3KH9A

Crystal structure of the periplasmic soluble domain of oxidized ccmg from pseudomonas aeruginosa
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
155
structure length
155
Chain Sequence
RGSHMLDPSELPSALIGKPFPAFDLPSVQDPARRLTEADLKGKPALVNVWGTWCPSCRVEHPELTRLAEQGVVIYGINYKDDNAAAIKWLNELHNPYLLSISDADGTLGLDLGVYGAPETYLIDKQGIIRHKIVGVVDQKVWREQLAPLYQQLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol:disulfide interchange protein dsbE
publication title Structural and functional characterization of CcmG from Pseudomonas aeruginosa, a key component of the bacterial cytochrome c maturation apparatus.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 47
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2009-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3kh9A00
4GF0A 4NXIA 4MPGA 3D5JA 3GV1A 1K0CA 1A0FA 1XXUA 4GXZA 1AXDA 1O7UA 1UC7A 3GKXA 4DSSA 4ECIA 3LSZA 3D22A 3EU3A 5G2ZA 4MLYA 2BTOT 2X8HA 1XIYA 3LYKA 4LL4B 1X9WB 1FO5A 4JZQA 3IHQA 2H1BA 3Q19A 4K9ZA 2G0FA 3I9V2 1GTUA 2I1UA 3F4RA 1JZDA 2GT6A 3LXZA 1Z6NA 3F8UA 1ZYEA 5ELAA 2A2RA 4XS4B 1AQVA 4L0UA 1A0RP 3NIVA 4POMA 3ZIVA 4YQUA 5F07A 3FKFA 4EXJA 3BJ5A 3ZFLA 1JFUA 1PL2A 3L4NA 3HVVA 2QC7A 2VL2C 4EL1A 1IYIA 4LMWA 4BPYA 2L4CA 4MH2A 4KGIA 5G31A 5DAKB 2KP2A 1A23A 5L71A 1RK4A 4HS1A 1K0DA 3EYTA 2WRTA 2PMTA 1RQMA 3EURA 3ZRDA 1AQWA 3HDCA 3J7Yk 2HRFA 3TB2A 3TJKA 4G19A 2WGRA 5HR3A 3G7IA 4I97A 5ECIB 4MA9A 2K9FA 1OC8A 4IP1A 1K0BA 1TI3A 2R4VA 3KMNA 1OAZA 5JWRB 1THOA 2VUPA 2H8LA 3UVHA 2HZEA 4WXTA 2FD3A 4TR0A 2GLRA 2E7PA 4HQZA 3Q6OA 5ECPB 1M9AA 5HFGA 5CRHA 3CSJA 1FAAA 5GSTA 4OFMA 1GSQA 2NTOA 4L0WA 1M0UA 4HI7A 2V41A 1XW9A 4ML6A 7GSSA 4F0BA 5D93A 2PGTA 5ECNB 3E0UA 2HXKA 1FVJA 3HD5A 3SWLA 5J9CA 3O76A 4K0NA 5ECLB 3GHAA 4K8MA 1OKTA 3TKSE 2VD1A 2DJ0A 3HJMA 3M0FA 4GSSA 4ZXGA 3VWVA 2C8UA 6GSYA 5AGYA 19GSA 2K8SA 3KD0A 2VL2A 3QPMA 1FW1A 3GIXA 3DMLA 2IFQA 1Z9HA 2H30A 5JWOB 4J2FA 2DJKA 2LKUA 5B8BA 5HR2A 1EV9A 1K3LA 2JSYA 4TKYA 1X9SB 4HU7A 4X43A 3P90A 2VCXA 5J3RA 2CX3A 4ULXA 1PKZA 2GDRA 1V2AA 1K0MA 3KJYA 3APQA 2DJ1A 2VAFA 2AAWA 2L57A 3F6DA 2B6MA 1V98A 5CRWA 3MSZA 2MYGA 4N10A 2LNTA 1OKDA 1YJ6A 5J41A 3ED3A 2OADA 4KDUA 1TU7A 2WCIA 1QMVA 3HHVA 2X64A 3FZ5A 5CAXA 1QFNA 1VF4A 4ZB8A 4Q5FA 2IMDA 3GURA 4G10A 3HA9A 1T00A 1A2LA 1SJZA 1Z5YE 3PR8A 1B4QA 3H93A 2ZUPA 2OA7A 3IV4A 1IYHA 4EDYA 3V1WA 2HFDA 4I6XA 3DVXA 1J08A 3QD9A 1SKSB 3TKSC 2TIRA 2EIQA 2M72A 3KP9A 2R37A 2EIOA 1H4OA 1AQXA 2QKEA 3FK8A 1JZWA 2PWJA 3M1GA 4G9HA 17GSA 2PPTA 4CDOA 3APOA 1O85A 1V57A 2B5XA 2GZZA 5ECHB 3TJGA 1MDKA 1ZOFA 2B1KA 3ZMLA 3L9VA 1GSYA 5CNWA 1ACVA 3P8WA 3F0IA 2OJLA 4MZCA 3QAWA 2H1DA 3IXRA 3GRXA 3HCZA 1NW2A 3CSIA 5CRDA 3TGZA 3RHBA 5HFKA 1T4YA 3EMPA 3TCOA 3HY2A 1F9MA 4IHUA 3TKQA 2MMOA 2GS3A 1GLPA 1HYUA 1PGTA 3LFLA 3ZVJA 4E8HA 2PU9C 2HT9A 3UIWA 2YZUA 3Q18A 2E2MA 4TW5A 4L5LA 2DMMA 1HNAA 1M2AA 2WB9A 3LWAA 5LD0A 1T4ZA 4IP6A 4N30A 2FWFA 2GSTA 3U6VA 1B4PA 2YPMA 3VWWA 3VWUA 1YZXA 3GL3A 3WGDA 4OO5A 3UJ1A 4YQVA 4KSMA 4DSQA 2GSQA 2CAQA 4TXOB 3M3MA 1PD21 3LQ7A 3VURA 2H74A 2J9HA 1I9DA 1SL0B 1C72A 4K1FA 3D21A 14GSA 1TRWA 1PSQA 2VCTA 3TKSA 5F8BA 4JR4A 2WJUA 18GSA 3IAS2 2B3SA 4LMVA 2AUVA 5HR0A 2IN3A 2C3QA 1X0RA 4QQ7A 1SYXA 1DE1A 5A4WA 1ILOA 3GTUB 1NHOA 1V40A 2OBIA 4NPBA 1ST9A 2XC2A 3IDVA 4WETA 4HJMA 4Q5QA 4ZB9A 3W8SA 3IAM2 1YF0A 1SENA 3NOFA 3KH9A 4OFTA 2K8VA 3PH9A 1TK8B 4YQMA 3DVWA 4V2LA 2AHEA 2I81A 3D4MA 3ERWA 9GSSA 2H75A 1HQOA 3W6GA 1R26A 2H01A 2N5FA 2WS2A 5EL8A 5A5KA 2F9SA 3H79A 5ID2A 2V32A 4MCUA 3EVIA 2MMAA 2G2QA 1YEXA 2B5YA 1R7HA 2E2GA 2P0GA 3TRXA 1EP8A 4YAPA 2CV4A 1XVQA 4GSTA 1G7EA 1LBKA 1XOAA 5ENUA 4Z7XA 3CRUA 3M8NA 1GUMA 2DIYA 3I43A 1Z7PA 4EF0A 3S9FA 4N0VA 3VPTA 1WE0A 2C0EA 4JR6A 2WFCA 2REMA 5DALA 5J9BA 3IRAA 4ZL7A 3EU4A 2ALBA 5ECKB 3KEBA 1ERTA 4KA0A 5DCGA 4ACSA 5IOWA 4IS0A 5DQSA 3IPZA 4EO3A 4HU9A 4J56E 4TR1B 2V6OA 1M7TA 3C1SA 2Z9SA 3BD2A 2OKAA 1ERUA 2E0QA 1TP9A 1DUGA 5ECRB 4PGTA 11GSA 4F0CA 4IVFA 1VF1A 4MMMA 2FY6A 2N5AA 2KHPA 2YCDA 4OMVA 4MJEA 2WDUA 4IN0A 3G7JA 3QFAC 1TRVA 2V2GA 3ZMKA 5IPHA 1GSFA 2C4JA 1UN2A 1TRSA 1KTEA 2YN1A 1K0AA 2CA8A 3TJBA 5KN1A 4HDEA 3CMIA 4FYBA 4D73A 1YQ1A 2XHFA 4MJAA 4IJ3A 4F2IA 4LL1B 4L8EA 1JLVA 2B7JA 1TXXA 3A2VA 1V9WA 1WIKA 2YJ7A 2ON7A 3F9UA 3KXOA 2JZSA 5HQPA 2YOIA 1E6BA 2MBTA 3HXSA 3H4KA 4KSOA 2C80A 3WGEA 4PUFC 3E9JB 2H76A 2PVOC 4JEDA 1HNBA 1TRUA 1FG4A 3CTGA 4AJ8A 3ZVJD 3LJRA 3P2AA 3US3A 5H5QA 5IIZA 4O7HA 4MJCA 1TK0B 3QDNA 4NHWA 1WPIA 4HQSA 1UA5A 2MBSA 3VI7A 3IBHA 1M99A 3WT1A 2H0IA 3DIEA 4IBPA 1ZCPA 4BA7A 4OD7A 2PBJA 5A4UA 1WOUA 5DDLA 4ZBAA 2IMIA 4MPFA 4V2MA 4OO4A 5AISA 1VF3A 3RHCA 1BX9A 2O85A 1QK8A 1B9XC 3RAZA 3KM6A 3TKRA 1X9MB 1OYJA 3WD6A 2P5RA 1KEBA 3APSA 5HR1A 4I5QA 1GUHA 3RPNA 4HUAA 4X1UA 5F06A 1F3BA 4KW6A 3MDKA 2HLSA 1VRSD 1DBYA 1WP0A 3UEMA 1KNGA 4ID0A 1ERVA 4WBJA 5CREA 3M9JA 4ZB6A 5IO2A 3VPQA 4WF4A 1A8YA 1N8JA 4DSRA 2DIZA 4N11A 2H0GA 2I3YA 4PNFA 1PQNA 2PN8A 4HOJA 3FEUA 3QAGA 3EC3A 4CHSA 3C71A 1F6MC 2GSSA 5JCWA 1U87A 5IMFA 2L6CA 1YY7A 2LQOA 1EGOA 2KOKA 4J57E 5H5SA 1GL8A 2FCHA 2GVPA 3ZTLA 3DRNA 3A3TA 2MMZA 1TTZA 1XOBA 3TOUA 2JSZA 2RLIA 2VM2A 4HEA2 3HJPA 2TRXA 4KCAA 4WBRD 3D6IA 1GSUA 3ZFBA 2I4AA 1SD8A 4TXVA 3GL5A 1FB0A 2L4QA 1OVNA 2GGTA 3FW2A 1EOHA 3GSTA 1HD2A 3IC4A 1YKCA 4ILFA 4I8BA 3GA4A 4XS4A 1ZMAA 3C7MA 3J7Yb 2FWEA 3ZIJA 1YEPA 4RUVA 3TJFA 4FH8A 3VI5A 2VLVA 2ZNMA 4XRDA 1R5AA 4HJ2A 5LNKe 4IW9A 3A2WA 3GX8A 1S3DA 1BAYA 3BCIA 2LRCA 2OE3A 3O3TA 5ECQB 3NZNA 4MF6A 3K8NA 5DAKA 2D2ZA 5IQYA 5J4UA 2FWHA 4EDZA 1PN9A 2GTUA 4O32A 2LRTA 3IR4A 1Z3EA 2C0DA 4NAXA 5D8IA 1GTBA 3KH7A 1YKAA 1B8XA 1YDKA 4ZILA 2YWOA 3TKPA 1VF2A 1JLWA 2F8FA 1TKDB 4NHZA 3HKRA 3A5WA 3GFKA 3P7XA 4O92A 6GSVA 1U88A 4MF5A 3C73A 4PQ1A 2B5EA 5B8AA 5IOXA 2WULA 3TRQA 5CRGA 4F03A 1TW9A 3KZQA 3A2XA 4H86A 3GMFA 3H1NA 1K0OA 3GH6A 3GSSA 1BQ7A 1XCCA 2JU5A 4KCEA 4IGJA 2YWIA 3QMXA 5IO0A 1O6JA 1JZOA 5FHIA 1MDIA 5JCUA 1USBA 2EC4A 4KDYA 4IQAA 4XS1A 2HSHA 3N5OA 2M46A 4BVYA 3C8EA 5EVOA 3LGCA 1TU8A 4AF2A 4FYCA 4K2DA 4EKZA 5JWQB 1ABAA 2DMLA 4NV5A 3F4SA 5AN1A 5J5NA 4EE0A 1MDJA 5G1LA 2OE1A 3UBKA 3M9KA 1FVKA 1Q98A 1R5PA 4PUAA 2RM5A 2YV9A 3FR6A 1OE7A 2FLSA 2VLTA 1M9BA 3LG6A 2VL3A 1TOFA 5IMDA 2IMKA 4NV2A 1X5DA 3JCML 2DBCA 2LTKA 3C1RA 2AB6A 3FY7A 1PMTA 10GSA 4PXOA 1O8WA 4CW9A 2C0GA 1R4WA 4FYUA 1OE8A 2CVKA 2CVDA 2LRNA 1NM3A 1EWXA 4IKHA 4LLRA 3WGXA 3I6AA 1EZKA 1ZYQB 4MZWA 4X0XA 1RW1A 4K7NA 4MK3A 4XRAA 1T1VA 2L5OA 3UVTA 4GCIA 1Y6EA 5H5RA 5CO3A 5AIVA 1A8LA 2C3TA 3DD3A 2OBKA 4PX1A 5LCZA 1JHBA 4QL7A 5ABRA 3VK9A 2YWNA 3GN3A 4AJ6A 1GSSA 3GKMA 2C0FA 4TOPA 2LUSA 5HFIA 5D9TA 2QSIA 1DE2A 4HZ4A 5GAND 4DSSB 2YWMA 2AJQB 3ZYWA 4K7OA 4G2EA 2VCWA 4GWRA 1B9YC 2I9HA 4WR5A 1SKRB 1SJ6A 1A2JA 16GSA 6GSXA 2A4VA 1GWCA 5G1KA 4Q5RA 2IWTA 4BL7A 3QFBC 2LSTA 1JZRA 2A2SA 2RUFA 3LYPA 4YH2A 5DVBA 1DSBA 4E8EA 2H70A 4POBA 2ON5A 1QXHA 1CQGA 3E3EA 1A2MA 1M2DA 2VCVA 2O7KA 3TJJA 2YP6A 4HZ2A 13GSA 4MJBA 2YNXA 2NDOA 3ERFA 1PX7A 3HVXA 1QGVA 4ECCA 2CT6A 4RI7A 1TK5B 2F8AA 1J9BA 4POLA 2LEGA 3GNJA 3UOMA 5EY6A 4TXOA 4XCSA 2GZYA 4V2NA 4IJIA 1U3AA 5DCHA 2M80A 22GSA 4V1Ap 1EOGA 1T3BA 2GQKA 1ZGNA 2K18A 2R5GA 1WWJA 3ZL5A 2X99A 2H1AA 4RI6A 3ZREA 2DSAA 4XTSA 3DKSA 3KTBA 1TI1A 5D96A 3QOUA 2XPDA 2JL4A 3GTUA 3ZLPA 3ZZXA 3EINA 1V58A 2H72A 1SL2B 5IPGA 3RPPA 2J23A 3FZ9A 1KBNA 2HZEB 2R6KA 4OFNA 4KE3A 1XW6A 1J0FA 4OWYA 2F3MA 3LEFA 1ERWA 2NVLA 8GSSA 5E59A 2FWGA 2YJHA 4XIHA 4WKWA 3ERGA 2XBIA 3L78A 5B7CA 1F37A 2V1MA 2FUG2 3GX0A 4NWYA 1TDIA 2YZHA 1XBSA 3ME8A 3FR3A 2BMXA 3RDWA 3PINA 5F05A 3UBLA 4FIWA 2F51A 2CZ3A 2CX4A 2CVBA 2VIMA 3W8JA 4AGSA 5IMVA 4ML1A 1CQHA 3MWHA 1GP1A 3F3QA 4ECJA 3TOTA 1GSDA 2LJRA 1Y25A 4KAEA 4KX4A 4TR1A 1GH2A 2IIYA 1F3AA 3OR5A 2JADA 2IFQB 2H71A 4RQXA 1G6YA 5D9VA 4IELA 4ZL9A 2LJAA 2CZ2A 4BVXA 3L0HA 4ISDA 1Q4JA 1ML6A 3IA1A 1TJDA 1OC9B 3MAKA 1K3YA 3VFIA 1PX6A 3FHKA 1MEKA 1QUWA 1EGRA 5EPFA 5KN3A 3BOAA 3D0ZA 2HYXA 3CYNA 5INYA 3ZITA 5ECOB 2JACA 5G5FA 2KP1A 4WR4A 4AJ7A 3L9SA 3KIJA 1XWCA 2GT5A 1YF1A 2H1GA 4LA1A 1MTCA 1MD3A 1K0NA 4WF5A 5FWGA 3D4TA 1BJXA 5E4WA 5IMAA 2R2JA 1ZL9A 4V1Ag 5B6NA 2AYTA 1Z6MA 1X5CA 3VWXA 2JZTA 4MDCA 3R2QA 3GYKA 1SD9A 4Q5NA 2RM6A 4FO5A 4O5RA 3UL3A 4PNGA 2O89A 4EUYA 3WT2A 1HNCA 2PVQA 2HSYA 4K6XA 5G30A 3HVSA 1XPVA 1VGLA 2X8GA 4F82A 4OCEA 3O6TA 1XW5A 2H19A 1GNEA 3Q74A 3GKNA 3AY8A 4F9ZA 4JE1A 2FGXA 4OCFA 4IQ1A 1EEJA 4QL9A 3H8QA 1THXA 3TRPA 4TVEA 1WJKA 3BCKA 2GQLA 2HE3A 2VL9A 3TDGA 1SU9A 3FYGA 3ISOA 3F3RA 2YV7A 5F0GA 1MD4A 2CQ9A 4JRRA 6GSWA 1UVZA 3KTLA 2XPEA 4ZL8A 1OC9A 2O8VB 4GTUA 1AC1A 1E2YA 1QQ2A 1EP7A 1M2BA 1FOVA 1T7PB 5G5EA 2QGVA 4KUNA 2VO4A 1GSEA 2DJ3A 4GQFA 2C3NA 1A24A 4JU5A 1XZOA 2ES7A 5KN0A 2CAIA 1GTIA 2NPBA 12GSA 3G9BA 4GRFA 1W4VA 3BBYA 4BWQA 5D9XA 1BYEA 2B1LA 4I2TA 3DXBA 1LJRA 2FNOA 3HZ8A 4YAVA 1GTAA 5COHA 5KN2A 2IMEA 5ELGA 1XVWA 1PRXA 3U5RE 3IE3A 1FHEA 1O73A 5DJMA 1SL1B 5C04A 1O8XA 6GSUA 3GKKA 2DJ2A 4KB3A 3CTFA 1XWAA 2YANA 5DJLA 1S3CA 2LQQA 2O87A 3F6FA 2IMFA 1SYRA 5KEJA 2KLXA 2OE0A 4TR3A 6GSSA 3CBUA 1X5EA 3L9UA 5CP1A 3RBTA 4XHMA 4JBBA 3CXGA 4PQHA 1SK2A 2X8CA 2VCZA 2GQMA 3LXTA 5ID2B 3GH9A 2VLUA 2FHEA 2FA8A 1FB6A 3UARA 5B6MA 2H6ZA 4PQIA 2VD0A 5IM9A 2R3XA 4ZBBA 6GSTA 3PGTA 4ECBA 2MMNA 3F4TA 1U3IA 20GSA 2LJKA 2P5QA 1GNWA 5FT3A 1G6WA 4TR4A 4KDXA 2EIRA 4L5OA 2V6KA 4KH7A 3HZ4A 2LNSA 5DALB 2LS5A 4DVCA 2L6DA 4KNDA 3DEXA 1XWBA 2OACA 2GSRA 2VCQA 1K3OA 4RQRA 2K6VA 3QR6A 4MZBA 3DYRA 2HNLA 1NSWA 3TUEA 1H75A 3DWVA 5DQYA 2H6XA 4I2UA 3LORA 2GZPA 1B48A 4GQCA 3DGQA 1URMA 1AAZA 2MZCA 5AIXA 1EEMA 1GUKA 4TRXA 1AUCA 5DBQA 3FZAA 3IK9A 2PERA 4GLTA 2H6YA 1S3AA 2HI7A 2H0HA 2LV3A 1ZZYA 2VOCA 3IOSA 2H73A 4D73B 1W89A 1T8EB 2IL3A 3KMOA 4ZBDA 2XBQA 5IMZA 3ME7A 3KGKA 2DLXA 2RIIA 5GZZB 4MF7A 1OC3A 3GUSA 2BJXA 3FR9A 4MP4A 3VLNA 1N2AA 2C1YA 4XS6A 3FRCA 3I69A 2KUCA 1EV4A 4PURA 2N5BA 4P3YB 3HJOA 3WYWA 3HYPA 5GSSA 3UAPA 2L5LA 3G7YA 1I5GA 1PL1A 4GSNA 3F63A 4K0GA 2NBSA 4N0ZA 5ECSA 2B7KA 5IMCA 1XFLA 2JZRA 3KCMA 1BEDA 4WEYA 3KP8A 3CSHA 1G7OA 3EE2A 1SK0A 2HRNA 4TN8A 5A4VA 3EWLA 5C00A 3QAVA 1AW9A 1U6TA 1Z7RA 1XWGA 2HZFA 5CYYA 1AIUA 1PA3A 3SBCA 5D73A 2RUEA 4MABA 2IJYA 5JCGA 4ZIJA 4BWSA 3EMXA 2ZCTA 1O81A 4NMUA 3UMAA 1WRYA 4MH3A 2DC5A 4POKA 3QCPA 1PKWA 1BG5A 2VM1A 1G0TA 5ECMB 3MNGA 1SK1A 3CRTA 4DEJA 1SKWB 4K7IA 4EC0A 3FZ4A 1LU4A 2PUKC 2WZ9A 2L59A 1NHYA 2IPAA 1ON4A 2TRCP 1GRXA 1WMJA 2P31A 2AV4A 1XWKA 1GULA 2H66A 1SJIA 5D9WA 3N9JA 5GAPD 2FA4A 3IK7A 1F2EA 4EVMA 2DJJA 1GLQA
chains in the Genus database with same CATH superfamily
4GF0A 4NXIA 4MPGA 3D5JA 3GV1A 1K0CA 1A0FA 1XXUA 4GXZA 1AXDA 1O7UA 1UC7A 3GKXA 4DSSA 4ECIA 2QA2A 3LSZA 3D22A 3EU3A 5G2ZA 4MLYA 2BTOT 2X8HA 1XIYA 3LYKA 4LL4B 1X9WB 1FO5A 4JZQA 3IHQA 2H1BA 3Q19A 4K9ZA 2G0FA 3I9V2 1GTUA 2I1UA 3F4RA 1JZDA 2GT6A 3LXZA 1Z6NA 3F8UA 1ZYEA 5ELAA 5BMUA 2A2RA 4XS4B 1AQVA 4L0UA 1A0RP 3NIVA 4POMA 3ZIVA 4YQUA 5F07A 2A2PA 3FKFA 4EXJA 3BJ5A 3ZFLA 1JFUA 1PL2A 3L4NA 3HVVA 2QC7A 2VL2C 4EL1A 1S3RA 1IYIA 2DKHA 4LMWA 4BPYA 2L4CA 4MH2A 4KGIA 5G31A 5DAKB 2KP2A 1A23A 5L71A 1RK4A 4HS1A 1K0DA 3EYTA 2WRTA 2PMTA 1RQMA 3EURA 3ZRDA 1AQWA 3HDCA 3FMWA 3J7Yk 2HRFA 3TB2A 3TJKA 4G19A 2WGRA 5HR3A 3G7IA 4I97A 5ECIB 4MA9A 2K9FA 1OC8A 4IP1A 1K0BA 1TI3A 2R4VA 3KMNA 1OAZA 5JWRB 1THOA 2VUPA 2H8LA 3UVHA 4G0LA 2HZEA 4FQUA 4WXTA 2FD3A 4TR0A 2GLRA 2E7PA 4HQZA 4Z2TA 3Q6OA 2X4AA 5ECPB 1M9AA 5HFGA 5CRHA 3CSJA 1FAAA 5GSTA 4OFMA 1GSQA 2NTOA 4L0WA 1M0UA 4HI7A 2V41A 1XW9A 4ML6A 7GSSA 4F0BA 5D93A 2PGTA 5ECNB 3E0UA 2HXKA 1FVJA 3HD5A 3SWLA 5J9CA 3O76A 4K0NA 5ECLB 3GHAA 4K8MA 1OKTA 3TKSE 2VD1A 2DJ0A 3HJMA 4BVYB 3M0FA 4GSSA 4ZXGA 3VWVA 2C8UA 6GSYA 5AGYA 19GSA 2K8SA 3KD0A 2VL2A 3QPMA 1FW1A 3GIXA 3PPUA 3DMLA 2IFQA 1Z9HA 2H30A 5JWOB 4J2FA 2DJKA 2LKUA 5B8BA 4K2XA 5HR2A 1EV9A 1K3LA 2JSYA 4TKYA 1X9SB 4HU7A 4X43A 3P90A 2VCXA 5J3RA 2CX3A 4ULXA 1PKZA 2GDRA 1V2AA 1K0MA 3KJYA 3APQA 2DJ1A 2VAFA 2AAWA 2L57A 3F6DA 2B6MA 4YKGA 1V98A 5CRWA 3A5IA 3MSZA 2MYGA 4N10A 2LNTA 1OKDA 1YJ6A 5J41A 3ED3A 2OADA 4KDUA 1TU7A 2WCIA 1QMVA 3HHVA 2X64A 3FZ5A 5CAXA 1QFNA 1VF4A 4ZB8A 4Q5FA 2IMDA 3GURA 4G10A 3HA9A 1T00A 1A2LA 1SJZA 1Z5YE 3PR8A 1B4QA 3H93A 2ZUPA 2OA7A 3IV4A 1IYHA 4EDYA 3V1WA 2HFDA 4I6XA 3DVXA 1J08A 3QD9A 1SKSB 3TKSC 2TIRA 2EIQA 2M72A 3KP9A 4O5QA 2R37A 2EIOA 1H4OA 1AQXA 2QKEA 3FK8A 1JZWA 2PWJA 3M1GA 4G9HA 17GSA 2PPTA 4CDOA 3APOA 1O85A 1V57A 3MIXA 2B5XA 2GZZA 5ECHB 3TJGA 1MDKA 1ZOFA 2B1KA 3ZMLA 3L9VA 1GSYA 5CNWA 1ACVA 3P8WA 3F0IA 2OJLA 4MZCA 3QAWA 2H1DA 3IXRA 3GRXA 3HCZA 1NW2A 3CSIA 5CRDA 3TGZA 3RHBA 5HFKA 1T4YA 3EMPA 3TCOA 3HY2A 1F9MA 4IHUA 3TKQA 2MMOA 2GS3A 1GLPA 1HYUA 1PGTA 3LFLA 3ZVJA 4E8HA 4X4JA 2PU9C 2HT9A 4BL7B 3UIWA 2YZUA 3Q18A 1PN0A 2E2MA 4TW5A 4L5LA 2DMMA 1HNAA 1M2AA 2WB9A 3LWAA 5LD0A 1T4ZA 4IP6A 4N30A 2FWFA 2GSTA 3U6VA 1B4PA 2YPMA 3VWWA 3VWUA 1YZXA 3GL3A 3WGDA 4OO5A 3UJ1A 4YQVA 4KSMA 4DSQA 2GSQA 2CAQA 4TXOB 3M3MA 1PD21 3LQ7A 3VURA 2H74A 2J9HA 1I9DA 1SL0B 1C72A 4K1FA 3D21A 14GSA 1TRWA 1PSQA 2VCTA 3TKSA 5F8BA 4JR4A 2WJUA 18GSA 3IAS2 2B3SA 4LMVA 2AUVA 5HR0A 2IN3A 2C3QA 1X0RA 4QQ7A 1SYXA 1DE1A 5A4WA 1ILOA 3GTUB 1NHOA 1V40A 2OBIA 4NPBA 1ST9A 2XC2A 3IDVA 4WETA 4HJMA 4Q5QA 4ZB9A 3W8SA 3IAM2 1YF0A 1SENA 3NOFA 3KH9A 4OFTA 2K8VA 3PH9A 1TK8B 4YQMA 3DVWA 4V2LA 2AHEA 2I81A 3D4MA 3ERWA 9GSSA 2H75A 1HQOA 3W6GA 1R26A 2H01A 2N5FA 2WS2A 5EL8A 4ICYA 5A5KA 2F9SA 3H79A 5ID2A 2V32A 4MCUA 3EVIA 2MMAA 2G2QA 1YEXA 2B5YA 2HRKA 1R7HA 2E2GA 2P0GA 3TRXA 1EP8A 4YAPA 2CV4A 1XVQA 4GSTA 1G7EA 1LBKA 1XOAA 5ENUA 1PFOA 4Z7XA 3CRUA 3M8NA 1GUMA 2DIYA 3I43A 1Z7PA 4EF0A 3S9FA 4N0VA 3VPTA 1WE0A 2C0EA 4JR6A 2WFCA 2REMA 5DALA 5J9BA 3IRAA 4ZL7A 3EU4A 2ALBA 5ECKB 3KEBA 1ERTA 4KA0A 5DCGA 4ACSA 5IOWA 4IS0A 5DQSA 1XG8A 3IPZA 4EO3A 4CY8A 4HU9A 4J56E 4TR1B 2V6OA 1M7TA 3C1SA 2Z9SA 3BD2A 2OKAA 1ERUA 2E0QA 1TP9A 1DUGA 5ECRB 4PGTA 11GSA 4F0CA 4IVFA 1VF1A 4MMMA 2FY6A 2N5AA 2KHPA 2YCDA 4BVXB 4OMVA 4MJEA 2WDUA 4IN0A 3G7JA 3QFAC 1TRVA 2V2GA 3ZMKA 5IPHA 1GSFA 2C4JA 1UN2A 1TRSA 1KTEA 2YN1A 1K0AA 2CA8A 3TJBA 5KN1A 4HDEA 3CMIA 1FOHA 4FYBA 4D73A 4USSA 1YQ1A 2XHFA 4MJAA 4IJ3A 3HVNA 4F2IA 4LL1B 4L8EA 1JLVA 2B7JA 2DKIA 1TXXA 3A2VA 1V9WA 1WIKA 2YJ7A 2ON7A 3F9UA 3KXOA 2JZSA 5HQPA 2YOIA 1E6BA 2MBTA 3HXSA 3H4KA 4KSOA 2C80A 3WGEA 4PUFC 3E9JB 2H76A 2PVOC 4JEDA 1HNBA 5KOWA 1TRUA 1FG4A 3CTGA 4AJ8A 3ZVJD 3LJRA 3P2AA 3US3A 5H5QA 5IIZA 4O7HA 4MJCA 1TK0B 3QDNA 4NHWA 1WPIA 4HQSA 1UA5A 2MBSA 3VI7A 1M3JA 3IBHA 1M99A 3WT1A 2H0IA 3DIEA 4IBPA 1ZCPA 4BA7A 4OD7A 2PBJA 5A4UA 1WOUA 5DDLA 4ZBAA 2IMIA 4MPFA 4V2MA 4OO4A 5AISA 1VF3A 3RHCA 1BX9A 2O85A 1QK8A 1B9XC 3RAZA 3KM6A 3TKRA 1X9MB 1OYJA 3WD6A 2P5RA 1KEBA 3APSA 5HR1A 4I5QA 1GUHA 3RPNA 4HUAA 4X1UA 5F06A 1F3BA 4KW6A 3MDKA 2HLSA 1VRSD 1DBYA 1WP0A 3UEMA 1KNGA 4ID0A 1ERVA 4WBJA 5CREA 3M9JA 4ZB6A 5IO2A 3VPQA 4WF4A 1A8YA 1N8JA 4DSRA 2DIZA 4N11A 2H0GA 2I3YA 4PNFA 1ZYNA 1PQNA 2PN8A 4HOJA 3FEUA 3QAGA 3EC3A 4CHSA 3C71A 1F6MC 2GSSA 5JCWA 1U87A 5IMFA 2L6CA 1YY7A 2LQOA 1EGOA 2KOKA 4J57E 5H5SA 1GL8A 2FCHA 2GVPA 3ZTLA 3DRNA 3A3TA 2MMZA 1TTZA 1XOBA 3TOUA 2JSZA 2RLIA 2VM2A 4HEA2 3HJPA 2TRXA 4KCAA 4WBRD 3D6IA 1GSUA 3ZFBA 2I4AA 1SD8A 4TXVA 3GL5A 1FB0A 2L4QA 1OVNA 2GGTA 3FW2A 1EOHA 3GSTA 1HD2A 3IC4A 1YKCA 4ILFA 4I8BA 3GA4A 4XS4A 1ZMAA 3C7MA 3J7Yb 2FWEA 3ZIJA 1YEPA 4RUVA 3TJFA 4FH8A 3VI5A 2VLVA 2ZNMA 4XRDA 1R5AA 4HJ2A 5LNKe 4IW9A 3A2WA 3GX8A 1S3DA 1BAYA 3BCIA 2LRCA 2OE3A 3O3TA 5ECQB 3NZNA 4MF6A 3K8NA 5DAKA 2D2ZA 5IQYA 5J4UA 2FWHA 4EDZA 1PN9A 2GTUA 4O32A 2LRTA 3IR4A 1Z3EA 2C0DA 4NAXA 1ZYPA 5D8IA 1GTBA 3KH7A 1YKAA 1B8XA 1YDKA 4ZILA 2HRAA 2YWOA 3TKPA 1VF2A 1JLWA 2F8FA 1TKDB 4NHZA 3HKRA 3A5WA 3GFKA 3P7XA 4O92A 6GSVA 1U88A 4MF5A 3C73A 4PQ1A 2B5EA 5B8AA 5IOXA 2WULA 1M3IA 3TRQA 5CRGA 4F03A 1TW9A 3KZQA 3A2XA 4H86A 3GMFA 3H1NA 1K0OA 3GH6A 3GSSA 1BQ7A 1XCCA 2JU5A 4KCEA 4IGJA 2YWIA 3QMXA 5IO0A 1O6JA 1JZOA 5FHIA 1MDIA 5JCUA 1USBA 2EC4A 4KDYA 4IQAA 4XS1A 2HSHA 3N5OA 2M46A 4BVYA 3C8EA 5EVOA 3LGCA 1TU8A 4AF2A 4FYCA 4K2DA 4EKZA 5JWQB 1ABAA 2DMLA 4NV5A 3F4SA 5AN1A 5J5NA 4EE0A 1MDJA 5G1LA 2OE1A 3UBKA 3M9KA 1FVKA 1Q98A 1R5PA 4PUAA 2RM5A 2YV9A 3FR6A 1OE7A 2FLSA 2VLTA 1M9BA 3LG6A 2VL3A 1TOFA 5IMDA 2IMKA 4NV2A 1X5DA 3JCML 2DBCA 2LTKA 3C1RA 2AB6A 3FY7A 1PMTA 10GSA 4PXOA 1O8WA 4CW9A 4EIPA 2C0GA 1R4WA 4FYUA 1OE8A 2CVKA 2CVDA 2LRNA 1NM3A 1EWXA 4IKHA 4LLRA 3WGXA 3I6AA 1EZKA 1ZYQB 4MZWA 4X0XA 1RW1A 4K7NA 4MK3A 4XRAA 1T1VA 2L5OA 3UVTA 4GCIA 1Y6EA 5H5RA 5CO3A 5AIVA 1A8LA 2C3TA 3DD3A 2OBKA 2HSMA 4PX1A 5LCZA 1JHBA 2A4HA 4QL7A 5ABRA 3VK9A 2YWNA 3GN3A 4AJ6A 1GSSA 3GKMA 2C0FA 4Z2UA 4TOPA 2LUSA 4MNNA 5HFIA 5D9TA 2QSIA 1DE2A 4HZ4A 5GAND 4DSSB 2YWMA 2AJQB 3ZYWA 4K7OA 4G2EA 2VCWA 4O5UA 4GWRA 1B9YC 2I9HA 4WR5A 1SKRB 1SJ6A 1A2JA 16GSA 6GSXA 2A4VA 1GWCA 5G1KA 4Q5RA 2IWTA 4BL7A 3QFBC 2LSTA 4A5PA 1JZRA 2A2SA 2RUFA 3LYPA 4YH2A 5DVBA 1DSBA 4E8EA 2H70A 4POBA 2ON5A 1QXHA 1CQGA 3E3EA 1A2MA 1M2DA 2VCVA 2O7KA 3TJJA 2YP6A 4HZ2A 13GSA 4MJBA 2YNXA 2NDOA 3ERFA 1PX7A 3HVXA 1QGVA 4ECCA 2CT6A 4RI7A 1TK5B 2F8AA 1J9BA 4POLA 2LEGA 3GNJA 3UOMA 5EY6A 4TXOA 4XCSA 2GZYA 4V2NA 4IJIA 1U3AA 5DCHA 2M80A 22GSA 4V1Ap 1EOGA 1T3BA 2GQKA 1ZGNA 2K18A 2R5GA 1WWJA 3ZL5A 2X99A 2H1AA 4RI6A 3ZREA 2DSAA 4XTSA 3DKSA 3KTBA 1TI1A 5D96A 3QOUA 2XPDA 4K5RA 2JL4A 3GTUA 3ZLPA 3ZZXA 3EINA 1V58A 2H72A 1SL2B 5IPGA 3RPPA 2J23A 3FZ9A 1KBNA 2HZEB 2R6KA 4OFNA 4KE3A 1XW6A 1J0FA 4OWYA 2F3MA 3LEFA 1ERWA 2NVLA 8GSSA 5E59A 2FWGA 2YJHA 4XIHA 4WKWA 3ERGA 2XBIA 3L78A 5B7CA 1F37A 5KOXA 2V1MA 2FUG2 3GX0A 4NWYA 1TDIA 2YZHA 1XBSA 3ME8A 4HSCX 3FR3A 2BMXA 3RDWA 3PINA 5F05A 3UBLA 4FIWA 2F51A 2CZ3A 2CX4A 2CVBA 2VIMA 3W8JA 4AGSA 5IMVA 4ML1A 1CQHA 3MWHA 1GP1A 2QA1A 3F3QA 4ECJA 3TOTA 1GSDA 2LJRA 1Y25A 4G0IA 4KAEA 4KX4A 4TR1A 1GH2A 2IIYA 1F3AA 3OR5A 2JADA 2IFQB 2H71A 4RQXA 1G6YA 5D9VA 4IELA 4ZL9A 2LJAA 2CZ2A 4BVXA 3L0HA 4KF9A 4ISDA 1Q4JA 1ML6A 3IA1A 1TJDA 1OC9B 3MAKA 1K3YA 3VFIA 1PX6A 3FHKA 1MEKA 1QUWA 1EGRA 5EPFA 5KN3A 3BOAA 3D0ZA 2HYXA 3CYNA 5INYA 3ZITA 5ECOB 2JACA 5G5FA 2KP1A 4WR4A 4AJ7A 3L9SA 3KIJA 1XWCA 2GT5A 1YF1A 2H1GA 4LA1A 1MTCA 1MD3A 1K0NA 4WF5A 5FWGA 3D4TA 1BJXA 5E4WA 5IMAA 2R2JA 1ZL9A 4V1Ag 5B6NA 2AYTA 1Z6MA 1X5CA 3VWXA 2JZTA 4MDCA 3R2QA 3GYKA 1SD9A 4Q5NA 2RM6A 4FO5A 4O5RA 3UL3A 4PNGA 4EIQA 2O89A 4EUYA 3WT2A 1HNCA 2PVQA 2R0PA 2HSYA 4K6XA 5G30A 4YKFA 3HVSA 1XPVA 1VGLA 2X8GA 4F82A 4OCEA 3O6TA 1XW5A 2H19A 1GNEA 3Q74A 3GKNA 3AY8A 4F9ZA 4JE1A 2FGXA 4OCFA 4IQ1A 1EEJA 4QL9A 3H8QA 1THXA 3TRPA 4TVEA 1WJKA 3BCKA 2GQLA 2HE3A 2VL9A 3TDGA 1SU9A 3FYGA 3ISOA 3F3RA 2YV7A 5F0GA 1MD4A 2CQ9A 4JRRA 6GSWA 1UVZA 3KTLA 2XPEA 3LW9A 4ZL8A 2UZ8A 1OC9A 2O8VB 4GTUA 3R3EA 1AC1A 1E2YA 1QQ2A 1EP7A 1M2BA 5BRTA 1FOVA 1T7PB 5G5EA 2QGVA 4KUNA 2VO4A 1GSEA 2DJ3A 4GQFA 2C3NA 1A24A 4JU5A 1XZOA 2ES7A 5KN0A 2CAIA 1GTIA 2NPBA 12GSA 3G9BA 4GRFA 1W4VA 3BBYA 4BWQA 5D9XA 1BYEA 2B1LA 4I2TA 3DXBA 1LJRA 2FNOA 3HZ8A 4YAVA 1GTAA 5COHA 5KN2A 2IMEA 5ELGA 1XVWA 1PRXA 3U5RE 3IC8A 3IE3A 1FHEA 1O73A 4G0KA 5DJMA 1SL1B 5C04A 1O8XA 4CY6A 6GSUA 4Z2RA 3GKKA 2DJ2A 4KB3A 3CTFA 1XWAA 2YANA 5DJLA 1S3CA 2LQQA 2O87A 3F6FA 2IMFA 1SYRA 5KEJA 2KLXA 2OE0A 4TR3A 6GSSA 3CBUA 1X5EA 3L9UA 5CP1A 3RBTA 4XHMA 4JBBA 3CXGA 4PQHA 1SK2A 2X8CA 2VCZA 2GQMA 3LXTA 5ID2B 3GH9A 2VLUA 2FHEA 2FA8A 1FB6A 3UARA 5B6MA 2H6ZA 4PQIA 2VD0A 5IM9A 2R3XA 4ZBBA 6GSTA 3PGTA 4ECBA 2MMNA 3F4TA 1U3IA 20GSA 2LJKA 2P5QA 1GNWA 5FT3A 1G6WA 4TR4A 4KDXA 2EIRA 4L5OA 2V6KA 4KH7A 3HZ4A 2LNSA 5DALB 2LS5A 4DVCA 2L6DA 4KNDA 3DEXA 1XWBA 2OACA 2GSRA 2VCQA 1K3OA 4RQRA 2K6VA 3QR6A 4MZBA 3DYRA 2HNLA 1NSWA 3TUEA 1H75A 3CQFA 3DWVA 5DQYA 2H6XA 4I2UA 3LORA 2R0CA 3IHGA 2GZPA 1B48A 4GQCA 3DGQA 1URMA 1AAZA 2MZCA 5AIXA 1EEMA 1GUKA 4TRXA 1AUCA 4PTSA 5DBQA 3FZAA 3IK9A 2PERA 4GLTA 2H6YA 1S3AA 2HI7A 2H0HA 2LV3A 1ZZYA 2VOCA 3IOSA 2H73A 4D73B 1W89A 1T8EB 2IL3A 3KMOA 4ZBDA 2XBQA 5IMZA 3ME7A 3KGKA 2DLXA 2RIIA 5GZZB 4MF7A 1OC3A 3GUSA 2BJXA 3FR9A 4MP4A 3VLNA 1N2AA 2C1YA 4XS6A 3FRCA 3I69A 2KUCA 4BIKA 1EV4A 4PURA 2N5BA 4P3YB 3HJOA 3WYWA 3HYPA 5GSSA 3UAPA 2L5LA 2R0GA 3G7YA 1I5GA 1PL1A 4GSNA 3F63A 4K0GA 2NBSA 4N0ZA 5ECSA 2B7KA 5IMCA 1XFLA 2JZRA 3KCMA 1BEDA 4WEYA 3KP8A 3CSHA 1G7OA 3EE2A 1SK0A 2HRNA 4TN8A 5A4VA 3EWLA 5C00A 3QAVA 1AW9A 1U6TA 3EPTA 1Z7RA 1XWGA 2HZFA 5CYYA 1AIUA 1PA3A 3SBCA 5D73A 2RUEA 4MABA 2IJYA 5JCGA 4ZIJA 4BWSA 3EMXA 2ZCTA 1O81A 4NMUA 3UMAA 1WRYA 4MH3A 2DC5A 4POKA 3QCPA 1PKWA 3MYDA 1BG5A 2VM1A 1G0TA 5ECMB 3MNGA 1SK1A 3CRTA 4DEJA 1SKWB 4K7IA 4EC0A 3FZ4A 1LU4A 2PUKC 2WZ9A 2L59A 1NHYA 2IPAA 1ON4A 2TRCP 2X49A 1GRXA 1WMJA 2P31A 2AV4A 4K5SA 1XWKA 1GULA 2H66A 1SJIA 5D9WA 3N9JA 5GAPD 2FA4A 3IK7A 1F2EA 4EVMA 2DJJA 1GLQA
chains in the Genus database with same CATH topology
4GF0A 4NXIA 4MPGA 3D5JA 3GV1A 1K0CA 1A0FA 1XXUA 4GXZA 1AXDA 1O7UA 1UC7A 3GKXA 4DSSA 4ECIA 2QA2A 3LSZA 3D22A 3EU3A 5G2ZA 4MLYA 2BTOT 2X8HA 1XIYA 3LYKA 4LL4B 1X9WB 1FO5A 4JZQA 3IHQA 2H1BA 3Q19A 4K9ZA 2G0FA 3I9V2 1GTUA 2I1UA 3F4RA 1JZDA 2GT6A 3LXZA 1Z6NA 3F8UA 1ZYEA 5ELAA 5BMUA 2A2RA 4XS4B 1AQVA 4L0UA 1A0RP 3NIVA 4POMA 3ZIVA 4YQUA 5F07A 2A2PA 3FKFA 4EXJA 3BJ5A 3ZFLA 1JFUA 1PL2A 3L4NA 3HVVA 2QC7A 2VL2C 4EL1A 1IYIA 2DKHA 4LMWA 4BPYA 2L4CA 4MH2A 4KGIA 5G31A 5DAKB 2KP2A 1A23A 5L71A 1RK4A 4HS1A 1K0DA 3EYTA 2WRTA 2PMTA 1RQMA 3EURA 3ZRDA 1AQWA 3HDCA 3FMWA 3J7Yk 2HRFA 3TB2A 3TJKA 4G19A 2WGRA 5HR3A 3G7IA 4I97A 5ECIB 4MA9A 2K9FA 1OC8A 4IP1A 1K0BA 1TI3A 2R4VA 3KMNA 1OAZA 5JWRB 1THOA 2VUPA 2H8LA 3UVHA 4G0LA 2HZEA 4FQUA 4WXTA 2FD3A 4TR0A 2GLRA 2E7PA 4HQZA 4Z2TA 3Q6OA 2X4AA 5ECPB 1M9AA 5HFGA 5CRHA 3CSJA 1FAAA 5GSTA 4OFMA 1GSQA 2NTOA 4L0WA 1M0UA 4HI7A 2V41A 1XW9A 4ML6A 7GSSA 4F0BA 5D93A 2PGTA 5ECNB 3E0UA 2HXKA 1FVJA 3HD5A 3SWLA 5J9CA 3O76A 4K0NA 5ECLB 3GHAA 4K8MA 1OKTA 3TKSE 2VD1A 2DJ0A 3HJMA 4BVYB 3M0FA 4GSSA 4ZXGA 3VWVA 2C8UA 6GSYA 5AGYA 19GSA 2K8SA 3KD0A 2VL2A 3QPMA 1FW1A 3GIXA 3PPUA 3DMLA 2IFQA 1Z9HA 2H30A 5JWOB 4J2FA 2DJKA 2LKUA 5B8BA 4K2XA 5HR2A 1EV9A 1K3LA 2JSYA 4TKYA 1X9SB 4HU7A 4X43A 3P90A 2VCXA 5J3RA 2CX3A 4ULXA 1PKZA 2GDRA 1V2AA 1K0MA 3KJYA 3APQA 2DJ1A 2VAFA 2AAWA 2L57A 3F6DA 2B6MA 4YKGA 1V98A 5CRWA 3A5IA 3MSZA 2MYGA 4N10A 2LNTA 1OKDA 1YJ6A 5J41A 3ED3A 2OADA 4KDUA 1TU7A 2WCIA 1QMVA 3HHVA 2X64A 3FZ5A 5CAXA 1QFNA 1VF4A 4ZB8A 4Q5FA 2IMDA 3GURA 4G10A 3HA9A 1T00A 1A2LA 1SJZA 1Z5YE 3PR8A 1B4QA 3H93A 2ZUPA 2OA7A 3IV4A 1IYHA 4EDYA 3V1WA 2HFDA 4I6XA 3DVXA 1J08A 3QD9A 1SKSB 3TKSC 2TIRA 2EIQA 2M72A 3KP9A 4O5QA 2R37A 2EIOA 1H4OA 1AQXA 2QKEA 3FK8A 1JZWA 2PWJA 3M1GA 4G9HA 17GSA 2PPTA 4CDOA 3APOA 1O85A 1V57A 3MIXA 2B5XA 2GZZA 5ECHB 3TJGA 1MDKA 1ZOFA 2B1KA 3ZMLA 3L9VA 1GSYA 5CNWA 1ACVA 3P8WA 3F0IA 2OJLA 4MZCA 3QAWA 2H1DA 3IXRA 3GRXA 3HCZA 1NW2A 3CSIA 5CRDA 3TGZA 3RHBA 5HFKA 1T4YA 3EMPA 3TCOA 3HY2A 1F9MA 4IHUA 3TKQA 2MMOA 2GS3A 1GLPA 1HYUA 1PGTA 3LFLA 3ZVJA 4E8HA 4X4JA 2PU9C 2HT9A 4BL7B 3UIWA 2YZUA 3Q18A 1PN0A 2E2MA 4TW5A 4L5LA 2DMMA 1HNAA 1M2AA 2WB9A 3LWAA 5LD0A 1T4ZA 4IP6A 4N30A 2FWFA 2GSTA 3U6VA 1B4PA 2YPMA 3VWWA 3VWUA 1YZXA 3GL3A 3WGDA 4OO5A 3UJ1A 4YQVA 4KSMA 4DSQA 2GSQA 2CAQA 4TXOB 3M3MA 1PD21 3LQ7A 3VURA 2H74A 2J9HA 1I9DA 1SL0B 1C72A 4K1FA 3D21A 14GSA 1TRWA 1PSQA 2VCTA 3TKSA 5F8BA 4JR4A 2WJUA 18GSA 3IAS2 2B3SA 4LMVA 2AUVA 5HR0A 2IN3A 2C3QA 1X0RA 4QQ7A 1SYXA 1DE1A 5A4WA 1ILOA 3GTUB 1NHOA 1V40A 2OBIA 4NPBA 1ST9A 2XC2A 3IDVA 4WETA 4HJMA 4Q5QA 4ZB9A 3W8SA 3IAM2 1YF0A 1SENA 3NOFA 3KH9A 4OFTA 2K8VA 3PH9A 1TK8B 4YQMA 3DVWA 4V2LA 2AHEA 2I81A 3D4MA 3ERWA 9GSSA 2H75A 1HQOA 3W6GA 1R26A 2H01A 2N5FA 2WS2A 5EL8A 4ICYA 5A5KA 2F9SA 3H79A 5ID2A 2V32A 4MCUA 3EVIA 2MMAA 2G2QA 1YEXA 2B5YA 2HRKA 1R7HA 2E2GA 2P0GA 3TRXA 1EP8A 4YAPA 2CV4A 1XVQA 4GSTA 1G7EA 1LBKA 1XOAA 5ENUA 4Z7XA 3CRUA 3M8NA 1GUMA 2DIYA 3I43A 1Z7PA 4EF0A 3S9FA 4N0VA 3VPTA 1WE0A 2C0EA 4JR6A 2WFCA 2REMA 5DALA 5J9BA 3IRAA 4ZL7A 3EU4A 2ALBA 5ECKB 3KEBA 1ERTA 4KA0A 5DCGA 4ACSA 5IOWA 4IS0A 5DQSA 3IPZA 4EO3A 4CY8A 4HU9A 4J56E 4TR1B 2V6OA 1M7TA 3C1SA 2Z9SA 3BD2A 2OKAA 1ERUA 2E0QA 1TP9A 1DUGA 5ECRB 4PGTA 11GSA 4F0CA 4IVFA 1VF1A 4MMMA 2FY6A 2N5AA 2KHPA 2YCDA 4BVXB 4OMVA 4MJEA 2WDUA 4IN0A 3G7JA 3QFAC 1TRVA 2V2GA 3ZMKA 5IPHA 1GSFA 2C4JA 1UN2A 1TRSA 1KTEA 2YN1A 1K0AA 2CA8A 3TJBA 5KN1A 4HDEA 3CMIA 1FOHA 4FYBA 4D73A 4USSA 1YQ1A 2XHFA 4MJAA 4IJ3A 4F2IA 4LL1B 4L8EA 1JLVA 2B7JA 2DKIA 1TXXA 3A2VA 1V9WA 1WIKA 2YJ7A 2ON7A 3F9UA 3KXOA 2JZSA 5HQPA 2YOIA 1E6BA 2MBTA 3HXSA 3H4KA 4KSOA 2C80A 3WGEA 4PUFC 3E9JB 2H76A 2PVOC 4JEDA 1HNBA 5KOWA 1TRUA 1FG4A 3CTGA 4AJ8A 3ZVJD 3LJRA 3P2AA 3US3A 5H5QA 5IIZA 4O7HA 4MJCA 1TK0B 3QDNA 4NHWA 1WPIA 4HQSA 1UA5A 2MBSA 3VI7A 3IBHA 1M99A 3WT1A 2H0IA 3DIEA 4IBPA 1ZCPA 4BA7A 4OD7A 2PBJA 5A4UA 1WOUA 5DDLA 4ZBAA 2IMIA 4MPFA 4V2MA 4OO4A 5AISA 1VF3A 3RHCA 1BX9A 2O85A 1QK8A 1B9XC 3RAZA 3KM6A 3TKRA 1X9MB 1OYJA 3WD6A 2P5RA 1KEBA 3APSA 5HR1A 4I5QA 1GUHA 3RPNA 4HUAA 4X1UA 5F06A 1F3BA 4KW6A 3MDKA 2HLSA 1VRSD 1DBYA 1WP0A 3UEMA 1KNGA 4ID0A 1ERVA 4WBJA 5CREA 3M9JA 4ZB6A 5IO2A 3VPQA 4WF4A 1A8YA 1N8JA 4DSRA 2DIZA 4N11A 2H0GA 2I3YA 4PNFA 1ZYNA 1PQNA 2PN8A 4HOJA 3FEUA 3QAGA 3EC3A 4CHSA 3C71A 1F6MC 2GSSA 5JCWA 1U87A 5IMFA 2L6CA 1YY7A 2LQOA 1EGOA 2KOKA 4J57E 5H5SA 1GL8A 2FCHA 2GVPA 3ZTLA 3DRNA 3A3TA 2MMZA 1TTZA 1XOBA 3TOUA 2JSZA 2RLIA 2VM2A 4HEA2 3HJPA 2TRXA 4KCAA 4WBRD 3D6IA 1GSUA 3ZFBA 2I4AA 1SD8A 4TXVA 3GL5A 1FB0A 2L4QA 1OVNA 2GGTA 3FW2A 1EOHA 3GSTA 1HD2A 3IC4A 1YKCA 4ILFA 4I8BA 3GA4A 4XS4A 1ZMAA 3C7MA 3J7Yb 2FWEA 3ZIJA 1YEPA 4RUVA 3TJFA 4FH8A 3VI5A 2VLVA 2ZNMA 4XRDA 1R5AA 4HJ2A 5LNKe 4IW9A 3A2WA 3GX8A 1S3DA 1BAYA 3BCIA 2LRCA 2OE3A 3O3TA 5ECQB 3NZNA 4MF6A 3K8NA 5DAKA 2D2ZA 5IQYA 5J4UA 2FWHA 4EDZA 1PN9A 2GTUA 4O32A 2LRTA 3IR4A 1Z3EA 2C0DA 4NAXA 1ZYPA 5D8IA 1GTBA 3KH7A 1YKAA 1B8XA 1YDKA 4ZILA 2HRAA 2YWOA 3TKPA 1VF2A 1JLWA 2F8FA 1TKDB 4NHZA 3HKRA 3A5WA 3GFKA 3P7XA 4O92A 6GSVA 1U88A 4MF5A 3C73A 4PQ1A 2B5EA 5B8AA 5IOXA 2WULA 3TRQA 5CRGA 4F03A 1TW9A 3KZQA 3A2XA 4H86A 3GMFA 3H1NA 1K0OA 3GH6A 3GSSA 1BQ7A 1XCCA 2JU5A 4KCEA 4IGJA 2YWIA 3QMXA 5IO0A 1O6JA 1JZOA 5FHIA 1MDIA 5JCUA 1USBA 2EC4A 4KDYA 4IQAA 4XS1A 2HSHA 3N5OA 2M46A 4BVYA 3C8EA 5EVOA 3LGCA 1TU8A 4AF2A 4FYCA 4K2DA 4EKZA 5JWQB 1ABAA 2DMLA 4NV5A 3F4SA 5AN1A 5J5NA 4EE0A 1MDJA 5G1LA 2OE1A 3UBKA 3M9KA 1FVKA 1Q98A 1R5PA 4PUAA 2RM5A 2YV9A 3FR6A 1OE7A 2FLSA 2VLTA 1M9BA 3LG6A 2VL3A 1TOFA 5IMDA 2IMKA 4NV2A 1X5DA 3JCML 2DBCA 2LTKA 3C1RA 2AB6A 3FY7A 1PMTA 10GSA 4PXOA 1O8WA 4CW9A 4EIPA 2C0GA 1R4WA 4FYUA 1OE8A 2CVKA 2CVDA 2LRNA 1NM3A 1EWXA 4IKHA 4LLRA 3WGXA 3I6AA 1EZKA 1ZYQB 4MZWA 4X0XA 1RW1A 4K7NA 4MK3A 4XRAA 1T1VA 2L5OA 3UVTA 4GCIA 1Y6EA 5H5RA 5CO3A 5AIVA 1A8LA 2C3TA 3DD3A 2OBKA 2HSMA 4PX1A 5LCZA 1JHBA 2A4HA 4QL7A 5ABRA 3VK9A 2YWNA 3GN3A 4AJ6A 1GSSA 3GKMA 2C0FA 4Z2UA 4TOPA 2LUSA 4MNNA 5HFIA 5D9TA 2QSIA 1DE2A 4HZ4A 5GAND 4DSSB 2YWMA 2AJQB 3ZYWA 4K7OA 4G2EA 2VCWA 4O5UA 4GWRA 1B9YC 2I9HA 4WR5A 1SKRB 1SJ6A 1A2JA 16GSA 6GSXA 2A4VA 1GWCA 5G1KA 4Q5RA 2IWTA 4BL7A 3QFBC 2LSTA 4A5PA 1JZRA 2A2SA 2RUFA 3LYPA 4YH2A 5DVBA 1DSBA 4E8EA 2H70A 4POBA 2ON5A 1QXHA 1CQGA 3E3EA 1A2MA 1M2DA 2VCVA 2O7KA 3TJJA 2YP6A 4HZ2A 13GSA 4MJBA 2YNXA 2NDOA 3ERFA 1PX7A 3HVXA 1QGVA 4ECCA 2CT6A 4RI7A 1TK5B 2F8AA 1J9BA 4POLA 2LEGA 3GNJA 3UOMA 5EY6A 4TXOA 4XCSA 2GZYA 4V2NA 4IJIA 1U3AA 5DCHA 2M80A 22GSA 4V1Ap 1EOGA 1T3BA 2GQKA 1ZGNA 2K18A 2R5GA 1WWJA 3ZL5A 2X99A 2H1AA 4RI6A 3ZREA 2DSAA 4XTSA 3DKSA 3KTBA 1TI1A 5D96A 3QOUA 2XPDA 4K5RA 2JL4A 3GTUA 3ZLPA 3ZZXA 3EINA 1V58A 2H72A 1SL2B 5IPGA 3RPPA 2J23A 3FZ9A 1KBNA 2HZEB 2R6KA 4OFNA 4KE3A 1XW6A 1J0FA 4OWYA 2F3MA 3LEFA 1ERWA 2NVLA 8GSSA 5E59A 2FWGA 2YJHA 4XIHA 4WKWA 3ERGA 2XBIA 3L78A 5B7CA 1F37A 5KOXA 2V1MA 2FUG2 3GX0A 4NWYA 1TDIA 2YZHA 1XBSA 3ME8A 3FR3A 2BMXA 3RDWA 3PINA 5F05A 3UBLA 4FIWA 2F51A 2CZ3A 2CX4A 2CVBA 2VIMA 3W8JA 4AGSA 5IMVA 4ML1A 1CQHA 3MWHA 1GP1A 2QA1A 3F3QA 4ECJA 3TOTA 1GSDA 2LJRA 1Y25A 4G0IA 4KAEA 4KX4A 4TR1A 1GH2A 2IIYA 1F3AA 3OR5A 2JADA 2IFQB 2H71A 4RQXA 1G6YA 5D9VA 4IELA 4ZL9A 2LJAA 2CZ2A 4BVXA 3L0HA 4KF9A 4ISDA 1Q4JA 1ML6A 3IA1A 1TJDA 1OC9B 3MAKA 1K3YA 3VFIA 1PX6A 3FHKA 1MEKA 1QUWA 1EGRA 5EPFA 5KN3A 3BOAA 3D0ZA 2HYXA 3CYNA 5INYA 3ZITA 5ECOB 2JACA 5G5FA 2KP1A 4WR4A 4AJ7A 3L9SA 3KIJA 1XWCA 2GT5A 1YF1A 2H1GA 4LA1A 1MTCA 1MD3A 1K0NA 4WF5A 5FWGA 3D4TA 1BJXA 5E4WA 5IMAA 2R2JA 1ZL9A 4V1Ag 5B6NA 2AYTA 1Z6MA 1X5CA 3VWXA 2JZTA 4MDCA 3R2QA 3GYKA 1SD9A 4Q5NA 2RM6A 4FO5A 4O5RA 3UL3A 4PNGA 4EIQA 2O89A 4EUYA 3WT2A 1HNCA 2PVQA 2R0PA 2HSYA 4K6XA 5G30A 4YKFA 3HVSA 1XPVA 1VGLA 2X8GA 4F82A 4OCEA 3O6TA 1XW5A 2H19A 1GNEA 3Q74A 3GKNA 3AY8A 4F9ZA 4JE1A 2FGXA 4OCFA 4IQ1A 1EEJA 4QL9A 3H8QA 1THXA 3TRPA 4TVEA 1WJKA 3BCKA 2GQLA 2HE3A 2VL9A 3TDGA 1SU9A 3FYGA 3ISOA 3F3RA 2YV7A 5F0GA 1MD4A 2CQ9A 4JRRA 6GSWA 1UVZA 3KTLA 2XPEA 3LW9A 4ZL8A 2UZ8A 1OC9A 2O8VB 4GTUA 3R3EA 1AC1A 1E2YA 1QQ2A 1EP7A 1M2BA 5BRTA 1FOVA 1T7PB 5G5EA 2QGVA 4KUNA 2VO4A 1GSEA 2DJ3A 4GQFA 2C3NA 1A24A 4JU5A 1XZOA 2ES7A 5KN0A 2CAIA 1GTIA 2NPBA 12GSA 3G9BA 4GRFA 1W4VA 3BBYA 4BWQA 5D9XA 1BYEA 2B1LA 4I2TA 3DXBA 1LJRA 2FNOA 3HZ8A 4YAVA 1GTAA 5COHA 5KN2A 2IMEA 5ELGA 1XVWA 1PRXA 3U5RE 3IC8A 3IE3A 1FHEA 1O73A 4G0KA 5DJMA 1SL1B 5C04A 1O8XA 4CY6A 6GSUA 4Z2RA 3GKKA 2DJ2A 4KB3A 3CTFA 1XWAA 2YANA 5DJLA 1S3CA 2LQQA 2O87A 3F6FA 2IMFA 1SYRA 5KEJA 2KLXA 2OE0A 4TR3A 6GSSA 3CBUA 1X5EA 3L9UA 5CP1A 3RBTA 4XHMA 4JBBA 3CXGA 4PQHA 1SK2A 2X8CA 2VCZA 2GQMA 3LXTA 5ID2B 3GH9A 2VLUA 2FHEA 2FA8A 1FB6A 3UARA 5B6MA 2H6ZA 4PQIA 2VD0A 5IM9A 2R3XA 4ZBBA 6GSTA 3PGTA 4ECBA 2MMNA 3F4TA 1U3IA 20GSA 2LJKA 2P5QA 1GNWA 5FT3A 1G6WA 4TR4A 4KDXA 2EIRA 4L5OA 2V6KA 4KH7A 3HZ4A 2LNSA 5DALB 2LS5A 4DVCA 2L6DA 4KNDA 3DEXA 1XWBA 2OACA 2GSRA 2VCQA 1K3OA 4RQRA 2K6VA 3QR6A 4MZBA 3DYRA 2HNLA 1NSWA 3TUEA 1H75A 3DWVA 5DQYA 2H6XA 4I2UA 3LORA 2R0CA 3IHGA 2GZPA 1B48A 4GQCA 3DGQA 1URMA 1AAZA 2MZCA 5AIXA 1EEMA 1GUKA 4TRXA 1AUCA 4PTSA 5DBQA 3FZAA 3IK9A 2PERA 4GLTA 2H6YA 1S3AA 2HI7A 2H0HA 2LV3A 1ZZYA 2VOCA 3IOSA 2H73A 4D73B 1W89A 1T8EB 2IL3A 3KMOA 4ZBDA 2XBQA 5IMZA 3ME7A 3KGKA 2DLXA 2RIIA 5GZZB 4MF7A 1OC3A 3GUSA 2BJXA 3FR9A 4MP4A 3VLNA 1N2AA 2C1YA 4XS6A 3FRCA 3I69A 2KUCA 1EV4A 4PURA 2N5BA 4P3YB 3HJOA 3WYWA 3HYPA 5GSSA 3UAPA 2L5LA 2R0GA 3G7YA 1I5GA 1PL1A 4GSNA 3F63A 4K0GA 2NBSA 4N0ZA 5ECSA 2B7KA 5IMCA 1XFLA 2JZRA 3KCMA 1BEDA 4WEYA 3KP8A 3CSHA 1G7OA 3EE2A 1SK0A 2HRNA 4TN8A 5A4VA 3EWLA 5C00A 3QAVA 1AW9A 1U6TA 3EPTA 1Z7RA 1XWGA 2HZFA 5CYYA 1AIUA 1PA3A 3SBCA 5D73A 2RUEA 4MABA 2IJYA 5JCGA 4ZIJA 4BWSA 3EMXA 2ZCTA 1O81A 4NMUA 3UMAA 1WRYA 4MH3A 2DC5A 4POKA 3QCPA 1PKWA 3MYDA 1BG5A 2VM1A 1G0TA 5ECMB 3MNGA 1SK1A 3CRTA 4DEJA 1SKWB 4K7IA 4EC0A 3FZ4A 1LU4A 2PUKC 2WZ9A 2L59A 1NHYA 2IPAA 1ON4A 2TRCP 2X49A 1GRXA 1WMJA 2P31A 2AV4A 4K5SA 1XWKA 1GULA 2H66A 1SJIA 5D9WA 3N9JA 5GAPD 2FA4A 3IK7A 1F2EA 4EVMA 2DJJA 1GLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GF0 A;  4NXI A;  4MPG A;  3D5J A;  3GV1 A;  1K0C A;  1A0F A;  1XXU A;  4GXZ A;  1AXD A;  1O7U A;  1UC7 A;  3GKX A;  4DSS A;  4ECI A;  3LSZ A;  3D22 A;  3EU3 A;  5G2Z A;  4MLY A;  2BTO T;  2X8H A;  1XIY A;  3LYK A;  4LL4 B;  1X9W B;  1FO5 A;  4JZQ A;  3IHQ A;  2H1B A;  3Q19 A;  4K9Z A;  2G0F A;  3I9V 2;  1GTU A;  2I1U A;  3F4R A;  1JZD A;  2GT6 A;  3LXZ A;  1Z6N A;  3F8U A;  1ZYE A;  5ELA A;  2A2R A;  4XS4 B;  1AQV A;  4L0U A;  1A0R P;  3NIV A;  4POM A;  3ZIV A;  4YQU A;  5F07 A;  3FKF A;  4EXJ A;  3BJ5 A;  3ZFL A;  1JFU A;  1PL2 A;  3L4N A;  3HVV A;  2QC7 A;  2VL2 C;  4EL1 A;  1IYI A;  4LMW A;  4BPY A;  2L4C A;  4MH2 A;  4KGI A;  5G31 A;  5DAK B;  2KP2 A;  1A23 A;  5L71 A;  1RK4 A;  4HS1 A;  1K0D A;  3EYT A;  2WRT A;  2PMT A;  1RQM A;  3EUR A;  3ZRD A;  1AQW A;  3HDC A;  3J7Y k;  2HRF A;  3TB2 A;  3TJK A;  4G19 A;  2WGR A;  5HR3 A;  3G7I A;  4I97 A;  5ECI B;  4MA9 A;  2K9F A;  1OC8 A;  4IP1 A;  1K0B A;  1TI3 A;  2R4V A;  3KMN A;  1OAZ A;  5JWR B;  1THO A;  2VUP A;  2H8L A;  3UVH A;  2HZE A;  4WXT A;  2FD3 A;  4TR0 A;  2GLR A;  2E7P A;  4HQZ A;  3Q6O A;  5ECP B;  1M9A A;  5HFG A;  5CRH A;  3CSJ A;  1FAA A;  5GST A;  4OFM A;  1GSQ A;  2NTO A;  4L0W A;  1M0U A;  4HI7 A;  2V41 A;  1XW9 A;  4ML6 A;  7GSS A;  4F0B A;  5D93 A;  2PGT A;  5ECN B;  3E0U A;  2HXK A;  1FVJ A;  3HD5 A;  3SWL A;  5J9C A;  3O76 A;  4K0N A;  5ECL B;  3GHA A;  4K8M A;  1OKT A;  3TKS E;  2VD1 A;  2DJ0 A;  3HJM A;  3M0F A;  4GSS A;  4ZXG A;  3VWV A;  2C8U A;  6GSY A;  5AGY A;  19GS A;  2K8S A;  3KD0 A;  2VL2 A;  3QPM A;  1FW1 A;  3GIX A;  3DML A;  2IFQ A;  1Z9H A;  2H30 A;  5JWO B;  4J2F A;  2DJK A;  2LKU A;  5B8B A;  5HR2 A;  1EV9 A;  1K3L A;  2JSY A;  4TKY A;  1X9S B;  4HU7 A;  4X43 A;  3P90 A;  2VCX A;  5J3R A;  2CX3 A;  4ULX A;  1PKZ A;  2GDR A;  1V2A A;  1K0M A;  3KJY A;  3APQ A;  2DJ1 A;  2VAF A;  2AAW A;  2L57 A;  3F6D A;  2B6M A;  1V98 A;  5CRW A;  3MSZ A;  2MYG A;  4N10 A;  2LNT A;  1OKD A;  1YJ6 A;  5J41 A;  3ED3 A;  2OAD A;  4KDU A;  1TU7 A;  2WCI A;  1QMV A;  3HHV A;  2X64 A;  3FZ5 A;  5CAX A;  1QFN A;  1VF4 A;  4ZB8 A;  4Q5F A;  2IMD A;  3GUR A;  4G10 A;  3HA9 A;  1T00 A;  1A2L A;  1SJZ A;  1Z5Y E;  3PR8 A;  1B4Q A;  3H93 A;  2ZUP A;  2OA7 A;  3IV4 A;  1IYH A;  4EDY A;  3V1W A;  2HFD A;  4I6X A;  3DVX A;  1J08 A;  3QD9 A;  1SKS B;  3TKS C;  2TIR A;  2EIQ A;  2M72 A;  3KP9 A;  2R37 A;  2EIO A;  1H4O A;  1AQX A;  2QKE A;  3FK8 A;  1JZW A;  2PWJ A;  3M1G A;  4G9H A;  17GS A;  2PPT A;  4CDO A;  3APO A;  1O85 A;  1V57 A;  2B5X A;  2GZZ A;  5ECH B;  3TJG A;  1MDK A;  1ZOF A;  2B1K A;  3ZML A;  3L9V A;  1GSY A;  5CNW A;  1ACV A;  3P8W A;  3F0I A;  2OJL A;  4MZC A;  3QAW A;  2H1D A;  3IXR A;  3GRX A;  3HCZ A;  1NW2 A;  3CSI A;  5CRD A;  3TGZ A;  3RHB A;  5HFK A;  1T4Y A;  3EMP A;  3TCO A;  3HY2 A;  1F9M A;  4IHU A;  3TKQ A;  2MMO A;  2GS3 A;  1GLP A;  1HYU A;  1PGT A;  3LFL A;  3ZVJ A;  4E8H A;  2PU9 C;  2HT9 A;  3UIW A;  2YZU A;  3Q18 A;  2E2M A;  4TW5 A;  4L5L A;  2DMM A;  1HNA A;  1M2A A;  2WB9 A;  3LWA A;  5LD0 A;  1T4Z A;  4IP6 A;  4N30 A;  2FWF A;  2GST A;  3U6V A;  1B4P A;  2YPM A;  3VWW A;  3VWU A;  1YZX A;  3GL3 A;  3WGD A;  4OO5 A;  3UJ1 A;  4YQV A;  4KSM A;  4DSQ A;  2GSQ A;  2CAQ A;  4TXO B;  3M3M A;  1PD2 1;  3LQ7 A;  3VUR A;  2H74 A;  2J9H A;  1I9D A;  1SL0 B;  1C72 A;  4K1F A;  3D21 A;  14GS A;  1TRW A;  1PSQ A;  2VCT A;  3TKS A;  5F8B A;  4JR4 A;  2WJU A;  18GS A;  3IAS 2;  2B3S A;  4LMV A;  2AUV A;  5HR0 A;  2IN3 A;  2C3Q A;  1X0R A;  4QQ7 A;  1SYX A;  1DE1 A;  5A4W A;  1ILO A;  3GTU B;  1NHO A;  1V40 A;  2OBI A;  4NPB A;  1ST9 A;  2XC2 A;  3IDV A;  4WET A;  4HJM A;  4Q5Q A;  4ZB9 A;  3W8S A;  3IAM 2;  1YF0 A;  1SEN A;  3NOF A;  3KH9 A;  4OFT A;  2K8V A;  3PH9 A;  1TK8 B;  4YQM A;  3DVW A;  4V2L A;  2AHE A;  2I81 A;  3D4M A;  3ERW A;  9GSS A;  2H75 A;  1HQO A;  3W6G A;  1R26 A;  2H01 A;  2N5F A;  2WS2 A;  5EL8 A;  5A5K A;  2F9S A;  3H79 A;  5ID2 A;  2V32 A;  4MCU A;  3EVI A;  2MMA A;  2G2Q A;  1YEX A;  2B5Y A;  1R7H A;  2E2G A;  2P0G A;  3TRX A;  1EP8 A;  4YAP A;  2CV4 A;  1XVQ A;  4GST A;  1G7E A;  1LBK A;  1XOA A;  5ENU A;  4Z7X A;  3CRU A;  3M8N A;  1GUM A;  2DIY A;  3I43 A;  1Z7P A;  4EF0 A;  3S9F A;  4N0V A;  3VPT A;  1WE0 A;  2C0E A;  4JR6 A;  2WFC A;  2REM A;  5DAL A;  5J9B A;  3IRA A;  4ZL7 A;  3EU4 A;  2ALB A;  5ECK B;  3KEB A;  1ERT A;  4KA0 A;  5DCG A;  4ACS A;  5IOW A;  4IS0 A;  5DQS A;  3IPZ A;  4EO3 A;  4HU9 A;  4J56 E;  4TR1 B;  2V6O A;  1M7T A;  3C1S A;  2Z9S A;  3BD2 A;  2OKA A;  1ERU A;  2E0Q A;  1TP9 A;  1DUG A;  5ECR B;  4PGT A;  11GS A;  4F0C A;  4IVF A;  1VF1 A;  4MMM A;  2FY6 A;  2N5A A;  2KHP A;  2YCD A;  4OMV A;  4MJE A;  2WDU A;  4IN0 A;  3G7J A;  3QFA C;  1TRV A;  2V2G A;  3ZMK A;  5IPH A;  1GSF A;  2C4J A;  1UN2 A;  1TRS A;  1KTE A;  2YN1 A;  1K0A A;  2CA8 A;  3TJB A;  5KN1 A;  4HDE A;  3CMI A;  4FYB A;  4D73 A;  1YQ1 A;  2XHF A;  4MJA A;  4IJ3 A;  4F2I A;  4LL1 B;  4L8E A;  1JLV A;  2B7J A;  1TXX A;  3A2V A;  1V9W A;  1WIK A;  2YJ7 A;  2ON7 A;  3F9U A;  3KXO A;  2JZS A;  5HQP A;  2YOI A;  1E6B A;  2MBT A;  3HXS A;  3H4K A;  4KSO A;  2C80 A;  3WGE A;  4PUF C;  3E9J B;  2H76 A;  2PVO C;  4JED A;  1HNB A;  1TRU A;  1FG4 A;  3CTG A;  4AJ8 A;  3ZVJ D;  3LJR A;  3P2A A;  3US3 A;  5H5Q A;  5IIZ A;  4O7H A;  4MJC A;  1TK0 B;  3QDN A;  4NHW A;  1WPI A;  4HQS A;  1UA5 A;  2MBS A;  3VI7 A;  3IBH A;  1M99 A;  3WT1 A;  2H0I A;  3DIE A;  4IBP A;  1ZCP A;  4BA7 A;  4OD7 A;  2PBJ A;  5A4U A;  1WOU A;  5DDL A;  4ZBA A;  2IMI A;  4MPF A;  4V2M A;  4OO4 A;  5AIS A;  1VF3 A;  3RHC A;  1BX9 A;  2O85 A;  1QK8 A;  1B9X C;  3RAZ A;  3KM6 A;  3TKR A;  1X9M B;  1OYJ A;  3WD6 A;  2P5R A;  1KEB A;  3APS A;  5HR1 A;  4I5Q A;  1GUH A;  3RPN A;  4HUA A;  4X1U A;  5F06 A;  1F3B A;  4KW6 A;  3MDK A;  2HLS A;  1VRS D;  1DBY A;  1WP0 A;  3UEM A;  1KNG A;  4ID0 A;  1ERV A;  4WBJ A;  5CRE A;  3M9J A;  4ZB6 A;  5IO2 A;  3VPQ A;  4WF4 A;  1A8Y A;  1N8J A;  4DSR A;  2DIZ A;  4N11 A;  2H0G A;  2I3Y A;  4PNF A;  1PQN A;  2PN8 A;  4HOJ A;  3FEU A;  3QAG A;  3EC3 A;  4CHS A;  3C71 A;  1F6M C;  2GSS A;  5JCW A;  1U87 A;  5IMF A;  2L6C A;  1YY7 A;  2LQO A;  1EGO A;  2KOK A;  4J57 E;  5H5S A;  1GL8 A;  2FCH A;  2GVP A;  3ZTL A;  3DRN A;  3A3T A;  2MMZ A;  1TTZ A;  1XOB A;  3TOU A;  2JSZ A;  2RLI A;  2VM2 A;  4HEA 2;  3HJP A;  2TRX A;  4KCA A;  4WBR D;  3D6I A;  1GSU A;  3ZFB A;  2I4A A;  1SD8 A;  4TXV A;  3GL5 A;  1FB0 A;  2L4Q A;  1OVN A;  2GGT A;  3FW2 A;  1EOH A;  3GST A;  1HD2 A;  3IC4 A;  1YKC A;  4ILF A;  4I8B A;  3GA4 A;  4XS4 A;  1ZMA A;  3C7M A;  3J7Y b;  2FWE A;  3ZIJ A;  1YEP A;  4RUV A;  3TJF A;  4FH8 A;  3VI5 A;  2VLV A;  2ZNM A;  4XRD A;  1R5A A;  4HJ2 A;  5LNK e;  4IW9 A;  3A2W A;  3GX8 A;  1S3D A;  1BAY A;  3BCI A;  2LRC A;  2OE3 A;  3O3T A;  5ECQ B;  3NZN A;  4MF6 A;  3K8N A;  5DAK A;  2D2Z A;  5IQY A;  5J4U A;  2FWH A;  4EDZ A;  1PN9 A;  2GTU A;  4O32 A;  2LRT A;  3IR4 A;  1Z3E A;  2C0D A;  4NAX A;  5D8I A;  1GTB A;  3KH7 A;  1YKA A;  1B8X A;  1YDK A;  4ZIL A;  2YWO A;  3TKP A;  1VF2 A;  1JLW A;  2F8F A;  1TKD B;  4NHZ A;  3HKR A;  3A5W A;  3GFK A;  3P7X A;  4O92 A;  6GSV A;  1U88 A;  4MF5 A;  3C73 A;  4PQ1 A;  2B5E A;  5B8A A;  5IOX A;  2WUL A;  3TRQ A;  5CRG A;  4F03 A;  1TW9 A;  3KZQ A;  3A2X A;  4H86 A;  3GMF A;  3H1N A;  1K0O A;  3GH6 A;  3GSS A;  1BQ7 A;  1XCC A;  2JU5 A;  4KCE A;  4IGJ A;  2YWI A;  3QMX A;  5IO0 A;  1O6J A;  1JZO A;  5FHI A;  1MDI A;  5JCU A;  1USB A;  2EC4 A;  4KDY A;  4IQA A;  4XS1 A;  2HSH A;  3N5O A;  2M46 A;  4BVY A;  3C8E A;  5EVO A;  3LGC A;  1TU8 A;  4AF2 A;  4FYC A;  4K2D A;  4EKZ A;  5JWQ B;  1ABA A;  2DML A;  4NV5 A;  3F4S A;  5AN1 A;  5J5N A;  4EE0 A;  1MDJ A;  5G1L A;  2OE1 A;  3UBK A;  3M9K A;  1FVK A;  1Q98 A;  1R5P A;  4PUA A;  2RM5 A;  2YV9 A;  3FR6 A;  1OE7 A;  2FLS A;  2VLT A;  1M9B A;  3LG6 A;  2VL3 A;  1TOF A;  5IMD A;  2IMK A;  4NV2 A;  1X5D A;  3JCM L;  2DBC A;  2LTK A;  3C1R A;  2AB6 A;  3FY7 A;  1PMT A;  10GS A;  4PXO A;  1O8W A;  4CW9 A;  2C0G A;  1R4W A;  4FYU A;  1OE8 A;  2CVK A;  2CVD A;  2LRN A;  1NM3 A;  1EWX A;  4IKH A;  4LLR A;  3WGX A;  3I6A A;  1EZK A;  1ZYQ B;  4MZW A;  4X0X A;  1RW1 A;  4K7N A;  4MK3 A;  4XRA A;  1T1V A;  2L5O A;  3UVT A;  4GCI A;  1Y6E A;  5H5R A;  5CO3 A;  5AIV A;  1A8L A;  2C3T A;  3DD3 A;  2OBK A;  4PX1 A;  5LCZ A;  1JHB A;  4QL7 A;  5ABR A;  3VK9 A;  2YWN A;  3GN3 A;  4AJ6 A;  1GSS A;  3GKM A;  2C0F A;  4TOP A;  2LUS A;  5HFI A;  5D9T A;  2QSI A;  1DE2 A;  4HZ4 A;  5GAN D;  4DSS B;  2YWM A;  2AJQ B;  3ZYW A;  4K7O A;  4G2E A;  2VCW A;  4GWR A;  1B9Y C;  2I9H A;  4WR5 A;  1SKR B;  1SJ6 A;  1A2J A;  16GS A;  6GSX A;  2A4V A;  1GWC A;  5G1K A;  4Q5R A;  2IWT A;  4BL7 A;  3QFB C;  2LST A;  1JZR A;  2A2S A;  2RUF A;  3LYP A;  4YH2 A;  5DVB A;  1DSB A;  4E8E A;  2H70 A;  4POB A;  2ON5 A;  1QXH A;  1CQG A;  3E3E A;  1A2M A;  1M2D A;  2VCV A;  2O7K A;  3TJJ A;  2YP6 A;  4HZ2 A;  13GS A;  4MJB A;  2YNX A;  2NDO A;  3ERF A;  1PX7 A;  3HVX A;  1QGV A;  4ECC A;  2CT6 A;  4RI7 A;  1TK5 B;  2F8A A;  1J9B A;  4POL A;  2LEG A;  3GNJ A;  3UOM A;  5EY6 A;  4TXO A;  4XCS A;  2GZY A;  4V2N A;  4IJI A;  1U3A A;  5DCH A;  2M80 A;  22GS A;  4V1A p;  1EOG A;  1T3B A;  2GQK A;  1ZGN A;  2K18 A;  2R5G A;  1WWJ A;  3ZL5 A;  2X99 A;  2H1A A;  4RI6 A;  3ZRE A;  2DSA A;  4XTS A;  3DKS A;  3KTB A;  1TI1 A;  5D96 A;  3QOU A;  2XPD A;  2JL4 A;  3GTU A;  3ZLP A;  3ZZX A;  3EIN A;  1V58 A;  2H72 A;  1SL2 B;  5IPG A;  3RPP A;  2J23 A;  3FZ9 A;  1KBN A;  2HZE B;  2R6K A;  4OFN A;  4KE3 A;  1XW6 A;  1J0F A;  4OWY A;  2F3M A;  3LEF A;  1ERW A;  2NVL A;  8GSS A;  5E59 A;  2FWG A;  2YJH A;  4XIH A;  4WKW A;  3ERG A;  2XBI A;  3L78 A;  5B7C A;  1F37 A;  2V1M A;  2FUG 2;  3GX0 A;  4NWY A;  1TDI A;  2YZH A;  1XBS A;  3ME8 A;  3FR3 A;  2BMX A;  3RDW A;  3PIN A;  5F05 A;  3UBL A;  4FIW A;  2F51 A;  2CZ3 A;  2CX4 A;  2CVB A;  2VIM A;  3W8J A;  4AGS A;  5IMV A;  4ML1 A;  1CQH A;  3MWH A;  1GP1 A;  3F3Q A;  4ECJ A;  3TOT A;  1GSD A;  2LJR A;  1Y25 A;  4KAE A;  4KX4 A;  4TR1 A;  1GH2 A;  2IIY A;  1F3A A;  3OR5 A;  2JAD A;  2IFQ B;  2H71 A;  4RQX A;  1G6Y A;  5D9V A;  4IEL A;  4ZL9 A;  2LJA A;  2CZ2 A;  4BVX A;  3L0H A;  4ISD A;  1Q4J A;  1ML6 A;  3IA1 A;  1TJD A;  1OC9 B;  3MAK A;  1K3Y A;  3VFI A;  1PX6 A;  3FHK A;  1MEK A;  1QUW A;  1EGR A;  5EPF A;  5KN3 A;  3BOA A;  3D0Z A;  2HYX A;  3CYN A;  5INY A;  3ZIT A;  5ECO B;  2JAC A;  5G5F A;  2KP1 A;  4WR4 A;  4AJ7 A;  3L9S A;  3KIJ A;  1XWC A;  2GT5 A;  1YF1 A;  2H1G A;  4LA1 A;  1MTC A;  1MD3 A;  1K0N A;  4WF5 A;  5FWG A;  3D4T A;  1BJX A;  5E4W A;  5IMA A;  2R2J A;  1ZL9 A;  4V1A g;  5B6N A;  2AYT A;  1Z6M A;  1X5C A;  3VWX A;  2JZT A;  4MDC A;  3R2Q A;  3GYK A;  1SD9 A;  4Q5N A;  2RM6 A;  4FO5 A;  4O5R A;  3UL3 A;  4PNG A;  2O89 A;  4EUY A;  3WT2 A;  1HNC A;  2PVQ A;  2HSY A;  4K6X A;  5G30 A;  3HVS A;  1XPV A;  1VGL A;  2X8G A;  4F82 A;  4OCE A;  3O6T A;  1XW5 A;  2H19 A;  1GNE A;  3Q74 A;  3GKN A;  3AY8 A;  4F9Z A;  4JE1 A;  2FGX A;  4OCF A;  4IQ1 A;  1EEJ A;  4QL9 A;  3H8Q A;  1THX A;  3TRP A;  4TVE A;  1WJK A;  3BCK A;  2GQL A;  2HE3 A;  2VL9 A;  3TDG A;  1SU9 A;  3FYG A;  3ISO A;  3F3R A;  2YV7 A;  5F0G A;  1MD4 A;  2CQ9 A;  4JRR A;  6GSW A;  1UVZ A;  3KTL A;  2XPE A;  4ZL8 A;  1OC9 A;  2O8V B;  4GTU A;  1AC1 A;  1E2Y A;  1QQ2 A;  1EP7 A;  1M2B A;  1FOV A;  1T7P B;  5G5E A;  2QGV A;  4KUN A;  2VO4 A;  1GSE A;  2DJ3 A;  4GQF A;  2C3N A;  1A24 A;  4JU5 A;  1XZO A;  2ES7 A;  5KN0 A;  2CAI A;  1GTI A;  2NPB A;  12GS A;  3G9B A;  4GRF A;  1W4V A;  3BBY A;  4BWQ A;  5D9X A;  1BYE A;  2B1L A;  4I2T A;  3DXB A;  1LJR A;  2FNO A;  3HZ8 A;  4YAV A;  1GTA A;  5COH A;  5KN2 A;  2IME A;  5ELG A;  1XVW A;  1PRX A;  3U5R E;  3IE3 A;  1FHE A;  1O73 A;  5DJM A;  1SL1 B;  5C04 A;  1O8X A;  6GSU A;  3GKK A;  2DJ2 A;  4KB3 A;  3CTF A;  1XWA A;  2YAN A;  5DJL A;  1S3C A;  2LQQ A;  2O87 A;  3F6F A;  2IMF A;  1SYR A;  5KEJ A;  2KLX A;  2OE0 A;  4TR3 A;  6GSS A;  3CBU A;  1X5E A;  3L9U A;  5CP1 A;  3RBT A;  4XHM A;  4JBB A;  3CXG A;  4PQH A;  1SK2 A;  2X8C A;  2VCZ A;  2GQM A;  3LXT A;  5ID2 B;  3GH9 A;  2VLU A;  2FHE A;  2FA8 A;  1FB6 A;  3UAR A;  5B6M A;  2H6Z A;  4PQI A;  2VD0 A;  5IM9 A;  2R3X A;  4ZBB A;  6GST A;  3PGT A;  4ECB A;  2MMN A;  3F4T A;  1U3I A;  20GS A;  2LJK A;  2P5Q A;  1GNW A;  5FT3 A;  1G6W A;  4TR4 A;  4KDX A;  2EIR A;  4L5O A;  2V6K A;  4KH7 A;  3HZ4 A;  2LNS A;  5DAL B;  2LS5 A;  4DVC A;  2L6D A;  4KND A;  3DEX A;  1XWB A;  2OAC A;  2GSR A;  2VCQ A;  1K3O A;  4RQR A;  2K6V A;  3QR6 A;  4MZB A;  3DYR A;  2HNL A;  1NSW A;  3TUE A;  1H75 A;  3DWV A;  5DQY A;  2H6X A;  4I2U A;  3LOR A;  2GZP A;  1B48 A;  4GQC A;  3DGQ A;  1URM A;  1AAZ A;  2MZC A;  5AIX A;  1EEM A;  1GUK A;  4TRX A;  1AUC A;  5DBQ A;  3FZA A;  3IK9 A;  2PER A;  4GLT A;  2H6Y A;  1S3A A;  2HI7 A;  2H0H A;  2LV3 A;  1ZZY A;  2VOC A;  3IOS A;  2H73 A;  4D73 B;  1W89 A;  1T8E B;  2IL3 A;  3KMO A;  4ZBD A;  2XBQ A;  5IMZ A;  3ME7 A;  3KGK A;  2DLX A;  2RII A;  5GZZ B;  4MF7 A;  1OC3 A;  3GUS A;  2BJX A;  3FR9 A;  4MP4 A;  3VLN A;  1N2A A;  2C1Y A;  4XS6 A;  3FRC A;  3I69 A;  2KUC A;  1EV4 A;  4PUR A;  2N5B A;  4P3Y B;  3HJO A;  3WYW A;  3HYP A;  5GSS A;  3UAP A;  2L5L A;  3G7Y A;  1I5G A;  1PL1 A;  4GSN A;  3F63 A;  4K0G A;  2NBS A;  4N0Z A;  5ECS A;  2B7K A;  5IMC A;  1XFL A;  2JZR A;  3KCM A;  1BED A;  4WEY A;  3KP8 A;  3CSH A;  1G7O A;  3EE2 A;  1SK0 A;  2HRN A;  4TN8 A;  5A4V A;  3EWL A;  5C00 A;  3QAV A;  1AW9 A;  1U6T A;  1Z7R A;  1XWG A;  2HZF A;  5CYY A;  1AIU A;  1PA3 A;  3SBC A;  5D73 A;  2RUE A;  4MAB A;  2IJY A;  5JCG A;  4ZIJ A;  4BWS A;  3EMX A;  2ZCT A;  1O81 A;  4NMU A;  3UMA A;  1WRY A;  4MH3 A;  2DC5 A;  4POK A;  3QCP A;  1PKW A;  1BG5 A;  2VM1 A;  1G0T A;  5ECM B;  3MNG A;  1SK1 A;  3CRT A;  4DEJ A;  1SKW B;  4K7I A;  4EC0 A;  3FZ4 A;  1LU4 A;  2PUK C;  2WZ9 A;  2L59 A;  1NHY A;  2IPA A;  1ON4 A;  2TRC P;  1GRX A;  1WMJ A;  2P31 A;  2AV4 A;  1XWK A;  1GUL A;  2H66 A;  1SJI A;  5D9W A;  3N9J A;  5GAP D;  2FA4 A;  3IK7 A;  1F2E A;  4EVM A;  2DJJ A;  1GLQ A; 
#chains in the Genus database with same CATH topology
 4GF0 A;  4NXI A;  4MPG A;  3D5J A;  3GV1 A;  1K0C A;  1A0F A;  1XXU A;  4GXZ A;  1AXD A;  1O7U A;  1UC7 A;  3GKX A;  4DSS A;  4ECI A;  2QA2 A;  3LSZ A;  3D22 A;  3EU3 A;  5G2Z A;  4MLY A;  2BTO T;  2X8H A;  1XIY A;  3LYK A;  4LL4 B;  1X9W B;  1FO5 A;  4JZQ A;  3IHQ A;  2H1B A;  3Q19 A;  4K9Z A;  2G0F A;  3I9V 2;  1GTU A;  2I1U A;  3F4R A;  1JZD A;  2GT6 A;  3LXZ A;  1Z6N A;  3F8U A;  1ZYE A;  5ELA A;  5BMU A;  2A2R A;  4XS4 B;  1AQV A;  4L0U A;  1A0R P;  3NIV A;  4POM A;  3ZIV A;  4YQU A;  5F07 A;  2A2P A;  3FKF A;  4EXJ A;  3BJ5 A;  3ZFL A;  1JFU A;  1PL2 A;  3L4N A;  3HVV A;  2QC7 A;  2VL2 C;  4EL1 A;  1S3R A;  1IYI A;  2DKH A;  4LMW A;  4BPY A;  2L4C A;  4MH2 A;  4KGI A;  5G31 A;  5DAK B;  2KP2 A;  1A23 A;  5L71 A;  1RK4 A;  4HS1 A;  1K0D A;  3EYT A;  2WRT A;  2PMT A;  1RQM A;  3EUR A;  3ZRD A;  1AQW A;  3HDC A;  3FMW A;  3J7Y k;  2HRF A;  3TB2 A;  3TJK A;  4G19 A;  2WGR A;  5HR3 A;  3G7I A;  4I97 A;  5ECI B;  4MA9 A;  2K9F A;  1OC8 A;  4IP1 A;  1K0B A;  1TI3 A;  2R4V A;  3KMN A;  1OAZ A;  5JWR B;  1THO A;  2VUP A;  2H8L A;  3UVH A;  4G0L A;  2HZE A;  4FQU A;  4WXT A;  2FD3 A;  4TR0 A;  2GLR A;  2E7P A;  4HQZ A;  4Z2T A;  3Q6O A;  2X4A A;  5ECP B;  1M9A A;  5HFG A;  5CRH A;  3CSJ A;  1FAA A;  5GST A;  4OFM A;  1GSQ A;  2NTO A;  4L0W A;  1M0U A;  4HI7 A;  2V41 A;  1XW9 A;  4ML6 A;  7GSS A;  4F0B A;  5D93 A;  2PGT A;  5ECN B;  3E0U A;  2HXK A;  1FVJ A;  3HD5 A;  3SWL A;  5J9C A;  3O76 A;  4K0N A;  5ECL B;  3GHA A;  4K8M A;  1OKT A;  3TKS E;  2VD1 A;  2DJ0 A;  3HJM A;  4BVY B;  3M0F A;  4GSS A;  4ZXG A;  3VWV A;  2C8U A;  6GSY A;  5AGY A;  19GS A;  2K8S A;  3KD0 A;  2VL2 A;  3QPM A;  1FW1 A;  3GIX A;  3PPU A;  3DML A;  2IFQ A;  1Z9H A;  2H30 A;  5JWO B;  4J2F A;  2DJK A;  2LKU A;  5B8B A;  4K2X A;  5HR2 A;  1EV9 A;  1K3L A;  2JSY A;  4TKY A;  1X9S B;  4HU7 A;  4X43 A;  3P90 A;  2VCX A;  5J3R A;  2CX3 A;  4ULX A;  1PKZ A;  2GDR A;  1V2A A;  1K0M A;  3KJY A;  3APQ A;  2DJ1 A;  2VAF A;  2AAW A;  2L57 A;  3F6D A;  2B6M A;  4YKG A;  1V98 A;  5CRW A;  3A5I A;  3MSZ A;  2MYG A;  4N10 A;  2LNT A;  1OKD A;  1YJ6 A;  5J41 A;  3ED3 A;  2OAD A;  4KDU A;  1TU7 A;  2WCI A;  1QMV A;  3HHV A;  2X64 A;  3FZ5 A;  5CAX A;  1QFN A;  1VF4 A;  4ZB8 A;  4Q5F A;  2IMD A;  3GUR A;  4G10 A;  3HA9 A;  1T00 A;  1A2L A;  1SJZ A;  1Z5Y E;  3PR8 A;  1B4Q A;  3H93 A;  2ZUP A;  2OA7 A;  3IV4 A;  1IYH A;  4EDY A;  3V1W A;  2HFD A;  4I6X A;  3DVX A;  1J08 A;  3QD9 A;  1SKS B;  3TKS C;  2TIR A;  2EIQ A;  2M72 A;  3KP9 A;  4O5Q A;  2R37 A;  2EIO A;  1H4O A;  1AQX A;  2QKE A;  3FK8 A;  1JZW A;  2PWJ A;  3M1G A;  4G9H A;  17GS A;  2PPT A;  4CDO A;  3APO A;  1O85 A;  1V57 A;  3MIX A;  2B5X A;  2GZZ A;  5ECH B;  3TJG A;  1MDK A;  1ZOF A;  2B1K A;  3ZML A;  3L9V A;  1GSY A;  5CNW A;  1ACV A;  3P8W A;  3F0I A;  2OJL A;  4MZC A;  3QAW A;  2H1D A;  3IXR A;  3GRX A;  3HCZ A;  1NW2 A;  3CSI A;  5CRD A;  3TGZ A;  3RHB A;  5HFK A;  1T4Y A;  3EMP A;  3TCO A;  3HY2 A;  1F9M A;  4IHU A;  3TKQ A;  2MMO A;  2GS3 A;  1GLP A;  1HYU A;  1PGT A;  3LFL A;  3ZVJ A;  4E8H A;  4X4J A;  2PU9 C;  2HT9 A;  4BL7 B;  3UIW A;  2YZU A;  3Q18 A;  1PN0 A;  2E2M A;  4TW5 A;  4L5L A;  2DMM A;  1HNA A;  1M2A A;  2WB9 A;  3LWA A;  5LD0 A;  1T4Z A;  4IP6 A;  4N30 A;  2FWF A;  2GST A;  3U6V A;  1B4P A;  2YPM A;  3VWW A;  3VWU A;  1YZX A;  3GL3 A;  3WGD A;  4OO5 A;  3UJ1 A;  4YQV A;  4KSM A;  4DSQ A;  2GSQ A;  2CAQ A;  4TXO B;  3M3M A;  1PD2 1;  3LQ7 A;  3VUR A;  2H74 A;  2J9H A;  1I9D A;  1SL0 B;  1C72 A;  4K1F A;  3D21 A;  14GS A;  1TRW A;  1PSQ A;  2VCT A;  3TKS A;  5F8B A;  4JR4 A;  2WJU A;  18GS A;  3IAS 2;  2B3S A;  4LMV A;  2AUV A;  5HR0 A;  2IN3 A;  2C3Q A;  1X0R A;  4QQ7 A;  1SYX A;  1DE1 A;  5A4W A;  1ILO A;  3GTU B;  1NHO A;  1V40 A;  2OBI A;  4NPB A;  1ST9 A;  2XC2 A;  3IDV A;  4WET A;  4HJM A;  4Q5Q A;  4ZB9 A;  3W8S A;  3IAM 2;  1YF0 A;  1SEN A;  3NOF A;  3KH9 A;  4OFT A;  2K8V A;  3PH9 A;  1TK8 B;  4YQM A;  3DVW A;  4V2L A;  2AHE A;  2I81 A;  3D4M A;  3ERW A;  9GSS A;  2H75 A;  1HQO A;  3W6G A;  1R26 A;  2H01 A;  2N5F A;  2WS2 A;  5EL8 A;  4ICY A;  5A5K A;  2F9S A;  3H79 A;  5ID2 A;  2V32 A;  4MCU A;  3EVI A;  2MMA A;  2G2Q A;  1YEX A;  2B5Y A;  2HRK A;  1R7H A;  2E2G A;  2P0G A;  3TRX A;  1EP8 A;  4YAP A;  2CV4 A;  1XVQ A;  4GST A;  1G7E A;  1LBK A;  1XOA A;  5ENU A;  1PFO A;  4Z7X A;  3CRU A;  3M8N A;  1GUM A;  2DIY A;  3I43 A;  1Z7P A;  4EF0 A;  3S9F A;  4N0V A;  3VPT A;  1WE0 A;  2C0E A;  4JR6 A;  2WFC A;  2REM A;  5DAL A;  5J9B A;  3IRA A;  4ZL7 A;  3EU4 A;  2ALB A;  5ECK B;  3KEB A;  1ERT A;  4KA0 A;  5DCG A;  4ACS A;  5IOW A;  4IS0 A;  5DQS A;  1XG8 A;  3IPZ A;  4EO3 A;  4CY8 A;  4HU9 A;  4J56 E;  4TR1 B;  2V6O A;  1M7T A;  3C1S A;  2Z9S A;  3BD2 A;  2OKA A;  1ERU A;  2E0Q A;  1TP9 A;  1DUG A;  5ECR B;  4PGT A;  11GS A;  4F0C A;  4IVF A;  1VF1 A;  4MMM A;  2FY6 A;  2N5A A;  2KHP A;  2YCD A;  4BVX B;  4OMV A;  4MJE A;  2WDU A;  4IN0 A;  3G7J A;  3QFA C;  1TRV A;  2V2G A;  3ZMK A;  5IPH A;  1GSF A;  2C4J A;  1UN2 A;  1TRS A;  1KTE A;  2YN1 A;  1K0A A;  2CA8 A;  3TJB A;  5KN1 A;  4HDE A;  3CMI A;  1FOH A;  4FYB A;  4D73 A;  4USS A;  1YQ1 A;  2XHF A;  4MJA A;  4IJ3 A;  3HVN A;  4F2I A;  4LL1 B;  4L8E A;  1JLV A;  2B7J A;  2DKI A;  1TXX A;  3A2V A;  1V9W A;  1WIK A;  2YJ7 A;  2ON7 A;  3F9U A;  3KXO A;  2JZS A;  5HQP A;  2YOI A;  1E6B A;  2MBT A;  3HXS A;  3H4K A;  4KSO A;  2C80 A;  3WGE A;  4PUF C;  3E9J B;  2H76 A;  2PVO C;  4JED A;  1HNB A;  5KOW A;  1TRU A;  1FG4 A;  3CTG A;  4AJ8 A;  3ZVJ D;  3LJR A;  3P2A A;  3US3 A;  5H5Q A;  5IIZ A;  4O7H A;  4MJC A;  1TK0 B;  3QDN A;  4NHW A;  1WPI A;  4HQS A;  1UA5 A;  2MBS A;  3VI7 A;  1M3J A;  3IBH A;  1M99 A;  3WT1 A;  2H0I A;  3DIE A;  4IBP A;  1ZCP A;  4BA7 A;  4OD7 A;  2PBJ A;  5A4U A;  1WOU A;  5DDL A;  4ZBA A;  2IMI A;  4MPF A;  4V2M A;  4OO4 A;  5AIS A;  1VF3 A;  3RHC A;  1BX9 A;  2O85 A;  1QK8 A;  1B9X C;  3RAZ A;  3KM6 A;  3TKR A;  1X9M B;  1OYJ A;  3WD6 A;  2P5R A;  1KEB A;  3APS A;  5HR1 A;  4I5Q A;  1GUH A;  3RPN A;  4HUA A;  4X1U A;  5F06 A;  1F3B A;  4KW6 A;  3MDK A;  2HLS A;  1VRS D;  1DBY A;  1WP0 A;  3UEM A;  1KNG A;  4ID0 A;  1ERV A;  4WBJ A;  5CRE A;  3M9J A;  4ZB6 A;  5IO2 A;  3VPQ A;  4WF4 A;  1A8Y A;  1N8J A;  4DSR A;  2DIZ A;  4N11 A;  2H0G A;  2I3Y A;  4PNF A;  1ZYN A;  1PQN A;  2PN8 A;  4HOJ A;  3FEU A;  3QAG A;  3EC3 A;  4CHS A;  3C71 A;  1F6M C;  2GSS A;  5JCW A;  1U87 A;  5IMF A;  2L6C A;  1YY7 A;  2LQO A;  1EGO A;  2KOK A;  4J57 E;  5H5S A;  1GL8 A;  2FCH A;  2GVP A;  3ZTL A;  3DRN A;  3A3T A;  2MMZ A;  1TTZ A;  1XOB A;  3TOU A;  2JSZ A;  2RLI A;  2VM2 A;  4HEA 2;  3HJP A;  2TRX A;  4KCA A;  4WBR D;  3D6I A;  1GSU A;  3ZFB A;  2I4A A;  1SD8 A;  4TXV A;  3GL5 A;  1FB0 A;  2L4Q A;  1OVN A;  2GGT A;  3FW2 A;  1EOH A;  3GST A;  1HD2 A;  3IC4 A;  1YKC A;  4ILF A;  4I8B A;  3GA4 A;  4XS4 A;  1ZMA A;  3C7M A;  3J7Y b;  2FWE A;  3ZIJ A;  1YEP A;  4RUV A;  3TJF A;  4FH8 A;  3VI5 A;  2VLV A;  2ZNM A;  4XRD A;  1R5A A;  4HJ2 A;  5LNK e;  4IW9 A;  3A2W A;  3GX8 A;  1S3D A;  1BAY A;  3BCI A;  2LRC A;  2OE3 A;  3O3T A;  5ECQ B;  3NZN A;  4MF6 A;  3K8N A;  5DAK A;  2D2Z A;  5IQY A;  5J4U A;  2FWH A;  4EDZ A;  1PN9 A;  2GTU A;  4O32 A;  2LRT A;  3IR4 A;  1Z3E A;  2C0D A;  4NAX A;  1ZYP A;  5D8I A;  1GTB A;  3KH7 A;  1YKA A;  1B8X A;  1YDK A;  4ZIL A;  2HRA A;  2YWO A;  3TKP A;  1VF2 A;  1JLW A;  2F8F A;  1TKD B;  4NHZ A;  3HKR A;  3A5W A;  3GFK A;  3P7X A;  4O92 A;  6GSV A;  1U88 A;  4MF5 A;  3C73 A;  4PQ1 A;  2B5E A;  5B8A A;  5IOX A;  2WUL A;  1M3I A;  3TRQ A;  5CRG A;  4F03 A;  1TW9 A;  3KZQ A;  3A2X A;  4H86 A;  3GMF A;  3H1N A;  1K0O A;  3GH6 A;  3GSS A;  1BQ7 A;  1XCC A;  2JU5 A;  4KCE A;  4IGJ A;  2YWI A;  3QMX A;  5IO0 A;  1O6J A;  1JZO A;  5FHI A;  1MDI A;  5JCU A;  1USB A;  2EC4 A;  4KDY A;  4IQA A;  4XS1 A;  2HSH A;  3N5O A;  2M46 A;  4BVY A;  3C8E A;  5EVO A;  3LGC A;  1TU8 A;  4AF2 A;  4FYC A;  4K2D A;  4EKZ A;  5JWQ B;  1ABA A;  2DML A;  4NV5 A;  3F4S A;  5AN1 A;  5J5N A;  4EE0 A;  1MDJ A;  5G1L A;  2OE1 A;  3UBK A;  3M9K A;  1FVK A;  1Q98 A;  1R5P A;  4PUA A;  2RM5 A;  2YV9 A;  3FR6 A;  1OE7 A;  2FLS A;  2VLT A;  1M9B A;  3LG6 A;  2VL3 A;  1TOF A;  5IMD A;  2IMK A;  4NV2 A;  1X5D A;  3JCM L;  2DBC A;  2LTK A;  3C1R A;  2AB6 A;  3FY7 A;  1PMT A;  10GS A;  4PXO A;  1O8W A;  4CW9 A;  4EIP A;  2C0G A;  1R4W A;  4FYU A;  1OE8 A;  2CVK A;  2CVD A;  2LRN A;  1NM3 A;  1EWX A;  4IKH A;  4LLR A;  3WGX A;  3I6A A;  1EZK A;  1ZYQ B;  4MZW A;  4X0X A;  1RW1 A;  4K7N A;  4MK3 A;  4XRA A;  1T1V A;  2L5O A;  3UVT A;  4GCI A;  1Y6E A;  5H5R A;  5CO3 A;  5AIV A;  1A8L A;  2C3T A;  3DD3 A;  2OBK A;  2HSM A;  4PX1 A;  5LCZ A;  1JHB A;  2A4H A;  4QL7 A;  5ABR A;  3VK9 A;  2YWN A;  3GN3 A;  4AJ6 A;  1GSS A;  3GKM A;  2C0F A;  4Z2U A;  4TOP A;  2LUS A;  4MNN A;  5HFI A;  5D9T A;  2QSI A;  1DE2 A;  4HZ4 A;  5GAN D;  4DSS B;  2YWM A;  2AJQ B;  3ZYW A;  4K7O A;  4G2E A;  2VCW A;  4O5U A;  4GWR A;  1B9Y C;  2I9H A;  4WR5 A;  1SKR B;  1SJ6 A;  1A2J A;  16GS A;  6GSX A;  2A4V A;  1GWC A;  5G1K A;  4Q5R A;  2IWT A;  4BL7 A;  3QFB C;  2LST A;  4A5P A;  1JZR A;  2A2S A;  2RUF A;  3LYP A;  4YH2 A;  5DVB A;  1DSB A;  4E8E A;  2H70 A;  4POB A;  2ON5 A;  1QXH A;  1CQG A;  3E3E A;  1A2M A;  1M2D A;  2VCV A;  2O7K A;  3TJJ A;  2YP6 A;  4HZ2 A;  13GS A;  4MJB A;  2YNX A;  2NDO A;  3ERF A;  1PX7 A;  3HVX A;  1QGV A;  4ECC A;  2CT6 A;  4RI7 A;  1TK5 B;  2F8A A;  1J9B A;  4POL A;  2LEG A;  3GNJ A;  3UOM A;  5EY6 A;  4TXO A;  4XCS A;  2GZY A;  4V2N A;  4IJI A;  1U3A A;  5DCH A;  2M80 A;  22GS A;  4V1A p;  1EOG A;  1T3B A;  2GQK A;  1ZGN A;  2K18 A;  2R5G A;  1WWJ A;  3ZL5 A;  2X99 A;  2H1A A;  4RI6 A;  3ZRE A;  2DSA A;  4XTS A;  3DKS A;  3KTB A;  1TI1 A;  5D96 A;  3QOU A;  2XPD A;  4K5R A;  2JL4 A;  3GTU A;  3ZLP A;  3ZZX A;  3EIN A;  1V58 A;  2H72 A;  1SL2 B;  5IPG A;  3RPP A;  2J23 A;  3FZ9 A;  1KBN A;  2HZE B;  2R6K A;  4OFN A;  4KE3 A;  1XW6 A;  1J0F A;  4OWY A;  2F3M A;  3LEF A;  1ERW A;  2NVL A;  8GSS A;  5E59 A;  2FWG A;  2YJH A;  4XIH A;  4WKW A;  3ERG A;  2XBI A;  3L78 A;  5B7C A;  1F37 A;  5KOX A;  2V1M A;  2FUG 2;  3GX0 A;  4NWY A;  1TDI A;  2YZH A;  1XBS A;  3ME8 A;  4HSC X;  3FR3 A;  2BMX A;  3RDW A;  3PIN A;  5F05 A;  3UBL A;  4FIW A;  2F51 A;  2CZ3 A;  2CX4 A;  2CVB A;  2VIM A;  3W8J A;  4AGS A;  5IMV A;  4ML1 A;  1CQH A;  3MWH A;  1GP1 A;  2QA1 A;  3F3Q A;  4ECJ A;  3TOT A;  1GSD A;  2LJR A;  1Y25 A;  4G0I A;  4KAE A;  4KX4 A;  4TR1 A;  1GH2 A;  2IIY A;  1F3A A;  3OR5 A;  2JAD A;  2IFQ B;  2H71 A;  4RQX A;  1G6Y A;  5D9V A;  4IEL A;  4ZL9 A;  2LJA A;  2CZ2 A;  4BVX A;  3L0H A;  4KF9 A;  4ISD A;  1Q4J A;  1ML6 A;  3IA1 A;  1TJD A;  1OC9 B;  3MAK A;  1K3Y A;  3VFI A;  1PX6 A;  3FHK A;  1MEK A;  1QUW A;  1EGR A;  5EPF A;  5KN3 A;  3BOA A;  3D0Z A;  2HYX A;  3CYN A;  5INY A;  3ZIT A;  5ECO B;  2JAC A;  5G5F A;  2KP1 A;  4WR4 A;  4AJ7 A;  3L9S A;  3KIJ A;  1XWC A;  2GT5 A;  1YF1 A;  2H1G A;  4LA1 A;  1MTC A;  1MD3 A;  1K0N A;  4WF5 A;  5FWG A;  3D4T A;  1BJX A;  5E4W A;  5IMA A;  2R2J A;  1ZL9 A;  4V1A g;  5B6N A;  2AYT A;  1Z6M A;  1X5C A;  3VWX A;  2JZT A;  4MDC A;  3R2Q A;  3GYK A;  1SD9 A;  4Q5N A;  2RM6 A;  4FO5 A;  4O5R A;  3UL3 A;  4PNG A;  4EIQ A;  2O89 A;  4EUY A;  3WT2 A;  1HNC A;  2PVQ A;  2R0P A;  2HSY A;  4K6X A;  5G30 A;  4YKF A;  3HVS A;  1XPV A;  1VGL A;  2X8G A;  4F82 A;  4OCE A;  3O6T A;  1XW5 A;  2H19 A;  1GNE A;  3Q74 A;  3GKN A;  3AY8 A;  4F9Z A;  4JE1 A;  2FGX A;  4OCF A;  4IQ1 A;  1EEJ A;  4QL9 A;  3H8Q A;  1THX A;  3TRP A;  4TVE A;  1WJK A;  3BCK A;  2GQL A;  2HE3 A;  2VL9 A;  3TDG A;  1SU9 A;  3FYG A;  3ISO A;  3F3R A;  2YV7 A;  5F0G A;  1MD4 A;  2CQ9 A;  4JRR A;  6GSW A;  1UVZ A;  3KTL A;  2XPE A;  3LW9 A;  4ZL8 A;  2UZ8 A;  1OC9 A;  2O8V B;  4GTU A;  3R3E A;  1AC1 A;  1E2Y A;  1QQ2 A;  1EP7 A;  1M2B A;  5BRT A;  1FOV A;  1T7P B;  5G5E A;  2QGV A;  4KUN A;  2VO4 A;  1GSE A;  2DJ3 A;  4GQF A;  2C3N A;  1A24 A;  4JU5 A;  1XZO A;  2ES7 A;  5KN0 A;  2CAI A;  1GTI A;  2NPB A;  12GS A;  3G9B A;  4GRF A;  1W4V A;  3BBY A;  4BWQ A;  5D9X A;  1BYE A;  2B1L A;  4I2T A;  3DXB A;  1LJR A;  2FNO A;  3HZ8 A;  4YAV A;  1GTA A;  5COH A;  5KN2 A;  2IME A;  5ELG A;  1XVW A;  1PRX A;  3U5R E;  3IC8 A;  3IE3 A;  1FHE A;  1O73 A;  4G0K A;  5DJM A;  1SL1 B;  5C04 A;  1O8X A;  4CY6 A;  6GSU A;  4Z2R A;  3GKK A;  2DJ2 A;  4KB3 A;  3CTF A;  1XWA A;  2YAN A;  5DJL A;  1S3C A;  2LQQ A;  2O87 A;  3F6F A;  2IMF A;  1SYR A;  5KEJ A;  2KLX A;  2OE0 A;  4TR3 A;  6GSS A;  3CBU A;  1X5E A;  3L9U A;  5CP1 A;  3RBT A;  4XHM A;  4JBB A;  3CXG A;  4PQH A;  1SK2 A;  2X8C A;  2VCZ A;  2GQM A;  3LXT A;  5ID2 B;  3GH9 A;  2VLU A;  2FHE A;  2FA8 A;  1FB6 A;  3UAR A;  5B6M A;  2H6Z A;  4PQI A;  2VD0 A;  5IM9 A;  2R3X A;  4ZBB A;  6GST A;  3PGT A;  4ECB A;  2MMN A;  3F4T A;  1U3I A;  20GS A;  2LJK A;  2P5Q A;  1GNW A;  5FT3 A;  1G6W A;  4TR4 A;  4KDX A;  2EIR A;  4L5O A;  2V6K A;  4KH7 A;  3HZ4 A;  2LNS A;  5DAL B;  2LS5 A;  4DVC A;  2L6D A;  4KND A;  3DEX A;  1XWB A;  2OAC A;  2GSR A;  2VCQ A;  1K3O A;  4RQR A;  2K6V A;  3QR6 A;  4MZB A;  3DYR A;  2HNL A;  1NSW A;  3TUE A;  1H75 A;  3CQF A;  3DWV A;  5DQY A;  2H6X A;  4I2U A;  3LOR A;  2R0C A;  3IHG A;  2GZP A;  1B48 A;  4GQC A;  3DGQ A;  1URM A;  1AAZ A;  2MZC A;  5AIX A;  1EEM A;  1GUK A;  4TRX A;  1AUC A;  4PTS A;  5DBQ A;  3FZA A;  3IK9 A;  2PER A;  4GLT A;  2H6Y A;  1S3A A;  2HI7 A;  2H0H A;  2LV3 A;  1ZZY A;  2VOC A;  3IOS A;  2H73 A;  4D73 B;  1W89 A;  1T8E B;  2IL3 A;  3KMO A;  4ZBD A;  2XBQ A;  5IMZ A;  3ME7 A;  3KGK A;  2DLX A;  2RII A;  5GZZ B;  4MF7 A;  1OC3 A;  3GUS A;  2BJX A;  3FR9 A;  4MP4 A;  3VLN A;  1N2A A;  2C1Y A;  4XS6 A;  3FRC A;  3I69 A;  2KUC A;  4BIK A;  1EV4 A;  4PUR A;  2N5B A;  4P3Y B;  3HJO A;  3WYW A;  3HYP A;  5GSS A;  3UAP A;  2L5L A;  2R0G A;  3G7Y A;  1I5G A;  1PL1 A;  4GSN A;  3F63 A;  4K0G A;  2NBS A;  4N0Z A;  5ECS A;  2B7K A;  5IMC A;  1XFL A;  2JZR A;  3KCM A;  1BED A;  4WEY A;  3KP8 A;  3CSH A;  1G7O A;  3EE2 A;  1SK0 A;  2HRN A;  4TN8 A;  5A4V A;  3EWL A;  5C00 A;  3QAV A;  1AW9 A;  1U6T A;  3EPT A;  1Z7R A;  1XWG A;  2HZF A;  5CYY A;  1AIU A;  1PA3 A;  3SBC A;  5D73 A;  2RUE A;  4MAB A;  2IJY A;  5JCG A;  4ZIJ A;  4BWS A;  3EMX A;  2ZCT A;  1O81 A;  4NMU A;  3UMA A;  1WRY A;  4MH3 A;  2DC5 A;  4POK A;  3QCP A;  1PKW A;  3MYD A;  1BG5 A;  2VM1 A;  1G0T A;  5ECM B;  3MNG A;  1SK1 A;  3CRT A;  4DEJ A;  1SKW B;  4K7I A;  4EC0 A;  3FZ4 A;  1LU4 A;  2PUK C;  2WZ9 A;  2L59 A;  1NHY A;  2IPA A;  1ON4 A;  2TRC P;  2X49 A;  1GRX A;  1WMJ A;  2P31 A;  2AV4 A;  4K5S A;  1XWK A;  1GUL A;  2H66 A;  1SJI A;  5D9W A;  3N9J A;  5GAP D;  2FA4 A;  3IK7 A;  1F2E A;  4EVM A;  2DJJ A;  1GLQ A; 
#chains in the Genus database with same CATH homology
 4GF0 A;  4NXI A;  4MPG A;  3D5J A;  3GV1 A;  1K0C A;  1A0F A;  1XXU A;  4GXZ A;  1AXD A;  1O7U A;  1UC7 A;  3GKX A;  4DSS A;  4ECI A;  2QA2 A;  3LSZ A;  3D22 A;  3EU3 A;  5G2Z A;  4MLY A;  2BTO T;  2X8H A;  1XIY A;  3LYK A;  4LL4 B;  1X9W B;  1FO5 A;  4JZQ A;  3IHQ A;  2H1B A;  3Q19 A;  4K9Z A;  2G0F A;  3I9V 2;  1GTU A;  2I1U A;  3F4R A;  1JZD A;  2GT6 A;  3LXZ A;  1Z6N A;  3F8U A;  1ZYE A;  5ELA A;  5BMU A;  2A2R A;  4XS4 B;  1AQV A;  4L0U A;  1A0R P;  3NIV A;  4POM A;  3ZIV A;  4YQU A;  5F07 A;  2A2P A;  3FKF A;  4EXJ A;  3BJ5 A;  3ZFL A;  1JFU A;  1PL2 A;  3L4N A;  3HVV A;  2QC7 A;  2VL2 C;  4EL1 A;  1IYI A;  2DKH A;  4LMW A;  4BPY A;  2L4C A;  4MH2 A;  4KGI A;  5G31 A;  5DAK B;  2KP2 A;  1A23 A;  5L71 A;  1RK4 A;  4HS1 A;  1K0D A;  3EYT A;  2WRT A;  2PMT A;  1RQM A;  3EUR A;  3ZRD A;  1AQW A;  3HDC A;  3FMW A;  3J7Y k;  2HRF A;  3TB2 A;  3TJK A;  4G19 A;  2WGR A;  5HR3 A;  3G7I A;  4I97 A;  5ECI B;  4MA9 A;  2K9F A;  1OC8 A;  4IP1 A;  1K0B A;  1TI3 A;  2R4V A;  3KMN A;  1OAZ A;  5JWR B;  1THO A;  2VUP A;  2H8L A;  3UVH A;  4G0L A;  2HZE A;  4FQU A;  4WXT A;  2FD3 A;  4TR0 A;  2GLR A;  2E7P A;  4HQZ A;  4Z2T A;  3Q6O A;  2X4A A;  5ECP B;  1M9A A;  5HFG A;  5CRH A;  3CSJ A;  1FAA A;  5GST A;  4OFM A;  1GSQ A;  2NTO A;  4L0W A;  1M0U A;  4HI7 A;  2V41 A;  1XW9 A;  4ML6 A;  7GSS A;  4F0B A;  5D93 A;  2PGT A;  5ECN B;  3E0U A;  2HXK A;  1FVJ A;  3HD5 A;  3SWL A;  5J9C A;  3O76 A;  4K0N A;  5ECL B;  3GHA A;  4K8M A;  1OKT A;  3TKS E;  2VD1 A;  2DJ0 A;  3HJM A;  4BVY B;  3M0F A;  4GSS A;  4ZXG A;  3VWV A;  2C8U A;  6GSY A;  5AGY A;  19GS A;  2K8S A;  3KD0 A;  2VL2 A;  3QPM A;  1FW1 A;  3GIX A;  3PPU A;  3DML A;  2IFQ A;  1Z9H A;  2H30 A;  5JWO B;  4J2F A;  2DJK A;  2LKU A;  5B8B A;  4K2X A;  5HR2 A;  1EV9 A;  1K3L A;  2JSY A;  4TKY A;  1X9S B;  4HU7 A;  4X43 A;  3P90 A;  2VCX A;  5J3R A;  2CX3 A;  4ULX A;  1PKZ A;  2GDR A;  1V2A A;  1K0M A;  3KJY A;  3APQ A;  2DJ1 A;  2VAF A;  2AAW A;  2L57 A;  3F6D A;  2B6M A;  4YKG A;  1V98 A;  5CRW A;  3A5I A;  3MSZ A;  2MYG A;  4N10 A;  2LNT A;  1OKD A;  1YJ6 A;  5J41 A;  3ED3 A;  2OAD A;  4KDU A;  1TU7 A;  2WCI A;  1QMV A;  3HHV A;  2X64 A;  3FZ5 A;  5CAX A;  1QFN A;  1VF4 A;  4ZB8 A;  4Q5F A;  2IMD A;  3GUR A;  4G10 A;  3HA9 A;  1T00 A;  1A2L A;  1SJZ A;  1Z5Y E;  3PR8 A;  1B4Q A;  3H93 A;  2ZUP A;  2OA7 A;  3IV4 A;  1IYH A;  4EDY A;  3V1W A;  2HFD A;  4I6X A;  3DVX A;  1J08 A;  3QD9 A;  1SKS B;  3TKS C;  2TIR A;  2EIQ A;  2M72 A;  3KP9 A;  4O5Q A;  2R37 A;  2EIO A;  1H4O A;  1AQX A;  2QKE A;  3FK8 A;  1JZW A;  2PWJ A;  3M1G A;  4G9H A;  17GS A;  2PPT A;  4CDO A;  3APO A;  1O85 A;  1V57 A;  3MIX A;  2B5X A;  2GZZ A;  5ECH B;  3TJG A;  1MDK A;  1ZOF A;  2B1K A;  3ZML A;  3L9V A;  1GSY A;  5CNW A;  1ACV A;  3P8W A;  3F0I A;  2OJL A;  4MZC A;  3QAW A;  2H1D A;  3IXR A;  3GRX A;  3HCZ A;  1NW2 A;  3CSI A;  5CRD A;  3TGZ A;  3RHB A;  5HFK A;  1T4Y A;  3EMP A;  3TCO A;  3HY2 A;  1F9M A;  4IHU A;  3TKQ A;  2MMO A;  2GS3 A;  1GLP A;  1HYU A;  1PGT A;  3LFL A;  3ZVJ A;  4E8H A;  4X4J A;  2PU9 C;  2HT9 A;  4BL7 B;  3UIW A;  2YZU A;  3Q18 A;  1PN0 A;  2E2M A;  4TW5 A;  4L5L A;  2DMM A;  1HNA A;  1M2A A;  2WB9 A;  3LWA A;  5LD0 A;  1T4Z A;  4IP6 A;  4N30 A;  2FWF A;  2GST A;  3U6V A;  1B4P A;  2YPM A;  3VWW A;  3VWU A;  1YZX A;  3GL3 A;  3WGD A;  4OO5 A;  3UJ1 A;  4YQV A;  4KSM A;  4DSQ A;  2GSQ A;  2CAQ A;  4TXO B;  3M3M A;  1PD2 1;  3LQ7 A;  3VUR A;  2H74 A;  2J9H A;  1I9D A;  1SL0 B;  1C72 A;  4K1F A;  3D21 A;  14GS A;  1TRW A;  1PSQ A;  2VCT A;  3TKS A;  5F8B A;  4JR4 A;  2WJU A;  18GS A;  3IAS 2;  2B3S A;  4LMV A;  2AUV A;  5HR0 A;  2IN3 A;  2C3Q A;  1X0R A;  4QQ7 A;  1SYX A;  1DE1 A;  5A4W A;  1ILO A;  3GTU B;  1NHO A;  1V40 A;  2OBI A;  4NPB A;  1ST9 A;  2XC2 A;  3IDV A;  4WET A;  4HJM A;  4Q5Q A;  4ZB9 A;  3W8S A;  3IAM 2;  1YF0 A;  1SEN A;  3NOF A;  3KH9 A;  4OFT A;  2K8V A;  3PH9 A;  1TK8 B;  4YQM A;  3DVW A;  4V2L A;  2AHE A;  2I81 A;  3D4M A;  3ERW A;  9GSS A;  2H75 A;  1HQO A;  3W6G A;  1R26 A;  2H01 A;  2N5F A;  2WS2 A;  5EL8 A;  4ICY A;  5A5K A;  2F9S A;  3H79 A;  5ID2 A;  2V32 A;  4MCU A;  3EVI A;  2MMA A;  2G2Q A;  1YEX A;  2B5Y A;  2HRK A;  1R7H A;  2E2G A;  2P0G A;  3TRX A;  1EP8 A;  4YAP A;  2CV4 A;  1XVQ A;  4GST A;  1G7E A;  1LBK A;  1XOA A;  5ENU A;  4Z7X A;  3CRU A;  3M8N A;  1GUM A;  2DIY A;  3I43 A;  1Z7P A;  4EF0 A;  3S9F A;  4N0V A;  3VPT A;  1WE0 A;  2C0E A;  4JR6 A;  2WFC A;  2REM A;  5DAL A;  5J9B A;  3IRA A;  4ZL7 A;  3EU4 A;  2ALB A;  5ECK B;  3KEB A;  1ERT A;  4KA0 A;  5DCG A;  4ACS A;  5IOW A;  4IS0 A;  5DQS A;  3IPZ A;  4EO3 A;  4CY8 A;  4HU9 A;  4J56 E;  4TR1 B;  2V6O A;  1M7T A;  3C1S A;  2Z9S A;  3BD2 A;  2OKA A;  1ERU A;  2E0Q A;  1TP9 A;  1DUG A;  5ECR B;  4PGT A;  11GS A;  4F0C A;  4IVF A;  1VF1 A;  4MMM A;  2FY6 A;  2N5A A;  2KHP A;  2YCD A;  4BVX B;  4OMV A;  4MJE A;  2WDU A;  4IN0 A;  3G7J A;  3QFA C;  1TRV A;  2V2G A;  3ZMK A;  5IPH A;  1GSF A;  2C4J A;  1UN2 A;  1TRS A;  1KTE A;  2YN1 A;  1K0A A;  2CA8 A;  3TJB A;  5KN1 A;  4HDE A;  3CMI A;  1FOH A;  4FYB A;  4D73 A;  4USS A;  1YQ1 A;  2XHF A;  4MJA A;  4IJ3 A;  4F2I A;  4LL1 B;  4L8E A;  1JLV A;  2B7J A;  2DKI A;  1TXX A;  3A2V A;  1V9W A;  1WIK A;  2YJ7 A;  2ON7 A;  3F9U A;  3KXO A;  2JZS A;  5HQP A;  2YOI A;  1E6B A;  2MBT A;  3HXS A;  3H4K A;  4KSO A;  2C80 A;  3WGE A;  4PUF C;  3E9J B;  2H76 A;  2PVO C;  4JED A;  1HNB A;  5KOW A;  1TRU A;  1FG4 A;  3CTG A;  4AJ8 A;  3ZVJ D;  3LJR A;  3P2A A;  3US3 A;  5H5Q A;  5IIZ A;  4O7H A;  4MJC A;  1TK0 B;  3QDN A;  4NHW A;  1WPI A;  4HQS A;  1UA5 A;  2MBS A;  3VI7 A;  3IBH A;  1M99 A;  3WT1 A;  2H0I A;  3DIE A;  4IBP A;  1ZCP A;  4BA7 A;  4OD7 A;  2PBJ A;  5A4U A;  1WOU A;  5DDL A;  4ZBA A;  2IMI A;  4MPF A;  4V2M A;  4OO4 A;  5AIS A;  1VF3 A;  3RHC A;  1BX9 A;  2O85 A;  1QK8 A;  1B9X C;  3RAZ A;  3KM6 A;  3TKR A;  1X9M B;  1OYJ A;  3WD6 A;  2P5R A;  1KEB A;  3APS A;  5HR1 A;  4I5Q A;  1GUH A;  3RPN A;  4HUA A;  4X1U A;  5F06 A;  1F3B A;  4KW6 A;  3MDK A;  2HLS A;  1VRS D;  1DBY A;  1WP0 A;  3UEM A;  1KNG A;  4ID0 A;  1ERV A;  4WBJ A;  5CRE A;  3M9J A;  4ZB6 A;  5IO2 A;  3VPQ A;  4WF4 A;  1A8Y A;  1N8J A;  4DSR A;  2DIZ A;  4N11 A;  2H0G A;  2I3Y A;  4PNF A;  1ZYN A;  1PQN A;  2PN8 A;  4HOJ A;  3FEU A;  3QAG A;  3EC3 A;  4CHS A;  3C71 A;  1F6M C;  2GSS A;  5JCW A;  1U87 A;  5IMF A;  2L6C A;  1YY7 A;  2LQO A;  1EGO A;  2KOK A;  4J57 E;  5H5S A;  1GL8 A;  2FCH A;  2GVP A;  3ZTL A;  3DRN A;  3A3T A;  2MMZ A;  1TTZ A;  1XOB A;  3TOU A;  2JSZ A;  2RLI A;  2VM2 A;  4HEA 2;  3HJP A;  2TRX A;  4KCA A;  4WBR D;  3D6I A;  1GSU A;  3ZFB A;  2I4A A;  1SD8 A;  4TXV A;  3GL5 A;  1FB0 A;  2L4Q A;  1OVN A;  2GGT A;  3FW2 A;  1EOH A;  3GST A;  1HD2 A;  3IC4 A;  1YKC A;  4ILF A;  4I8B A;  3GA4 A;  4XS4 A;  1ZMA A;  3C7M A;  3J7Y b;  2FWE A;  3ZIJ A;  1YEP A;  4RUV A;  3TJF A;  4FH8 A;  3VI5 A;  2VLV A;  2ZNM A;  4XRD A;  1R5A A;  4HJ2 A;  5LNK e;  4IW9 A;  3A2W A;  3GX8 A;  1S3D A;  1BAY A;  3BCI A;  2LRC A;  2OE3 A;  3O3T A;  5ECQ B;  3NZN A;  4MF6 A;  3K8N A;  5DAK A;  2D2Z A;  5IQY A;  5J4U A;  2FWH A;  4EDZ A;  1PN9 A;  2GTU A;  4O32 A;  2LRT A;  3IR4 A;  1Z3E A;  2C0D A;  4NAX A;  1ZYP A;  5D8I A;  1GTB A;  3KH7 A;  1YKA A;  1B8X A;  1YDK A;  4ZIL A;  2HRA A;  2YWO A;  3TKP A;  1VF2 A;  1JLW A;  2F8F A;  1TKD B;  4NHZ A;  3HKR A;  3A5W A;  3GFK A;  3P7X A;  4O92 A;  6GSV A;  1U88 A;  4MF5 A;  3C73 A;  4PQ1 A;  2B5E A;  5B8A A;  5IOX A;  2WUL A;  3TRQ A;  5CRG A;  4F03 A;  1TW9 A;  3KZQ A;  3A2X A;  4H86 A;  3GMF A;  3H1N A;  1K0O A;  3GH6 A;  3GSS A;  1BQ7 A;  1XCC A;  2JU5 A;  4KCE A;  4IGJ A;  2YWI A;  3QMX A;  5IO0 A;  1O6J A;  1JZO A;  5FHI A;  1MDI A;  5JCU A;  1USB A;  2EC4 A;  4KDY A;  4IQA A;  4XS1 A;  2HSH A;  3N5O A;  2M46 A;  4BVY A;  3C8E A;  5EVO A;  3LGC A;  1TU8 A;  4AF2 A;  4FYC A;  4K2D A;  4EKZ A;  5JWQ B;  1ABA A;  2DML A;  4NV5 A;  3F4S A;  5AN1 A;  5J5N A;  4EE0 A;  1MDJ A;  5G1L A;  2OE1 A;  3UBK A;  3M9K A;  1FVK A;  1Q98 A;  1R5P A;  4PUA A;  2RM5 A;  2YV9 A;  3FR6 A;  1OE7 A;  2FLS A;  2VLT A;  1M9B A;  3LG6 A;  2VL3 A;  1TOF A;  5IMD A;  2IMK A;  4NV2 A;  1X5D A;  3JCM L;  2DBC A;  2LTK A;  3C1R A;  2AB6 A;  3FY7 A;  1PMT A;  10GS A;  4PXO A;  1O8W A;  4CW9 A;  4EIP A;  2C0G A;  1R4W A;  4FYU A;  1OE8 A;  2CVK A;  2CVD A;  2LRN A;  1NM3 A;  1EWX A;  4IKH A;  4LLR A;  3WGX A;  3I6A A;  1EZK A;  1ZYQ B;  4MZW A;  4X0X A;  1RW1 A;  4K7N A;  4MK3 A;  4XRA A;  1T1V A;  2L5O A;  3UVT A;  4GCI A;  1Y6E A;  5H5R A;  5CO3 A;  5AIV A;  1A8L A;  2C3T A;  3DD3 A;  2OBK A;  2HSM A;  4PX1 A;  5LCZ A;  1JHB A;  2A4H A;  4QL7 A;  5ABR A;  3VK9 A;  2YWN A;  3GN3 A;  4AJ6 A;  1GSS A;  3GKM A;  2C0F A;  4Z2U A;  4TOP A;  2LUS A;  4MNN A;  5HFI A;  5D9T A;  2QSI A;  1DE2 A;  4HZ4 A;  5GAN D;  4DSS B;  2YWM A;  2AJQ B;  3ZYW A;  4K7O A;  4G2E A;  2VCW A;  4O5U A;  4GWR A;  1B9Y C;  2I9H A;  4WR5 A;  1SKR B;  1SJ6 A;  1A2J A;  16GS A;  6GSX A;  2A4V A;  1GWC A;  5G1K A;  4Q5R A;  2IWT A;  4BL7 A;  3QFB C;  2LST A;  4A5P A;  1JZR A;  2A2S A;  2RUF A;  3LYP A;  4YH2 A;  5DVB A;  1DSB A;  4E8E A;  2H70 A;  4POB A;  2ON5 A;  1QXH A;  1CQG A;  3E3E A;  1A2M A;  1M2D A;  2VCV A;  2O7K A;  3TJJ A;  2YP6 A;  4HZ2 A;  13GS A;  4MJB A;  2YNX A;  2NDO A;  3ERF A;  1PX7 A;  3HVX A;  1QGV A;  4ECC A;  2CT6 A;  4RI7 A;  1TK5 B;  2F8A A;  1J9B A;  4POL A;  2LEG A;  3GNJ A;  3UOM A;  5EY6 A;  4TXO A;  4XCS A;  2GZY A;  4V2N A;  4IJI A;  1U3A A;  5DCH A;  2M80 A;  22GS A;  4V1A p;  1EOG A;  1T3B A;  2GQK A;  1ZGN A;  2K18 A;  2R5G A;  1WWJ A;  3ZL5 A;  2X99 A;  2H1A A;  4RI6 A;  3ZRE A;  2DSA A;  4XTS A;  3DKS A;  3KTB A;  1TI1 A;  5D96 A;  3QOU A;  2XPD A;  4K5R A;  2JL4 A;  3GTU A;  3ZLP A;  3ZZX A;  3EIN A;  1V58 A;  2H72 A;  1SL2 B;  5IPG A;  3RPP A;  2J23 A;  3FZ9 A;  1KBN A;  2HZE B;  2R6K A;  4OFN A;  4KE3 A;  1XW6 A;  1J0F A;  4OWY A;  2F3M A;  3LEF A;  1ERW A;  2NVL A;  8GSS A;  5E59 A;  2FWG A;  2YJH A;  4XIH A;  4WKW A;  3ERG A;  2XBI A;  3L78 A;  5B7C A;  1F37 A;  5KOX A;  2V1M A;  2FUG 2;  3GX0 A;  4NWY A;  1TDI A;  2YZH A;  1XBS A;  3ME8 A;  3FR3 A;  2BMX A;  3RDW A;  3PIN A;  5F05 A;  3UBL A;  4FIW A;  2F51 A;  2CZ3 A;  2CX4 A;  2CVB A;  2VIM A;  3W8J A;  4AGS A;  5IMV A;  4ML1 A;  1CQH A;  3MWH A;  1GP1 A;  2QA1 A;  3F3Q A;  4ECJ A;  3TOT A;  1GSD A;  2LJR A;  1Y25 A;  4G0I A;  4KAE A;  4KX4 A;  4TR1 A;  1GH2 A;  2IIY A;  1F3A A;  3OR5 A;  2JAD A;  2IFQ B;  2H71 A;  4RQX A;  1G6Y A;  5D9V A;  4IEL A;  4ZL9 A;  2LJA A;  2CZ2 A;  4BVX A;  3L0H A;  4KF9 A;  4ISD A;  1Q4J A;  1ML6 A;  3IA1 A;  1TJD A;  1OC9 B;  3MAK A;  1K3Y A;  3VFI A;  1PX6 A;  3FHK A;  1MEK A;  1QUW A;  1EGR A;  5EPF A;  5KN3 A;  3BOA A;  3D0Z A;  2HYX A;  3CYN A;  5INY A;  3ZIT A;  5ECO B;  2JAC A;  5G5F A;  2KP1 A;  4WR4 A;  4AJ7 A;  3L9S A;  3KIJ A;  1XWC A;  2GT5 A;  1YF1 A;  2H1G A;  4LA1 A;  1MTC A;  1MD3 A;  1K0N A;  4WF5 A;  5FWG A;  3D4T A;  1BJX A;  5E4W A;  5IMA A;  2R2J A;  1ZL9 A;  4V1A g;  5B6N A;  2AYT A;  1Z6M A;  1X5C A;  3VWX A;  2JZT A;  4MDC A;  3R2Q A;  3GYK A;  1SD9 A;  4Q5N A;  2RM6 A;  4FO5 A;  4O5R A;  3UL3 A;  4PNG A;  4EIQ A;  2O89 A;  4EUY A;  3WT2 A;  1HNC A;  2PVQ A;  2R0P A;  2HSY A;  4K6X A;  5G30 A;  4YKF A;  3HVS A;  1XPV A;  1VGL A;  2X8G A;  4F82 A;  4OCE A;  3O6T A;  1XW5 A;  2H19 A;  1GNE A;  3Q74 A;  3GKN A;  3AY8 A;  4F9Z A;  4JE1 A;  2FGX A;  4OCF A;  4IQ1 A;  1EEJ A;  4QL9 A;  3H8Q A;  1THX A;  3TRP A;  4TVE A;  1WJK A;  3BCK A;  2GQL A;  2HE3 A;  2VL9 A;  3TDG A;  1SU9 A;  3FYG A;  3ISO A;  3F3R A;  2YV7 A;  5F0G A;  1MD4 A;  2CQ9 A;  4JRR A;  6GSW A;  1UVZ A;  3KTL A;  2XPE A;  3LW9 A;  4ZL8 A;  2UZ8 A;  1OC9 A;  2O8V B;  4GTU A;  3R3E A;  1AC1 A;  1E2Y A;  1QQ2 A;  1EP7 A;  1M2B A;  5BRT A;  1FOV A;  1T7P B;  5G5E A;  2QGV A;  4KUN A;  2VO4 A;  1GSE A;  2DJ3 A;  4GQF A;  2C3N A;  1A24 A;  4JU5 A;  1XZO A;  2ES7 A;  5KN0 A;  2CAI A;  1GTI A;  2NPB A;  12GS A;  3G9B A;  4GRF A;  1W4V A;  3BBY A;  4BWQ A;  5D9X A;  1BYE A;  2B1L A;  4I2T A;  3DXB A;  1LJR A;  2FNO A;  3HZ8 A;  4YAV A;  1GTA A;  5COH A;  5KN2 A;  2IME A;  5ELG A;  1XVW A;  1PRX A;  3U5R E;  3IC8 A;  3IE3 A;  1FHE A;  1O73 A;  4G0K A;  5DJM A;  1SL1 B;  5C04 A;  1O8X A;  4CY6 A;  6GSU A;  4Z2R A;  3GKK A;  2DJ2 A;  4KB3 A;  3CTF A;  1XWA A;  2YAN A;  5DJL A;  1S3C A;  2LQQ A;  2O87 A;  3F6F A;  2IMF A;  1SYR A;  5KEJ A;  2KLX A;  2OE0 A;  4TR3 A;  6GSS A;  3CBU A;  1X5E A;  3L9U A;  5CP1 A;  3RBT A;  4XHM A;  4JBB A;  3CXG A;  4PQH A;  1SK2 A;  2X8C A;  2VCZ A;  2GQM A;  3LXT A;  5ID2 B;  3GH9 A;  2VLU A;  2FHE A;  2FA8 A;  1FB6 A;  3UAR A;  5B6M A;  2H6Z A;  4PQI A;  2VD0 A;  5IM9 A;  2R3X A;  4ZBB A;  6GST A;  3PGT A;  4ECB A;  2MMN A;  3F4T A;  1U3I A;  20GS A;  2LJK A;  2P5Q A;  1GNW A;  5FT3 A;  1G6W A;  4TR4 A;  4KDX A;  2EIR A;  4L5O A;  2V6K A;  4KH7 A;  3HZ4 A;  2LNS A;  5DAL B;  2LS5 A;  4DVC A;  2L6D A;  4KND A;  3DEX A;  1XWB A;  2OAC A;  2GSR A;  2VCQ A;  1K3O A;  4RQR A;  2K6V A;  3QR6 A;  4MZB A;  3DYR A;  2HNL A;  1NSW A;  3TUE A;  1H75 A;  3DWV A;  5DQY A;  2H6X A;  4I2U A;  3LOR A;  2R0C A;  3IHG A;  2GZP A;  1B48 A;  4GQC A;  3DGQ A;  1URM A;  1AAZ A;  2MZC A;  5AIX A;  1EEM A;  1GUK A;  4TRX A;  1AUC A;  4PTS A;  5DBQ A;  3FZA A;  3IK9 A;  2PER A;  4GLT A;  2H6Y A;  1S3A A;  2HI7 A;  2H0H A;  2LV3 A;  1ZZY A;  2VOC A;  3IOS A;  2H73 A;  4D73 B;  1W89 A;  1T8E B;  2IL3 A;  3KMO A;  4ZBD A;  2XBQ A;  5IMZ A;  3ME7 A;  3KGK A;  2DLX A;  2RII A;  5GZZ B;  4MF7 A;  1OC3 A;  3GUS A;  2BJX A;  3FR9 A;  4MP4 A;  3VLN A;  1N2A A;  2C1Y A;  4XS6 A;  3FRC A;  3I69 A;  2KUC A;  1EV4 A;  4PUR A;  2N5B A;  4P3Y B;  3HJO A;  3WYW A;  3HYP A;  5GSS A;  3UAP A;  2L5L A;  2R0G A;  3G7Y A;  1I5G A;  1PL1 A;  4GSN A;  3F63 A;  4K0G A;  2NBS A;  4N0Z A;  5ECS A;  2B7K A;  5IMC A;  1XFL A;  2JZR A;  3KCM A;  1BED A;  4WEY A;  3KP8 A;  3CSH A;  1G7O A;  3EE2 A;  1SK0 A;  2HRN A;  4TN8 A;  5A4V A;  3EWL A;  5C00 A;  3QAV A;  1AW9 A;  1U6T A;  3EPT A;  1Z7R A;  1XWG A;  2HZF A;  5CYY A;  1AIU A;  1PA3 A;  3SBC A;  5D73 A;  2RUE A;  4MAB A;  2IJY A;  5JCG A;  4ZIJ A;  4BWS A;  3EMX A;  2ZCT A;  1O81 A;  4NMU A;  3UMA A;  1WRY A;  4MH3 A;  2DC5 A;  4POK A;  3QCP A;  1PKW A;  3MYD A;  1BG5 A;  2VM1 A;  1G0T A;  5ECM B;  3MNG A;  1SK1 A;  3CRT A;  4DEJ A;  1SKW B;  4K7I A;  4EC0 A;  3FZ4 A;  1LU4 A;  2PUK C;  2WZ9 A;  2L59 A;  1NHY A;  2IPA A;  1ON4 A;  2TRC P;  2X49 A;  1GRX A;  1WMJ A;  2P31 A;  2AV4 A;  4K5S A;  1XWK A;  1GUL A;  2H66 A;  1SJI A;  5D9W A;  3N9J A;  5GAP D;  2FA4 A;  3IK7 A;  1F2E A;  4EVM A;  2DJJ A;  1GLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...