3EURA

Crystal structure of the c-terminal domain of uncharacterized protein from bacteroides fragilis nctc 9343
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
140
structure length
140
Chain Sequence
AKNRLGTKALNFTYTLDSGVKGTLYQFPAEYTLLFINNPGCHACAEMIEGLKASPVINGFTAAKKLKVLSIYPDEELDEWKKHRNDFAKEWTNGYDKELVIKNKNLYDLRAIPTLYLLDKNKTVLLKDATLQKVEQYLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
publication title Crystal structure of the C-terminal domain of uncharacterized protein from Bacteroides fragilis NCTC 9343
rcsb
source organism Bacteroides fragilis
total genus 44
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2008-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3eurA00
4MF6A 1DBYA 3A3TA 3A5WA 2OACA 1ZCPA 1A2JA 1W4VA 2AAWA 4YQVA 4WF5A 1F9MA 5ECPB 3RHCA 2H66A 1A24A 17GSA 4OWYA 3P7XA 3ZITA 2H0GA 1G0TA 2IN3A 1TKDB 3DMLA 3EE2A 4WETA 5G1KA 3GH6A 1Y25A 1GTBA 2WS2A 4KAEA 3GV1A 18GSA 13GSA 1N2AA 1M2AA 5DJLA 2GQMA 1LBKA 1TK8B 2DJ1A 5DAKB 1UC7A 2GSQA 1O6JA 4K9ZA 5D9XA 1YJ6A 6GSXA 2WULA 1FHEA 5J9CA 2IMFA 5ABRA 1R4WA 2BTOT 2V1MA 1JHBA 1Z7RA 4I2UA 4EF0A 1FB6A 2GS3A 3RPPA 2R5GA 2K18A 4L5OA 3FR6A 3LQ7A 2M46A 3DGQA 1GWCA 2HZEA 2IFQB 3U5RE 4O7HA 3FY7A 4EVMA 4V2NA 1JZDA 2CT6A 5EVOA 3NOFA 3CRUA 4TR3A 4F0CA 1TK0B 5D73A 5HR1A 2QKEA 2OJLA 5ECHB 1M2BA 1TU7A 1XPVA 2FNOA 2GGTA 3EMXA 3A2XA 2FUG2 5F8BA 4XHMA 1VF2A 3HVVA 1F6MC 1TDIA 5ECNB 1OC8A 2X99A 3TJKA 4GTUA 4FYBA 5CRDA 1SK1A 4YQUA 4JZQA 4KH7A 2C8UA 3KTLA 2XC2A 1V2AA 3QOUA 4ZL8A 2LJRA 4DSRA 2LV3A 4MK3A 2V41A 1MD3A 5D93A 3TRXA 3I9V2 5J4UA 4AGSA 3PGTA 1PRXA 1GSSA 3DIEA 5IO2A 2H0IA 5GAND 2CZ2A 5CNWA 3IHQA 1MDKA 2AYTA 3D4MA 5GSTA 2L4QA 1U88A 3VI7A 3Q18A 2JZSA 2B3SA 2VO4A 4X0XA 1F3BA 4IVFA 1OE7A 1K0BA 1PX7A 2VD0A 2E2GA 3H79A 3OR5A 1EV4A 2GSRA 1VF1A 4BWSA 3TJBA 4NXIA 3UMAA 3U6VA 2DMLA 1AQWA 2VCQA 6GSTA 4DEJA 3QFAC 3Q74A 2VCVA 1M2DA 1QXHA 2B1KA 3P2AA 5JWRB 4F0BA 1RK4A 3DKSA 3FZ4A 3ZREA 1I5GA 1B8XA 4ZXGA 2KOKA 3L4NA 1KEBA 2JACA 4NAXA 2WRTA 3LSZA 4K8MA 3MWHA 2HI7A 5A4VA 2OKAA 3F4SA 3D0ZA 2I1UA 1NHOA 5A4WA 3P8WA 4PQHA 1PSQA 1THXA 5IOXA 2YV7A 3ZFLA 2CQ9A 3QFBC 2YWMA 3IPZA 2JZTA 3LYPA 1X9MB 1ILOA 3IXRA 5CREA 5GSSA 4MPFA 1SK2A 2JU5A 3HA9A 2YOIA 4D73A 3HVXA 1F3AA 1OYJA 1HD2A 2OE3A 5L71A 2F8AA 5IIZA 5F06A 4V1Ag 4LL1B 2FHEA 4ML6A 1ML6A 3VURA 1GUHA 1T8EB 4POMA 1T4YA 2C80A 4ZL7A 2J23A 5J9BA 4P3YB 3M9KA 4WEYA 2IMDA 5E59A 4J2FA 2VLTA 3IK9A 20GSA 3C1RA 2OBKA 3TKPA 3ZMKA 3SBCA 2GZPA 3TCOA 2L59A 4H86A 2JADA 2DJ3A 1XWAA 1CQHA 4YAVA 5IOWA 3KH9A 3IC4A 5IMZA 1EGOA 2H8LA 5FT3A 1IYIA 1B4QA 1K0DA 3ZYWA 2LJAA 2CVDA 1JZOA 3GSTA 1GLQA 2PWJA 4ZB9A 1TK5B 3UVHA 2J9HA 3ZLPA 3EU3A 2H1AA 2VM1A 1AIUA 3I6AA 1SJ6A 4POBA 5EPFA 6GSWA 3RDWA 3WGDA 3UAPA 2VCZA 4MMMA 5CO3A 1GP1A 2EIOA 3NZNA 4F9ZA 6GSSA 2VAFA 2E0QA 4J56E 3CTGA 4XS1A 1XW5A 3BD2A 2TRCP 2IMIA 2LEGA 1SENA 3G7YA 1WMJA 4G9HA 12GSA 4WF4A 5ECLB 1QQ2A 16GSA 2VUPA 5CRHA 3BOAA 2L57A 11GSA 5G5EA 4LLRA 1T7PB 1TJDA 1IYHA 2MMOA 2N5AA 2NTOA 4IQAA 3TUEA 2RLIA 3VWWA 4ZB6A 4NV5A 3KXOA 3PINA 1K0MA 1BX9A 3KH7A 1TXXA 1S3AA 3QPMA 5A5KA 3FR9A 3ME7A 2FGXA 4V1Ap 3UEMA 3RHBA 4XIHA 4O5RA 5B6MA 1O8XA 1ACVA 1V40A 5KN0A 3UJ1A 1OC9A 2WZ9A 1H4OA 4BWQA 3CSIA 3IV4A 1PKWA 3QMXA 2CAIA 2PBJA 3NIVA 5CRGA 1XIYA 4NV2A 3C7MA 5DALA 1K0CA 2O85A 1WJKA 1QMVA 1R7HA 1EOGA 2YWNA 2ON5A 4JRRA 3HZ8A 5EL8A 1O73A 3BCIA 4QQ7A 3HYPA 2H72A 3EMPA 3QD9A 1YEXA 1K3OA 3QAVA 3M1GA 4IW9A 3KP8A 2F51A 3RAZA 3VFIA 5ECIB 5IM9A 1QK8A 2XBIA 1WRYA 4PNGA 5ECRB 1C72A 5H5RA 3GX8A 2FA8A 1B48A 2WJUA 4PUAA 2IL3A 1PMTA 2ES7A 4RQXA 4MDCA 3O6TA 4IP1A 3FZAA 4QL9A 1PKZA 3GTUA 5IMFA 2H70A 1X9WB 3E0UA 3GL3A 3ED3A 1VRSD 3VK9A 3MDKA 3F8UA 1U87A 1QGVA 1ST9A 5HFKA 1GUMA 3TRQA 4BA7A 3IAS2 2HXKA 4ZBDA 1M0UA 1XZOA 4GQFA 3ZZXA 1YKAA 1SKWB 2AJQB 2P5RA 4XS4A 4MABA 5DBQA 1JLWA 3J7Yk 5F07A 2TRXA 4YH2A 3L78A 1X0RA 4CDOA 4I6XA 3APOA 2N5BA 2HRNA 4GCIA 3GN3A 5DJMA 1BYEA 1GSQA 1USBA 2XPEA 1ZOFA 1G6WA 5H5QA 1HNCA 1RW1A 4EL1A 4D73B 2I81A 2LNSA 4G10A 4KB3A 1VGLA 2V6KA 2XPDA 4WBJA 1ERWA 2OADA 4O92A 3DRNA 3LFLA 4L5LA 2MYGA 1OC3A 1TRVA 3VI5A 1A2LA 3WT1A 1UVZA 1M99A 3FZ5A 2H6XA 2F3MA 3KGKA 4IS0A 2YANA 1NHYA 4XRDA 3ZRDA 3F63A 3I69A 3WD6A 2KHPA 3L9SA 1F2EA 5IMCA 8GSSA 4MH2A 2L5LA 2DBCA 2N5FA 1WPIA 6GSUA 1X5CA 3C8EA 5J5NA 1KBNA 4JE1A 1JZRA 1KTEA 3TJFA 3KMOA 2AUVA 2L5OA 4MZBA 4BPYA 3QDNA 4IN0A 2WGRA 4PXOA 4ID0A 3HKRA 1XOBA 3HD5A 4G19A 3W8SA 1NW2A 4ULXA 2FCHA 1WOUA 2I9HA 2O7KA 2H71A 2DIYA 3VWXA 3TJGA 4TR4A 5IPHA 2BJXA 1NM3A 2IJYA 3E9JB 3EYTA 4OCFA 2FWHA 1XVQA 4POKA 3LJRA 3GURA 1A2MA 5ELAA 2H1DA 3AY8A 2WCIA 3IK7A 2OE0A 3F4RA 2I4AA 6GSYA 1ZL9A 4GSNA 1MEKA 2ALBA 1Z5YE 4RI6A 1ERVA 1SL2B 2XHFA 3WYWA 1GULA 1R5PA 3LORA 4WBRD 1FAAA 1GUKA 4GF0A 4TKYA 3GSSA 2CX3A 4JR4A 5CAXA 1Q98A 2NPBA 4E8EA 4KCAA 1SJZA 4F82A 5IPGA 2C0FA 4KSOA 3HJMA 3EC3A 1GLPA 5ECSA 1OC9B 4L0WA 2F8FA 2FLSA 3EWLA 3HHVA 2L4CA 5ECMB 4IKHA 4ECIA 1JLVA 2NDOA 9GSSA 1QUWA 5HQPA 1TU8A 4HJ2A 2CV4A 2R4VA 1B9YC 5CP1A 1R26A 3GH9A 3PR8A 4ECCA 4PX1A 2LRCA 1AAZA 4GQCA 1TRWA 2RM5A 4V2LA 4HU9A 3K8NA 5AIXA 6GSVA 4GLTA 2V2GA 4NHWA 4IJ3A 4OMVA 4EDYA 3KD0A 3F6FA 2YWOA 2VCXA 3EVIA 4WXTA 2DIZA 2HT9A 5DVBA 4HZ2A 3CSHA 3DXBA 1EP7A 2R3XA 2LTKA 4TN8A 2NBSA 4HQSA 4V2MA 1Y6EA 2DLXA 4Q5NA 1XWBA 1B9XC 2GZZA 1GSUA 3TJJA 5EY6A 1OAZA 4ACSA 5LD0A 3RBTA 2RUFA 3TOUA 2CVKA 2H1BA 4KSMA 4XS4B 1PQNA 1WP0A 3WT2A 4N0VA 2E7PA 5GZZB 1YKCA 4NPBA 2H01A 2H0HA 2MMNA 4J57E 3MAKA 2X8CA 3G7JA 2DJ2A 2HZFA 3D5JA 5AN1A 1K3YA 1OE8A 3HJPA 5B8BA 4TVEA 1OVNA 1DSBA 1XOAA 1XVWA 3L9UA 5ENUA 4MPGA 4HUAA 4BVXA 2JSYA 2QSIA 3W6GA 4PQ1A 1FOVA 3Q6OA 3TKSE 4G2EA 3BJ5A 5D9TA 4LL4B 2C4JA 1B4PA 1O85A 2B1LA 2FA4A 3FK8A 4ZL9A 2FD3A 3C1SA 3IRAA 3O3TA 2FWGA 5IMVA 1EZKA 2YJHA 4DVCA 4ZIJA 3M3MA 2YV9A 5CRWA 1ZMAA 4MJBA 1T00A 3MSZA 2C0GA 4QL7A 2H6YA 2A4VA 2P31A 4YAPA 3M8NA 4Q5FA 4WR5A 1O81A 3KIJA 1TRUA 3GL5A 2KP2A 4I8BA 4HZ4A 3UARA 2WDUA 3EURA 1XBSA 5B8AA 3GFKA 1U3AA 1WIKA 1ON4A 2GT5A 2HRFA 1G7OA 5CYYA 3D21A 2C1YA 1CQGA 3GX0A 4ZILA 2PERA 4K7NA 2YZHA 4CHSA 1URMA 1O7UA 2YNXA 1TI1A 1PN9A 3ERWA 4PQIA 2R2JA 2HZEB 5E4WA 1PA3A 2C0DA 2PMTA 1BEDA 2VCWA 1FW1A 5JWQB 3ZIVA 1TW9A 3HVSA 2OE1A 1T3BA 1TOFA 4FYCA 3KM6A 4KGIA 2I3YA 1OKDA 2IFQA 3H4KA 1V58A 1F37A 3TKSA 4POLA 3ERFA 2BMXA 2G0FA 2HNLA 4RQRA 1A0RP 3APSA 5DQYA 2AB6A 1THOA 1FO5A 2CAQA 1EWXA 3EINA 2LS5A 1PX6A 3DD3A 4O32A 2YJ7A 1T4ZA 2PU9C 2H19A 1A0FA 1HNBA 1O8WA 3CSJA 2VL3A 3L0HA 1SYRA 3GYKA 4PNFA 1X9SB 4JR6A 1ZYQB 1W89A 3HY2A 4NHZA 3ZFBA 2IMEA 4E8HA 3GHAA 1V9WA 1LJRA 4KNDA 2G2QA 3L9VA 1HQOA 1TRSA 3FR3A 4Z7XA 3LG6A 1GRXA 1U6TA 2A2SA 4TOPA 3H1NA 5G30A 4KCEA 4NWYA 2CA8A 4MJCA 1M9AA 1MTCA 1MD4A 4KE3A 2V32A 4JEDA 2MZCA 2DJ0A 3F6DA 4K2DA 2B5XA 1U3IA 4Q5RA 3FYGA 5D9VA 2HYXA 2VL2C 5HR2A 3FEUA 4EUYA 2TIRA 5F0GA 5D9WA 4XRAA 1A8YA 1AQVA 1EGRA 4OFTA 2CX4A 3BBYA 3VWVA 3Q19A 1ABAA 3KCMA 5KN1A 1BQ7A 4RI7A 1GTUA 2V6OA 3LXTA 3UBLA 3SWLA 3H8QA 3D4TA 3A2WA 3ERGA 1UA5A 2YWIA 1GH2A 3DVXA 2FWFA 2PGTA 1S3CA 1VF4A 5C04A 2HE3A 3KTBA 22GSA 1FG4A 4IELA 1Z6MA 3RPNA 4IJIA 1HYUA 4I5QA 5KEJA 2CZ3A 4ECBA 2YZUA 5F05A 4N30A 2L6CA 4K0GA 5IMAA 4I97A 2REMA 5JCUA 3ZIJA 1ERUA 4HJMA 3IAM2 2RIIA 4CW9A 2GSSA 3M0FA 3DYRA 2B5EA 4FO5A 5ECOB 2X8GA 2GTUA 2VM2A 3GMFA 3VLNA 3D22A 2GZYA 1G7EA 2M80A 4LA1A 3HJOA 2HFDA 1UN2A 2DJKA 3CTFA 4OCEA 5DCHA 3GRXA 2ZCTA 4TR0A 4TR1A 5ECQB 2H75A 5C00A 3UIWA 1SD9A 2H76A 1YEPA 3GIXA 4XTSA 3KEBA 4I2TA 3P90A 5G31A 4GRFA 4IQ1A 4IGJA 4HI7A 1KNGA 4OFNA 3TRPA 4GXZA 3IE3A 2PVQA 5J41A 3FZ9A 4OFMA 2PN8A 1SK0A 4BVYA 1K3LA 1V57A 10GSA 2M72A 4HU7A 1Z9HA 1BAYA 3UVTA 3EU4A 3H93A 4ML1A 1V98A 3UBKA 4ZBAA 2QGVA 3TGZA 5JCGA 1WWJA 4MH3A 2DJJA 4MZCA 1GNEA 3GKXA 1MDJA 2D2ZA 3G7IA 4X43A 4IBPA 1G6YA 2OA7A 2WFCA 7GSSA 2C3NA 3LYKA 2K8VA 3IOSA 3FW2A 1FB0A 2DMMA 4KX4A 1J9BA 5H5SA 3WGXA 2FWEA 3O76A 3QAWA 3TDGA 3IBHA 4GWRA 2O89A 2H6ZA 2MMZA 4AJ7A 1J0FA 1AC1A 2FY6A 4TRXA 4KDUA 1Q4JA 1YF0A 5DALB 2LQQA 3F0IA 2VLUA 1T1VA 4ISDA 5FHIA 3ZVJA 1H75A 1RQMA 2IIYA 1S3DA 1Z6NA 2E2MA 2VIMA 3QAGA 1XW9A 2GQKA 2VOCA 3GUSA 3ZVJD 4NMUA 1Z3EA 2K6VA 4AF2A 3ZTLA 1FVJA 3CBUA 1A8LA 2CVBA 3IR4A 2IPAA 4LMWA 2VLVA 4X1UA 2LUSA 3KJYA 1PL1A 2B7JA 1GL8A 2R6KA 1EEMA 2LSTA 4KW6A 3GTUB 4PGTA 2YN1A 3C71A 5AGYA 4F03A 1XW6A 2EIQA 3ZL5A 2A2RA 3APQA 5ECKB 3DWVA 4TXOA 4KUNA 4FYUA 1XCCA 2P5QA 4EKZA 5COHA 3FRCA 4ECJA 5HFGA 1WE0A 2B5YA 4K1FA 4FIWA 2PVOC 2PUKC 4AJ8A 4LMVA 1J08A 1GTAA 5HR0A 4DSSA 3M9JA 2MBTA 4GSSA 2C0EA 2H74A 4XCSA 5HR3A 1NSWA 3IA1A 4K6XA 4EDZA 3C73A 2KP1A 3QR6A 3F3RA 1YF1A 3R2QA 3PH9A 4L0UA 1XFLA 1DE2A 3HZ4A 3UOMA 4HDEA 2VCTA 1SKSB 1YQ1A 3DVWA 1Z7PA 3KP9A 1ERTA 1YZXA 2LJKA 3WGEA 4JBBA 1SL0B 4TW5A 4HS1A 3FHKA 3HDCA 5ID2A 3KZQA 1ZYEA 2RM6A 4ZB8A 1M7TA 1PGTA 3QCPA 1DE1A 1JZWA 4OO5A 3TKQA 4KDXA 3DEXA 4MF7A 1EV9A 1TTZA 4ILFA 1E2YA 2F9SA 1N8JA 5KN2A 2O87A 4HQZA 2LRNA 4EO3A 2C3TA 3US3A 3HXSA 5IQYA 5IO0A 2MMAA 3UL3A 4TR1B 2ZUPA 1GSFA 2GLRA 4MLYA 5LCZA 5FWGA 3BCKA 5GAPD 1SYXA 4DSQA 4N10A 1GSEA 2K8SA 4MP4A 3TB2A 1SKRB 5LNKe 2B7KA 3I43A 2WB9A 3LEFA 1X5DA 5D96A 1EP8A 5DAKA 2YCDA 1BJXA 2IMKA 2H30A 1HNAA 2KUCA 1SU9A 1K0OA 2HLSA 2LNTA 4KA0A 4MZWA 2KLXA 1PD21 3GKMA 3GA4A 3CYNA 3IDVA 1X5EA 2GDRA 2YPMA 1XWCA 3CMIA 2DSAA 4MCUA 3GKKA 3F9UA 1M9BA 5B7CA 3ME8A 2OBIA 3N5OA 4MJEA 1I9DA 3F4TA 2R37A 4F2IA 3FKFA 1JFUA 2L6DA 3VPTA 4MJAA 14GSA 4RUVA 5G1LA 2O8VB 3F3QA 1YY7A 2GQLA 3E3EA 4KDYA 4EXJA 2GSTA 3N9JA 1SJIA 4OO4A 1GNWA 2NVLA 2X8HA 1OKTA 3HCZA 5D8IA 3LWAA 1AW9A 4HEA2 3TOTA 4L8EA 4AJ6A 3GKNA 2ON7A 2YP6A 3TKSC 5AIVA 1K0NA 3VWUA 1FVKA 4WKWA 4PUFC 1GSYA 1TI3A 4K7OA 4FH8A 2K9FA 5DDLA 1GTIA 5G2ZA 1XWGA 5A4UA 3J7Yb 2EIRA 4MF5A 2P0GA 1MDIA 4K0NA 1XWKA 3S9FA 2VL9A 5KN3A 5B6NA 1SL1B 1DUGA 2VL2A 3G9BA 3ISOA 1LU4A 1VF3A 4TXVA 1AXDA 5AISA 1A23A 4XS6A 2HSHA 1K0AA 2MBSA 1PL2A 4ZBBA 2PPTA 5J3RA 4TXOB 3LGCA 1ZZYA 2C3QA 1AQXA 1GSDA 3ZMLA 4N0ZA 1EOHA 1E6BA 1EEJA 4IP6A 3D6IA 2AHEA 5HFIA 5JWOB 1SD8A 1ZGNA 2Z9SA 4DSSB 2ZNMA 3MNGA 1QFNA 2DC5A 4N11A 2VD1A 2HSYA 4YQMA 3W8JA 4EC0A 2JSZA 1YDKA 2GVPA 2IWTA 2JL4A 2XBQA 4JU5A 4HOJA 2AV4A 2EC4A 2JZRA 2LKUA 2LRTA 4GSTA 2GT6A 2H73A 2LQOA 4MA9A 4WR4A 1TP9A 5INYA 5DQSA 1AUCA 3GNJA 3CXGA 3LXZA 4EE0A 2B6MA 19GSA 3A2VA 5IMDA 5ELGA 3VPQA 5G5FA 4Q5QA 1R5AA 4PURA 3V1WA 5ID2B 4K7IA 1BG5A 5JCWA 2RUEA 4IHUA 3KMNA 2QC7A 4OD7A 3CRTA 2H1GA 1XXUA 4BL7A 2X64A 5DCGA 3TKRA 3JCML
chains in the Genus database with same CATH superfamily
4MF6A 1DBYA 3A3TA 3A5WA 2OACA 1ZCPA 2UZ8A 1A2JA 1W4VA 2AAWA 4YQVA 4WF5A 1F9MA 5ECPB 4HSCX 3RHCA 2H66A 1A24A 5KOWA 17GSA 4OWYA 4A5PA 3P7XA 3ZITA 2H0GA 1G0TA 2IN3A 1TKDB 3DMLA 3EE2A 4WETA 5G1KA 3GH6A 1Y25A 1GTBA 2WS2A 4KAEA 3GV1A 18GSA 13GSA 4K2XA 1N2AA 1M2AA 5DJLA 2GQMA 1LBKA 1TK8B 2DJ1A 5DAKB 1UC7A 4YKFA 2GSQA 1O6JA 4K9ZA 5D9XA 1YJ6A 6GSXA 2WULA 1FHEA 5J9CA 2IMFA 5ABRA 1R4WA 2BTOT 2V1MA 1JHBA 1Z7RA 4I2UA 4EF0A 1FB6A 2GS3A 3RPPA 2R5GA 2K18A 4L5OA 3FR6A 3LQ7A 2M46A 3DGQA 1GWCA 2HZEA 2IFQB 3U5RE 4O7HA 3FY7A 4EVMA 4V2NA 1JZDA 2CT6A 5EVOA 3NOFA 3CRUA 4TR3A 4F0CA 1TK0B 5D73A 5HR1A 2QKEA 2OJLA 5ECHB 1M2BA 1TU7A 1XPVA 5KOXA 2FNOA 2GGTA 3EMXA 3A2XA 2FUG2 5F8BA 4XHMA 1VF2A 3HVVA 1F6MC 1TDIA 5ECNB 1OC8A 2X99A 3TJKA 4GTUA 4FYBA 5CRDA 1SK1A 4YQUA 4JZQA 4KH7A 2C8UA 3KTLA 2QA2A 2XC2A 1V2AA 3QOUA 4ZL8A 2LJRA 4DSRA 2R0PA 2LV3A 4MK3A 2V41A 1MD3A 5D93A 3TRXA 3I9V2 2HRKA 5J4UA 4AGSA 3PGTA 1PRXA 1GSSA 3DIEA 5IO2A 2H0IA 5GAND 2CZ2A 5CNWA 3IHQA 1MDKA 2AYTA 3D4MA 5GSTA 2L4QA 1U88A 3VI7A 3Q18A 4K5RA 2JZSA 2B3SA 2VO4A 4X0XA 1F3BA 4IVFA 1OE7A 1K0BA 1PX7A 2VD0A 2E2GA 3H79A 3OR5A 1EV4A 2GSRA 1VF1A 1PFOA 4BWSA 3TJBA 4NXIA 3UMAA 3U6VA 2DMLA 1AQWA 2VCQA 6GSTA 4DEJA 3QFAC 3Q74A 2VCVA 1M2DA 1QXHA 2B1KA 3P2AA 5JWRB 4F0BA 1RK4A 3DKSA 3FZ4A 3ZREA 1I5GA 2QA1A 1B8XA 4ZXGA 2KOKA 3L4NA 1KEBA 2JACA 4NAXA 2WRTA 3LSZA 4K8MA 3MWHA 2HI7A 5A4VA 2OKAA 3F4SA 3D0ZA 2I1UA 1NHOA 5A4WA 3P8WA 4PQHA 1PSQA 1THXA 5IOXA 2YV7A 3ZFLA 2CQ9A 3QFBC 2YWMA 3IPZA 2JZTA 3LYPA 1X9MB 1ILOA 3IXRA 5CREA 5GSSA 4MPFA 1SK2A 2JU5A 3HA9A 2HRAA 2YOIA 4D73A 3HVXA 1F3AA 1OYJA 4G0LA 1HD2A 2OE3A 5L71A 3PPUA 2F8AA 1PN0A 5IIZA 5F06A 4V1Ag 4LL1B 2FHEA 4ML6A 1ML6A 1XG8A 3VURA 1GUHA 1T8EB 4POMA 1T4YA 2C80A 4ZL7A 2J23A 5J9BA 4P3YB 3M9KA 4WEYA 2IMDA 5E59A 4J2FA 2VLTA 3IK9A 20GSA 3C1RA 2OBKA 3TKPA 3ZMKA 3SBCA 2GZPA 3TCOA 2L59A 4H86A 2JADA 2DJ3A 1XWAA 1CQHA 4YAVA 5IOWA 3KH9A 3IC4A 5IMZA 5BRTA 1EGOA 2H8LA 5FT3A 1IYIA 1B4QA 1K0DA 3ZYWA 2LJAA 2CVDA 1JZOA 3GSTA 1GLQA 2PWJA 4ZB9A 1TK5B 3UVHA 2J9HA 3ZLPA 3EU3A 2H1AA 3FMWA 2VM1A 1AIUA 3I6AA 1SJ6A 4POBA 5EPFA 6GSWA 3RDWA 3WGDA 3UAPA 2VCZA 4MMMA 3A5IA 5CO3A 4BVYB 1GP1A 2EIOA 3NZNA 4F9ZA 6GSSA 2VAFA 2E0QA 4J56E 3CTGA 4XS1A 1XW5A 3BD2A 2TRCP 2IMIA 2LEGA 1SENA 3G7YA 1WMJA 4G9HA 12GSA 4WF4A 5ECLB 1QQ2A 16GSA 2VUPA 5CRHA 3BOAA 2L57A 11GSA 5G5EA 4LLRA 1T7PB 1TJDA 1IYHA 2MMOA 2N5AA 2NTOA 4IQAA 3TUEA 2RLIA 3VWWA 4ZB6A 4NV5A 3KXOA 3PINA 1K0MA 1BX9A 3KH7A 1TXXA 1S3AA 2DKIA 3QPMA 5A5KA 3FR9A 3ME7A 2FGXA 4V1Ap 3UEMA 3RHBA 4XIHA 4O5RA 5B6MA 1O8XA 1ACVA 1V40A 5KN0A 3UJ1A 1OC9A 2WZ9A 1H4OA 4BWQA 3CSIA 3IV4A 1PKWA 3QMXA 2CAIA 2PBJA 3NIVA 5CRGA 3CQFA 1XIYA 4NV2A 3C7MA 5DALA 1K0CA 2O85A 1WJKA 1QMVA 1R7HA 1EOGA 2YWNA 2ON5A 4JRRA 3HZ8A 5EL8A 1O73A 3BCIA 4QQ7A 3HYPA 2H72A 3EMPA 3QD9A 1YEXA 1K3OA 3QAVA 3M1GA 4IW9A 3KP8A 2F51A 3RAZA 3VFIA 5ECIB 5IM9A 1QK8A 2XBIA 1WRYA 4PNGA 5ECRB 1C72A 5H5RA 3GX8A 2FA8A 1B48A 2WJUA 4PUAA 2IL3A 1PMTA 2ES7A 4RQXA 4MDCA 3O6TA 4IP1A 3FZAA 4QL9A 1PKZA 3GTUA 5IMFA 2H70A 1X9WB 3E0UA 3GL3A 4G0IA 3ED3A 1VRSD 3VK9A 3MDKA 3F8UA 1U87A 1QGVA 1ST9A 5HFKA 1GUMA 3TRQA 4BA7A 3IAS2 2HXKA 4ZBDA 1M0UA 1XZOA 4GQFA 3ZZXA 1YKAA 1SKWB 2AJQB 2P5RA 4XS4A 4MABA 5DBQA 1JLWA 3J7Yk 5F07A 2TRXA 4YH2A 3L78A 1X0RA 4CDOA 4I6XA 3APOA 2N5BA 2HRNA 4GCIA 3GN3A 5DJMA 1BYEA 1GSQA 1USBA 2XPEA 1ZOFA 1G6WA 5H5QA 1HNCA 1RW1A 4EL1A 4D73B 2I81A 2LNSA 4G10A 4KB3A 1VGLA 2V6KA 2XPDA 4WBJA 1ERWA 2OADA 4O92A 3DRNA 3LFLA 4L5LA 2MYGA 1OC3A 1TRVA 3VI5A 1A2LA 3WT1A 1UVZA 1M99A 3FZ5A 1ZYNA 2H6XA 2F3MA 3KGKA 4IS0A 2YANA 1NHYA 4XRDA 3ZRDA 3F63A 3I69A 3WD6A 2KHPA 3L9SA 1F2EA 5IMCA 8GSSA 4MH2A 2L5LA 2DBCA 2N5FA 1WPIA 6GSUA 1X5CA 3C8EA 5J5NA 1KBNA 4JE1A 1JZRA 1KTEA 3TJFA 3KMOA 2AUVA 2L5OA 4MZBA 4BPYA 3QDNA 4IN0A 5BMUA 3HVNA 2WGRA 4PXOA 4ID0A 3HKRA 1XOBA 3HD5A 4G19A 3W8SA 1NW2A 4ULXA 2FCHA 1WOUA 2I9HA 2O7KA 2H71A 2DIYA 3VWXA 3TJGA 4TR4A 5IPHA 2BJXA 1NM3A 2IJYA 3E9JB 3EYTA 4OCFA 2FWHA 1XVQA 4POKA 3LJRA 3GURA 1A2MA 5ELAA 2H1DA 3AY8A 2WCIA 3IK7A 2OE0A 3F4RA 2I4AA 6GSYA 1ZL9A 4GSNA 1MEKA 2ALBA 1Z5YE 4RI6A 1ERVA 1SL2B 2XHFA 3WYWA 1GULA 1R5PA 3LORA 3MYDA 4WBRD 1FAAA 1GUKA 4GF0A 4TKYA 3GSSA 2CX3A 4JR4A 5CAXA 1Q98A 2NPBA 4E8EA 4KCAA 1SJZA 4F82A 5IPGA 2C0FA 4KSOA 3HJMA 3EC3A 1GLPA 5ECSA 1OC9B 4Z2UA 4L0WA 2F8FA 2FLSA 3EWLA 3HHVA 2L4CA 5ECMB 4IKHA 4ECIA 1JLVA 2NDOA 9GSSA 1QUWA 5HQPA 1TU8A 4HJ2A 2CV4A 2R4VA 1B9YC 5CP1A 1R26A 3GH9A 3PR8A 4ECCA 4PX1A 2LRCA 1AAZA 4GQCA 1TRWA 2RM5A 4V2LA 4HU9A 3K8NA 5AIXA 6GSVA 4GLTA 2V2GA 4NHWA 4IJ3A 4OMVA 4EDYA 3KD0A 3F6FA 2YWOA 2VCXA 2R0GA 3EVIA 4WXTA 2DIZA 2HT9A 5DVBA 4HZ2A 3CSHA 3DXBA 1EP7A 2R3XA 2LTKA 4TN8A 2NBSA 4HQSA 4V2MA 1Y6EA 2DLXA 4K5SA 4Q5NA 1XWBA 1B9XC 2GZZA 1GSUA 3TJJA 5EY6A 1OAZA 4ACSA 5LD0A 3RBTA 2RUFA 3TOUA 2CVKA 2H1BA 4KSMA 4XS4B 1PQNA 1WP0A 4ICYA 4N0VA 3WT2A 4EIQA 2E7PA 5GZZB 1YKCA 4NPBA 2H01A 2H0HA 2MMNA 4J57E 3MAKA 2X8CA 4Z2RA 3G7JA 2DJ2A 2HZFA 3D5JA 5AN1A 1K3YA 1OE8A 3HJPA 5B8BA 4TVEA 1OVNA 1DSBA 1XOAA 1XVWA 3L9UA 5ENUA 4MPGA 4HUAA 4BVXA 2JSYA 2QSIA 4G0KA 3W6GA 4PQ1A 1FOVA 3Q6OA 3TKSE 4G2EA 3BJ5A 5D9TA 4BL7B 4X4JA 4LL4B 2C4JA 1B4PA 1O85A 2B1LA 2FA4A 3FK8A 4ZL9A 2FD3A 3C1SA 3IRAA 3O3TA 2FWGA 5IMVA 1EZKA 2YJHA 4DVCA 4ZIJA 3M3MA 2YV9A 5CRWA 1ZMAA 4MJBA 1T00A 4EIPA 3MIXA 3MSZA 2C0GA 4QL7A 2H6YA 2A4VA 2P31A 4YAPA 3M8NA 4Q5FA 1S3RA 4WR5A 1O81A 3KIJA 1TRUA 3GL5A 2KP2A 4I8BA 4HZ4A 3UARA 2WDUA 3EURA 1XBSA 5B8AA 3GFKA 1U3AA 1WIKA 1ON4A 2GT5A 2HRFA 1G7OA 5CYYA 3D21A 2C1YA 1CQGA 3GX0A 4ZILA 2PERA 4K7NA 2YZHA 4CHSA 1URMA 1O7UA 2YNXA 1TI1A 1PN9A 3ERWA 4PQIA 2R2JA 2HZEB 5E4WA 1PA3A 2C0DA 2PMTA 1BEDA 2VCWA 1FW1A 5JWQB 3ZIVA 1TW9A 3HVSA 2OE1A 1T3BA 1TOFA 4FYCA 2A4HA 3KM6A 4KGIA 2I3YA 1OKDA 2IFQA 3H4KA 1V58A 1F37A 3TKSA 4POLA 3ERFA 2BMXA 2G0FA 2HNLA 4RQRA 1A0RP 3APSA 5DQYA 2AB6A 1THOA 1FO5A 2CAQA 1EWXA 3EINA 2LS5A 1PX6A 4PTSA 3DD3A 4O32A 2HSMA 2YJ7A 1T4ZA 2PU9C 2H19A 1A0FA 1HNBA 1O8WA 3CSJA 2VL3A 3L0HA 1SYRA 3GYKA 4PNFA 1X9SB 4JR6A 1ZYQB 1W89A 3HY2A 4NHZA 3ZFBA 2IMEA 4E8HA 3GHAA 1V9WA 1LJRA 4KNDA 2G2QA 3L9VA 1HQOA 1TRSA 3FR3A 4Z7XA 3LG6A 1GRXA 1U6TA 2A2SA 4TOPA 3H1NA 5G30A 4KCEA 4NWYA 2CA8A 4MJCA 1M9AA 1MTCA 1MD4A 4KE3A 2V32A 4JEDA 2MZCA 1FOHA 2DJ0A 3F6DA 4K2DA 2B5XA 1U3IA 4Q5RA 3FYGA 5D9VA 2HYXA 2VL2C 5HR2A 3FEUA 4EUYA 2TIRA 5F0GA 5D9WA 4XRAA 1A8YA 1AQVA 1EGRA 4OFTA 2CX4A 3BBYA 3VWVA 3Q19A 1ABAA 3KCMA 5KN1A 1BQ7A 4RI7A 1GTUA 2V6OA 3LXTA 3UBLA 3SWLA 3H8QA 3D4TA 3A2WA 3ERGA 1UA5A 2YWIA 1GH2A 3DVXA 2FWFA 2PGTA 1S3CA 1VF4A 5C04A 2HE3A 3KTBA 22GSA 1FG4A 4IELA 1Z6MA 3RPNA 4IJIA 1HYUA 4I5QA 5KEJA 2CZ3A 4ECBA 2YZUA 5F05A 4N30A 2L6CA 4K0GA 5IMAA 4I97A 2REMA 5JCUA 3ZIJA 1ERUA 4HJMA 3IAM2 2RIIA 4CW9A 2GSSA 3M0FA 3DYRA 2B5EA 4FO5A 5ECOB 2X8GA 2GTUA 2VM2A 3GMFA 3VLNA 3D22A 2GZYA 1G7EA 4CY6A 2M80A 4LA1A 3HJOA 2HFDA 1UN2A 2DJKA 3CTFA 3EPTA 4OCEA 5DCHA 3GRXA 2ZCTA 4TR0A 4TR1A 4FQUA 5ECQB 2H75A 5C00A 3UIWA 1SD9A 2H76A 1YEPA 3GIXA 4XTSA 3KEBA 4I2TA 3P90A 5G31A 4GRFA 4IQ1A 4IGJA 4HI7A 1KNGA 2X4AA 4OFNA 3TRPA 4GXZA 4Z2TA 3IE3A 2PVQA 5J41A 3FZ9A 4OFMA 2PN8A 1SK0A 4BVYA 1K3LA 1V57A 10GSA 2M72A 4HU7A 1Z9HA 1BAYA 3UVTA 3EU4A 3H93A 4ML1A 1V98A 3UBKA 4ZBAA 2QGVA 3TGZA 2DKHA 5JCGA 1WWJA 4MH3A 2DJJA 4MZCA 1GNEA 3GKXA 1MDJA 2D2ZA 3G7IA 4X43A 4IBPA 1G6YA 2OA7A 2WFCA 7GSSA 2C3NA 3LYKA 2K8VA 3IOSA 3FW2A 1FB0A 2DMMA 4KX4A 4YKGA 1J9BA 5H5SA 3WGXA 2FWEA 3O76A 3QAWA 3TDGA 3IBHA 4GWRA 2O89A 2H6ZA 2MMZA 4AJ7A 1J0FA 1AC1A 2FY6A 4TRXA 4KDUA 1Q4JA 1YF0A 5DALB 2LQQA 3F0IA 2VLUA 1T1VA 4ISDA 5FHIA 3ZVJA 1H75A 1RQMA 2IIYA 1S3DA 1Z6NA 2E2MA 2VIMA 3QAGA 1XW9A 2GQKA 2VOCA 3GUSA 3ZVJD 4NMUA 1Z3EA 2K6VA 4AF2A 3ZTLA 1FVJA 3CBUA 1A8LA 2CVBA 3IR4A 2IPAA 4LMWA 2VLVA 4X1UA 2LUSA 3KJYA 1PL1A 2B7JA 1GL8A 2R6KA 1EEMA 2LSTA 4KW6A 3GTUB 4PGTA 2YN1A 3C71A 5AGYA 4F03A 1XW6A 2EIQA 3ZL5A 2A2RA 3APQA 5ECKB 3DWVA 4TXOA 4KUNA 4FYUA 1XCCA 2P5QA 4EKZA 5COHA 3FRCA 4ECJA 5HFGA 1WE0A 2B5YA 4K1FA 4FIWA 2PVOC 2PUKC 4AJ8A 4LMVA 1J08A 1GTAA 1M3IA 5HR0A 4DSSA 3M9JA 2MBTA 4GSSA 2C0EA 4CY8A 2H74A 4XCSA 5HR3A 1NSWA 3IA1A 4K6XA 2X49A 4EDZA 3C73A 2KP1A 3QR6A 3F3RA 1YF1A 3R2QA 3PH9A 4L0UA 1XFLA 3IHGA 1DE2A 3HZ4A 3UOMA 4HDEA 2VCTA 1SKSB 1YQ1A 3DVWA 1Z7PA 3KP9A 1ERTA 1YZXA 2LJKA 3R3EA 3WGEA 4JBBA 1SL0B 4TW5A 4HS1A 3FHKA 3HDCA 5ID2A 3KZQA 1ZYEA 2RM6A 4ZB8A 1M7TA 1PGTA 3QCPA 1DE1A 1JZWA 4OO5A 3TKQA 4KDXA 3DEXA 4MF7A 1EV9A 1TTZA 4ILFA 1E2YA 2F9SA 1N8JA 5KN2A 1ZYPA 2O87A 4HQZA 2LRNA 4EO3A 2C3TA 3US3A 3HXSA 4O5QA 5IQYA 5IO0A 2MMAA 3UL3A 4TR1B 2ZUPA 1GSFA 2GLRA 4MLYA 5LCZA 5FWGA 3BCKA 5GAPD 1SYXA 4DSQA 4N10A 1GSEA 2K8SA 4MP4A 3TB2A 1SKRB 5LNKe 2B7KA 3I43A 2WB9A 3LEFA 1X5DA 5D96A 1EP8A 5DAKA 2YCDA 1BJXA 2IMKA 2H30A 1HNAA 2KUCA 1SU9A 1K0OA 2HLSA 2LNTA 4KA0A 4MZWA 2KLXA 3LW9A 1PD21 3GKMA 3GA4A 3CYNA 3IDVA 1X5EA 2GDRA 2YPMA 1XWCA 3CMIA 2DSAA 4MCUA 3GKKA 3F9UA 1M9BA 5B7CA 3ME8A 2OBIA 3N5OA 4MJEA 1I9DA 3F4TA 2R37A 4F2IA 3FKFA 1JFUA 2L6DA 3VPTA 4MJAA 14GSA 4RUVA 5G1LA 2O8VB 3F3QA 1YY7A 2GQLA 3E3EA 4KDYA 4EXJA 2GSTA 3N9JA 1SJIA 4OO4A 1GNWA 2NVLA 2X8HA 1OKTA 3HCZA 5D8IA 3LWAA 1AW9A 4HEA2 3TOTA 4L8EA 4AJ6A 3GKNA 2ON7A 2YP6A 3TKSC 5AIVA 1K0NA 3VWUA 1FVKA 4WKWA 4PUFC 1GSYA 1TI3A 4K7OA 4O5UA 4FH8A 2K9FA 5DDLA 1GTIA 5G2ZA 1XWGA 5A4UA 3J7Yb 2EIRA 4MF5A 2P0GA 1MDIA 4K0NA 4BIKA 1XWKA 3S9FA 2VL9A 5KN3A 5B6NA 1SL1B 1DUGA 2VL2A 3G9BA 3ISOA 1LU4A 1VF3A 4TXVA 1AXDA 5AISA 1A23A 4XS6A 2HSHA 1K0AA 2MBSA 1PL2A 4ZBBA 2PPTA 3IC8A 4KF9A 4TXOB 5J3RA 3LGCA 1ZZYA 2C3QA 1AQXA 1GSDA 3ZMLA 4USSA 4N0ZA 1EOHA 1E6BA 1EEJA 4IP6A 3D6IA 2AHEA 5HFIA 5JWOB 1SD8A 1ZGNA 2Z9SA 4DSSB 4MNNA 2ZNMA 3MNGA 1QFNA 2DC5A 4N11A 2VD1A 2HSYA 4YQMA 3W8JA 4EC0A 2JSZA 1YDKA 2GVPA 2IWTA 2JL4A 2XBQA 4JU5A 4HOJA 2AV4A 2EC4A 2JZRA 2LKUA 2LRTA 4GSTA 2GT6A 2H73A 2LQOA 4MA9A 4WR4A 4BVXB 1TP9A 5INYA 5DQSA 1AUCA 3GNJA 3CXGA 3LXZA 4EE0A 2B6MA 19GSA 3A2VA 5IMDA 5ELGA 3VPQA 5G5FA 4Q5QA 2A2PA 1R5AA 4PURA 3V1WA 5ID2B 4K7IA 1BG5A 5JCWA 2RUEA 4IHUA 3KMNA 2QC7A 4OD7A 3CRTA 2H1GA 2R0CA 1XXUA 4BL7A 2X64A 5DCGA 3TKRA 1M3JA 3JCML
chains in the Genus database with same CATH topology
4MF6A 1DBYA 3A3TA 3A5WA 2OACA 1ZCPA 2UZ8A 1A2JA 1W4VA 2AAWA 4YQVA 4WF5A 1F9MA 5ECPB 3RHCA 2H66A 1A24A 5KOWA 17GSA 4OWYA 4A5PA 3P7XA 3ZITA 2H0GA 1G0TA 2IN3A 1TKDB 3DMLA 3EE2A 4WETA 5G1KA 3GH6A 1Y25A 1GTBA 2WS2A 4KAEA 3GV1A 18GSA 13GSA 4K2XA 1N2AA 1M2AA 5DJLA 2GQMA 1LBKA 1TK8B 2DJ1A 5DAKB 1UC7A 4YKFA 2GSQA 1O6JA 4K9ZA 5D9XA 1YJ6A 6GSXA 2WULA 1FHEA 5J9CA 2IMFA 5ABRA 1R4WA 2BTOT 2V1MA 1JHBA 1Z7RA 4I2UA 4EF0A 1FB6A 2GS3A 3RPPA 2R5GA 2K18A 4L5OA 3FR6A 3LQ7A 2M46A 3DGQA 1GWCA 2HZEA 2IFQB 3U5RE 4O7HA 3FY7A 4EVMA 4V2NA 1JZDA 2CT6A 5EVOA 3NOFA 3CRUA 4TR3A 4F0CA 1TK0B 5D73A 5HR1A 2QKEA 2OJLA 5ECHB 1M2BA 1TU7A 1XPVA 5KOXA 2FNOA 2GGTA 3EMXA 3A2XA 2FUG2 5F8BA 4XHMA 1VF2A 3HVVA 1F6MC 1TDIA 5ECNB 1OC8A 2X99A 3TJKA 4GTUA 4FYBA 5CRDA 1SK1A 4YQUA 4JZQA 4KH7A 2C8UA 3KTLA 2QA2A 2XC2A 1V2AA 3QOUA 4ZL8A 2LJRA 4DSRA 2R0PA 2LV3A 4MK3A 2V41A 1MD3A 5D93A 3TRXA 3I9V2 2HRKA 5J4UA 4AGSA 3PGTA 1PRXA 1GSSA 3DIEA 5IO2A 2H0IA 5GAND 2CZ2A 5CNWA 3IHQA 1MDKA 2AYTA 3D4MA 5GSTA 2L4QA 1U88A 3VI7A 3Q18A 4K5RA 2JZSA 2B3SA 2VO4A 4X0XA 1F3BA 4IVFA 1OE7A 1K0BA 1PX7A 2VD0A 2E2GA 3H79A 3OR5A 1EV4A 2GSRA 1VF1A 4BWSA 3TJBA 4NXIA 3UMAA 3U6VA 2DMLA 1AQWA 2VCQA 6GSTA 4DEJA 3QFAC 3Q74A 2VCVA 1M2DA 1QXHA 2B1KA 3P2AA 5JWRB 4F0BA 1RK4A 3DKSA 3FZ4A 3ZREA 1I5GA 2QA1A 1B8XA 4ZXGA 2KOKA 3L4NA 1KEBA 2JACA 4NAXA 2WRTA 3LSZA 4K8MA 3MWHA 2HI7A 5A4VA 2OKAA 3F4SA 3D0ZA 2I1UA 1NHOA 5A4WA 3P8WA 4PQHA 1PSQA 1THXA 5IOXA 2YV7A 3ZFLA 2CQ9A 3QFBC 2YWMA 3IPZA 2JZTA 3LYPA 1X9MB 1ILOA 3IXRA 5CREA 5GSSA 4MPFA 1SK2A 2JU5A 3HA9A 2HRAA 2YOIA 4D73A 3HVXA 1F3AA 1OYJA 4G0LA 1HD2A 2OE3A 5L71A 3PPUA 2F8AA 1PN0A 5IIZA 5F06A 4V1Ag 4LL1B 2FHEA 4ML6A 1ML6A 3VURA 1GUHA 1T8EB 4POMA 1T4YA 2C80A 4ZL7A 2J23A 5J9BA 4P3YB 3M9KA 4WEYA 2IMDA 5E59A 4J2FA 2VLTA 3IK9A 20GSA 3C1RA 2OBKA 3TKPA 3ZMKA 3SBCA 2GZPA 3TCOA 2L59A 4H86A 2JADA 2DJ3A 1XWAA 1CQHA 4YAVA 5IOWA 3KH9A 3IC4A 5IMZA 5BRTA 1EGOA 2H8LA 5FT3A 1IYIA 1B4QA 1K0DA 3ZYWA 2LJAA 2CVDA 1JZOA 3GSTA 1GLQA 2PWJA 4ZB9A 1TK5B 3UVHA 2J9HA 3ZLPA 3EU3A 2H1AA 3FMWA 2VM1A 1AIUA 3I6AA 1SJ6A 4POBA 5EPFA 6GSWA 3RDWA 3WGDA 3UAPA 2VCZA 4MMMA 3A5IA 5CO3A 4BVYB 1GP1A 2EIOA 3NZNA 4F9ZA 6GSSA 2VAFA 2E0QA 4J56E 3CTGA 4XS1A 1XW5A 3BD2A 2TRCP 2IMIA 2LEGA 1SENA 3G7YA 1WMJA 4G9HA 12GSA 4WF4A 5ECLB 1QQ2A 16GSA 2VUPA 5CRHA 3BOAA 2L57A 11GSA 5G5EA 4LLRA 1T7PB 1TJDA 1IYHA 2MMOA 2N5AA 2NTOA 4IQAA 3TUEA 2RLIA 3VWWA 4ZB6A 4NV5A 3KXOA 3PINA 1K0MA 1BX9A 3KH7A 1TXXA 1S3AA 2DKIA 3QPMA 5A5KA 3FR9A 3ME7A 2FGXA 4V1Ap 3UEMA 3RHBA 4XIHA 4O5RA 5B6MA 1O8XA 1ACVA 1V40A 5KN0A 3UJ1A 1OC9A 2WZ9A 1H4OA 4BWQA 3CSIA 3IV4A 1PKWA 3QMXA 2CAIA 2PBJA 3NIVA 5CRGA 1XIYA 4NV2A 3C7MA 5DALA 1K0CA 2O85A 1WJKA 1QMVA 1R7HA 1EOGA 2YWNA 2ON5A 4JRRA 3HZ8A 5EL8A 1O73A 3BCIA 4QQ7A 3HYPA 2H72A 3EMPA 3QD9A 1YEXA 1K3OA 3QAVA 3M1GA 4IW9A 3KP8A 2F51A 3RAZA 3VFIA 5ECIB 5IM9A 1QK8A 2XBIA 1WRYA 4PNGA 5ECRB 1C72A 5H5RA 3GX8A 2FA8A 1B48A 2WJUA 4PUAA 2IL3A 1PMTA 2ES7A 4RQXA 4MDCA 3O6TA 4IP1A 3FZAA 4QL9A 1PKZA 3GTUA 5IMFA 2H70A 1X9WB 3E0UA 3GL3A 4G0IA 3ED3A 1VRSD 3VK9A 3MDKA 3F8UA 1U87A 1QGVA 1ST9A 5HFKA 1GUMA 3TRQA 4BA7A 3IAS2 2HXKA 4ZBDA 1M0UA 1XZOA 4GQFA 3ZZXA 1YKAA 1SKWB 2AJQB 2P5RA 4XS4A 4MABA 5DBQA 1JLWA 3J7Yk 5F07A 2TRXA 4YH2A 3L78A 1X0RA 4CDOA 4I6XA 3APOA 2N5BA 2HRNA 4GCIA 3GN3A 5DJMA 1BYEA 1GSQA 1USBA 2XPEA 1ZOFA 1G6WA 5H5QA 1HNCA 1RW1A 4EL1A 4D73B 2I81A 2LNSA 4G10A 4KB3A 1VGLA 2V6KA 2XPDA 4WBJA 1ERWA 2OADA 4O92A 3DRNA 3LFLA 4L5LA 2MYGA 1OC3A 1TRVA 3VI5A 1A2LA 3WT1A 1UVZA 1M99A 3FZ5A 1ZYNA 2H6XA 2F3MA 3KGKA 4IS0A 2YANA 1NHYA 4XRDA 3ZRDA 3F63A 3I69A 3WD6A 2KHPA 3L9SA 1F2EA 5IMCA 8GSSA 4MH2A 2L5LA 2DBCA 2N5FA 1WPIA 6GSUA 1X5CA 3C8EA 5J5NA 1KBNA 4JE1A 1JZRA 1KTEA 3TJFA 3KMOA 2AUVA 2L5OA 4MZBA 4BPYA 3QDNA 4IN0A 5BMUA 2WGRA 4PXOA 4ID0A 3HKRA 1XOBA 3HD5A 4G19A 3W8SA 1NW2A 4ULXA 2FCHA 1WOUA 2I9HA 2O7KA 2H71A 2DIYA 3VWXA 3TJGA 4TR4A 5IPHA 2BJXA 1NM3A 2IJYA 3E9JB 3EYTA 4OCFA 2FWHA 1XVQA 4POKA 3LJRA 3GURA 1A2MA 5ELAA 2H1DA 3AY8A 2WCIA 3IK7A 2OE0A 3F4RA 2I4AA 6GSYA 1ZL9A 4GSNA 1MEKA 2ALBA 1Z5YE 4RI6A 1ERVA 1SL2B 2XHFA 3WYWA 1GULA 1R5PA 3LORA 3MYDA 4WBRD 1FAAA 1GUKA 4GF0A 4TKYA 3GSSA 2CX3A 4JR4A 5CAXA 1Q98A 2NPBA 4E8EA 4KCAA 1SJZA 4F82A 5IPGA 2C0FA 4KSOA 3HJMA 3EC3A 1GLPA 5ECSA 1OC9B 4Z2UA 4L0WA 2F8FA 2FLSA 3EWLA 3HHVA 2L4CA 5ECMB 4IKHA 4ECIA 1JLVA 2NDOA 9GSSA 1QUWA 5HQPA 1TU8A 4HJ2A 2CV4A 2R4VA 1B9YC 5CP1A 1R26A 3GH9A 3PR8A 4ECCA 4PX1A 2LRCA 1AAZA 4GQCA 1TRWA 2RM5A 4V2LA 4HU9A 3K8NA 5AIXA 6GSVA 4GLTA 2V2GA 4NHWA 4IJ3A 4OMVA 4EDYA 3KD0A 3F6FA 2YWOA 2VCXA 2R0GA 3EVIA 4WXTA 2DIZA 2HT9A 5DVBA 4HZ2A 3CSHA 3DXBA 1EP7A 2R3XA 2LTKA 4TN8A 2NBSA 4HQSA 4V2MA 1Y6EA 2DLXA 4K5SA 4Q5NA 1XWBA 1B9XC 2GZZA 1GSUA 3TJJA 5EY6A 1OAZA 4ACSA 5LD0A 3RBTA 2RUFA 3TOUA 2CVKA 2H1BA 4KSMA 4XS4B 1PQNA 1WP0A 4ICYA 4N0VA 3WT2A 4EIQA 2E7PA 5GZZB 1YKCA 4NPBA 2H01A 2H0HA 2MMNA 4J57E 3MAKA 2X8CA 4Z2RA 3G7JA 2DJ2A 2HZFA 3D5JA 5AN1A 1K3YA 1OE8A 3HJPA 5B8BA 4TVEA 1OVNA 1DSBA 1XOAA 1XVWA 3L9UA 5ENUA 4MPGA 4HUAA 4BVXA 2JSYA 2QSIA 4G0KA 3W6GA 4PQ1A 1FOVA 3Q6OA 3TKSE 4G2EA 3BJ5A 5D9TA 4BL7B 4X4JA 4LL4B 2C4JA 1B4PA 1O85A 2B1LA 2FA4A 3FK8A 4ZL9A 2FD3A 3C1SA 3IRAA 3O3TA 2FWGA 5IMVA 1EZKA 2YJHA 4DVCA 4ZIJA 3M3MA 2YV9A 5CRWA 1ZMAA 4MJBA 1T00A 4EIPA 3MIXA 3MSZA 2C0GA 4QL7A 2H6YA 2A4VA 2P31A 4YAPA 3M8NA 4Q5FA 4WR5A 1O81A 3KIJA 1TRUA 3GL5A 2KP2A 4I8BA 4HZ4A 3UARA 2WDUA 3EURA 1XBSA 5B8AA 3GFKA 1U3AA 1WIKA 1ON4A 2GT5A 2HRFA 1G7OA 5CYYA 3D21A 2C1YA 1CQGA 3GX0A 4ZILA 2PERA 4K7NA 2YZHA 4CHSA 1URMA 1O7UA 2YNXA 1TI1A 1PN9A 3ERWA 4PQIA 2R2JA 2HZEB 5E4WA 1PA3A 2C0DA 2PMTA 1BEDA 2VCWA 1FW1A 5JWQB 3ZIVA 1TW9A 3HVSA 2OE1A 1T3BA 1TOFA 4FYCA 2A4HA 3KM6A 4KGIA 2I3YA 1OKDA 2IFQA 3H4KA 1V58A 1F37A 3TKSA 4POLA 3ERFA 2BMXA 2G0FA 2HNLA 4RQRA 1A0RP 3APSA 5DQYA 2AB6A 1THOA 1FO5A 2CAQA 1EWXA 3EINA 2LS5A 1PX6A 4PTSA 3DD3A 4O32A 2HSMA 2YJ7A 1T4ZA 2PU9C 2H19A 1A0FA 1HNBA 1O8WA 3CSJA 2VL3A 3L0HA 1SYRA 3GYKA 4PNFA 1X9SB 4JR6A 1ZYQB 1W89A 3HY2A 4NHZA 3ZFBA 2IMEA 4E8HA 3GHAA 1V9WA 1LJRA 4KNDA 2G2QA 3L9VA 1HQOA 1TRSA 3FR3A 4Z7XA 3LG6A 1GRXA 1U6TA 2A2SA 4TOPA 3H1NA 5G30A 4KCEA 4NWYA 2CA8A 4MJCA 1M9AA 1MTCA 1MD4A 4KE3A 2V32A 4JEDA 2MZCA 1FOHA 2DJ0A 3F6DA 4K2DA 2B5XA 1U3IA 4Q5RA 3FYGA 5D9VA 2HYXA 2VL2C 5HR2A 3FEUA 4EUYA 2TIRA 5F0GA 5D9WA 4XRAA 1A8YA 1AQVA 1EGRA 4OFTA 2CX4A 3BBYA 3VWVA 3Q19A 1ABAA 3KCMA 5KN1A 1BQ7A 4RI7A 1GTUA 2V6OA 3LXTA 3UBLA 3SWLA 3H8QA 3D4TA 3A2WA 3ERGA 1UA5A 2YWIA 1GH2A 3DVXA 2FWFA 2PGTA 1S3CA 1VF4A 5C04A 2HE3A 3KTBA 22GSA 1FG4A 4IELA 1Z6MA 3RPNA 4IJIA 1HYUA 4I5QA 5KEJA 2CZ3A 4ECBA 2YZUA 5F05A 4N30A 2L6CA 4K0GA 5IMAA 4I97A 2REMA 5JCUA 3ZIJA 1ERUA 4HJMA 3IAM2 2RIIA 4CW9A 2GSSA 3M0FA 3DYRA 2B5EA 4FO5A 5ECOB 2X8GA 2GTUA 2VM2A 3GMFA 3VLNA 3D22A 2GZYA 1G7EA 4CY6A 2M80A 4LA1A 3HJOA 2HFDA 1UN2A 2DJKA 3CTFA 3EPTA 4OCEA 5DCHA 3GRXA 2ZCTA 4TR0A 4TR1A 4FQUA 5ECQB 2H75A 5C00A 3UIWA 1SD9A 2H76A 1YEPA 3GIXA 4XTSA 3KEBA 4I2TA 3P90A 5G31A 4GRFA 4IQ1A 4IGJA 4HI7A 1KNGA 2X4AA 4OFNA 3TRPA 4GXZA 4Z2TA 3IE3A 2PVQA 5J41A 3FZ9A 4OFMA 2PN8A 1SK0A 4BVYA 1K3LA 1V57A 10GSA 2M72A 4HU7A 1Z9HA 1BAYA 3UVTA 3EU4A 3H93A 4ML1A 1V98A 3UBKA 4ZBAA 2QGVA 3TGZA 2DKHA 5JCGA 1WWJA 4MH3A 2DJJA 4MZCA 1GNEA 3GKXA 1MDJA 2D2ZA 3G7IA 4X43A 4IBPA 1G6YA 2OA7A 2WFCA 7GSSA 2C3NA 3LYKA 2K8VA 3IOSA 3FW2A 1FB0A 2DMMA 4KX4A 4YKGA 1J9BA 5H5SA 3WGXA 2FWEA 3O76A 3QAWA 3TDGA 3IBHA 4GWRA 2O89A 2H6ZA 2MMZA 4AJ7A 1J0FA 1AC1A 2FY6A 4TRXA 4KDUA 1Q4JA 1YF0A 5DALB 2LQQA 3F0IA 2VLUA 1T1VA 4ISDA 5FHIA 3ZVJA 1H75A 1RQMA 2IIYA 1S3DA 1Z6NA 2E2MA 2VIMA 3QAGA 1XW9A 2GQKA 2VOCA 3GUSA 3ZVJD 4NMUA 1Z3EA 2K6VA 4AF2A 3ZTLA 1FVJA 3CBUA 1A8LA 2CVBA 3IR4A 2IPAA 4LMWA 2VLVA 4X1UA 2LUSA 3KJYA 1PL1A 2B7JA 1GL8A 2R6KA 1EEMA 2LSTA 4KW6A 3GTUB 4PGTA 2YN1A 3C71A 5AGYA 4F03A 1XW6A 2EIQA 3ZL5A 2A2RA 3APQA 5ECKB 3DWVA 4TXOA 4KUNA 4FYUA 1XCCA 2P5QA 4EKZA 5COHA 3FRCA 4ECJA 5HFGA 1WE0A 2B5YA 4K1FA 4FIWA 2PVOC 2PUKC 4AJ8A 4LMVA 1J08A 1GTAA 5HR0A 4DSSA 3M9JA 2MBTA 4GSSA 2C0EA 4CY8A 2H74A 4XCSA 5HR3A 1NSWA 3IA1A 4K6XA 2X49A 4EDZA 3C73A 2KP1A 3QR6A 3F3RA 1YF1A 3R2QA 3PH9A 4L0UA 1XFLA 3IHGA 1DE2A 3HZ4A 3UOMA 4HDEA 2VCTA 1SKSB 1YQ1A 3DVWA 1Z7PA 3KP9A 1ERTA 1YZXA 2LJKA 3R3EA 3WGEA 4JBBA 1SL0B 4TW5A 4HS1A 3FHKA 3HDCA 5ID2A 3KZQA 1ZYEA 2RM6A 4ZB8A 1M7TA 1PGTA 3QCPA 1DE1A 1JZWA 4OO5A 3TKQA 4KDXA 3DEXA 4MF7A 1EV9A 1TTZA 4ILFA 1E2YA 2F9SA 1N8JA 5KN2A 1ZYPA 2O87A 4HQZA 2LRNA 4EO3A 2C3TA 3US3A 3HXSA 4O5QA 5IQYA 5IO0A 2MMAA 3UL3A 4TR1B 2ZUPA 1GSFA 2GLRA 4MLYA 5LCZA 5FWGA 3BCKA 5GAPD 1SYXA 4DSQA 4N10A 1GSEA 2K8SA 4MP4A 3TB2A 1SKRB 5LNKe 2B7KA 3I43A 2WB9A 3LEFA 1X5DA 5D96A 1EP8A 5DAKA 2YCDA 1BJXA 2IMKA 2H30A 1HNAA 2KUCA 1SU9A 1K0OA 2HLSA 2LNTA 4KA0A 4MZWA 2KLXA 3LW9A 1PD21 3GKMA 3GA4A 3CYNA 3IDVA 1X5EA 2GDRA 2YPMA 1XWCA 3CMIA 2DSAA 4MCUA 3GKKA 3F9UA 1M9BA 5B7CA 3ME8A 2OBIA 3N5OA 4MJEA 1I9DA 3F4TA 2R37A 4F2IA 3FKFA 1JFUA 2L6DA 3VPTA 4MJAA 14GSA 4RUVA 5G1LA 2O8VB 3F3QA 1YY7A 2GQLA 3E3EA 4KDYA 4EXJA 2GSTA 3N9JA 1SJIA 4OO4A 1GNWA 2NVLA 2X8HA 1OKTA 3HCZA 5D8IA 3LWAA 1AW9A 4HEA2 3TOTA 4L8EA 4AJ6A 3GKNA 2ON7A 2YP6A 3TKSC 5AIVA 1K0NA 3VWUA 1FVKA 4WKWA 4PUFC 1GSYA 1TI3A 4K7OA 4O5UA 4FH8A 2K9FA 5DDLA 1GTIA 5G2ZA 1XWGA 5A4UA 3J7Yb 2EIRA 4MF5A 2P0GA 1MDIA 4K0NA 1XWKA 3S9FA 2VL9A 5KN3A 5B6NA 1SL1B 1DUGA 2VL2A 3G9BA 3ISOA 1LU4A 1VF3A 4TXVA 1AXDA 5AISA 1A23A 4XS6A 2HSHA 1K0AA 2MBSA 1PL2A 4ZBBA 2PPTA 3IC8A 4KF9A 4TXOB 5J3RA 3LGCA 1ZZYA 2C3QA 1AQXA 1GSDA 3ZMLA 4USSA 4N0ZA 1EOHA 1E6BA 1EEJA 4IP6A 3D6IA 2AHEA 5HFIA 5JWOB 1SD8A 1ZGNA 2Z9SA 4DSSB 4MNNA 2ZNMA 3MNGA 1QFNA 2DC5A 4N11A 2VD1A 2HSYA 4YQMA 3W8JA 4EC0A 2JSZA 1YDKA 2GVPA 2IWTA 2JL4A 2XBQA 4JU5A 4HOJA 2AV4A 2EC4A 2JZRA 2LKUA 2LRTA 4GSTA 2GT6A 2H73A 2LQOA 4MA9A 4WR4A 4BVXB 1TP9A 5INYA 5DQSA 1AUCA 3GNJA 3CXGA 3LXZA 4EE0A 2B6MA 19GSA 3A2VA 5IMDA 5ELGA 3VPQA 5G5FA 4Q5QA 2A2PA 1R5AA 4PURA 3V1WA 5ID2B 4K7IA 1BG5A 5JCWA 2RUEA 4IHUA 3KMNA 2QC7A 4OD7A 3CRTA 2H1GA 2R0CA 1XXUA 4BL7A 2X64A 5DCGA 3TKRA 3JCML
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MF6 A;  1DBY A;  3A3T A;  3A5W A;  2OAC A;  1ZCP A;  1A2J A;  1W4V A;  2AAW A;  4YQV A;  4WF5 A;  1F9M A;  5ECP B;  3RHC A;  2H66 A;  1A24 A;  17GS A;  4OWY A;  3P7X A;  3ZIT A;  2H0G A;  1G0T A;  2IN3 A;  1TKD B;  3DML A;  3EE2 A;  4WET A;  5G1K A;  3GH6 A;  1Y25 A;  1GTB A;  2WS2 A;  4KAE A;  3GV1 A;  18GS A;  13GS A;  1N2A A;  1M2A A;  5DJL A;  2GQM A;  1LBK A;  1TK8 B;  2DJ1 A;  5DAK B;  1UC7 A;  2GSQ A;  1O6J A;  4K9Z A;  5D9X A;  1YJ6 A;  6GSX A;  2WUL A;  1FHE A;  5J9C A;  2IMF A;  5ABR A;  1R4W A;  2BTO T;  2V1M A;  1JHB A;  1Z7R A;  4I2U A;  4EF0 A;  1FB6 A;  2GS3 A;  3RPP A;  2R5G A;  2K18 A;  4L5O A;  3FR6 A;  3LQ7 A;  2M46 A;  3DGQ A;  1GWC A;  2HZE A;  2IFQ B;  3U5R E;  4O7H A;  3FY7 A;  4EVM A;  4V2N A;  1JZD A;  2CT6 A;  5EVO A;  3NOF A;  3CRU A;  4TR3 A;  4F0C A;  1TK0 B;  5D73 A;  5HR1 A;  2QKE A;  2OJL A;  5ECH B;  1M2B A;  1TU7 A;  1XPV A;  2FNO A;  2GGT A;  3EMX A;  3A2X A;  2FUG 2;  5F8B A;  4XHM A;  1VF2 A;  3HVV A;  1F6M C;  1TDI A;  5ECN B;  1OC8 A;  2X99 A;  3TJK A;  4GTU A;  4FYB A;  5CRD A;  1SK1 A;  4YQU A;  4JZQ A;  4KH7 A;  2C8U A;  3KTL A;  2XC2 A;  1V2A A;  3QOU A;  4ZL8 A;  2LJR A;  4DSR A;  2LV3 A;  4MK3 A;  2V41 A;  1MD3 A;  5D93 A;  3TRX A;  3I9V 2;  5J4U A;  4AGS A;  3PGT A;  1PRX A;  1GSS A;  3DIE A;  5IO2 A;  2H0I A;  5GAN D;  2CZ2 A;  5CNW A;  3IHQ A;  1MDK A;  2AYT A;  3D4M A;  5GST A;  2L4Q A;  1U88 A;  3VI7 A;  3Q18 A;  2JZS A;  2B3S A;  2VO4 A;  4X0X A;  1F3B A;  4IVF A;  1OE7 A;  1K0B A;  1PX7 A;  2VD0 A;  2E2G A;  3H79 A;  3OR5 A;  1EV4 A;  2GSR A;  1VF1 A;  4BWS A;  3TJB A;  4NXI A;  3UMA A;  3U6V A;  2DML A;  1AQW A;  2VCQ A;  6GST A;  4DEJ A;  3QFA C;  3Q74 A;  2VCV A;  1M2D A;  1QXH A;  2B1K A;  3P2A A;  5JWR B;  4F0B A;  1RK4 A;  3DKS A;  3FZ4 A;  3ZRE A;  1I5G A;  1B8X A;  4ZXG A;  2KOK A;  3L4N A;  1KEB A;  2JAC A;  4NAX A;  2WRT A;  3LSZ A;  4K8M A;  3MWH A;  2HI7 A;  5A4V A;  2OKA A;  3F4S A;  3D0Z A;  2I1U A;  1NHO A;  5A4W A;  3P8W A;  4PQH A;  1PSQ A;  1THX A;  5IOX A;  2YV7 A;  3ZFL A;  2CQ9 A;  3QFB C;  2YWM A;  3IPZ A;  2JZT A;  3LYP A;  1X9M B;  1ILO A;  3IXR A;  5CRE A;  5GSS A;  4MPF A;  1SK2 A;  2JU5 A;  3HA9 A;  2YOI A;  4D73 A;  3HVX A;  1F3A A;  1OYJ A;  1HD2 A;  2OE3 A;  5L71 A;  2F8A A;  5IIZ A;  5F06 A;  4V1A g;  4LL1 B;  2FHE A;  4ML6 A;  1ML6 A;  3VUR A;  1GUH A;  1T8E B;  4POM A;  1T4Y A;  2C80 A;  4ZL7 A;  2J23 A;  5J9B A;  4P3Y B;  3M9K A;  4WEY A;  2IMD A;  5E59 A;  4J2F A;  2VLT A;  3IK9 A;  20GS A;  3C1R A;  2OBK A;  3TKP A;  3ZMK A;  3SBC A;  2GZP A;  3TCO A;  2L59 A;  4H86 A;  2JAD A;  2DJ3 A;  1XWA A;  1CQH A;  4YAV A;  5IOW A;  3KH9 A;  3IC4 A;  5IMZ A;  1EGO A;  2H8L A;  5FT3 A;  1IYI A;  1B4Q A;  1K0D A;  3ZYW A;  2LJA A;  2CVD A;  1JZO A;  3GST A;  1GLQ A;  2PWJ A;  4ZB9 A;  1TK5 B;  3UVH A;  2J9H A;  3ZLP A;  3EU3 A;  2H1A A;  2VM1 A;  1AIU A;  3I6A A;  1SJ6 A;  4POB A;  5EPF A;  6GSW A;  3RDW A;  3WGD A;  3UAP A;  2VCZ A;  4MMM A;  5CO3 A;  1GP1 A;  2EIO A;  3NZN A;  4F9Z A;  6GSS A;  2VAF A;  2E0Q A;  4J56 E;  3CTG A;  4XS1 A;  1XW5 A;  3BD2 A;  2TRC P;  2IMI A;  2LEG A;  1SEN A;  3G7Y A;  1WMJ A;  4G9H A;  12GS A;  4WF4 A;  5ECL B;  1QQ2 A;  16GS A;  2VUP A;  5CRH A;  3BOA A;  2L57 A;  11GS A;  5G5E A;  4LLR A;  1T7P B;  1TJD A;  1IYH A;  2MMO A;  2N5A A;  2NTO A;  4IQA A;  3TUE A;  2RLI A;  3VWW A;  4ZB6 A;  4NV5 A;  3KXO A;  3PIN A;  1K0M A;  1BX9 A;  3KH7 A;  1TXX A;  1S3A A;  3QPM A;  5A5K A;  3FR9 A;  3ME7 A;  2FGX A;  4V1A p;  3UEM A;  3RHB A;  4XIH A;  4O5R A;  5B6M A;  1O8X A;  1ACV A;  1V40 A;  5KN0 A;  3UJ1 A;  1OC9 A;  2WZ9 A;  1H4O A;  4BWQ A;  3CSI A;  3IV4 A;  1PKW A;  3QMX A;  2CAI A;  2PBJ A;  3NIV A;  5CRG A;  1XIY A;  4NV2 A;  3C7M A;  5DAL A;  1K0C A;  2O85 A;  1WJK A;  1QMV A;  1R7H A;  1EOG A;  2YWN A;  2ON5 A;  4JRR A;  3HZ8 A;  5EL8 A;  1O73 A;  3BCI A;  4QQ7 A;  3HYP A;  2H72 A;  3EMP A;  3QD9 A;  1YEX A;  1K3O A;  3QAV A;  3M1G A;  4IW9 A;  3KP8 A;  2F51 A;  3RAZ A;  3VFI A;  5ECI B;  5IM9 A;  1QK8 A;  2XBI A;  1WRY A;  4PNG A;  5ECR B;  1C72 A;  5H5R A;  3GX8 A;  2FA8 A;  1B48 A;  2WJU A;  4PUA A;  2IL3 A;  1PMT A;  2ES7 A;  4RQX A;  4MDC A;  3O6T A;  4IP1 A;  3FZA A;  4QL9 A;  1PKZ A;  3GTU A;  5IMF A;  2H70 A;  1X9W B;  3E0U A;  3GL3 A;  3ED3 A;  1VRS D;  3VK9 A;  3MDK A;  3F8U A;  1U87 A;  1QGV A;  1ST9 A;  5HFK A;  1GUM A;  3TRQ A;  4BA7 A;  3IAS 2;  2HXK A;  4ZBD A;  1M0U A;  1XZO A;  4GQF A;  3ZZX A;  1YKA A;  1SKW B;  2AJQ B;  2P5R A;  4XS4 A;  4MAB A;  5DBQ A;  1JLW A;  3J7Y k;  5F07 A;  2TRX A;  4YH2 A;  3L78 A;  1X0R A;  4CDO A;  4I6X A;  3APO A;  2N5B A;  2HRN A;  4GCI A;  3GN3 A;  5DJM A;  1BYE A;  1GSQ A;  1USB A;  2XPE A;  1ZOF A;  1G6W A;  5H5Q A;  1HNC A;  1RW1 A;  4EL1 A;  4D73 B;  2I81 A;  2LNS A;  4G10 A;  4KB3 A;  1VGL A;  2V6K A;  2XPD A;  4WBJ A;  1ERW A;  2OAD A;  4O92 A;  3DRN A;  3LFL A;  4L5L A;  2MYG A;  1OC3 A;  1TRV A;  3VI5 A;  1A2L A;  3WT1 A;  1UVZ A;  1M99 A;  3FZ5 A;  2H6X A;  2F3M A;  3KGK A;  4IS0 A;  2YAN A;  1NHY A;  4XRD A;  3ZRD A;  3F63 A;  3I69 A;  3WD6 A;  2KHP A;  3L9S A;  1F2E A;  5IMC A;  8GSS A;  4MH2 A;  2L5L A;  2DBC A;  2N5F A;  1WPI A;  6GSU A;  1X5C A;  3C8E A;  5J5N A;  1KBN A;  4JE1 A;  1JZR A;  1KTE A;  3TJF A;  3KMO A;  2AUV A;  2L5O A;  4MZB A;  4BPY A;  3QDN A;  4IN0 A;  2WGR A;  4PXO A;  4ID0 A;  3HKR A;  1XOB A;  3HD5 A;  4G19 A;  3W8S A;  1NW2 A;  4ULX A;  2FCH A;  1WOU A;  2I9H A;  2O7K A;  2H71 A;  2DIY A;  3VWX A;  3TJG A;  4TR4 A;  5IPH A;  2BJX A;  1NM3 A;  2IJY A;  3E9J B;  3EYT A;  4OCF A;  2FWH A;  1XVQ A;  4POK A;  3LJR A;  3GUR A;  1A2M A;  5ELA A;  2H1D A;  3AY8 A;  2WCI A;  3IK7 A;  2OE0 A;  3F4R A;  2I4A A;  6GSY A;  1ZL9 A;  4GSN A;  1MEK A;  2ALB A;  1Z5Y E;  4RI6 A;  1ERV A;  1SL2 B;  2XHF A;  3WYW A;  1GUL A;  1R5P A;  3LOR A;  4WBR D;  1FAA A;  1GUK A;  4GF0 A;  4TKY A;  3GSS A;  2CX3 A;  4JR4 A;  5CAX A;  1Q98 A;  2NPB A;  4E8E A;  4KCA A;  1SJZ A;  4F82 A;  5IPG A;  2C0F A;  4KSO A;  3HJM A;  3EC3 A;  1GLP A;  5ECS A;  1OC9 B;  4L0W A;  2F8F A;  2FLS A;  3EWL A;  3HHV A;  2L4C A;  5ECM B;  4IKH A;  4ECI A;  1JLV A;  2NDO A;  9GSS A;  1QUW A;  5HQP A;  1TU8 A;  4HJ2 A;  2CV4 A;  2R4V A;  1B9Y C;  5CP1 A;  1R26 A;  3GH9 A;  3PR8 A;  4ECC A;  4PX1 A;  2LRC A;  1AAZ A;  4GQC A;  1TRW A;  2RM5 A;  4V2L A;  4HU9 A;  3K8N A;  5AIX A;  6GSV A;  4GLT A;  2V2G A;  4NHW A;  4IJ3 A;  4OMV A;  4EDY A;  3KD0 A;  3F6F A;  2YWO A;  2VCX A;  3EVI A;  4WXT A;  2DIZ A;  2HT9 A;  5DVB A;  4HZ2 A;  3CSH A;  3DXB A;  1EP7 A;  2R3X A;  2LTK A;  4TN8 A;  2NBS A;  4HQS A;  4V2M A;  1Y6E A;  2DLX A;  4Q5N A;  1XWB A;  1B9X C;  2GZZ A;  1GSU A;  3TJJ A;  5EY6 A;  1OAZ A;  4ACS A;  5LD0 A;  3RBT A;  2RUF A;  3TOU A;  2CVK A;  2H1B A;  4KSM A;  4XS4 B;  1PQN A;  1WP0 A;  3WT2 A;  4N0V A;  2E7P A;  5GZZ B;  1YKC A;  4NPB A;  2H01 A;  2H0H A;  2MMN A;  4J57 E;  3MAK A;  2X8C A;  3G7J A;  2DJ2 A;  2HZF A;  3D5J A;  5AN1 A;  1K3Y A;  1OE8 A;  3HJP A;  5B8B A;  4TVE A;  1OVN A;  1DSB A;  1XOA A;  1XVW A;  3L9U A;  5ENU A;  4MPG A;  4HUA A;  4BVX A;  2JSY A;  2QSI A;  3W6G A;  4PQ1 A;  1FOV A;  3Q6O A;  3TKS E;  4G2E A;  3BJ5 A;  5D9T A;  4LL4 B;  2C4J A;  1B4P A;  1O85 A;  2B1L A;  2FA4 A;  3FK8 A;  4ZL9 A;  2FD3 A;  3C1S A;  3IRA A;  3O3T A;  2FWG A;  5IMV A;  1EZK A;  2YJH A;  4DVC A;  4ZIJ A;  3M3M A;  2YV9 A;  5CRW A;  1ZMA A;  4MJB A;  1T00 A;  3MSZ A;  2C0G A;  4QL7 A;  2H6Y A;  2A4V A;  2P31 A;  4YAP A;  3M8N A;  4Q5F A;  4WR5 A;  1O81 A;  3KIJ A;  1TRU A;  3GL5 A;  2KP2 A;  4I8B A;  4HZ4 A;  3UAR A;  2WDU A;  3EUR A;  1XBS A;  5B8A A;  3GFK A;  1U3A A;  1WIK A;  1ON4 A;  2GT5 A;  2HRF A;  1G7O A;  5CYY A;  3D21 A;  2C1Y A;  1CQG A;  3GX0 A;  4ZIL A;  2PER A;  4K7N A;  2YZH A;  4CHS A;  1URM A;  1O7U A;  2YNX A;  1TI1 A;  1PN9 A;  3ERW A;  4PQI A;  2R2J A;  2HZE B;  5E4W A;  1PA3 A;  2C0D A;  2PMT A;  1BED A;  2VCW A;  1FW1 A;  5JWQ B;  3ZIV A;  1TW9 A;  3HVS A;  2OE1 A;  1T3B A;  1TOF A;  4FYC A;  3KM6 A;  4KGI A;  2I3Y A;  1OKD A;  2IFQ A;  3H4K A;  1V58 A;  1F37 A;  3TKS A;  4POL A;  3ERF A;  2BMX A;  2G0F A;  2HNL A;  4RQR A;  1A0R P;  3APS A;  5DQY A;  2AB6 A;  1THO A;  1FO5 A;  2CAQ A;  1EWX A;  3EIN A;  2LS5 A;  1PX6 A;  3DD3 A;  4O32 A;  2YJ7 A;  1T4Z A;  2PU9 C;  2H19 A;  1A0F A;  1HNB A;  1O8W A;  3CSJ A;  2VL3 A;  3L0H A;  1SYR A;  3GYK A;  4PNF A;  1X9S B;  4JR6 A;  1ZYQ B;  1W89 A;  3HY2 A;  4NHZ A;  3ZFB A;  2IME A;  4E8H A;  3GHA A;  1V9W A;  1LJR A;  4KND A;  2G2Q A;  3L9V A;  1HQO A;  1TRS A;  3FR3 A;  4Z7X A;  3LG6 A;  1GRX A;  1U6T A;  2A2S A;  4TOP A;  3H1N A;  5G30 A;  4KCE A;  4NWY A;  2CA8 A;  4MJC A;  1M9A A;  1MTC A;  1MD4 A;  4KE3 A;  2V32 A;  4JED A;  2MZC A;  2DJ0 A;  3F6D A;  4K2D A;  2B5X A;  1U3I A;  4Q5R A;  3FYG A;  5D9V A;  2HYX A;  2VL2 C;  5HR2 A;  3FEU A;  4EUY A;  2TIR A;  5F0G A;  5D9W A;  4XRA A;  1A8Y A;  1AQV A;  1EGR A;  4OFT A;  2CX4 A;  3BBY A;  3VWV A;  3Q19 A;  1ABA A;  3KCM A;  5KN1 A;  1BQ7 A;  4RI7 A;  1GTU A;  2V6O A;  3LXT A;  3UBL A;  3SWL A;  3H8Q A;  3D4T A;  3A2W A;  3ERG A;  1UA5 A;  2YWI A;  1GH2 A;  3DVX A;  2FWF A;  2PGT A;  1S3C A;  1VF4 A;  5C04 A;  2HE3 A;  3KTB A;  22GS A;  1FG4 A;  4IEL A;  1Z6M A;  3RPN A;  4IJI A;  1HYU A;  4I5Q A;  5KEJ A;  2CZ3 A;  4ECB A;  2YZU A;  5F05 A;  4N30 A;  2L6C A;  4K0G A;  5IMA A;  4I97 A;  2REM A;  5JCU A;  3ZIJ A;  1ERU A;  4HJM A;  3IAM 2;  2RII A;  4CW9 A;  2GSS A;  3M0F A;  3DYR A;  2B5E A;  4FO5 A;  5ECO B;  2X8G A;  2GTU A;  2VM2 A;  3GMF A;  3VLN A;  3D22 A;  2GZY A;  1G7E A;  2M80 A;  4LA1 A;  3HJO A;  2HFD A;  1UN2 A;  2DJK A;  3CTF A;  4OCE A;  5DCH A;  3GRX A;  2ZCT A;  4TR0 A;  4TR1 A;  5ECQ B;  2H75 A;  5C00 A;  3UIW A;  1SD9 A;  2H76 A;  1YEP A;  3GIX A;  4XTS A;  3KEB A;  4I2T A;  3P90 A;  5G31 A;  4GRF A;  4IQ1 A;  4IGJ A;  4HI7 A;  1KNG A;  4OFN A;  3TRP A;  4GXZ A;  3IE3 A;  2PVQ A;  5J41 A;  3FZ9 A;  4OFM A;  2PN8 A;  1SK0 A;  4BVY A;  1K3L A;  1V57 A;  10GS A;  2M72 A;  4HU7 A;  1Z9H A;  1BAY A;  3UVT A;  3EU4 A;  3H93 A;  4ML1 A;  1V98 A;  3UBK A;  4ZBA A;  2QGV A;  3TGZ A;  5JCG A;  1WWJ A;  4MH3 A;  2DJJ A;  4MZC A;  1GNE A;  3GKX A;  1MDJ A;  2D2Z A;  3G7I A;  4X43 A;  4IBP A;  1G6Y A;  2OA7 A;  2WFC A;  7GSS A;  2C3N A;  3LYK A;  2K8V A;  3IOS A;  3FW2 A;  1FB0 A;  2DMM A;  4KX4 A;  1J9B A;  5H5S A;  3WGX A;  2FWE A;  3O76 A;  3QAW A;  3TDG A;  3IBH A;  4GWR A;  2O89 A;  2H6Z A;  2MMZ A;  4AJ7 A;  1J0F A;  1AC1 A;  2FY6 A;  4TRX A;  4KDU A;  1Q4J A;  1YF0 A;  5DAL B;  2LQQ A;  3F0I A;  2VLU A;  1T1V A;  4ISD A;  5FHI A;  3ZVJ A;  1H75 A;  1RQM A;  2IIY A;  1S3D A;  1Z6N A;  2E2M A;  2VIM A;  3QAG A;  1XW9 A;  2GQK A;  2VOC A;  3GUS A;  3ZVJ D;  4NMU A;  1Z3E A;  2K6V A;  4AF2 A;  3ZTL A;  1FVJ A;  3CBU A;  1A8L A;  2CVB A;  3IR4 A;  2IPA A;  4LMW A;  2VLV A;  4X1U A;  2LUS A;  3KJY A;  1PL1 A;  2B7J A;  1GL8 A;  2R6K A;  1EEM A;  2LST A;  4KW6 A;  3GTU B;  4PGT A;  2YN1 A;  3C71 A;  5AGY A;  4F03 A;  1XW6 A;  2EIQ A;  3ZL5 A;  2A2R A;  3APQ A;  5ECK B;  3DWV A;  4TXO A;  4KUN A;  4FYU A;  1XCC A;  2P5Q A;  4EKZ A;  5COH A;  3FRC A;  4ECJ A;  5HFG A;  1WE0 A;  2B5Y A;  4K1F A;  4FIW A;  2PVO C;  2PUK C;  4AJ8 A;  4LMV A;  1J08 A;  1GTA A;  5HR0 A;  4DSS A;  3M9J A;  2MBT A;  4GSS A;  2C0E A;  2H74 A;  4XCS A;  5HR3 A;  1NSW A;  3IA1 A;  4K6X A;  4EDZ A;  3C73 A;  2KP1 A;  3QR6 A;  3F3R A;  1YF1 A;  3R2Q A;  3PH9 A;  4L0U A;  1XFL A;  1DE2 A;  3HZ4 A;  3UOM A;  4HDE A;  2VCT A;  1SKS B;  1YQ1 A;  3DVW A;  1Z7P A;  3KP9 A;  1ERT A;  1YZX A;  2LJK A;  3WGE A;  4JBB A;  1SL0 B;  4TW5 A;  4HS1 A;  3FHK A;  3HDC A;  5ID2 A;  3KZQ A;  1ZYE A;  2RM6 A;  4ZB8 A;  1M7T A;  1PGT A;  3QCP A;  1DE1 A;  1JZW A;  4OO5 A;  3TKQ A;  4KDX A;  3DEX A;  4MF7 A;  1EV9 A;  1TTZ A;  4ILF A;  1E2Y A;  2F9S A;  1N8J A;  5KN2 A;  2O87 A;  4HQZ A;  2LRN A;  4EO3 A;  2C3T A;  3US3 A;  3HXS A;  5IQY A;  5IO0 A;  2MMA A;  3UL3 A;  4TR1 B;  2ZUP A;  1GSF A;  2GLR A;  4MLY A;  5LCZ A;  5FWG A;  3BCK A;  5GAP D;  1SYX A;  4DSQ A;  4N10 A;  1GSE A;  2K8S A;  4MP4 A;  3TB2 A;  1SKR B;  5LNK e;  2B7K A;  3I43 A;  2WB9 A;  3LEF A;  1X5D A;  5D96 A;  1EP8 A;  5DAK A;  2YCD A;  1BJX A;  2IMK A;  2H30 A;  1HNA A;  2KUC A;  1SU9 A;  1K0O A;  2HLS A;  2LNT A;  4KA0 A;  4MZW A;  2KLX A;  1PD2 1;  3GKM A;  3GA4 A;  3CYN A;  3IDV A;  1X5E A;  2GDR A;  2YPM A;  1XWC A;  3CMI A;  2DSA A;  4MCU A;  3GKK A;  3F9U A;  1M9B A;  5B7C A;  3ME8 A;  2OBI A;  3N5O A;  4MJE A;  1I9D A;  3F4T A;  2R37 A;  4F2I A;  3FKF A;  1JFU A;  2L6D A;  3VPT A;  4MJA A;  14GS A;  4RUV A;  5G1L A;  2O8V B;  3F3Q A;  1YY7 A;  2GQL A;  3E3E A;  4KDY A;  4EXJ A;  2GST A;  3N9J A;  1SJI A;  4OO4 A;  1GNW A;  2NVL A;  2X8H A;  1OKT A;  3HCZ A;  5D8I A;  3LWA A;  1AW9 A;  4HEA 2;  3TOT A;  4L8E A;  4AJ6 A;  3GKN A;  2ON7 A;  2YP6 A;  3TKS C;  5AIV A;  1K0N A;  3VWU A;  1FVK A;  4WKW A;  4PUF C;  1GSY A;  1TI3 A;  4K7O A;  4FH8 A;  2K9F A;  5DDL A;  1GTI A;  5G2Z A;  1XWG A;  5A4U A;  3J7Y b;  2EIR A;  4MF5 A;  2P0G A;  1MDI A;  4K0N A;  1XWK A;  3S9F A;  2VL9 A;  5KN3 A;  5B6N A;  1SL1 B;  1DUG A;  2VL2 A;  3G9B A;  3ISO A;  1LU4 A;  1VF3 A;  4TXV A;  1AXD A;  5AIS A;  1A23 A;  4XS6 A;  2HSH A;  1K0A A;  2MBS A;  1PL2 A;  4ZBB A;  2PPT A;  5J3R A;  4TXO B;  3LGC A;  1ZZY A;  2C3Q A;  1AQX A;  1GSD A;  3ZML A;  4N0Z A;  1EOH A;  1E6B A;  1EEJ A;  4IP6 A;  3D6I A;  2AHE A;  5HFI A;  5JWO B;  1SD8 A;  1ZGN A;  2Z9S A;  4DSS B;  2ZNM A;  3MNG A;  1QFN A;  2DC5 A;  4N11 A;  2VD1 A;  2HSY A;  4YQM A;  3W8J A;  4EC0 A;  2JSZ A;  1YDK A;  2GVP A;  2IWT A;  2JL4 A;  2XBQ A;  4JU5 A;  4HOJ A;  2AV4 A;  2EC4 A;  2JZR A;  2LKU A;  2LRT A;  4GST A;  2GT6 A;  2H73 A;  2LQO A;  4MA9 A;  4WR4 A;  1TP9 A;  5INY A;  5DQS A;  1AUC A;  3GNJ A;  3CXG A;  3LXZ A;  4EE0 A;  2B6M A;  19GS A;  3A2V A;  5IMD A;  5ELG A;  3VPQ A;  5G5F A;  4Q5Q A;  1R5A A;  4PUR A;  3V1W A;  5ID2 B;  4K7I A;  1BG5 A;  5JCW A;  2RUE A;  4IHU A;  3KMN A;  2QC7 A;  4OD7 A;  3CRT A;  2H1G A;  1XXU A;  4BL7 A;  2X64 A;  5DCG A;  3TKR A;  3JCM L; 
#chains in the Genus database with same CATH topology
 4MF6 A;  1DBY A;  3A3T A;  3A5W A;  2OAC A;  1ZCP A;  2UZ8 A;  1A2J A;  1W4V A;  2AAW A;  4YQV A;  4WF5 A;  1F9M A;  5ECP B;  4HSC X;  3RHC A;  2H66 A;  1A24 A;  5KOW A;  17GS A;  4OWY A;  4A5P A;  3P7X A;  3ZIT A;  2H0G A;  1G0T A;  2IN3 A;  1TKD B;  3DML A;  3EE2 A;  4WET A;  5G1K A;  3GH6 A;  1Y25 A;  1GTB A;  2WS2 A;  4KAE A;  3GV1 A;  18GS A;  13GS A;  4K2X A;  1N2A A;  1M2A A;  5DJL A;  2GQM A;  1LBK A;  1TK8 B;  2DJ1 A;  5DAK B;  1UC7 A;  4YKF A;  2GSQ A;  1O6J A;  4K9Z A;  5D9X A;  1YJ6 A;  6GSX A;  2WUL A;  1FHE A;  5J9C A;  2IMF A;  5ABR A;  1R4W A;  2BTO T;  2V1M A;  1JHB A;  1Z7R A;  4I2U A;  4EF0 A;  1FB6 A;  2GS3 A;  3RPP A;  2R5G A;  2K18 A;  4L5O A;  3FR6 A;  3LQ7 A;  2M46 A;  3DGQ A;  1GWC A;  2HZE A;  2IFQ B;  3U5R E;  4O7H A;  3FY7 A;  4EVM A;  4V2N A;  1JZD A;  2CT6 A;  5EVO A;  3NOF A;  3CRU A;  4TR3 A;  4F0C A;  1TK0 B;  5D73 A;  5HR1 A;  2QKE A;  2OJL A;  5ECH B;  1M2B A;  1TU7 A;  1XPV A;  5KOX A;  2FNO A;  2GGT A;  3EMX A;  3A2X A;  2FUG 2;  5F8B A;  4XHM A;  1VF2 A;  3HVV A;  1F6M C;  1TDI A;  5ECN B;  1OC8 A;  2X99 A;  3TJK A;  4GTU A;  4FYB A;  5CRD A;  1SK1 A;  4YQU A;  4JZQ A;  4KH7 A;  2C8U A;  3KTL A;  2QA2 A;  2XC2 A;  1V2A A;  3QOU A;  4ZL8 A;  2LJR A;  4DSR A;  2R0P A;  2LV3 A;  4MK3 A;  2V41 A;  1MD3 A;  5D93 A;  3TRX A;  3I9V 2;  2HRK A;  5J4U A;  4AGS A;  3PGT A;  1PRX A;  1GSS A;  3DIE A;  5IO2 A;  2H0I A;  5GAN D;  2CZ2 A;  5CNW A;  3IHQ A;  1MDK A;  2AYT A;  3D4M A;  5GST A;  2L4Q A;  1U88 A;  3VI7 A;  3Q18 A;  4K5R A;  2JZS A;  2B3S A;  2VO4 A;  4X0X A;  1F3B A;  4IVF A;  1OE7 A;  1K0B A;  1PX7 A;  2VD0 A;  2E2G A;  3H79 A;  3OR5 A;  1EV4 A;  2GSR A;  1VF1 A;  1PFO A;  4BWS A;  3TJB A;  4NXI A;  3UMA A;  3U6V A;  2DML A;  1AQW A;  2VCQ A;  6GST A;  4DEJ A;  3QFA C;  3Q74 A;  2VCV A;  1M2D A;  1QXH A;  2B1K A;  3P2A A;  5JWR B;  4F0B A;  1RK4 A;  3DKS A;  3FZ4 A;  3ZRE A;  1I5G A;  2QA1 A;  1B8X A;  4ZXG A;  2KOK A;  3L4N A;  1KEB A;  2JAC A;  4NAX A;  2WRT A;  3LSZ A;  4K8M A;  3MWH A;  2HI7 A;  5A4V A;  2OKA A;  3F4S A;  3D0Z A;  2I1U A;  1NHO A;  5A4W A;  3P8W A;  4PQH A;  1PSQ A;  1THX A;  5IOX A;  2YV7 A;  3ZFL A;  2CQ9 A;  3QFB C;  2YWM A;  3IPZ A;  2JZT A;  3LYP A;  1X9M B;  1ILO A;  3IXR A;  5CRE A;  5GSS A;  4MPF A;  1SK2 A;  2JU5 A;  3HA9 A;  2HRA A;  2YOI A;  4D73 A;  3HVX A;  1F3A A;  1OYJ A;  4G0L A;  1HD2 A;  2OE3 A;  5L71 A;  3PPU A;  2F8A A;  1PN0 A;  5IIZ A;  5F06 A;  4V1A g;  4LL1 B;  2FHE A;  4ML6 A;  1ML6 A;  1XG8 A;  3VUR A;  1GUH A;  1T8E B;  4POM A;  1T4Y A;  2C80 A;  4ZL7 A;  2J23 A;  5J9B A;  4P3Y B;  3M9K A;  4WEY A;  2IMD A;  5E59 A;  4J2F A;  2VLT A;  3IK9 A;  20GS A;  3C1R A;  2OBK A;  3TKP A;  3ZMK A;  3SBC A;  2GZP A;  3TCO A;  2L59 A;  4H86 A;  2JAD A;  2DJ3 A;  1XWA A;  1CQH A;  4YAV A;  5IOW A;  3KH9 A;  3IC4 A;  5IMZ A;  5BRT A;  1EGO A;  2H8L A;  5FT3 A;  1IYI A;  1B4Q A;  1K0D A;  3ZYW A;  2LJA A;  2CVD A;  1JZO A;  3GST A;  1GLQ A;  2PWJ A;  4ZB9 A;  1TK5 B;  3UVH A;  2J9H A;  3ZLP A;  3EU3 A;  2H1A A;  3FMW A;  2VM1 A;  1AIU A;  3I6A A;  1SJ6 A;  4POB A;  5EPF A;  6GSW A;  3RDW A;  3WGD A;  3UAP A;  2VCZ A;  4MMM A;  3A5I A;  5CO3 A;  4BVY B;  1GP1 A;  2EIO A;  3NZN A;  4F9Z A;  6GSS A;  2VAF A;  2E0Q A;  4J56 E;  3CTG A;  4XS1 A;  1XW5 A;  3BD2 A;  2TRC P;  2IMI A;  2LEG A;  1SEN A;  3G7Y A;  1WMJ A;  4G9H A;  12GS A;  4WF4 A;  5ECL B;  1QQ2 A;  16GS A;  2VUP A;  5CRH A;  3BOA A;  2L57 A;  11GS A;  5G5E A;  4LLR A;  1T7P B;  1TJD A;  1IYH A;  2MMO A;  2N5A A;  2NTO A;  4IQA A;  3TUE A;  2RLI A;  3VWW A;  4ZB6 A;  4NV5 A;  3KXO A;  3PIN A;  1K0M A;  1BX9 A;  3KH7 A;  1TXX A;  1S3A A;  2DKI A;  3QPM A;  5A5K A;  3FR9 A;  3ME7 A;  2FGX A;  4V1A p;  3UEM A;  3RHB A;  4XIH A;  4O5R A;  5B6M A;  1O8X A;  1ACV A;  1V40 A;  5KN0 A;  3UJ1 A;  1OC9 A;  2WZ9 A;  1H4O A;  4BWQ A;  3CSI A;  3IV4 A;  1PKW A;  3QMX A;  2CAI A;  2PBJ A;  3NIV A;  5CRG A;  3CQF A;  1XIY A;  4NV2 A;  3C7M A;  5DAL A;  1K0C A;  2O85 A;  1WJK A;  1QMV A;  1R7H A;  1EOG A;  2YWN A;  2ON5 A;  4JRR A;  3HZ8 A;  5EL8 A;  1O73 A;  3BCI A;  4QQ7 A;  3HYP A;  2H72 A;  3EMP A;  3QD9 A;  1YEX A;  1K3O A;  3QAV A;  3M1G A;  4IW9 A;  3KP8 A;  2F51 A;  3RAZ A;  3VFI A;  5ECI B;  5IM9 A;  1QK8 A;  2XBI A;  1WRY A;  4PNG A;  5ECR B;  1C72 A;  5H5R A;  3GX8 A;  2FA8 A;  1B48 A;  2WJU A;  4PUA A;  2IL3 A;  1PMT A;  2ES7 A;  4RQX A;  4MDC A;  3O6T A;  4IP1 A;  3FZA A;  4QL9 A;  1PKZ A;  3GTU A;  5IMF A;  2H70 A;  1X9W B;  3E0U A;  3GL3 A;  4G0I A;  3ED3 A;  1VRS D;  3VK9 A;  3MDK A;  3F8U A;  1U87 A;  1QGV A;  1ST9 A;  5HFK A;  1GUM A;  3TRQ A;  4BA7 A;  3IAS 2;  2HXK A;  4ZBD A;  1M0U A;  1XZO A;  4GQF A;  3ZZX A;  1YKA A;  1SKW B;  2AJQ B;  2P5R A;  4XS4 A;  4MAB A;  5DBQ A;  1JLW A;  3J7Y k;  5F07 A;  2TRX A;  4YH2 A;  3L78 A;  1X0R A;  4CDO A;  4I6X A;  3APO A;  2N5B A;  2HRN A;  4GCI A;  3GN3 A;  5DJM A;  1BYE A;  1GSQ A;  1USB A;  2XPE A;  1ZOF A;  1G6W A;  5H5Q A;  1HNC A;  1RW1 A;  4EL1 A;  4D73 B;  2I81 A;  2LNS A;  4G10 A;  4KB3 A;  1VGL A;  2V6K A;  2XPD A;  4WBJ A;  1ERW A;  2OAD A;  4O92 A;  3DRN A;  3LFL A;  4L5L A;  2MYG A;  1OC3 A;  1TRV A;  3VI5 A;  1A2L A;  3WT1 A;  1UVZ A;  1M99 A;  3FZ5 A;  1ZYN A;  2H6X A;  2F3M A;  3KGK A;  4IS0 A;  2YAN A;  1NHY A;  4XRD A;  3ZRD A;  3F63 A;  3I69 A;  3WD6 A;  2KHP A;  3L9S A;  1F2E A;  5IMC A;  8GSS A;  4MH2 A;  2L5L A;  2DBC A;  2N5F A;  1WPI A;  6GSU A;  1X5C A;  3C8E A;  5J5N A;  1KBN A;  4JE1 A;  1JZR A;  1KTE A;  3TJF A;  3KMO A;  2AUV A;  2L5O A;  4MZB A;  4BPY A;  3QDN A;  4IN0 A;  5BMU A;  3HVN A;  2WGR A;  4PXO A;  4ID0 A;  3HKR A;  1XOB A;  3HD5 A;  4G19 A;  3W8S A;  1NW2 A;  4ULX A;  2FCH A;  1WOU A;  2I9H A;  2O7K A;  2H71 A;  2DIY A;  3VWX A;  3TJG A;  4TR4 A;  5IPH A;  2BJX A;  1NM3 A;  2IJY A;  3E9J B;  3EYT A;  4OCF A;  2FWH A;  1XVQ A;  4POK A;  3LJR A;  3GUR A;  1A2M A;  5ELA A;  2H1D A;  3AY8 A;  2WCI A;  3IK7 A;  2OE0 A;  3F4R A;  2I4A A;  6GSY A;  1ZL9 A;  4GSN A;  1MEK A;  2ALB A;  1Z5Y E;  4RI6 A;  1ERV A;  1SL2 B;  2XHF A;  3WYW A;  1GUL A;  1R5P A;  3LOR A;  3MYD A;  4WBR D;  1FAA A;  1GUK A;  4GF0 A;  4TKY A;  3GSS A;  2CX3 A;  4JR4 A;  5CAX A;  1Q98 A;  2NPB A;  4E8E A;  4KCA A;  1SJZ A;  4F82 A;  5IPG A;  2C0F A;  4KSO A;  3HJM A;  3EC3 A;  1GLP A;  5ECS A;  1OC9 B;  4Z2U A;  4L0W A;  2F8F A;  2FLS A;  3EWL A;  3HHV A;  2L4C A;  5ECM B;  4IKH A;  4ECI A;  1JLV A;  2NDO A;  9GSS A;  1QUW A;  5HQP A;  1TU8 A;  4HJ2 A;  2CV4 A;  2R4V A;  1B9Y C;  5CP1 A;  1R26 A;  3GH9 A;  3PR8 A;  4ECC A;  4PX1 A;  2LRC A;  1AAZ A;  4GQC A;  1TRW A;  2RM5 A;  4V2L A;  4HU9 A;  3K8N A;  5AIX A;  6GSV A;  4GLT A;  2V2G A;  4NHW A;  4IJ3 A;  4OMV A;  4EDY A;  3KD0 A;  3F6F A;  2YWO A;  2VCX A;  2R0G A;  3EVI A;  4WXT A;  2DIZ A;  2HT9 A;  5DVB A;  4HZ2 A;  3CSH A;  3DXB A;  1EP7 A;  2R3X A;  2LTK A;  4TN8 A;  2NBS A;  4HQS A;  4V2M A;  1Y6E A;  2DLX A;  4K5S A;  4Q5N A;  1XWB A;  1B9X C;  2GZZ A;  1GSU A;  3TJJ A;  5EY6 A;  1OAZ A;  4ACS A;  5LD0 A;  3RBT A;  2RUF A;  3TOU A;  2CVK A;  2H1B A;  4KSM A;  4XS4 B;  1PQN A;  1WP0 A;  4ICY A;  4N0V A;  3WT2 A;  4EIQ A;  2E7P A;  5GZZ B;  1YKC A;  4NPB A;  2H01 A;  2H0H A;  2MMN A;  4J57 E;  3MAK A;  2X8C A;  4Z2R A;  3G7J A;  2DJ2 A;  2HZF A;  3D5J A;  5AN1 A;  1K3Y A;  1OE8 A;  3HJP A;  5B8B A;  4TVE A;  1OVN A;  1DSB A;  1XOA A;  1XVW A;  3L9U A;  5ENU A;  4MPG A;  4HUA A;  4BVX A;  2JSY A;  2QSI A;  4G0K A;  3W6G A;  4PQ1 A;  1FOV A;  3Q6O A;  3TKS E;  4G2E A;  3BJ5 A;  5D9T A;  4BL7 B;  4X4J A;  4LL4 B;  2C4J A;  1B4P A;  1O85 A;  2B1L A;  2FA4 A;  3FK8 A;  4ZL9 A;  2FD3 A;  3C1S A;  3IRA A;  3O3T A;  2FWG A;  5IMV A;  1EZK A;  2YJH A;  4DVC A;  4ZIJ A;  3M3M A;  2YV9 A;  5CRW A;  1ZMA A;  4MJB A;  1T00 A;  4EIP A;  3MIX A;  3MSZ A;  2C0G A;  4QL7 A;  2H6Y A;  2A4V A;  2P31 A;  4YAP A;  3M8N A;  4Q5F A;  1S3R A;  4WR5 A;  1O81 A;  3KIJ A;  1TRU A;  3GL5 A;  2KP2 A;  4I8B A;  4HZ4 A;  3UAR A;  2WDU A;  3EUR A;  1XBS A;  5B8A A;  3GFK A;  1U3A A;  1WIK A;  1ON4 A;  2GT5 A;  2HRF A;  1G7O A;  5CYY A;  3D21 A;  2C1Y A;  1CQG A;  3GX0 A;  4ZIL A;  2PER A;  4K7N A;  2YZH A;  4CHS A;  1URM A;  1O7U A;  2YNX A;  1TI1 A;  1PN9 A;  3ERW A;  4PQI A;  2R2J A;  2HZE B;  5E4W A;  1PA3 A;  2C0D A;  2PMT A;  1BED A;  2VCW A;  1FW1 A;  5JWQ B;  3ZIV A;  1TW9 A;  3HVS A;  2OE1 A;  1T3B A;  1TOF A;  4FYC A;  2A4H A;  3KM6 A;  4KGI A;  2I3Y A;  1OKD A;  2IFQ A;  3H4K A;  1V58 A;  1F37 A;  3TKS A;  4POL A;  3ERF A;  2BMX A;  2G0F A;  2HNL A;  4RQR A;  1A0R P;  3APS A;  5DQY A;  2AB6 A;  1THO A;  1FO5 A;  2CAQ A;  1EWX A;  3EIN A;  2LS5 A;  1PX6 A;  4PTS A;  3DD3 A;  4O32 A;  2HSM A;  2YJ7 A;  1T4Z A;  2PU9 C;  2H19 A;  1A0F A;  1HNB A;  1O8W A;  3CSJ A;  2VL3 A;  3L0H A;  1SYR A;  3GYK A;  4PNF A;  1X9S B;  4JR6 A;  1ZYQ B;  1W89 A;  3HY2 A;  4NHZ A;  3ZFB A;  2IME A;  4E8H A;  3GHA A;  1V9W A;  1LJR A;  4KND A;  2G2Q A;  3L9V A;  1HQO A;  1TRS A;  3FR3 A;  4Z7X A;  3LG6 A;  1GRX A;  1U6T A;  2A2S A;  4TOP A;  3H1N A;  5G30 A;  4KCE A;  4NWY A;  2CA8 A;  4MJC A;  1M9A A;  1MTC A;  1MD4 A;  4KE3 A;  2V32 A;  4JED A;  2MZC A;  1FOH A;  2DJ0 A;  3F6D A;  4K2D A;  2B5X A;  1U3I A;  4Q5R A;  3FYG A;  5D9V A;  2HYX A;  2VL2 C;  5HR2 A;  3FEU A;  4EUY A;  2TIR A;  5F0G A;  5D9W A;  4XRA A;  1A8Y A;  1AQV A;  1EGR A;  4OFT A;  2CX4 A;  3BBY A;  3VWV A;  3Q19 A;  1ABA A;  3KCM A;  5KN1 A;  1BQ7 A;  4RI7 A;  1GTU A;  2V6O A;  3LXT A;  3UBL A;  3SWL A;  3H8Q A;  3D4T A;  3A2W A;  3ERG A;  1UA5 A;  2YWI A;  1GH2 A;  3DVX A;  2FWF A;  2PGT A;  1S3C A;  1VF4 A;  5C04 A;  2HE3 A;  3KTB A;  22GS A;  1FG4 A;  4IEL A;  1Z6M A;  3RPN A;  4IJI A;  1HYU A;  4I5Q A;  5KEJ A;  2CZ3 A;  4ECB A;  2YZU A;  5F05 A;  4N30 A;  2L6C A;  4K0G A;  5IMA A;  4I97 A;  2REM A;  5JCU A;  3ZIJ A;  1ERU A;  4HJM A;  3IAM 2;  2RII A;  4CW9 A;  2GSS A;  3M0F A;  3DYR A;  2B5E A;  4FO5 A;  5ECO B;  2X8G A;  2GTU A;  2VM2 A;  3GMF A;  3VLN A;  3D22 A;  2GZY A;  1G7E A;  4CY6 A;  2M80 A;  4LA1 A;  3HJO A;  2HFD A;  1UN2 A;  2DJK A;  3CTF A;  3EPT A;  4OCE A;  5DCH A;  3GRX A;  2ZCT A;  4TR0 A;  4TR1 A;  4FQU A;  5ECQ B;  2H75 A;  5C00 A;  3UIW A;  1SD9 A;  2H76 A;  1YEP A;  3GIX A;  4XTS A;  3KEB A;  4I2T A;  3P90 A;  5G31 A;  4GRF A;  4IQ1 A;  4IGJ A;  4HI7 A;  1KNG A;  2X4A A;  4OFN A;  3TRP A;  4GXZ A;  4Z2T A;  3IE3 A;  2PVQ A;  5J41 A;  3FZ9 A;  4OFM A;  2PN8 A;  1SK0 A;  4BVY A;  1K3L A;  1V57 A;  10GS A;  2M72 A;  4HU7 A;  1Z9H A;  1BAY A;  3UVT A;  3EU4 A;  3H93 A;  4ML1 A;  1V98 A;  3UBK A;  4ZBA A;  2QGV A;  3TGZ A;  2DKH A;  5JCG A;  1WWJ A;  4MH3 A;  2DJJ A;  4MZC A;  1GNE A;  3GKX A;  1MDJ A;  2D2Z A;  3G7I A;  4X43 A;  4IBP A;  1G6Y A;  2OA7 A;  2WFC A;  7GSS A;  2C3N A;  3LYK A;  2K8V A;  3IOS A;  3FW2 A;  1FB0 A;  2DMM A;  4KX4 A;  4YKG A;  1J9B A;  5H5S A;  3WGX A;  2FWE A;  3O76 A;  3QAW A;  3TDG A;  3IBH A;  4GWR A;  2O89 A;  2H6Z A;  2MMZ A;  4AJ7 A;  1J0F A;  1AC1 A;  2FY6 A;  4TRX A;  4KDU A;  1Q4J A;  1YF0 A;  5DAL B;  2LQQ A;  3F0I A;  2VLU A;  1T1V A;  4ISD A;  5FHI A;  3ZVJ A;  1H75 A;  1RQM A;  2IIY A;  1S3D A;  1Z6N A;  2E2M A;  2VIM A;  3QAG A;  1XW9 A;  2GQK A;  2VOC A;  3GUS A;  3ZVJ D;  4NMU A;  1Z3E A;  2K6V A;  4AF2 A;  3ZTL A;  1FVJ A;  3CBU A;  1A8L A;  2CVB A;  3IR4 A;  2IPA A;  4LMW A;  2VLV A;  4X1U A;  2LUS A;  3KJY A;  1PL1 A;  2B7J A;  1GL8 A;  2R6K A;  1EEM A;  2LST A;  4KW6 A;  3GTU B;  4PGT A;  2YN1 A;  3C71 A;  5AGY A;  4F03 A;  1XW6 A;  2EIQ A;  3ZL5 A;  2A2R A;  3APQ A;  5ECK B;  3DWV A;  4TXO A;  4KUN A;  4FYU A;  1XCC A;  2P5Q A;  4EKZ A;  5COH A;  3FRC A;  4ECJ A;  5HFG A;  1WE0 A;  2B5Y A;  4K1F A;  4FIW A;  2PVO C;  2PUK C;  4AJ8 A;  4LMV A;  1J08 A;  1GTA A;  1M3I A;  5HR0 A;  4DSS A;  3M9J A;  2MBT A;  4GSS A;  2C0E A;  4CY8 A;  2H74 A;  4XCS A;  5HR3 A;  1NSW A;  3IA1 A;  4K6X A;  2X49 A;  4EDZ A;  3C73 A;  2KP1 A;  3QR6 A;  3F3R A;  1YF1 A;  3R2Q A;  3PH9 A;  4L0U A;  1XFL A;  3IHG A;  1DE2 A;  3HZ4 A;  3UOM A;  4HDE A;  2VCT A;  1SKS B;  1YQ1 A;  3DVW A;  1Z7P A;  3KP9 A;  1ERT A;  1YZX A;  2LJK A;  3R3E A;  3WGE A;  4JBB A;  1SL0 B;  4TW5 A;  4HS1 A;  3FHK A;  3HDC A;  5ID2 A;  3KZQ A;  1ZYE A;  2RM6 A;  4ZB8 A;  1M7T A;  1PGT A;  3QCP A;  1DE1 A;  1JZW A;  4OO5 A;  3TKQ A;  4KDX A;  3DEX A;  4MF7 A;  1EV9 A;  1TTZ A;  4ILF A;  1E2Y A;  2F9S A;  1N8J A;  5KN2 A;  1ZYP A;  2O87 A;  4HQZ A;  2LRN A;  4EO3 A;  2C3T A;  3US3 A;  3HXS A;  4O5Q A;  5IQY A;  5IO0 A;  2MMA A;  3UL3 A;  4TR1 B;  2ZUP A;  1GSF A;  2GLR A;  4MLY A;  5LCZ A;  5FWG A;  3BCK A;  5GAP D;  1SYX A;  4DSQ A;  4N10 A;  1GSE A;  2K8S A;  4MP4 A;  3TB2 A;  1SKR B;  5LNK e;  2B7K A;  3I43 A;  2WB9 A;  3LEF A;  1X5D A;  5D96 A;  1EP8 A;  5DAK A;  2YCD A;  1BJX A;  2IMK A;  2H30 A;  1HNA A;  2KUC A;  1SU9 A;  1K0O A;  2HLS A;  2LNT A;  4KA0 A;  4MZW A;  2KLX A;  3LW9 A;  1PD2 1;  3GKM A;  3GA4 A;  3CYN A;  3IDV A;  1X5E A;  2GDR A;  2YPM A;  1XWC A;  3CMI A;  2DSA A;  4MCU A;  3GKK A;  3F9U A;  1M9B A;  5B7C A;  3ME8 A;  2OBI A;  3N5O A;  4MJE A;  1I9D A;  3F4T A;  2R37 A;  4F2I A;  3FKF A;  1JFU A;  2L6D A;  3VPT A;  4MJA A;  14GS A;  4RUV A;  5G1L A;  2O8V B;  3F3Q A;  1YY7 A;  2GQL A;  3E3E A;  4KDY A;  4EXJ A;  2GST A;  3N9J A;  1SJI A;  4OO4 A;  1GNW A;  2NVL A;  2X8H A;  1OKT A;  3HCZ A;  5D8I A;  3LWA A;  1AW9 A;  4HEA 2;  3TOT A;  4L8E A;  4AJ6 A;  3GKN A;  2ON7 A;  2YP6 A;  3TKS C;  5AIV A;  1K0N A;  3VWU A;  1FVK A;  4WKW A;  4PUF C;  1GSY A;  1TI3 A;  4K7O A;  4O5U A;  4FH8 A;  2K9F A;  5DDL A;  1GTI A;  5G2Z A;  1XWG A;  5A4U A;  3J7Y b;  2EIR A;  4MF5 A;  2P0G A;  1MDI A;  4K0N A;  4BIK A;  1XWK A;  3S9F A;  2VL9 A;  5KN3 A;  5B6N A;  1SL1 B;  1DUG A;  2VL2 A;  3G9B A;  3ISO A;  1LU4 A;  1VF3 A;  4TXV A;  1AXD A;  5AIS A;  1A23 A;  4XS6 A;  2HSH A;  1K0A A;  2MBS A;  1PL2 A;  4ZBB A;  2PPT A;  3IC8 A;  4KF9 A;  4TXO B;  5J3R A;  3LGC A;  1ZZY A;  2C3Q A;  1AQX A;  1GSD A;  3ZML A;  4USS A;  4N0Z A;  1EOH A;  1E6B A;  1EEJ A;  4IP6 A;  3D6I A;  2AHE A;  5HFI A;  5JWO B;  1SD8 A;  1ZGN A;  2Z9S A;  4DSS B;  4MNN A;  2ZNM A;  3MNG A;  1QFN A;  2DC5 A;  4N11 A;  2VD1 A;  2HSY A;  4YQM A;  3W8J A;  4EC0 A;  2JSZ A;  1YDK A;  2GVP A;  2IWT A;  2JL4 A;  2XBQ A;  4JU5 A;  4HOJ A;  2AV4 A;  2EC4 A;  2JZR A;  2LKU A;  2LRT A;  4GST A;  2GT6 A;  2H73 A;  2LQO A;  4MA9 A;  4WR4 A;  4BVX B;  1TP9 A;  5INY A;  5DQS A;  1AUC A;  3GNJ A;  3CXG A;  3LXZ A;  4EE0 A;  2B6M A;  19GS A;  3A2V A;  5IMD A;  5ELG A;  3VPQ A;  5G5F A;  4Q5Q A;  2A2P A;  1R5A A;  4PUR A;  3V1W A;  5ID2 B;  4K7I A;  1BG5 A;  5JCW A;  2RUE A;  4IHU A;  3KMN A;  2QC7 A;  4OD7 A;  3CRT A;  2H1G A;  2R0C A;  1XXU A;  4BL7 A;  2X64 A;  5DCG A;  3TKR A;  1M3J A;  3JCM L; 
#chains in the Genus database with same CATH homology
 4MF6 A;  1DBY A;  3A3T A;  3A5W A;  2OAC A;  1ZCP A;  2UZ8 A;  1A2J A;  1W4V A;  2AAW A;  4YQV A;  4WF5 A;  1F9M A;  5ECP B;  3RHC A;  2H66 A;  1A24 A;  5KOW A;  17GS A;  4OWY A;  4A5P A;  3P7X A;  3ZIT A;  2H0G A;  1G0T A;  2IN3 A;  1TKD B;  3DML A;  3EE2 A;  4WET A;  5G1K A;  3GH6 A;  1Y25 A;  1GTB A;  2WS2 A;  4KAE A;  3GV1 A;  18GS A;  13GS A;  4K2X A;  1N2A A;  1M2A A;  5DJL A;  2GQM A;  1LBK A;  1TK8 B;  2DJ1 A;  5DAK B;  1UC7 A;  4YKF A;  2GSQ A;  1O6J A;  4K9Z A;  5D9X A;  1YJ6 A;  6GSX A;  2WUL A;  1FHE A;  5J9C A;  2IMF A;  5ABR A;  1R4W A;  2BTO T;  2V1M A;  1JHB A;  1Z7R A;  4I2U A;  4EF0 A;  1FB6 A;  2GS3 A;  3RPP A;  2R5G A;  2K18 A;  4L5O A;  3FR6 A;  3LQ7 A;  2M46 A;  3DGQ A;  1GWC A;  2HZE A;  2IFQ B;  3U5R E;  4O7H A;  3FY7 A;  4EVM A;  4V2N A;  1JZD A;  2CT6 A;  5EVO A;  3NOF A;  3CRU A;  4TR3 A;  4F0C A;  1TK0 B;  5D73 A;  5HR1 A;  2QKE A;  2OJL A;  5ECH B;  1M2B A;  1TU7 A;  1XPV A;  5KOX A;  2FNO A;  2GGT A;  3EMX A;  3A2X A;  2FUG 2;  5F8B A;  4XHM A;  1VF2 A;  3HVV A;  1F6M C;  1TDI A;  5ECN B;  1OC8 A;  2X99 A;  3TJK A;  4GTU A;  4FYB A;  5CRD A;  1SK1 A;  4YQU A;  4JZQ A;  4KH7 A;  2C8U A;  3KTL A;  2QA2 A;  2XC2 A;  1V2A A;  3QOU A;  4ZL8 A;  2LJR A;  4DSR A;  2R0P A;  2LV3 A;  4MK3 A;  2V41 A;  1MD3 A;  5D93 A;  3TRX A;  3I9V 2;  2HRK A;  5J4U A;  4AGS A;  3PGT A;  1PRX A;  1GSS A;  3DIE A;  5IO2 A;  2H0I A;  5GAN D;  2CZ2 A;  5CNW A;  3IHQ A;  1MDK A;  2AYT A;  3D4M A;  5GST A;  2L4Q A;  1U88 A;  3VI7 A;  3Q18 A;  4K5R A;  2JZS A;  2B3S A;  2VO4 A;  4X0X A;  1F3B A;  4IVF A;  1OE7 A;  1K0B A;  1PX7 A;  2VD0 A;  2E2G A;  3H79 A;  3OR5 A;  1EV4 A;  2GSR A;  1VF1 A;  4BWS A;  3TJB A;  4NXI A;  3UMA A;  3U6V A;  2DML A;  1AQW A;  2VCQ A;  6GST A;  4DEJ A;  3QFA C;  3Q74 A;  2VCV A;  1M2D A;  1QXH A;  2B1K A;  3P2A A;  5JWR B;  4F0B A;  1RK4 A;  3DKS A;  3FZ4 A;  3ZRE A;  1I5G A;  2QA1 A;  1B8X A;  4ZXG A;  2KOK A;  3L4N A;  1KEB A;  2JAC A;  4NAX A;  2WRT A;  3LSZ A;  4K8M A;  3MWH A;  2HI7 A;  5A4V A;  2OKA A;  3F4S A;  3D0Z A;  2I1U A;  1NHO A;  5A4W A;  3P8W A;  4PQH A;  1PSQ A;  1THX A;  5IOX A;  2YV7 A;  3ZFL A;  2CQ9 A;  3QFB C;  2YWM A;  3IPZ A;  2JZT A;  3LYP A;  1X9M B;  1ILO A;  3IXR A;  5CRE A;  5GSS A;  4MPF A;  1SK2 A;  2JU5 A;  3HA9 A;  2HRA A;  2YOI A;  4D73 A;  3HVX A;  1F3A A;  1OYJ A;  4G0L A;  1HD2 A;  2OE3 A;  5L71 A;  3PPU A;  2F8A A;  1PN0 A;  5IIZ A;  5F06 A;  4V1A g;  4LL1 B;  2FHE A;  4ML6 A;  1ML6 A;  3VUR A;  1GUH A;  1T8E B;  4POM A;  1T4Y A;  2C80 A;  4ZL7 A;  2J23 A;  5J9B A;  4P3Y B;  3M9K A;  4WEY A;  2IMD A;  5E59 A;  4J2F A;  2VLT A;  3IK9 A;  20GS A;  3C1R A;  2OBK A;  3TKP A;  3ZMK A;  3SBC A;  2GZP A;  3TCO A;  2L59 A;  4H86 A;  2JAD A;  2DJ3 A;  1XWA A;  1CQH A;  4YAV A;  5IOW A;  3KH9 A;  3IC4 A;  5IMZ A;  5BRT A;  1EGO A;  2H8L A;  5FT3 A;  1IYI A;  1B4Q A;  1K0D A;  3ZYW A;  2LJA A;  2CVD A;  1JZO A;  3GST A;  1GLQ A;  2PWJ A;  4ZB9 A;  1TK5 B;  3UVH A;  2J9H A;  3ZLP A;  3EU3 A;  2H1A A;  3FMW A;  2VM1 A;  1AIU A;  3I6A A;  1SJ6 A;  4POB A;  5EPF A;  6GSW A;  3RDW A;  3WGD A;  3UAP A;  2VCZ A;  4MMM A;  3A5I A;  5CO3 A;  4BVY B;  1GP1 A;  2EIO A;  3NZN A;  4F9Z A;  6GSS A;  2VAF A;  2E0Q A;  4J56 E;  3CTG A;  4XS1 A;  1XW5 A;  3BD2 A;  2TRC P;  2IMI A;  2LEG A;  1SEN A;  3G7Y A;  1WMJ A;  4G9H A;  12GS A;  4WF4 A;  5ECL B;  1QQ2 A;  16GS A;  2VUP A;  5CRH A;  3BOA A;  2L57 A;  11GS A;  5G5E A;  4LLR A;  1T7P B;  1TJD A;  1IYH A;  2MMO A;  2N5A A;  2NTO A;  4IQA A;  3TUE A;  2RLI A;  3VWW A;  4ZB6 A;  4NV5 A;  3KXO A;  3PIN A;  1K0M A;  1BX9 A;  3KH7 A;  1TXX A;  1S3A A;  2DKI A;  3QPM A;  5A5K A;  3FR9 A;  3ME7 A;  2FGX A;  4V1A p;  3UEM A;  3RHB A;  4XIH A;  4O5R A;  5B6M A;  1O8X A;  1ACV A;  1V40 A;  5KN0 A;  3UJ1 A;  1OC9 A;  2WZ9 A;  1H4O A;  4BWQ A;  3CSI A;  3IV4 A;  1PKW A;  3QMX A;  2CAI A;  2PBJ A;  3NIV A;  5CRG A;  1XIY A;  4NV2 A;  3C7M A;  5DAL A;  1K0C A;  2O85 A;  1WJK A;  1QMV A;  1R7H A;  1EOG A;  2YWN A;  2ON5 A;  4JRR A;  3HZ8 A;  5EL8 A;  1O73 A;  3BCI A;  4QQ7 A;  3HYP A;  2H72 A;  3EMP A;  3QD9 A;  1YEX A;  1K3O A;  3QAV A;  3M1G A;  4IW9 A;  3KP8 A;  2F51 A;  3RAZ A;  3VFI A;  5ECI B;  5IM9 A;  1QK8 A;  2XBI A;  1WRY A;  4PNG A;  5ECR B;  1C72 A;  5H5R A;  3GX8 A;  2FA8 A;  1B48 A;  2WJU A;  4PUA A;  2IL3 A;  1PMT A;  2ES7 A;  4RQX A;  4MDC A;  3O6T A;  4IP1 A;  3FZA A;  4QL9 A;  1PKZ A;  3GTU A;  5IMF A;  2H70 A;  1X9W B;  3E0U A;  3GL3 A;  4G0I A;  3ED3 A;  1VRS D;  3VK9 A;  3MDK A;  3F8U A;  1U87 A;  1QGV A;  1ST9 A;  5HFK A;  1GUM A;  3TRQ A;  4BA7 A;  3IAS 2;  2HXK A;  4ZBD A;  1M0U A;  1XZO A;  4GQF A;  3ZZX A;  1YKA A;  1SKW B;  2AJQ B;  2P5R A;  4XS4 A;  4MAB A;  5DBQ A;  1JLW A;  3J7Y k;  5F07 A;  2TRX A;  4YH2 A;  3L78 A;  1X0R A;  4CDO A;  4I6X A;  3APO A;  2N5B A;  2HRN A;  4GCI A;  3GN3 A;  5DJM A;  1BYE A;  1GSQ A;  1USB A;  2XPE A;  1ZOF A;  1G6W A;  5H5Q A;  1HNC A;  1RW1 A;  4EL1 A;  4D73 B;  2I81 A;  2LNS A;  4G10 A;  4KB3 A;  1VGL A;  2V6K A;  2XPD A;  4WBJ A;  1ERW A;  2OAD A;  4O92 A;  3DRN A;  3LFL A;  4L5L A;  2MYG A;  1OC3 A;  1TRV A;  3VI5 A;  1A2L A;  3WT1 A;  1UVZ A;  1M99 A;  3FZ5 A;  1ZYN A;  2H6X A;  2F3M A;  3KGK A;  4IS0 A;  2YAN A;  1NHY A;  4XRD A;  3ZRD A;  3F63 A;  3I69 A;  3WD6 A;  2KHP A;  3L9S A;  1F2E A;  5IMC A;  8GSS A;  4MH2 A;  2L5L A;  2DBC A;  2N5F A;  1WPI A;  6GSU A;  1X5C A;  3C8E A;  5J5N A;  1KBN A;  4JE1 A;  1JZR A;  1KTE A;  3TJF A;  3KMO A;  2AUV A;  2L5O A;  4MZB A;  4BPY A;  3QDN A;  4IN0 A;  5BMU A;  2WGR A;  4PXO A;  4ID0 A;  3HKR A;  1XOB A;  3HD5 A;  4G19 A;  3W8S A;  1NW2 A;  4ULX A;  2FCH A;  1WOU A;  2I9H A;  2O7K A;  2H71 A;  2DIY A;  3VWX A;  3TJG A;  4TR4 A;  5IPH A;  2BJX A;  1NM3 A;  2IJY A;  3E9J B;  3EYT A;  4OCF A;  2FWH A;  1XVQ A;  4POK A;  3LJR A;  3GUR A;  1A2M A;  5ELA A;  2H1D A;  3AY8 A;  2WCI A;  3IK7 A;  2OE0 A;  3F4R A;  2I4A A;  6GSY A;  1ZL9 A;  4GSN A;  1MEK A;  2ALB A;  1Z5Y E;  4RI6 A;  1ERV A;  1SL2 B;  2XHF A;  3WYW A;  1GUL A;  1R5P A;  3LOR A;  3MYD A;  4WBR D;  1FAA A;  1GUK A;  4GF0 A;  4TKY A;  3GSS A;  2CX3 A;  4JR4 A;  5CAX A;  1Q98 A;  2NPB A;  4E8E A;  4KCA A;  1SJZ A;  4F82 A;  5IPG A;  2C0F A;  4KSO A;  3HJM A;  3EC3 A;  1GLP A;  5ECS A;  1OC9 B;  4Z2U A;  4L0W A;  2F8F A;  2FLS A;  3EWL A;  3HHV A;  2L4C A;  5ECM B;  4IKH A;  4ECI A;  1JLV A;  2NDO A;  9GSS A;  1QUW A;  5HQP A;  1TU8 A;  4HJ2 A;  2CV4 A;  2R4V A;  1B9Y C;  5CP1 A;  1R26 A;  3GH9 A;  3PR8 A;  4ECC A;  4PX1 A;  2LRC A;  1AAZ A;  4GQC A;  1TRW A;  2RM5 A;  4V2L A;  4HU9 A;  3K8N A;  5AIX A;  6GSV A;  4GLT A;  2V2G A;  4NHW A;  4IJ3 A;  4OMV A;  4EDY A;  3KD0 A;  3F6F A;  2YWO A;  2VCX A;  2R0G A;  3EVI A;  4WXT A;  2DIZ A;  2HT9 A;  5DVB A;  4HZ2 A;  3CSH A;  3DXB A;  1EP7 A;  2R3X A;  2LTK A;  4TN8 A;  2NBS A;  4HQS A;  4V2M A;  1Y6E A;  2DLX A;  4K5S A;  4Q5N A;  1XWB A;  1B9X C;  2GZZ A;  1GSU A;  3TJJ A;  5EY6 A;  1OAZ A;  4ACS A;  5LD0 A;  3RBT A;  2RUF A;  3TOU A;  2CVK A;  2H1B A;  4KSM A;  4XS4 B;  1PQN A;  1WP0 A;  4ICY A;  4N0V A;  3WT2 A;  4EIQ A;  2E7P A;  5GZZ B;  1YKC A;  4NPB A;  2H01 A;  2H0H A;  2MMN A;  4J57 E;  3MAK A;  2X8C A;  4Z2R A;  3G7J A;  2DJ2 A;  2HZF A;  3D5J A;  5AN1 A;  1K3Y A;  1OE8 A;  3HJP A;  5B8B A;  4TVE A;  1OVN A;  1DSB A;  1XOA A;  1XVW A;  3L9U A;  5ENU A;  4MPG A;  4HUA A;  4BVX A;  2JSY A;  2QSI A;  4G0K A;  3W6G A;  4PQ1 A;  1FOV A;  3Q6O A;  3TKS E;  4G2E A;  3BJ5 A;  5D9T A;  4BL7 B;  4X4J A;  4LL4 B;  2C4J A;  1B4P A;  1O85 A;  2B1L A;  2FA4 A;  3FK8 A;  4ZL9 A;  2FD3 A;  3C1S A;  3IRA A;  3O3T A;  2FWG A;  5IMV A;  1EZK A;  2YJH A;  4DVC A;  4ZIJ A;  3M3M A;  2YV9 A;  5CRW A;  1ZMA A;  4MJB A;  1T00 A;  4EIP A;  3MIX A;  3MSZ A;  2C0G A;  4QL7 A;  2H6Y A;  2A4V A;  2P31 A;  4YAP A;  3M8N A;  4Q5F A;  4WR5 A;  1O81 A;  3KIJ A;  1TRU A;  3GL5 A;  2KP2 A;  4I8B A;  4HZ4 A;  3UAR A;  2WDU A;  3EUR A;  1XBS A;  5B8A A;  3GFK A;  1U3A A;  1WIK A;  1ON4 A;  2GT5 A;  2HRF A;  1G7O A;  5CYY A;  3D21 A;  2C1Y A;  1CQG A;  3GX0 A;  4ZIL A;  2PER A;  4K7N A;  2YZH A;  4CHS A;  1URM A;  1O7U A;  2YNX A;  1TI1 A;  1PN9 A;  3ERW A;  4PQI A;  2R2J A;  2HZE B;  5E4W A;  1PA3 A;  2C0D A;  2PMT A;  1BED A;  2VCW A;  1FW1 A;  5JWQ B;  3ZIV A;  1TW9 A;  3HVS A;  2OE1 A;  1T3B A;  1TOF A;  4FYC A;  2A4H A;  3KM6 A;  4KGI A;  2I3Y A;  1OKD A;  2IFQ A;  3H4K A;  1V58 A;  1F37 A;  3TKS A;  4POL A;  3ERF A;  2BMX A;  2G0F A;  2HNL A;  4RQR A;  1A0R P;  3APS A;  5DQY A;  2AB6 A;  1THO A;  1FO5 A;  2CAQ A;  1EWX A;  3EIN A;  2LS5 A;  1PX6 A;  4PTS A;  3DD3 A;  4O32 A;  2HSM A;  2YJ7 A;  1T4Z A;  2PU9 C;  2H19 A;  1A0F A;  1HNB A;  1O8W A;  3CSJ A;  2VL3 A;  3L0H A;  1SYR A;  3GYK A;  4PNF A;  1X9S B;  4JR6 A;  1ZYQ B;  1W89 A;  3HY2 A;  4NHZ A;  3ZFB A;  2IME A;  4E8H A;  3GHA A;  1V9W A;  1LJR A;  4KND A;  2G2Q A;  3L9V A;  1HQO A;  1TRS A;  3FR3 A;  4Z7X A;  3LG6 A;  1GRX A;  1U6T A;  2A2S A;  4TOP A;  3H1N A;  5G30 A;  4KCE A;  4NWY A;  2CA8 A;  4MJC A;  1M9A A;  1MTC A;  1MD4 A;  4KE3 A;  2V32 A;  4JED A;  2MZC A;  1FOH A;  2DJ0 A;  3F6D A;  4K2D A;  2B5X A;  1U3I A;  4Q5R A;  3FYG A;  5D9V A;  2HYX A;  2VL2 C;  5HR2 A;  3FEU A;  4EUY A;  2TIR A;  5F0G A;  5D9W A;  4XRA A;  1A8Y A;  1AQV A;  1EGR A;  4OFT A;  2CX4 A;  3BBY A;  3VWV A;  3Q19 A;  1ABA A;  3KCM A;  5KN1 A;  1BQ7 A;  4RI7 A;  1GTU A;  2V6O A;  3LXT A;  3UBL A;  3SWL A;  3H8Q A;  3D4T A;  3A2W A;  3ERG A;  1UA5 A;  2YWI A;  1GH2 A;  3DVX A;  2FWF A;  2PGT A;  1S3C A;  1VF4 A;  5C04 A;  2HE3 A;  3KTB A;  22GS A;  1FG4 A;  4IEL A;  1Z6M A;  3RPN A;  4IJI A;  1HYU A;  4I5Q A;  5KEJ A;  2CZ3 A;  4ECB A;  2YZU A;  5F05 A;  4N30 A;  2L6C A;  4K0G A;  5IMA A;  4I97 A;  2REM A;  5JCU A;  3ZIJ A;  1ERU A;  4HJM A;  3IAM 2;  2RII A;  4CW9 A;  2GSS A;  3M0F A;  3DYR A;  2B5E A;  4FO5 A;  5ECO B;  2X8G A;  2GTU A;  2VM2 A;  3GMF A;  3VLN A;  3D22 A;  2GZY A;  1G7E A;  4CY6 A;  2M80 A;  4LA1 A;  3HJO A;  2HFD A;  1UN2 A;  2DJK A;  3CTF A;  3EPT A;  4OCE A;  5DCH A;  3GRX A;  2ZCT A;  4TR0 A;  4TR1 A;  4FQU A;  5ECQ B;  2H75 A;  5C00 A;  3UIW A;  1SD9 A;  2H76 A;  1YEP A;  3GIX A;  4XTS A;  3KEB A;  4I2T A;  3P90 A;  5G31 A;  4GRF A;  4IQ1 A;  4IGJ A;  4HI7 A;  1KNG A;  2X4A A;  4OFN A;  3TRP A;  4GXZ A;  4Z2T A;  3IE3 A;  2PVQ A;  5J41 A;  3FZ9 A;  4OFM A;  2PN8 A;  1SK0 A;  4BVY A;  1K3L A;  1V57 A;  10GS A;  2M72 A;  4HU7 A;  1Z9H A;  1BAY A;  3UVT A;  3EU4 A;  3H93 A;  4ML1 A;  1V98 A;  3UBK A;  4ZBA A;  2QGV A;  3TGZ A;  2DKH A;  5JCG A;  1WWJ A;  4MH3 A;  2DJJ A;  4MZC A;  1GNE A;  3GKX A;  1MDJ A;  2D2Z A;  3G7I A;  4X43 A;  4IBP A;  1G6Y A;  2OA7 A;  2WFC A;  7GSS A;  2C3N A;  3LYK A;  2K8V A;  3IOS A;  3FW2 A;  1FB0 A;  2DMM A;  4KX4 A;  4YKG A;  1J9B A;  5H5S A;  3WGX A;  2FWE A;  3O76 A;  3QAW A;  3TDG A;  3IBH A;  4GWR A;  2O89 A;  2H6Z A;  2MMZ A;  4AJ7 A;  1J0F A;  1AC1 A;  2FY6 A;  4TRX A;  4KDU A;  1Q4J A;  1YF0 A;  5DAL B;  2LQQ A;  3F0I A;  2VLU A;  1T1V A;  4ISD A;  5FHI A;  3ZVJ A;  1H75 A;  1RQM A;  2IIY A;  1S3D A;  1Z6N A;  2E2M A;  2VIM A;  3QAG A;  1XW9 A;  2GQK A;  2VOC A;  3GUS A;  3ZVJ D;  4NMU A;  1Z3E A;  2K6V A;  4AF2 A;  3ZTL A;  1FVJ A;  3CBU A;  1A8L A;  2CVB A;  3IR4 A;  2IPA A;  4LMW A;  2VLV A;  4X1U A;  2LUS A;  3KJY A;  1PL1 A;  2B7J A;  1GL8 A;  2R6K A;  1EEM A;  2LST A;  4KW6 A;  3GTU B;  4PGT A;  2YN1 A;  3C71 A;  5AGY A;  4F03 A;  1XW6 A;  2EIQ A;  3ZL5 A;  2A2R A;  3APQ A;  5ECK B;  3DWV A;  4TXO A;  4KUN A;  4FYU A;  1XCC A;  2P5Q A;  4EKZ A;  5COH A;  3FRC A;  4ECJ A;  5HFG A;  1WE0 A;  2B5Y A;  4K1F A;  4FIW A;  2PVO C;  2PUK C;  4AJ8 A;  4LMV A;  1J08 A;  1GTA A;  5HR0 A;  4DSS A;  3M9J A;  2MBT A;  4GSS A;  2C0E A;  4CY8 A;  2H74 A;  4XCS A;  5HR3 A;  1NSW A;  3IA1 A;  4K6X A;  2X49 A;  4EDZ A;  3C73 A;  2KP1 A;  3QR6 A;  3F3R A;  1YF1 A;  3R2Q A;  3PH9 A;  4L0U A;  1XFL A;  3IHG A;  1DE2 A;  3HZ4 A;  3UOM A;  4HDE A;  2VCT A;  1SKS B;  1YQ1 A;  3DVW A;  1Z7P A;  3KP9 A;  1ERT A;  1YZX A;  2LJK A;  3R3E A;  3WGE A;  4JBB A;  1SL0 B;  4TW5 A;  4HS1 A;  3FHK A;  3HDC A;  5ID2 A;  3KZQ A;  1ZYE A;  2RM6 A;  4ZB8 A;  1M7T A;  1PGT A;  3QCP A;  1DE1 A;  1JZW A;  4OO5 A;  3TKQ A;  4KDX A;  3DEX A;  4MF7 A;  1EV9 A;  1TTZ A;  4ILF A;  1E2Y A;  2F9S A;  1N8J A;  5KN2 A;  1ZYP A;  2O87 A;  4HQZ A;  2LRN A;  4EO3 A;  2C3T A;  3US3 A;  3HXS A;  4O5Q A;  5IQY A;  5IO0 A;  2MMA A;  3UL3 A;  4TR1 B;  2ZUP A;  1GSF A;  2GLR A;  4MLY A;  5LCZ A;  5FWG A;  3BCK A;  5GAP D;  1SYX A;  4DSQ A;  4N10 A;  1GSE A;  2K8S A;  4MP4 A;  3TB2 A;  1SKR B;  5LNK e;  2B7K A;  3I43 A;  2WB9 A;  3LEF A;  1X5D A;  5D96 A;  1EP8 A;  5DAK A;  2YCD A;  1BJX A;  2IMK A;  2H30 A;  1HNA A;  2KUC A;  1SU9 A;  1K0O A;  2HLS A;  2LNT A;  4KA0 A;  4MZW A;  2KLX A;  3LW9 A;  1PD2 1;  3GKM A;  3GA4 A;  3CYN A;  3IDV A;  1X5E A;  2GDR A;  2YPM A;  1XWC A;  3CMI A;  2DSA A;  4MCU A;  3GKK A;  3F9U A;  1M9B A;  5B7C A;  3ME8 A;  2OBI A;  3N5O A;  4MJE A;  1I9D A;  3F4T A;  2R37 A;  4F2I A;  3FKF A;  1JFU A;  2L6D A;  3VPT A;  4MJA A;  14GS A;  4RUV A;  5G1L A;  2O8V B;  3F3Q A;  1YY7 A;  2GQL A;  3E3E A;  4KDY A;  4EXJ A;  2GST A;  3N9J A;  1SJI A;  4OO4 A;  1GNW A;  2NVL A;  2X8H A;  1OKT A;  3HCZ A;  5D8I A;  3LWA A;  1AW9 A;  4HEA 2;  3TOT A;  4L8E A;  4AJ6 A;  3GKN A;  2ON7 A;  2YP6 A;  3TKS C;  5AIV A;  1K0N A;  3VWU A;  1FVK A;  4WKW A;  4PUF C;  1GSY A;  1TI3 A;  4K7O A;  4O5U A;  4FH8 A;  2K9F A;  5DDL A;  1GTI A;  5G2Z A;  1XWG A;  5A4U A;  3J7Y b;  2EIR A;  4MF5 A;  2P0G A;  1MDI A;  4K0N A;  1XWK A;  3S9F A;  2VL9 A;  5KN3 A;  5B6N A;  1SL1 B;  1DUG A;  2VL2 A;  3G9B A;  3ISO A;  1LU4 A;  1VF3 A;  4TXV A;  1AXD A;  5AIS A;  1A23 A;  4XS6 A;  2HSH A;  1K0A A;  2MBS A;  1PL2 A;  4ZBB A;  2PPT A;  3IC8 A;  4KF9 A;  4TXO B;  5J3R A;  3LGC A;  1ZZY A;  2C3Q A;  1AQX A;  1GSD A;  3ZML A;  4USS A;  4N0Z A;  1EOH A;  1E6B A;  1EEJ A;  4IP6 A;  3D6I A;  2AHE A;  5HFI A;  5JWO B;  1SD8 A;  1ZGN A;  2Z9S A;  4DSS B;  4MNN A;  2ZNM A;  3MNG A;  1QFN A;  2DC5 A;  4N11 A;  2VD1 A;  2HSY A;  4YQM A;  3W8J A;  4EC0 A;  2JSZ A;  1YDK A;  2GVP A;  2IWT A;  2JL4 A;  2XBQ A;  4JU5 A;  4HOJ A;  2AV4 A;  2EC4 A;  2JZR A;  2LKU A;  2LRT A;  4GST A;  2GT6 A;  2H73 A;  2LQO A;  4MA9 A;  4WR4 A;  4BVX B;  1TP9 A;  5INY A;  5DQS A;  1AUC A;  3GNJ A;  3CXG A;  3LXZ A;  4EE0 A;  2B6M A;  19GS A;  3A2V A;  5IMD A;  5ELG A;  3VPQ A;  5G5F A;  4Q5Q A;  2A2P A;  1R5A A;  4PUR A;  3V1W A;  5ID2 B;  4K7I A;  1BG5 A;  5JCW A;  2RUE A;  4IHU A;  3KMN A;  2QC7 A;  4OD7 A;  3CRT A;  2H1G A;  2R0C A;  1XXU A;  4BL7 A;  2X64 A;  5DCG A;  3TKR A;  3JCM L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...