3KH9A

Crystal structure of the periplasmic soluble domain of oxidized ccmg from pseudomonas aeruginosa
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
155
structure length
155
Chain Sequence
RGSHMLDPSELPSALIGKPFPAFDLPSVQDPARRLTEADLKGKPALVNVWGTWCPSCRVEHPELTRLAEQGVVIYGINYKDDNAAAIKWLNELHNPYLLSISDADGTLGLDLGVYGAPETYLIDKQGIIRHKIVGVVDQKVWREQLAPLYQQLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbE
publication title Structural and functional characterization of CcmG from Pseudomonas aeruginosa, a key component of the bacterial cytochrome c maturation apparatus.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 47
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2009-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3kh9A00
3BD2A 4KNDA 1A24A 4V2MA 4HUAA 4PNFA 1PKWA 2FD3A 3IOSA 2TIRA 2PVQA 2VAFA 2N5AA 1DUGA 4F0BA 1Z7RA 2BMXA 1XW5A 4O92A 4FO5A 4Q5FA 1BJXA 2C3QA 3A3TA 4EL1A 4YH2A 5IQYA 3LYKA 4OFMA 2CX4A 3PR8A 4MK3A 2CAQA 3GYKA 1BG5A 1J08A 2YPMA 4WR4A 3IR4A 3UIWA 4WKWA 1UA5A 2VLUA 5IO2A 4K0NA 4GF0A 4OCFA 5GSSA 4K8MA 3LFLA 3KZQA 1AQVA 2X64A 1AIUA 2VLTA 2VLVA 6GSYA 5JWRB 4RUVA 2OE3A 4IJ3A 3TRXA 1XOAA 1TRVA 3A5WA 3HZ8A 3GFKA 2DJJA 4IN0A 3U6VA 5DALA 3QD9A 2OE1A 2PBJA 5F05A 1SD9A 2GT6A 16GSA 5CRHA 1R4WA 5DAKA 3DD3A 3G7YA 3UMAA 1M9AA 4L5OA 1SD8A 2KP2A 1X9MB 3H93A 1XWCA 2FNOA 2A4VA 2R3XA 4KW6A 3LXZA 2YCDA 2O7KA 5EL8A 1K3YA 4TW5A 5DALB 4WBJA 2HRFA 4XS4A 1SKWB 4D73B 3N9JA 1ZMAA 2DJ1A 3LEFA 3VWUA 5DAKB 4HQSA 4NPBA 4DEJA 5IOXA 4I2TA 1YF0A 4X43A 5ID2A 1GSDA 5HFKA 1WRYA 4MZCA 4YAVA 5G1KA 4NV2A 2LTKA 4HOJA 1TRUA 3AY8A 5CO3A 1TOFA 2N5BA 3C8EA 1F3BA 1OAZA 1NW2A 1A0RP 2N5FA 5E59A 1K0OA 2OBKA 1S3AA 1AC1A 3KIJA 8GSSA 1TU8A 1XWAA 4LMVA 3GRXA 5G30A 4N11A 4IKHA 3D4MA 1HNCA 1ERUA 4V1Ap 2MYGA 2H01A 2HSHA 4PUAA 1O85A 9GSSA 2H1DA 2IJYA 3W8SA 5HR0A 2VL9A 5G2ZA 1ON4A 1XIYA 1WIKA 2LKUA 1ZYQB 1XOBA 4BPYA 1LU4A 1XXUA 4K7NA 4MCUA 1N2AA 1YJ6A 4I5QA 2HZEA 5CNWA 4MJEA 3HY2A 1QXHA 2H76A 4TVEA 3CMIA 2LQOA 1PRXA 4HU7A 4JBBA 2H30A 22GSA 4O7HA 2VCWA 3HXSA 1EV4A 2FWFA 1JZDA 3CSIA 1FW1A 2CVBA 1B4PA 1R5AA 1ZGNA 2HZEB 5EVOA 3E9JB 3E3EA 1AUCA 5J4UA 3L78A 2F9SA 2O89A 4GCIA 3VLNA 1OKTA 4BL7A 4PGTA 1AXDA 3I43A 4I6XA 4ZL7A 4TOPA 1XWGA 4ZL9A 6GSXA 2AB6A 3A2WA 1V40A 1Z7PA 3F6DA 4NHWA 3DMLA 1ABAA 1JHBA 2VO4A 4L5LA 2LRCA 1CQGA 4HI7A 1XW6A 3P8WA 2B5YA 2OKAA 4MJCA 2K8SA 2PMTA 4J57E 2YN1A 3FRCA 1THOA 4ECBA 2O8VB 2GZPA 1F3AA 3TOTA 3FYGA 4KDYA 3GV1A 2GQMA 1EV9A 1EEMA 3Q6OA 3OR5A 3DVWA 2WFCA 1BQ7A 3F4RA 3F4SA 1SL1B 2NBSA 4ULXA 1VF2A 1K3LA 2IPAA 3VWVA 3UL3A 4WF5A 3PINA 1GUHA 2A2SA 3CBUA 2J23A 3C73A 4LLRA 2PGTA 4QQ7A 1YKCA 2C1YA 1QFNA 1NHYA 1V57A 1WJKA 3MNGA 4YAPA 4PUFC 2AJQB 4X1UA 2CX3A 3GKNA 2WRTA 4POKA 1PA3A 2GDRA 1XVQA 2LSTA 1TTZA 3BJ5A 3FZ9A 4BWSA 3ZYWA 1G7OA 3UOMA 3ZL5A 5A4VA 5HFIA 4FH8A 2VOCA 1LBKA 2OA7A 4HS1A 5FWGA 3IV4A 2WDUA 2YOIA 2JSZA 2C0EA 4MPGA 3QDNA 4HQZA 4MZWA 2X8GA 2WCIA 1B4QA 2L6CA 1M9BA 1F6MC 4TR1A 3F4TA 2MZCA 5ECPB 2R2JA 4L0UA 1EOHA 2H1BA 1SK2A 1Z5YE 3O6TA 3DRNA 2H66A 5D96A 1B48A 5D9XA 2RM6A 3KH9A 1O7UA 2HYXA 1GSSA 2P5QA 5J5NA 3L4NA 4ZB9A 5IMFA 2AV4A 1SU9A 2DJ0A 3HYPA 1OYJA 4EDYA 2EIOA 4TR1B 4PQ1A 1ACVA 2DC5A 2CZ2A 2DIZA 2LRNA 3HKRA 2B6MA 4YQVA 4ID0A 1TJDA 4ILFA 1GTIA 2PN8A 3TOUA 2TRXA 1GULA 4NXIA 3TKRA 4ZL8A 2AAWA 2GSTA 2RUEA 2H70A 5IIZA 1FOVA 4MH3A 1XWBA 3ME7A 3QFAC 5IMCA 5G5EA 4I97A 3DVXA 3VURA 3GMFA 1PX6A 1PD21 1USBA 2IMEA 3I6AA 4IJIA 3GTUA 2MMAA 3HJOA 4BWQA 1U87A 1EGRA 2GTUA 3EE2A 3U5RE 3ZREA 1SKRB 3D21A 1OVNA 1E2YA 1ML6A 2K9FA 3EC3A 3ERFA 5ECNB 1R7HA 4LMWA 3IAM2 2C4JA 3WGXA 4LL1B 1ZCPA 3C1SA 1HD2A 3IXRA 1A2MA 5AN1A 3BBYA 4RI7A 3DGQA 4KE3A 5CP1A 1Z6MA 1EP8A 5JWOB 3BCKA 2H1GA 1GNWA 5ECRB 5EPFA 2LEGA 2PPTA 3KJYA 2CV4A 1GUMA 1F2EA 3F63A 3QAVA 5ECHB 4YQMA 1B9XC 1H75A 13GSA 5IO0A 2XBIA 2EC4A 2DMMA 2V2GA 2GSSA 3IBHA 2E2GA 2D2ZA 2RUFA 2CVDA 5A4UA 2H6YA 2IN3A 2IWTA 2L57A 3L9UA 2JZRA 4MZBA 2ALBA 4IP1A 1WMJA 3LGCA 3EU4A 4I8BA 2BJXA 5ECKB 4TXVA 2EIRA 3HD5A 4HJMA 4JE1A 3FZ4A 3O3TA 3QFBC 5KN2A 1YF1A 4GXZA 4RI6A 1PL1A 2TRCP 2FA4A 4JR6A 2I9HA 5B8AA 4WF4A 1ZZYA 4AJ7A 4WR5A 3HA9A 4JU5A 4XRDA 1XCCA 1MDJA 3QAGA 3C71A 1X5CA 3D22A 4BA7A 2WB9A 4BVYA 4XCSA 2ON5A 2LRTA 2G2QA 4DSQA 2R37A 4J56E 1DSBA 3GL5A 2VCVA 11GSA 4IHUA 1MDIA 2IMIA 3HVSA 14GSA 3TCOA 2LQQA 2H71A 2IMDA 2L6DA 4IQ1A 4MJBA 3FR6A 1YDKA 4KCEA 1X5EA 3TUEA 3ZRDA 1I9DA 12GSA 3UBKA 2DMLA 2LS5A 4WEYA 1K0CA 1EWXA 3IHQA 1WPIA 1X9SB 4ZB8A 4HJ2A 3TKSE 5B8BA 2NTOA 2V1MA 1GL8A 4KUNA 3E0UA 1WWJA 2LNSA 3H79A 4KA0A 1KNGA 1PKZA 3GH6A 5H5QA 4G2EA 5JCGA 3ZFBA 3F6FA 3P7XA 4MA9A 3M8NA 3KCMA 2H73A 1XFLA 3QR6A 1KTEA 2EIQA 3LORA 3RAZA 4MF7A 1DE2A 1HNAA 2VD1A 1S3DA 4WETA 3G7JA 5KEJA 3CYNA 4TN8A 3DXBA 3KEBA 1VRSD 5G31A 3ZTLA 5HFGA 3HJMA 2A2RA 1X0RA 4WXTA 1A0FA 3KH7A 2CA8A 4N0ZA 3TDGA 3O76A 3QOUA 3EYTA 1BX9A 4G10A 2XHFA 3C1RA 3RPNA 1T4YA 3KTBA 2H0HA 4XRAA 1SK1A 4GSSA 2F51A 3EURA 5HR3A 4ML1A 1PQNA 2YWMA 1U3AA 4NWYA 1RW1A 4MH2A 4XS4B 4KX4A 2YNXA 5B6NA 4TR3A 5AISA 1LJRA 5IMVA 2P5RA 5ID2B 2WULA 2AUVA 1VGLA 2I1UA 3D0ZA 4MMMA 2PWJA 4ZILA 1SK0A 5ECMB 2M46A 1YKAA 5J9BA 2H0GA 4E8HA 4NAXA 2HE3A 1M2AA 4GQCA 2MMNA 1Q4JA 1O73A 3GURA 4JEDA 3IAS2 4EXJA 2GS3A 3F3QA 2HZFA 3RDWA 2I3YA 4TKYA 1SJIA 2NDOA 3EMPA 2FY6A 2YV7A 5IMDA 3K8NA 3VPTA 2H6ZA 2GQLA 5ECIB 2O85A 3ZVJD 3F9UA 4FYCA 1OE8A 5CREA 1QUWA 1F9MA 1GSEA 3TRQA 1ZOFA 4EVMA 2GZYA 2YWOA 3VFIA 2I81A 3LQ7A 1V2AA 4POBA 2R6KA 1G6YA 1ERWA 2HSYA 4CW9A 5IM9A 2O87A 1O81A 19GSA 1QGVA 1O6JA 2KLXA 3FKFA 3GSSA 3HHVA 2REMA 2KHPA 2HRNA 1A2LA 4ZBBA 1ZYEA 3LXTA 3FR3A 2H19A 3TKPA 2E7PA 3WYWA 2DLXA 6GSTA 3DKSA 1SYXA 5HR2A 4PQHA 1O8XA 3FK8A 3IPZA 1AAZA 2IMFA 4DSRA 3GA4A 5H5SA 1DBYA 5DBQA 4DSSA 5DJMA 2YJHA 4V1Ag 3UAPA 2C80A 1ST9A 4Q5NA 2QGVA 1OC9A 2V6OA 5A4WA 2ES7A 4NV5A 1SJZA 2Z9SA 1ZL9A 3EINA 4KH7A 1U88A 2QSIA 5GAND 1AW9A 3KXOA 4AJ8A 4JR4A 5A5KA 4EKZA 4TRXA 2DIYA 1A23A 3F0IA 3GX8A 3ZVJA 3D6IA 4AGSA 5CRWA 1OKDA 3WD6A 1A8LA 4MLYA 1M2BA 2C0FA 3KMNA 4MF5A 3WT2A 3VI7A 4GTUA 2RLIA 1IYIA 4JRRA 5AIVA 1Q98A 5DJLA 4ZXGA 3BOAA 3TGZA 3FEUA 3A2VA 3D5JA 1GLPA 4IVFA 2GSRA 1U3IA 3P90A 2C3TA 3FW2A 1AQXA 4XTSA 3I69A 4KB3A 1YY7A 1ERTA 1SENA 2E2MA 2FWHA 2IIYA 1A2JA 3DEXA 2M72A 2FLSA 1E6BA 2P0GA 4L8EA 3ZMKA 1FAAA 1IYHA 3ED3A 1W4VA 2KP1A 1G0TA 1JZOA 3Q19A 2FHEA 5CYYA 3ISOA 3UJ1A 3LJRA 2RIIA 3FY7A 3V1WA 1K3OA 1S3CA 3CSJA 5GAPD 3RBTA 2GGTA 3KM6A 5D9VA 3KP9A 6GSSA 3N5OA 1Z6NA 4POLA 1YEPA 1YQ1A 2R4VA 1J0FA 2FA8A 3RPPA 4K7IA 1FVKA 1TDIA 1GUKA 3M0FA 3FR9A 1Y6EA 3Q74A 4ZBAA 3SWLA 4PURA 4O32A 1NM3A 3MWHA 1TK0B 1JZWA 3GNJA 3VK9A 3M9JA 1W89A 2DBCA 2V32A 3UVTA 2WJUA 3KTLA 1JFUA 5F07A 5EY6A 1FB0A 4K1FA 1A8YA 3VWXA 3HZ4A 4PX1A 3TJFA 5JWQB 3DIEA 2DJ2A 3HJPA 5LCZA 3GSTA 4MF6A 2JSYA 1TI1A 5IMAA 2HI7A 3W8JA 2B5EA 4WBRD 5IPGA 2PVOC 2HXKA 3ERWA 4OWYA 4PQIA 1PSQA 3GTUB 4V2LA 1HQOA 2H1AA 2ZNMA 3ZMLA 4XIHA 4K0GA 4LA1A 3FZ5A 2GZZA 3DYRA 4Q5RA 3APOA 4TR4A 4IELA 3P2AA 3BCIA 1GH2A 4I2UA 1G7EA 1PN9A 2FUG2 1VF1A 1TK8B 1SKSB 3CTGA 5GSTA 2VD0A 3MSZA 2H75A 2YZUA 1UC7A 1GSQA 3GIXA 2WS2A 1X9WB 3D4TA 3ZFLA 4DVCA 3QAWA 3IRAA 4IBPA 3F3RA 3GHAA 1TW9A 3GKKA 5IOWA 2QKEA 5J41A 2OADA 3G9BA 4J2FA 1VF4A 4Q5QA 1K0MA 5ECSA 2CZ3A 4N0VA 5ECQB 1FVJA 2VL3A 1HYUA 4KAEA 2DJ3A 2H8LA 1M99A 2CAIA 2F8AA 4FYUA 5F0GA 1URMA 6GSUA 1WP0A 5LD0A 4OFTA 5B6MA 5E4WA 3GUSA 4PNGA 2B1KA 2KOKA 4OD7A 5IMZA 2I4AA 4IQAA 1MDKA 4EDZA 1M7TA 1K0NA 5D73A 1U6TA 2HNLA 3F8UA 5FHIA 1XPVA 4F0CA 1TK5B 1NHOA 4O5RA 1B9YC 3L0HA 10GSA 1JLWA 2PERA 1N8JA 5ENUA 2YZHA 4G19A 2GQKA 2M80A 1TKDB 4P3YB 3HVVA 1MD4A 4NMUA 4GSTA 1FG4A 3CSHA 3VPQA 4KDUA 1JLVA 3A2XA 1GLQA 4AJ6A 3NIVA 4ECCA 1OC8A 1XVWA 3W6GA 1MTCA 2ZCTA 1WOUA 2C8UA 2E0QA 6GSVA 2G0FA 1TP9A 1YEXA 4D73A 2CVKA 3GKMA 1VF3A 2RM5A 4CDOA 5FT3A 1GRXA 2H74A 1TXXA 4LL4B 4KSOA 4F9ZA 3I9V2 4KDXA 1TRSA 2LJRA 1EGOA 5DQSA 4IGJA 3TJBA 3EMXA 2VCZA 5B7CA 3TJJA 2YV9A 5G5FA 3NOFA 1B8XA 2K6VA 2MMZA 4GWRA 3ZZXA 3TJKA 2L4CA 5C00A 4K9ZA 18GSA 3GKXA 5CAXA 1CQHA 3APQA 3MAKA 2R5GA 2LJKA 3RHBA 2PUKC 4ML6A 3HCZA 3C7MA 3CTFA 3ME8A 2IFQA 20GSA 4Z7XA 3LYPA 3QCPA 3PH9A 3EVIA 3US3A 3CRUA 1OE7A 2FWGA 5F06A 5KN3A 2HFDA 4ISDA 4K2DA 4ZBDA 4FYBA 3GH9A 2IL3A 1C72A 4GSNA 1SJ6A 5IPHA 2LNTA 4IW9A 2KUCA 2K18A 2IFQB 1EP7A 1GSUA 2C3NA 5ECOB 4K7OA 4F03A 5ELAA 1H4OA 4PXOA 1SL2B 2VL2A 3TRPA 2B7KA 5ABRA 1PX7A 2VCXA 1MEKA 2YJ7A 4H86A 3WGEA 3R2QA 5DQYA 2H6XA 1RQMA 4HDEA 3H8QA 2YANA 5HR1A 5DVBA 4FIWA 3EU3A 5DDLA 1GWCA 3GL3A 4AF2A 5J3RA 2J9HA 1PMTA 2GSQA 1NSWA 3FHKA 4EUYA 2B3SA 1SYRA 2V6KA 4N10A 3PGTA 4JZQA 3KP8A 6GSWA 1BYEA 1FHEA 4HU9A 4QL9A 1RK4A 4IP6A 3J7Yk 2JL4A 4MJAA 4XHMA 2MBSA 3TKQA 2VUPA 3L9SA 3G7IA 4RQRA 1XBSA 2AHEA 2NPBA 1T7PB 3ZIVA 3HDCA 5DCGA 4KSMA 3GX0A 1GSYA 4OFNA 1GTUA 5DCHA 1F37A 7GSSA 2OE0A 4TXOA 1M2DA 2GT5A 3UARA 1GNEA 2HLSA 1GTAA 2LV3A 1FO5A 2B5XA 1EEJA 3IK9A 4MDCA 4YQUA 2VL2C 5KN0A 3M3MA 2XC2A 3LWAA 4N30A 4DSSB 3EWLA 4KGIA 3KGKA 3M9KA 3TKSA 1PL2A 1AQWA 1J9BA 1OC9B 1THXA 5JCUA 4TXOB 1M0UA 5CRDA 4E8EA 4OO5A 3VWWA 1XWKA 2C0GA 5KN1A 3FZAA 3DWVA 3CXGA 2QC7A 1BAYA 5AGYA 1T4ZA 1XZOA 2JZSA 4EO3A 1K0AA 2MBTA 5AIXA 1KBNA 2DJKA 2CT6A 2AYTA 1WE0A 1ILOA 1QMVA 2WZ9A 1SL0B 4GQFA 3QMXA 3M1GA 4MABA 2H0IA 3UBLA 4OMVA 5GZZB 5C04A 4ECJA 2DSAA 5F8BA 4GLTA 4OO4A 4POMA 3TB2A 2VM1A 3Q18A 5D9TA 4OCEA 4XS6A 5LNKe 3ZIJA 3VI5A 4HEA2 4IS0A 1K0BA 3H4KA 3TJGA 2LJAA 4MPFA 1G6WA 2XPEA 2JADA 3WGDA 2YWIA 2LUSA 2X99A 4F2IA 4XS1A 1V9WA 4QL7A 2NVLA 3IK7A 2X8CA 3TKSC 4EC0A 4RQXA 1T00A 17GSA 2F3MA 4NHZA 5HQPA 1FB6A 1OC3A 1QQ2A 2GVPA 2FGXA 2OACA 2X8HA 2VCTA 4V2NA 3L9VA 3HVXA 2ON7A 3H1NA 4MP4A 2XPDA 3JCML 3ZLPA 3LSZA 1BEDA 2JZTA 3SBCA 3MDKA 1V98A 1HNBA 1EOGA 5ECLB 3UEMA 4L0WA 3IC4A 2FWEA 5D9WA 2WGRA 2H72A 2P31A 1K0DA 1XW9A 4KCAA 4HZ4A 1TU7A 5D93A 4X0XA 1V58A 2CQ9A 1QK8A 2OJLA 3J7Yb 2JACA 2VIMA 2PU9C 4CHSA 4ACSA 3KMOA 1DE1A 5COHA 3IDVA 1TI3A 2L59A 3GN3A 1T8EB 1PGTA 2C0DA 2ZUPA 5J9CA 3ERGA 2JU5A 3NZNA 1Z9HA 3RHCA 2XBQA 1T3BA 5CRGA 1KEBA 3APSA 1R5PA 2IMKA 3KD0A 3WT1A 2OBIA 1X5DA 5H5RA 4GRFA 3S9FA 2V41A 2GLRA 3LG6A 2L5LA 1UVZA 5D8IA 4EE0A 1YZXA 1O8WA 2K8VA 2BTOT 1Y25A 4ECIA 3CRTA 5ELGA 1GTBA 4ZIJA 4EF0A 2HT9A 1ERVA 2F8FA 2FCHA 4K6XA 5G1LA 5INYA 3ZITA 1UN2A 1GSFA 1Z3EA 2L4QA 4F82A 2MMOA 5L71A 1TRWA 3QPMA 3IE3A 1R26A 2B7JA 1I5GA 1MD3A 3IA1A 2L5OA 2YP6A 2VM2A 1T1VA 2YWNA 4G9HA 1GP1A 4TR0A 4BVXA 5JCWA 1EZKA 2B1LA 2VCQA 1JZRA 4HZ2A 4ZB6A 3UVHA
chains in the Genus database with same CATH superfamily
3BD2A 4KNDA 1A24A 4V2MA 4HUAA 4PNFA 1PKWA 2FD3A 3IOSA 2TIRA 2PVQA 2VAFA 2N5AA 1DUGA 4F0BA 1Z7RA 4Z2UA 2BMXA 1XW5A 4O92A 4FO5A 4Q5FA 1BJXA 2C3QA 3A3TA 4EL1A 4YH2A 5IQYA 3LYKA 1PFOA 4OFMA 2CX4A 3PR8A 4MK3A 2CAQA 3GYKA 1BG5A 1J08A 4A5PA 2YPMA 4WR4A 3IR4A 3UIWA 4WKWA 1UA5A 2VLUA 5IO2A 4K0NA 4GF0A 4OCFA 5GSSA 4K8MA 3LFLA 5BMUA 3KZQA 1AQVA 2X64A 1AIUA 2VLTA 2VLVA 6GSYA 5JWRB 4RUVA 2OE3A 4IJ3A 3TRXA 1XOAA 1TRVA 3A5WA 3HZ8A 3GFKA 2DJJA 4IN0A 3U6VA 5DALA 3QD9A 2OE1A 2PBJA 5F05A 1SD9A 2GT6A 16GSA 5CRHA 1R4WA 5DAKA 3DD3A 3G7YA 3UMAA 1PN0A 1M9AA 4L5OA 1SD8A 2HSMA 2KP2A 1X9MB 3H93A 1XWCA 2FNOA 2A4VA 2R3XA 4KW6A 3LXZA 2YCDA 2O7KA 5EL8A 1K3YA 4TW5A 5DALB 4WBJA 2HRFA 4XS4A 1SKWB 4D73B 3N9JA 1ZMAA 2DJ1A 3LEFA 3VWUA 5DAKB 4HQSA 4NPBA 4DEJA 5IOXA 4CY8A 4I2TA 1YF0A 4X43A 5ID2A 1GSDA 5HFKA 1WRYA 4MZCA 4YAVA 5G1KA 4NV2A 2LTKA 4HOJA 1TRUA 3AY8A 5CO3A 1TOFA 2N5BA 3C8EA 1F3BA 1OAZA 1NW2A 1A0RP 4FQUA 2N5FA 2DKIA 5E59A 1K0OA 2OBKA 1S3AA 1AC1A 3KIJA 8GSSA 1TU8A 1XWAA 4LMVA 3GRXA 5G30A 4N11A 4IKHA 3D4MA 3LW9A 1HNCA 1ERUA 4V1Ap 2MYGA 2H01A 2HSHA 4PUAA 1O85A 9GSSA 2H1DA 2IJYA 3W8SA 5HR0A 2VL9A 2HRAA 5G2ZA 1ON4A 1XIYA 1WIKA 2LKUA 1ZYQB 1XOBA 4BPYA 1LU4A 1XXUA 4K7NA 4MCUA 1N2AA 1YJ6A 4I5QA 2HZEA 5CNWA 4MJEA 3HY2A 1QXHA 2H76A 4TVEA 3CMIA 2LQOA 1PRXA 4HU7A 4JBBA 2H30A 22GSA 4O7HA 2VCWA 3HXSA 1EV4A 2FWFA 1JZDA 3A5IA 3CSIA 1FW1A 2CVBA 1B4PA 1R5AA 1ZGNA 2HZEB 5EVOA 3E9JB 3E3EA 1AUCA 5J4UA 3L78A 2F9SA 2O89A 4GCIA 3VLNA 1OKTA 4BL7A 4PGTA 1AXDA 3I43A 4I6XA 4ZL7A 3PPUA 4TOPA 1XWGA 4ZL9A 6GSXA 2AB6A 3A2WA 1V40A 1Z7PA 3F6DA 4NHWA 3DMLA 1ABAA 1JHBA 2VO4A 4BL7B 4L5LA 2LRCA 1CQGA 4HI7A 1XW6A 3P8WA 2B5YA 2OKAA 4MJCA 2K8SA 2PMTA 4J57E 2YN1A 3FRCA 1THOA 4ECBA 2O8VB 2GZPA 1F3AA 3TOTA 3FYGA 4KDYA 3GV1A 2GQMA 1EV9A 1EEMA 3Q6OA 3OR5A 3DVWA 2WFCA 1BQ7A 3F4RA 3F4SA 1SL1B 2NBSA 4ULXA 1VF2A 1K3LA 2IPAA 2X4AA 3UL3A 3VWVA 4WF5A 3PINA 1GUHA 2A2SA 4HSCX 3CBUA 2J23A 3C73A 4LLRA 2PGTA 4QQ7A 1YKCA 2C1YA 1QFNA 1NHYA 1V57A 1WJKA 3MNGA 4YAPA 4PUFC 2AJQB 4X1UA 2CX3A 3GKNA 2WRTA 4POKA 1PA3A 2GDRA 2UZ8A 1XVQA 2LSTA 1TTZA 3BJ5A 3FZ9A 4BWSA 3ZYWA 1G7OA 3UOMA 3ZL5A 5A4VA 5HFIA 4FH8A 2VOCA 1LBKA 2OA7A 4HS1A 5FWGA 3IV4A 2WDUA 2YOIA 2JSZA 2C0EA 4MPGA 3QDNA 4HQZA 4MZWA 2X8GA 2WCIA 1B4QA 2L6CA 1M9BA 1F6MC 4TR1A 3F4TA 2QA1A 2MZCA 5ECPB 2R2JA 4L0UA 1EOHA 2H1BA 1SK2A 1Z5YE 2R0CA 3O6TA 3DRNA 2H66A 5D96A 1B48A 5D9XA 2RM6A 3KH9A 1O7UA 2HYXA 1GSSA 2P5QA 5J5NA 3L4NA 4ZB9A 5IMFA 2R0PA 2AV4A 1SU9A 2DJ0A 3HYPA 1OYJA 4EDYA 2EIOA 4TR1B 4PQ1A 1ACVA 2DC5A 2CZ2A 2DIZA 2LRNA 3HKRA 2B6MA 4YQVA 4ID0A 1TJDA 4ILFA 1GTIA 2PN8A 2QA2A 3TOUA 2TRXA 1GULA 4NXIA 3TKRA 4ZL8A 2AAWA 2GSTA 2RUEA 2H70A 5IIZA 1FOVA 4MH3A 1XWBA 3ME7A 3QFAC 5IMCA 5G5EA 5KOXA 2X49A 3DVXA 4I97A 3VURA 3GMFA 1PX6A 1PD21 1USBA 2IMEA 3I6AA 4IJIA 3GTUA 2MMAA 3HJOA 4BWQA 1U87A 1EGRA 2GTUA 3EE2A 3U5RE 3ZREA 1SKRB 3D21A 1OVNA 1E2YA 1ML6A 2K9FA 3EC3A 3ERFA 5ECNB 1R7HA 4LMWA 3IAM2 2C4JA 3WGXA 4Z2TA 4LL1B 1ZCPA 3C1SA 1HD2A 3IXRA 1A2MA 5AN1A 3BBYA 4RI7A 3DGQA 4KE3A 5CP1A 1Z6MA 1EP8A 5JWOB 3BCKA 2H1GA 1GNWA 5ECRB 5EPFA 2LEGA 2PPTA 3KJYA 2CV4A 1GUMA 1F2EA 3F63A 3QAVA 5ECHB 4YQMA 1B9XC 1H75A 13GSA 5IO0A 2XBIA 2EC4A 2DMMA 2V2GA 2GSSA 3IBHA 2E2GA 2D2ZA 2RUFA 2CVDA 5A4UA 2H6YA 2IN3A 2IWTA 2L57A 3L9UA 2JZRA 4MZBA 2ALBA 4IP1A 1WMJA 3LGCA 3EU4A 4I8BA 2BJXA 5ECKB 4TXVA 2EIRA 3HD5A 4HJMA 4JE1A 3FZ4A 3O3TA 3QFBC 5KN2A 1YF1A 4GXZA 4RI6A 1PL1A 2TRCP 2FA4A 4JR6A 2I9HA 3MIXA 5B8AA 4WF4A 1ZZYA 4AJ7A 4WR5A 3HA9A 4JU5A 4XRDA 1XCCA 4BVXB 1MDJA 3QAGA 3C71A 1X5CA 3D22A 4BA7A 2WB9A 4BVYA 4XCSA 2ON5A 2LRTA 2G2QA 4DSQA 2R37A 4J56E 1DSBA 3GL5A 2VCVA 11GSA 4IHUA 1MDIA 2IMIA 3HVSA 14GSA 3TCOA 2LQQA 4G0IA 4O5UA 4PTSA 2H71A 2IMDA 2L6DA 4IQ1A 4MJBA 3FR6A 1YDKA 4KCEA 1X5EA 3TUEA 2HRKA 3ZRDA 1I9DA 12GSA 3UBKA 2DMLA 2LS5A 4WEYA 4BVYB 1K0CA 1EWXA 3IHQA 1WPIA 1X9SB 4ZB8A 4HJ2A 3TKSE 5B8BA 2NTOA 2V1MA 1GL8A 4KUNA 3E0UA 1WWJA 2LNSA 3H79A 4KA0A 1KNGA 1PKZA 3GH6A 5H5QA 4G2EA 5JCGA 3ZFBA 3F6FA 3P7XA 4MA9A 3M8NA 3KCMA 2H73A 1XFLA 3QR6A 1KTEA 2EIQA 3LORA 3RAZA 4MF7A 1DE2A 1HNAA 2VD1A 1S3DA 4WETA 3G7JA 5KEJA 3CYNA 4TN8A 3DXBA 3KEBA 1VRSD 5G31A 3ZTLA 5HFGA 3HJMA 2A2RA 1X0RA 4WXTA 1A0FA 3KH7A 2CA8A 4N0ZA 3TDGA 3O76A 3QOUA 3EYTA 1BX9A 4G10A 2XHFA 3C1RA 3RPNA 1T4YA 3KTBA 1M3IA 2H0HA 4XRAA 1M3JA 1SK1A 4GSSA 2F51A 3EURA 5HR3A 4ML1A 1PQNA 2YWMA 4G0LA 1U3AA 4NWYA 1RW1A 4MH2A 4XS4B 4KX4A 2YNXA 5B6NA 4TR3A 4YKFA 5AISA 1LJRA 5IMVA 2P5RA 5ID2B 2WULA 2AUVA 1VGLA 2I1UA 3D0ZA 4MMMA 2PWJA 4ZILA 1SK0A 1ZYNA 5ECMB 2M46A 1YKAA 5J9BA 2H0GA 4E8HA 4NAXA 2HE3A 1M2AA 4GQCA 2MMNA 1Q4JA 1O73A 3GURA 4JEDA 3IAS2 4EXJA 2GS3A 3F3QA 2HZFA 3RDWA 2I3YA 4TKYA 1SJIA 2NDOA 3EMPA 2FY6A 2YV7A 5IMDA 3K8NA 3VPTA 2H6ZA 2GQLA 5ECIB 2O85A 3ZVJD 3F9UA 4FYCA 1OE8A 5CREA 1QUWA 1F9MA 1GSEA 3TRQA 1ZOFA 4EVMA 2GZYA 2YWOA 3VFIA 2I81A 3LQ7A 1V2AA 4O5QA 4POBA 2R6KA 1G6YA 1ERWA 2HSYA 4CW9A 5IM9A 2O87A 1O81A 19GSA 1QGVA 1O6JA 2KLXA 3FKFA 3GSSA 3HHVA 2REMA 2KHPA 2HRNA 1A2LA 4ZBBA 1ZYEA 3LXTA 3FR3A 2H19A 3TKPA 3IC8A 2E7PA 3WYWA 2DLXA 6GSTA 3DKSA 1SYXA 5HR2A 4PQHA 1O8XA 3FK8A 3IPZA 1AAZA 2IMFA 4DSRA 3GA4A 5H5SA 1DBYA 5DBQA 4DSSA 5DJMA 2YJHA 4V1Ag 3UAPA 2C80A 1ST9A 4Q5NA 2QGVA 1OC9A 2V6OA 5A4WA 2ES7A 4NV5A 1SJZA 2R0GA 2Z9SA 1ZL9A 3EINA 4KH7A 1U88A 2QSIA 5GAND 1AW9A 3KXOA 4AJ8A 4JR4A 5A5KA 4EKZA 4TRXA 2DIYA 1A23A 3F0IA 3GX8A 3ZVJA 3D6IA 4AGSA 5CRWA 1OKDA 3WD6A 1A8LA 4MLYA 1M2BA 2C0FA 3KMNA 4MF5A 3WT2A 3VI7A 4GTUA 2RLIA 1IYIA 4JRRA 4K2XA 5AIVA 1Q98A 5DJLA 4ZXGA 3BOAA 3TGZA 3FEUA 3A2VA 3D5JA 1GLPA 4IVFA 2GSRA 1U3IA 3P90A 2C3TA 3FW2A 1AQXA 4XTSA 3I69A 4KB3A 1YY7A 1ERTA 1SENA 5KOWA 2E2MA 2FWHA 2IIYA 1A2JA 3DEXA 2M72A 2FLSA 1E6BA 3R3EA 2P0GA 4L8EA 3ZMKA 1FAAA 1IYHA 3ED3A 1W4VA 2KP1A 1G0TA 4EIPA 1JZOA 3Q19A 2FHEA 5CYYA 3ISOA 3UJ1A 3LJRA 3FMWA 2RIIA 3FY7A 3V1WA 1K3OA 1S3CA 3CSJA 5GAPD 3RBTA 2GGTA 3KM6A 5D9VA 3KP9A 6GSSA 3N5OA 3MYDA 1Z6NA 4POLA 3EPTA 1YEPA 1YQ1A 2R4VA 1J0FA 2FA8A 3RPPA 4K7IA 1FVKA 1TDIA 1GUKA 3M0FA 3FR9A 1Y6EA 3Q74A 4ZBAA 3SWLA 4PURA 4O32A 1NM3A 3MWHA 1TK0B 1JZWA 3GNJA 3VK9A 3M9JA 1W89A 2DBCA 2V32A 3UVTA 2WJUA 3KTLA 1JFUA 5F07A 5EY6A 1FB0A 4K1FA 1A8YA 3VWXA 3HZ4A 4PX1A 3TJFA 5JWQB 3DIEA 2DJ2A 3HJPA 5LCZA 3GSTA 4MF6A 2JSYA 1TI1A 5IMAA 2HI7A 3W8JA 2B5EA 4WBRD 5IPGA 2PVOC 4X4JA 2HXKA 3ERWA 4OWYA 4PQIA 1PSQA 3GTUB 4V2LA 1HQOA 2H1AA 2ZNMA 3ZMLA 4XIHA 4K0GA 4LA1A 3FZ5A 2GZZA 3DYRA 4Q5RA 3APOA 4TR4A 4IELA 3P2AA 3BCIA 1GH2A 4I2UA 1G7EA 1PN9A 2FUG2 1VF1A 1TK8B 1SKSB 3CTGA 5GSTA 2VD0A 3MSZA 2H75A 2YZUA 1UC7A 1GSQA 3GIXA 2WS2A 1X9WB 3D4TA 3ZFLA 4DVCA 3QAWA 3IRAA 4IBPA 3F3RA 3GHAA 1TW9A 3GKKA 5IOWA 2QKEA 5J41A 2OADA 3G9BA 4J2FA 1VF4A 4Q5QA 1K0MA 5ECSA 2CZ3A 4N0VA 5ECQB 1FVJA 2VL3A 1HYUA 4KAEA 2DJ3A 2H8LA 1M99A 2CAIA 2F8AA 4FYUA 5F0GA 1URMA 6GSUA 1WP0A 5LD0A 4OFTA 5B6MA 5E4WA 4KF9A 3GUSA 4PNGA 2B1KA 2KOKA 4OD7A 2A4HA 5IMZA 2I4AA 4IQAA 1MDKA 4EDZA 1M7TA 1K0NA 5D73A 1U6TA 2HNLA 3F8UA 5FHIA 1XPVA 4F0CA 1TK5B 1NHOA 4O5RA 1B9YC 3L0HA 10GSA 1JLWA 2PERA 1N8JA 5ENUA 2YZHA 4G19A 2GQKA 2M80A 4ICYA 1TKDB 4P3YB 3HVVA 1MD4A 4NMUA 4GSTA 1FG4A 3CSHA 3VPQA 1XG8A 4KDUA 1JLVA 3A2XA 1GLQA 4AJ6A 3NIVA 4ECCA 1OC8A 1XVWA 3W6GA 1MTCA 2ZCTA 1WOUA 2C8UA 2E0QA 6GSVA 2G0FA 1TP9A 1YEXA 4D73A 2CVKA 3GKMA 1VF3A 2RM5A 4CDOA 5FT3A 1GRXA 2H74A 1TXXA 4LL4B 4KSOA 4F9ZA 3I9V2 4KDXA 1TRSA 2LJRA 1EGOA 5DQSA 4IGJA 3TJBA 3EMXA 2VCZA 5B7CA 3TJJA 2YV9A 5G5FA 3NOFA 1B8XA 2K6VA 2MMZA 4GWRA 4K5RA 3ZZXA 3TJKA 2L4CA 5C00A 4K9ZA 18GSA 3GKXA 5CAXA 1CQHA 3APQA 3MAKA 2R5GA 2LJKA 2A2PA 3RHBA 2PUKC 4ML6A 3HCZA 3C7MA 3CTFA 3ME8A 2IFQA 20GSA 4Z7XA 3LYPA 3QCPA 3PH9A 3EVIA 3US3A 3CRUA 1OE7A 2FWGA 5F06A 5KN3A 2HFDA 4ISDA 4K2DA 4ZBDA 4FYBA 3GH9A 2IL3A 1C72A 4GSNA 4G0KA 1SJ6A 5IPHA 2LNTA 4IW9A 2KUCA 2K18A 2IFQB 1EP7A 1GSUA 2C3NA 5ECOB 4K7OA 4F03A 5ELAA 1H4OA 4PXOA 1SL2B 2VL2A 3TRPA 2B7KA 5ABRA 1PX7A 2VCXA 1MEKA 2YJ7A 4H86A 3WGEA 3R2QA 5DQYA 4MNNA 2H6XA 1RQMA 4HDEA 3H8QA 4BIKA 2YANA 5HR1A 2DKHA 5DVBA 4FIWA 3EU3A 5DDLA 1GWCA 3GL3A 4AF2A 5J3RA 2J9HA 1PMTA 2GSQA 1NSWA 3FHKA 4EUYA 2B3SA 1SYRA 2V6KA 4N10A 3PGTA 4JZQA 3KP8A 6GSWA 1BYEA 1FHEA 4HU9A 4QL9A 1RK4A 4IP6A 3J7Yk 2JL4A 4MJAA 4XHMA 2MBSA 3TKQA 2VUPA 3L9SA 3G7IA 4RQRA 1XBSA 2AHEA 2NPBA 3IHGA 1T7PB 3ZIVA 3HDCA 5DCGA 4KSMA 3GX0A 1GSYA 4OFNA 1GTUA 5DCHA 1F37A 7GSSA 2OE0A 4TXOA 1M2DA 2GT5A 3UARA 1GNEA 4Z2RA 2HLSA 1GTAA 2LV3A 1FO5A 2B5XA 1EEJA 3IK9A 4MDCA 4YQUA 4USSA 2VL2C 5KN0A 3M3MA 2XC2A 3LWAA 4N30A 4DSSB 3EWLA 4KGIA 3KGKA 3M9KA 3TKSA 1PL2A 1AQWA 1J9BA 1OC9B 1THXA 5JCUA 4TXOB 1M0UA 5CRDA 4E8EA 4OO5A 3VWWA 1XWKA 2C0GA 5KN1A 3FZAA 3DWVA 3CXGA 2QC7A 1BAYA 5AGYA 1T4ZA 1XZOA 2JZSA 4EO3A 1K0AA 2MBTA 5AIXA 1KBNA 2DJKA 4CY6A 2CT6A 2AYTA 1WE0A 1ILOA 1QMVA 2WZ9A 1SL0B 4GQFA 3QMXA 3M1GA 4MABA 2H0IA 3UBLA 5BRTA 4OMVA 5GZZB 5C04A 4ECJA 2DSAA 5F8BA 4GLTA 4OO4A 4POMA 3TB2A 2VM1A 3Q18A 4OCEA 5D9TA 4XS6A 5LNKe 3ZIJA 3VI5A 4HEA2 4IS0A 1K0BA 3H4KA 3TJGA 2LJAA 4MPFA 1G6WA 2XPEA 2JADA 3WGDA 2YWIA 2LUSA 2X99A 4F2IA 4XS1A 1V9WA 4QL7A 2NVLA 3IK7A 2X8CA 3TKSC 4EC0A 4RQXA 1T00A 17GSA 2F3MA 4NHZA 5HQPA 1FB6A 1OC3A 1QQ2A 2GVPA 2FGXA 2OACA 2X8HA 2VCTA 4V2NA 3L9VA 3HVXA 2ON7A 3H1NA 4MP4A 2XPDA 3JCML 3ZLPA 3LSZA 1BEDA 2JZTA 3SBCA 1S3RA 3MDKA 1V98A 1HNBA 1EOGA 5ECLB 3UEMA 4L0WA 3IC4A 2FWEA 5D9WA 2WGRA 3CQFA 2H72A 2P31A 1K0DA 1XW9A 4KCAA 4HZ4A 1TU7A 5D93A 4X0XA 1V58A 2CQ9A 1QK8A 4EIQA 2OJLA 3J7Yb 2JACA 2VIMA 2PU9C 4CHSA 4ACSA 3KMOA 1DE1A 1ZYPA 4YKGA 5COHA 3IDVA 1TI3A 2L59A 3GN3A 3HVNA 1T8EB 1PGTA 2C0DA 2ZUPA 5J9CA 3ERGA 2JU5A 3NZNA 1Z9HA 3RHCA 2XBQA 1T3BA 5CRGA 4K5SA 1KEBA 3APSA 1R5PA 2IMKA 3KD0A 3WT1A 2OBIA 1X5DA 5H5RA 4GRFA 3S9FA 2V41A 2GLRA 3LG6A 2L5LA 1UVZA 5D8IA 4EE0A 1YZXA 1O8WA 2K8VA 2BTOT 1Y25A 4ECIA 3CRTA 5ELGA 1GTBA 4ZIJA 4EF0A 2HT9A 1ERVA 2F8FA 2FCHA 4K6XA 5G1LA 5INYA 3ZITA 1UN2A 1GSFA 1Z3EA 2L4QA 4F82A 2MMOA 5L71A 1TRWA 3QPMA 3IE3A 1R26A 2B7JA 1I5GA 1MD3A 3IA1A 2L5OA 2YP6A 2VM2A 1T1VA 2YWNA 4G9HA 1GP1A 4TR0A 4BVXA 5JCWA 1EZKA 2B1LA 2VCQA 1JZRA 1FOHA 4HZ2A 4ZB6A 3UVHA
chains in the Genus database with same CATH topology
3BD2A 4KNDA 1A24A 4V2MA 4HUAA 4PNFA 1PKWA 2FD3A 3IOSA 2TIRA 2PVQA 2VAFA 2N5AA 1DUGA 4F0BA 1Z7RA 4Z2UA 2BMXA 1XW5A 4O92A 4FO5A 4Q5FA 1BJXA 2C3QA 3A3TA 4EL1A 4YH2A 5IQYA 3LYKA 4OFMA 2CX4A 3PR8A 4MK3A 2CAQA 3GYKA 1BG5A 1J08A 4A5PA 2YPMA 4WR4A 3IR4A 3UIWA 4WKWA 1UA5A 2VLUA 5IO2A 4K0NA 4GF0A 4OCFA 5GSSA 4K8MA 3LFLA 5BMUA 3KZQA 1AQVA 2X64A 1AIUA 2VLTA 2VLVA 6GSYA 5JWRB 4RUVA 2OE3A 4IJ3A 3TRXA 1XOAA 1TRVA 3A5WA 3HZ8A 3GFKA 2DJJA 4IN0A 3U6VA 5DALA 3QD9A 2OE1A 2PBJA 5F05A 1SD9A 2GT6A 16GSA 5CRHA 1R4WA 5DAKA 3DD3A 3G7YA 3UMAA 1PN0A 1M9AA 4L5OA 1SD8A 2HSMA 2KP2A 1X9MB 3H93A 1XWCA 2FNOA 2A4VA 2R3XA 4KW6A 3LXZA 2YCDA 2O7KA 5EL8A 1K3YA 4TW5A 5DALB 4WBJA 2HRFA 4XS4A 1SKWB 4D73B 3N9JA 1ZMAA 2DJ1A 3LEFA 3VWUA 5DAKB 4HQSA 4NPBA 4DEJA 5IOXA 4CY8A 4I2TA 1YF0A 4X43A 5ID2A 1GSDA 5HFKA 1WRYA 4MZCA 4YAVA 5G1KA 4NV2A 2LTKA 4HOJA 1TRUA 3AY8A 5CO3A 1TOFA 2N5BA 3C8EA 1F3BA 1OAZA 1NW2A 1A0RP 4FQUA 2N5FA 2DKIA 5E59A 1K0OA 2OBKA 1S3AA 1AC1A 3KIJA 8GSSA 1TU8A 1XWAA 4LMVA 3GRXA 5G30A 4N11A 4IKHA 3D4MA 3LW9A 1HNCA 1ERUA 4V1Ap 2MYGA 2H01A 2HSHA 4PUAA 1O85A 9GSSA 2H1DA 2IJYA 3W8SA 5HR0A 2VL9A 2HRAA 5G2ZA 1ON4A 1XIYA 1WIKA 2LKUA 1ZYQB 1XOBA 4BPYA 1LU4A 1XXUA 4K7NA 4MCUA 1N2AA 1YJ6A 4I5QA 2HZEA 5CNWA 4MJEA 3HY2A 1QXHA 2H76A 4TVEA 3CMIA 2LQOA 1PRXA 4HU7A 4JBBA 2H30A 22GSA 4O7HA 2VCWA 3HXSA 1EV4A 2FWFA 1JZDA 3A5IA 3CSIA 1FW1A 2CVBA 1B4PA 1R5AA 1ZGNA 2HZEB 5EVOA 3E9JB 3E3EA 1AUCA 5J4UA 3L78A 2F9SA 2O89A 4GCIA 3VLNA 1OKTA 4BL7A 4PGTA 1AXDA 3I43A 4I6XA 4ZL7A 3PPUA 4TOPA 1XWGA 4ZL9A 6GSXA 2AB6A 3A2WA 1V40A 1Z7PA 3F6DA 4NHWA 3DMLA 1ABAA 1JHBA 2VO4A 4BL7B 4L5LA 2LRCA 1CQGA 4HI7A 1XW6A 3P8WA 2B5YA 2OKAA 4MJCA 2K8SA 2PMTA 4J57E 2YN1A 3FRCA 1THOA 4ECBA 2O8VB 2GZPA 1F3AA 3TOTA 3FYGA 4KDYA 3GV1A 2GQMA 1EV9A 1EEMA 3Q6OA 3OR5A 3DVWA 2WFCA 1BQ7A 3F4RA 3F4SA 1SL1B 2NBSA 4ULXA 1VF2A 1K3LA 2IPAA 2X4AA 3UL3A 3VWVA 4WF5A 3PINA 1GUHA 2A2SA 3CBUA 2J23A 3C73A 4LLRA 2PGTA 4QQ7A 1YKCA 2C1YA 1QFNA 1NHYA 1V57A 1WJKA 3MNGA 4YAPA 4PUFC 2AJQB 4X1UA 2CX3A 3GKNA 2WRTA 4POKA 1PA3A 2GDRA 2UZ8A 1XVQA 2LSTA 1TTZA 3BJ5A 3FZ9A 4BWSA 3ZYWA 1G7OA 3UOMA 3ZL5A 5A4VA 5HFIA 4FH8A 2VOCA 1LBKA 2OA7A 4HS1A 5FWGA 3IV4A 2WDUA 2YOIA 2JSZA 2C0EA 4MPGA 3QDNA 4HQZA 4MZWA 2X8GA 2WCIA 1B4QA 2L6CA 1M9BA 1F6MC 4TR1A 3F4TA 2QA1A 2MZCA 5ECPB 2R2JA 4L0UA 1EOHA 2H1BA 1SK2A 1Z5YE 2R0CA 3O6TA 3DRNA 2H66A 5D96A 1B48A 5D9XA 2RM6A 3KH9A 1O7UA 2HYXA 1GSSA 2P5QA 5J5NA 3L4NA 4ZB9A 5IMFA 2R0PA 2AV4A 1SU9A 2DJ0A 3HYPA 1OYJA 4EDYA 2EIOA 4TR1B 4PQ1A 1ACVA 2DC5A 2CZ2A 2DIZA 2LRNA 3HKRA 2B6MA 4YQVA 4ID0A 1TJDA 4ILFA 1GTIA 2PN8A 2QA2A 3TOUA 2TRXA 1GULA 4NXIA 3TKRA 4ZL8A 2AAWA 2GSTA 2RUEA 2H70A 5IIZA 1FOVA 4MH3A 1XWBA 3ME7A 3QFAC 5IMCA 5G5EA 5KOXA 2X49A 3DVXA 4I97A 3VURA 3GMFA 1PX6A 1PD21 1USBA 2IMEA 3I6AA 4IJIA 3GTUA 2MMAA 3HJOA 4BWQA 1U87A 1EGRA 2GTUA 3EE2A 3U5RE 3ZREA 1SKRB 3D21A 1OVNA 1E2YA 1ML6A 2K9FA 3EC3A 3ERFA 5ECNB 1R7HA 4LMWA 3IAM2 2C4JA 3WGXA 4Z2TA 4LL1B 1ZCPA 3C1SA 1HD2A 3IXRA 1A2MA 5AN1A 3BBYA 4RI7A 3DGQA 4KE3A 5CP1A 1Z6MA 1EP8A 5JWOB 3BCKA 2H1GA 1GNWA 5ECRB 5EPFA 2LEGA 2PPTA 3KJYA 2CV4A 1GUMA 1F2EA 3F63A 3QAVA 5ECHB 4YQMA 1B9XC 1H75A 13GSA 5IO0A 2XBIA 2EC4A 2DMMA 2V2GA 2GSSA 3IBHA 2E2GA 2D2ZA 2RUFA 2CVDA 5A4UA 2H6YA 2IN3A 2IWTA 2L57A 3L9UA 2JZRA 4MZBA 2ALBA 4IP1A 1WMJA 3LGCA 3EU4A 4I8BA 2BJXA 5ECKB 4TXVA 2EIRA 3HD5A 4HJMA 4JE1A 3FZ4A 3O3TA 3QFBC 5KN2A 1YF1A 4GXZA 4RI6A 1PL1A 2TRCP 2FA4A 4JR6A 2I9HA 3MIXA 5B8AA 4WF4A 1ZZYA 4AJ7A 4WR5A 3HA9A 4JU5A 4XRDA 1XCCA 4BVXB 1MDJA 3QAGA 3C71A 1X5CA 3D22A 4BA7A 2WB9A 4BVYA 4XCSA 2ON5A 2LRTA 2G2QA 4DSQA 2R37A 4J56E 1DSBA 3GL5A 2VCVA 11GSA 4IHUA 1MDIA 2IMIA 3HVSA 14GSA 3TCOA 2LQQA 4G0IA 4O5UA 4PTSA 2H71A 2IMDA 2L6DA 4IQ1A 4MJBA 3FR6A 1YDKA 4KCEA 1X5EA 3TUEA 2HRKA 3ZRDA 1I9DA 12GSA 3UBKA 2DMLA 2LS5A 4WEYA 4BVYB 1K0CA 1EWXA 3IHQA 1WPIA 1X9SB 4ZB8A 4HJ2A 3TKSE 5B8BA 2NTOA 2V1MA 1GL8A 4KUNA 3E0UA 1WWJA 2LNSA 3H79A 4KA0A 1KNGA 1PKZA 3GH6A 5H5QA 4G2EA 5JCGA 3ZFBA 3F6FA 3P7XA 4MA9A 3M8NA 3KCMA 2H73A 1XFLA 3QR6A 1KTEA 2EIQA 3LORA 3RAZA 4MF7A 1DE2A 1HNAA 2VD1A 1S3DA 4WETA 3G7JA 5KEJA 3CYNA 4TN8A 3DXBA 3KEBA 1VRSD 5G31A 3ZTLA 5HFGA 3HJMA 2A2RA 1X0RA 4WXTA 1A0FA 3KH7A 2CA8A 4N0ZA 3TDGA 3O76A 3QOUA 3EYTA 1BX9A 4G10A 2XHFA 3C1RA 3RPNA 1T4YA 3KTBA 2H0HA 4XRAA 1SK1A 4GSSA 2F51A 3EURA 5HR3A 4ML1A 1PQNA 2YWMA 4G0LA 1U3AA 4NWYA 1RW1A 4MH2A 4XS4B 4KX4A 2YNXA 5B6NA 4TR3A 4YKFA 5AISA 1LJRA 5IMVA 2P5RA 5ID2B 2WULA 2AUVA 1VGLA 2I1UA 3D0ZA 4MMMA 2PWJA 4ZILA 1SK0A 1ZYNA 5ECMB 2M46A 1YKAA 5J9BA 2H0GA 4E8HA 4NAXA 2HE3A 1M2AA 4GQCA 2MMNA 1Q4JA 1O73A 3GURA 4JEDA 3IAS2 4EXJA 2GS3A 3F3QA 2HZFA 3RDWA 2I3YA 4TKYA 1SJIA 2NDOA 3EMPA 2FY6A 2YV7A 5IMDA 3K8NA 3VPTA 2H6ZA 2GQLA 5ECIB 2O85A 3ZVJD 3F9UA 4FYCA 1OE8A 5CREA 1QUWA 1F9MA 1GSEA 3TRQA 1ZOFA 4EVMA 2GZYA 2YWOA 3VFIA 2I81A 3LQ7A 1V2AA 4O5QA 4POBA 2R6KA 1G6YA 1ERWA 2HSYA 4CW9A 5IM9A 2O87A 1O81A 19GSA 1QGVA 1O6JA 2KLXA 3FKFA 3GSSA 3HHVA 2REMA 2KHPA 2HRNA 1A2LA 4ZBBA 1ZYEA 3LXTA 3FR3A 2H19A 3TKPA 3IC8A 2E7PA 3WYWA 2DLXA 6GSTA 3DKSA 1SYXA 5HR2A 4PQHA 1O8XA 3FK8A 3IPZA 1AAZA 2IMFA 4DSRA 3GA4A 5H5SA 1DBYA 5DBQA 4DSSA 5DJMA 2YJHA 4V1Ag 3UAPA 2C80A 1ST9A 4Q5NA 2QGVA 1OC9A 2V6OA 5A4WA 2ES7A 4NV5A 1SJZA 2R0GA 2Z9SA 1ZL9A 3EINA 4KH7A 1U88A 2QSIA 5GAND 1AW9A 3KXOA 4AJ8A 4JR4A 5A5KA 4EKZA 4TRXA 2DIYA 1A23A 3F0IA 3GX8A 3ZVJA 3D6IA 4AGSA 5CRWA 1OKDA 3WD6A 1A8LA 4MLYA 1M2BA 2C0FA 3KMNA 4MF5A 3WT2A 3VI7A 4GTUA 2RLIA 1IYIA 4JRRA 4K2XA 5AIVA 1Q98A 5DJLA 4ZXGA 3BOAA 3TGZA 3FEUA 3A2VA 3D5JA 1GLPA 4IVFA 2GSRA 1U3IA 3P90A 2C3TA 3FW2A 1AQXA 4XTSA 3I69A 4KB3A 1YY7A 1ERTA 1SENA 5KOWA 2E2MA 2FWHA 2IIYA 1A2JA 3DEXA 2M72A 2FLSA 1E6BA 3R3EA 2P0GA 4L8EA 3ZMKA 1FAAA 1IYHA 3ED3A 1W4VA 2KP1A 1G0TA 4EIPA 1JZOA 3Q19A 2FHEA 5CYYA 3ISOA 3UJ1A 3LJRA 3FMWA 2RIIA 3FY7A 3V1WA 1K3OA 1S3CA 3CSJA 5GAPD 3RBTA 2GGTA 3KM6A 5D9VA 3KP9A 6GSSA 3N5OA 3MYDA 1Z6NA 4POLA 3EPTA 1YEPA 1YQ1A 2R4VA 1J0FA 2FA8A 3RPPA 4K7IA 1FVKA 1TDIA 1GUKA 3M0FA 3FR9A 1Y6EA 3Q74A 4ZBAA 3SWLA 4PURA 4O32A 1NM3A 3MWHA 1TK0B 1JZWA 3GNJA 3VK9A 3M9JA 1W89A 2DBCA 2V32A 3UVTA 2WJUA 3KTLA 1JFUA 5F07A 5EY6A 1FB0A 4K1FA 1A8YA 3VWXA 3HZ4A 4PX1A 3TJFA 5JWQB 3DIEA 2DJ2A 3HJPA 5LCZA 3GSTA 4MF6A 2JSYA 1TI1A 5IMAA 2HI7A 3W8JA 2B5EA 4WBRD 5IPGA 2PVOC 4X4JA 2HXKA 3ERWA 4OWYA 4PQIA 1PSQA 3GTUB 4V2LA 1HQOA 2H1AA 2ZNMA 3ZMLA 4XIHA 4K0GA 4LA1A 3FZ5A 2GZZA 3DYRA 4Q5RA 3APOA 4TR4A 4IELA 3P2AA 3BCIA 1GH2A 4I2UA 1G7EA 1PN9A 2FUG2 1VF1A 1TK8B 1SKSB 3CTGA 5GSTA 2VD0A 3MSZA 2H75A 2YZUA 1UC7A 1GSQA 3GIXA 2WS2A 1X9WB 3D4TA 3ZFLA 4DVCA 3QAWA 3IRAA 4IBPA 3F3RA 3GHAA 1TW9A 3GKKA 5IOWA 2QKEA 5J41A 2OADA 3G9BA 4J2FA 1VF4A 4Q5QA 1K0MA 5ECSA 2CZ3A 4N0VA 5ECQB 1FVJA 2VL3A 1HYUA 4KAEA 2DJ3A 2H8LA 1M99A 2CAIA 2F8AA 4FYUA 5F0GA 1URMA 6GSUA 1WP0A 5LD0A 4OFTA 5B6MA 5E4WA 4KF9A 3GUSA 4PNGA 2B1KA 2KOKA 4OD7A 2A4HA 5IMZA 2I4AA 4IQAA 1MDKA 4EDZA 1M7TA 1K0NA 5D73A 1U6TA 2HNLA 3F8UA 5FHIA 1XPVA 4F0CA 1TK5B 1NHOA 4O5RA 1B9YC 3L0HA 10GSA 1JLWA 2PERA 1N8JA 5ENUA 2YZHA 4G19A 2GQKA 2M80A 4ICYA 1TKDB 4P3YB 3HVVA 1MD4A 4NMUA 4GSTA 1FG4A 3CSHA 3VPQA 4KDUA 1JLVA 3A2XA 1GLQA 4AJ6A 3NIVA 4ECCA 1OC8A 1XVWA 3W6GA 1MTCA 2ZCTA 1WOUA 2C8UA 2E0QA 6GSVA 2G0FA 1TP9A 1YEXA 4D73A 2CVKA 3GKMA 1VF3A 2RM5A 4CDOA 5FT3A 1GRXA 2H74A 1TXXA 4LL4B 4KSOA 4F9ZA 3I9V2 4KDXA 1TRSA 2LJRA 1EGOA 5DQSA 4IGJA 3TJBA 3EMXA 2VCZA 5B7CA 3TJJA 2YV9A 5G5FA 3NOFA 1B8XA 2K6VA 2MMZA 4GWRA 4K5RA 3ZZXA 3TJKA 2L4CA 5C00A 4K9ZA 18GSA 3GKXA 5CAXA 1CQHA 3APQA 3MAKA 2R5GA 2LJKA 2A2PA 3RHBA 2PUKC 4ML6A 3HCZA 3C7MA 3CTFA 3ME8A 2IFQA 20GSA 4Z7XA 3LYPA 3QCPA 3PH9A 3EVIA 3US3A 3CRUA 1OE7A 2FWGA 5F06A 5KN3A 2HFDA 4ISDA 4K2DA 4ZBDA 4FYBA 3GH9A 2IL3A 1C72A 4GSNA 4G0KA 1SJ6A 5IPHA 2LNTA 4IW9A 2KUCA 2K18A 2IFQB 1EP7A 1GSUA 2C3NA 5ECOB 4K7OA 4F03A 5ELAA 1H4OA 4PXOA 1SL2B 2VL2A 3TRPA 2B7KA 5ABRA 1PX7A 2VCXA 1MEKA 2YJ7A 4H86A 3WGEA 3R2QA 5DQYA 4MNNA 2H6XA 1RQMA 4HDEA 3H8QA 2YANA 5HR1A 2DKHA 5DVBA 4FIWA 3EU3A 5DDLA 1GWCA 3GL3A 4AF2A 5J3RA 2J9HA 1PMTA 2GSQA 1NSWA 3FHKA 4EUYA 2B3SA 1SYRA 2V6KA 4N10A 3PGTA 4JZQA 3KP8A 6GSWA 1BYEA 1FHEA 4HU9A 4QL9A 1RK4A 4IP6A 3J7Yk 2JL4A 4MJAA 4XHMA 2MBSA 3TKQA 2VUPA 3L9SA 3G7IA 4RQRA 1XBSA 2AHEA 2NPBA 3IHGA 1T7PB 3ZIVA 3HDCA 5DCGA 4KSMA 3GX0A 1GSYA 4OFNA 1GTUA 5DCHA 1F37A 7GSSA 2OE0A 4TXOA 1M2DA 2GT5A 3UARA 1GNEA 4Z2RA 2HLSA 1GTAA 2LV3A 1FO5A 2B5XA 1EEJA 3IK9A 4MDCA 4YQUA 4USSA 2VL2C 5KN0A 3M3MA 2XC2A 3LWAA 4N30A 4DSSB 3EWLA 4KGIA 3KGKA 3M9KA 3TKSA 1PL2A 1AQWA 1J9BA 1OC9B 1THXA 5JCUA 4TXOB 1M0UA 5CRDA 4E8EA 4OO5A 3VWWA 1XWKA 2C0GA 5KN1A 3FZAA 3DWVA 3CXGA 2QC7A 1BAYA 5AGYA 1T4ZA 1XZOA 2JZSA 4EO3A 1K0AA 2MBTA 5AIXA 1KBNA 2DJKA 4CY6A 2CT6A 2AYTA 1WE0A 1ILOA 1QMVA 2WZ9A 1SL0B 4GQFA 3QMXA 3M1GA 4MABA 2H0IA 3UBLA 5BRTA 4OMVA 5GZZB 5C04A 4ECJA 2DSAA 5F8BA 4GLTA 4OO4A 4POMA 3TB2A 2VM1A 3Q18A 4OCEA 5D9TA 4XS6A 5LNKe 3ZIJA 3VI5A 4HEA2 4IS0A 1K0BA 3H4KA 3TJGA 2LJAA 4MPFA 1G6WA 2XPEA 2JADA 3WGDA 2YWIA 2LUSA 2X99A 4F2IA 4XS1A 1V9WA 4QL7A 2NVLA 3IK7A 2X8CA 3TKSC 4EC0A 4RQXA 1T00A 17GSA 2F3MA 4NHZA 5HQPA 1FB6A 1OC3A 1QQ2A 2GVPA 2FGXA 2OACA 2X8HA 2VCTA 4V2NA 3L9VA 3HVXA 2ON7A 3H1NA 4MP4A 2XPDA 3JCML 3ZLPA 3LSZA 1BEDA 2JZTA 3SBCA 3MDKA 1V98A 1HNBA 1EOGA 5ECLB 3UEMA 4L0WA 3IC4A 2FWEA 5D9WA 2WGRA 2H72A 2P31A 1K0DA 1XW9A 4KCAA 4HZ4A 1TU7A 5D93A 4X0XA 1V58A 2CQ9A 1QK8A 4EIQA 2OJLA 3J7Yb 2JACA 2VIMA 2PU9C 4CHSA 4ACSA 3KMOA 1DE1A 1ZYPA 4YKGA 5COHA 3IDVA 1TI3A 2L59A 3GN3A 1T8EB 1PGTA 2C0DA 2ZUPA 5J9CA 3ERGA 2JU5A 3NZNA 1Z9HA 3RHCA 2XBQA 1T3BA 5CRGA 4K5SA 1KEBA 3APSA 1R5PA 2IMKA 3KD0A 3WT1A 2OBIA 1X5DA 5H5RA 4GRFA 3S9FA 2V41A 2GLRA 3LG6A 2L5LA 1UVZA 5D8IA 4EE0A 1YZXA 1O8WA 2K8VA 2BTOT 1Y25A 4ECIA 3CRTA 5ELGA 1GTBA 4ZIJA 4EF0A 2HT9A 1ERVA 2F8FA 2FCHA 4K6XA 5G1LA 5INYA 3ZITA 1UN2A 1GSFA 1Z3EA 2L4QA 4F82A 2MMOA 5L71A 1TRWA 3QPMA 3IE3A 1R26A 2B7JA 1I5GA 1MD3A 3IA1A 2L5OA 2YP6A 2VM2A 1T1VA 2YWNA 4G9HA 1GP1A 4TR0A 4BVXA 5JCWA 1EZKA 2B1LA 2VCQA 1JZRA 1FOHA 4HZ2A 4ZB6A 3UVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BD2 A;  4KND A;  1A24 A;  4V2M A;  4HUA A;  4PNF A;  1PKW A;  2FD3 A;  3IOS A;  2TIR A;  2PVQ A;  2VAF A;  2N5A A;  1DUG A;  4F0B A;  1Z7R A;  2BMX A;  1XW5 A;  4O92 A;  4FO5 A;  4Q5F A;  1BJX A;  2C3Q A;  3A3T A;  4EL1 A;  4YH2 A;  5IQY A;  3LYK A;  4OFM A;  2CX4 A;  3PR8 A;  4MK3 A;  2CAQ A;  3GYK A;  1BG5 A;  1J08 A;  2YPM A;  4WR4 A;  3IR4 A;  3UIW A;  4WKW A;  1UA5 A;  2VLU A;  5IO2 A;  4K0N A;  4GF0 A;  4OCF A;  5GSS A;  4K8M A;  3LFL A;  3KZQ A;  1AQV A;  2X64 A;  1AIU A;  2VLT A;  2VLV A;  6GSY A;  5JWR B;  4RUV A;  2OE3 A;  4IJ3 A;  3TRX A;  1XOA A;  1TRV A;  3A5W A;  3HZ8 A;  3GFK A;  2DJJ A;  4IN0 A;  3U6V A;  5DAL A;  3QD9 A;  2OE1 A;  2PBJ A;  5F05 A;  1SD9 A;  2GT6 A;  16GS A;  5CRH A;  1R4W A;  5DAK A;  3DD3 A;  3G7Y A;  3UMA A;  1M9A A;  4L5O A;  1SD8 A;  2KP2 A;  1X9M B;  3H93 A;  1XWC A;  2FNO A;  2A4V A;  2R3X A;  4KW6 A;  3LXZ A;  2YCD A;  2O7K A;  5EL8 A;  1K3Y A;  4TW5 A;  5DAL B;  4WBJ A;  2HRF A;  4XS4 A;  1SKW B;  4D73 B;  3N9J A;  1ZMA A;  2DJ1 A;  3LEF A;  3VWU A;  5DAK B;  4HQS A;  4NPB A;  4DEJ A;  5IOX A;  4I2T A;  1YF0 A;  4X43 A;  5ID2 A;  1GSD A;  5HFK A;  1WRY A;  4MZC A;  4YAV A;  5G1K A;  4NV2 A;  2LTK A;  4HOJ A;  1TRU A;  3AY8 A;  5CO3 A;  1TOF A;  2N5B A;  3C8E A;  1F3B A;  1OAZ A;  1NW2 A;  1A0R P;  2N5F A;  5E59 A;  1K0O A;  2OBK A;  1S3A A;  1AC1 A;  3KIJ A;  8GSS A;  1TU8 A;  1XWA A;  4LMV A;  3GRX A;  5G30 A;  4N11 A;  4IKH A;  3D4M A;  1HNC A;  1ERU A;  4V1A p;  2MYG A;  2H01 A;  2HSH A;  4PUA A;  1O85 A;  9GSS A;  2H1D A;  2IJY A;  3W8S A;  5HR0 A;  2VL9 A;  5G2Z A;  1ON4 A;  1XIY A;  1WIK A;  2LKU A;  1ZYQ B;  1XOB A;  4BPY A;  1LU4 A;  1XXU A;  4K7N A;  4MCU A;  1N2A A;  1YJ6 A;  4I5Q A;  2HZE A;  5CNW A;  4MJE A;  3HY2 A;  1QXH A;  2H76 A;  4TVE A;  3CMI A;  2LQO A;  1PRX A;  4HU7 A;  4JBB A;  2H30 A;  22GS A;  4O7H A;  2VCW A;  3HXS A;  1EV4 A;  2FWF A;  1JZD A;  3CSI A;  1FW1 A;  2CVB A;  1B4P A;  1R5A A;  1ZGN A;  2HZE B;  5EVO A;  3E9J B;  3E3E A;  1AUC A;  5J4U A;  3L78 A;  2F9S A;  2O89 A;  4GCI A;  3VLN A;  1OKT A;  4BL7 A;  4PGT A;  1AXD A;  3I43 A;  4I6X A;  4ZL7 A;  4TOP A;  1XWG A;  4ZL9 A;  6GSX A;  2AB6 A;  3A2W A;  1V40 A;  1Z7P A;  3F6D A;  4NHW A;  3DML A;  1ABA A;  1JHB A;  2VO4 A;  4L5L A;  2LRC A;  1CQG A;  4HI7 A;  1XW6 A;  3P8W A;  2B5Y A;  2OKA A;  4MJC A;  2K8S A;  2PMT A;  4J57 E;  2YN1 A;  3FRC A;  1THO A;  4ECB A;  2O8V B;  2GZP A;  1F3A A;  3TOT A;  3FYG A;  4KDY A;  3GV1 A;  2GQM A;  1EV9 A;  1EEM A;  3Q6O A;  3OR5 A;  3DVW A;  2WFC A;  1BQ7 A;  3F4R A;  3F4S A;  1SL1 B;  2NBS A;  4ULX A;  1VF2 A;  1K3L A;  2IPA A;  3VWV A;  3UL3 A;  4WF5 A;  3PIN A;  1GUH A;  2A2S A;  3CBU A;  2J23 A;  3C73 A;  4LLR A;  2PGT A;  4QQ7 A;  1YKC A;  2C1Y A;  1QFN A;  1NHY A;  1V57 A;  1WJK A;  3MNG A;  4YAP A;  4PUF C;  2AJQ B;  4X1U A;  2CX3 A;  3GKN A;  2WRT A;  4POK A;  1PA3 A;  2GDR A;  1XVQ A;  2LST A;  1TTZ A;  3BJ5 A;  3FZ9 A;  4BWS A;  3ZYW A;  1G7O A;  3UOM A;  3ZL5 A;  5A4V A;  5HFI A;  4FH8 A;  2VOC A;  1LBK A;  2OA7 A;  4HS1 A;  5FWG A;  3IV4 A;  2WDU A;  2YOI A;  2JSZ A;  2C0E A;  4MPG A;  3QDN A;  4HQZ A;  4MZW A;  2X8G A;  2WCI A;  1B4Q A;  2L6C A;  1M9B A;  1F6M C;  4TR1 A;  3F4T A;  2MZC A;  5ECP B;  2R2J A;  4L0U A;  1EOH A;  2H1B A;  1SK2 A;  1Z5Y E;  3O6T A;  3DRN A;  2H66 A;  5D96 A;  1B48 A;  5D9X A;  2RM6 A;  3KH9 A;  1O7U A;  2HYX A;  1GSS A;  2P5Q A;  5J5N A;  3L4N A;  4ZB9 A;  5IMF A;  2AV4 A;  1SU9 A;  2DJ0 A;  3HYP A;  1OYJ A;  4EDY A;  2EIO A;  4TR1 B;  4PQ1 A;  1ACV A;  2DC5 A;  2CZ2 A;  2DIZ A;  2LRN A;  3HKR A;  2B6M A;  4YQV A;  4ID0 A;  1TJD A;  4ILF A;  1GTI A;  2PN8 A;  3TOU A;  2TRX A;  1GUL A;  4NXI A;  3TKR A;  4ZL8 A;  2AAW A;  2GST A;  2RUE A;  2H70 A;  5IIZ A;  1FOV A;  4MH3 A;  1XWB A;  3ME7 A;  3QFA C;  5IMC A;  5G5E A;  4I97 A;  3DVX A;  3VUR A;  3GMF A;  1PX6 A;  1PD2 1;  1USB A;  2IME A;  3I6A A;  4IJI A;  3GTU A;  2MMA A;  3HJO A;  4BWQ A;  1U87 A;  1EGR A;  2GTU A;  3EE2 A;  3U5R E;  3ZRE A;  1SKR B;  3D21 A;  1OVN A;  1E2Y A;  1ML6 A;  2K9F A;  3EC3 A;  3ERF A;  5ECN B;  1R7H A;  4LMW A;  3IAM 2;  2C4J A;  3WGX A;  4LL1 B;  1ZCP A;  3C1S A;  1HD2 A;  3IXR A;  1A2M A;  5AN1 A;  3BBY A;  4RI7 A;  3DGQ A;  4KE3 A;  5CP1 A;  1Z6M A;  1EP8 A;  5JWO B;  3BCK A;  2H1G A;  1GNW A;  5ECR B;  5EPF A;  2LEG A;  2PPT A;  3KJY A;  2CV4 A;  1GUM A;  1F2E A;  3F63 A;  3QAV A;  5ECH B;  4YQM A;  1B9X C;  1H75 A;  13GS A;  5IO0 A;  2XBI A;  2EC4 A;  2DMM A;  2V2G A;  2GSS A;  3IBH A;  2E2G A;  2D2Z A;  2RUF A;  2CVD A;  5A4U A;  2H6Y A;  2IN3 A;  2IWT A;  2L57 A;  3L9U A;  2JZR A;  4MZB A;  2ALB A;  4IP1 A;  1WMJ A;  3LGC A;  3EU4 A;  4I8B A;  2BJX A;  5ECK B;  4TXV A;  2EIR A;  3HD5 A;  4HJM A;  4JE1 A;  3FZ4 A;  3O3T A;  3QFB C;  5KN2 A;  1YF1 A;  4GXZ A;  4RI6 A;  1PL1 A;  2TRC P;  2FA4 A;  4JR6 A;  2I9H A;  5B8A A;  4WF4 A;  1ZZY A;  4AJ7 A;  4WR5 A;  3HA9 A;  4JU5 A;  4XRD A;  1XCC A;  1MDJ A;  3QAG A;  3C71 A;  1X5C A;  3D22 A;  4BA7 A;  2WB9 A;  4BVY A;  4XCS A;  2ON5 A;  2LRT A;  2G2Q A;  4DSQ A;  2R37 A;  4J56 E;  1DSB A;  3GL5 A;  2VCV A;  11GS A;  4IHU A;  1MDI A;  2IMI A;  3HVS A;  14GS A;  3TCO A;  2LQQ A;  2H71 A;  2IMD A;  2L6D A;  4IQ1 A;  4MJB A;  3FR6 A;  1YDK A;  4KCE A;  1X5E A;  3TUE A;  3ZRD A;  1I9D A;  12GS A;  3UBK A;  2DML A;  2LS5 A;  4WEY A;  1K0C A;  1EWX A;  3IHQ A;  1WPI A;  1X9S B;  4ZB8 A;  4HJ2 A;  3TKS E;  5B8B A;  2NTO A;  2V1M A;  1GL8 A;  4KUN A;  3E0U A;  1WWJ A;  2LNS A;  3H79 A;  4KA0 A;  1KNG A;  1PKZ A;  3GH6 A;  5H5Q A;  4G2E A;  5JCG A;  3ZFB A;  3F6F A;  3P7X A;  4MA9 A;  3M8N A;  3KCM A;  2H73 A;  1XFL A;  3QR6 A;  1KTE A;  2EIQ A;  3LOR A;  3RAZ A;  4MF7 A;  1DE2 A;  1HNA A;  2VD1 A;  1S3D A;  4WET A;  3G7J A;  5KEJ A;  3CYN A;  4TN8 A;  3DXB A;  3KEB A;  1VRS D;  5G31 A;  3ZTL A;  5HFG A;  3HJM A;  2A2R A;  1X0R A;  4WXT A;  1A0F A;  3KH7 A;  2CA8 A;  4N0Z A;  3TDG A;  3O76 A;  3QOU A;  3EYT A;  1BX9 A;  4G10 A;  2XHF A;  3C1R A;  3RPN A;  1T4Y A;  3KTB A;  2H0H A;  4XRA A;  1SK1 A;  4GSS A;  2F51 A;  3EUR A;  5HR3 A;  4ML1 A;  1PQN A;  2YWM A;  1U3A A;  4NWY A;  1RW1 A;  4MH2 A;  4XS4 B;  4KX4 A;  2YNX A;  5B6N A;  4TR3 A;  5AIS A;  1LJR A;  5IMV A;  2P5R A;  5ID2 B;  2WUL A;  2AUV A;  1VGL A;  2I1U A;  3D0Z A;  4MMM A;  2PWJ A;  4ZIL A;  1SK0 A;  5ECM B;  2M46 A;  1YKA A;  5J9B A;  2H0G A;  4E8H A;  4NAX A;  2HE3 A;  1M2A A;  4GQC A;  2MMN A;  1Q4J A;  1O73 A;  3GUR A;  4JED A;  3IAS 2;  4EXJ A;  2GS3 A;  3F3Q A;  2HZF A;  3RDW A;  2I3Y A;  4TKY A;  1SJI A;  2NDO A;  3EMP A;  2FY6 A;  2YV7 A;  5IMD A;  3K8N A;  3VPT A;  2H6Z A;  2GQL A;  5ECI B;  2O85 A;  3ZVJ D;  3F9U A;  4FYC A;  1OE8 A;  5CRE A;  1QUW A;  1F9M A;  1GSE A;  3TRQ A;  1ZOF A;  4EVM A;  2GZY A;  2YWO A;  3VFI A;  2I81 A;  3LQ7 A;  1V2A A;  4POB A;  2R6K A;  1G6Y A;  1ERW A;  2HSY A;  4CW9 A;  5IM9 A;  2O87 A;  1O81 A;  19GS A;  1QGV A;  1O6J A;  2KLX A;  3FKF A;  3GSS A;  3HHV A;  2REM A;  2KHP A;  2HRN A;  1A2L A;  4ZBB A;  1ZYE A;  3LXT A;  3FR3 A;  2H19 A;  3TKP A;  2E7P A;  3WYW A;  2DLX A;  6GST A;  3DKS A;  1SYX A;  5HR2 A;  4PQH A;  1O8X A;  3FK8 A;  3IPZ A;  1AAZ A;  2IMF A;  4DSR A;  3GA4 A;  5H5S A;  1DBY A;  5DBQ A;  4DSS A;  5DJM A;  2YJH A;  4V1A g;  3UAP A;  2C80 A;  1ST9 A;  4Q5N A;  2QGV A;  1OC9 A;  2V6O A;  5A4W A;  2ES7 A;  4NV5 A;  1SJZ A;  2Z9S A;  1ZL9 A;  3EIN A;  4KH7 A;  1U88 A;  2QSI A;  5GAN D;  1AW9 A;  3KXO A;  4AJ8 A;  4JR4 A;  5A5K A;  4EKZ A;  4TRX A;  2DIY A;  1A23 A;  3F0I A;  3GX8 A;  3ZVJ A;  3D6I A;  4AGS A;  5CRW A;  1OKD A;  3WD6 A;  1A8L A;  4MLY A;  1M2B A;  2C0F A;  3KMN A;  4MF5 A;  3WT2 A;  3VI7 A;  4GTU A;  2RLI A;  1IYI A;  4JRR A;  5AIV A;  1Q98 A;  5DJL A;  4ZXG A;  3BOA A;  3TGZ A;  3FEU A;  3A2V A;  3D5J A;  1GLP A;  4IVF A;  2GSR A;  1U3I A;  3P90 A;  2C3T A;  3FW2 A;  1AQX A;  4XTS A;  3I69 A;  4KB3 A;  1YY7 A;  1ERT A;  1SEN A;  2E2M A;  2FWH A;  2IIY A;  1A2J A;  3DEX A;  2M72 A;  2FLS A;  1E6B A;  2P0G A;  4L8E A;  3ZMK A;  1FAA A;  1IYH A;  3ED3 A;  1W4V A;  2KP1 A;  1G0T A;  1JZO A;  3Q19 A;  2FHE A;  5CYY A;  3ISO A;  3UJ1 A;  3LJR A;  2RII A;  3FY7 A;  3V1W A;  1K3O A;  1S3C A;  3CSJ A;  5GAP D;  3RBT A;  2GGT A;  3KM6 A;  5D9V A;  3KP9 A;  6GSS A;  3N5O A;  1Z6N A;  4POL A;  1YEP A;  1YQ1 A;  2R4V A;  1J0F A;  2FA8 A;  3RPP A;  4K7I A;  1FVK A;  1TDI A;  1GUK A;  3M0F A;  3FR9 A;  1Y6E A;  3Q74 A;  4ZBA A;  3SWL A;  4PUR A;  4O32 A;  1NM3 A;  3MWH A;  1TK0 B;  1JZW A;  3GNJ A;  3VK9 A;  3M9J A;  1W89 A;  2DBC A;  2V32 A;  3UVT A;  2WJU A;  3KTL A;  1JFU A;  5F07 A;  5EY6 A;  1FB0 A;  4K1F A;  1A8Y A;  3VWX A;  3HZ4 A;  4PX1 A;  3TJF A;  5JWQ B;  3DIE A;  2DJ2 A;  3HJP A;  5LCZ A;  3GST A;  4MF6 A;  2JSY A;  1TI1 A;  5IMA A;  2HI7 A;  3W8J A;  2B5E A;  4WBR D;  5IPG A;  2PVO C;  2HXK A;  3ERW A;  4OWY A;  4PQI A;  1PSQ A;  3GTU B;  4V2L A;  1HQO A;  2H1A A;  2ZNM A;  3ZML A;  4XIH A;  4K0G A;  4LA1 A;  3FZ5 A;  2GZZ A;  3DYR A;  4Q5R A;  3APO A;  4TR4 A;  4IEL A;  3P2A A;  3BCI A;  1GH2 A;  4I2U A;  1G7E A;  1PN9 A;  2FUG 2;  1VF1 A;  1TK8 B;  1SKS B;  3CTG A;  5GST A;  2VD0 A;  3MSZ A;  2H75 A;  2YZU A;  1UC7 A;  1GSQ A;  3GIX A;  2WS2 A;  1X9W B;  3D4T A;  3ZFL A;  4DVC A;  3QAW A;  3IRA A;  4IBP A;  3F3R A;  3GHA A;  1TW9 A;  3GKK A;  5IOW A;  2QKE A;  5J41 A;  2OAD A;  3G9B A;  4J2F A;  1VF4 A;  4Q5Q A;  1K0M A;  5ECS A;  2CZ3 A;  4N0V A;  5ECQ B;  1FVJ A;  2VL3 A;  1HYU A;  4KAE A;  2DJ3 A;  2H8L A;  1M99 A;  2CAI A;  2F8A A;  4FYU A;  5F0G A;  1URM A;  6GSU A;  1WP0 A;  5LD0 A;  4OFT A;  5B6M A;  5E4W A;  3GUS A;  4PNG A;  2B1K A;  2KOK A;  4OD7 A;  5IMZ A;  2I4A A;  4IQA A;  1MDK A;  4EDZ A;  1M7T A;  1K0N A;  5D73 A;  1U6T A;  2HNL A;  3F8U A;  5FHI A;  1XPV A;  4F0C A;  1TK5 B;  1NHO A;  4O5R A;  1B9Y C;  3L0H A;  10GS A;  1JLW A;  2PER A;  1N8J A;  5ENU A;  2YZH A;  4G19 A;  2GQK A;  2M80 A;  1TKD B;  4P3Y B;  3HVV A;  1MD4 A;  4NMU A;  4GST A;  1FG4 A;  3CSH A;  3VPQ A;  4KDU A;  1JLV A;  3A2X A;  1GLQ A;  4AJ6 A;  3NIV A;  4ECC A;  1OC8 A;  1XVW A;  3W6G A;  1MTC A;  2ZCT A;  1WOU A;  2C8U A;  2E0Q A;  6GSV A;  2G0F A;  1TP9 A;  1YEX A;  4D73 A;  2CVK A;  3GKM A;  1VF3 A;  2RM5 A;  4CDO A;  5FT3 A;  1GRX A;  2H74 A;  1TXX A;  4LL4 B;  4KSO A;  4F9Z A;  3I9V 2;  4KDX A;  1TRS A;  2LJR A;  1EGO A;  5DQS A;  4IGJ A;  3TJB A;  3EMX A;  2VCZ A;  5B7C A;  3TJJ A;  2YV9 A;  5G5F A;  3NOF A;  1B8X A;  2K6V A;  2MMZ A;  4GWR A;  3ZZX A;  3TJK A;  2L4C A;  5C00 A;  4K9Z A;  18GS A;  3GKX A;  5CAX A;  1CQH A;  3APQ A;  3MAK A;  2R5G A;  2LJK A;  3RHB A;  2PUK C;  4ML6 A;  3HCZ A;  3C7M A;  3CTF A;  3ME8 A;  2IFQ A;  20GS A;  4Z7X A;  3LYP A;  3QCP A;  3PH9 A;  3EVI A;  3US3 A;  3CRU A;  1OE7 A;  2FWG A;  5F06 A;  5KN3 A;  2HFD A;  4ISD A;  4K2D A;  4ZBD A;  4FYB A;  3GH9 A;  2IL3 A;  1C72 A;  4GSN A;  1SJ6 A;  5IPH A;  2LNT A;  4IW9 A;  2KUC A;  2K18 A;  2IFQ B;  1EP7 A;  1GSU A;  2C3N A;  5ECO B;  4K7O A;  4F03 A;  5ELA A;  1H4O A;  4PXO A;  1SL2 B;  2VL2 A;  3TRP A;  2B7K A;  5ABR A;  1PX7 A;  2VCX A;  1MEK A;  2YJ7 A;  4H86 A;  3WGE A;  3R2Q A;  5DQY A;  2H6X A;  1RQM A;  4HDE A;  3H8Q A;  2YAN A;  5HR1 A;  5DVB A;  4FIW A;  3EU3 A;  5DDL A;  1GWC A;  3GL3 A;  4AF2 A;  5J3R A;  2J9H A;  1PMT A;  2GSQ A;  1NSW A;  3FHK A;  4EUY A;  2B3S A;  1SYR A;  2V6K A;  4N10 A;  3PGT A;  4JZQ A;  3KP8 A;  6GSW A;  1BYE A;  1FHE A;  4HU9 A;  4QL9 A;  1RK4 A;  4IP6 A;  3J7Y k;  2JL4 A;  4MJA A;  4XHM A;  2MBS A;  3TKQ A;  2VUP A;  3L9S A;  3G7I A;  4RQR A;  1XBS A;  2AHE A;  2NPB A;  1T7P B;  3ZIV A;  3HDC A;  5DCG A;  4KSM A;  3GX0 A;  1GSY A;  4OFN A;  1GTU A;  5DCH A;  1F37 A;  7GSS A;  2OE0 A;  4TXO A;  1M2D A;  2GT5 A;  3UAR A;  1GNE A;  2HLS A;  1GTA A;  2LV3 A;  1FO5 A;  2B5X A;  1EEJ A;  3IK9 A;  4MDC A;  4YQU A;  2VL2 C;  5KN0 A;  3M3M A;  2XC2 A;  3LWA A;  4N30 A;  4DSS B;  3EWL A;  4KGI A;  3KGK A;  3M9K A;  3TKS A;  1PL2 A;  1AQW A;  1J9B A;  1OC9 B;  1THX A;  5JCU A;  4TXO B;  1M0U A;  5CRD A;  4E8E A;  4OO5 A;  3VWW A;  1XWK A;  2C0G A;  5KN1 A;  3FZA A;  3DWV A;  3CXG A;  2QC7 A;  1BAY A;  5AGY A;  1T4Z A;  1XZO A;  2JZS A;  4EO3 A;  1K0A A;  2MBT A;  5AIX A;  1KBN A;  2DJK A;  2CT6 A;  2AYT A;  1WE0 A;  1ILO A;  1QMV A;  2WZ9 A;  1SL0 B;  4GQF A;  3QMX A;  3M1G A;  4MAB A;  2H0I A;  3UBL A;  4OMV A;  5GZZ B;  5C04 A;  4ECJ A;  2DSA A;  5F8B A;  4GLT A;  4OO4 A;  4POM A;  3TB2 A;  2VM1 A;  3Q18 A;  5D9T A;  4OCE A;  4XS6 A;  5LNK e;  3ZIJ A;  3VI5 A;  4HEA 2;  4IS0 A;  1K0B A;  3H4K A;  3TJG A;  2LJA A;  4MPF A;  1G6W A;  2XPE A;  2JAD A;  3WGD A;  2YWI A;  2LUS A;  2X99 A;  4F2I A;  4XS1 A;  1V9W A;  4QL7 A;  2NVL A;  3IK7 A;  2X8C A;  3TKS C;  4EC0 A;  4RQX A;  1T00 A;  17GS A;  2F3M A;  4NHZ A;  5HQP A;  1FB6 A;  1OC3 A;  1QQ2 A;  2GVP A;  2FGX A;  2OAC A;  2X8H A;  2VCT A;  4V2N A;  3L9V A;  3HVX A;  2ON7 A;  3H1N A;  4MP4 A;  2XPD A;  3JCM L;  3ZLP A;  3LSZ A;  1BED A;  2JZT A;  3SBC A;  3MDK A;  1V98 A;  1HNB A;  1EOG A;  5ECL B;  3UEM A;  4L0W A;  3IC4 A;  2FWE A;  5D9W A;  2WGR A;  2H72 A;  2P31 A;  1K0D A;  1XW9 A;  4KCA A;  4HZ4 A;  1TU7 A;  5D93 A;  4X0X A;  1V58 A;  2CQ9 A;  1QK8 A;  2OJL A;  3J7Y b;  2JAC A;  2VIM A;  2PU9 C;  4CHS A;  4ACS A;  3KMO A;  1DE1 A;  5COH A;  3IDV A;  1TI3 A;  2L59 A;  3GN3 A;  1T8E B;  1PGT A;  2C0D A;  2ZUP A;  5J9C A;  3ERG A;  2JU5 A;  3NZN A;  1Z9H A;  3RHC A;  2XBQ A;  1T3B A;  5CRG A;  1KEB A;  3APS A;  1R5P A;  2IMK A;  3KD0 A;  3WT1 A;  2OBI A;  1X5D A;  5H5R A;  4GRF A;  3S9F A;  2V41 A;  2GLR A;  3LG6 A;  2L5L A;  1UVZ A;  5D8I A;  4EE0 A;  1YZX A;  1O8W A;  2K8V A;  2BTO T;  1Y25 A;  4ECI A;  3CRT A;  5ELG A;  1GTB A;  4ZIJ A;  4EF0 A;  2HT9 A;  1ERV A;  2F8F A;  2FCH A;  4K6X A;  5G1L A;  5INY A;  3ZIT A;  1UN2 A;  1GSF A;  1Z3E A;  2L4Q A;  4F82 A;  2MMO A;  5L71 A;  1TRW A;  3QPM A;  3IE3 A;  1R26 A;  2B7J A;  1I5G A;  1MD3 A;  3IA1 A;  2L5O A;  2YP6 A;  2VM2 A;  1T1V A;  2YWN A;  4G9H A;  1GP1 A;  4TR0 A;  4BVX A;  5JCW A;  1EZK A;  2B1L A;  2VCQ A;  1JZR A;  4HZ2 A;  4ZB6 A;  3UVH A; 
#chains in the Genus database with same CATH topology
 3BD2 A;  4KND A;  1A24 A;  4V2M A;  4HUA A;  4PNF A;  1PKW A;  2FD3 A;  3IOS A;  2TIR A;  2PVQ A;  2VAF A;  2N5A A;  1DUG A;  4F0B A;  1Z7R A;  4Z2U A;  2BMX A;  1XW5 A;  4O92 A;  4FO5 A;  4Q5F A;  1BJX A;  2C3Q A;  3A3T A;  4EL1 A;  4YH2 A;  5IQY A;  3LYK A;  1PFO A;  4OFM A;  2CX4 A;  3PR8 A;  4MK3 A;  2CAQ A;  3GYK A;  1BG5 A;  1J08 A;  4A5P A;  2YPM A;  4WR4 A;  3IR4 A;  3UIW A;  4WKW A;  1UA5 A;  2VLU A;  5IO2 A;  4K0N A;  4GF0 A;  4OCF A;  5GSS A;  4K8M A;  3LFL A;  5BMU A;  3KZQ A;  1AQV A;  2X64 A;  1AIU A;  2VLT A;  2VLV A;  6GSY A;  5JWR B;  4RUV A;  2OE3 A;  4IJ3 A;  3TRX A;  1XOA A;  1TRV A;  3A5W A;  3HZ8 A;  3GFK A;  2DJJ A;  4IN0 A;  3U6V A;  5DAL A;  3QD9 A;  2OE1 A;  2PBJ A;  5F05 A;  1SD9 A;  2GT6 A;  16GS A;  5CRH A;  1R4W A;  5DAK A;  3DD3 A;  3G7Y A;  3UMA A;  1PN0 A;  1M9A A;  4L5O A;  1SD8 A;  2HSM A;  2KP2 A;  1X9M B;  3H93 A;  1XWC A;  2FNO A;  2A4V A;  2R3X A;  4KW6 A;  3LXZ A;  2YCD A;  2O7K A;  5EL8 A;  1K3Y A;  4TW5 A;  5DAL B;  4WBJ A;  2HRF A;  4XS4 A;  1SKW B;  4D73 B;  3N9J A;  1ZMA A;  2DJ1 A;  3LEF A;  3VWU A;  5DAK B;  4HQS A;  4NPB A;  4DEJ A;  5IOX A;  4CY8 A;  4I2T A;  1YF0 A;  4X43 A;  5ID2 A;  1GSD A;  5HFK A;  1WRY A;  4MZC A;  4YAV A;  5G1K A;  4NV2 A;  2LTK A;  4HOJ A;  1TRU A;  3AY8 A;  5CO3 A;  1TOF A;  2N5B A;  3C8E A;  1F3B A;  1OAZ A;  1NW2 A;  1A0R P;  4FQU A;  2N5F A;  2DKI A;  5E59 A;  1K0O A;  2OBK A;  1S3A A;  1AC1 A;  3KIJ A;  8GSS A;  1TU8 A;  1XWA A;  4LMV A;  3GRX A;  5G30 A;  4N11 A;  4IKH A;  3D4M A;  3LW9 A;  1HNC A;  1ERU A;  4V1A p;  2MYG A;  2H01 A;  2HSH A;  4PUA A;  1O85 A;  9GSS A;  2H1D A;  2IJY A;  3W8S A;  5HR0 A;  2VL9 A;  2HRA A;  5G2Z A;  1ON4 A;  1XIY A;  1WIK A;  2LKU A;  1ZYQ B;  1XOB A;  4BPY A;  1LU4 A;  1XXU A;  4K7N A;  4MCU A;  1N2A A;  1YJ6 A;  4I5Q A;  2HZE A;  5CNW A;  4MJE A;  3HY2 A;  1QXH A;  2H76 A;  4TVE A;  3CMI A;  2LQO A;  1PRX A;  4HU7 A;  4JBB A;  2H30 A;  22GS A;  4O7H A;  2VCW A;  3HXS A;  1EV4 A;  2FWF A;  1JZD A;  3A5I A;  3CSI A;  1FW1 A;  2CVB A;  1B4P A;  1R5A A;  1ZGN A;  2HZE B;  5EVO A;  3E9J B;  3E3E A;  1AUC A;  5J4U A;  3L78 A;  2F9S A;  2O89 A;  4GCI A;  3VLN A;  1OKT A;  4BL7 A;  4PGT A;  1AXD A;  3I43 A;  4I6X A;  4ZL7 A;  3PPU A;  4TOP A;  1XWG A;  4ZL9 A;  6GSX A;  2AB6 A;  3A2W A;  1V40 A;  1Z7P A;  3F6D A;  4NHW A;  3DML A;  1ABA A;  1JHB A;  2VO4 A;  4BL7 B;  4L5L A;  2LRC A;  1CQG A;  4HI7 A;  1XW6 A;  3P8W A;  2B5Y A;  2OKA A;  4MJC A;  2K8S A;  2PMT A;  4J57 E;  2YN1 A;  3FRC A;  1THO A;  4ECB A;  2O8V B;  2GZP A;  1F3A A;  3TOT A;  3FYG A;  4KDY A;  3GV1 A;  2GQM A;  1EV9 A;  1EEM A;  3Q6O A;  3OR5 A;  3DVW A;  2WFC A;  1BQ7 A;  3F4R A;  3F4S A;  1SL1 B;  2NBS A;  4ULX A;  1VF2 A;  1K3L A;  2IPA A;  2X4A A;  3UL3 A;  3VWV A;  4WF5 A;  3PIN A;  1GUH A;  2A2S A;  4HSC X;  3CBU A;  2J23 A;  3C73 A;  4LLR A;  2PGT A;  4QQ7 A;  1YKC A;  2C1Y A;  1QFN A;  1NHY A;  1V57 A;  1WJK A;  3MNG A;  4YAP A;  4PUF C;  2AJQ B;  4X1U A;  2CX3 A;  3GKN A;  2WRT A;  4POK A;  1PA3 A;  2GDR A;  2UZ8 A;  1XVQ A;  2LST A;  1TTZ A;  3BJ5 A;  3FZ9 A;  4BWS A;  3ZYW A;  1G7O A;  3UOM A;  3ZL5 A;  5A4V A;  5HFI A;  4FH8 A;  2VOC A;  1LBK A;  2OA7 A;  4HS1 A;  5FWG A;  3IV4 A;  2WDU A;  2YOI A;  2JSZ A;  2C0E A;  4MPG A;  3QDN A;  4HQZ A;  4MZW A;  2X8G A;  2WCI A;  1B4Q A;  2L6C A;  1M9B A;  1F6M C;  4TR1 A;  3F4T A;  2QA1 A;  2MZC A;  5ECP B;  2R2J A;  4L0U A;  1EOH A;  2H1B A;  1SK2 A;  1Z5Y E;  2R0C A;  3O6T A;  3DRN A;  2H66 A;  5D96 A;  1B48 A;  5D9X A;  2RM6 A;  3KH9 A;  1O7U A;  2HYX A;  1GSS A;  2P5Q A;  5J5N A;  3L4N A;  4ZB9 A;  5IMF A;  2R0P A;  2AV4 A;  1SU9 A;  2DJ0 A;  3HYP A;  1OYJ A;  4EDY A;  2EIO A;  4TR1 B;  4PQ1 A;  1ACV A;  2DC5 A;  2CZ2 A;  2DIZ A;  2LRN A;  3HKR A;  2B6M A;  4YQV A;  4ID0 A;  1TJD A;  4ILF A;  1GTI A;  2PN8 A;  2QA2 A;  3TOU A;  2TRX A;  1GUL A;  4NXI A;  3TKR A;  4ZL8 A;  2AAW A;  2GST A;  2RUE A;  2H70 A;  5IIZ A;  1FOV A;  4MH3 A;  1XWB A;  3ME7 A;  3QFA C;  5IMC A;  5G5E A;  5KOX A;  2X49 A;  3DVX A;  4I97 A;  3VUR A;  3GMF A;  1PX6 A;  1PD2 1;  1USB A;  2IME A;  3I6A A;  4IJI A;  3GTU A;  2MMA A;  3HJO A;  4BWQ A;  1U87 A;  1EGR A;  2GTU A;  3EE2 A;  3U5R E;  3ZRE A;  1SKR B;  3D21 A;  1OVN A;  1E2Y A;  1ML6 A;  2K9F A;  3EC3 A;  3ERF A;  5ECN B;  1R7H A;  4LMW A;  3IAM 2;  2C4J A;  3WGX A;  4Z2T A;  4LL1 B;  1ZCP A;  3C1S A;  1HD2 A;  3IXR A;  1A2M A;  5AN1 A;  3BBY A;  4RI7 A;  3DGQ A;  4KE3 A;  5CP1 A;  1Z6M A;  1EP8 A;  5JWO B;  3BCK A;  2H1G A;  1GNW A;  5ECR B;  5EPF A;  2LEG A;  2PPT A;  3KJY A;  2CV4 A;  1GUM A;  1F2E A;  3F63 A;  3QAV A;  5ECH B;  4YQM A;  1B9X C;  1H75 A;  13GS A;  5IO0 A;  2XBI A;  2EC4 A;  2DMM A;  2V2G A;  2GSS A;  3IBH A;  2E2G A;  2D2Z A;  2RUF A;  2CVD A;  5A4U A;  2H6Y A;  2IN3 A;  2IWT A;  2L57 A;  3L9U A;  2JZR A;  4MZB A;  2ALB A;  4IP1 A;  1WMJ A;  3LGC A;  3EU4 A;  4I8B A;  2BJX A;  5ECK B;  4TXV A;  2EIR A;  3HD5 A;  4HJM A;  4JE1 A;  3FZ4 A;  3O3T A;  3QFB C;  5KN2 A;  1YF1 A;  4GXZ A;  4RI6 A;  1PL1 A;  2TRC P;  2FA4 A;  4JR6 A;  2I9H A;  3MIX A;  5B8A A;  4WF4 A;  1ZZY A;  4AJ7 A;  4WR5 A;  3HA9 A;  4JU5 A;  4XRD A;  1XCC A;  4BVX B;  1MDJ A;  3QAG A;  3C71 A;  1X5C A;  3D22 A;  4BA7 A;  2WB9 A;  4BVY A;  4XCS A;  2ON5 A;  2LRT A;  2G2Q A;  4DSQ A;  2R37 A;  4J56 E;  1DSB A;  3GL5 A;  2VCV A;  11GS A;  4IHU A;  1MDI A;  2IMI A;  3HVS A;  14GS A;  3TCO A;  2LQQ A;  4G0I A;  4O5U A;  4PTS A;  2H71 A;  2IMD A;  2L6D A;  4IQ1 A;  4MJB A;  3FR6 A;  1YDK A;  4KCE A;  1X5E A;  3TUE A;  2HRK A;  3ZRD A;  1I9D A;  12GS A;  3UBK A;  2DML A;  2LS5 A;  4WEY A;  4BVY B;  1K0C A;  1EWX A;  3IHQ A;  1WPI A;  1X9S B;  4ZB8 A;  4HJ2 A;  3TKS E;  5B8B A;  2NTO A;  2V1M A;  1GL8 A;  4KUN A;  3E0U A;  1WWJ A;  2LNS A;  3H79 A;  4KA0 A;  1KNG A;  1PKZ A;  3GH6 A;  5H5Q A;  4G2E A;  5JCG A;  3ZFB A;  3F6F A;  3P7X A;  4MA9 A;  3M8N A;  3KCM A;  2H73 A;  1XFL A;  3QR6 A;  1KTE A;  2EIQ A;  3LOR A;  3RAZ A;  4MF7 A;  1DE2 A;  1HNA A;  2VD1 A;  1S3D A;  4WET A;  3G7J A;  5KEJ A;  3CYN A;  4TN8 A;  3DXB A;  3KEB A;  1VRS D;  5G31 A;  3ZTL A;  5HFG A;  3HJM A;  2A2R A;  1X0R A;  4WXT A;  1A0F A;  3KH7 A;  2CA8 A;  4N0Z A;  3TDG A;  3O76 A;  3QOU A;  3EYT A;  1BX9 A;  4G10 A;  2XHF A;  3C1R A;  3RPN A;  1T4Y A;  3KTB A;  1M3I A;  2H0H A;  4XRA A;  1M3J A;  1SK1 A;  4GSS A;  2F51 A;  3EUR A;  5HR3 A;  4ML1 A;  1PQN A;  2YWM A;  4G0L A;  1U3A A;  4NWY A;  1RW1 A;  4MH2 A;  4XS4 B;  4KX4 A;  2YNX A;  5B6N A;  4TR3 A;  4YKF A;  5AIS A;  1LJR A;  5IMV A;  2P5R A;  5ID2 B;  2WUL A;  2AUV A;  1VGL A;  2I1U A;  3D0Z A;  4MMM A;  2PWJ A;  4ZIL A;  1SK0 A;  1ZYN A;  5ECM B;  2M46 A;  1YKA A;  5J9B A;  2H0G A;  4E8H A;  4NAX A;  2HE3 A;  1M2A A;  4GQC A;  2MMN A;  1Q4J A;  1O73 A;  3GUR A;  4JED A;  3IAS 2;  4EXJ A;  2GS3 A;  3F3Q A;  2HZF A;  3RDW A;  2I3Y A;  4TKY A;  1SJI A;  2NDO A;  3EMP A;  2FY6 A;  2YV7 A;  5IMD A;  3K8N A;  3VPT A;  2H6Z A;  2GQL A;  5ECI B;  2O85 A;  3ZVJ D;  3F9U A;  4FYC A;  1OE8 A;  5CRE A;  1QUW A;  1F9M A;  1GSE A;  3TRQ A;  1ZOF A;  4EVM A;  2GZY A;  2YWO A;  3VFI A;  2I81 A;  3LQ7 A;  1V2A A;  4O5Q A;  4POB A;  2R6K A;  1G6Y A;  1ERW A;  2HSY A;  4CW9 A;  5IM9 A;  2O87 A;  1O81 A;  19GS A;  1QGV A;  1O6J A;  2KLX A;  3FKF A;  3GSS A;  3HHV A;  2REM A;  2KHP A;  2HRN A;  1A2L A;  4ZBB A;  1ZYE A;  3LXT A;  3FR3 A;  2H19 A;  3TKP A;  3IC8 A;  2E7P A;  3WYW A;  2DLX A;  6GST A;  3DKS A;  1SYX A;  5HR2 A;  4PQH A;  1O8X A;  3FK8 A;  3IPZ A;  1AAZ A;  2IMF A;  4DSR A;  3GA4 A;  5H5S A;  1DBY A;  5DBQ A;  4DSS A;  5DJM A;  2YJH A;  4V1A g;  3UAP A;  2C80 A;  1ST9 A;  4Q5N A;  2QGV A;  1OC9 A;  2V6O A;  5A4W A;  2ES7 A;  4NV5 A;  1SJZ A;  2R0G A;  2Z9S A;  1ZL9 A;  3EIN A;  4KH7 A;  1U88 A;  2QSI A;  5GAN D;  1AW9 A;  3KXO A;  4AJ8 A;  4JR4 A;  5A5K A;  4EKZ A;  4TRX A;  2DIY A;  1A23 A;  3F0I A;  3GX8 A;  3ZVJ A;  3D6I A;  4AGS A;  5CRW A;  1OKD A;  3WD6 A;  1A8L A;  4MLY A;  1M2B A;  2C0F A;  3KMN A;  4MF5 A;  3WT2 A;  3VI7 A;  4GTU A;  2RLI A;  1IYI A;  4JRR A;  4K2X A;  5AIV A;  1Q98 A;  5DJL A;  4ZXG A;  3BOA A;  3TGZ A;  3FEU A;  3A2V A;  3D5J A;  1GLP A;  4IVF A;  2GSR A;  1U3I A;  3P90 A;  2C3T A;  3FW2 A;  1AQX A;  4XTS A;  3I69 A;  4KB3 A;  1YY7 A;  1ERT A;  1SEN A;  5KOW A;  2E2M A;  2FWH A;  2IIY A;  1A2J A;  3DEX A;  2M72 A;  2FLS A;  1E6B A;  3R3E A;  2P0G A;  4L8E A;  3ZMK A;  1FAA A;  1IYH A;  3ED3 A;  1W4V A;  2KP1 A;  1G0T A;  4EIP A;  1JZO A;  3Q19 A;  2FHE A;  5CYY A;  3ISO A;  3UJ1 A;  3LJR A;  3FMW A;  2RII A;  3FY7 A;  3V1W A;  1K3O A;  1S3C A;  3CSJ A;  5GAP D;  3RBT A;  2GGT A;  3KM6 A;  5D9V A;  3KP9 A;  6GSS A;  3N5O A;  3MYD A;  1Z6N A;  4POL A;  3EPT A;  1YEP A;  1YQ1 A;  2R4V A;  1J0F A;  2FA8 A;  3RPP A;  4K7I A;  1FVK A;  1TDI A;  1GUK A;  3M0F A;  3FR9 A;  1Y6E A;  3Q74 A;  4ZBA A;  3SWL A;  4PUR A;  4O32 A;  1NM3 A;  3MWH A;  1TK0 B;  1JZW A;  3GNJ A;  3VK9 A;  3M9J A;  1W89 A;  2DBC A;  2V32 A;  3UVT A;  2WJU A;  3KTL A;  1JFU A;  5F07 A;  5EY6 A;  1FB0 A;  4K1F A;  1A8Y A;  3VWX A;  3HZ4 A;  4PX1 A;  3TJF A;  5JWQ B;  3DIE A;  2DJ2 A;  3HJP A;  5LCZ A;  3GST A;  4MF6 A;  2JSY A;  1TI1 A;  5IMA A;  2HI7 A;  3W8J A;  2B5E A;  4WBR D;  5IPG A;  2PVO C;  4X4J A;  2HXK A;  3ERW A;  4OWY A;  4PQI A;  1PSQ A;  3GTU B;  4V2L A;  1HQO A;  2H1A A;  2ZNM A;  3ZML A;  4XIH A;  4K0G A;  4LA1 A;  3FZ5 A;  2GZZ A;  3DYR A;  4Q5R A;  3APO A;  4TR4 A;  4IEL A;  3P2A A;  3BCI A;  1GH2 A;  4I2U A;  1G7E A;  1PN9 A;  2FUG 2;  1VF1 A;  1TK8 B;  1SKS B;  3CTG A;  5GST A;  2VD0 A;  3MSZ A;  2H75 A;  2YZU A;  1UC7 A;  1GSQ A;  3GIX A;  2WS2 A;  1X9W B;  3D4T A;  3ZFL A;  4DVC A;  3QAW A;  3IRA A;  4IBP A;  3F3R A;  3GHA A;  1TW9 A;  3GKK A;  5IOW A;  2QKE A;  5J41 A;  2OAD A;  3G9B A;  4J2F A;  1VF4 A;  4Q5Q A;  1K0M A;  5ECS A;  2CZ3 A;  4N0V A;  5ECQ B;  1FVJ A;  2VL3 A;  1HYU A;  4KAE A;  2DJ3 A;  2H8L A;  1M99 A;  2CAI A;  2F8A A;  4FYU A;  5F0G A;  1URM A;  6GSU A;  1WP0 A;  5LD0 A;  4OFT A;  5B6M A;  5E4W A;  4KF9 A;  3GUS A;  4PNG A;  2B1K A;  2KOK A;  4OD7 A;  2A4H A;  5IMZ A;  2I4A A;  4IQA A;  1MDK A;  4EDZ A;  1M7T A;  1K0N A;  5D73 A;  1U6T A;  2HNL A;  3F8U A;  5FHI A;  1XPV A;  4F0C A;  1TK5 B;  1NHO A;  4O5R A;  1B9Y C;  3L0H A;  10GS A;  1JLW A;  2PER A;  1N8J A;  5ENU A;  2YZH A;  4G19 A;  2GQK A;  2M80 A;  4ICY A;  1TKD B;  4P3Y B;  3HVV A;  1MD4 A;  4NMU A;  4GST A;  1FG4 A;  3CSH A;  3VPQ A;  1XG8 A;  4KDU A;  1JLV A;  3A2X A;  1GLQ A;  4AJ6 A;  3NIV A;  4ECC A;  1OC8 A;  1XVW A;  3W6G A;  1MTC A;  2ZCT A;  1WOU A;  2C8U A;  2E0Q A;  6GSV A;  2G0F A;  1TP9 A;  1YEX A;  4D73 A;  2CVK A;  3GKM A;  1VF3 A;  2RM5 A;  4CDO A;  5FT3 A;  1GRX A;  2H74 A;  1TXX A;  4LL4 B;  4KSO A;  4F9Z A;  3I9V 2;  4KDX A;  1TRS A;  2LJR A;  1EGO A;  5DQS A;  4IGJ A;  3TJB A;  3EMX A;  2VCZ A;  5B7C A;  3TJJ A;  2YV9 A;  5G5F A;  3NOF A;  1B8X A;  2K6V A;  2MMZ A;  4GWR A;  4K5R A;  3ZZX A;  3TJK A;  2L4C A;  5C00 A;  4K9Z A;  18GS A;  3GKX A;  5CAX A;  1CQH A;  3APQ A;  3MAK A;  2R5G A;  2LJK A;  2A2P A;  3RHB A;  2PUK C;  4ML6 A;  3HCZ A;  3C7M A;  3CTF A;  3ME8 A;  2IFQ A;  20GS A;  4Z7X A;  3LYP A;  3QCP A;  3PH9 A;  3EVI A;  3US3 A;  3CRU A;  1OE7 A;  2FWG A;  5F06 A;  5KN3 A;  2HFD A;  4ISD A;  4K2D A;  4ZBD A;  4FYB A;  3GH9 A;  2IL3 A;  1C72 A;  4GSN A;  4G0K A;  1SJ6 A;  5IPH A;  2LNT A;  4IW9 A;  2KUC A;  2K18 A;  2IFQ B;  1EP7 A;  1GSU A;  2C3N A;  5ECO B;  4K7O A;  4F03 A;  5ELA A;  1H4O A;  4PXO A;  1SL2 B;  2VL2 A;  3TRP A;  2B7K A;  5ABR A;  1PX7 A;  2VCX A;  1MEK A;  2YJ7 A;  4H86 A;  3WGE A;  3R2Q A;  5DQY A;  4MNN A;  2H6X A;  1RQM A;  4HDE A;  3H8Q A;  4BIK A;  2YAN A;  5HR1 A;  2DKH A;  5DVB A;  4FIW A;  3EU3 A;  5DDL A;  1GWC A;  3GL3 A;  4AF2 A;  5J3R A;  2J9H A;  1PMT A;  2GSQ A;  1NSW A;  3FHK A;  4EUY A;  2B3S A;  1SYR A;  2V6K A;  4N10 A;  3PGT A;  4JZQ A;  3KP8 A;  6GSW A;  1BYE A;  1FHE A;  4HU9 A;  4QL9 A;  1RK4 A;  4IP6 A;  3J7Y k;  2JL4 A;  4MJA A;  4XHM A;  2MBS A;  3TKQ A;  2VUP A;  3L9S A;  3G7I A;  4RQR A;  1XBS A;  2AHE A;  2NPB A;  3IHG A;  1T7P B;  3ZIV A;  3HDC A;  5DCG A;  4KSM A;  3GX0 A;  1GSY A;  4OFN A;  1GTU A;  5DCH A;  1F37 A;  7GSS A;  2OE0 A;  4TXO A;  1M2D A;  2GT5 A;  3UAR A;  1GNE A;  4Z2R A;  2HLS A;  1GTA A;  2LV3 A;  1FO5 A;  2B5X A;  1EEJ A;  3IK9 A;  4MDC A;  4YQU A;  4USS A;  2VL2 C;  5KN0 A;  3M3M A;  2XC2 A;  3LWA A;  4N30 A;  4DSS B;  3EWL A;  4KGI A;  3KGK A;  3M9K A;  3TKS A;  1PL2 A;  1AQW A;  1J9B A;  1OC9 B;  1THX A;  5JCU A;  4TXO B;  1M0U A;  5CRD A;  4E8E A;  4OO5 A;  3VWW A;  1XWK A;  2C0G A;  5KN1 A;  3FZA A;  3DWV A;  3CXG A;  2QC7 A;  1BAY A;  5AGY A;  1T4Z A;  1XZO A;  2JZS A;  4EO3 A;  1K0A A;  2MBT A;  5AIX A;  1KBN A;  2DJK A;  4CY6 A;  2CT6 A;  2AYT A;  1WE0 A;  1ILO A;  1QMV A;  2WZ9 A;  1SL0 B;  4GQF A;  3QMX A;  3M1G A;  4MAB A;  2H0I A;  3UBL A;  5BRT A;  4OMV A;  5GZZ B;  5C04 A;  4ECJ A;  2DSA A;  5F8B A;  4GLT A;  4OO4 A;  4POM A;  3TB2 A;  2VM1 A;  3Q18 A;  4OCE A;  5D9T A;  4XS6 A;  5LNK e;  3ZIJ A;  3VI5 A;  4HEA 2;  4IS0 A;  1K0B A;  3H4K A;  3TJG A;  2LJA A;  4MPF A;  1G6W A;  2XPE A;  2JAD A;  3WGD A;  2YWI A;  2LUS A;  2X99 A;  4F2I A;  4XS1 A;  1V9W A;  4QL7 A;  2NVL A;  3IK7 A;  2X8C A;  3TKS C;  4EC0 A;  4RQX A;  1T00 A;  17GS A;  2F3M A;  4NHZ A;  5HQP A;  1FB6 A;  1OC3 A;  1QQ2 A;  2GVP A;  2FGX A;  2OAC A;  2X8H A;  2VCT A;  4V2N A;  3L9V A;  3HVX A;  2ON7 A;  3H1N A;  4MP4 A;  2XPD A;  3JCM L;  3ZLP A;  3LSZ A;  1BED A;  2JZT A;  3SBC A;  1S3R A;  3MDK A;  1V98 A;  1HNB A;  1EOG A;  5ECL B;  3UEM A;  4L0W A;  3IC4 A;  2FWE A;  5D9W A;  2WGR A;  3CQF A;  2H72 A;  2P31 A;  1K0D A;  1XW9 A;  4KCA A;  4HZ4 A;  1TU7 A;  5D93 A;  4X0X A;  1V58 A;  2CQ9 A;  1QK8 A;  4EIQ A;  2OJL A;  3J7Y b;  2JAC A;  2VIM A;  2PU9 C;  4CHS A;  4ACS A;  3KMO A;  1DE1 A;  1ZYP A;  4YKG A;  5COH A;  3IDV A;  1TI3 A;  2L59 A;  3GN3 A;  3HVN A;  1T8E B;  1PGT A;  2C0D A;  2ZUP A;  5J9C A;  3ERG A;  2JU5 A;  3NZN A;  1Z9H A;  3RHC A;  2XBQ A;  1T3B A;  5CRG A;  4K5S A;  1KEB A;  3APS A;  1R5P A;  2IMK A;  3KD0 A;  3WT1 A;  2OBI A;  1X5D A;  5H5R A;  4GRF A;  3S9F A;  2V41 A;  2GLR A;  3LG6 A;  2L5L A;  1UVZ A;  5D8I A;  4EE0 A;  1YZX A;  1O8W A;  2K8V A;  2BTO T;  1Y25 A;  4ECI A;  3CRT A;  5ELG A;  1GTB A;  4ZIJ A;  4EF0 A;  2HT9 A;  1ERV A;  2F8F A;  2FCH A;  4K6X A;  5G1L A;  5INY A;  3ZIT A;  1UN2 A;  1GSF A;  1Z3E A;  2L4Q A;  4F82 A;  2MMO A;  5L71 A;  1TRW A;  3QPM A;  3IE3 A;  1R26 A;  2B7J A;  1I5G A;  1MD3 A;  3IA1 A;  2L5O A;  2YP6 A;  2VM2 A;  1T1V A;  2YWN A;  4G9H A;  1GP1 A;  4TR0 A;  4BVX A;  5JCW A;  1EZK A;  2B1L A;  2VCQ A;  1JZR A;  1FOH A;  4HZ2 A;  4ZB6 A;  3UVH A; 
#chains in the Genus database with same CATH homology
 3BD2 A;  4KND A;  1A24 A;  4V2M A;  4HUA A;  4PNF A;  1PKW A;  2FD3 A;  3IOS A;  2TIR A;  2PVQ A;  2VAF A;  2N5A A;  1DUG A;  4F0B A;  1Z7R A;  4Z2U A;  2BMX A;  1XW5 A;  4O92 A;  4FO5 A;  4Q5F A;  1BJX A;  2C3Q A;  3A3T A;  4EL1 A;  4YH2 A;  5IQY A;  3LYK A;  4OFM A;  2CX4 A;  3PR8 A;  4MK3 A;  2CAQ A;  3GYK A;  1BG5 A;  1J08 A;  4A5P A;  2YPM A;  4WR4 A;  3IR4 A;  3UIW A;  4WKW A;  1UA5 A;  2VLU A;  5IO2 A;  4K0N A;  4GF0 A;  4OCF A;  5GSS A;  4K8M A;  3LFL A;  5BMU A;  3KZQ A;  1AQV A;  2X64 A;  1AIU A;  2VLT A;  2VLV A;  6GSY A;  5JWR B;  4RUV A;  2OE3 A;  4IJ3 A;  3TRX A;  1XOA A;  1TRV A;  3A5W A;  3HZ8 A;  3GFK A;  2DJJ A;  4IN0 A;  3U6V A;  5DAL A;  3QD9 A;  2OE1 A;  2PBJ A;  5F05 A;  1SD9 A;  2GT6 A;  16GS A;  5CRH A;  1R4W A;  5DAK A;  3DD3 A;  3G7Y A;  3UMA A;  1PN0 A;  1M9A A;  4L5O A;  1SD8 A;  2HSM A;  2KP2 A;  1X9M B;  3H93 A;  1XWC A;  2FNO A;  2A4V A;  2R3X A;  4KW6 A;  3LXZ A;  2YCD A;  2O7K A;  5EL8 A;  1K3Y A;  4TW5 A;  5DAL B;  4WBJ A;  2HRF A;  4XS4 A;  1SKW B;  4D73 B;  3N9J A;  1ZMA A;  2DJ1 A;  3LEF A;  3VWU A;  5DAK B;  4HQS A;  4NPB A;  4DEJ A;  5IOX A;  4CY8 A;  4I2T A;  1YF0 A;  4X43 A;  5ID2 A;  1GSD A;  5HFK A;  1WRY A;  4MZC A;  4YAV A;  5G1K A;  4NV2 A;  2LTK A;  4HOJ A;  1TRU A;  3AY8 A;  5CO3 A;  1TOF A;  2N5B A;  3C8E A;  1F3B A;  1OAZ A;  1NW2 A;  1A0R P;  4FQU A;  2N5F A;  2DKI A;  5E59 A;  1K0O A;  2OBK A;  1S3A A;  1AC1 A;  3KIJ A;  8GSS A;  1TU8 A;  1XWA A;  4LMV A;  3GRX A;  5G30 A;  4N11 A;  4IKH A;  3D4M A;  3LW9 A;  1HNC A;  1ERU A;  4V1A p;  2MYG A;  2H01 A;  2HSH A;  4PUA A;  1O85 A;  9GSS A;  2H1D A;  2IJY A;  3W8S A;  5HR0 A;  2VL9 A;  2HRA A;  5G2Z A;  1ON4 A;  1XIY A;  1WIK A;  2LKU A;  1ZYQ B;  1XOB A;  4BPY A;  1LU4 A;  1XXU A;  4K7N A;  4MCU A;  1N2A A;  1YJ6 A;  4I5Q A;  2HZE A;  5CNW A;  4MJE A;  3HY2 A;  1QXH A;  2H76 A;  4TVE A;  3CMI A;  2LQO A;  1PRX A;  4HU7 A;  4JBB A;  2H30 A;  22GS A;  4O7H A;  2VCW A;  3HXS A;  1EV4 A;  2FWF A;  1JZD A;  3A5I A;  3CSI A;  1FW1 A;  2CVB A;  1B4P A;  1R5A A;  1ZGN A;  2HZE B;  5EVO A;  3E9J B;  3E3E A;  1AUC A;  5J4U A;  3L78 A;  2F9S A;  2O89 A;  4GCI A;  3VLN A;  1OKT A;  4BL7 A;  4PGT A;  1AXD A;  3I43 A;  4I6X A;  4ZL7 A;  3PPU A;  4TOP A;  1XWG A;  4ZL9 A;  6GSX A;  2AB6 A;  3A2W A;  1V40 A;  1Z7P A;  3F6D A;  4NHW A;  3DML A;  1ABA A;  1JHB A;  2VO4 A;  4BL7 B;  4L5L A;  2LRC A;  1CQG A;  4HI7 A;  1XW6 A;  3P8W A;  2B5Y A;  2OKA A;  4MJC A;  2K8S A;  2PMT A;  4J57 E;  2YN1 A;  3FRC A;  1THO A;  4ECB A;  2O8V B;  2GZP A;  1F3A A;  3TOT A;  3FYG A;  4KDY A;  3GV1 A;  2GQM A;  1EV9 A;  1EEM A;  3Q6O A;  3OR5 A;  3DVW A;  2WFC A;  1BQ7 A;  3F4R A;  3F4S A;  1SL1 B;  2NBS A;  4ULX A;  1VF2 A;  1K3L A;  2IPA A;  2X4A A;  3UL3 A;  3VWV A;  4WF5 A;  3PIN A;  1GUH A;  2A2S A;  3CBU A;  2J23 A;  3C73 A;  4LLR A;  2PGT A;  4QQ7 A;  1YKC A;  2C1Y A;  1QFN A;  1NHY A;  1V57 A;  1WJK A;  3MNG A;  4YAP A;  4PUF C;  2AJQ B;  4X1U A;  2CX3 A;  3GKN A;  2WRT A;  4POK A;  1PA3 A;  2GDR A;  2UZ8 A;  1XVQ A;  2LST A;  1TTZ A;  3BJ5 A;  3FZ9 A;  4BWS A;  3ZYW A;  1G7O A;  3UOM A;  3ZL5 A;  5A4V A;  5HFI A;  4FH8 A;  2VOC A;  1LBK A;  2OA7 A;  4HS1 A;  5FWG A;  3IV4 A;  2WDU A;  2YOI A;  2JSZ A;  2C0E A;  4MPG A;  3QDN A;  4HQZ A;  4MZW A;  2X8G A;  2WCI A;  1B4Q A;  2L6C A;  1M9B A;  1F6M C;  4TR1 A;  3F4T A;  2QA1 A;  2MZC A;  5ECP B;  2R2J A;  4L0U A;  1EOH A;  2H1B A;  1SK2 A;  1Z5Y E;  2R0C A;  3O6T A;  3DRN A;  2H66 A;  5D96 A;  1B48 A;  5D9X A;  2RM6 A;  3KH9 A;  1O7U A;  2HYX A;  1GSS A;  2P5Q A;  5J5N A;  3L4N A;  4ZB9 A;  5IMF A;  2R0P A;  2AV4 A;  1SU9 A;  2DJ0 A;  3HYP A;  1OYJ A;  4EDY A;  2EIO A;  4TR1 B;  4PQ1 A;  1ACV A;  2DC5 A;  2CZ2 A;  2DIZ A;  2LRN A;  3HKR A;  2B6M A;  4YQV A;  4ID0 A;  1TJD A;  4ILF A;  1GTI A;  2PN8 A;  2QA2 A;  3TOU A;  2TRX A;  1GUL A;  4NXI A;  3TKR A;  4ZL8 A;  2AAW A;  2GST A;  2RUE A;  2H70 A;  5IIZ A;  1FOV A;  4MH3 A;  1XWB A;  3ME7 A;  3QFA C;  5IMC A;  5G5E A;  5KOX A;  2X49 A;  3DVX A;  4I97 A;  3VUR A;  3GMF A;  1PX6 A;  1PD2 1;  1USB A;  2IME A;  3I6A A;  4IJI A;  3GTU A;  2MMA A;  3HJO A;  4BWQ A;  1U87 A;  1EGR A;  2GTU A;  3EE2 A;  3U5R E;  3ZRE A;  1SKR B;  3D21 A;  1OVN A;  1E2Y A;  1ML6 A;  2K9F A;  3EC3 A;  3ERF A;  5ECN B;  1R7H A;  4LMW A;  3IAM 2;  2C4J A;  3WGX A;  4Z2T A;  4LL1 B;  1ZCP A;  3C1S A;  1HD2 A;  3IXR A;  1A2M A;  5AN1 A;  3BBY A;  4RI7 A;  3DGQ A;  4KE3 A;  5CP1 A;  1Z6M A;  1EP8 A;  5JWO B;  3BCK A;  2H1G A;  1GNW A;  5ECR B;  5EPF A;  2LEG A;  2PPT A;  3KJY A;  2CV4 A;  1GUM A;  1F2E A;  3F63 A;  3QAV A;  5ECH B;  4YQM A;  1B9X C;  1H75 A;  13GS A;  5IO0 A;  2XBI A;  2EC4 A;  2DMM A;  2V2G A;  2GSS A;  3IBH A;  2E2G A;  2D2Z A;  2RUF A;  2CVD A;  5A4U A;  2H6Y A;  2IN3 A;  2IWT A;  2L57 A;  3L9U A;  2JZR A;  4MZB A;  2ALB A;  4IP1 A;  1WMJ A;  3LGC A;  3EU4 A;  4I8B A;  2BJX A;  5ECK B;  4TXV A;  2EIR A;  3HD5 A;  4HJM A;  4JE1 A;  3FZ4 A;  3O3T A;  3QFB C;  5KN2 A;  1YF1 A;  4GXZ A;  4RI6 A;  1PL1 A;  2TRC P;  2FA4 A;  4JR6 A;  2I9H A;  3MIX A;  5B8A A;  4WF4 A;  1ZZY A;  4AJ7 A;  4WR5 A;  3HA9 A;  4JU5 A;  4XRD A;  1XCC A;  4BVX B;  1MDJ A;  3QAG A;  3C71 A;  1X5C A;  3D22 A;  4BA7 A;  2WB9 A;  4BVY A;  4XCS A;  2ON5 A;  2LRT A;  2G2Q A;  4DSQ A;  2R37 A;  4J56 E;  1DSB A;  3GL5 A;  2VCV A;  11GS A;  4IHU A;  1MDI A;  2IMI A;  3HVS A;  14GS A;  3TCO A;  2LQQ A;  4G0I A;  4O5U A;  4PTS A;  2H71 A;  2IMD A;  2L6D A;  4IQ1 A;  4MJB A;  3FR6 A;  1YDK A;  4KCE A;  1X5E A;  3TUE A;  2HRK A;  3ZRD A;  1I9D A;  12GS A;  3UBK A;  2DML A;  2LS5 A;  4WEY A;  4BVY B;  1K0C A;  1EWX A;  3IHQ A;  1WPI A;  1X9S B;  4ZB8 A;  4HJ2 A;  3TKS E;  5B8B A;  2NTO A;  2V1M A;  1GL8 A;  4KUN A;  3E0U A;  1WWJ A;  2LNS A;  3H79 A;  4KA0 A;  1KNG A;  1PKZ A;  3GH6 A;  5H5Q A;  4G2E A;  5JCG A;  3ZFB A;  3F6F A;  3P7X A;  4MA9 A;  3M8N A;  3KCM A;  2H73 A;  1XFL A;  3QR6 A;  1KTE A;  2EIQ A;  3LOR A;  3RAZ A;  4MF7 A;  1DE2 A;  1HNA A;  2VD1 A;  1S3D A;  4WET A;  3G7J A;  5KEJ A;  3CYN A;  4TN8 A;  3DXB A;  3KEB A;  1VRS D;  5G31 A;  3ZTL A;  5HFG A;  3HJM A;  2A2R A;  1X0R A;  4WXT A;  1A0F A;  3KH7 A;  2CA8 A;  4N0Z A;  3TDG A;  3O76 A;  3QOU A;  3EYT A;  1BX9 A;  4G10 A;  2XHF A;  3C1R A;  3RPN A;  1T4Y A;  3KTB A;  2H0H A;  4XRA A;  1SK1 A;  4GSS A;  2F51 A;  3EUR A;  5HR3 A;  4ML1 A;  1PQN A;  2YWM A;  4G0L A;  1U3A A;  4NWY A;  1RW1 A;  4MH2 A;  4XS4 B;  4KX4 A;  2YNX A;  5B6N A;  4TR3 A;  4YKF A;  5AIS A;  1LJR A;  5IMV A;  2P5R A;  5ID2 B;  2WUL A;  2AUV A;  1VGL A;  2I1U A;  3D0Z A;  4MMM A;  2PWJ A;  4ZIL A;  1SK0 A;  1ZYN A;  5ECM B;  2M46 A;  1YKA A;  5J9B A;  2H0G A;  4E8H A;  4NAX A;  2HE3 A;  1M2A A;  4GQC A;  2MMN A;  1Q4J A;  1O73 A;  3GUR A;  4JED A;  3IAS 2;  4EXJ A;  2GS3 A;  3F3Q A;  2HZF A;  3RDW A;  2I3Y A;  4TKY A;  1SJI A;  2NDO A;  3EMP A;  2FY6 A;  2YV7 A;  5IMD A;  3K8N A;  3VPT A;  2H6Z A;  2GQL A;  5ECI B;  2O85 A;  3ZVJ D;  3F9U A;  4FYC A;  1OE8 A;  5CRE A;  1QUW A;  1F9M A;  1GSE A;  3TRQ A;  1ZOF A;  4EVM A;  2GZY A;  2YWO A;  3VFI A;  2I81 A;  3LQ7 A;  1V2A A;  4O5Q A;  4POB A;  2R6K A;  1G6Y A;  1ERW A;  2HSY A;  4CW9 A;  5IM9 A;  2O87 A;  1O81 A;  19GS A;  1QGV A;  1O6J A;  2KLX A;  3FKF A;  3GSS A;  3HHV A;  2REM A;  2KHP A;  2HRN A;  1A2L A;  4ZBB A;  1ZYE A;  3LXT A;  3FR3 A;  2H19 A;  3TKP A;  3IC8 A;  2E7P A;  3WYW A;  2DLX A;  6GST A;  3DKS A;  1SYX A;  5HR2 A;  4PQH A;  1O8X A;  3FK8 A;  3IPZ A;  1AAZ A;  2IMF A;  4DSR A;  3GA4 A;  5H5S A;  1DBY A;  5DBQ A;  4DSS A;  5DJM A;  2YJH A;  4V1A g;  3UAP A;  2C80 A;  1ST9 A;  4Q5N A;  2QGV A;  1OC9 A;  2V6O A;  5A4W A;  2ES7 A;  4NV5 A;  1SJZ A;  2R0G A;  2Z9S A;  1ZL9 A;  3EIN A;  4KH7 A;  1U88 A;  2QSI A;  5GAN D;  1AW9 A;  3KXO A;  4AJ8 A;  4JR4 A;  5A5K A;  4EKZ A;  4TRX A;  2DIY A;  1A23 A;  3F0I A;  3GX8 A;  3ZVJ A;  3D6I A;  4AGS A;  5CRW A;  1OKD A;  3WD6 A;  1A8L A;  4MLY A;  1M2B A;  2C0F A;  3KMN A;  4MF5 A;  3WT2 A;  3VI7 A;  4GTU A;  2RLI A;  1IYI A;  4JRR A;  4K2X A;  5AIV A;  1Q98 A;  5DJL A;  4ZXG A;  3BOA A;  3TGZ A;  3FEU A;  3A2V A;  3D5J A;  1GLP A;  4IVF A;  2GSR A;  1U3I A;  3P90 A;  2C3T A;  3FW2 A;  1AQX A;  4XTS A;  3I69 A;  4KB3 A;  1YY7 A;  1ERT A;  1SEN A;  5KOW A;  2E2M A;  2FWH A;  2IIY A;  1A2J A;  3DEX A;  2M72 A;  2FLS A;  1E6B A;  3R3E A;  2P0G A;  4L8E A;  3ZMK A;  1FAA A;  1IYH A;  3ED3 A;  1W4V A;  2KP1 A;  1G0T A;  4EIP A;  1JZO A;  3Q19 A;  2FHE A;  5CYY A;  3ISO A;  3UJ1 A;  3LJR A;  3FMW A;  2RII A;  3FY7 A;  3V1W A;  1K3O A;  1S3C A;  3CSJ A;  5GAP D;  3RBT A;  2GGT A;  3KM6 A;  5D9V A;  3KP9 A;  6GSS A;  3N5O A;  3MYD A;  1Z6N A;  4POL A;  3EPT A;  1YEP A;  1YQ1 A;  2R4V A;  1J0F A;  2FA8 A;  3RPP A;  4K7I A;  1FVK A;  1TDI A;  1GUK A;  3M0F A;  3FR9 A;  1Y6E A;  3Q74 A;  4ZBA A;  3SWL A;  4PUR A;  4O32 A;  1NM3 A;  3MWH A;  1TK0 B;  1JZW A;  3GNJ A;  3VK9 A;  3M9J A;  1W89 A;  2DBC A;  2V32 A;  3UVT A;  2WJU A;  3KTL A;  1JFU A;  5F07 A;  5EY6 A;  1FB0 A;  4K1F A;  1A8Y A;  3VWX A;  3HZ4 A;  4PX1 A;  3TJF A;  5JWQ B;  3DIE A;  2DJ2 A;  3HJP A;  5LCZ A;  3GST A;  4MF6 A;  2JSY A;  1TI1 A;  5IMA A;  2HI7 A;  3W8J A;  2B5E A;  4WBR D;  5IPG A;  2PVO C;  4X4J A;  2HXK A;  3ERW A;  4OWY A;  4PQI A;  1PSQ A;  3GTU B;  4V2L A;  1HQO A;  2H1A A;  2ZNM A;  3ZML A;  4XIH A;  4K0G A;  4LA1 A;  3FZ5 A;  2GZZ A;  3DYR A;  4Q5R A;  3APO A;  4TR4 A;  4IEL A;  3P2A A;  3BCI A;  1GH2 A;  4I2U A;  1G7E A;  1PN9 A;  2FUG 2;  1VF1 A;  1TK8 B;  1SKS B;  3CTG A;  5GST A;  2VD0 A;  3MSZ A;  2H75 A;  2YZU A;  1UC7 A;  1GSQ A;  3GIX A;  2WS2 A;  1X9W B;  3D4T A;  3ZFL A;  4DVC A;  3QAW A;  3IRA A;  4IBP A;  3F3R A;  3GHA A;  1TW9 A;  3GKK A;  5IOW A;  2QKE A;  5J41 A;  2OAD A;  3G9B A;  4J2F A;  1VF4 A;  4Q5Q A;  1K0M A;  5ECS A;  2CZ3 A;  4N0V A;  5ECQ B;  1FVJ A;  2VL3 A;  1HYU A;  4KAE A;  2DJ3 A;  2H8L A;  1M99 A;  2CAI A;  2F8A A;  4FYU A;  5F0G A;  1URM A;  6GSU A;  1WP0 A;  5LD0 A;  4OFT A;  5B6M A;  5E4W A;  4KF9 A;  3GUS A;  4PNG A;  2B1K A;  2KOK A;  4OD7 A;  2A4H A;  5IMZ A;  2I4A A;  4IQA A;  1MDK A;  4EDZ A;  1M7T A;  1K0N A;  5D73 A;  1U6T A;  2HNL A;  3F8U A;  5FHI A;  1XPV A;  4F0C A;  1TK5 B;  1NHO A;  4O5R A;  1B9Y C;  3L0H A;  10GS A;  1JLW A;  2PER A;  1N8J A;  5ENU A;  2YZH A;  4G19 A;  2GQK A;  2M80 A;  4ICY A;  1TKD B;  4P3Y B;  3HVV A;  1MD4 A;  4NMU A;  4GST A;  1FG4 A;  3CSH A;  3VPQ A;  4KDU A;  1JLV A;  3A2X A;  1GLQ A;  4AJ6 A;  3NIV A;  4ECC A;  1OC8 A;  1XVW A;  3W6G A;  1MTC A;  2ZCT A;  1WOU A;  2C8U A;  2E0Q A;  6GSV A;  2G0F A;  1TP9 A;  1YEX A;  4D73 A;  2CVK A;  3GKM A;  1VF3 A;  2RM5 A;  4CDO A;  5FT3 A;  1GRX A;  2H74 A;  1TXX A;  4LL4 B;  4KSO A;  4F9Z A;  3I9V 2;  4KDX A;  1TRS A;  2LJR A;  1EGO A;  5DQS A;  4IGJ A;  3TJB A;  3EMX A;  2VCZ A;  5B7C A;  3TJJ A;  2YV9 A;  5G5F A;  3NOF A;  1B8X A;  2K6V A;  2MMZ A;  4GWR A;  4K5R A;  3ZZX A;  3TJK A;  2L4C A;  5C00 A;  4K9Z A;  18GS A;  3GKX A;  5CAX A;  1CQH A;  3APQ A;  3MAK A;  2R5G A;  2LJK A;  2A2P A;  3RHB A;  2PUK C;  4ML6 A;  3HCZ A;  3C7M A;  3CTF A;  3ME8 A;  2IFQ A;  20GS A;  4Z7X A;  3LYP A;  3QCP A;  3PH9 A;  3EVI A;  3US3 A;  3CRU A;  1OE7 A;  2FWG A;  5F06 A;  5KN3 A;  2HFD A;  4ISD A;  4K2D A;  4ZBD A;  4FYB A;  3GH9 A;  2IL3 A;  1C72 A;  4GSN A;  4G0K A;  1SJ6 A;  5IPH A;  2LNT A;  4IW9 A;  2KUC A;  2K18 A;  2IFQ B;  1EP7 A;  1GSU A;  2C3N A;  5ECO B;  4K7O A;  4F03 A;  5ELA A;  1H4O A;  4PXO A;  1SL2 B;  2VL2 A;  3TRP A;  2B7K A;  5ABR A;  1PX7 A;  2VCX A;  1MEK A;  2YJ7 A;  4H86 A;  3WGE A;  3R2Q A;  5DQY A;  4MNN A;  2H6X A;  1RQM A;  4HDE A;  3H8Q A;  2YAN A;  5HR1 A;  2DKH A;  5DVB A;  4FIW A;  3EU3 A;  5DDL A;  1GWC A;  3GL3 A;  4AF2 A;  5J3R A;  2J9H A;  1PMT A;  2GSQ A;  1NSW A;  3FHK A;  4EUY A;  2B3S A;  1SYR A;  2V6K A;  4N10 A;  3PGT A;  4JZQ A;  3KP8 A;  6GSW A;  1BYE A;  1FHE A;  4HU9 A;  4QL9 A;  1RK4 A;  4IP6 A;  3J7Y k;  2JL4 A;  4MJA A;  4XHM A;  2MBS A;  3TKQ A;  2VUP A;  3L9S A;  3G7I A;  4RQR A;  1XBS A;  2AHE A;  2NPB A;  3IHG A;  1T7P B;  3ZIV A;  3HDC A;  5DCG A;  4KSM A;  3GX0 A;  1GSY A;  4OFN A;  1GTU A;  5DCH A;  1F37 A;  7GSS A;  2OE0 A;  4TXO A;  1M2D A;  2GT5 A;  3UAR A;  1GNE A;  4Z2R A;  2HLS A;  1GTA A;  2LV3 A;  1FO5 A;  2B5X A;  1EEJ A;  3IK9 A;  4MDC A;  4YQU A;  4USS A;  2VL2 C;  5KN0 A;  3M3M A;  2XC2 A;  3LWA A;  4N30 A;  4DSS B;  3EWL A;  4KGI A;  3KGK A;  3M9K A;  3TKS A;  1PL2 A;  1AQW A;  1J9B A;  1OC9 B;  1THX A;  5JCU A;  4TXO B;  1M0U A;  5CRD A;  4E8E A;  4OO5 A;  3VWW A;  1XWK A;  2C0G A;  5KN1 A;  3FZA A;  3DWV A;  3CXG A;  2QC7 A;  1BAY A;  5AGY A;  1T4Z A;  1XZO A;  2JZS A;  4EO3 A;  1K0A A;  2MBT A;  5AIX A;  1KBN A;  2DJK A;  4CY6 A;  2CT6 A;  2AYT A;  1WE0 A;  1ILO A;  1QMV A;  2WZ9 A;  1SL0 B;  4GQF A;  3QMX A;  3M1G A;  4MAB A;  2H0I A;  3UBL A;  5BRT A;  4OMV A;  5GZZ B;  5C04 A;  4ECJ A;  2DSA A;  5F8B A;  4GLT A;  4OO4 A;  4POM A;  3TB2 A;  2VM1 A;  3Q18 A;  4OCE A;  5D9T A;  4XS6 A;  5LNK e;  3ZIJ A;  3VI5 A;  4HEA 2;  4IS0 A;  1K0B A;  3H4K A;  3TJG A;  2LJA A;  4MPF A;  1G6W A;  2XPE A;  2JAD A;  3WGD A;  2YWI A;  2LUS A;  2X99 A;  4F2I A;  4XS1 A;  1V9W A;  4QL7 A;  2NVL A;  3IK7 A;  2X8C A;  3TKS C;  4EC0 A;  4RQX A;  1T00 A;  17GS A;  2F3M A;  4NHZ A;  5HQP A;  1FB6 A;  1OC3 A;  1QQ2 A;  2GVP A;  2FGX A;  2OAC A;  2X8H A;  2VCT A;  4V2N A;  3L9V A;  3HVX A;  2ON7 A;  3H1N A;  4MP4 A;  2XPD A;  3JCM L;  3ZLP A;  3LSZ A;  1BED A;  2JZT A;  3SBC A;  3MDK A;  1V98 A;  1HNB A;  1EOG A;  5ECL B;  3UEM A;  4L0W A;  3IC4 A;  2FWE A;  5D9W A;  2WGR A;  2H72 A;  2P31 A;  1K0D A;  1XW9 A;  4KCA A;  4HZ4 A;  1TU7 A;  5D93 A;  4X0X A;  1V58 A;  2CQ9 A;  1QK8 A;  4EIQ A;  2OJL A;  3J7Y b;  2JAC A;  2VIM A;  2PU9 C;  4CHS A;  4ACS A;  3KMO A;  1DE1 A;  1ZYP A;  4YKG A;  5COH A;  3IDV A;  1TI3 A;  2L59 A;  3GN3 A;  1T8E B;  1PGT A;  2C0D A;  2ZUP A;  5J9C A;  3ERG A;  2JU5 A;  3NZN A;  1Z9H A;  3RHC A;  2XBQ A;  1T3B A;  5CRG A;  4K5S A;  1KEB A;  3APS A;  1R5P A;  2IMK A;  3KD0 A;  3WT1 A;  2OBI A;  1X5D A;  5H5R A;  4GRF A;  3S9F A;  2V41 A;  2GLR A;  3LG6 A;  2L5L A;  1UVZ A;  5D8I A;  4EE0 A;  1YZX A;  1O8W A;  2K8V A;  2BTO T;  1Y25 A;  4ECI A;  3CRT A;  5ELG A;  1GTB A;  4ZIJ A;  4EF0 A;  2HT9 A;  1ERV A;  2F8F A;  2FCH A;  4K6X A;  5G1L A;  5INY A;  3ZIT A;  1UN2 A;  1GSF A;  1Z3E A;  2L4Q A;  4F82 A;  2MMO A;  5L71 A;  1TRW A;  3QPM A;  3IE3 A;  1R26 A;  2B7J A;  1I5G A;  1MD3 A;  3IA1 A;  2L5O A;  2YP6 A;  2VM2 A;  1T1V A;  2YWN A;  4G9H A;  1GP1 A;  4TR0 A;  4BVX A;  5JCW A;  1EZK A;  2B1L A;  2VCQ A;  1JZR A;  1FOH A;  4HZ2 A;  4ZB6 A;  3UVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...