;  4FIW A;  4ULX A;  4TR3 A;  2HRN A;  2I9H A;  2FHE A;  3TOT A;  1U6T A;  2RM5 A;  1T8E B;  1Z3E A;  1PL1 A;  1GWC A;  1HNC A;  5ELA A;  5EL8 A;  2X64 A;  3HD5 A;  4JR4 A;  4OMV A;  3C8E A;  3QOU A;  2XC2 A;  5E59 A;  1ZYN A;  4ZBB A;  2H0G A;  4JE1 A;  4BVX B;  3EMP A;  2VD0 A;  2LJA A;  3CRT A;  4MF6 A;  1UA5 A;  3HZ8 A;  3GST A;  1NHY A;  2AB6 A;  5JCG A;  4J56 E;  4POL A;  3GN3 A;  2H66 A;  4GTU A;  3ZMK A;  1TI3 A;  1Z6M A;  5G30 A;  4YKG A;  3LEF A;  1XCC A;  1PKZ A;  4CW9 A;  2QA1 A;  1O7U A;  3GUS A;  4V2L A;  3RPN A;  3EWL A;  3KH7 A;  2H74 A;  3ZRE A;  1OC9 B;  1G7E A;  1XWG A;  3VLN A;  3ZIJ A;  1B48 A;  2H6Y A;  1EZK A;  5CO3 A;  4FO5 A;  1LU4 A;  4LL1 B;  4PUF C;  4I8B A;  2V2G A;  2H0H A;  3GNJ A;  2X8C A;  1A2L A;  3I9V 2;  2YJH A;  3UVT A;  2VL2 A;  5FHI A;  3N9J A;  5CAX A;  4HOJ A;  5INY A;  1YQ1 A;  1GLQ A;  4AJ6 A;  3ZZX A;  1QXH A;  2WZ9 A;  1A8Y A;  2A2S A;  4MMM A;  2IFQ A;  4KSM A;  3EIN A;  5LNK e;  1PN9 A;  4XS1 A;  3ZIT A;  3APO A;  3CTG A;  4XCS A;  3IA1 A;  2YZH A;  4MPG A;  2H1B A;  3QMX A;  4AF2 A;  3VK9 A;  1Z7P A;  1Y25 A;  1LJR A;  1B8X A;  2VAF A;  2MMN A;  4LMV A;  1V58 A;  2VLV A;  4HDE A;  4IN0 A;  3CSI A;  2FUG 2;  2PPT A;  3DWV A;  1KBN A;  1PX6 A;  3RPP A;  4OCF A;  1AXD A;  5D9W A;  4DSS B;  3M8N A;  2G2Q A;  2RII A;  4ILF A;  1K3Y A;  2VL2 C;  3E9J B;  3DD3 A;  5G2Z A;  4D73 B;  2FA8 A;  1IYH A;  2OE1 A;  4XS4 A;  4NV2 A;  5IMC A;  4ZB6 A;  2LV3 A;  4KE3 A;  2VCX A;  4JZQ A;  2C3T A;  2LTK A;  4IP1 A;  2PMT A;  5AGY A;  1T3B A;  5ECH B;  4ID0 A;  4WET A;  3WGX A;  7GSS A;  1F37 A;  3A3T A;  3GKK A;  1TK8 B;  5G1K A;  1QGV A;  2GT5 A;  2WJU A;  2DJ1 A;  2L6D A;  4DEJ A;  3APS A;  3C1S A;  2EC4 A;  3JCM L;  4EF0 A;  2C8U A;  4FYU A;  2A4H A;  4IQ1 A;  4OO5 A;  5F0G A;  4BWS A;  2H71 A;  2RUE A;  2H73 A;  4O5R A;  4IW9 A;  3P90 A;  5IMF A;  2PU9 C;  2OE3 A;  4I6X A;  5DJL A;  1SKR B;  4RUV A;  1SKS B;  3IOS A;  2IN3 A;  2VCT A;  1OC9 A;  2X99 A;  1WJK A;  3FZ4 A;  4MJA A;  5KOX A;  3FKF A;  1K0B A;  4GWR A;  5CRE A;  3K8N A;  2AV4 A;  4WR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...