3EURA

Crystal structure of the c-terminal domain of uncharacterized protein from bacteroides fragilis nctc 9343
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
140
structure length
140
Chain Sequence
AKNRLGTKALNFTYTLDSGVKGTLYQFPAEYTLLFINNPGCHACAEMIEGLKASPVINGFTAAKKLKVLSIYPDEELDEWKKHRNDFAKEWTNGYDKELVIKNKNLYDLRAIPTLYLLDKNKTVLLKDATLQKVEQYLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein
publication title Crystal structure of the C-terminal domain of uncharacterized protein from Bacteroides fragilis NCTC 9343
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
total genus 44
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2008-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3eurA00
4XHMA 1EP8A 1EP7A 1ERVA 4OWYA 2WCIA 1MTCA 1PA3A 2C3NA 2LEGA 5HR3A 3W6GA 4G10A 1K0DA 4PURA 2LJRA 3IBHA 4MCUA 4J2FA 1YQ1A 1W89A 5IMAA 1HD2A 2OKAA 4KDYA 1BG5A 1GH2A 3F6DA 1F37A 2H71A 3LYPA 3C73A 2AHEA 2H01A 2B7KA 2VLUA 1BYEA 3EMPA 1U6TA 4MDCA 1SKWB 3HY2A 2YJ7A 4WBJA 4POLA 4D73B 1PD21 1M9BA 4EUYA 4JEDA 1VRSD 5GZZB 2HSHA 4QQ7A 3EWLA 4EL1A 3QCPA 2H8LA 1GLPA 1XOBA 1LJRA 1O73A 2DJ2A 2H0IA 3LEFA 4MJCA 2M46A 3IOSA 3MDKA 1QXHA 3GFKA 3L9VA 2E0QA 2P31A 2J9HA 2OBIA 2JSYA 3H79A 1CQHA 1O85A 4MA9A 1XZOA 1XWAA 2VLTA 5DQYA 3AY8A 4HS1A 3GV1A 3ZREA 4JBBA 2MMOA 2AB6A 3VURA 2O7KA 1HNCA 2LNTA 1A2JA 2VL3A 3GKMA 5CRGA 2FA4A 2IIYA 2GT6A 3KTBA 3ZFBA 4EE0A 1TI3A 3HVXA 2KOKA 5ABRA 3IE3A 3FRCA 3HVSA 1YJ6A 5B8AA 4IW9A 1M0UA 1K3LA 2IMDA 3IAM2 4K2DA 4GF0A 4N0VA 2B1KA 2DIZA 2MMAA 4FIWA 3GTUA 3IK7A 3Q18A 3TKSC 2RLIA 2HYXA 3KD0A 2VCXA 1AC1A 2M72A 2OA7A 5IOWA 2WFCA 2O89A 2GZYA 2YV9A 4GTUA 4LL1B 4L0WA 4MF5A 2ON5A 1MDIA 3EURA 3HD5A 3F9UA 20GSA 4F82A 5JWRB 4ML1A 2CZ2A 4V1Ag 2DJ0A 4Q5NA 4OO5A 2H73A 1GNWA 5ECRB 4WETA 3ISOA 1ERWA 2LRNA 1NSWA 4ZL7A 3JCML 2FUG2 4KE3A 1SL2B 2FCHA 4KCAA 3DWVA 3MSZA 5CP1A 3W8JA 3F3RA 1U3IA 1X9WB 3GMFA 1U87A 5DJLA 4PNFA 2JZTA 1T8EB 3KIJA 3DGQA 2VL9A 3U6VA 2GVPA 1VF2A 4DEJA 3N9JA 1GWCA 3TJKA 4GQFA 5DVBA 1SK0A 4HJ2A 3UOMA 1GSYA 2DSAA 5D93A 5A4VA 1M2DA 2PMTA 1E6BA 3CSHA 2HNLA 4K1FA 3D0ZA 2KHPA 3P8WA 5IO0A 5IMZA 5EL8A 3ZRDA 1TRVA 3RHCA 2H30A 3TOTA 1THXA 2X99A 4O32A 4NPBA 1M7TA 1Q98A 2V2GA 3M9JA 3A5WA 5F07A 2G0FA 2N5BA 4KUNA 3TUEA 2C3QA 4N11A 2H6YA 3GX8A 4KX4A 18GSA 5D9TA 1ZGNA 3C7MA 2O8VB 3HYPA 2AAWA 3VFIA 2AUVA 3FZ5A 1BJXA 3BOAA 1H4OA 5ECLB 1PSQA 3ZMLA 2I4AA 4WXTA 2C3TA 4OFTA 2FWGA 3APQA 3FZ4A 4TRXA 3TKQA 4DSQA 2YPMA 4Q5QA 2VM2A 1X9SB 4POMA 5AISA 1TTZA 2FY6A 1WP0A 3NOFA 1BEDA 1V9WA 5JCUA 1GULA 4QL9A 2V6KA 3IV4A 2JU5A 2B7JA 1AQVA 2H1GA 2GSQA 3RDWA 5B6MA 3I43A 4XIHA 2K8SA 1A23A 3ZFLA 4GLTA 4WEYA 2WULA 3D4TA 2F8AA 3VWWA 1FVJA 1XFLA 1TI1A 1QFNA 2V1MA 3HXSA 1ON4A 2PU9C 3RAZA 2B6MA 3FHKA 2WZ9A 3FR3A 5HQPA 1XWGA 1O7UA 4CW9A 5F05A 3A2VA 3HJOA 1Y25A 1PQNA 1WWJA 2GQKA 4V2LA 3CTFA 4PUFC 3ERFA 1GSFA 1TP9A 1NHYA 1SKRB 2M80A 3CBUA 3Q74A 4OCEA 2LS5A 5LNKe 4TR0A 1ZCPA 2MBTA 4FYBA 4V2MA 4IBPA 3QR6A 1F3BA 3DIEA 5G5FA 5CRWA 4KW6A 1K0NA 2CX3A 4GSTA 4PNGA 2QC7A 5G30A 4I2TA 4XCSA 2HRNA 5CO3A 2LSTA 4GQCA 5J9CA 3G7JA 1DE2A 2C4JA 4EO3A 2PUKC 3LYKA 5LD0A 5C04A 2FNOA 1B48A 3NZNA 2VIMA 2DC5A 4MJEA 2L6CA 2DJKA 1R7HA 1TU7A 1AXDA 1MEKA 1BQ7A 1PX7A 3UBKA 4NHZA 1X5DA 2IMEA 3C1RA 4KNDA 3W8SA 4XS4B 4MPGA 6GSSA 1CQGA 2VL2A 1V2AA 5ENUA 3UL3A 4TR1B 4WF5A 2IFQA 4K6XA 5DAKA 4MJAA 2DLXA 3GH6A 2LKUA 2AV4A 4LA1A 3BJ5A 2YOIA 2VCWA 2IFQB 5GSTA 5HFGA 2GT5A 1TOFA 3C1SA 2TRXA 3GL5A 2GZZA 3TRPA 1GTAA 1EV4A 3GN3A 2E2GA 2LJKA 1JZDA 3LGCA 1G7OA 2VD1A 3EC3A 1HNBA 2DMMA 1A8LA 3KZQA 2H19A 4DSSB 4LL4B 2QKEA 2YCDA 4ZXGA 3DMLA 3M9KA 1Z7RA 1DUGA 1FB0A 1GNEA 4ZBBA 2QGVA 5DDLA 1IYIA 1ERTA 3P2AA 4NXIA 3CTGA 4XRAA 5CAXA 3FW2A 2R4VA 1GUMA 1Q4JA 3QPMA 3E9JB 5HFKA 5IMDA 3ZVJD 3HJPA 4AJ8A 1K3OA 2B3SA 2H0HA 2NDOA 4HQZA 1T00A 1XBSA 2HZEB 1U88A 2I3YA 2I9HA 5KN3A 1SL0B 3UARA 1PL1A 1PKZA 1A2MA 3O3TA 4LMWA 3LWAA 3F8UA 4N30A 3KH7A 5FWGA 2ALBA 1TU8A 2HXKA 4HI7A 3TDGA 1OAZA 5IPHA 2EC4A 1USBA 2OE0A 2LJAA 5DCGA 3RPPA 2X64A 3APSA 4ECIA 3PR8A 1FVKA 1VGLA 3ME7A 3L0HA 5ECSA 5J41A 5ECPB 1A0RP 1MDKA 3TKSE 4KA0A 1XVQA 2C0GA 3DD3A 2EIRA 4ZL9A 5B8BA 2RUEA 2IWTA 3EINA 2GLRA 5DALA 2CZ3A 1EOGA 4KDXA 3TOUA 1B4PA 5A4UA 1VF1A 1SK1A 2YNXA 3A3TA 1ZZYA 1A8YA 3J7Yk 1YKCA 3ZMKA 1YZXA 3L9SA 2E2MA 2H6XA 3EU3A 1GUKA 1OE7A 4NHWA 5G2ZA 4IJ3A 3DXBA 3HJMA 4TW5A 1UVZA 3FZAA 1LBKA 3G7YA 1WRYA 3ZYWA 3RPNA 1OC8A 2JL4A 5DCHA 3PGTA 1V58A 1YF0A 3IA1A 4BWQA 1O81A 5IMCA 4NWYA 2B1LA 4ZB6A 1NW2A 3GL3A 3ED3A 4MABA 4X1UA 5ID2A 4EVMA 1J9BA 3F4RA 3QD9A 4YAPA 4ULXA 1WPIA 3WT1A 4K0NA 1SK2A 4ZBAA 3CRUA 3GKXA 2MBSA 4FYUA 22GSA 4OCFA 5ECMB 2OE1A 1AW9A 4ZL8A 3LG6A 6GSXA 1GSSA 4I97A 4HJMA 1V98A 4F0CA 2CAIA 5ECHB 5IPGA 3Q6OA 1B4QA 2VCZA 1FW1A 4MPFA 4IP6A 1Z9HA 3HVVA 1XW9A 2BMXA 4ZBDA 4MZWA 5INYA 2YWNA 2DJ1A 1XW5A 3HKRA 1J0FA 1V40A 3GTUB 3CYNA 1TK0B 1SYRA 4MH2A 4WF4A 1AIUA 2I81A 2VUPA 2X8HA 3FKFA 2MMZA 2YN1A 4E8EA 3FK8A 1S3DA 1PL2A 2JZSA 2CA8A 3UMAA 2OBKA 2A2SA 1TRUA 2RM6A 2E7PA 4TR3A 2BJXA 3QMXA 2OADA 4PQHA 1GUHA 2WGRA 1WJKA 4XS1A 1R26A 4XTSA 1AQWA 2FWFA 1FAAA 4NV5A 3F0IA 5JCGA 4X0XA 14GSA 4GXZA 1ZOFA 2CV4A 3K8NA 2PVOC 3F6FA 4MMMA 5J4UA 2PPTA 3GNJA 4KDUA 2CT6A 1EOHA 2YJHA 2EIQA 4BWSA 2X8CA 4KSOA 4ZB8A 1HQOA 1Z6MA 2MZCA 3CMIA 2EIOA 5IMFA 2VO4A 11GSA 10GSA 2C80A 4TKYA 2IMKA 5G31A 3UJ1A 3VI7A 5E4WA 3G9BA 4PGTA 5HFIA 4Q5RA 2L59A 1KEBA 4DVCA 4F2IA 1K0CA 4MF6A 16GSA 2HT9A 4J56E 1HYUA 1B9YC 3WYWA 2LUSA 2HRFA 3A2XA 3UVHA 1SKSB 3H4KA 1NHOA 1N8JA 1ACVA 3FY7A 1K0AA 2QSIA 3KJYA 1KBNA 1SD8A 1XVWA 2K6VA 1ILOA 2K8VA 1PGTA 1K0OA 2PGTA 4JU5A 5H5QA 4EDZA 2NVLA 5F8BA 1ABAA 3HDCA 3VPQA 4KCEA 4AJ6A 5ECNB 5KN0A 2K18A 4JE1A 1OYJA 2L5LA 3APOA 1TDIA 3HA9A 3QAGA 1R5AA 3WGEA 2OACA 5EY6A 1B8XA 2NTOA 5E59A 1W4VA 2OJLA 1WMJA 2AYTA 2C0DA 4LLRA 4GCIA 4TOPA 13GSA 2MMNA 2H6ZA 2P5QA 4GSNA 17GSA 1R5PA 4EXJA 5G1KA 1M99A 4BPYA 4ZB9A 1A24A 2R5GA 1Z3EA 3M3MA 1GSUA 4RI7A 5CREA 1ERUA 2LQOA 4EF0A 4G9HA 1F2EA 5D9WA 2RIIA 5KEJA 1JZWA 3UIWA 3VWXA 1GLQA 3EMXA 1RK4A 2CX4A 3LXTA 4JR6A 2HSYA 6GSYA 2KP2A 3CRTA 3BBYA 3WGXA 3VPTA 4HU9A 2A4VA 3EE2A 2WB9A 1GRXA 5IM9A 3I69A 3DKSA 4BVXA 5D73A 3P90A 2PN8A 1ZL9A 2FWEA 1YEPA 3WT2A 4DSRA 2V32A 4GSSA 3LJRA 2VM1A 1JLVA 2JACA 4HDEA 2PBJA 4OFMA 2H66A 3QAVA 3IPZA 2XPEA 3O6TA 2G2QA 2YWIA 2K9FA 4YQMA 4IGJA 1GP1A 2C8UA 5ECKB 4MZCA 5JWQB 2O87A 3KP9A 1HNAA 2H1BA 1M2AA 4ACSA 1YKAA 4JR4A 2X8GA 1V57A 1VF4A 1THOA 1T4YA 1SL1B 2FHEA 5A5KA 2WS2A 3QFAC 1PN9A 3TJBA 1ZYQB 3KXOA 2Z9SA 2VCTA 5DAKB 1WIKA 3CSIA 2JSZA 4L8EA 5CRHA 1XWCA 3A2WA 3QFBC 4L5LA 2VAFA 4OO4A 2HFDA 1PRXA 2IMIA 2L4CA 3IXRA 3O76A 5ECQB 4ECBA 2KUCA 2B5YA 2F9SA 2JZRA 1Z6NA 4O5RA 2GQMA 3HCZA 1OC9A 3IHQA 5EVOA 3IK9A 4EKZA 1OC9B 1EEJA 1SJ6A 4TN8A 3ZL5A 4K9ZA 2WRTA 3ERWA 3GRXA 1I9DA 2FD3A 4IHUA 3LFLA 4WKWA 3UEMA 2LRTA 3VI5A 3I6AA 1QMVA 4PXOA 3GYKA 5ELGA 4HU7A 5H5SA 3BD2A 3KH9A 4NAXA 5IMVA 1XW6A 2LNSA 2IJYA 3ZTLA 1H75A 4Q5FA 3ZIJA 3D4MA 1OKDA 1PKWA 4JZQA 4MK3A 2OE3A 3LSZA 4L0UA 3L4NA 1EZKA 2DJ3A 5DQSA 5AN1A 4IP1A 3GURA 1T7PB 1MDJA 2WDUA 4E8HA 1FB6A 1M2BA 4XRDA 4YH2A 1M9AA 3D5JA 3D6IA 4RUVA 5ECOB 5IIZA 2ZUPA 5CYYA 3F4TA 1TRSA 2YZUA 4IN0A 4HOJA 4YAVA 3U5RE 2HZFA 3TKSA 3GSSA 4AJ7A 1GL8A 3F4SA 2FLSA 3DVXA 5KN1A 1SD9A 3EU4A 2XPDA 2P5RA 3H93A 5HR1A 3DVWA 2BTOT 5DALB 2REMA 4Z7XA 4EC0A 2H76A 2VL2C 5IOXA 1GTBA 3RHBA 5IQYA 5AIVA 3LQ7A 4LMVA 1X9MB 2HE3A 2XHFA 2GGTA 2YWOA 4K7IA 1G7EA 3ERGA 2GSRA 5IO2A 1UN2A 2H1DA 2CQ9A 4IS0A 1B9XC 4HUAA 5J5NA 4EDYA 1GSDA 3DYRA 1XXUA 4N10A 1A2LA 1OC3A 4AF2A 1O8XA 1XWBA 4PUAA 1VF3A 2C1YA 3P7XA 3WD6A 2P0GA 3R2QA 3KMNA 2IL3A 4D73A 4YQVA 1ST9A 3CSJA 3FR6A 4PX1A 1F9MA 1FHEA 2GSTA 3UVTA 3TGZA 4TXOA 2MYGA 3TB2A 4IELA 2CVDA 4ID0A 5ID2B 3VWVA 4F0BA 2LV3A 3TJJA 2TIRA 4TXOB 3GH9A 3VWUA 5F06A 5HR2A 1RQMA 2XBQA 2AJQB 2F51A 1YDKA 3ME8A 2DBCA 3IAS2 6GSVA 1PMTA 4TVEA 1OKTA 4KGIA 3QAWA 2HI7A 2R37A 1GSQA 4O92A 3KP8A 1DSBA 2NBSA 4NMUA 1XWKA 5EPFA 4K0GA 4XS6A 4I5QA 5DBQA 4HZ4A 1SENA 2V6OA 4PQ1A 1A0FA 2NPBA 1ZMAA 4IJIA 1U3AA 3BCIA 5C00A 1AQXA 1T3BA 3GA4A 4IQAA 1QGVA 5HR0A 3QOUA 1UC7A 2H70A 4V1Ap 1R4WA 2IN3A 2H0GA 3DEXA 4KSMA 4OFNA 2B5XA 1QQ2A 2VOCA 1QUWA 3GUSA 2VCVA 4ECCA 1MD3A 2L4QA 3F3QA 3N5OA 1JFUA 1Z7PA 2R3XA 3OR5A 2HLSA 4O7HA 3V1WA 1MD4A 3KTLA 2RM5A 3D22A 4RQRA 3BCKA 2IMFA 3H1NA 4POKA 1JZOA 2H74A 4RI6A 3TRXA 4ML6A 1YEXA 9GSSA 5FHIA 1N2AA 5B7CA 2GZPA 3KM6A 3IR4A 1T1VA 4GWRA 3ZIVA 1XOAA 3LXZA 2LTKA 3GSTA 1FOVA 2VCQA 2CAQA 5JWOB 1S3CA 5GSSA 4IQ1A 3HZ4A 5D8IA 4PQIA 1BAYA 3E0UA 4JRRA 2GDRA 2VLVA 1TK8B 4MLYA 1X5CA 2L5OA 1EV9A 4KH7A 3FYGA 3IC4A 3CXGA 4YQUA 4WR4A 2H72A 1TXXA 5JCWA 3HZ8A 1SU9A 6GSTA 4G19A 4TR4A 2H75A 3WGDA 2A2RA 6GSWA 3GKNA 1TRWA 3I9V2 4X43A 3MWHA 5ELAA 2DJJA 7GSSA 4OD7A 3HHVA 2DMLA 1OVNA 4HZ2A 2WJUA 1FG4A 1QK8A 5B6NA 1BX9A 4CHSA 2R2JA 4H86A 4P3YB 1AUCA 1LU4A 2CVKA 4WBRD 5J9BA 3F63A 3Q19A 1TKDB 5G1LA 1O8WA 4GRFA 1NM3A 1URMA 2B5EA 2V41A 4OMVA 3TCOA 1SYXA 2FA8A 3SBCA 1EWXA 1OE8A 2H1AA 1ZYEA 1X0RA 4IKHA 2O85A 5D9VA 2ES7A 1JZRA 4BL7A 4AGSA 3KMOA 3MNGA 1UA5A 2FWHA 4ILFA 3G7IA 1EGRA 3PINA 1AAZA 2GS3A 1TJDA 2KLXA 2J23A 2YV7A 1RW1A 5D9XA 3M0FA 2I1UA 4MJBA 3TJFA 4BVYA 1JHBA 3KCMA 4K7OA 4FH8A 4I2UA 4V2NA 3TJGA 1JLWA 3PH9A 3M1GA 1K0BA 5H5RA 1YY7A 19GSA 4FO5A 1TW9A 5GAPD 1S3AA 6GSUA 1XPVA 3GX0A 1G6YA 5J3RA 4NV2A 2F8FA 1EEMA 2GSSA 2L57A 2XBIA 3UBLA 4MZBA 5AIXA 4N0ZA 3TKPA 5CNWA 3L78A 1O6JA 2ZCTA 4ZIJA 2F3MA 1WE0A 2CVBA 2N5FA 3FEUA 1GTUA 2DIYA 3KEBA 4QL7A 3LORA 3MAKA 1WOUA 1C72A 3TRQA 1J08A 4KAEA 5A4WA 3S9FA 2ON7A 2TRCP 3VK9A 1GSEA 4XS4A 4ZILA 3KGKA 1Y6EA 1DBYA 1G6WA 2R6KA 3FZ9A 4TR1A 1SJZA 4RQXA 1XCCA 2PERA 1YF1A 5LCZA 4WR5A 2JADA 3ZITA 3GIXA 2LQQA 2FGXA 5DJMA 5D96A 1KNGA 2D2ZA 3DRNA 3C71A 4CDOA 2XC2A 1Z5YE 1KTEA 1IYHA 4F9ZA 2C0FA 3NIVA 5F0GA 2PVQA 3ZLPA 1DE1A 4I6XA 4G2EA 3L9UA 3UAPA 1XIYA 5KN2A 2YWMA 2YANA 3C8EA 4DSSA 2IPAA 3EVIA 3EYTA 3QDNA 3TKRA 3GKKA 1T4ZA 3VLNA 4TXVA 2N5AA 1F6MC 1K3YA 1PX6A 2YP6A 4F03A 3SWLA 1I5GA 5AGYA 1EGOA 1FO5A 3US3A 2RUFA 4POBA 1E2YA 3FR9A 5GAND 1GTIA 3IRAA 12GSA 1K0MA 4MF7A 3H8QA 2GTUA 3ZZXA 5FT3A 2VD0A 4L5OA 3GHAA 3J7Yb 2YZHA 2HZEA 1G0TA 5L71A 5G5EA 4J57E 2PWJA 4MH3A 4K7NA 1ML6A 3D21A 1F3AA 2L6DA 4K8MA 5CRDA 4IVFA 1SJIA 3ZVJA 4KB3A 4BA7A 4HQSA 5ECIB 4ECJA 8GSSA 1TK5B 1X5EA 2KP1A 5COHA 4HEA2 3E3EA 4ISDA 4I8BA 3IDVA 2LRCA 3RBTA 2C0EA 4FYCA 2GQLA 2ZNMA 3M8NA 4MP4A
chains in the Genus database with same CATH superfamily
4XHMA 1EP8A 1EP7A 1ERVA 4OWYA 3EPTA 2WCIA 1MTCA 1PA3A 2C3NA 2LEGA 5HR3A 3W6GA 4G10A 1K0DA 4PURA 2LJRA 3IBHA 4MCUA 4J2FA 1YQ1A 1W89A 5IMAA 1HD2A 2OKAA 4KDYA 1BG5A 1GH2A 3F6DA 1F37A 2H71A 3LYPA 3C73A 2AHEA 2H01A 2B7KA 2VLUA 1BYEA 4G0IA 3EMPA 1U6TA 4MDCA 1SKWB 3HY2A 2YJ7A 4WBJA 4POLA 4D73B 1PD21 1M9BA 4EUYA 4JEDA 1VRSD 5GZZB 2HSHA 4QQ7A 3EWLA 4EL1A 3QCPA 2H8LA 1GLPA 1XOBA 1LJRA 1O73A 2DJ2A 2H0IA 3LEFA 4MJCA 2M46A 3IOSA 3MDKA 1QXHA 3GFKA 3L9VA 2E0QA 2P31A 2J9HA 2OBIA 2JSYA 3H79A 1CQHA 1O85A 4MA9A 1XZOA 1XWAA 2VLTA 5DQYA 3AY8A 4HS1A 3GV1A 3ZREA 4JBBA 2MMOA 2AB6A 3VURA 2O7KA 1HNCA 2LNTA 1A2JA 2VL3A 3GKMA 5CRGA 2FA4A 2IIYA 2GT6A 3KTBA 3ZFBA 4EE0A 1TI3A 3HVXA 2KOKA 5ABRA 3IE3A 3FRCA 3HVSA 1YJ6A 5B8AA 4IW9A 1M0UA 1K3LA 2IMDA 3IAM2 4K2DA 4GF0A 4N0VA 2B1KA 2DIZA 2MMAA 4FIWA 3GTUA 3IK7A 3Q18A 3TKSC 2RLIA 2HYXA 3KD0A 2VCXA 1AC1A 2M72A 2OA7A 5IOWA 2WFCA 2O89A 2GZYA 2YV9A 4GTUA 4LL1B 4L0WA 4MF5A 2ON5A 1MDIA 3EURA 3HD5A 3F9UA 20GSA 4F82A 5JWRB 4ML1A 2CZ2A 4V1Ag 2DJ0A 4Q5NA 4OO5A 2H73A 1GNWA 5ECRB 4WETA 3ISOA 4CY8A 1ERWA 2LRNA 1NSWA 4ZL7A 3JCML 2FUG2 4KE3A 1SL2B 2FCHA 4KCAA 3DWVA 3MSZA 5CP1A 3W8JA 3F3RA 1U3IA 1X9WB 3GMFA 1U87A 5DJLA 4PNFA 2JZTA 1T8EB 3KIJA 3DGQA 1M3IA 2VL9A 3U6VA 2GVPA 1VF2A 4DEJA 3N9JA 1GWCA 3TJKA 4GQFA 5DVBA 1SK0A 4HJ2A 3UOMA 1GSYA 2DSAA 5D93A 5A4VA 1M2DA 2PMTA 1E6BA 3CSHA 2HNLA 4K1FA 3D0ZA 2KHPA 3P8WA 5IO0A 5IMZA 5EL8A 3ZRDA 1TRVA 4Z2RA 3RHCA 2H30A 3TOTA 1THXA 2X99A 4O32A 4NPBA 1M7TA 1Q98A 2V2GA 3M9JA 3A5WA 5F07A 2G0FA 2N5BA 4KUNA 3TUEA 2C3QA 4N11A 2H6YA 3GX8A 4KX4A 18GSA 5D9TA 1ZGNA 3C7MA 2O8VB 3HYPA 2AAWA 3VFIA 2AUVA 3FZ5A 1BJXA 3BOAA 1H4OA 2X49A 5ECLB 1PSQA 3ZMLA 2I4AA 4WXTA 2C3TA 4OFTA 2FWGA 3APQA 3FZ4A 4TRXA 3TKQA 4DSQA 2YPMA 4Q5QA 2VM2A 1X9SB 4POMA 5AISA 1TTZA 2FY6A 1WP0A 3NOFA 1BEDA 1V9WA 5JCUA 1GULA 5KOWA 4QL9A 2V6KA 3IV4A 2R0CA 2JU5A 2B7JA 1AQVA 2H1GA 2GSQA 3RDWA 5B6MA 3I43A 3IHGA 2K8SA 4XIHA 1A23A 3ZFLA 4GLTA 4WEYA 2WULA 3D4TA 2F8AA 3LW9A 3VWWA 1FVJA 1XFLA 1TI1A 4BL7B 1QFNA 2V1MA 3HXSA 1M3JA 1ON4A 2PU9C 3RAZA 2B6MA 3FHKA 2WZ9A 3FR3A 5HQPA 1XWGA 1O7UA 4CW9A 5F05A 3A2VA 3HJOA 1Y25A 1PQNA 1WWJA 2GQKA 4V2LA 4BVYB 3CTFA 4PUFC 3ERFA 1GSFA 1TP9A 1NHYA 1SKRB 2M80A 3CBUA 3Q74A 4OCEA 2LS5A 5LNKe 4TR0A 1ZCPA 2MBTA 4FYBA 4V2MA 4G0LA 4IBPA 3QR6A 1F3BA 3DIEA 3FMWA 5G5FA 5CRWA 4KW6A 1K0NA 2CX3A 4GSTA 4PNGA 2QC7A 5G30A 4I2TA 4XCSA 2HRNA 5CO3A 2LSTA 4GQCA 5J9CA 3G7JA 1DE2A 2C4JA 4EO3A 2PUKC 3LYKA 5LD0A 5C04A 2FNOA 1B48A 3NZNA 2VIMA 2DC5A 4MJEA 2L6CA 2DJKA 1R7HA 1TU7A 1AXDA 1MEKA 1BQ7A 1PX7A 3UBKA 4NHZA 1X5DA 2IMEA 3C1RA 4KNDA 3W8SA 4XS4B 4MPGA 3MIXA 6GSSA 1CQGA 2VL2A 1V2AA 5ENUA 3UL3A 4TR1B 4WF5A 2IFQA 4K6XA 5DAKA 4MJAA 2DLXA 3GH6A 2LKUA 2AV4A 4LA1A 3BJ5A 2YOIA 2VCWA 2IFQB 5GSTA 5HFGA 2GT5A 4O5QA 1TOFA 3C1SA 2TRXA 4BIKA 3GL5A 2GZZA 3TRPA 1GTAA 1EV4A 3GN3A 2E2GA 2LJKA 1JZDA 3LGCA 1G7OA 2VD1A 3EC3A 1HNBA 2DMMA 2HRAA 1A8LA 3KZQA 2H19A 4DSSB 4LL4B 2QKEA 2YCDA 4ZXGA 3DMLA 4YKGA 3M9KA 1Z7RA 1DUGA 1FB0A 1GNEA 4ZBBA 2QGVA 5DDLA 1IYIA 1ERTA 3P2AA 4NXIA 3CTGA 4XRAA 5CAXA 1XG8A 3FW2A 2R4VA 1GUMA 1Q4JA 3QPMA 3E9JB 5HFKA 5IMDA 3ZVJD 3HJPA 4AJ8A 1K3OA 2B3SA 2H0HA 2NDOA 4HQZA 1T00A 1XBSA 2HZEB 1U88A 2I3YA 2I9HA 5KN3A 1SL0B 3UARA 1PL1A 1PKZA 1A2MA 3O3TA 4LMWA 3LWAA 3F8UA 4N30A 3KH7A 4ICYA 5FWGA 2ALBA 1TU8A 2HXKA 4G0KA 4HI7A 3TDGA 1OAZA 5IPHA 2EC4A 1USBA 2OE0A 2LJAA 5DCGA 3RPPA 2X64A 3APSA 4ECIA 3PR8A 1FVKA 1VGLA 3ME7A 3L0HA 5ECSA 5J41A 5ECPB 1A0RP 1MDKA 3TKSE 4KA0A 1XVQA 2C0GA 3DD3A 2EIRA 4ZL9A 5B8BA 2RUEA 1ZYNA 2IWTA 3EINA 2GLRA 5DALA 2CZ3A 1EOGA 4KDXA 3TOUA 1B4PA 5A4UA 1VF1A 1SK1A 2YNXA 3A3TA 1ZZYA 1A8YA 3J7Yk 1YKCA 3ZMKA 1YZXA 3L9SA 2E2MA 2H6XA 3EU3A 1GUKA 1OE7A 4NHWA 5G2ZA 4IJ3A 3DXBA 3HJMA 4TW5A 1UVZA 3FZAA 1LBKA 3G7YA 1WRYA 3ZYWA 3RPNA 1OC8A 2JL4A 5DCHA 3PGTA 1V58A 1YF0A 3IA1A 4BWQA 1O81A 5IMCA 4NWYA 2B1LA 4ZB6A 1NW2A 3GL3A 3ED3A 4MABA 4X1UA 5ID2A 4EVMA 1J9BA 3F4RA 3QD9A 4YAPA 4ULXA 1WPIA 2R0PA 3WT1A 4KF9A 4K0NA 1SK2A 4ZBAA 3CRUA 3GKXA 2MBSA 4FYUA 22GSA 4OCFA 5ECMB 2OE1A 1AW9A 4ZL8A 3LG6A 6GSXA 1GSSA 4I97A 4HJMA 1V98A 4F0CA 2CAIA 5ECHB 5IPGA 3Q6OA 1B4QA 2VCZA 1FW1A 4MPFA 4IP6A 1Z9HA 3A5IA 3HVVA 1XW9A 2BMXA 5BRTA 4ZBDA 4MZWA 5INYA 2YWNA 2DJ1A 1XW5A 3HKRA 3PPUA 4CY6A 1J0FA 1V40A 3GTUB 3CYNA 1TK0B 1SYRA 4MH2A 4WF4A 1AIUA 2I81A 2VUPA 2X8HA 3FKFA 2MMZA 2YN1A 4E8EA 3FK8A 1S3DA 1PL2A 2JZSA 2CA8A 3UMAA 2OBKA 2A2SA 1TRUA 2RM6A 2E7PA 4TR3A 2BJXA 3QMXA 2OADA 4PQHA 1GUHA 2WGRA 1WJKA 4XS1A 1R26A 4XTSA 1AQWA 2FWFA 1FAAA 4NV5A 3F0IA 5JCGA 4X0XA 14GSA 4GXZA 1ZOFA 2CV4A 3K8NA 2PVOC 3F6FA 4MMMA 5J4UA 2PPTA 3GNJA 4KDUA 2CT6A 1EOHA 2YJHA 2EIQA 4BWSA 1PN0A 2X8CA 4KSOA 4ZB8A 1HQOA 1Z6MA 2MZCA 3CMIA 1FOHA 2EIOA 5IMFA 2VO4A 11GSA 10GSA 2C80A 4TKYA 2IMKA 5G31A 3UJ1A 3VI7A 5E4WA 3G9BA 4PGTA 5HFIA 4Q5RA 2L59A 1KEBA 4DVCA 4F2IA 1K0CA 4MF6A 16GSA 2HT9A 4J56E 1HYUA 1B9YC 3WYWA 2LUSA 2HRFA 3A2XA 3UVHA 1SKSB 3H4KA 1NHOA 1N8JA 1ACVA 3FY7A 1K0AA 2QSIA 3KJYA 1KBNA 1SD8A 1XVWA 2K6VA 1ILOA 2K8VA 1PGTA 1K0OA 2PGTA 4JU5A 5H5QA 4EDZA 2NVLA 5F8BA 1ABAA 3HDCA 3VPQA 4KCEA 4AJ6A 5ECNB 5KN0A 2K18A 4JE1A 1OYJA 2L5LA 2R0GA 3APOA 1TDIA 3HA9A 3QAGA 1R5AA 3WGEA 2OACA 5EY6A 1B8XA 2NTOA 5E59A 1W4VA 2OJLA 1WMJA 2AYTA 2C0DA 4LLRA 4GCIA 4TOPA 13GSA 2MMNA 2H6ZA 2P5QA 4GSNA 17GSA 1R5PA 4EXJA 5G1KA 1M99A 3HVNA 4BPYA 4ZB9A 1A24A 2R5GA 1Z3EA 3M3MA 1GSUA 4RI7A 5CREA 1ERUA 2LQOA 4EF0A 4G9HA 1F2EA 5D9WA 2RIIA 5KEJA 1JZWA 3UIWA 3VWXA 1GLQA 3EMXA 1RK4A 2CX4A 3LXTA 4JR6A 2HSYA 6GSYA 2KP2A 3CRTA 3BBYA 3WGXA 5KOXA 3VPTA 4HU9A 2A4VA 3EE2A 2WB9A 1GRXA 5IM9A 3I69A 3DKSA 4BVXA 5D73A 3P90A 2PN8A 1ZL9A 2FWEA 1YEPA 3WT2A 4DSRA 2V32A 4GSSA 3LJRA 2VM1A 1JLVA 2JACA 4HDEA 2PBJA 4OFMA 2H66A 3QAVA 3IPZA 2XPEA 3O6TA 2G2QA 2YWIA 2K9FA 4YQMA 4IGJA 1GP1A 2C8UA 5ECKB 4MZCA 5JWQB 2O87A 3KP9A 1HNAA 2H1BA 1M2AA 4ACSA 1YKAA 4JR4A 2X8GA 1V57A 1VF4A 1THOA 1T4YA 1SL1B 2FHEA 5A5KA 2WS2A 3QFAC 1PN9A 3TJBA 1ZYQB 3KXOA 2Z9SA 2VCTA 5DAKB 1WIKA 3CSIA 2JSZA 4L8EA 5CRHA 1XWCA 3A2WA 3QFBC 4L5LA 2VAFA 4OO4A 2HFDA 1PRXA 2IMIA 2L4CA 3IXRA 3O76A 5ECQB 4ECBA 2KUCA 2B5YA 2F9SA 2JZRA 1Z6NA 4O5RA 2GQMA 3HCZA 1OC9A 3IHQA 5EVOA 3IK9A 4EKZA 1OC9B 1EEJA 1SJ6A 4TN8A 3ZL5A 4K9ZA 2WRTA 4HSCX 3ERWA 3GRXA 1I9DA 2FD3A 4IHUA 3LFLA 4WKWA 3UEMA 2LRTA 3VI5A 3I6AA 1QMVA 4PXOA 3GYKA 5ELGA 4HU7A 5H5SA 3BD2A 3KH9A 4NAXA 5IMVA 1XW6A 2LNSA 2IJYA 3ZTLA 1H75A 4Q5FA 3ZIJA 3D4MA 1OKDA 1PKWA 4JZQA 4MK3A 2OE3A 3LSZA 4L0UA 3L4NA 1EZKA 2DJ3A 3CQFA 5DQSA 5AN1A 4IP1A 3GURA 1T7PB 1MDJA 2WDUA 4E8HA 1FB6A 1M2BA 4XRDA 4YH2A 4EIQA 1M9AA 3D5JA 3D6IA 4RUVA 5ECOB 5IIZA 2ZUPA 5CYYA 3F4TA 1TRSA 2YZUA 4IN0A 4HOJA 4YAVA 3U5RE 2HZFA 3TKSA 3GSSA 4AJ7A 1GL8A 2HSMA 3F4SA 2UZ8A 2FLSA 3DVXA 5KN1A 1SD9A 3EU4A 2XPDA 2P5RA 3H93A 5HR1A 3DVWA 2BTOT 5DALB 2REMA 4Z7XA 4EC0A 2H76A 2VL2C 5IOXA 1GTBA 3RHBA 5IQYA 5AIVA 3LQ7A 4LMVA 1X9MB 2HE3A 2XHFA 2GGTA 2YWOA 4K7IA 1G7EA 3ERGA 2GSRA 5IO2A 1UN2A 2H1DA 2CQ9A 4IS0A 3IC8A 1B9XC 4HUAA 5J5NA 4PTSA 4EDYA 1GSDA 3DYRA 1XXUA 4N10A 1A2LA 1OC3A 4AF2A 1O8XA 1XWBA 4PUAA 1VF3A 2C1YA 3P7XA 3WD6A 2P0GA 3R2QA 3KMNA 2IL3A 4D73A 4YQVA 1ST9A 3CSJA 3FR6A 4PX1A 1F9MA 1FHEA 2GSTA 3UVTA 3TGZA 4TXOA 2MYGA 3TB2A 4IELA 2CVDA 4ID0A 5ID2B 3VWVA 4F0BA 2LV3A 1ZYPA 2DKIA 2TIRA 4TXOB 3TJJA 4MNNA 3GH9A 3VWUA 5F06A 5HR2A 1RQMA 2XBQA 2AJQB 2F51A 1YDKA 3ME8A 2DBCA 3IAS2 6GSVA 1PMTA 4TVEA 1OKTA 4KGIA 3QAWA 2HI7A 2R37A 1GSQA 4O92A 3KP8A 1DSBA 2NBSA 4NMUA 1XWKA 5EPFA 4K0GA 4XS6A 4I5QA 5DBQA 4HZ4A 1SENA 2V6OA 4PQ1A 1A0FA 2NPBA 1ZMAA 4IJIA 2DKHA 1U3AA 3BCIA 5C00A 1AQXA 1T3BA 3GA4A 4IQAA 1QGVA 5HR0A 3QOUA 1UC7A 2H70A 4V1Ap 1R4WA 2IN3A 2H0GA 3DEXA 4KSMA 4OFNA 2B5XA 1QQ2A 2VOCA 1QUWA 3GUSA 2VCVA 4ECCA 1MD3A 4YKFA 2L4QA 3F3QA 3N5OA 1JFUA 1Z7PA 2R3XA 3OR5A 2HLSA 4O7HA 3V1WA 1MD4A 3KTLA 2RM5A 3D22A 4RQRA 3BCKA 2IMFA 3H1NA 4POKA 1JZOA 2H74A 4RI6A 3TRXA 4ML6A 1YEXA 9GSSA 5FHIA 1N2AA 5B7CA 2GZPA 3KM6A 3IR4A 1T1VA 4GWRA 3ZIVA 1XOAA 3LXZA 2LTKA 3GSTA 1FOVA 2VCQA 2CAQA 5JWOB 1S3CA 2X4AA 5GSSA 4IQ1A 3HZ4A 5D8IA 4PQIA 1BAYA 3E0UA 4JRRA 2GDRA 2VLVA 1TK8B 4MLYA 4USSA 1X5CA 2L5OA 1EV9A 4KH7A 3FYGA 3IC4A 3CXGA 4YQUA 4WR4A 2H72A 1TXXA 5JCWA 4X4JA 3HZ8A 1SU9A 6GSTA 4G19A 4TR4A 2H75A 3WGDA 2A2RA 6GSWA 3GKNA 1TRWA 3I9V2 4X43A 3MWHA 5ELAA 2DJJA 7GSSA 4OD7A 3HHVA 2DMLA 4EIPA 1OVNA 4HZ2A 2WJUA 1FG4A 1QK8A 5B6NA 1BX9A 4CHSA 2R2JA 4H86A 4P3YB 1AUCA 1LU4A 2CVKA 4WBRD 5J9BA 3F63A 3Q19A 4K2XA 1TKDB 5G1LA 1O8WA 4GRFA 1NM3A 1URMA 2B5EA 2V41A 4OMVA 3TCOA 1SYXA 2FA8A 3SBCA 2QA2A 1EWXA 1OE8A 2H1AA 1ZYEA 1X0RA 4IKHA 2O85A 5D9VA 2ES7A 1JZRA 4BL7A 4AGSA 3KMOA 3MNGA 1UA5A 2FWHA 4ILFA 3G7IA 1EGRA 4K5SA 3PINA 1AAZA 2GS3A 1TJDA 2KLXA 2J23A 2YV7A 1RW1A 5D9XA 3M0FA 2I1UA 4MJBA 3TJFA 4BVYA 1JHBA 3KCMA 4K7OA 4FH8A 4I2UA 4V2NA 3TJGA 1JLWA 3PH9A 3M1GA 1K0BA 5H5RA 1YY7A 19GSA 4FO5A 1TW9A 5GAPD 1S3AA 3R3EA 6GSUA 1XPVA 3GX0A 1G6YA 5J3RA 4NV2A 2F8FA 4BVXB 1EEMA 2GSSA 2L57A 2XBIA 3UBLA 4MZBA 5AIXA 4N0ZA 3TKPA 5CNWA 2A4HA 3L78A 1O6JA 4Z2UA 2ZCTA 4ZIJA 2F3MA 1WE0A 2CVBA 2N5FA 3FEUA 1GTUA 2DIYA 3KEBA 4QL7A 3LORA 3MAKA 1WOUA 1C72A 3TRQA 1J08A 4KAEA 5A4WA 3S9FA 2ON7A 2TRCP 3VK9A 1GSEA 4XS4A 4ZILA 3KGKA 1Y6EA 1DBYA 1G6WA 2R6KA 3FZ9A 4TR1A 1SJZA 4RQXA 1XCCA 2PERA 1YF1A 1S3RA 5LCZA 4WR5A 2JADA 3ZITA 3GIXA 2LQQA 4A5PA 2FGXA 5DJMA 5D96A 1KNGA 2D2ZA 3DRNA 3C71A 4CDOA 2XC2A 1Z5YE 1KTEA 1IYHA 4F9ZA 2C0FA 3NIVA 5F0GA 2PVQA 3ZLPA 1DE1A 4I6XA 4G2EA 3L9UA 3UAPA 1XIYA 5KN2A 2YWMA 2YANA 3C8EA 4DSSA 2IPAA 3EVIA 3EYTA 4O5UA 3QDNA 3TKRA 3GKKA 1T4ZA 3VLNA 4TXVA 2N5AA 1F6MC 1K3YA 1PX6A 2YP6A 4F03A 3SWLA 1I5GA 5AGYA 1EGOA 1FO5A 3MYDA 3US3A 2RUFA 4POBA 1E2YA 3FR9A 5GAND 1GTIA 3IRAA 12GSA 1K0MA 4MF7A 3H8QA 2GTUA 2HRKA 3ZZXA 5FT3A 2VD0A 4L5OA 3GHAA 1PFOA 5BMUA 3J7Yb 2YZHA 2HZEA 1G0TA 5L71A 5G5EA 4J57E 2PWJA 4K5RA 4MH3A 4K7NA 1ML6A 4Z2TA 3D21A 1F3AA 2L6DA 4K8MA 5CRDA 4IVFA 1SJIA 3ZVJA 4KB3A 4BA7A 4HQSA 5ECIB 4ECJA 8GSSA 1TK5B 2A2PA 4FQUA 1X5EA 2KP1A 5COHA 4HEA2 3E3EA 4ISDA 4I8BA 3IDVA 2LRCA 3RBTA 2C0EA 4FYCA 2GQLA 2ZNMA 3M8NA 4MP4A 2QA1A
chains in the Genus database with same CATH topology
4XHMA 1EP8A 1EP7A 1ERVA 4OWYA 3EPTA 2WCIA 1MTCA 1PA3A 2C3NA 2LEGA 5HR3A 3W6GA 4G10A 1K0DA 4PURA 2LJRA 3IBHA 4MCUA 4J2FA 1YQ1A 1W89A 5IMAA 1HD2A 2OKAA 4KDYA 1BG5A 1GH2A 3F6DA 1F37A 2H71A 3LYPA 3C73A 2AHEA 2H01A 2B7KA 2VLUA 1BYEA 4G0IA 3EMPA 1U6TA 4MDCA 1SKWB 3HY2A 2YJ7A 4WBJA 4POLA 4D73B 1PD21 1M9BA 4EUYA 4JEDA 1VRSD 5GZZB 2HSHA 4QQ7A 3EWLA 4EL1A 3QCPA 2H8LA 1GLPA 1XOBA 1LJRA 1O73A 2DJ2A 2H0IA 3LEFA 4MJCA 2M46A 3IOSA 3MDKA 1QXHA 3GFKA 3L9VA 2E0QA 2P31A 2J9HA 2OBIA 2JSYA 3H79A 1CQHA 1O85A 4MA9A 1XZOA 1XWAA 2VLTA 5DQYA 3AY8A 4HS1A 3GV1A 3ZREA 4JBBA 2MMOA 2AB6A 3VURA 2O7KA 1HNCA 2LNTA 1A2JA 2VL3A 3GKMA 5CRGA 2FA4A 2IIYA 2GT6A 3KTBA 3ZFBA 4EE0A 1TI3A 3HVXA 2KOKA 5ABRA 3IE3A 3FRCA 3HVSA 1YJ6A 5B8AA 4IW9A 1M0UA 1K3LA 2IMDA 3IAM2 4K2DA 4GF0A 4N0VA 2B1KA 2DIZA 2MMAA 4FIWA 3GTUA 3IK7A 3Q18A 3TKSC 2RLIA 2HYXA 3KD0A 2VCXA 1AC1A 2M72A 2OA7A 5IOWA 2WFCA 2O89A 2GZYA 2YV9A 4GTUA 4LL1B 4L0WA 4MF5A 2ON5A 1MDIA 3EURA 3HD5A 3F9UA 20GSA 4F82A 5JWRB 4ML1A 2CZ2A 4V1Ag 2DJ0A 4Q5NA 4OO5A 2H73A 1GNWA 5ECRB 4WETA 3ISOA 4CY8A 1ERWA 2LRNA 1NSWA 4ZL7A 3JCML 2FUG2 4KE3A 1SL2B 2FCHA 4KCAA 3DWVA 3MSZA 5CP1A 3W8JA 3F3RA 1U3IA 1X9WB 3GMFA 1U87A 5DJLA 4PNFA 2JZTA 1T8EB 3KIJA 3DGQA 2VL9A 3U6VA 2GVPA 1VF2A 4DEJA 3N9JA 1GWCA 3TJKA 4GQFA 5DVBA 1SK0A 4HJ2A 3UOMA 1GSYA 2DSAA 5D93A 5A4VA 1M2DA 2PMTA 1E6BA 3CSHA 2HNLA 4K1FA 3D0ZA 2KHPA 3P8WA 5IO0A 5IMZA 5EL8A 3ZRDA 1TRVA 4Z2RA 3RHCA 2H30A 3TOTA 1THXA 2X99A 4O32A 4NPBA 1M7TA 1Q98A 2V2GA 3M9JA 3A5WA 5F07A 2G0FA 2N5BA 4KUNA 3TUEA 2C3QA 4N11A 2H6YA 3GX8A 4KX4A 18GSA 5D9TA 1ZGNA 3C7MA 2O8VB 3HYPA 2AAWA 3VFIA 2AUVA 3FZ5A 1BJXA 3BOAA 1H4OA 2X49A 5ECLB 1PSQA 3ZMLA 2I4AA 4WXTA 2C3TA 4OFTA 2FWGA 3APQA 3FZ4A 4TRXA 3TKQA 4DSQA 2YPMA 4Q5QA 2VM2A 1X9SB 4POMA 5AISA 1TTZA 2FY6A 1WP0A 3NOFA 1BEDA 1V9WA 5JCUA 1GULA 5KOWA 4QL9A 2V6KA 3IV4A 2R0CA 2JU5A 2B7JA 1AQVA 2H1GA 2GSQA 3RDWA 5B6MA 3I43A 3IHGA 2K8SA 4XIHA 1A23A 3ZFLA 4GLTA 4WEYA 2WULA 3D4TA 2F8AA 3LW9A 3VWWA 1FVJA 1XFLA 1TI1A 4BL7B 1QFNA 2V1MA 3HXSA 1ON4A 2PU9C 3RAZA 2B6MA 3FHKA 2WZ9A 3FR3A 5HQPA 1XWGA 1O7UA 4CW9A 5F05A 3A2VA 3HJOA 1Y25A 1PQNA 1WWJA 2GQKA 4V2LA 4BVYB 3CTFA 4PUFC 3ERFA 1GSFA 1TP9A 1NHYA 1SKRB 2M80A 3CBUA 3Q74A 4OCEA 2LS5A 5LNKe 4TR0A 1ZCPA 2MBTA 4FYBA 4V2MA 4G0LA 4IBPA 3QR6A 1F3BA 3DIEA 3FMWA 5G5FA 5CRWA 4KW6A 1K0NA 2CX3A 4GSTA 4PNGA 2QC7A 5G30A 4I2TA 4XCSA 2HRNA 5CO3A 2LSTA 4GQCA 5J9CA 3G7JA 1DE2A 2C4JA 4EO3A 2PUKC 3LYKA 5LD0A 5C04A 2FNOA 1B48A 3NZNA 2VIMA 2DC5A 4MJEA 2L6CA 2DJKA 1R7HA 1TU7A 1AXDA 1MEKA 1BQ7A 1PX7A 3UBKA 4NHZA 1X5DA 2IMEA 3C1RA 4KNDA 3W8SA 4XS4B 4MPGA 3MIXA 6GSSA 1CQGA 2VL2A 1V2AA 5ENUA 3UL3A 4TR1B 4WF5A 2IFQA 4K6XA 5DAKA 4MJAA 2DLXA 3GH6A 2LKUA 2AV4A 4LA1A 3BJ5A 2YOIA 2VCWA 2IFQB 5GSTA 5HFGA 2GT5A 4O5QA 1TOFA 3C1SA 2TRXA 3GL5A 2GZZA 3TRPA 1GTAA 1EV4A 3GN3A 2E2GA 2LJKA 1JZDA 3LGCA 1G7OA 2VD1A 3EC3A 1HNBA 2DMMA 2HRAA 1A8LA 3KZQA 2H19A 4DSSB 4LL4B 2QKEA 2YCDA 4ZXGA 3DMLA 4YKGA 3M9KA 1Z7RA 1DUGA 1FB0A 1GNEA 4ZBBA 2QGVA 5DDLA 1IYIA 1ERTA 3P2AA 4NXIA 3CTGA 4XRAA 5CAXA 3FW2A 2R4VA 1GUMA 1Q4JA 3QPMA 3E9JB 5HFKA 5IMDA 3ZVJD 3HJPA 4AJ8A 1K3OA 2B3SA 2H0HA 2NDOA 4HQZA 1T00A 1XBSA 2HZEB 1U88A 2I3YA 2I9HA 5KN3A 1SL0B 3UARA 1PL1A 1PKZA 1A2MA 3O3TA 4LMWA 3LWAA 3F8UA 4N30A 3KH7A 4ICYA 5FWGA 2ALBA 1TU8A 2HXKA 4G0KA 4HI7A 3TDGA 1OAZA 5IPHA 2EC4A 1USBA 2OE0A 2LJAA 5DCGA 3RPPA 2X64A 3APSA 4ECIA 3PR8A 1FVKA 1VGLA 3ME7A 3L0HA 5ECSA 5J41A 5ECPB 1A0RP 1MDKA 3TKSE 4KA0A 1XVQA 2C0GA 3DD3A 2EIRA 4ZL9A 5B8BA 2RUEA 1ZYNA 2IWTA 3EINA 2GLRA 5DALA 2CZ3A 1EOGA 4KDXA 3TOUA 1B4PA 5A4UA 1VF1A 1SK1A 2YNXA 3A3TA 1ZZYA 1A8YA 3J7Yk 1YKCA 3ZMKA 1YZXA 3L9SA 2E2MA 2H6XA 3EU3A 1GUKA 1OE7A 4NHWA 5G2ZA 4IJ3A 3DXBA 3HJMA 4TW5A 1UVZA 3FZAA 1LBKA 3G7YA 1WRYA 3ZYWA 3RPNA 1OC8A 2JL4A 5DCHA 3PGTA 1V58A 1YF0A 3IA1A 4BWQA 1O81A 5IMCA 4NWYA 2B1LA 4ZB6A 1NW2A 3GL3A 3ED3A 4MABA 4X1UA 5ID2A 4EVMA 1J9BA 3F4RA 3QD9A 4YAPA 4ULXA 1WPIA 2R0PA 3WT1A 4KF9A 4K0NA 1SK2A 4ZBAA 3CRUA 3GKXA 2MBSA 4FYUA 22GSA 4OCFA 5ECMB 2OE1A 1AW9A 4ZL8A 3LG6A 6GSXA 1GSSA 4I97A 4HJMA 1V98A 4F0CA 2CAIA 5ECHB 5IPGA 3Q6OA 1B4QA 2VCZA 1FW1A 4MPFA 4IP6A 1Z9HA 3A5IA 3HVVA 1XW9A 2BMXA 5BRTA 4ZBDA 4MZWA 5INYA 2YWNA 2DJ1A 1XW5A 3HKRA 3PPUA 4CY6A 1J0FA 1V40A 3GTUB 3CYNA 1TK0B 1SYRA 4MH2A 4WF4A 1AIUA 2I81A 2VUPA 2X8HA 3FKFA 2MMZA 2YN1A 4E8EA 3FK8A 1S3DA 1PL2A 2JZSA 2CA8A 3UMAA 2OBKA 2A2SA 1TRUA 2RM6A 2E7PA 4TR3A 2BJXA 3QMXA 2OADA 4PQHA 1GUHA 2WGRA 1WJKA 4XS1A 1R26A 4XTSA 1AQWA 2FWFA 1FAAA 4NV5A 3F0IA 5JCGA 4X0XA 14GSA 4GXZA 1ZOFA 2CV4A 3K8NA 2PVOC 3F6FA 4MMMA 5J4UA 2PPTA 3GNJA 4KDUA 2CT6A 1EOHA 2YJHA 2EIQA 4BWSA 1PN0A 2X8CA 4KSOA 4ZB8A 1HQOA 1Z6MA 2MZCA 3CMIA 1FOHA 2EIOA 5IMFA 2VO4A 11GSA 10GSA 2C80A 4TKYA 2IMKA 5G31A 3UJ1A 3VI7A 5E4WA 3G9BA 4PGTA 5HFIA 4Q5RA 2L59A 1KEBA 4DVCA 4F2IA 1K0CA 4MF6A 16GSA 2HT9A 4J56E 1HYUA 1B9YC 3WYWA 2LUSA 2HRFA 3A2XA 3UVHA 1SKSB 3H4KA 1NHOA 1N8JA 1ACVA 3FY7A 1K0AA 2QSIA 3KJYA 1KBNA 1SD8A 1XVWA 2K6VA 1ILOA 2K8VA 1PGTA 1K0OA 2PGTA 4JU5A 5H5QA 4EDZA 2NVLA 5F8BA 1ABAA 3HDCA 3VPQA 4KCEA 4AJ6A 5ECNB 5KN0A 2K18A 4JE1A 1OYJA 2L5LA 2R0GA 3APOA 1TDIA 3HA9A 3QAGA 1R5AA 3WGEA 2OACA 5EY6A 1B8XA 2NTOA 5E59A 1W4VA 2OJLA 1WMJA 2AYTA 2C0DA 4LLRA 4GCIA 4TOPA 13GSA 2MMNA 2H6ZA 2P5QA 4GSNA 17GSA 1R5PA 4EXJA 5G1KA 1M99A 4BPYA 4ZB9A 1A24A 2R5GA 1Z3EA 3M3MA 1GSUA 4RI7A 5CREA 1ERUA 2LQOA 4EF0A 4G9HA 1F2EA 5D9WA 2RIIA 5KEJA 1JZWA 3UIWA 3VWXA 1GLQA 3EMXA 1RK4A 2CX4A 3LXTA 4JR6A 2HSYA 6GSYA 2KP2A 3CRTA 3BBYA 3WGXA 5KOXA 3VPTA 4HU9A 2A4VA 3EE2A 2WB9A 1GRXA 5IM9A 3I69A 3DKSA 4BVXA 5D73A 3P90A 2PN8A 1ZL9A 2FWEA 1YEPA 3WT2A 4DSRA 2V32A 4GSSA 3LJRA 2VM1A 1JLVA 2JACA 4HDEA 2PBJA 4OFMA 2H66A 3QAVA 3IPZA 2XPEA 3O6TA 2G2QA 2YWIA 2K9FA 4YQMA 4IGJA 1GP1A 2C8UA 5ECKB 4MZCA 5JWQB 2O87A 3KP9A 1HNAA 2H1BA 1M2AA 4ACSA 1YKAA 4JR4A 2X8GA 1V57A 1VF4A 1THOA 1T4YA 1SL1B 2FHEA 5A5KA 2WS2A 3QFAC 1PN9A 3TJBA 1ZYQB 3KXOA 2Z9SA 2VCTA 5DAKB 1WIKA 3CSIA 2JSZA 4L8EA 5CRHA 1XWCA 3A2WA 3QFBC 4L5LA 2VAFA 4OO4A 2HFDA 1PRXA 2IMIA 2L4CA 3IXRA 3O76A 5ECQB 4ECBA 2KUCA 2B5YA 2F9SA 2JZRA 1Z6NA 4O5RA 2GQMA 3HCZA 1OC9A 3IHQA 5EVOA 3IK9A 4EKZA 1OC9B 1EEJA 1SJ6A 4TN8A 3ZL5A 4K9ZA 2WRTA 3ERWA 3GRXA 1I9DA 2FD3A 4IHUA 3LFLA 4WKWA 3UEMA 2LRTA 3VI5A 3I6AA 1QMVA 4PXOA 3GYKA 5ELGA 4HU7A 5H5SA 3BD2A 3KH9A 4NAXA 5IMVA 1XW6A 2LNSA 2IJYA 3ZTLA 1H75A 4Q5FA 3ZIJA 3D4MA 1OKDA 1PKWA 4JZQA 4MK3A 2OE3A 3LSZA 4L0UA 3L4NA 1EZKA 2DJ3A 5DQSA 5AN1A 4IP1A 3GURA 1T7PB 1MDJA 2WDUA 4E8HA 1FB6A 1M2BA 4XRDA 4YH2A 4EIQA 1M9AA 3D5JA 3D6IA 4RUVA 5ECOB 5IIZA 2ZUPA 5CYYA 3F4TA 1TRSA 2YZUA 4IN0A 4HOJA 4YAVA 3U5RE 2HZFA 3TKSA 3GSSA 4AJ7A 1GL8A 2HSMA 3F4SA 2UZ8A 2FLSA 3DVXA 5KN1A 1SD9A 3EU4A 2XPDA 2P5RA 3H93A 5HR1A 3DVWA 2BTOT 5DALB 2REMA 4Z7XA 4EC0A 2H76A 2VL2C 5IOXA 1GTBA 3RHBA 5IQYA 5AIVA 3LQ7A 4LMVA 1X9MB 2HE3A 2XHFA 2GGTA 2YWOA 4K7IA 1G7EA 3ERGA 2GSRA 5IO2A 1UN2A 2H1DA 2CQ9A 4IS0A 3IC8A 1B9XC 4HUAA 5J5NA 4PTSA 4EDYA 1GSDA 3DYRA 1XXUA 4N10A 1A2LA 1OC3A 4AF2A 1O8XA 1XWBA 4PUAA 1VF3A 2C1YA 3P7XA 3WD6A 2P0GA 3R2QA 3KMNA 2IL3A 4D73A 4YQVA 1ST9A 3CSJA 3FR6A 4PX1A 1F9MA 1FHEA 2GSTA 3UVTA 3TGZA 4TXOA 2MYGA 3TB2A 4IELA 2CVDA 4ID0A 5ID2B 3VWVA 4F0BA 2LV3A 1ZYPA 2DKIA 2TIRA 4TXOB 3TJJA 4MNNA 3GH9A 3VWUA 5F06A 5HR2A 1RQMA 2XBQA 2AJQB 2F51A 1YDKA 3ME8A 2DBCA 3IAS2 6GSVA 1PMTA 4TVEA 1OKTA 4KGIA 3QAWA 2HI7A 2R37A 1GSQA 4O92A 3KP8A 1DSBA 2NBSA 4NMUA 1XWKA 5EPFA 4K0GA 4XS6A 4I5QA 5DBQA 4HZ4A 1SENA 2V6OA 4PQ1A 1A0FA 2NPBA 1ZMAA 4IJIA 2DKHA 1U3AA 3BCIA 5C00A 1AQXA 1T3BA 3GA4A 4IQAA 1QGVA 5HR0A 3QOUA 1UC7A 2H70A 4V1Ap 1R4WA 2IN3A 2H0GA 3DEXA 4KSMA 4OFNA 2B5XA 1QQ2A 2VOCA 1QUWA 3GUSA 2VCVA 4ECCA 1MD3A 4YKFA 2L4QA 3F3QA 3N5OA 1JFUA 1Z7PA 2R3XA 3OR5A 2HLSA 4O7HA 3V1WA 1MD4A 3KTLA 2RM5A 3D22A 4RQRA 3BCKA 2IMFA 3H1NA 4POKA 1JZOA 2H74A 4RI6A 3TRXA 4ML6A 1YEXA 9GSSA 5FHIA 1N2AA 5B7CA 2GZPA 3KM6A 3IR4A 1T1VA 4GWRA 3ZIVA 1XOAA 3LXZA 2LTKA 3GSTA 1FOVA 2VCQA 2CAQA 5JWOB 1S3CA 2X4AA 5GSSA 4IQ1A 3HZ4A 5D8IA 4PQIA 1BAYA 3E0UA 4JRRA 2GDRA 2VLVA 1TK8B 4MLYA 4USSA 1X5CA 2L5OA 1EV9A 4KH7A 3FYGA 3IC4A 3CXGA 4YQUA 4WR4A 2H72A 1TXXA 5JCWA 4X4JA 3HZ8A 1SU9A 6GSTA 4G19A 4TR4A 2H75A 3WGDA 2A2RA 6GSWA 3GKNA 1TRWA 3I9V2 4X43A 3MWHA 5ELAA 2DJJA 7GSSA 4OD7A 3HHVA 2DMLA 4EIPA 1OVNA 4HZ2A 2WJUA 1FG4A 1QK8A 5B6NA 1BX9A 4CHSA 2R2JA 4H86A 4P3YB 1AUCA 1LU4A 2CVKA 4WBRD 5J9BA 3F63A 3Q19A 4K2XA 1TKDB 5G1LA 1O8WA 4GRFA 1NM3A 1URMA 2B5EA 2V41A 4OMVA 3TCOA 1SYXA 2FA8A 3SBCA 2QA2A 1EWXA 1OE8A 2H1AA 1ZYEA 1X0RA 4IKHA 2O85A 5D9VA 2ES7A 1JZRA 4BL7A 4AGSA 3KMOA 3MNGA 1UA5A 2FWHA 4ILFA 3G7IA 1EGRA 4K5SA 3PINA 1AAZA 2GS3A 1TJDA 2KLXA 2J23A 2YV7A 1RW1A 5D9XA 3M0FA 2I1UA 4MJBA 3TJFA 4BVYA 1JHBA 3KCMA 4K7OA 4FH8A 4I2UA 4V2NA 3TJGA 1JLWA 3PH9A 3M1GA 1K0BA 5H5RA 1YY7A 19GSA 4FO5A 1TW9A 5GAPD 1S3AA 3R3EA 6GSUA 1XPVA 3GX0A 1G6YA 5J3RA 4NV2A 2F8FA 4BVXB 1EEMA 2GSSA 2L57A 2XBIA 3UBLA 4MZBA 5AIXA 4N0ZA 3TKPA 5CNWA 2A4HA 3L78A 1O6JA 4Z2UA 2ZCTA 4ZIJA 2F3MA 1WE0A 2CVBA 2N5FA 3FEUA 1GTUA 2DIYA 3KEBA 4QL7A 3LORA 3MAKA 1WOUA 1C72A 3TRQA 1J08A 4KAEA 5A4WA 3S9FA 2ON7A 2TRCP 3VK9A 1GSEA 4XS4A 4ZILA 3KGKA 1Y6EA 1DBYA 1G6WA 2R6KA 3FZ9A 4TR1A 1SJZA 4RQXA 1XCCA 2PERA 1YF1A 5LCZA 4WR5A 2JADA 3ZITA 3GIXA 2LQQA 4A5PA 2FGXA 5DJMA 5D96A 1KNGA 2D2ZA 3DRNA 3C71A 4CDOA 2XC2A 1Z5YE 1KTEA 1IYHA 4F9ZA 2C0FA 3NIVA 5F0GA 2PVQA 3ZLPA 1DE1A 4I6XA 4G2EA 3L9UA 3UAPA 1XIYA 5KN2A 2YWMA 2YANA 3C8EA 4DSSA 2IPAA 3EVIA 3EYTA 4O5UA 3QDNA 3TKRA 3GKKA 1T4ZA 3VLNA 4TXVA 2N5AA 1F6MC 1K3YA 1PX6A 2YP6A 4F03A 3SWLA 1I5GA 5AGYA 1EGOA 1FO5A 3MYDA 3US3A 2RUFA 4POBA 1E2YA 3FR9A 5GAND 1GTIA 3IRAA 12GSA 1K0MA 4MF7A 3H8QA 2GTUA 2HRKA 3ZZXA 5FT3A 2VD0A 4L5OA 3GHAA 5BMUA 3J7Yb 2YZHA 2HZEA 1G0TA 5L71A 5G5EA 4J57E 2PWJA 4K5RA 4MH3A 4K7NA 1ML6A 4Z2TA 3D21A 1F3AA 2L6DA 4K8MA 5CRDA 4IVFA 1SJIA 3ZVJA 4KB3A 4BA7A 4HQSA 5ECIB 4ECJA 8GSSA 1TK5B 2A2PA 4FQUA 1X5EA 2KP1A 5COHA 4HEA2 3E3EA 4ISDA 4I8BA 3IDVA 2LRCA 3RBTA 2C0EA 4FYCA 2GQLA 2ZNMA 3M8NA 4MP4A 2QA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XHM A;  1EP8 A;  1EP7 A;  1ERV A;  4OWY A;  2WCI A;  1MTC A;  1PA3 A;  2C3N A;  2LEG A;  5HR3 A;  3W6G A;  4G10 A;  1K0D A;  4PUR A;  2LJR A;  3IBH A;  4MCU A;  4J2F A;  1YQ1 A;  1W89 A;  5IMA A;  1HD2 A;  2OKA A;  4KDY A;  1BG5 A;  1GH2 A;  3F6D A;  1F37 A;  2H71 A;  3LYP A;  3C73 A;  2AHE A;  2H01 A;  2B7K A;  2VLU A;  1BYE A;  3EMP A;  1U6T A;  4MDC A;  1SKW B;  3HY2 A;  2YJ7 A;  4WBJ A;  4POL A;  4D73 B;  1PD2 1;  1M9B A;  4EUY A;  4JED A;  1VRS D;  5GZZ B;  2HSH A;  4QQ7 A;  3EWL A;  4EL1 A;  3QCP A;  2H8L A;  1GLP A;  1XOB A;  1LJR A;  1O73 A;  2DJ2 A;  2H0I A;  3LEF A;  4MJC A;  2M46 A;  3IOS A;  3MDK A;  1QXH A;  3GFK A;  3L9V A;  2E0Q A;  2P31 A;  2J9H A;  2OBI A;  2JSY A;  3H79 A;  1CQH A;  1O85 A;  4MA9 A;  1XZO A;  1XWA A;  2VLT A;  5DQY A;  3AY8 A;  4HS1 A;  3GV1 A;  3ZRE A;  4JBB A;  2MMO A;  2AB6 A;  3VUR A;  2O7K A;  1HNC A;  2LNT A;  1A2J A;  2VL3 A;  3GKM A;  5CRG A;  2FA4 A;  2IIY A;  2GT6 A;  3KTB A;  3ZFB A;  4EE0 A;  1TI3 A;  3HVX A;  2KOK A;  5ABR A;  3IE3 A;  3FRC A;  3HVS A;  1YJ6 A;  5B8A A;  4IW9 A;  1M0U A;  1K3L A;  2IMD A;  3IAM 2;  4K2D A;  4GF0 A;  4N0V A;  2B1K A;  2DIZ A;  2MMA A;  4FIW A;  3GTU A;  3IK7 A;  3Q18 A;  3TKS C;  2RLI A;  2HYX A;  3KD0 A;  2VCX A;  1AC1 A;  2M72 A;  2OA7 A;  5IOW A;  2WFC A;  2O89 A;  2GZY A;  2YV9 A;  4GTU A;  4LL1 B;  4L0W A;  4MF5 A;  2ON5 A;  1MDI A;  3EUR A;  3HD5 A;  3F9U A;  20GS A;  4F82 A;  5JWR B;  4ML1 A;  2CZ2 A;  4V1A g;  2DJ0 A;  4Q5N A;  4OO5 A;  2H73 A;  1GNW A;  5ECR B;  4WET A;  3ISO A;  1ERW A;  2LRN A;  1NSW A;  4ZL7 A;  3JCM L;  2FUG 2;  4KE3 A;  1SL2 B;  2FCH A;  4KCA A;  3DWV A;  3MSZ A;  5CP1 A;  3W8J A;  3F3R A;  1U3I A;  1X9W B;  3GMF A;  1U87 A;  5DJL A;  4PNF A;  2JZT A;  1T8E B;  3KIJ A;  3DGQ A;  2VL9 A;  3U6V A;  2GVP A;  1VF2 A;  4DEJ A;  3N9J A;  1GWC A;  3TJK A;  4GQF A;  5DVB A;  1SK0 A;  4HJ2 A;  3UOM A;  1GSY A;  2DSA A;  5D93 A;  5A4V A;  1M2D A;  2PMT A;  1E6B A;  3CSH A;  2HNL A;  4K1F A;  3D0Z A;  2KHP A;  3P8W A;  5IO0 A;  5IMZ A;  5EL8 A;  3ZRD A;  1TRV A;  3RHC A;  2H30 A;  3TOT A;  1THX A;  2X99 A;  4O32 A;  4NPB A;  1M7T A;  1Q98 A;  2V2G A;  3M9J A;  3A5W A;  5F07 A;  2G0F A;  2N5B A;  4KUN A;  3TUE A;  2C3Q A;  4N11 A;  2H6Y A;  3GX8 A;  4KX4 A;  18GS A;  5D9T A;  1ZGN A;  3C7M A;  2O8V B;  3HYP A;  2AAW A;  3VFI A;  2AUV A;  3FZ5 A;  1BJX A;  3BOA A;  1H4O A;  5ECL B;  1PSQ A;  3ZML A;  2I4A A;  4WXT A;  2C3T A;  4OFT A;  2FWG A;  3APQ A;  3FZ4 A;  4TRX A;  3TKQ A;  4DSQ A;  2YPM A;  4Q5Q A;  2VM2 A;  1X9S B;  4POM A;  5AIS A;  1TTZ A;  2FY6 A;  1WP0 A;  3NOF A;  1BED A;  1V9W A;  5JCU A;  1GUL A;  4QL9 A;  2V6K A;  3IV4 A;  2JU5 A;  2B7J A;  1AQV A;  2H1G A;  2GSQ A;  3RDW A;  5B6M A;  3I43 A;  4XIH A;  2K8S A;  1A23 A;  3ZFL A;  4GLT A;  4WEY A;  2WUL A;  3D4T A;  2F8A A;  3VWW A;  1FVJ A;  1XFL A;  1TI1 A;  1QFN A;  2V1M A;  3HXS A;  1ON4 A;  2PU9 C;  3RAZ A;  2B6M A;  3FHK A;  2WZ9 A;  3FR3 A;  5HQP A;  1XWG A;  1O7U A;  4CW9 A;  5F05 A;  3A2V A;  3HJO A;  1Y25 A;  1PQN A;  1WWJ A;  2GQK A;  4V2L A;  3CTF A;  4PUF C;  3ERF A;  1GSF A;  1TP9 A;  1NHY A;  1SKR B;  2M80 A;  3CBU A;  3Q74 A;  4OCE A;  2LS5 A;  5LNK e;  4TR0 A;  1ZCP A;  2MBT A;  4FYB A;  4V2M A;  4IBP A;  3QR6 A;  1F3B A;  3DIE A;  5G5F A;  5CRW A;  4KW6 A;  1K0N A;  2CX3 A;  4GST A;  4PNG A;  2QC7 A;  5G30 A;  4I2T A;  4XCS A;  2HRN A;  5CO3 A;  2LST A;  4GQC A;  5J9C A;  3G7J A;  1DE2 A;  2C4J A;  4EO3 A;  2PUK C;  3LYK A;  5LD0 A;  5C04 A;  2FNO A;  1B48 A;  3NZN A;  2VIM A;  2DC5 A;  4MJE A;  2L6C A;  2DJK A;  1R7H A;  1TU7 A;  1AXD A;  1MEK A;  1BQ7 A;  1PX7 A;  3UBK A;  4NHZ A;  1X5D A;  2IME A;  3C1R A;  4KND A;  3W8S A;  4XS4 B;  4MPG A;  6GSS A;  1CQG A;  2VL2 A;  1V2A A;  5ENU A;  3UL3 A;  4TR1 B;  4WF5 A;  2IFQ A;  4K6X A;  5DAK A;  4MJA A;  2DLX A;  3GH6 A;  2LKU A;  2AV4 A;  4LA1 A;  3BJ5 A;  2YOI A;  2VCW A;  2IFQ B;  5GST A;  5HFG A;  2GT5 A;  1TOF A;  3C1S A;  2TRX A;  3GL5 A;  2GZZ A;  3TRP A;  1GTA A;  1EV4 A;  3GN3 A;  2E2G A;  2LJK A;  1JZD A;  3LGC A;  1G7O A;  2VD1 A;  3EC3 A;  1HNB A;  2DMM A;  1A8L A;  3KZQ A;  2H19 A;  4DSS B;  4LL4 B;  2QKE A;  2YCD A;  4ZXG A;  3DML A;  3M9K A;  1Z7R A;  1DUG A;  1FB0 A;  1GNE A;  4ZBB A;  2QGV A;  5DDL A;  1IYI A;  1ERT A;  3P2A A;  4NXI A;  3CTG A;  4XRA A;  5CAX A;  3FW2 A;  2R4V A;  1GUM A;  1Q4J A;  3QPM A;  3E9J B;  5HFK A;  5IMD A;  3ZVJ D;  3HJP A;  4AJ8 A;  1K3O A;  2B3S A;  2H0H A;  2NDO A;  4HQZ A;  1T00 A;  1XBS A;  2HZE B;  1U88 A;  2I3Y A;  2I9H A;  5KN3 A;  1SL0 B;  3UAR A;  1PL1 A;  1PKZ A;  1A2M A;  3O3T A;  4LMW A;  3LWA A;  3F8U A;  4N30 A;  3KH7 A;  5FWG A;  2ALB A;  1TU8 A;  2HXK A;  4HI7 A;  3TDG A;  1OAZ A;  5IPH A;  2EC4 A;  1USB A;  2OE0 A;  2LJA A;  5DCG A;  3RPP A;  2X64 A;  3APS A;  4ECI A;  3PR8 A;  1FVK A;  1VGL A;  3ME7 A;  3L0H A;  5ECS A;  5J41 A;  5ECP B;  1A0R P;  1MDK A;  3TKS E;  4KA0 A;  1XVQ A;  2C0G A;  3DD3 A;  2EIR A;  4ZL9 A;  5B8B A;  2RUE A;  2IWT A;  3EIN A;  2GLR A;  5DAL A;  2CZ3 A;  1EOG A;  4KDX A;  3TOU A;  1B4P A;  5A4U A;  1VF1 A;  1SK1 A;  2YNX A;  3A3T A;  1ZZY A;  1A8Y A;  3J7Y k;  1YKC A;  3ZMK A;  1YZX A;  3L9S A;  2E2M A;  2H6X A;  3EU3 A;  1GUK A;  1OE7 A;  4NHW A;  5G2Z A;  4IJ3 A;  3DXB A;  3HJM A;  4TW5 A;  1UVZ A;  3FZA A;  1LBK A;  3G7Y A;  1WRY A;  3ZYW A;  3RPN A;  1OC8 A;  2JL4 A;  5DCH A;  3PGT A;  1V58 A;  1YF0 A;  3IA1 A;  4BWQ A;  1O81 A;  5IMC A;  4NWY A;  2B1L A;  4ZB6 A;  1NW2 A;  3GL3 A;  3ED3 A;  4MAB A;  4X1U A;  5ID2 A;  4EVM A;  1J9B A;  3F4R A;  3QD9 A;  4YAP A;  4ULX A;  1WPI A;  3WT1 A;  4K0N A;  1SK2 A;  4ZBA A;  3CRU A;  3GKX A;  2MBS A;  4FYU A;  22GS A;  4OCF A;  5ECM B;  2OE1 A;  1AW9 A;  4ZL8 A;  3LG6 A;  6GSX A;  1GSS A;  4I97 A;  4HJM A;  1V98 A;  4F0C A;  2CAI A;  5ECH B;  5IPG A;  3Q6O A;  1B4Q A;  2VCZ A;  1FW1 A;  4MPF A;  4IP6 A;  1Z9H A;  3HVV A;  1XW9 A;  2BMX A;  4ZBD A;  4MZW A;  5INY A;  2YWN A;  2DJ1 A;  1XW5 A;  3HKR A;  1J0F A;  1V40 A;  3GTU B;  3CYN A;  1TK0 B;  1SYR A;  4MH2 A;  4WF4 A;  1AIU A;  2I81 A;  2VUP A;  2X8H A;  3FKF A;  2MMZ A;  2YN1 A;  4E8E A;  3FK8 A;  1S3D A;  1PL2 A;  2JZS A;  2CA8 A;  3UMA A;  2OBK A;  2A2S A;  1TRU A;  2RM6 A;  2E7P A;  4TR3 A;  2BJX A;  3QMX A;  2OAD A;  4PQH A;  1GUH A;  2WGR A;  1WJK A;  4XS1 A;  1R26 A;  4XTS A;  1AQW A;  2FWF A;  1FAA A;  4NV5 A;  3F0I A;  5JCG A;  4X0X A;  14GS A;  4GXZ A;  1ZOF A;  2CV4 A;  3K8N A;  2PVO C;  3F6F A;  4MMM A;  5J4U A;  2PPT A;  3GNJ A;  4KDU A;  2CT6 A;  1EOH A;  2YJH A;  2EIQ A;  4BWS A;  2X8C A;  4KSO A;  4ZB8 A;  1HQO A;  1Z6M A;  2MZC A;  3CMI A;  2EIO A;  5IMF A;  2VO4 A;  11GS A;  10GS A;  2C80 A;  4TKY A;  2IMK A;  5G31 A;  3UJ1 A;  3VI7 A;  5E4W A;  3G9B A;  4PGT A;  5HFI A;  4Q5R A;  2L59 A;  1KEB A;  4DVC A;  4F2I A;  1K0C A;  4MF6 A;  16GS A;  2HT9 A;  4J56 E;  1HYU A;  1B9Y C;  3WYW A;  2LUS A;  2HRF A;  3A2X A;  3UVH A;  1SKS B;  3H4K A;  1NHO A;  1N8J A;  1ACV A;  3FY7 A;  1K0A A;  2QSI A;  3KJY A;  1KBN A;  1SD8 A;  1XVW A;  2K6V A;  1ILO A;  2K8V A;  1PGT A;  1K0O A;  2PGT A;  4JU5 A;  5H5Q A;  4EDZ A;  2NVL A;  5F8B A;  1ABA A;  3HDC A;  3VPQ A;  4KCE A;  4AJ6 A;  5ECN B;  5KN0 A;  2K18 A;  4JE1 A;  1OYJ A;  2L5L A;  3APO A;  1TDI A;  3HA9 A;  3QAG A;  1R5A A;  3WGE A;  2OAC A;  5EY6 A;  1B8X A;  2NTO A;  5E59 A;  1W4V A;  2OJL A;  1WMJ A;  2AYT A;  2C0D A;  4LLR A;  4GCI A;  4TOP A;  13GS A;  2MMN A;  2H6Z A;  2P5Q A;  4GSN A;  17GS A;  1R5P A;  4EXJ A;  5G1K A;  1M99 A;  4BPY A;  4ZB9 A;  1A24 A;  2R5G A;  1Z3E A;  3M3M A;  1GSU A;  4RI7 A;  5CRE A;  1ERU A;  2LQO A;  4EF0 A;  4G9H A;  1F2E A;  5D9W A;  2RII A;  5KEJ A;  1JZW A;  3UIW A;  3VWX A;  1GLQ A;  3EMX A;  1RK4 A;  2CX4 A;  3LXT A;  4JR6 A;  2HSY A;  6GSY A;  2KP2 A;  3CRT A;  3BBY A;  3WGX A;  3VPT A;  4HU9 A;  2A4V A;  3EE2 A;  2WB9 A;  1GRX A;  5IM9 A;  3I69 A;  3DKS A;  4BVX A;  5D73 A;  3P90 A;  2PN8 A;  1ZL9 A;  2FWE A;  1YEP A;  3WT2 A;  4DSR A;  2V32 A;  4GSS A;  3LJR A;  2VM1 A;  1JLV A;  2JAC A;  4HDE A;  2PBJ A;  4OFM A;  2H66 A;  3QAV A;  3IPZ A;  2XPE A;  3O6T A;  2G2Q A;  2YWI A;  2K9F A;  4YQM A;  4IGJ A;  1GP1 A;  2C8U A;  5ECK B;  4MZC A;  5JWQ B;  2O87 A;  3KP9 A;  1HNA A;  2H1B A;  1M2A A;  4ACS A;  1YKA A;  4JR4 A;  2X8G A;  1V57 A;  1VF4 A;  1THO A;  1T4Y A;  1SL1 B;  2FHE A;  5A5K A;  2WS2 A;  3QFA C;  1PN9 A;  3TJB A;  1ZYQ B;  3KXO A;  2Z9S A;  2VCT A;  5DAK B;  1WIK A;  3CSI A;  2JSZ A;  4L8E A;  5CRH A;  1XWC A;  3A2W A;  3QFB C;  4L5L A;  2VAF A;  4OO4 A;  2HFD A;  1PRX A;  2IMI A;  2L4C A;  3IXR A;  3O76 A;  5ECQ B;  4ECB A;  2KUC A;  2B5Y A;  2F9S A;  2JZR A;  1Z6N A;  4O5R A;  2GQM A;  3HCZ A;  1OC9 A;  3IHQ A;  5EVO A;  3IK9 A;  4EKZ A;  1OC9 B;  1EEJ A;  1SJ6 A;  4TN8 A;  3ZL5 A;  4K9Z A;  2WRT A;  3ERW A;  3GRX A;  1I9D A;  2FD3 A;  4IHU A;  3LFL A;  4WKW A;  3UEM A;  2LRT A;  3VI5 A;  3I6A A;  1QMV A;  4PXO A;  3GYK A;  5ELG A;  4HU7 A;  5H5S A;  3BD2 A;  3KH9 A;  4NAX A;  5IMV A;  1XW6 A;  2LNS A;  2IJY A;  3ZTL A;  1H75 A;  4Q5F A;  3ZIJ A;  3D4M A;  1OKD A;  1PKW A;  4JZQ A;  4MK3 A;  2OE3 A;  3LSZ A;  4L0U A;  3L4N A;  1EZK A;  2DJ3 A;  5DQS A;  5AN1 A;  4IP1 A;  3GUR A;  1T7P B;  1MDJ A;  2WDU A;  4E8H A;  1FB6 A;  1M2B A;  4XRD A;  4YH2 A;  1M9A A;  3D5J A;  3D6I A;  4RUV A;  5ECO B;  5IIZ A;  2ZUP A;  5CYY A;  3F4T A;  1TRS A;  2YZU A;  4IN0 A;  4HOJ A;  4YAV A;  3U5R E;  2HZF A;  3TKS A;  3GSS A;  4AJ7 A;  1GL8 A;  3F4S A;  2FLS A;  3DVX A;  5KN1 A;  1SD9 A;  3EU4 A;  2XPD A;  2P5R A;  3H93 A;  5HR1 A;  3DVW A;  2BTO T;  5DAL B;  2REM A;  4Z7X A;  4EC0 A;  2H76 A;  2VL2 C;  5IOX A;  1GTB A;  3RHB A;  5IQY A;  5AIV A;  3LQ7 A;  4LMV A;  1X9M B;  2HE3 A;  2XHF A;  2GGT A;  2YWO A;  4K7I A;  1G7E A;  3ERG A;  2GSR A;  5IO2 A;  1UN2 A;  2H1D A;  2CQ9 A;  4IS0 A;  1B9X C;  4HUA A;  5J5N A;  4EDY A;  1GSD A;  3DYR A;  1XXU A;  4N10 A;  1A2L A;  1OC3 A;  4AF2 A;  1O8X A;  1XWB A;  4PUA A;  1VF3 A;  2C1Y A;  3P7X A;  3WD6 A;  2P0G A;  3R2Q A;  3KMN A;  2IL3 A;  4D73 A;  4YQV A;  1ST9 A;  3CSJ A;  3FR6 A;  4PX1 A;  1F9M A;  1FHE A;  2GST A;  3UVT A;  3TGZ A;  4TXO A;  2MYG A;  3TB2 A;  4IEL A;  2CVD A;  4ID0 A;  5ID2 B;  3VWV A;  4F0B A;  2LV3 A;  3TJJ A;  2TIR A;  4TXO B;  3GH9 A;  3VWU A;  5F06 A;  5HR2 A;  1RQM A;  2XBQ A;  2AJQ B;  2F51 A;  1YDK A;  3ME8 A;  2DBC A;  3IAS 2;  6GSV A;  1PMT A;  4TVE A;  1OKT A;  4KGI A;  3QAW A;  2HI7 A;  2R37 A;  1GSQ A;  4O92 A;  3KP8 A;  1DSB A;  2NBS A;  4NMU A;  1XWK A;  5EPF A;  4K0G A;  4XS6 A;  4I5Q A;  5DBQ A;  4HZ4 A;  1SEN A;  2V6O A;  4PQ1 A;  1A0F A;  2NPB A;  1ZMA A;  4IJI A;  1U3A A;  3BCI A;  5C00 A;  1AQX A;  1T3B A;  3GA4 A;  4IQA A;  1QGV A;  5HR0 A;  3QOU A;  1UC7 A;  2H70 A;  4V1A p;  1R4W A;  2IN3 A;  2H0G A;  3DEX A;  4KSM A;  4OFN A;  2B5X A;  1QQ2 A;  2VOC A;  1QUW A;  3GUS A;  2VCV A;  4ECC A;  1MD3 A;  2L4Q A;  3F3Q A;  3N5O A;  1JFU A;  1Z7P A;  2R3X A;  3OR5 A;  2HLS A;  4O7H A;  3V1W A;  1MD4 A;  3KTL A;  2RM5 A;  3D22 A;  4RQR A;  3BCK A;  2IMF A;  3H1N A;  4POK A;  1JZO A;  2H74 A;  4RI6 A;  3TRX A;  4ML6 A;  1YEX A;  9GSS A;  5FHI A;  1N2A A;  5B7C A;  2GZP A;  3KM6 A;  3IR4 A;  1T1V A;  4GWR A;  3ZIV A;  1XOA A;  3LXZ A;  2LTK A;  3GST A;  1FOV A;  2VCQ A;  2CAQ A;  5JWO B;  1S3C A;  5GSS A;  4IQ1 A;  3HZ4 A;  5D8I A;  4PQI A;  1BAY A;  3E0U A;  4JRR A;  2GDR A;  2VLV A;  1TK8 B;  4MLY A;  1X5C A;  2L5O A;  1EV9 A;  4KH7 A;  3FYG A;  3IC4 A;  3CXG A;  4YQU A;  4WR4 A;  2H72 A;  1TXX A;  5JCW A;  3HZ8 A;  1SU9 A;  6GST A;  4G19 A;  4TR4 A;  2H75 A;  3WGD A;  2A2R A;  6GSW A;  3GKN A;  1TRW A;  3I9V 2;  4X43 A;  3MWH A;  5ELA A;  2DJJ A;  7GSS A;  4OD7 A;  3HHV A;  2DML A;  1OVN A;  4HZ2 A;  2WJU A;  1FG4 A;  1QK8 A;  5B6N A;  1BX9 A;  4CHS A;  2R2J A;  4H86 A;  4P3Y B;  1AUC A;  1LU4 A;  2CVK A;  4WBR D;  5J9B A;  3F63 A;  3Q19 A;  1TKD B;  5G1L A;  1O8W A;  4GRF A;  1NM3 A;  1URM A;  2B5E A;  2V41 A;  4OMV A;  3TCO A;  1SYX A;  2FA8 A;  3SBC A;  1EWX A;  1OE8 A;  2H1A A;  1ZYE A;  1X0R A;  4IKH A;  2O85 A;  5D9V A;  2ES7 A;  1JZR A;  4BL7 A;  4AGS A;  3KMO A;  3MNG A;  1UA5 A;  2FWH A;  4ILF A;  3G7I A;  1EGR A;  3PIN A;  1AAZ A;  2GS3 A;  1TJD A;  2KLX A;  2J23 A;  2YV7 A;  1RW1 A;  5D9X A;  3M0F A;  2I1U A;  4MJB A;  3TJF A;  4BVY A;  1JHB A;  3KCM A;  4K7O A;  4FH8 A;  4I2U A;  4V2N A;  3TJG A;  1JLW A;  3PH9 A;  3M1G A;  1K0B A;  5H5R A;  1YY7 A;  19GS A;  4FO5 A;  1TW9 A;  5GAP D;  1S3A A;  6GSU A;  1XPV A;  3GX0 A;  1G6Y A;  5J3R A;  4NV2 A;  2F8F A;  1EEM A;  2GSS A;  2L57 A;  2XBI A;  3UBL A;  4MZB A;  5AIX A;  4N0Z A;  3TKP A;  5CNW A;  3L78 A;  1O6J A;  2ZCT A;  4ZIJ A;  2F3M A;  1WE0 A;  2CVB A;  2N5F A;  3FEU A;  1GTU A;  2DIY A;  3KEB A;  4QL7 A;  3LOR A;  3MAK A;  1WOU A;  1C72 A;  3TRQ A;  1J08 A;  4KAE A;  5A4W A;  3S9F A;  2ON7 A;  2TRC P;  3VK9 A;  1GSE A;  4XS4 A;  4ZIL A;  3KGK A;  1Y6E A;  1DBY A;  1G6W A;  2R6K A;  3FZ9 A;  4TR1 A;  1SJZ A;  4RQX A;  1XCC A;  2PER A;  1YF1 A;  5LCZ A;  4WR5 A;  2JAD A;  3ZIT A;  3GIX A;  2LQQ A;  2FGX A;  5DJM A;  5D96 A;  1KNG A;  2D2Z A;  3DRN A;  3C71 A;  4CDO A;  2XC2 A;  1Z5Y E;  1KTE A;  1IYH A;  4F9Z A;  2C0F A;  3NIV A;  5F0G A;  2PVQ A;  3ZLP A;  1DE1 A;  4I6X A;  4G2E A;  3L9U A;  3UAP A;  1XIY A;  5KN2 A;  2YWM A;  2YAN A;  3C8E A;  4DSS A;  2IPA A;  3EVI A;  3EYT A;  3QDN A;  3TKR A;  3GKK A;  1T4Z A;  3VLN A;  4TXV A;  2N5A A;  1F6M C;  1K3Y A;  1PX6 A;  2YP6 A;  4F03 A;  3SWL A;  1I5G A;  5AGY A;  1EGO A;  1FO5 A;  3US3 A;  2RUF A;  4POB A;  1E2Y A;  3FR9 A;  5GAN D;  1GTI A;  3IRA A;  12GS A;  1K0M A;  4MF7 A;  3H8Q A;  2GTU A;  3ZZX A;  5FT3 A;  2VD0 A;  4L5O A;  3GHA A;  3J7Y b;  2YZH A;  2HZE A;  1G0T A;  5L71 A;  5G5E A;  4J57 E;  2PWJ A;  4MH3 A;  4K7N A;  1ML6 A;  3D21 A;  1F3A A;  2L6D A;  4K8M A;  5CRD A;  4IVF A;  1SJI A;  3ZVJ A;  4KB3 A;  4BA7 A;  4HQS A;  5ECI B;  4ECJ A;  8GSS A;  1TK5 B;  1X5E A;  2KP1 A;  5COH A;  4HEA 2;  3E3E A;  4ISD A;  4I8B A;  3IDV A;  2LRC A;  3RBT A;  2C0E A;  4FYC A;  2GQL A;  2ZNM A;  3M8N A;  4MP4 A; 
#chains in the Genus database with same CATH topology
 4XHM A;  1EP8 A;  1EP7 A;  1ERV A;  4OWY A;  3EPT A;  2WCI A;  1MTC A;  1PA3 A;  2C3N A;  2LEG A;  5HR3 A;  3W6G A;  4G10 A;  1K0D A;  4PUR A;  2LJR A;  3IBH A;  4MCU A;  4J2F A;  1YQ1 A;  1W89 A;  5IMA A;  1HD2 A;  2OKA A;  4KDY A;  1BG5 A;  1GH2 A;  3F6D A;  1F37 A;  2H71 A;  3LYP A;  3C73 A;  2AHE A;  2H01 A;  2B7K A;  2VLU A;  1BYE A;  4G0I A;  3EMP A;  1U6T A;  4MDC A;  1SKW B;  3HY2 A;  2YJ7 A;  4WBJ A;  4POL A;  4D73 B;  1PD2 1;  1M9B A;  4EUY A;  4JED A;  1VRS D;  5GZZ B;  2HSH A;  4QQ7 A;  3EWL A;  4EL1 A;  3QCP A;  2H8L A;  1GLP A;  1XOB A;  1LJR A;  1O73 A;  2DJ2 A;  2H0I A;  3LEF A;  4MJC A;  2M46 A;  3IOS A;  3MDK A;  1QXH A;  3GFK A;  3L9V A;  2E0Q A;  2P31 A;  2J9H A;  2OBI A;  2JSY A;  3H79 A;  1CQH A;  1O85 A;  4MA9 A;  1XZO A;  1XWA A;  2VLT A;  5DQY A;  3AY8 A;  4HS1 A;  3GV1 A;  3ZRE A;  4JBB A;  2MMO A;  2AB6 A;  3VUR A;  2O7K A;  1HNC A;  2LNT A;  1A2J A;  2VL3 A;  3GKM A;  5CRG A;  2FA4 A;  2IIY A;  2GT6 A;  3KTB A;  3ZFB A;  4EE0 A;  1TI3 A;  3HVX A;  2KOK A;  5ABR A;  3IE3 A;  3FRC A;  3HVS A;  1YJ6 A;  5B8A A;  4IW9 A;  1M0U A;  1K3L A;  2IMD A;  3IAM 2;  4K2D A;  4GF0 A;  4N0V A;  2B1K A;  2DIZ A;  2MMA A;  4FIW A;  3GTU A;  3IK7 A;  3Q18 A;  3TKS C;  2RLI A;  2HYX A;  3KD0 A;  2VCX A;  1AC1 A;  2M72 A;  2OA7 A;  5IOW A;  2WFC A;  2O89 A;  2GZY A;  2YV9 A;  4GTU A;  4LL1 B;  4L0W A;  4MF5 A;  2ON5 A;  1MDI A;  3EUR A;  3HD5 A;  3F9U A;  20GS A;  4F82 A;  5JWR B;  4ML1 A;  2CZ2 A;  4V1A g;  2DJ0 A;  4Q5N A;  4OO5 A;  2H73 A;  1GNW A;  5ECR B;  4WET A;  3ISO A;  4CY8 A;  1ERW A;  2LRN A;  1NSW A;  4ZL7 A;  3JCM L;  2FUG 2;  4KE3 A;  1SL2 B;  2FCH A;  4KCA A;  3DWV A;  3MSZ A;  5CP1 A;  3W8J A;  3F3R A;  1U3I A;  1X9W B;  3GMF A;  1U87 A;  5DJL A;  4PNF A;  2JZT A;  1T8E B;  3KIJ A;  3DGQ A;  1M3I A;  2VL9 A;  3U6V A;  2GVP A;  1VF2 A;  4DEJ A;  3N9J A;  1GWC A;  3TJK A;  4GQF A;  5DVB A;  1SK0 A;  4HJ2 A;  3UOM A;  1GSY A;  2DSA A;  5D93 A;  5A4V A;  1M2D A;  2PMT A;  1E6B A;  3CSH A;  2HNL A;  4K1F A;  3D0Z A;  2KHP A;  3P8W A;  5IO0 A;  5IMZ A;  5EL8 A;  3ZRD A;  1TRV A;  4Z2R A;  3RHC A;  2H30 A;  3TOT A;  1THX A;  2X99 A;  4O32 A;  4NPB A;  1M7T A;  1Q98 A;  2V2G A;  3M9J A;  3A5W A;  5F07 A;  2G0F A;  2N5B A;  4KUN A;  3TUE A;  2C3Q A;  4N11 A;  2H6Y A;  3GX8 A;  4KX4 A;  18GS A;  5D9T A;  1ZGN A;  3C7M A;  2O8V B;  3HYP A;  2AAW A;  3VFI A;  2AUV A;  3FZ5 A;  1BJX A;  3BOA A;  1H4O A;  2X49 A;  5ECL B;  1PSQ A;  3ZML A;  2I4A A;  4WXT A;  2C3T A;  4OFT A;  2FWG A;  3APQ A;  3FZ4 A;  4TRX A;  3TKQ A;  4DSQ A;  2YPM A;  4Q5Q A;  2VM2 A;  1X9S B;  4POM A;  5AIS A;  1TTZ A;  2FY6 A;  1WP0 A;  3NOF A;  1BED A;  1V9W A;  5JCU A;  1GUL A;  5KOW A;  4QL9 A;  2V6K A;  3IV4 A;  2R0C A;  2JU5 A;  2B7J A;  1AQV A;  2H1G A;  2GSQ A;  3RDW A;  5B6M A;  3I43 A;  3IHG A;  2K8S A;  4XIH A;  1A23 A;  3ZFL A;  4GLT A;  4WEY A;  2WUL A;  3D4T A;  2F8A A;  3LW9 A;  3VWW A;  1FVJ A;  1XFL A;  1TI1 A;  4BL7 B;  1QFN A;  2V1M A;  3HXS A;  1M3J A;  1ON4 A;  2PU9 C;  3RAZ A;  2B6M A;  3FHK A;  2WZ9 A;  3FR3 A;  5HQP A;  1XWG A;  1O7U A;  4CW9 A;  5F05 A;  3A2V A;  3HJO A;  1Y25 A;  1PQN A;  1WWJ A;  2GQK A;  4V2L A;  4BVY B;  3CTF A;  4PUF C;  3ERF A;  1GSF A;  1TP9 A;  1NHY A;  1SKR B;  2M80 A;  3CBU A;  3Q74 A;  4OCE A;  2LS5 A;  5LNK e;  4TR0 A;  1ZCP A;  2MBT A;  4FYB A;  4V2M A;  4G0L A;  4IBP A;  3QR6 A;  1F3B A;  3DIE A;  3FMW A;  5G5F A;  5CRW A;  4KW6 A;  1K0N A;  2CX3 A;  4GST A;  4PNG A;  2QC7 A;  5G30 A;  4I2T A;  4XCS A;  2HRN A;  5CO3 A;  2LST A;  4GQC A;  5J9C A;  3G7J A;  1DE2 A;  2C4J A;  4EO3 A;  2PUK C;  3LYK A;  5LD0 A;  5C04 A;  2FNO A;  1B48 A;  3NZN A;  2VIM A;  2DC5 A;  4MJE A;  2L6C A;  2DJK A;  1R7H A;  1TU7 A;  1AXD A;  1MEK A;  1BQ7 A;  1PX7 A;  3UBK A;  4NHZ A;  1X5D A;  2IME A;  3C1R A;  4KND A;  3W8S A;  4XS4 B;  4MPG A;  3MIX A;  6GSS A;  1CQG A;  2VL2 A;  1V2A A;  5ENU A;  3UL3 A;  4TR1 B;  4WF5 A;  2IFQ A;  4K6X A;  5DAK A;  4MJA A;  2DLX A;  3GH6 A;  2LKU A;  2AV4 A;  4LA1 A;  3BJ5 A;  2YOI A;  2VCW A;  2IFQ B;  5GST A;  5HFG A;  2GT5 A;  4O5Q A;  1TOF A;  3C1S A;  2TRX A;  4BIK A;  3GL5 A;  2GZZ A;  3TRP A;  1GTA A;  1EV4 A;  3GN3 A;  2E2G A;  2LJK A;  1JZD A;  3LGC A;  1G7O A;  2VD1 A;  3EC3 A;  1HNB A;  2DMM A;  2HRA A;  1A8L A;  3KZQ A;  2H19 A;  4DSS B;  4LL4 B;  2QKE A;  2YCD A;  4ZXG A;  3DML A;  4YKG A;  3M9K A;  1Z7R A;  1DUG A;  1FB0 A;  1GNE A;  4ZBB A;  2QGV A;  5DDL A;  1IYI A;  1ERT A;  3P2A A;  4NXI A;  3CTG A;  4XRA A;  5CAX A;  1XG8 A;  3FW2 A;  2R4V A;  1GUM A;  1Q4J A;  3QPM A;  3E9J B;  5HFK A;  5IMD A;  3ZVJ D;  3HJP A;  4AJ8 A;  1K3O A;  2B3S A;  2H0H A;  2NDO A;  4HQZ A;  1T00 A;  1XBS A;  2HZE B;  1U88 A;  2I3Y A;  2I9H A;  5KN3 A;  1SL0 B;  3UAR A;  1PL1 A;  1PKZ A;  1A2M A;  3O3T A;  4LMW A;  3LWA A;  3F8U A;  4N30 A;  3KH7 A;  4ICY A;  5FWG A;  2ALB A;  1TU8 A;  2HXK A;  4G0K A;  4HI7 A;  3TDG A;  1OAZ A;  5IPH A;  2EC4 A;  1USB A;  2OE0 A;  2LJA A;  5DCG A;  3RPP A;  2X64 A;  3APS A;  4ECI A;  3PR8 A;  1FVK A;  1VGL A;  3ME7 A;  3L0H A;  5ECS A;  5J41 A;  5ECP B;  1A0R P;  1MDK A;  3TKS E;  4KA0 A;  1XVQ A;  2C0G A;  3DD3 A;  2EIR A;  4ZL9 A;  5B8B A;  2RUE A;  1ZYN A;  2IWT A;  3EIN A;  2GLR A;  5DAL A;  2CZ3 A;  1EOG A;  4KDX A;  3TOU A;  1B4P A;  5A4U A;  1VF1 A;  1SK1 A;  2YNX A;  3A3T A;  1ZZY A;  1A8Y A;  3J7Y k;  1YKC A;  3ZMK A;  1YZX A;  3L9S A;  2E2M A;  2H6X A;  3EU3 A;  1GUK A;  1OE7 A;  4NHW A;  5G2Z A;  4IJ3 A;  3DXB A;  3HJM A;  4TW5 A;  1UVZ A;  3FZA A;  1LBK A;  3G7Y A;  1WRY A;  3ZYW A;  3RPN A;  1OC8 A;  2JL4 A;  5DCH A;  3PGT A;  1V58 A;  1YF0 A;  3IA1 A;  4BWQ A;  1O81 A;  5IMC A;  4NWY A;  2B1L A;  4ZB6 A;  1NW2 A;  3GL3 A;  3ED3 A;  4MAB A;  4X1U A;  5ID2 A;  4EVM A;  1J9B A;  3F4R A;  3QD9 A;  4YAP A;  4ULX A;  1WPI A;  2R0P A;  3WT1 A;  4KF9 A;  4K0N A;  1SK2 A;  4ZBA A;  3CRU A;  3GKX A;  2MBS A;  4FYU A;  22GS A;  4OCF A;  5ECM B;  2OE1 A;  1AW9 A;  4ZL8 A;  3LG6 A;  6GSX A;  1GSS A;  4I97 A;  4HJM A;  1V98 A;  4F0C A;  2CAI A;  5ECH B;  5IPG A;  3Q6O A;  1B4Q A;  2VCZ A;  1FW1 A;  4MPF A;  4IP6 A;  1Z9H A;  3A5I A;  3HVV A;  1XW9 A;  2BMX A;  5BRT A;  4ZBD A;  4MZW A;  5INY A;  2YWN A;  2DJ1 A;  1XW5 A;  3HKR A;  3PPU A;  4CY6 A;  1J0F A;  1V40 A;  3GTU B;  3CYN A;  1TK0 B;  1SYR A;  4MH2 A;  4WF4 A;  1AIU A;  2I81 A;  2VUP A;  2X8H A;  3FKF A;  2MMZ A;  2YN1 A;  4E8E A;  3FK8 A;  1S3D A;  1PL2 A;  2JZS A;  2CA8 A;  3UMA A;  2OBK A;  2A2S A;  1TRU A;  2RM6 A;  2E7P A;  4TR3 A;  2BJX A;  3QMX A;  2OAD A;  4PQH A;  1GUH A;  2WGR A;  1WJK A;  4XS1 A;  1R26 A;  4XTS A;  1AQW A;  2FWF A;  1FAA A;  4NV5 A;  3F0I A;  5JCG A;  4X0X A;  14GS A;  4GXZ A;  1ZOF A;  2CV4 A;  3K8N A;  2PVO C;  3F6F A;  4MMM A;  5J4U A;  2PPT A;  3GNJ A;  4KDU A;  2CT6 A;  1EOH A;  2YJH A;  2EIQ A;  4BWS A;  1PN0 A;  2X8C A;  4KSO A;  4ZB8 A;  1HQO A;  1Z6M A;  2MZC A;  3CMI A;  1FOH A;  2EIO A;  5IMF A;  2VO4 A;  11GS A;  10GS A;  2C80 A;  4TKY A;  2IMK A;  5G31 A;  3UJ1 A;  3VI7 A;  5E4W A;  3G9B A;  4PGT A;  5HFI A;  4Q5R A;  2L59 A;  1KEB A;  4DVC A;  4F2I A;  1K0C A;  4MF6 A;  16GS A;  2HT9 A;  4J56 E;  1HYU A;  1B9Y C;  3WYW A;  2LUS A;  2HRF A;  3A2X A;  3UVH A;  1SKS B;  3H4K A;  1NHO A;  1N8J A;  1ACV A;  3FY7 A;  1K0A A;  2QSI A;  3KJY A;  1KBN A;  1SD8 A;  1XVW A;  2K6V A;  1ILO A;  2K8V A;  1PGT A;  1K0O A;  2PGT A;  4JU5 A;  5H5Q A;  4EDZ A;  2NVL A;  5F8B A;  1ABA A;  3HDC A;  3VPQ A;  4KCE A;  4AJ6 A;  5ECN B;  5KN0 A;  2K18 A;  4JE1 A;  1OYJ A;  2L5L A;  2R0G A;  3APO A;  1TDI A;  3HA9 A;  3QAG A;  1R5A A;  3WGE A;  2OAC A;  5EY6 A;  1B8X A;  2NTO A;  5E59 A;  1W4V A;  2OJL A;  1WMJ A;  2AYT A;  2C0D A;  4LLR A;  4GCI A;  4TOP A;  13GS A;  2MMN A;  2H6Z A;  2P5Q A;  4GSN A;  17GS A;  1R5P A;  4EXJ A;  5G1K A;  1M99 A;  3HVN A;  4BPY A;  4ZB9 A;  1A24 A;  2R5G A;  1Z3E A;  3M3M A;  1GSU A;  4RI7 A;  5CRE A;  1ERU A;  2LQO A;  4EF0 A;  4G9H A;  1F2E A;  5D9W A;  2RII A;  5KEJ A;  1JZW A;  3UIW A;  3VWX A;  1GLQ A;  3EMX A;  1RK4 A;  2CX4 A;  3LXT A;  4JR6 A;  2HSY A;  6GSY A;  2KP2 A;  3CRT A;  3BBY A;  3WGX A;  5KOX A;  3VPT A;  4HU9 A;  2A4V A;  3EE2 A;  2WB9 A;  1GRX A;  5IM9 A;  3I69 A;  3DKS A;  4BVX A;  5D73 A;  3P90 A;  2PN8 A;  1ZL9 A;  2FWE A;  1YEP A;  3WT2 A;  4DSR A;  2V32 A;  4GSS A;  3LJR A;  2VM1 A;  1JLV A;  2JAC A;  4HDE A;  2PBJ A;  4OFM A;  2H66 A;  3QAV A;  3IPZ A;  2XPE A;  3O6T A;  2G2Q A;  2YWI A;  2K9F A;  4YQM A;  4IGJ A;  1GP1 A;  2C8U A;  5ECK B;  4MZC A;  5JWQ B;  2O87 A;  3KP9 A;  1HNA A;  2H1B A;  1M2A A;  4ACS A;  1YKA A;  4JR4 A;  2X8G A;  1V57 A;  1VF4 A;  1THO A;  1T4Y A;  1SL1 B;  2FHE A;  5A5K A;  2WS2 A;  3QFA C;  1PN9 A;  3TJB A;  1ZYQ B;  3KXO A;  2Z9S A;  2VCT A;  5DAK B;  1WIK A;  3CSI A;  2JSZ A;  4L8E A;  5CRH A;  1XWC A;  3A2W A;  3QFB C;  4L5L A;  2VAF A;  4OO4 A;  2HFD A;  1PRX A;  2IMI A;  2L4C A;  3IXR A;  3O76 A;  5ECQ B;  4ECB A;  2KUC A;  2B5Y A;  2F9S A;  2JZR A;  1Z6N A;  4O5R A;  2GQM A;  3HCZ A;  1OC9 A;  3IHQ A;  5EVO A;  3IK9 A;  4EKZ A;  1OC9 B;  1EEJ A;  1SJ6 A;  4TN8 A;  3ZL5 A;  4K9Z A;  2WRT A;  4HSC X;  3ERW A;  3GRX A;  1I9D A;  2FD3 A;  4IHU A;  3LFL A;  4WKW A;  3UEM A;  2LRT A;  3VI5 A;  3I6A A;  1QMV A;  4PXO A;  3GYK A;  5ELG A;  4HU7 A;  5H5S A;  3BD2 A;  3KH9 A;  4NAX A;  5IMV A;  1XW6 A;  2LNS A;  2IJY A;  3ZTL A;  1H75 A;  4Q5F A;  3ZIJ A;  3D4M A;  1OKD A;  1PKW A;  4JZQ A;  4MK3 A;  2OE3 A;  3LSZ A;  4L0U A;  3L4N A;  1EZK A;  2DJ3 A;  3CQF A;  5DQS A;  5AN1 A;  4IP1 A;  3GUR A;  1T7P B;  1MDJ A;  2WDU A;  4E8H A;  1FB6 A;  1M2B A;  4XRD A;  4YH2 A;  4EIQ A;  1M9A A;  3D5J A;  3D6I A;  4RUV A;  5ECO B;  5IIZ A;  2ZUP A;  5CYY A;  3F4T A;  1TRS A;  2YZU A;  4IN0 A;  4HOJ A;  4YAV A;  3U5R E;  2HZF A;  3TKS A;  3GSS A;  4AJ7 A;  1GL8 A;  2HSM A;  3F4S A;  2UZ8 A;  2FLS A;  3DVX A;  5KN1 A;  1SD9 A;  3EU4 A;  2XPD A;  2P5R A;  3H93 A;  5HR1 A;  3DVW A;  2BTO T;  5DAL B;  2REM A;  4Z7X A;  4EC0 A;  2H76 A;  2VL2 C;  5IOX A;  1GTB A;  3RHB A;  5IQY A;  5AIV A;  3LQ7 A;  4LMV A;  1X9M B;  2HE3 A;  2XHF A;  2GGT A;  2YWO A;  4K7I A;  1G7E A;  3ERG A;  2GSR A;  5IO2 A;  1UN2 A;  2H1D A;  2CQ9 A;  4IS0 A;  3IC8 A;  1B9X C;  4HUA A;  5J5N A;  4PTS A;  4EDY A;  1GSD A;  3DYR A;  1XXU A;  4N10 A;  1A2L A;  1OC3 A;  4AF2 A;  1O8X A;  1XWB A;  4PUA A;  1VF3 A;  2C1Y A;  3P7X A;  3WD6 A;  2P0G A;  3R2Q A;  3KMN A;  2IL3 A;  4D73 A;  4YQV A;  1ST9 A;  3CSJ A;  3FR6 A;  4PX1 A;  1F9M A;  1FHE A;  2GST A;  3UVT A;  3TGZ A;  4TXO A;  2MYG A;  3TB2 A;  4IEL A;  2CVD A;  4ID0 A;  5ID2 B;  3VWV A;  4F0B A;  2LV3 A;  1ZYP A;  2DKI A;  2TIR A;  4TXO B;  3TJJ A;  4MNN A;  3GH9 A;  3VWU A;  5F06 A;  5HR2 A;  1RQM A;  2XBQ A;  2AJQ B;  2F51 A;  1YDK A;  3ME8 A;  2DBC A;  3IAS 2;  6GSV A;  1PMT A;  4TVE A;  1OKT A;  4KGI A;  3QAW A;  2HI7 A;  2R37 A;  1GSQ A;  4O92 A;  3KP8 A;  1DSB A;  2NBS A;  4NMU A;  1XWK A;  5EPF A;  4K0G A;  4XS6 A;  4I5Q A;  5DBQ A;  4HZ4 A;  1SEN A;  2V6O A;  4PQ1 A;  1A0F A;  2NPB A;  1ZMA A;  4IJI A;  2DKH A;  1U3A A;  3BCI A;  5C00 A;  1AQX A;  1T3B A;  3GA4 A;  4IQA A;  1QGV A;  5HR0 A;  3QOU A;  1UC7 A;  2H70 A;  4V1A p;  1R4W A;  2IN3 A;  2H0G A;  3DEX A;  4KSM A;  4OFN A;  2B5X A;  1QQ2 A;  2VOC A;  1QUW A;  3GUS A;  2VCV A;  4ECC A;  1MD3 A;  4YKF A;  2L4Q A;  3F3Q A;  3N5O A;  1JFU A;  1Z7P A;  2R3X A;  3OR5 A;  2HLS A;  4O7H A;  3V1W A;  1MD4 A;  3KTL A;  2RM5 A;  3D22 A;  4RQR A;  3BCK A;  2IMF A;  3H1N A;  4POK A;  1JZO A;  2H74 A;  4RI6 A;  3TRX A;  4ML6 A;  1YEX A;  9GSS A;  5FHI A;  1N2A A;  5B7C A;  2GZP A;  3KM6 A;  3IR4 A;  1T1V A;  4GWR A;  3ZIV A;  1XOA A;  3LXZ A;  2LTK A;  3GST A;  1FOV A;  2VCQ A;  2CAQ A;  5JWO B;  1S3C A;  2X4A A;  5GSS A;  4IQ1 A;  3HZ4 A;  5D8I A;  4PQI A;  1BAY A;  3E0U A;  4JRR A;  2GDR A;  2VLV A;  1TK8 B;  4MLY A;  4USS A;  1X5C A;  2L5O A;  1EV9 A;  4KH7 A;  3FYG A;  3IC4 A;  3CXG A;  4YQU A;  4WR4 A;  2H72 A;  1TXX A;  5JCW A;  4X4J A;  3HZ8 A;  1SU9 A;  6GST A;  4G19 A;  4TR4 A;  2H75 A;  3WGD A;  2A2R A;  6GSW A;  3GKN A;  1TRW A;  3I9V 2;  4X43 A;  3MWH A;  5ELA A;  2DJJ A;  7GSS A;  4OD7 A;  3HHV A;  2DML A;  4EIP A;  1OVN A;  4HZ2 A;  2WJU A;  1FG4 A;  1QK8 A;  5B6N A;  1BX9 A;  4CHS A;  2R2J A;  4H86 A;  4P3Y B;  1AUC A;  1LU4 A;  2CVK A;  4WBR D;  5J9B A;  3F63 A;  3Q19 A;  4K2X A;  1TKD B;  5G1L A;  1O8W A;  4GRF A;  1NM3 A;  1URM A;  2B5E A;  2V41 A;  4OMV A;  3TCO A;  1SYX A;  2FA8 A;  3SBC A;  2QA2 A;  1EWX A;  1OE8 A;  2H1A A;  1ZYE A;  1X0R A;  4IKH A;  2O85 A;  5D9V A;  2ES7 A;  1JZR A;  4BL7 A;  4AGS A;  3KMO A;  3MNG A;  1UA5 A;  2FWH A;  4ILF A;  3G7I A;  1EGR A;  4K5S A;  3PIN A;  1AAZ A;  2GS3 A;  1TJD A;  2KLX A;  2J23 A;  2YV7 A;  1RW1 A;  5D9X A;  3M0F A;  2I1U A;  4MJB A;  3TJF A;  4BVY A;  1JHB A;  3KCM A;  4K7O A;  4FH8 A;  4I2U A;  4V2N A;  3TJG A;  1JLW A;  3PH9 A;  3M1G A;  1K0B A;  5H5R A;  1YY7 A;  19GS A;  4FO5 A;  1TW9 A;  5GAP D;  1S3A A;  3R3E A;  6GSU A;  1XPV A;  3GX0 A;  1G6Y A;  5J3R A;  4NV2 A;  2F8F A;  4BVX B;  1EEM A;  2GSS A;  2L57 A;  2XBI A;  3UBL A;  4MZB A;  5AIX A;  4N0Z A;  3TKP A;  5CNW A;  2A4H A;  3L78 A;  1O6J A;  4Z2U A;  2ZCT A;  4ZIJ A;  2F3M A;  1WE0 A;  2CVB A;  2N5F A;  3FEU A;  1GTU A;  2DIY A;  3KEB A;  4QL7 A;  3LOR A;  3MAK A;  1WOU A;  1C72 A;  3TRQ A;  1J08 A;  4KAE A;  5A4W A;  3S9F A;  2ON7 A;  2TRC P;  3VK9 A;  1GSE A;  4XS4 A;  4ZIL A;  3KGK A;  1Y6E A;  1DBY A;  1G6W A;  2R6K A;  3FZ9 A;  4TR1 A;  1SJZ A;  4RQX A;  1XCC A;  2PER A;  1YF1 A;  1S3R A;  5LCZ A;  4WR5 A;  2JAD A;  3ZIT A;  3GIX A;  2LQQ A;  4A5P A;  2FGX A;  5DJM A;  5D96 A;  1KNG A;  2D2Z A;  3DRN A;  3C71 A;  4CDO A;  2XC2 A;  1Z5Y E;  1KTE A;  1IYH A;  4F9Z A;  2C0F A;  3NIV A;  5F0G A;  2PVQ A;  3ZLP A;  1DE1 A;  4I6X A;  4G2E A;  3L9U A;  3UAP A;  1XIY A;  5KN2 A;  2YWM A;  2YAN A;  3C8E A;  4DSS A;  2IPA A;  3EVI A;  3EYT A;  4O5U A;  3QDN A;  3TKR A;  3GKK A;  1T4Z A;  3VLN A;  4TXV A;  2N5A A;  1F6M C;  1K3Y A;  1PX6 A;  2YP6 A;  4F03 A;  3SWL A;  1I5G A;  5AGY A;  1EGO A;  1FO5 A;  3MYD A;  3US3 A;  2RUF A;  4POB A;  1E2Y A;  3FR9 A;  5GAN D;  1GTI A;  3IRA A;  12GS A;  1K0M A;  4MF7 A;  3H8Q A;  2GTU A;  2HRK A;  3ZZX A;  5FT3 A;  2VD0 A;  4L5O A;  3GHA A;  1PFO A;  5BMU A;  3J7Y b;  2YZH A;  2HZE A;  1G0T A;  5L71 A;  5G5E A;  4J57 E;  2PWJ A;  4K5R A;  4MH3 A;  4K7N A;  1ML6 A;  4Z2T A;  3D21 A;  1F3A A;  2L6D A;  4K8M A;  5CRD A;  4IVF A;  1SJI A;  3ZVJ A;  4KB3 A;  4BA7 A;  4HQS A;  5ECI B;  4ECJ A;  8GSS A;  1TK5 B;  2A2P A;  4FQU A;  1X5E A;  2KP1 A;  5COH A;  4HEA 2;  3E3E A;  4ISD A;  4I8B A;  3IDV A;  2LRC A;  3RBT A;  2C0E A;  4FYC A;  2GQL A;  2ZNM A;  3M8N A;  4MP4 A;  2QA1 A; 
#chains in the Genus database with same CATH homology
 4XHM A;  1EP8 A;  1EP7 A;  1ERV A;  4OWY A;  3EPT A;  2WCI A;  1MTC A;  1PA3 A;  2C3N A;  2LEG A;  5HR3 A;  3W6G A;  4G10 A;  1K0D A;  4PUR A;  2LJR A;  3IBH A;  4MCU A;  4J2F A;  1YQ1 A;  1W89 A;  5IMA A;  1HD2 A;  2OKA A;  4KDY A;  1BG5 A;  1GH2 A;  3F6D A;  1F37 A;  2H71 A;  3LYP A;  3C73 A;  2AHE A;  2H01 A;  2B7K A;  2VLU A;  1BYE A;  4G0I A;  3EMP A;  1U6T A;  4MDC A;  1SKW B;  3HY2 A;  2YJ7 A;  4WBJ A;  4POL A;  4D73 B;  1PD2 1;  1M9B A;  4EUY A;  4JED A;  1VRS D;  5GZZ B;  2HSH A;  4QQ7 A;  3EWL A;  4EL1 A;  3QCP A;  2H8L A;  1GLP A;  1XOB A;  1LJR A;  1O73 A;  2DJ2 A;  2H0I A;  3LEF A;  4MJC A;  2M46 A;  3IOS A;  3MDK A;  1QXH A;  3GFK A;  3L9V A;  2E0Q A;  2P31 A;  2J9H A;  2OBI A;  2JSY A;  3H79 A;  1CQH A;  1O85 A;  4MA9 A;  1XZO A;  1XWA A;  2VLT A;  5DQY A;  3AY8 A;  4HS1 A;  3GV1 A;  3ZRE A;  4JBB A;  2MMO A;  2AB6 A;  3VUR A;  2O7K A;  1HNC A;  2LNT A;  1A2J A;  2VL3 A;  3GKM A;  5CRG A;  2FA4 A;  2IIY A;  2GT6 A;  3KTB A;  3ZFB A;  4EE0 A;  1TI3 A;  3HVX A;  2KOK A;  5ABR A;  3IE3 A;  3FRC A;  3HVS A;  1YJ6 A;  5B8A A;  4IW9 A;  1M0U A;  1K3L A;  2IMD A;  3IAM 2;  4K2D A;  4GF0 A;  4N0V A;  2B1K A;  2DIZ A;  2MMA A;  4FIW A;  3GTU A;  3IK7 A;  3Q18 A;  3TKS C;  2RLI A;  2HYX A;  3KD0 A;  2VCX A;  1AC1 A;  2M72 A;  2OA7 A;  5IOW A;  2WFC A;  2O89 A;  2GZY A;  2YV9 A;  4GTU A;  4LL1 B;  4L0W A;  4MF5 A;  2ON5 A;  1MDI A;  3EUR A;  3HD5 A;  3F9U A;  20GS A;  4F82 A;  5JWR B;  4ML1 A;  2CZ2 A;  4V1A g;  2DJ0 A;  4Q5N A;  4OO5 A;  2H73 A;  1GNW A;  5ECR B;  4WET A;  3ISO A;  4CY8 A;  1ERW A;  2LRN A;  1NSW A;  4ZL7 A;  3JCM L;  2FUG 2;  4KE3 A;  1SL2 B;  2FCH A;  4KCA A;  3DWV A;  3MSZ A;  5CP1 A;  3W8J A;  3F3R A;  1U3I A;  1X9W B;  3GMF A;  1U87 A;  5DJL A;  4PNF A;  2JZT A;  1T8E B;  3KIJ A;  3DGQ A;  2VL9 A;  3U6V A;  2GVP A;  1VF2 A;  4DEJ A;  3N9J A;  1GWC A;  3TJK A;  4GQF A;  5DVB A;  1SK0 A;  4HJ2 A;  3UOM A;  1GSY A;  2DSA A;  5D93 A;  5A4V A;  1M2D A;  2PMT A;  1E6B A;  3CSH A;  2HNL A;  4K1F A;  3D0Z A;  2KHP A;  3P8W A;  5IO0 A;  5IMZ A;  5EL8 A;  3ZRD A;  1TRV A;  4Z2R A;  3RHC A;  2H30 A;  3TOT A;  1THX A;  2X99 A;  4O32 A;  4NPB A;  1M7T A;  1Q98 A;  2V2G A;  3M9J A;  3A5W A;  5F07 A;  2G0F A;  2N5B A;  4KUN A;  3TUE A;  2C3Q A;  4N11 A;  2H6Y A;  3GX8 A;  4KX4 A;  18GS A;  5D9T A;  1ZGN A;  3C7M A;  2O8V B;  3HYP A;  2AAW A;  3VFI A;  2AUV A;  3FZ5 A;  1BJX A;  3BOA A;  1H4O A;  2X49 A;  5ECL B;  1PSQ A;  3ZML A;  2I4A A;  4WXT A;  2C3T A;  4OFT A;  2FWG A;  3APQ A;  3FZ4 A;  4TRX A;  3TKQ A;  4DSQ A;  2YPM A;  4Q5Q A;  2VM2 A;  1X9S B;  4POM A;  5AIS A;  1TTZ A;  2FY6 A;  1WP0 A;  3NOF A;  1BED A;  1V9W A;  5JCU A;  1GUL A;  5KOW A;  4QL9 A;  2V6K A;  3IV4 A;  2R0C A;  2JU5 A;  2B7J A;  1AQV A;  2H1G A;  2GSQ A;  3RDW A;  5B6M A;  3I43 A;  3IHG A;  2K8S A;  4XIH A;  1A23 A;  3ZFL A;  4GLT A;  4WEY A;  2WUL A;  3D4T A;  2F8A A;  3LW9 A;  3VWW A;  1FVJ A;  1XFL A;  1TI1 A;  4BL7 B;  1QFN A;  2V1M A;  3HXS A;  1ON4 A;  2PU9 C;  3RAZ A;  2B6M A;  3FHK A;  2WZ9 A;  3FR3 A;  5HQP A;  1XWG A;  1O7U A;  4CW9 A;  5F05 A;  3A2V A;  3HJO A;  1Y25 A;  1PQN A;  1WWJ A;  2GQK A;  4V2L A;  4BVY B;  3CTF A;  4PUF C;  3ERF A;  1GSF A;  1TP9 A;  1NHY A;  1SKR B;  2M80 A;  3CBU A;  3Q74 A;  4OCE A;  2LS5 A;  5LNK e;  4TR0 A;  1ZCP A;  2MBT A;  4FYB A;  4V2M A;  4G0L A;  4IBP A;  3QR6 A;  1F3B A;  3DIE A;  3FMW A;  5G5F A;  5CRW A;  4KW6 A;  1K0N A;  2CX3 A;  4GST A;  4PNG A;  2QC7 A;  5G30 A;  4I2T A;  4XCS A;  2HRN A;  5CO3 A;  2LST A;  4GQC A;  5J9C A;  3G7J A;  1DE2 A;  2C4J A;  4EO3 A;  2PUK C;  3LYK A;  5LD0 A;  5C04 A;  2FNO A;  1B48 A;  3NZN A;  2VIM A;  2DC5 A;  4MJE A;  2L6C A;  2DJK A;  1R7H A;  1TU7 A;  1AXD A;  1MEK A;  1BQ7 A;  1PX7 A;  3UBK A;  4NHZ A;  1X5D A;  2IME A;  3C1R A;  4KND A;  3W8S A;  4XS4 B;  4MPG A;  3MIX A;  6GSS A;  1CQG A;  2VL2 A;  1V2A A;  5ENU A;  3UL3 A;  4TR1 B;  4WF5 A;  2IFQ A;  4K6X A;  5DAK A;  4MJA A;  2DLX A;  3GH6 A;  2LKU A;  2AV4 A;  4LA1 A;  3BJ5 A;  2YOI A;  2VCW A;  2IFQ B;  5GST A;  5HFG A;  2GT5 A;  4O5Q A;  1TOF A;  3C1S A;  2TRX A;  3GL5 A;  2GZZ A;  3TRP A;  1GTA A;  1EV4 A;  3GN3 A;  2E2G A;  2LJK A;  1JZD A;  3LGC A;  1G7O A;  2VD1 A;  3EC3 A;  1HNB A;  2DMM A;  2HRA A;  1A8L A;  3KZQ A;  2H19 A;  4DSS B;  4LL4 B;  2QKE A;  2YCD A;  4ZXG A;  3DML A;  4YKG A;  3M9K A;  1Z7R A;  1DUG A;  1FB0 A;  1GNE A;  4ZBB A;  2QGV A;  5DDL A;  1IYI A;  1ERT A;  3P2A A;  4NXI A;  3CTG A;  4XRA A;  5CAX A;  3FW2 A;  2R4V A;  1GUM A;  1Q4J A;  3QPM A;  3E9J B;  5HFK A;  5IMD A;  3ZVJ D;  3HJP A;  4AJ8 A;  1K3O A;  2B3S A;  2H0H A;  2NDO A;  4HQZ A;  1T00 A;  1XBS A;  2HZE B;  1U88 A;  2I3Y A;  2I9H A;  5KN3 A;  1SL0 B;  3UAR A;  1PL1 A;  1PKZ A;  1A2M A;  3O3T A;  4LMW A;  3LWA A;  3F8U A;  4N30 A;  3KH7 A;  4ICY A;  5FWG A;  2ALB A;  1TU8 A;  2HXK A;  4G0K A;  4HI7 A;  3TDG A;  1OAZ A;  5IPH A;  2EC4 A;  1USB A;  2OE0 A;  2LJA A;  5DCG A;  3RPP A;  2X64 A;  3APS A;  4ECI A;  3PR8 A;  1FVK A;  1VGL A;  3ME7 A;  3L0H A;  5ECS A;  5J41 A;  5ECP B;  1A0R P;  1MDK A;  3TKS E;  4KA0 A;  1XVQ A;  2C0G A;  3DD3 A;  2EIR A;  4ZL9 A;  5B8B A;  2RUE A;  1ZYN A;  2IWT A;  3EIN A;  2GLR A;  5DAL A;  2CZ3 A;  1EOG A;  4KDX A;  3TOU A;  1B4P A;  5A4U A;  1VF1 A;  1SK1 A;  2YNX A;  3A3T A;  1ZZY A;  1A8Y A;  3J7Y k;  1YKC A;  3ZMK A;  1YZX A;  3L9S A;  2E2M A;  2H6X A;  3EU3 A;  1GUK A;  1OE7 A;  4NHW A;  5G2Z A;  4IJ3 A;  3DXB A;  3HJM A;  4TW5 A;  1UVZ A;  3FZA A;  1LBK A;  3G7Y A;  1WRY A;  3ZYW A;  3RPN A;  1OC8 A;  2JL4 A;  5DCH A;  3PGT A;  1V58 A;  1YF0 A;  3IA1 A;  4BWQ A;  1O81 A;  5IMC A;  4NWY A;  2B1L A;  4ZB6 A;  1NW2 A;  3GL3 A;  3ED3 A;  4MAB A;  4X1U A;  5ID2 A;  4EVM A;  1J9B A;  3F4R A;  3QD9 A;  4YAP A;  4ULX A;  1WPI A;  2R0P A;  3WT1 A;  4KF9 A;  4K0N A;  1SK2 A;  4ZBA A;  3CRU A;  3GKX A;  2MBS A;  4FYU A;  22GS A;  4OCF A;  5ECM B;  2OE1 A;  1AW9 A;  4ZL8 A;  3LG6 A;  6GSX A;  1GSS A;  4I97 A;  4HJM A;  1V98 A;  4F0C A;  2CAI A;  5ECH B;  5IPG A;  3Q6O A;  1B4Q A;  2VCZ A;  1FW1 A;  4MPF A;  4IP6 A;  1Z9H A;  3A5I A;  3HVV A;  1XW9 A;  2BMX A;  5BRT A;  4ZBD A;  4MZW A;  5INY A;  2YWN A;  2DJ1 A;  1XW5 A;  3HKR A;  3PPU A;  4CY6 A;  1J0F A;  1V40 A;  3GTU B;  3CYN A;  1TK0 B;  1SYR A;  4MH2 A;  4WF4 A;  1AIU A;  2I81 A;  2VUP A;  2X8H A;  3FKF A;  2MMZ A;  2YN1 A;  4E8E A;  3FK8 A;  1S3D A;  1PL2 A;  2JZS A;  2CA8 A;  3UMA A;  2OBK A;  2A2S A;  1TRU A;  2RM6 A;  2E7P A;  4TR3 A;  2BJX A;  3QMX A;  2OAD A;  4PQH A;  1GUH A;  2WGR A;  1WJK A;  4XS1 A;  1R26 A;  4XTS A;  1AQW A;  2FWF A;  1FAA A;  4NV5 A;  3F0I A;  5JCG A;  4X0X A;  14GS A;  4GXZ A;  1ZOF A;  2CV4 A;  3K8N A;  2PVO C;  3F6F A;  4MMM A;  5J4U A;  2PPT A;  3GNJ A;  4KDU A;  2CT6 A;  1EOH A;  2YJH A;  2EIQ A;  4BWS A;  1PN0 A;  2X8C A;  4KSO A;  4ZB8 A;  1HQO A;  1Z6M A;  2MZC A;  3CMI A;  1FOH A;  2EIO A;  5IMF A;  2VO4 A;  11GS A;  10GS A;  2C80 A;  4TKY A;  2IMK A;  5G31 A;  3UJ1 A;  3VI7 A;  5E4W A;  3G9B A;  4PGT A;  5HFI A;  4Q5R A;  2L59 A;  1KEB A;  4DVC A;  4F2I A;  1K0C A;  4MF6 A;  16GS A;  2HT9 A;  4J56 E;  1HYU A;  1B9Y C;  3WYW A;  2LUS A;  2HRF A;  3A2X A;  3UVH A;  1SKS B;  3H4K A;  1NHO A;  1N8J A;  1ACV A;  3FY7 A;  1K0A A;  2QSI A;  3KJY A;  1KBN A;  1SD8 A;  1XVW A;  2K6V A;  1ILO A;  2K8V A;  1PGT A;  1K0O A;  2PGT A;  4JU5 A;  5H5Q A;  4EDZ A;  2NVL A;  5F8B A;  1ABA A;  3HDC A;  3VPQ A;  4KCE A;  4AJ6 A;  5ECN B;  5KN0 A;  2K18 A;  4JE1 A;  1OYJ A;  2L5L A;  2R0G A;  3APO A;  1TDI A;  3HA9 A;  3QAG A;  1R5A A;  3WGE A;  2OAC A;  5EY6 A;  1B8X A;  2NTO A;  5E59 A;  1W4V A;  2OJL A;  1WMJ A;  2AYT A;  2C0D A;  4LLR A;  4GCI A;  4TOP A;  13GS A;  2MMN A;  2H6Z A;  2P5Q A;  4GSN A;  17GS A;  1R5P A;  4EXJ A;  5G1K A;  1M99 A;  4BPY A;  4ZB9 A;  1A24 A;  2R5G A;  1Z3E A;  3M3M A;  1GSU A;  4RI7 A;  5CRE A;  1ERU A;  2LQO A;  4EF0 A;  4G9H A;  1F2E A;  5D9W A;  2RII A;  5KEJ A;  1JZW A;  3UIW A;  3VWX A;  1GLQ A;  3EMX A;  1RK4 A;  2CX4 A;  3LXT A;  4JR6 A;  2HSY A;  6GSY A;  2KP2 A;  3CRT A;  3BBY A;  3WGX A;  5KOX A;  3VPT A;  4HU9 A;  2A4V A;  3EE2 A;  2WB9 A;  1GRX A;  5IM9 A;  3I69 A;  3DKS A;  4BVX A;  5D73 A;  3P90 A;  2PN8 A;  1ZL9 A;  2FWE A;  1YEP A;  3WT2 A;  4DSR A;  2V32 A;  4GSS A;  3LJR A;  2VM1 A;  1JLV A;  2JAC A;  4HDE A;  2PBJ A;  4OFM A;  2H66 A;  3QAV A;  3IPZ A;  2XPE A;  3O6T A;  2G2Q A;  2YWI A;  2K9F A;  4YQM A;  4IGJ A;  1GP1 A;  2C8U A;  5ECK B;  4MZC A;  5JWQ B;  2O87 A;  3KP9 A;  1HNA A;  2H1B A;  1M2A A;  4ACS A;  1YKA A;  4JR4 A;  2X8G A;  1V57 A;  1VF4 A;  1THO A;  1T4Y A;  1SL1 B;  2FHE A;  5A5K A;  2WS2 A;  3QFA C;  1PN9 A;  3TJB A;  1ZYQ B;  3KXO A;  2Z9S A;  2VCT A;  5DAK B;  1WIK A;  3CSI A;  2JSZ A;  4L8E A;  5CRH A;  1XWC A;  3A2W A;  3QFB C;  4L5L A;  2VAF A;  4OO4 A;  2HFD A;  1PRX A;  2IMI A;  2L4C A;  3IXR A;  3O76 A;  5ECQ B;  4ECB A;  2KUC A;  2B5Y A;  2F9S A;  2JZR A;  1Z6N A;  4O5R A;  2GQM A;  3HCZ A;  1OC9 A;  3IHQ A;  5EVO A;  3IK9 A;  4EKZ A;  1OC9 B;  1EEJ A;  1SJ6 A;  4TN8 A;  3ZL5 A;  4K9Z A;  2WRT A;  3ERW A;  3GRX A;  1I9D A;  2FD3 A;  4IHU A;  3LFL A;  4WKW A;  3UEM A;  2LRT A;  3VI5 A;  3I6A A;  1QMV A;  4PXO A;  3GYK A;  5ELG A;  4HU7 A;  5H5S A;  3BD2 A;  3KH9 A;  4NAX A;  5IMV A;  1XW6 A;  2LNS A;  2IJY A;  3ZTL A;  1H75 A;  4Q5F A;  3ZIJ A;  3D4M A;  1OKD A;  1PKW A;  4JZQ A;  4MK3 A;  2OE3 A;  3LSZ A;  4L0U A;  3L4N A;  1EZK A;  2DJ3 A;  5DQS A;  5AN1 A;  4IP1 A;  3GUR A;  1T7P B;  1MDJ A;  2WDU A;  4E8H A;  1FB6 A;  1M2B A;  4XRD A;  4YH2 A;  4EIQ A;  1M9A A;  3D5J A;  3D6I A;  4RUV A;  5ECO B;  5IIZ A;  2ZUP A;  5CYY A;  3F4T A;  1TRS A;  2YZU A;  4IN0 A;  4HOJ A;  4YAV A;  3U5R E;  2HZF A;  3TKS A;  3GSS A;  4AJ7 A;  1GL8 A;  2HSM A;  3F4S A;  2UZ8 A;  2FLS A;  3DVX A;  5KN1 A;  1SD9 A;  3EU4 A;  2XPD A;  2P5R A;  3H93 A;  5HR1 A;  3DVW A;  2BTO T;  5DAL B;  2REM A;  4Z7X A;  4EC0 A;  2H76 A;  2VL2 C;  5IOX A;  1GTB A;  3RHB A;  5IQY A;  5AIV A;  3LQ7 A;  4LMV A;  1X9M B;  2HE3 A;  2XHF A;  2GGT A;  2YWO A;  4K7I A;  1G7E A;  3ERG A;  2GSR A;  5IO2 A;  1UN2 A;  2H1D A;  2CQ9 A;  4IS0 A;  3IC8 A;  1B9X C;  4HUA A;  5J5N A;  4PTS A;  4EDY A;  1GSD A;  3DYR A;  1XXU A;  4N10 A;  1A2L A;  1OC3 A;  4AF2 A;  1O8X A;  1XWB A;  4PUA A;  1VF3 A;  2C1Y A;  3P7X A;  3WD6 A;  2P0G A;  3R2Q A;  3KMN A;  2IL3 A;  4D73 A;  4YQV A;  1ST9 A;  3CSJ A;  3FR6 A;  4PX1 A;  1F9M A;  1FHE A;  2GST A;  3UVT A;  3TGZ A;  4TXO A;  2MYG A;  3TB2 A;  4IEL A;  2CVD A;  4ID0 A;  5ID2 B;  3VWV A;  4F0B A;  2LV3 A;  1ZYP A;  2DKI A;  2TIR A;  4TXO B;  3TJJ A;  4MNN A;  3GH9 A;  3VWU A;  5F06 A;  5HR2 A;  1RQM A;  2XBQ A;  2AJQ B;  2F51 A;  1YDK A;  3ME8 A;  2DBC A;  3IAS 2;  6GSV A;  1PMT A;  4TVE A;  1OKT A;  4KGI A;  3QAW A;  2HI7 A;  2R37 A;  1GSQ A;  4O92 A;  3KP8 A;  1DSB A;  2NBS A;  4NMU A;  1XWK A;  5EPF A;  4K0G A;  4XS6 A;  4I5Q A;  5DBQ A;  4HZ4 A;  1SEN A;  2V6O A;  4PQ1 A;  1A0F A;  2NPB A;  1ZMA A;  4IJI A;  2DKH A;  1U3A A;  3BCI A;  5C00 A;  1AQX A;  1T3B A;  3GA4 A;  4IQA A;  1QGV A;  5HR0 A;  3QOU A;  1UC7 A;  2H70 A;  4V1A p;  1R4W A;  2IN3 A;  2H0G A;  3DEX A;  4KSM A;  4OFN A;  2B5X A;  1QQ2 A;  2VOC A;  1QUW A;  3GUS A;  2VCV A;  4ECC A;  1MD3 A;  4YKF A;  2L4Q A;  3F3Q A;  3N5O A;  1JFU A;  1Z7P A;  2R3X A;  3OR5 A;  2HLS A;  4O7H A;  3V1W A;  1MD4 A;  3KTL A;  2RM5 A;  3D22 A;  4RQR A;  3BCK A;  2IMF A;  3H1N A;  4POK A;  1JZO A;  2H74 A;  4RI6 A;  3TRX A;  4ML6 A;  1YEX A;  9GSS A;  5FHI A;  1N2A A;  5B7C A;  2GZP A;  3KM6 A;  3IR4 A;  1T1V A;  4GWR A;  3ZIV A;  1XOA A;  3LXZ A;  2LTK A;  3GST A;  1FOV A;  2VCQ A;  2CAQ A;  5JWO B;  1S3C A;  2X4A A;  5GSS A;  4IQ1 A;  3HZ4 A;  5D8I A;  4PQI A;  1BAY A;  3E0U A;  4JRR A;  2GDR A;  2VLV A;  1TK8 B;  4MLY A;  4USS A;  1X5C A;  2L5O A;  1EV9 A;  4KH7 A;  3FYG A;  3IC4 A;  3CXG A;  4YQU A;  4WR4 A;  2H72 A;  1TXX A;  5JCW A;  4X4J A;  3HZ8 A;  1SU9 A;  6GST A;  4G19 A;  4TR4 A;  2H75 A;  3WGD A;  2A2R A;  6GSW A;  3GKN A;  1TRW A;  3I9V 2;  4X43 A;  3MWH A;  5ELA A;  2DJJ A;  7GSS A;  4OD7 A;  3HHV A;  2DML A;  4EIP A;  1OVN A;  4HZ2 A;  2WJU A;  1FG4 A;  1QK8 A;  5B6N A;  1BX9 A;  4CHS A;  2R2J A;  4H86 A;  4P3Y B;  1AUC A;  1LU4 A;  2CVK A;  4WBR D;  5J9B A;  3F63 A;  3Q19 A;  4K2X A;  1TKD B;  5G1L A;  1O8W A;  4GRF A;  1NM3 A;  1URM A;  2B5E A;  2V41 A;  4OMV A;  3TCO A;  1SYX A;  2FA8 A;  3SBC A;  2QA2 A;  1EWX A;  1OE8 A;  2H1A A;  1ZYE A;  1X0R A;  4IKH A;  2O85 A;  5D9V A;  2ES7 A;  1JZR A;  4BL7 A;  4AGS A;  3KMO A;  3MNG A;  1UA5 A;  2FWH A;  4ILF A;  3G7I A;  1EGR A;  4K5S A;  3PIN A;  1AAZ A;  2GS3 A;  1TJD A;  2KLX A;  2J23 A;  2YV7 A;  1RW1 A;  5D9X A;  3M0F A;  2I1U A;  4MJB A;  3TJF A;  4BVY A;  1JHB A;  3KCM A;  4K7O A;  4FH8 A;  4I2U A;  4V2N A;  3TJG A;  1JLW A;  3PH9 A;  3M1G A;  1K0B A;  5H5R A;  1YY7 A;  19GS A;  4FO5 A;  1TW9 A;  5GAP D;  1S3A A;  3R3E A;  6GSU A;  1XPV A;  3GX0 A;  1G6Y A;  5J3R A;  4NV2 A;  2F8F A;  4BVX B;  1EEM A;  2GSS A;  2L57 A;  2XBI A;  3UBL A;  4MZB A;  5AIX A;  4N0Z A;  3TKP A;  5CNW A;  2A4H A;  3L78 A;  1O6J A;  4Z2U A;  2ZCT A;  4ZIJ A;  2F3M A;  1WE0 A;  2CVB A;  2N5F A;  3FEU A;  1GTU A;  2DIY A;  3KEB A;  4QL7 A;  3LOR A;  3MAK A;  1WOU A;  1C72 A;  3TRQ A;  1J08 A;  4KAE A;  5A4W A;  3S9F A;  2ON7 A;  2TRC P;  3VK9 A;  1GSE A;  4XS4 A;  4ZIL A;  3KGK A;  1Y6E A;  1DBY A;  1G6W A;  2R6K A;  3FZ9 A;  4TR1 A;  1SJZ A;  4RQX A;  1XCC A;  2PER A;  1YF1 A;  5LCZ A;  4WR5 A;  2JAD A;  3ZIT A;  3GIX A;  2LQQ A;  4A5P A;  2FGX A;  5DJM A;  5D96 A;  1KNG A;  2D2Z A;  3DRN A;  3C71 A;  4CDO A;  2XC2 A;  1Z5Y E;  1KTE A;  1IYH A;  4F9Z A;  2C0F A;  3NIV A;  5F0G A;  2PVQ A;  3ZLP A;  1DE1 A;  4I6X A;  4G2E A;  3L9U A;  3UAP A;  1XIY A;  5KN2 A;  2YWM A;  2YAN A;  3C8E A;  4DSS A;  2IPA A;  3EVI A;  3EYT A;  4O5U A;  3QDN A;  3TKR A;  3GKK A;  1T4Z A;  3VLN A;  4TXV A;  2N5A A;  1F6M C;  1K3Y A;  1PX6 A;  2YP6 A;  4F03 A;  3SWL A;  1I5G A;  5AGY A;  1EGO A;  1FO5 A;  3MYD A;  3US3 A;  2RUF A;  4POB A;  1E2Y A;  3FR9 A;  5GAN D;  1GTI A;  3IRA A;  12GS A;  1K0M A;  4MF7 A;  3H8Q A;  2GTU A;  2HRK A;  3ZZX A;  5FT3 A;  2VD0 A;  4L5O A;  3GHA A;  5BMU A;  3J7Y b;  2YZH A;  2HZE A;  1G0T A;  5L71 A;  5G5E A;  4J57 E;  2PWJ A;  4K5R A;  4MH3 A;  4K7N A;  1ML6 A;  4Z2T A;  3D21 A;  1F3A A;  2L6D A;  4K8M A;  5CRD A;  4IVF A;  1SJI A;  3ZVJ A;  4KB3 A;  4BA7 A;  4HQS A;  5ECI B;  4ECJ A;  8GSS A;  1TK5 B;  2A2P A;  4FQU A;  1X5E A;  2KP1 A;  5COH A;  4HEA 2;  3E3E A;  4ISD A;  4I8B A;  3IDV A;  2LRC A;  3RBT A;  2C0E A;  4FYC A;  2GQL A;  2ZNM A;  3M8N A;  4MP4 A;  2QA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...