2I3YA

Crystal structure of human glutathione peroxidase 5
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
188
structure length
188
Chain Sequence
DCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPELNALQEELKPYGLVVLGFPCNQFGKQEPGDNKEILPGLKYVRPGGGFVPSFQLFEKGDVNGEKEQKVFSFLKHSCPHPSEILGTFKSISWDPVKVHDIRWNFEKFLVGPDGIPVMRWSHRATVSSVKTDILAYLKQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Epididymal secretory glutathione peroxidase
publication title Crystal structure of human glutathione peroxidase 5
rcsb
source organism Homo sapiens
total genus 54
structure length 188
sequence length 188
ec nomenclature ec 1.11.1.9: Glutathione peroxidase.
pdb deposition date 2006-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00255 GSHPx Glutathione peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2i3yA01
4ACSA 1WIKA 1PX6A 2H0IA 5ECLB 4XS6A 4O7HA 2IMIA 2YP6A 1PSQA 2XPDA 2HRFA 3A5WA 1B9YC 1KNGA 4XS4B 1XBSA 2E7PA 2ALBA 2VAFA 4CW9A 2OBIA 3GN3A 4GTUA 3F3QA 2FNOA 4MJEA 3KGKA 4MF5A 1SU9A 1TRVA 17GSA 2V32A 3O3TA 3CBUA 2WRTA 3RPPA 3IAM2 3ZIJA 3CTGA 5G5EA 5J3RA 1VF2A 5CREA 2WULA 4NAXA 1TRUA 4ILFA 2CT6A 2YV7A 5A4VA 4GRFA 4HOJA 2V6OA 1GRXA 4HJMA 3F6DA 4JR6A 2DMMA 18GSA 5JWRB 3KEBA 1PA3A 2PERA 2QC7A 1G7OA 1KEBA 4FO5A 1G0TA 2DJ0A 2VCWA 4IS0A 1DSBA 2H75A 2RM6A 2ON7A 4MF6A 4IGJA 4E8HA 3KTLA 2YANA 7GSSA 1QFNA 1SYXA 3A2XA 4PQIA 2Z9SA 3APOA 1TP9A 2RM5A 4MZWA 3P90A 4EL1A 3UBKA 3KZQA 1FOVA 2JACA 3S9FA 2OE1A 2PVQA 4F2IA 4PX1A 3KP8A 4G10A 2H0GA 4K7NA 5JWQB 3GA4A 5DQYA 1N2AA 1TU7A 3MWHA 3IXRA 3HDCA 3DWVA 5IO2A 1THOA 3NZNA 4K7IA 2VOCA 11GSA 5D9XA 1ML6A 5ELGA 3D5JA 4V2MA 2O87A 2LRCA 4OFTA 4KDUA 3TDGA 1GH2A 4D73A 1OC3A 4MMMA 3BCIA 4K8MA 5ELAA 1BYEA 1GUMA 1AQXA 1ZCPA 3UARA 3KIJA 2JSZA 2RLIA 1OE7A 5DALA 4WF5A 5LD0A 2PU9C 1G7EA 4NPBA 2B6MA 4QL7A 2B7JA 3VWWA 4F9ZA 3CSIA 1X0RA 3BBYA 3QR6A 3CSJA 3ZMLA 4FIWA 1Y6EA 1GSUA 2IJYA 2PBJA 3JCML 3TJFA 3TUEA 1FVJA 2EIQA 2IFQA 4POMA 2H72A 2YJHA 1WMJA 4J56E 1FW1A 3GTUA 4EC0A 1HD2A 1A8YA 2H70A 4Q5RA 2PVOC 1O81A 1ZGNA 2L6CA 1SJIA 3VWUA 1VF1A 4XCSA 4OWYA 3LYPA 1MD3A 1M2AA 6GSWA 3IA1A 1XVQA 2K18A 1K3YA 4JR4A 4HI7A 4RUVA 3EC3A 2AUVA 1NW2A 20GSA 1V40A 1O85A 3TOTA 3QAVA 5ENUA 4EKZA 2REMA 4I2UA 3ZFBA 2ON5A 2AV4A 5E59A 1AUCA 5G1KA 3UOMA 5EY6A 4K0NA 4FYUA 4E8EA 2X64A 2WJUA 3N5OA 3P8WA 4AF2A 1JHBA 2AYTA 4KAEA 4OFNA 3GNJA 3IDVA 2HRNA 2YWNA 2XPEA 3HY2A 2MMAA 4MF7A 3IOSA 5HQPA 1G6YA 3H8QA 5DDLA 2MMOA 3KXOA 1XOBA 3F9UA 4IJ3A 5IMFA 5IO0A 3RAZA 4TR4A 2DJ3A 4IW9A 1GULA 1T00A 1YDKA 5D9WA 3HVXA 22GSA 2F8AA 4MZCA 4I6XA 4XRDA 2I3YA 3CSHA 4TR3A 5CYYA 3FZ9A 5ECMB 2GGTA 3US3A 2NDOA 3F4TA 2WFCA 2YPMA 4I5QA 2YCDA 3UIWA 3UJ1A 2O89A 2FWGA 3BD2A 5IMZA 3ERFA 3KMOA 1DUGA 2D2ZA 1EP8A 1V9WA 3V1WA 1ZL9A 2CV4A 2YZUA 1TRSA 3F4RA 1Y25A 4OCEA 3F63A 2V2GA 3Q74A 4MJCA 3EINA 1Z3EA 4RQXA 2HI7A 2H1DA 2CVDA 2VLVA 4DSSA 1QQ2A 1R26A 5D93A 2TRCP 1GNEA 3A2VA 4ECIA 1GSYA 2IMEA 2H66A 4LLRA 2B5EA 3W8SA 5ID2B 1H75A 4TR1B 4POKA 4P3YB 3HJOA 1PN9A 2H01A 4J57E 2RUFA 2RUEA 3O76A 4IVFA 4IELA 3EURA 1M9BA 4NV2A 5IOXA 1V58A 5F8BA 4KW6A 1XXUA 3TCOA 5HFGA 2C3NA 2LTKA 3QMXA 1O6JA 2LUSA 2PN8A 1FO5A 2VL9A 4WKWA 5B6MA 2L4QA 3RHBA 1KTEA 1K0NA 4WF4A 1YF1A 4GSTA 4MJAA 2DJ2A 1B9XC 4ZB8A 1GTAA 5IPHA 2C8UA 2R5GA 5DJLA 3N9JA 1OVNA 4G9HA 4MPFA 4K9ZA 4ZBBA 1XZOA 2A2SA 2B1KA 1SD8A 3U6VA 2R4VA 2R37A 3LFLA 1W89A 4WEYA 3HZ4A 3I9V2 2WZ9A 5G30A 2CAQA 3L4NA 5CO3A 3HJMA 2CVBA 2ZNMA 3P2AA 2JL4A 2BMXA 1RK4A 4OMVA 1EGOA 4MZBA 4OD7A 3PINA 3VK9A 4PURA 2TRXA 2VCQA 1JZWA 3LQ7A 1XWKA 1GL8A 1FG4A 4EDYA 4L8EA 1DBYA 3VWXA 5A5KA 1SJ6A 4YQUA 4RQRA 4V1Ap 4XIHA 2KHPA 2C0FA 2H19A 2L6DA 1O8XA 3FHKA 2KUCA 5CAXA 1M2BA 1T4ZA 3F0IA 2DBCA 5IMVA 3ZRDA 3LJRA 4GXZA 4XS1A 1A0RP 1AQWA 1IYIA 2PUKC 4HU9A 1RQMA 1X9WB 4K1FA 6GSYA 4GWRA 4PUAA 1ZZYA 1GSEA 3C71A 2P0GA 1TU8A 1F3BA 3UBLA 6GSVA 2R3XA 4ECBA 2VD1A 4N30A 1N8JA 3WGEA 3HYPA 2NTOA 4AJ6A 1TOFA 2MBTA 4K0GA 3VURA 4AJ7A 4CDOA 3ERGA 1GSFA 2H6XA 3G9BA 2X8HA 5HFIA 3IAS2 4LMWA 3KP9A 2LNSA 4IKHA 1X5CA 1K3OA 1HNBA 4O5RA 2GSTA 1XWBA 3HD5A 2VL2C 2AHEA 3UVHA 4NHWA 3IBHA 1XFLA 3GL3A 2GDRA 4KNDA 1WOUA 3G7YA 1O7UA 1URMA 1YEXA 3FEUA 4DSRA 4HEA2 3PR8A 3FR9A 1K0CA 4ZL8A 2PWJA 1VGLA 4K7OA 4XS4A 5B7CA 2H73A 5E4WA 4X0XA 3TJJA 2E0QA 2YWIA 5J4UA 1ACVA 4KSMA 1FHEA 1SL1B 3WYWA 4MH2A 4L5OA 3CRUA 3QAGA 5C00A 3UEMA 4EO3A 2N5BA 3L78A 1ERWA 3F6FA 2C80A 2PGTA 4L5LA 2YN1A 2G0FA 5IOWA 5J5NA 1PL2A 2V41A 1DE1A 5LCZA 2DIYA 2VCZA 5DAKB 1GLPA 2HYXA 3F3RA 4FH8A 2WCIA 3D6IA 3ME7A 1A8LA 4G2EA 3HA9A 2C0DA 2GQKA 2L5OA 2RIIA 4JEDA 4EVMA 1AW9A 1AXDA 2FGXA 1EEJA 5ECNB 4TXOB 4O32A 5ECKB 3C7MA 5EVOA 1HNAA 2X8GA 5DALB 1H4OA 3IR4A 2MMNA 10GSA 3EU3A 3P7XA 4KH7A 5J41A 2F51A 4HQZA 5EPFA 1SKSB 5DJMA 1ERVA 1MEKA 5G1LA 2VL3A 2WDUA 1QMVA 2XC2A 1TK5B 1VF3A 4KGIA 2MZCA 1GUKA 1PRXA 4PNFA 1XWAA 1T4YA 4ZBAA 1GTUA 5CRHA 2I1UA 2HXKA 1JLWA 1B4PA 1OKTA 3GX8A 1I5GA 1OC9B 1R7HA 4IQAA 1A0FA 1XW6A 2GT5A 2L57A 3HZ8A 9GSSA 4HJ2A 1WE0A 2JADA 3C8EA 5CRDA 3FZ4A 6GSTA 5AIVA 4X43A 3FR3A 1SKRB 4MCUA 1SYRA 3ERWA 1X5DA 4J2FA 4YQVA 1QK8A 2H30A 3L9SA 5GAPD 1Z6NA 1BEDA 2FCHA 1YQ1A 4POLA 2F8FA 5ABRA 5F0GA 1F9MA 1ERTA 4BVYA 2FD3A 4NMUA 3A2WA 1J0FA 2G2QA 3GKNA 5AGYA 4PNGA 3H93A 5FWGA 3ZL5A 2M46A 4TW5A 2KLXA 3F8UA 3TJKA 1TXXA 4OO4A 1SJZA 1EOHA 1SL2B 5DBQA 3VPTA 3M1GA 1KBNA 1U6TA 4TKYA 4V2NA 2YJ7A 1T8EB 4EE0A 5AN1A 1XWCA 3HHVA 2QKEA 3VPQA 2OJLA 3ED3A 1R5PA 3GUSA 1YY7A 3GKKA 2AAWA 3DIEA 2AJQB 4JU5A 4OFMA 1Z6MA 3GL5A 5B6NA 1AQVA 4KX4A 1MD4A 2VCVA 2HT9A 3CYNA 2LJKA 4PUFC 4N11A 1USBA 4TVEA 2L4CA 5A4WA 1Z5YE 3IE3A 4DVCA 2QGVA 3MDKA 4PGTA 3D21A 3GSTA 8GSSA 3M8NA 4TN8A 5GAND 4JE1A 1TTZA 4I2TA 3U5RE 3ZLPA 4GLTA 2IPAA 1HYUA 2FWEA 1TJDA 6GSSA 4ZL9A 3VWVA 2VM2A 3J7Yk 1UC7A 3ZITA 1LBKA 4DSSB 3WT2A 3TRXA 13GSA 4EF0A 3LG6A 6GSUA 3VFIA 2KP2A 4TOPA 2YOIA 5H5SA 2H8LA 4KDXA 1XW9A 3RBTA 4ZXGA 3E9JB 2ZUPA 1M99A 2KOKA 2DSAA 3LWAA 1OE8A 1PQNA 3TJGA 4G19A 4ECJA 5D9TA 3LXZA 3ZMKA 2H1AA 2GZZA 1GSQA 1U87A 4TRXA 1PL1A 4V1Ag 4BPYA 2FA4A 3F4SA 1S3AA 2C4JA 2CZ3A 5CRGA 2YZHA 1WPIA 3AY8A 3QFBC 4H86A 4JBBA 3GHAA 1OC8A 1EZKA 4KUNA 1JZOA 5LNKe 1XIYA 1K0MA 1XWGA 3OR5A 3HKRA 1V57A 3DD3A 3H79A 1JZDA 2KP1A 1T7PB 2L59A 4MH3A 3FKFA 2WS2A 2LEGA 3K8NA 2PMTA 5ID2A 1SK1A 4TR1A 2OKAA 4CHSA 4ZL7A 1YKCA 1MDKA 5IMAA 2R6KA 1S3DA 4GQFA 3CXGA 1IYHA 1OKDA 1PD21 3EMPA 1R5AA 2CVKA 2X99A 3GFKA 4F0CA 3IK7A 2J23A 4L0WA 2OACA 5G2ZA 2EIOA 3VI7A 3GRXA 1T3BA 1PKWA 1WP0A 2IN3A 2P5RA 1HQOA 3QDNA 1OYJA 2LJAA 4F0BA 3SWLA 4WXTA 1WJKA 4L0UA 3IC4A 1X9SB 3HXSA 4LMVA 1Z7RA 4Q5QA 4N10A 5IMDA 4NV5A 3ZIVA 5JCGA 2LKUA 2M80A 3TKPA 2HZEB 5ECQB 2FUG2 5HR3A 3GMFA 1ABAA 1W4VA 3IHQA 3EWLA 1F3AA 3DKSA 1XOAA 4PQ1A 5ECSA 1M0UA 3I6AA 3Q6OA 3E0UA 4OO5A 1GWCA 4BL7A 4IP1A 3TJBA 2BTOT 3WGDA 3TKQA 3I69A 2XHFA 2WB9A 3CRTA 2K6VA 2NBSA 4ML6A 1GTIA 2LQQA 3ME8A 4BWSA 14GSA 4GQCA 3SBCA 4WETA 5KN0A 3TRPA 1F2EA 1EGRA 1AAZA 5HR2A 1V2AA 1YEPA 4QQ7A 5J9CA 1ON4A 4YAVA 2X8CA 1K0DA 1TW9A 2F3MA 3EYTA 2I9HA 1MDIA 3FK8A 5AISA 4PQHA 3Q18A 3PGTA 1BJXA 2YV9A 2VIMA 2LRTA 3W8JA 4I8BA 2ZCTA 2PPTA 3DRNA 1O73A 4Z7XA 1NHOA 1GSDA 3APQA 3M9JA 4RI6A 3EE2A 2GQLA 2GT6A 3TOUA 1M2DA 3G7IA 2MBSA 2GVPA 3ZFLA 4POBA 4ZIJA 1LJRA 2LJRA 1F6MC 2N5AA 19GSA 4PXOA 3DXBA 4HUAA 5H5RA 3KH7A 1PKZA 2GLRA 4AJ8A 2GTUA 1Z9HA 1XW5A 2HLSA 3ZYWA 4YH2A 3VLNA 4RI7A 2FA8A 1A23A 2F9SA 3L9VA 2GSQA 1HNCA 4KSOA 1SD9A 1EEMA 2IMDA 1C72A 4KDYA 1XPVA 5FT3A 1ST9A 4NXIA 4F03A 1J08A 1UVZA 5G31A 5DVBA 3CMIA 4KCEA 3PH9A 4IJIA 2N5FA 2B5XA 1WWJA 1OAZA 4GSNA 2JZTA 1TK8B 1NHYA 5B8BA 1B8XA 3GV1A 5DCHA 3R2QA 1ZYQB 4JRRA 1Q4JA 3CTFA 3KTBA 4Q5FA 4IQ1A 2OE3A 2JZSA 2FY6A 5KN3A 3DMLA 3DVXA 1K0OA 2DLXA 3MAKA 3Q19A 4ML1A 2VLTA 3H4KA 1EP7A 3FRCA 3QPMA 4D73B 2DIZA 2IL3A 1WRYA 3FY7A 5KN2A 3ZREA 4JZQA 5D96A 1PMTA 3FW2A 1CQGA 4F82A 3C1SA 5DQSA 1K0AA 3APSA 4BA7A 5DAKA 1EV4A 5D73A 3IRAA 4X1UA 1CQHA 3GSSA 3HCZA 3QCPA 1BQ7A 1DE2A 1MTCA 2BJXA 1GNWA 4NHZA 1FVKA 5ECPB 1TDIA 4EXJA 3HVVA 4IP6A 4ZILA 2A2RA 4OCFA 5COHA 4HZ2A 4ULXA 2IFQB 2IMFA 3FR6A 1TRWA 5IMCA 2O7KA 4TXOA 1SL0B 4QL9A 1E6BA 3GTUB 2GZYA 4YAPA 2MYGA 2CA8A 2K8VA 3DGQA 1SK0A 5CRWA 5HR0A 4MK3A 4FYBA 5ECHB 3UMAA 3UVTA 3TGZA 4K6XA 4YQMA 1J9BA 5DCGA 5KEJA 1K3LA 2GS3A 2H76A 3D4MA 2LRNA 3M0FA 3L9UA 3A3TA 3TKSE 4Q5NA 5JCWA 2HFDA 2VO4A 3NIVA 1I9DA 2VM1A 4WBJA 1TI1A 1UA5A 3WT1A 1A2JA 4IBPA 2O8VB 3LORA 2NVLA 2GSSA 3FZ5A 2GSRA 2HE3A 2XBIA 5JWOB 12GSA 2JZRA 1OC9A 3E3EA 4K2DA 1AC1A 3VI5A 2P5QA 1RW1A 2H6YA 5ECRB 3QOUA 1A2MA 3ISOA 3TRQA 2J9HA 2VD0A 5ECIB 3O6TA 4HS1A 1ZOFA 2WGRA 1V98A 1UN2A 3RHCA 5FHIA 5F07A 3KMNA 4XRAA 4WBRD 3ZZXA 4GCIA 2DC5A 1GSSA 3MNGA 4ECCA 3J7Yb 1S3CA 4HU7A 5CP1A 2C1YA 3GYKA 1XVWA 5HR1A 1GLQA 1XCCA 2CZ2A 1JLVA 2L5LA 3KH9A 2XBQA 2LV3A 3FZAA 5KN1A 4KB3A 1U3IA 1VRSD 3IV4A 2B7KA 4FYCA 1VF4A 2OA7A 4MABA 3ZVJD 6GSXA 2H0HA 5B8AA 1YJ6A 1G6WA 3GX0A 4DEJA 4GF0A 2EIRA 2C3QA 2I4AA 4NWYA 1FB0A 5INYA 3GH6A 3LGCA 2LS5A 4N0VA 4IN0A 5F06A 3ZTLA 3BJ5A 4WR5A 1Z7PA 1GUHA 3TB2A 2M72A 1M9AA 3D0ZA 3GH9A 1SKWB 3GKMA 4HZ4A 1QXHA 2YWMA 3KM6A 3MSZA 2GQMA 4HDEA 2DJKA 4KE3A 2CX4A 1TI3A 2I81A 3DEXA 4XHMA 2VLUA 3IK9A 5CNWA 2CQ9A 4ZB6A 3EMXA 1A24A 1GTBA 2VUPA 3DYRA 3GIXA 4XTSA 2E2MA 1AIUA 1E2YA 2H71A 2DJ1A 2R2JA 5JCUA 2HSYA 1M7TA 1GP1A 3TKRA 1EV9A 3UL3A 1FAAA 1NM3A 3TKSA 3D22A 4O92A 4MLYA 3LXTA 4V2LA 2VCTA 1YF0A 1T1VA 2H1BA 3QFAC 3KD0A 3LYKA 2IMKA 2OE0A 3KJYA 1R4WA 4I97A 3D4TA 1X9MB 2HZFA 2JSYA 3C73A 3RDWA 4ISDA 1FB6A 4EDZA 1ZMAA 4ZBDA 3H1NA 4MDCA 2LQOA 3HJPA 2VL2A 3EVIA 1ERUA 1BAYA 2ES7A 4EUYA 1TK0B 2B3SA 2JU5A 2CAIA 2HNLA 4LL1B 1JZRA 3QD9A 1EOGA 2YWOA 1YKAA 1EWXA 5HFKA 2B5YA 3DVWA 5J9BA 2FHEA 2H6ZA 5D9VA 2K9FA 4DSQA 5F05A 5IPGA 4KCAA 2IIYA 1QUWA 5C04A 3FYGA 3M3MA 2LNTA 5ECOB 2A4VA 3BOAA 4HQSA 2C0GA 1B48A 2EC4A 1Q98A 2HSHA 5IQYA 4TR0A 1U88A 2E2GA 5GSSA 4GSSA 2V6KA 5AIXA 5GSTA 2C0EA 4MPGA 2FWHA 3QAWA 3LEFA 2GZPA 2H74A 4MP4A 4MA9A 5IM9A 2FLSA 4N0ZA 1LU4A 2NPBA 1U3AA 3G7JA 2P31A 1QGVA 5H5QA 4LL4B 3I43A 1A2LA 2H1GA 1JFUA 4MJBA 3ZVJA 2OADA 3M9KA 3EU4A 4IHUA 3UAPA 3BCKA 2C3TA 3IPZA 4BWQA 2K8SA 2DJJA 1MDJA 1NSWA 2AB6A 1SK2A 4AGSA 1O8WA 2CX3A 3W6GA 1YZXA 2LSTA 1F37A 4LA1A 3C1RA 3GKXA 1ILOA 1B4QA 2TIRA 3NOFA 3KCMA 4KA0A 3WGXA 2V1MA 1TKDB 5IIZA 2HZEA 1K0BA 1PX7A 3RPNA 2VCXA 16GSA 2DMLA 1PGTA 4ID0A 2MMZA 5GZZB 1BG5A 1ZYEA 3LSZA 3GURA 3WD6A 1SENA 5A4UA 2YNXA 4TXVA 4WR4A 3HVSA 2QSIA 2FWFA 3L0HA 1THXA 2B1LA 1BX9A 2OBKA 5EL8A 5D8IA 3TKSC 4ZB9A 2IWTA 4BVXA 5G5FA 1X5EA 5L71A 2O85A
chains in the Genus database with same CATH superfamily
4ACSA 1WIKA 1PX6A 2H0IA 5ECLB 4XS6A 4CY6A 4O7HA 2IMIA 2YP6A 1PSQA 2XPDA 2HRFA 3A5WA 1B9YC 1KNGA 4XS4B 1XBSA 2E7PA 2ALBA 2VAFA 4CW9A 2OBIA 3GN3A 4GTUA 3F3QA 2FNOA 4MJEA 3KGKA 4MF5A 1SU9A 1TRVA 17GSA 2V32A 3O3TA 3CBUA 2WRTA 3RPPA 3IAM2 3ZIJA 3CTGA 5G5EA 5J3RA 1VF2A 5CREA 2WULA 4NAXA 1TRUA 4ILFA 2CT6A 2YV7A 5A4VA 4GRFA 4HOJA 2V6OA 1GRXA 4HJMA 3F6DA 4JR6A 2DMMA 18GSA 5JWRB 3KEBA 1PA3A 2PERA 2QC7A 1G7OA 1KEBA 4FO5A 1G0TA 2DJ0A 4BIKA 2VCWA 4IS0A 1DSBA 2H75A 2RM6A 2ON7A 4MF6A 4IGJA 4E8HA 3KTLA 2YANA 7GSSA 1QFNA 1SYXA 3A2XA 4PQIA 2Z9SA 3APOA 1TP9A 2RM5A 4MZWA 3P90A 4MNNA 4EL1A 2HSMA 3UBKA 3KZQA 1FOVA 2JACA 3S9FA 2OE1A 2PVQA 4F2IA 4PX1A 3KP8A 4G10A 2H0GA 4K7NA 5JWQB 3GA4A 5DQYA 1N2AA 1TU7A 3MWHA 3IXRA 3HDCA 3DWVA 5IO2A 1THOA 3NZNA 4K7IA 2VOCA 11GSA 5D9XA 1ML6A 5ELGA 3D5JA 4V2MA 2O87A 2LRCA 4OFTA 4KDUA 3TDGA 1GH2A 4D73A 1OC3A 4MMMA 3BCIA 4K8MA 5ELAA 1BYEA 1GUMA 1AQXA 1ZCPA 3UARA 3KIJA 2JSZA 2RLIA 1OE7A 5DALA 4WF5A 5LD0A 2PU9C 1G7EA 4NPBA 2B6MA 4QL7A 2B7JA 3VWWA 4F9ZA 3CSIA 1X0RA 3BBYA 3QR6A 3CSJA 3ZMLA 4FIWA 1Y6EA 1GSUA 2IJYA 2PBJA 3JCML 3TJFA 3TUEA 1FVJA 2EIQA 2IFQA 4POMA 2H72A 2YJHA 1WMJA 4J56E 1FW1A 3GTUA 4EC0A 1HD2A 1A8YA 2H70A 4Q5RA 2PVOC 1O81A 1ZGNA 2L6CA 1SJIA 3VWUA 1VF1A 4XCSA 4OWYA 3LYPA 1MD3A 1M2AA 6GSWA 3IA1A 1XVQA 2K18A 1K3YA 4JR4A 4HI7A 4RUVA 3EC3A 2AUVA 1NW2A 2X49A 20GSA 1V40A 1O85A 3TOTA 3QAVA 5ENUA 4EKZA 2REMA 4I2UA 3ZFBA 2ON5A 2AV4A 5E59A 1AUCA 5G1KA 3UOMA 5EY6A 4K0NA 4FYUA 4E8EA 2X64A 2WJUA 3N5OA 3P8WA 4G0LA 4AF2A 1JHBA 2AYTA 4KAEA 4OFNA 3GNJA 3IDVA 2HRNA 2YWNA 2XPEA 3HY2A 2MMAA 4MF7A 3IOSA 5HQPA 1G6YA 3H8QA 5DDLA 2MMOA 3KXOA 1XOBA 3F9UA 4IJ3A 5IMFA 5IO0A 3RAZA 4TR4A 2DJ3A 4IW9A 1GULA 1T00A 1YDKA 5D9WA 3HVXA 22GSA 2F8AA 4MZCA 4I6XA 4XRDA 2I3YA 3CSHA 4TR3A 4X4JA 5CYYA 3FZ9A 5ECMB 2GGTA 3US3A 2NDOA 3F4TA 2WFCA 2YPMA 4I5QA 2YCDA 3UIWA 3UJ1A 2O89A 2FWGA 3BD2A 4ICYA 5IMZA 3ERFA 3KMOA 1DUGA 2D2ZA 1EP8A 1V9WA 3V1WA 4Z2RA 1ZL9A 1ZYPA 4YKFA 2CV4A 2YZUA 1TRSA 3F4RA 1Y25A 4OCEA 3F63A 2V2GA 3Q74A 4MJCA 3EINA 1Z3EA 4RQXA 2HI7A 2H1DA 2CVDA 2VLVA 4DSSA 1QQ2A 1R26A 5D93A 2TRCP 1GNEA 3A2VA 4ECIA 1GSYA 2IMEA 2H66A 4LLRA 2B5EA 3W8SA 5ID2B 1H75A 4TR1B 4POKA 4P3YB 3HJOA 1PN9A 2QA2A 2H01A 4J57E 2RUFA 2RUEA 3O76A 4IVFA 4IELA 3EURA 1M9BA 4NV2A 5IOXA 1V58A 5F8BA 4KW6A 1XXUA 3TCOA 5HFGA 2C3NA 2LTKA 3QMXA 1O6JA 2LUSA 2PN8A 1FO5A 2VL9A 4WKWA 5B6MA 2L4QA 3RHBA 1KTEA 1K0NA 4WF4A 1YF1A 4GSTA 2DKIA 4MJAA 2DJ2A 1B9XC 1S3RA 4ZB8A 1GTAA 5IPHA 2C8UA 2R5GA 5DJLA 3N9JA 1OVNA 4G9HA 4MPFA 4K9ZA 4ZBBA 1XZOA 2A2SA 2B1KA 1SD8A 3U6VA 2R4VA 2R37A 3LFLA 1W89A 4WEYA 3HZ4A 3I9V2 2WZ9A 5G30A 2CAQA 5KOXA 3L4NA 5CO3A 3HJMA 2CVBA 2ZNMA 3P2AA 4BL7B 2JL4A 2BMXA 1RK4A 4OMVA 1EGOA 4MZBA 4OD7A 3PINA 3VK9A 4PURA 2TRXA 2R0GA 2VCQA 1JZWA 3LQ7A 1XWKA 1GL8A 1FG4A 4EDYA 4L8EA 1DBYA 3VWXA 5A5KA 1SJ6A 4YQUA 4RQRA 4V1Ap 4XIHA 2KHPA 2C0FA 2H19A 2L6DA 1O8XA 3FHKA 2KUCA 5CAXA 1M2BA 1T4ZA 2HRKA 2DKHA 3F0IA 2DBCA 5IMVA 3ZRDA 3LJRA 4GXZA 4XS1A 4EIPA 1A0RP 1AQWA 1IYIA 4BVXB 2PUKC 4HU9A 1RQMA 1X9WB 4K1FA 6GSYA 4GWRA 4PUAA 1ZZYA 1GSEA 3C71A 2P0GA 4O5UA 1TU8A 1F3BA 3UBLA 6GSVA 2R3XA 4ECBA 1PFOA 2VD1A 4N30A 1N8JA 3WGEA 1PN0A 3HYPA 2NTOA 4AJ6A 1TOFA 2MBTA 4K0GA 3VURA 4AJ7A 4CDOA 3ERGA 1GSFA 2H6XA 3G9BA 2X8HA 5HFIA 3IAS2 4LMWA 3KP9A 2LNSA 4IKHA 1X5CA 1K3OA 1HNBA 2A4HA 4O5RA 2GSTA 4G0IA 1XWBA 3HD5A 2VL2C 2AHEA 3UVHA 4NHWA 3IBHA 1XFLA 3GL3A 2GDRA 4KNDA 1WOUA 3G7YA 1O7UA 1URMA 1YEXA 3FEUA 4DSRA 4HEA2 1M3JA 3PR8A 3FR9A 1K0CA 4ZL8A 2PWJA 1VGLA 4K7OA 4XS4A 5B7CA 2H73A 5E4WA 4X0XA 1XG8A 3TJJA 2E0QA 2YWIA 5J4UA 1ACVA 4KSMA 1FHEA 1SL1B 3WYWA 4MH2A 4L5OA 3CRUA 3QAGA 5C00A 3UEMA 4EO3A 2N5BA 3L78A 1ERWA 3F6FA 2C80A 2PGTA 4L5LA 2YN1A 2G0FA 5IOWA 5J5NA 1PL2A 2V41A 1DE1A 5LCZA 2DIYA 2VCZA 5DAKB 1GLPA 2HYXA 3F3RA 4FH8A 2WCIA 3D6IA 3ME7A 1A8LA 4G2EA 3HA9A 2C0DA 2GQKA 2L5OA 2RIIA 4JEDA 4EVMA 1AW9A 1AXDA 2FGXA 1EEJA 5ECNB 4TXOB 4O32A 5ECKB 3C7MA 5EVOA 1HNAA 2X8GA 5DALB 1H4OA 3IR4A 2MMNA 10GSA 3EU3A 3P7XA 4KH7A 5J41A 2F51A 4HQZA 5EPFA 1SKSB 1ERVA 1MEKA 5DJMA 5G1LA 2VL3A 2WDUA 1QMVA 2XC2A 1TK5B 3FMWA 1VF3A 4KGIA 2MZCA 1GUKA 1PRXA 4PNFA 1XWAA 1T4YA 4ZBAA 3HVNA 1GTUA 5KOWA 5CRHA 2I1UA 2HXKA 1JLWA 1B4PA 1OKTA 3GX8A 1I5GA 1OC9B 1R7HA 4IQAA 1A0FA 1XW6A 2GT5A 2L57A 3HZ8A 9GSSA 4HJ2A 1WE0A 2JADA 3C8EA 5CRDA 3FZ4A 6GSTA 5AIVA 4X43A 3FR3A 1SKRB 4MCUA 1SYRA 3ERWA 1X5DA 2A2PA 4J2FA 4YQVA 1QK8A 2H30A 3L9SA 5GAPD 1Z6NA 1BEDA 2FCHA 1YQ1A 4POLA 2F8FA 5ABRA 5F0GA 1F9MA 1ERTA 4BVYA 2FD3A 4NMUA 3A2WA 1J0FA 2G2QA 3GKNA 2QA1A 5AGYA 3H93A 5FWGA 4PNGA 3ZL5A 2M46A 4TW5A 2KLXA 3F8UA 3TJKA 1TXXA 4OO4A 1SJZA 1EOHA 1SL2B 5DBQA 3VPTA 3M1GA 1KBNA 1U6TA 4TKYA 4V2NA 2YJ7A 1T8EB 4EE0A 5AN1A 1XWCA 3HHVA 2QKEA 3VPQA 2OJLA 3ED3A 1R5PA 3GUSA 1YY7A 3GKKA 2AAWA 3DIEA 2AJQB 4JU5A 4OFMA 1Z6MA 3GL5A 5B6NA 1AQVA 4KX4A 1MD4A 2VCVA 2HT9A 3CYNA 2LJKA 4PUFC 4N11A 1USBA 4TVEA 2L4CA 5A4WA 1Z5YE 3IE3A 4DVCA 2QGVA 3MDKA 4PGTA 3D21A 3GSTA 8GSSA 3M8NA 4TN8A 5GAND 4JE1A 1TTZA 4I2TA 3U5RE 3ZLPA 4GLTA 2IPAA 1HYUA 2FWEA 1TJDA 6GSSA 4ZL9A 3VWVA 2VM2A 3J7Yk 1UC7A 3ZITA 1LBKA 4DSSB 3WT2A 3TRXA 13GSA 4EF0A 3LG6A 6GSUA 3VFIA 2KP2A 4TOPA 2YOIA 5H5SA 2H8LA 4G0KA 4KDXA 1XW9A 3RBTA 4ZXGA 3E9JB 2ZUPA 1M99A 2KOKA 2DSAA 3LWAA 1OE8A 1PQNA 3TJGA 4USSA 4G19A 4ECJA 5D9TA 3LXZA 3ZMKA 2H1AA 2GZZA 1GSQA 1U87A 4K5SA 4TRXA 1PL1A 4V1Ag 4BPYA 2FA4A 4HSCX 3F4SA 1S3AA 2C4JA 2CZ3A 5CRGA 2YZHA 1WPIA 3AY8A 3QFBC 4H86A 4JBBA 3GHAA 1OC8A 1EZKA 4KUNA 1JZOA 5LNKe 1XIYA 1K0MA 1XWGA 3OR5A 3HKRA 1V57A 3DD3A 3H79A 1JZDA 2KP1A 1T7PB 2L59A 4MH3A 3FKFA 2WS2A 2LEGA 3K8NA 2PMTA 5ID2A 1SK1A 4TR1A 2OKAA 4CHSA 4ZL7A 1YKCA 1MDKA 5IMAA 2R6KA 1S3DA 4GQFA 3CXGA 1IYHA 1OKDA 1PD21 3EMPA 1R5AA 2CVKA 2X99A 3GFKA 4F0CA 3IK7A 2J23A 4L0WA 2OACA 5G2ZA 2EIOA 3VI7A 3GRXA 1T3BA 1PKWA 1WP0A 2IN3A 2P5RA 1HQOA 3QDNA 1OYJA 2LJAA 4F0BA 3SWLA 4WXTA 1WJKA 4L0UA 3IC4A 1X9SB 3HXSA 4LMVA 1Z7RA 4Q5QA 4N10A 5IMDA 4NV5A 3ZIVA 5JCGA 2LKUA 2M80A 3TKPA 2HZEB 5ECQB 2FUG2 5HR3A 3GMFA 1ABAA 1W4VA 3IHQA 3EWLA 1F3AA 3DKSA 1XOAA 4PQ1A 5ECSA 1M0UA 3I6AA 3Q6OA 3E0UA 4OO5A 1GWCA 4BL7A 4IP1A 3TJBA 2BTOT 2HRAA 3IC8A 3WGDA 3TKQA 3R3EA 3I69A 2XHFA 2WB9A 3CRTA 2K6VA 2NBSA 4ML6A 1GTIA 2LQQA 3ME8A 4BWSA 14GSA 3PPUA 4GQCA 3SBCA 4WETA 5KN0A 3TRPA 1F2EA 1EGRA 1AAZA 5HR2A 1V2AA 1YEPA 2R0CA 4QQ7A 5J9CA 1ON4A 4YAVA 2X8CA 1K0DA 1TW9A 2F3MA 3EYTA 2I9HA 1MDIA 3FK8A 5AISA 3A5IA 4PQHA 3Q18A 3PGTA 1BJXA 2YV9A 2VIMA 2LRTA 3W8JA 4I8BA 2ZCTA 2PPTA 3DRNA 1O73A 4Z7XA 1NHOA 1GSDA 3APQA 3M9JA 4RI6A 3EE2A 4O5QA 2GQLA 2GT6A 3TOUA 1M2DA 3G7IA 2MBSA 2GVPA 3ZFLA 4POBA 4ZIJA 4PTSA 1LJRA 2LJRA 1F6MC 2N5AA 4KF9A 19GSA 4PXOA 4K5RA 3DXBA 4HUAA 5H5RA 3KH7A 1PKZA 4Z2TA 2GLRA 4AJ8A 2GTUA 1Z9HA 1XW5A 2HLSA 3ZYWA 4YH2A 3VLNA 4RI7A 2FA8A 1A23A 2F9SA 3L9VA 2GSQA 1HNCA 4KSOA 1SD9A 1EEMA 2IMDA 1C72A 4KDYA 1XPVA 5FT3A 1ST9A 4NXIA 4F03A 1J08A 1UVZA 5G31A 5DVBA 3CMIA 4KCEA 3PH9A 4IJIA 2N5FA 2B5XA 1WWJA 1OAZA 4GSNA 2JZTA 1TK8B 1NHYA 5B8BA 1B8XA 3GV1A 5DCHA 3R2QA 1ZYQB 4JRRA 1Q4JA 3CTFA 3KTBA 4Q5FA 4IQ1A 2OE3A 2JZSA 2FY6A 5KN3A 3DMLA 3DVXA 1K0OA 2DLXA 3MAKA 3Q19A 4ML1A 2VLTA 3H4KA 1EP7A 3FRCA 3QPMA 4D73B 2DIZA 2IL3A 1WRYA 3FY7A 5KN2A 3ZREA 4JZQA 5D96A 1PMTA 3FW2A 1CQGA 4F82A 3C1SA 5DQSA 1K0AA 3APSA 4BA7A 5DAKA 1EV4A 5D73A 3IRAA 4X1UA 1CQHA 3GSSA 3HCZA 3QCPA 1BQ7A 1DE2A 1MTCA 2BJXA 1GNWA 4NHZA 1FVKA 5ECPB 1TDIA 4EXJA 3HVVA 4IP6A 4ZILA 2A2RA 4OCFA 5COHA 4HZ2A 4ULXA 2IFQB 2IMFA 3FR6A 1TRWA 5IMCA 2O7KA 4TXOA 1SL0B 4QL9A 1E6BA 3GTUB 2GZYA 4YAPA 2MYGA 2CA8A 2K8VA 3DGQA 1SK0A 5CRWA 5HR0A 4MK3A 4FYBA 5ECHB 3UMAA 2R0PA 3UVTA 3TGZA 4K6XA 4YQMA 1J9BA 5DCGA 5KEJA 4EIQA 1K3LA 5BRTA 2GS3A 2H76A 3D4MA 2LRNA 3MYDA 3M0FA 3L9UA 3A3TA 3TKSE 4Q5NA 4BVYB 5JCWA 2HFDA 2VO4A 3MIXA 3NIVA 3CQFA 1I9DA 2VM1A 4WBJA 1TI1A 1UA5A 3WT1A 1A2JA 4IBPA 2O8VB 3LORA 2NVLA 2GSSA 3FZ5A 2GSRA 2HE3A 2XBIA 5JWOB 12GSA 2JZRA 1OC9A 3E3EA 4K2DA 1AC1A 3VI5A 2P5QA 1RW1A 2H6YA 5ECRB 3QOUA 1A2MA 3ISOA 3TRQA 2J9HA 1ZYNA 2VD0A 5ECIB 3O6TA 4HS1A 1ZOFA 2WGRA 1V98A 1UN2A 3RHCA 5FHIA 5F07A 3KMNA 4XRAA 4WBRD 3ZZXA 4GCIA 2DC5A 3EPTA 1GSSA 3MNGA 4ECCA 3J7Yb 1S3CA 4HU7A 5CP1A 2C1YA 3GYKA 1XVWA 5HR1A 1GLQA 1XCCA 2CZ2A 1JLVA 2L5LA 3KH9A 2XBQA 2LV3A 3FZAA 5KN1A 4KB3A 1U3IA 1VRSD 3IV4A 2B7KA 4FYCA 1VF4A 2OA7A 4MABA 3ZVJD 5BMUA 6GSXA 2H0HA 5B8AA 1YJ6A 1G6WA 1M3IA 3GX0A 4DEJA 4GF0A 2EIRA 2C3QA 2I4AA 4NWYA 1FB0A 5INYA 3GH6A 3LGCA 2LS5A 4N0VA 4IN0A 5F06A 3ZTLA 3BJ5A 4WR5A 1Z7PA 1GUHA 3TB2A 2M72A 1M9AA 3D0ZA 3GH9A 4CY8A 1SKWB 3GKMA 4HZ4A 1QXHA 2YWMA 3KM6A 3MSZA 4Z2UA 2GQMA 3IHGA 4HDEA 2DJKA 4KE3A 2CX4A 1TI3A 2I81A 3DEXA 4XHMA 2VLUA 3IK9A 5CNWA 2CQ9A 4ZB6A 3EMXA 1A24A 1GTBA 2VUPA 3DYRA 1FOHA 3GIXA 4XTSA 2E2MA 1AIUA 1E2YA 2H71A 2DJ1A 2R2JA 5JCUA 2HSYA 1M7TA 1GP1A 3TKRA 1EV9A 3UL3A 1FAAA 1NM3A 3TKSA 3D22A 4O92A 4MLYA 3LXTA 4V2LA 2VCTA 1YF0A 1T1VA 2H1BA 3QFAC 3KD0A 3LYKA 2IMKA 2OE0A 3KJYA 1R4WA 4I97A 4A5PA 3D4TA 1X9MB 2HZFA 2JSYA 3C73A 3RDWA 2X4AA 4ISDA 1FB6A 4EDZA 1ZMAA 4ZBDA 3H1NA 4MDCA 2LQOA 3HJPA 2VL2A 3EVIA 1ERUA 1BAYA 2ES7A 4EUYA 1TK0B 2B3SA 2JU5A 2CAIA 2HNLA 4LL1B 1JZRA 3QD9A 1EOGA 2YWOA 1YKAA 1EWXA 5HFKA 2B5YA 3DVWA 5J9BA 2UZ8A 2FHEA 2H6ZA 5D9VA 2K9FA 4DSQA 5F05A 5IPGA 4KCAA 2IIYA 1QUWA 5C04A 3FYGA 3M3MA 2LNTA 5ECOB 2A4VA 3BOAA 4HQSA 2C0GA 1B48A 2EC4A 1Q98A 2HSHA 5IQYA 4TR0A 1U88A 2E2GA 5GSSA 4GSSA 2V6KA 5AIXA 5GSTA 2C0EA 4FQUA 4MPGA 2FWHA 3QAWA 3LEFA 2GZPA 2H74A 4MP4A 4MA9A 5IM9A 2FLSA 4N0ZA 1LU4A 2NPBA 1U3AA 3G7JA 2P31A 1QGVA 5H5QA 4LL4B 3I43A 1A2LA 2H1GA 1JFUA 4MJBA 3ZVJA 2OADA 3M9KA 3EU4A 4IHUA 3UAPA 3BCKA 2C3TA 3IPZA 4BWQA 2K8SA 2DJJA 1MDJA 1NSWA 2AB6A 1SK2A 4AGSA 1O8WA 2CX3A 3W6GA 1YZXA 2LSTA 1F37A 4LA1A 3C1RA 3GKXA 1ILOA 1B4QA 2TIRA 3NOFA 3KCMA 4KA0A 3WGXA 2V1MA 1TKDB 5IIZA 2HZEA 1K0BA 1PX7A 3RPNA 2VCXA 16GSA 2DMLA 1PGTA 4ID0A 2MMZA 5GZZB 1BG5A 1ZYEA 3LSZA 3GURA 3WD6A 1SENA 5A4UA 2YNXA 4TXVA 4WR4A 3HVSA 2QSIA 2FWFA 3L0HA 1THXA 2B1LA 1BX9A 2OBKA 5EL8A 5D8IA 3TKSC 4K2XA 4ZB9A 2IWTA 4BVXA 3LW9A 5G5FA 1X5EA 5L71A 2O85A 4YKGA
chains in the Genus database with same CATH topology
4ACSA 1WIKA 1PX6A 2H0IA 5ECLB 4XS6A 4CY6A 4O7HA 2IMIA 2YP6A 1PSQA 2XPDA 2HRFA 3A5WA 1B9YC 1KNGA 4XS4B 1XBSA 2E7PA 2ALBA 2VAFA 4CW9A 2OBIA 3GN3A 4GTUA 3F3QA 2FNOA 4MJEA 3KGKA 4MF5A 1SU9A 1TRVA 17GSA 2V32A 3O3TA 3CBUA 2WRTA 3RPPA 3IAM2 3ZIJA 3CTGA 5G5EA 5J3RA 1VF2A 5CREA 2WULA 4NAXA 1TRUA 4ILFA 2CT6A 2YV7A 5A4VA 4GRFA 4HOJA 2V6OA 1GRXA 4HJMA 3F6DA 4JR6A 2DMMA 18GSA 5JWRB 3KEBA 1PA3A 2PERA 2QC7A 1G7OA 1KEBA 4FO5A 1G0TA 2DJ0A 2VCWA 4IS0A 1DSBA 2H75A 2RM6A 2ON7A 4MF6A 4IGJA 4E8HA 3KTLA 2YANA 7GSSA 1QFNA 1SYXA 3A2XA 4PQIA 2Z9SA 3APOA 1TP9A 2RM5A 4MZWA 3P90A 4MNNA 4EL1A 2HSMA 3UBKA 3KZQA 1FOVA 2JACA 3S9FA 2OE1A 2PVQA 4F2IA 4PX1A 3KP8A 4G10A 2H0GA 4K7NA 5JWQB 3GA4A 5DQYA 1N2AA 1TU7A 3MWHA 3IXRA 3HDCA 3DWVA 5IO2A 1THOA 3NZNA 4K7IA 2VOCA 11GSA 5D9XA 1ML6A 5ELGA 3D5JA 4V2MA 2O87A 2LRCA 4OFTA 4KDUA 3TDGA 1GH2A 4D73A 1OC3A 4MMMA 3BCIA 4K8MA 5ELAA 1BYEA 1GUMA 1AQXA 1ZCPA 3UARA 3KIJA 2JSZA 2RLIA 1OE7A 5DALA 4WF5A 5LD0A 2PU9C 1G7EA 4NPBA 2B6MA 4QL7A 2B7JA 3VWWA 4F9ZA 3CSIA 1X0RA 3BBYA 3QR6A 3CSJA 3ZMLA 4FIWA 1Y6EA 1GSUA 2IJYA 2PBJA 3JCML 3TJFA 3TUEA 1FVJA 2EIQA 2IFQA 4POMA 2H72A 2YJHA 1WMJA 4J56E 1FW1A 3GTUA 4EC0A 1HD2A 1A8YA 2H70A 4Q5RA 2PVOC 1O81A 1ZGNA 2L6CA 1SJIA 3VWUA 1VF1A 4XCSA 4OWYA 3LYPA 1MD3A 1M2AA 6GSWA 3IA1A 1XVQA 2K18A 1K3YA 4JR4A 4HI7A 4RUVA 3EC3A 2AUVA 1NW2A 2X49A 20GSA 1V40A 1O85A 3TOTA 3QAVA 5ENUA 4EKZA 2REMA 4I2UA 3ZFBA 2ON5A 2AV4A 5E59A 1AUCA 5G1KA 3UOMA 5EY6A 4K0NA 4FYUA 4E8EA 2X64A 2WJUA 3N5OA 3P8WA 4G0LA 4AF2A 1JHBA 2AYTA 4KAEA 4OFNA 3GNJA 3IDVA 2HRNA 2YWNA 2XPEA 3HY2A 2MMAA 4MF7A 3IOSA 5HQPA 1G6YA 3H8QA 5DDLA 2MMOA 3KXOA 1XOBA 3F9UA 4IJ3A 5IMFA 5IO0A 3RAZA 4TR4A 2DJ3A 4IW9A 1GULA 1T00A 1YDKA 5D9WA 3HVXA 22GSA 2F8AA 4MZCA 4I6XA 4XRDA 2I3YA 3CSHA 4TR3A 4X4JA 5CYYA 3FZ9A 5ECMB 2GGTA 3US3A 2NDOA 3F4TA 2WFCA 2YPMA 4I5QA 2YCDA 3UIWA 3UJ1A 2O89A 2FWGA 3BD2A 4ICYA 5IMZA 3ERFA 3KMOA 1DUGA 2D2ZA 1EP8A 1V9WA 3V1WA 4Z2RA 1ZL9A 1ZYPA 4YKFA 2CV4A 2YZUA 1TRSA 3F4RA 1Y25A 4OCEA 3F63A 2V2GA 3Q74A 4MJCA 3EINA 1Z3EA 4RQXA 2HI7A 2H1DA 2CVDA 2VLVA 4DSSA 1QQ2A 1R26A 5D93A 2TRCP 1GNEA 3A2VA 4ECIA 1GSYA 2IMEA 2H66A 4LLRA 2B5EA 3W8SA 5ID2B 1H75A 4TR1B 4POKA 4P3YB 3HJOA 1PN9A 2QA2A 2H01A 4J57E 2RUFA 2RUEA 3O76A 4IVFA 4IELA 3EURA 1M9BA 4NV2A 5IOXA 1V58A 5F8BA 4KW6A 1XXUA 3TCOA 5HFGA 2C3NA 2LTKA 3QMXA 1O6JA 2LUSA 2PN8A 1FO5A 2VL9A 4WKWA 5B6MA 2L4QA 3RHBA 1KTEA 1K0NA 4WF4A 1YF1A 4GSTA 2DKIA 4MJAA 2DJ2A 1B9XC 4ZB8A 1GTAA 5IPHA 2C8UA 2R5GA 5DJLA 3N9JA 1OVNA 4G9HA 4MPFA 4K9ZA 4ZBBA 1XZOA 2A2SA 2B1KA 1SD8A 3U6VA 2R4VA 2R37A 3LFLA 1W89A 4WEYA 3HZ4A 3I9V2 2WZ9A 5G30A 2CAQA 5KOXA 3L4NA 5CO3A 3HJMA 2CVBA 2ZNMA 3P2AA 4BL7B 2JL4A 2BMXA 1RK4A 4OMVA 1EGOA 4MZBA 4OD7A 3PINA 3VK9A 4PURA 2TRXA 2R0GA 2VCQA 1JZWA 3LQ7A 1XWKA 1GL8A 1FG4A 4EDYA 4L8EA 1DBYA 3VWXA 5A5KA 1SJ6A 4YQUA 4RQRA 4V1Ap 4XIHA 2KHPA 2C0FA 2H19A 2L6DA 1O8XA 3FHKA 2KUCA 5CAXA 1M2BA 1T4ZA 2HRKA 2DKHA 3F0IA 2DBCA 5IMVA 3ZRDA 3LJRA 4GXZA 4XS1A 4EIPA 1A0RP 1AQWA 1IYIA 4BVXB 2PUKC 4HU9A 1RQMA 1X9WB 4K1FA 6GSYA 4GWRA 4PUAA 1ZZYA 1GSEA 3C71A 2P0GA 4O5UA 1TU8A 1F3BA 3UBLA 6GSVA 2R3XA 4ECBA 2VD1A 4N30A 1N8JA 3WGEA 1PN0A 3HYPA 2NTOA 4AJ6A 1TOFA 2MBTA 4K0GA 3VURA 4AJ7A 4CDOA 3ERGA 1GSFA 2H6XA 3G9BA 2X8HA 5HFIA 3IAS2 4LMWA 3KP9A 2LNSA 4IKHA 1X5CA 1K3OA 1HNBA 2A4HA 4O5RA 2GSTA 4G0IA 1XWBA 3HD5A 2VL2C 2AHEA 3UVHA 4NHWA 3IBHA 1XFLA 3GL3A 2GDRA 4KNDA 1WOUA 3G7YA 1O7UA 1URMA 1YEXA 3FEUA 4DSRA 4HEA2 3PR8A 3FR9A 1K0CA 4ZL8A 2PWJA 1VGLA 4K7OA 4XS4A 5B7CA 2H73A 5E4WA 4X0XA 3TJJA 2E0QA 2YWIA 5J4UA 1ACVA 4KSMA 1FHEA 1SL1B 3WYWA 4MH2A 4L5OA 3CRUA 3QAGA 5C00A 3UEMA 4EO3A 2N5BA 3L78A 1ERWA 3F6FA 2C80A 2PGTA 4L5LA 2YN1A 2G0FA 5IOWA 5J5NA 1PL2A 2V41A 1DE1A 5LCZA 2DIYA 2VCZA 5DAKB 1GLPA 2HYXA 3F3RA 4FH8A 2WCIA 3D6IA 3ME7A 1A8LA 4G2EA 3HA9A 2C0DA 2GQKA 2L5OA 2RIIA 4JEDA 4EVMA 1AW9A 1AXDA 2FGXA 1EEJA 5ECNB 4TXOB 4O32A 5ECKB 3C7MA 5EVOA 1HNAA 2X8GA 5DALB 1H4OA 3IR4A 2MMNA 10GSA 3EU3A 3P7XA 4KH7A 5J41A 2F51A 4HQZA 5EPFA 1SKSB 1ERVA 1MEKA 5DJMA 5G1LA 2VL3A 2WDUA 1QMVA 2XC2A 1TK5B 3FMWA 1VF3A 4KGIA 2MZCA 1GUKA 1PRXA 4PNFA 1XWAA 1T4YA 4ZBAA 1GTUA 5KOWA 5CRHA 2I1UA 2HXKA 1JLWA 1B4PA 1OKTA 3GX8A 1I5GA 1OC9B 1R7HA 4IQAA 1A0FA 1XW6A 2GT5A 2L57A 3HZ8A 9GSSA 4HJ2A 1WE0A 2JADA 3C8EA 5CRDA 3FZ4A 6GSTA 5AIVA 4X43A 3FR3A 1SKRB 4MCUA 1SYRA 3ERWA 1X5DA 2A2PA 4J2FA 4YQVA 1QK8A 2H30A 3L9SA 5GAPD 1Z6NA 1BEDA 2FCHA 1YQ1A 4POLA 2F8FA 5ABRA 5F0GA 1F9MA 1ERTA 4BVYA 2FD3A 4NMUA 3A2WA 1J0FA 2G2QA 3GKNA 2QA1A 5AGYA 3H93A 5FWGA 4PNGA 3ZL5A 2M46A 4TW5A 2KLXA 3F8UA 3TJKA 1TXXA 4OO4A 1SJZA 1EOHA 1SL2B 5DBQA 3VPTA 3M1GA 1KBNA 1U6TA 4TKYA 4V2NA 2YJ7A 1T8EB 4EE0A 5AN1A 1XWCA 3HHVA 2QKEA 3VPQA 2OJLA 3ED3A 1R5PA 3GUSA 1YY7A 3GKKA 2AAWA 3DIEA 2AJQB 4JU5A 4OFMA 1Z6MA 3GL5A 5B6NA 1AQVA 4KX4A 1MD4A 2VCVA 2HT9A 3CYNA 2LJKA 4PUFC 4N11A 1USBA 4TVEA 2L4CA 5A4WA 1Z5YE 3IE3A 4DVCA 2QGVA 3MDKA 4PGTA 3D21A 3GSTA 8GSSA 3M8NA 4TN8A 5GAND 4JE1A 1TTZA 4I2TA 3U5RE 3ZLPA 4GLTA 2IPAA 1HYUA 2FWEA 1TJDA 6GSSA 4ZL9A 3VWVA 2VM2A 3J7Yk 1UC7A 3ZITA 1LBKA 4DSSB 3WT2A 3TRXA 13GSA 4EF0A 3LG6A 6GSUA 3VFIA 2KP2A 4TOPA 2YOIA 5H5SA 2H8LA 4G0KA 4KDXA 1XW9A 3RBTA 4ZXGA 3E9JB 2ZUPA 1M99A 2KOKA 2DSAA 3LWAA 1OE8A 1PQNA 3TJGA 4USSA 4G19A 4ECJA 5D9TA 3LXZA 3ZMKA 2H1AA 2GZZA 1GSQA 1U87A 4K5SA 4TRXA 1PL1A 4V1Ag 4BPYA 2FA4A 3F4SA 1S3AA 2C4JA 2CZ3A 5CRGA 2YZHA 1WPIA 3AY8A 3QFBC 4H86A 4JBBA 3GHAA 1OC8A 1EZKA 4KUNA 1JZOA 5LNKe 1XIYA 1K0MA 1XWGA 3OR5A 3HKRA 1V57A 3DD3A 3H79A 1JZDA 2KP1A 1T7PB 2L59A 4MH3A 3FKFA 2WS2A 2LEGA 3K8NA 2PMTA 5ID2A 1SK1A 4TR1A 2OKAA 4CHSA 4ZL7A 1YKCA 1MDKA 5IMAA 2R6KA 1S3DA 4GQFA 3CXGA 1IYHA 1OKDA 1PD21 3EMPA 1R5AA 2CVKA 2X99A 3GFKA 4F0CA 3IK7A 2J23A 4L0WA 2OACA 5G2ZA 2EIOA 3VI7A 3GRXA 1T3BA 1PKWA 1WP0A 2IN3A 2P5RA 1HQOA 3QDNA 1OYJA 2LJAA 4F0BA 3SWLA 4WXTA 1WJKA 4L0UA 3IC4A 1X9SB 3HXSA 4LMVA 1Z7RA 4Q5QA 4N10A 5IMDA 4NV5A 3ZIVA 5JCGA 2LKUA 2M80A 3TKPA 2HZEB 5ECQB 2FUG2 5HR3A 3GMFA 1ABAA 1W4VA 3IHQA 3EWLA 1F3AA 3DKSA 1XOAA 4PQ1A 5ECSA 1M0UA 3I6AA 3Q6OA 3E0UA 4OO5A 1GWCA 4BL7A 4IP1A 3TJBA 2BTOT 2HRAA 3IC8A 3WGDA 3TKQA 3R3EA 3I69A 2XHFA 2WB9A 3CRTA 2K6VA 2NBSA 4ML6A 1GTIA 2LQQA 3ME8A 4BWSA 14GSA 3PPUA 4GQCA 3SBCA 4WETA 5KN0A 3TRPA 1F2EA 1EGRA 1AAZA 5HR2A 1V2AA 1YEPA 2R0CA 4QQ7A 5J9CA 1ON4A 4YAVA 2X8CA 1K0DA 1TW9A 2F3MA 3EYTA 2I9HA 1MDIA 3FK8A 5AISA 3A5IA 4PQHA 3Q18A 3PGTA 1BJXA 2YV9A 2VIMA 2LRTA 3W8JA 4I8BA 2ZCTA 2PPTA 3DRNA 1O73A 4Z7XA 1NHOA 1GSDA 3APQA 3M9JA 4RI6A 3EE2A 4O5QA 2GQLA 2GT6A 3TOUA 1M2DA 3G7IA 2MBSA 2GVPA 3ZFLA 4POBA 4ZIJA 4PTSA 1LJRA 2LJRA 1F6MC 2N5AA 4KF9A 19GSA 4PXOA 4K5RA 3DXBA 4HUAA 5H5RA 3KH7A 1PKZA 4Z2TA 2GLRA 4AJ8A 2GTUA 1Z9HA 1XW5A 2HLSA 3ZYWA 4YH2A 3VLNA 4RI7A 2FA8A 1A23A 2F9SA 3L9VA 2GSQA 1HNCA 4KSOA 1SD9A 1EEMA 2IMDA 1C72A 4KDYA 1XPVA 5FT3A 1ST9A 4NXIA 4F03A 1J08A 1UVZA 5G31A 5DVBA 3CMIA 4KCEA 3PH9A 4IJIA 2N5FA 2B5XA 1WWJA 1OAZA 4GSNA 2JZTA 1TK8B 1NHYA 5B8BA 1B8XA 3GV1A 5DCHA 3R2QA 1ZYQB 4JRRA 1Q4JA 3CTFA 3KTBA 4Q5FA 4IQ1A 2OE3A 2JZSA 2FY6A 5KN3A 3DMLA 3DVXA 1K0OA 2DLXA 3MAKA 3Q19A 4ML1A 2VLTA 3H4KA 1EP7A 3FRCA 3QPMA 4D73B 2DIZA 2IL3A 1WRYA 3FY7A 5KN2A 3ZREA 4JZQA 5D96A 1PMTA 3FW2A 1CQGA 4F82A 3C1SA 5DQSA 1K0AA 3APSA 4BA7A 5DAKA 1EV4A 5D73A 3IRAA 4X1UA 1CQHA 3GSSA 3HCZA 3QCPA 1BQ7A 1DE2A 1MTCA 2BJXA 1GNWA 4NHZA 1FVKA 5ECPB 1TDIA 4EXJA 3HVVA 4IP6A 4ZILA 2A2RA 4OCFA 5COHA 4HZ2A 4ULXA 2IFQB 2IMFA 3FR6A 1TRWA 5IMCA 2O7KA 4TXOA 1SL0B 4QL9A 1E6BA 3GTUB 2GZYA 4YAPA 2MYGA 2CA8A 2K8VA 3DGQA 1SK0A 5CRWA 5HR0A 4MK3A 4FYBA 5ECHB 3UMAA 2R0PA 3UVTA 3TGZA 4K6XA 4YQMA 1J9BA 5DCGA 5KEJA 4EIQA 1K3LA 5BRTA 2GS3A 2H76A 3D4MA 2LRNA 3MYDA 3M0FA 3L9UA 3A3TA 3TKSE 4Q5NA 4BVYB 5JCWA 2HFDA 2VO4A 3MIXA 3NIVA 1I9DA 2VM1A 4WBJA 1TI1A 1UA5A 3WT1A 1A2JA 4IBPA 2O8VB 3LORA 2NVLA 2GSSA 3FZ5A 2GSRA 2HE3A 2XBIA 5JWOB 12GSA 2JZRA 1OC9A 3E3EA 4K2DA 1AC1A 3VI5A 2P5QA 1RW1A 2H6YA 5ECRB 3QOUA 1A2MA 3ISOA 3TRQA 2J9HA 1ZYNA 2VD0A 5ECIB 3O6TA 4HS1A 1ZOFA 2WGRA 1V98A 1UN2A 3RHCA 5FHIA 5F07A 3KMNA 4XRAA 4WBRD 3ZZXA 4GCIA 2DC5A 3EPTA 1GSSA 3MNGA 4ECCA 3J7Yb 1S3CA 4HU7A 5CP1A 2C1YA 3GYKA 1XVWA 5HR1A 1GLQA 1XCCA 2CZ2A 1JLVA 2L5LA 3KH9A 2XBQA 2LV3A 3FZAA 5KN1A 4KB3A 1U3IA 1VRSD 3IV4A 2B7KA 4FYCA 1VF4A 2OA7A 4MABA 3ZVJD 5BMUA 6GSXA 2H0HA 5B8AA 1YJ6A 1G6WA 3GX0A 4DEJA 4GF0A 2EIRA 2C3QA 2I4AA 4NWYA 1FB0A 5INYA 3GH6A 3LGCA 2LS5A 4N0VA 4IN0A 5F06A 3ZTLA 3BJ5A 4WR5A 1Z7PA 1GUHA 3TB2A 2M72A 1M9AA 3D0ZA 3GH9A 4CY8A 1SKWB 3GKMA 4HZ4A 1QXHA 2YWMA 3KM6A 3MSZA 4Z2UA 2GQMA 3IHGA 4HDEA 2DJKA 4KE3A 2CX4A 1TI3A 2I81A 3DEXA 4XHMA 2VLUA 3IK9A 5CNWA 2CQ9A 4ZB6A 3EMXA 1A24A 1GTBA 2VUPA 3DYRA 1FOHA 3GIXA 4XTSA 2E2MA 1AIUA 1E2YA 2H71A 2DJ1A 2R2JA 5JCUA 2HSYA 1M7TA 1GP1A 3TKRA 1EV9A 3UL3A 1FAAA 1NM3A 3TKSA 3D22A 4O92A 4MLYA 3LXTA 4V2LA 2VCTA 1YF0A 1T1VA 2H1BA 3QFAC 3KD0A 3LYKA 2IMKA 2OE0A 3KJYA 1R4WA 4I97A 4A5PA 3D4TA 1X9MB 2HZFA 2JSYA 3C73A 3RDWA 2X4AA 4ISDA 1FB6A 4EDZA 1ZMAA 4ZBDA 3H1NA 4MDCA 2LQOA 3HJPA 2VL2A 3EVIA 1ERUA 1BAYA 2ES7A 4EUYA 1TK0B 2B3SA 2JU5A 2CAIA 2HNLA 4LL1B 1JZRA 3QD9A 1EOGA 2YWOA 1YKAA 1EWXA 5HFKA 2B5YA 3DVWA 5J9BA 2UZ8A 2FHEA 2H6ZA 5D9VA 2K9FA 4DSQA 5F05A 5IPGA 4KCAA 2IIYA 1QUWA 5C04A 3FYGA 3M3MA 2LNTA 5ECOB 2A4VA 3BOAA 4HQSA 2C0GA 1B48A 2EC4A 1Q98A 2HSHA 5IQYA 4TR0A 1U88A 2E2GA 5GSSA 4GSSA 2V6KA 5AIXA 5GSTA 2C0EA 4FQUA 4MPGA 2FWHA 3QAWA 3LEFA 2GZPA 2H74A 4MP4A 4MA9A 5IM9A 2FLSA 4N0ZA 1LU4A 2NPBA 1U3AA 3G7JA 2P31A 1QGVA 5H5QA 4LL4B 3I43A 1A2LA 2H1GA 1JFUA 4MJBA 3ZVJA 2OADA 3M9KA 3EU4A 4IHUA 3UAPA 3BCKA 2C3TA 3IPZA 4BWQA 2K8SA 2DJJA 1MDJA 1NSWA 2AB6A 1SK2A 4AGSA 1O8WA 2CX3A 3W6GA 1YZXA 2LSTA 1F37A 4LA1A 3C1RA 3GKXA 1ILOA 1B4QA 2TIRA 3NOFA 3KCMA 4KA0A 3WGXA 2V1MA 1TKDB 5IIZA 2HZEA 1K0BA 1PX7A 3RPNA 2VCXA 16GSA 2DMLA 1PGTA 4ID0A 2MMZA 5GZZB 1BG5A 1ZYEA 3LSZA 3GURA 3WD6A 1SENA 5A4UA 2YNXA 4TXVA 4WR4A 3HVSA 2QSIA 2FWFA 3L0HA 1THXA 2B1LA 1BX9A 2OBKA 5EL8A 5D8IA 3TKSC 4K2XA 4ZB9A 2IWTA 4BVXA 3LW9A 5G5FA 1X5EA 5L71A 2O85A 4YKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ACS A;  1WIK A;  1PX6 A;  2H0I A;  5ECL B;  4XS6 A;  4O7H A;  2IMI A;  2YP6 A;  1PSQ A;  2XPD A;  2HRF A;  3A5W A;  1B9Y C;  1KNG A;  4XS4 B;  1XBS A;  2E7P A;  2ALB A;  2VAF A;  4CW9 A;  2OBI A;  3GN3 A;  4GTU A;  3F3Q A;  2FNO A;  4MJE A;  3KGK A;  4MF5 A;  1SU9 A;  1TRV A;  17GS A;  2V32 A;  3O3T A;  3CBU A;  2WRT A;  3RPP A;  3IAM 2;  3ZIJ A;  3CTG A;  5G5E A;  5J3R A;  1VF2 A;  5CRE A;  2WUL A;  4NAX A;  1TRU A;  4ILF A;  2CT6 A;  2YV7 A;  5A4V A;  4GRF A;  4HOJ A;  2V6O A;  1GRX A;  4HJM A;  3F6D A;  4JR6 A;  2DMM A;  18GS A;  5JWR B;  3KEB A;  1PA3 A;  2PER A;  2QC7 A;  1G7O A;  1KEB A;  4FO5 A;  1G0T A;  2DJ0 A;  2VCW A;  4IS0 A;  1DSB A;  2H75 A;  2RM6 A;  2ON7 A;  4MF6 A;  4IGJ A;  4E8H A;  3KTL A;  2YAN A;  7GSS A;  1QFN A;  1SYX A;  3A2X A;  4PQI A;  2Z9S A;  3APO A;  1TP9 A;  2RM5 A;  4MZW A;  3P90 A;  4EL1 A;  3UBK A;  3KZQ A;  1FOV A;  2JAC A;  3S9F A;  2OE1 A;  2PVQ A;  4F2I A;  4PX1 A;  3KP8 A;  4G10 A;  2H0G A;  4K7N A;  5JWQ B;  3GA4 A;  5DQY A;  1N2A A;  1TU7 A;  3MWH A;  3IXR A;  3HDC A;  3DWV A;  5IO2 A;  1THO A;  3NZN A;  4K7I A;  2VOC A;  11GS A;  5D9X A;  1ML6 A;  5ELG A;  3D5J A;  4V2M A;  2O87 A;  2LRC A;  4OFT A;  4KDU A;  3TDG A;  1GH2 A;  4D73 A;  1OC3 A;  4MMM A;  3BCI A;  4K8M A;  5ELA A;  1BYE A;  1GUM A;  1AQX A;  1ZCP A;  3UAR A;  3KIJ A;  2JSZ A;  2RLI A;  1OE7 A;  5DAL A;  4WF5 A;  5LD0 A;  2PU9 C;  1G7E A;  4NPB A;  2B6M A;  4QL7 A;  2B7J A;  3VWW A;  4F9Z A;  3CSI A;  1X0R A;  3BBY A;  3QR6 A;  3CSJ A;  3ZML A;  4FIW A;  1Y6E A;  1GSU A;  2IJY A;  2PBJ A;  3JCM L;  3TJF A;  3TUE A;  1FVJ A;  2EIQ A;  2IFQ A;  4POM A;  2H72 A;  2YJH A;  1WMJ A;  4J56 E;  1FW1 A;  3GTU A;  4EC0 A;  1HD2 A;  1A8Y A;  2H70 A;  4Q5R A;  2PVO C;  1O81 A;  1ZGN A;  2L6C A;  1SJI A;  3VWU A;  1VF1 A;  4XCS A;  4OWY A;  3LYP A;  1MD3 A;  1M2A A;  6GSW A;  3IA1 A;  1XVQ A;  2K18 A;  1K3Y A;  4JR4 A;  4HI7 A;  4RUV A;  3EC3 A;  2AUV A;  1NW2 A;  20GS A;  1V40 A;  1O85 A;  3TOT A;  3QAV A;  5ENU A;  4EKZ A;  2REM A;  4I2U A;  3ZFB A;  2ON5 A;  2AV4 A;  5E59 A;  1AUC A;  5G1K A;  3UOM A;  5EY6 A;  4K0N A;  4FYU A;  4E8E A;  2X64 A;  2WJU A;  3N5O A;  3P8W A;  4AF2 A;  1JHB A;  2AYT A;  4KAE A;  4OFN A;  3GNJ A;  3IDV A;  2HRN A;  2YWN A;  2XPE A;  3HY2 A;  2MMA A;  4MF7 A;  3IOS A;  5HQP A;  1G6Y A;  3H8Q A;  5DDL A;  2MMO A;  3KXO A;  1XOB A;  3F9U A;  4IJ3 A;  5IMF A;  5IO0 A;  3RAZ A;  4TR4 A;  2DJ3 A;  4IW9 A;  1GUL A;  1T00 A;  1YDK A;  5D9W A;  3HVX A;  22GS A;  2F8A A;  4MZC A;  4I6X A;  4XRD A;  2I3Y A;  3CSH A;  4TR3 A;  5CYY A;  3FZ9 A;  5ECM B;  2GGT A;  3US3 A;  2NDO A;  3F4T A;  2WFC A;  2YPM A;  4I5Q A;  2YCD A;  3UIW A;  3UJ1 A;  2O89 A;  2FWG A;  3BD2 A;  5IMZ A;  3ERF A;  3KMO A;  1DUG A;  2D2Z A;  1EP8 A;  1V9W A;  3V1W A;  1ZL9 A;  2CV4 A;  2YZU A;  1TRS A;  3F4R A;  1Y25 A;  4OCE A;  3F63 A;  2V2G A;  3Q74 A;  4MJC A;  3EIN A;  1Z3E A;  4RQX A;  2HI7 A;  2H1D A;  2CVD A;  2VLV A;  4DSS A;  1QQ2 A;  1R26 A;  5D93 A;  2TRC P;  1GNE A;  3A2V A;  4ECI A;  1GSY A;  2IME A;  2H66 A;  4LLR A;  2B5E A;  3W8S A;  5ID2 B;  1H75 A;  4TR1 B;  4POK A;  4P3Y B;  3HJO A;  1PN9 A;  2H01 A;  4J57 E;  2RUF A;  2RUE A;  3O76 A;  4IVF A;  4IEL A;  3EUR A;  1M9B A;  4NV2 A;  5IOX A;  1V58 A;  5F8B A;  4KW6 A;  1XXU A;  3TCO A;  5HFG A;  2C3N A;  2LTK A;  3QMX A;  1O6J A;  2LUS A;  2PN8 A;  1FO5 A;  2VL9 A;  4WKW A;  5B6M A;  2L4Q A;  3RHB A;  1KTE A;  1K0N A;  4WF4 A;  1YF1 A;  4GST A;  4MJA A;  2DJ2 A;  1B9X C;  4ZB8 A;  1GTA A;  5IPH A;  2C8U A;  2R5G A;  5DJL A;  3N9J A;  1OVN A;  4G9H A;  4MPF A;  4K9Z A;  4ZBB A;  1XZO A;  2A2S A;  2B1K A;  1SD8 A;  3U6V A;  2R4V A;  2R37 A;  3LFL A;  1W89 A;  4WEY A;  3HZ4 A;  3I9V 2;  2WZ9 A;  5G30 A;  2CAQ A;  3L4N A;  5CO3 A;  3HJM A;  2CVB A;  2ZNM A;  3P2A A;  2JL4 A;  2BMX A;  1RK4 A;  4OMV A;  1EGO A;  4MZB A;  4OD7 A;  3PIN A;  3VK9 A;  4PUR A;  2TRX A;  2VCQ A;  1JZW A;  3LQ7 A;  1XWK A;  1GL8 A;  1FG4 A;  4EDY A;  4L8E A;  1DBY A;  3VWX A;  5A5K A;  1SJ6 A;  4YQU A;  4RQR A;  4V1A p;  4XIH A;  2KHP A;  2C0F A;  2H19 A;  2L6D A;  1O8X A;  3FHK A;  2KUC A;  5CAX A;  1M2B A;  1T4Z A;  3F0I A;  2DBC A;  5IMV A;  3ZRD A;  3LJR A;  4GXZ A;  4XS1 A;  1A0R P;  1AQW A;  1IYI A;  2PUK C;  4HU9 A;  1RQM A;  1X9W B;  4K1F A;  6GSY A;  4GWR A;  4PUA A;  1ZZY A;  1GSE A;  3C71 A;  2P0G A;  1TU8 A;  1F3B A;  3UBL A;  6GSV A;  2R3X A;  4ECB A;  2VD1 A;  4N30 A;  1N8J A;  3WGE A;  3HYP A;  2NTO A;  4AJ6 A;  1TOF A;  2MBT A;  4K0G A;  3VUR A;  4AJ7 A;  4CDO A;  3ERG A;  1GSF A;  2H6X A;  3G9B A;  2X8H A;  5HFI A;  3IAS 2;  4LMW A;  3KP9 A;  2LNS A;  4IKH A;  1X5C A;  1K3O A;  1HNB A;  4O5R A;  2GST A;  1XWB A;  3HD5 A;  2VL2 C;  2AHE A;  3UVH A;  4NHW A;  3IBH A;  1XFL A;  3GL3 A;  2GDR A;  4KND A;  1WOU A;  3G7Y A;  1O7U A;  1URM A;  1YEX A;  3FEU A;  4DSR A;  4HEA 2;  3PR8 A;  3FR9 A;  1K0C A;  4ZL8 A;  2PWJ A;  1VGL A;  4K7O A;  4XS4 A;  5B7C A;  2H73 A;  5E4W A;  4X0X A;  3TJJ A;  2E0Q A;  2YWI A;  5J4U A;  1ACV A;  4KSM A;  1FHE A;  1SL1 B;  3WYW A;  4MH2 A;  4L5O A;  3CRU A;  3QAG A;  5C00 A;  3UEM A;  4EO3 A;  2N5B A;  3L78 A;  1ERW A;  3F6F A;  2C80 A;  2PGT A;  4L5L A;  2YN1 A;  2G0F A;  5IOW A;  5J5N A;  1PL2 A;  2V41 A;  1DE1 A;  5LCZ A;  2DIY A;  2VCZ A;  5DAK B;  1GLP A;  2HYX A;  3F3R A;  4FH8 A;  2WCI A;  3D6I A;  3ME7 A;  1A8L A;  4G2E A;  3HA9 A;  2C0D A;  2GQK A;  2L5O A;  2RII A;  4JED A;  4EVM A;  1AW9 A;  1AXD A;  2FGX A;  1EEJ A;  5ECN B;  4TXO B;  4O32 A;  5ECK B;  3C7M A;  5EVO A;  1HNA A;  2X8G A;  5DAL B;  1H4O A;  3IR4 A;  2MMN A;  10GS A;  3EU3 A;  3P7X A;  4KH7 A;  5J41 A;  2F51 A;  4HQZ A;  5EPF A;  1SKS B;  5DJM A;  1ERV A;  1MEK A;  5G1L A;  2VL3 A;  2WDU A;  1QMV A;  2XC2 A;  1TK5 B;  1VF3 A;  4KGI A;  2MZC A;  1GUK A;  1PRX A;  4PNF A;  1XWA A;  1T4Y A;  4ZBA A;  1GTU A;  5CRH A;  2I1U A;  2HXK A;  1JLW A;  1B4P A;  1OKT A;  3GX8 A;  1I5G A;  1OC9 B;  1R7H A;  4IQA A;  1A0F A;  1XW6 A;  2GT5 A;  2L57 A;  3HZ8 A;  9GSS A;  4HJ2 A;  1WE0 A;  2JAD A;  3C8E A;  5CRD A;  3FZ4 A;  6GST A;  5AIV A;  4X43 A;  3FR3 A;  1SKR B;  4MCU A;  1SYR A;  3ERW A;  1X5D A;  4J2F A;  4YQV A;  1QK8 A;  2H30 A;  3L9S A;  5GAP D;  1Z6N A;  1BED A;  2FCH A;  1YQ1 A;  4POL A;  2F8F A;  5ABR A;  5F0G A;  1F9M A;  1ERT A;  4BVY A;  2FD3 A;  4NMU A;  3A2W A;  1J0F A;  2G2Q A;  3GKN A;  5AGY A;  4PNG A;  3H93 A;  5FWG A;  3ZL5 A;  2M46 A;  4TW5 A;  2KLX A;  3F8U A;  3TJK A;  1TXX A;  4OO4 A;  1SJZ A;  1EOH A;  1SL2 B;  5DBQ A;  3VPT A;  3M1G A;  1KBN A;  1U6T A;  4TKY A;  4V2N A;  2YJ7 A;  1T8E B;  4EE0 A;  5AN1 A;  1XWC A;  3HHV A;  2QKE A;  3VPQ A;  2OJL A;  3ED3 A;  1R5P A;  3GUS A;  1YY7 A;  3GKK A;  2AAW A;  3DIE A;  2AJQ B;  4JU5 A;  4OFM A;  1Z6M A;  3GL5 A;  5B6N A;  1AQV A;  4KX4 A;  1MD4 A;  2VCV A;  2HT9 A;  3CYN A;  2LJK A;  4PUF C;  4N11 A;  1USB A;  4TVE A;  2L4C A;  5A4W A;  1Z5Y E;  3IE3 A;  4DVC A;  2QGV A;  3MDK A;  4PGT A;  3D21 A;  3GST A;  8GSS A;  3M8N A;  4TN8 A;  5GAN D;  4JE1 A;  1TTZ A;  4I2T A;  3U5R E;  3ZLP A;  4GLT A;  2IPA A;  1HYU A;  2FWE A;  1TJD A;  6GSS A;  4ZL9 A;  3VWV A;  2VM2 A;  3J7Y k;  1UC7 A;  3ZIT A;  1LBK A;  4DSS B;  3WT2 A;  3TRX A;  13GS A;  4EF0 A;  3LG6 A;  6GSU A;  3VFI A;  2KP2 A;  4TOP A;  2YOI A;  5H5S A;  2H8L A;  4KDX A;  1XW9 A;  3RBT A;  4ZXG A;  3E9J B;  2ZUP A;  1M99 A;  2KOK A;  2DSA A;  3LWA A;  1OE8 A;  1PQN A;  3TJG A;  4G19 A;  4ECJ A;  5D9T A;  3LXZ A;  3ZMK A;  2H1A A;  2GZZ A;  1GSQ A;  1U87 A;  4TRX A;  1PL1 A;  4V1A g;  4BPY A;  2FA4 A;  3F4S A;  1S3A A;  2C4J A;  2CZ3 A;  5CRG A;  2YZH A;  1WPI A;  3AY8 A;  3QFB C;  4H86 A;  4JBB A;  3GHA A;  1OC8 A;  1EZK A;  4KUN A;  1JZO A;  5LNK e;  1XIY A;  1K0M A;  1XWG A;  3OR5 A;  3HKR A;  1V57 A;  3DD3 A;  3H79 A;  1JZD A;  2KP1 A;  1T7P B;  2L59 A;  4MH3 A;  3FKF A;  2WS2 A;  2LEG A;  3K8N A;  2PMT A;  5ID2 A;  1SK1 A;  4TR1 A;  2OKA A;  4CHS A;  4ZL7 A;  1YKC A;  1MDK A;  5IMA A;  2R6K A;  1S3D A;  4GQF A;  3CXG A;  1IYH A;  1OKD A;  1PD2 1;  3EMP A;  1R5A A;  2CVK A;  2X99 A;  3GFK A;  4F0C A;  3IK7 A;  2J23 A;  4L0W A;  2OAC A;  5G2Z A;  2EIO A;  3VI7 A;  3GRX A;  1T3B A;  1PKW A;  1WP0 A;  2IN3 A;  2P5R A;  1HQO A;  3QDN A;  1OYJ A;  2LJA A;  4F0B A;  3SWL A;  4WXT A;  1WJK A;  4L0U A;  3IC4 A;  1X9S B;  3HXS A;  4LMV A;  1Z7R A;  4Q5Q A;  4N10 A;  5IMD A;  4NV5 A;  3ZIV A;  5JCG A;  2LKU A;  2M80 A;  3TKP A;  2HZE B;  5ECQ B;  2FUG 2;  5HR3 A;  3GMF A;  1ABA A;  1W4V A;  3IHQ A;  3EWL A;  1F3A A;  3DKS A;  1XOA A;  4PQ1 A;  5ECS A;  1M0U A;  3I6A A;  3Q6O A;  3E0U A;  4OO5 A;  1GWC A;  4BL7 A;  4IP1 A;  3TJB A;  2BTO T;  3WGD A;  3TKQ A;  3I69 A;  2XHF A;  2WB9 A;  3CRT A;  2K6V A;  2NBS A;  4ML6 A;  1GTI A;  2LQQ A;  3ME8 A;  4BWS A;  14GS A;  4GQC A;  3SBC A;  4WET A;  5KN0 A;  3TRP A;  1F2E A;  1EGR A;  1AAZ A;  5HR2 A;  1V2A A;  1YEP A;  4QQ7 A;  5J9C A;  1ON4 A;  4YAV A;  2X8C A;  1K0D A;  1TW9 A;  2F3M A;  3EYT A;  2I9H A;  1MDI A;  3FK8 A;  5AIS A;  4PQH A;  3Q18 A;  3PGT A;  1BJX A;  2YV9 A;  2VIM A;  2LRT A;  3W8J A;  4I8B A;  2ZCT A;  2PPT A;  3DRN A;  1O73 A;  4Z7X A;  1NHO A;  1GSD A;  3APQ A;  3M9J A;  4RI6 A;  3EE2 A;  2GQL A;  2GT6 A;  3TOU A;  1M2D A;  3G7I A;  2MBS A;  2GVP A;  3ZFL A;  4POB A;  4ZIJ A;  1LJR A;  2LJR A;  1F6M C;  2N5A A;  19GS A;  4PXO A;  3DXB A;  4HUA A;  5H5R A;  3KH7 A;  1PKZ A;  2GLR A;  4AJ8 A;  2GTU A;  1Z9H A;  1XW5 A;  2HLS A;  3ZYW A;  4YH2 A;  3VLN A;  4RI7 A;  2FA8 A;  1A23 A;  2F9S A;  3L9V A;  2GSQ A;  1HNC A;  4KSO A;  1SD9 A;  1EEM A;  2IMD A;  1C72 A;  4KDY A;  1XPV A;  5FT3 A;  1ST9 A;  4NXI A;  4F03 A;  1J08 A;  1UVZ A;  5G31 A;  5DVB A;  3CMI A;  4KCE A;  3PH9 A;  4IJI A;  2N5F A;  2B5X A;  1WWJ A;  1OAZ A;  4GSN A;  2JZT A;  1TK8 B;  1NHY A;  5B8B A;  1B8X A;  3GV1 A;  5DCH A;  3R2Q A;  1ZYQ B;  4JRR A;  1Q4J A;  3CTF A;  3KTB A;  4Q5F A;  4IQ1 A;  2OE3 A;  2JZS A;  2FY6 A;  5KN3 A;  3DML A;  3DVX A;  1K0O A;  2DLX A;  3MAK A;  3Q19 A;  4ML1 A;  2VLT A;  3H4K A;  1EP7 A;  3FRC A;  3QPM A;  4D73 B;  2DIZ A;  2IL3 A;  1WRY A;  3FY7 A;  5KN2 A;  3ZRE A;  4JZQ A;  5D96 A;  1PMT A;  3FW2 A;  1CQG A;  4F82 A;  3C1S A;  5DQS A;  1K0A A;  3APS A;  4BA7 A;  5DAK A;  1EV4 A;  5D73 A;  3IRA A;  4X1U A;  1CQH A;  3GSS A;  3HCZ A;  3QCP A;  1BQ7 A;  1DE2 A;  1MTC A;  2BJX A;  1GNW A;  4NHZ A;  1FVK A;  5ECP B;  1TDI A;  4EXJ A;  3HVV A;  4IP6 A;  4ZIL A;  2A2R A;  4OCF A;  5COH A;  4HZ2 A;  4ULX A;  2IFQ B;  2IMF A;  3FR6 A;  1TRW A;  5IMC A;  2O7K A;  4TXO A;  1SL0 B;  4QL9 A;  1E6B A;  3GTU B;  2GZY A;  4YAP A;  2MYG A;  2CA8 A;  2K8V A;  3DGQ A;  1SK0 A;  5CRW A;  5HR0 A;  4MK3 A;  4FYB A;  5ECH B;  3UMA A;  3UVT A;  3TGZ A;  4K6X A;  4YQM A;  1J9B A;  5DCG A;  5KEJ A;  1K3L A;  2GS3 A;  2H76 A;  3D4M A;  2LRN A;  3M0F A;  3L9U A;  3A3T A;  3TKS E;  4Q5N A;  5JCW A;  2HFD A;  2VO4 A;  3NIV A;  1I9D A;  2VM1 A;  4WBJ A;  1TI1 A;  1UA5 A;  3WT1 A;  1A2J A;  4IBP A;  2O8V B;  3LOR A;  2NVL A;  2GSS A;  3FZ5 A;  2GSR A;  2HE3 A;  2XBI A;  5JWO B;  12GS A;  2JZR A;  1OC9 A;  3E3E A;  4K2D A;  1AC1 A;  3VI5 A;  2P5Q A;  1RW1 A;  2H6Y A;  5ECR B;  3QOU A;  1A2M A;  3ISO A;  3TRQ A;  2J9H A;  2VD0 A;  5ECI B;  3O6T A;  4HS1 A;  1ZOF A;  2WGR A;  1V98 A;  1UN2 A;  3RHC A;  5FHI A;  5F07 A;  3KMN A;  4XRA A;  4WBR D;  3ZZX A;  4GCI A;  2DC5 A;  1GSS A;  3MNG A;  4ECC A;  3J7Y b;  1S3C A;  4HU7 A;  5CP1 A;  2C1Y A;  3GYK A;  1XVW A;  5HR1 A;  1GLQ A;  1XCC A;  2CZ2 A;  1JLV A;  2L5L A;  3KH9 A;  2XBQ A;  2LV3 A;  3FZA A;  5KN1 A;  4KB3 A;  1U3I A;  1VRS D;  3IV4 A;  2B7K A;  4FYC A;  1VF4 A;  2OA7 A;  4MAB A;  3ZVJ D;  6GSX A;  2H0H A;  5B8A A;  1YJ6 A;  1G6W A;  3GX0 A;  4DEJ A;  4GF0 A;  2EIR A;  2C3Q A;  2I4A A;  4NWY A;  1FB0 A;  5INY A;  3GH6 A;  3LGC A;  2LS5 A;  4N0V A;  4IN0 A;  5F06 A;  3ZTL A;  3BJ5 A;  4WR5 A;  1Z7P A;  1GUH A;  3TB2 A;  2M72 A;  1M9A A;  3D0Z A;  3GH9 A;  1SKW B;  3GKM A;  4HZ4 A;  1QXH A;  2YWM A;  3KM6 A;  3MSZ A;  2GQM A;  4HDE A;  2DJK A;  4KE3 A;  2CX4 A;  1TI3 A;  2I81 A;  3DEX A;  4XHM A;  2VLU A;  3IK9 A;  5CNW A;  2CQ9 A;  4ZB6 A;  3EMX A;  1A24 A;  1GTB A;  2VUP A;  3DYR A;  3GIX A;  4XTS A;  2E2M A;  1AIU A;  1E2Y A;  2H71 A;  2DJ1 A;  2R2J A;  5JCU A;  2HSY A;  1M7T A;  1GP1 A;  3TKR A;  1EV9 A;  3UL3 A;  1FAA A;  1NM3 A;  3TKS A;  3D22 A;  4O92 A;  4MLY A;  3LXT A;  4V2L A;  2VCT A;  1YF0 A;  1T1V A;  2H1B A;  3QFA C;  3KD0 A;  3LYK A;  2IMK A;  2OE0 A;  3KJY A;  1R4W A;  4I97 A;  3D4T A;  1X9M B;  2HZF A;  2JSY A;  3C73 A;  3RDW A;  4ISD A;  1FB6 A;  4EDZ A;  1ZMA A;  4ZBD A;  3H1N A;  4MDC A;  2LQO A;  3HJP A;  2VL2 A;  3EVI A;  1ERU A;  1BAY A;  2ES7 A;  4EUY A;  1TK0 B;  2B3S A;  2JU5 A;  2CAI A;  2HNL A;  4LL1 B;  1JZR A;  3QD9 A;  1EOG A;  2YWO A;  1YKA A;  1EWX A;  5HFK A;  2B5Y A;  3DVW A;  5J9B A;  2FHE A;  2H6Z A;  5D9V A;  2K9F A;  4DSQ A;  5F05 A;  5IPG A;  4KCA A;  2IIY A;  1QUW A;  5C04 A;  3FYG A;  3M3M A;  2LNT A;  5ECO B;  2A4V A;  3BOA A;  4HQS A;  2C0G A;  1B48 A;  2EC4 A;  1Q98 A;  2HSH A;  5IQY A;  4TR0 A;  1U88 A;  2E2G A;  5GSS A;  4GSS A;  2V6K A;  5AIX A;  5GST A;  2C0E A;  4MPG A;  2FWH A;  3QAW A;  3LEF A;  2GZP A;  2H74 A;  4MP4 A;  4MA9 A;  5IM9 A;  2FLS A;  4N0Z A;  1LU4 A;  2NPB A;  1U3A A;  3G7J A;  2P31 A;  1QGV A;  5H5Q A;  4LL4 B;  3I43 A;  1A2L A;  2H1G A;  1JFU A;  4MJB A;  3ZVJ A;  2OAD A;  3M9K A;  3EU4 A;  4IHU A;  3UAP A;  3BCK A;  2C3T A;  3IPZ A;  4BWQ A;  2K8S A;  2DJJ A;  1MDJ A;  1NSW A;  2AB6 A;  1SK2 A;  4AGS A;  1O8W A;  2CX3 A;  3W6G A;  1YZX A;  2LST A;  1F37 A;  4LA1 A;  3C1R A;  3GKX A;  1ILO A;  1B4Q A;  2TIR A;  3NOF A;  3KCM A;  4KA0 A;  3WGX A;  2V1M A;  1TKD B;  5IIZ A;  2HZE A;  1K0B A;  1PX7 A;  3RPN A;  2VCX A;  16GS A;  2DML A;  1PGT A;  4ID0 A;  2MMZ A;  5GZZ B;  1BG5 A;  1ZYE A;  3LSZ A;  3GUR A;  3WD6 A;  1SEN A;  5A4U A;  2YNX A;  4TXV A;  4WR4 A;  3HVS A;  2QSI A;  2FWF A;  3L0H A;  1THX A;  2B1L A;  1BX9 A;  2OBK A;  5EL8 A;  5D8I A;  3TKS C;  4ZB9 A;  2IWT A;  4BVX A;  5G5F A;  1X5E A;  5L71 A;  2O85 A; 
#chains in the Genus database with same CATH topology
 4ACS A;  1WIK A;  1PX6 A;  2H0I A;  5ECL B;  4XS6 A;  4CY6 A;  4O7H A;  2IMI A;  2YP6 A;  1PSQ A;  2XPD A;  2HRF A;  3A5W A;  1B9Y C;  1KNG A;  4XS4 B;  1XBS A;  2E7P A;  2ALB A;  2VAF A;  4CW9 A;  2OBI A;  3GN3 A;  4GTU A;  3F3Q A;  2FNO A;  4MJE A;  3KGK A;  4MF5 A;  1SU9 A;  1TRV A;  17GS A;  2V32 A;  3O3T A;  3CBU A;  2WRT A;  3RPP A;  3IAM 2;  3ZIJ A;  3CTG A;  5G5E A;  5J3R A;  1VF2 A;  5CRE A;  2WUL A;  4NAX A;  1TRU A;  4ILF A;  2CT6 A;  2YV7 A;  5A4V A;  4GRF A;  4HOJ A;  2V6O A;  1GRX A;  4HJM A;  3F6D A;  4JR6 A;  2DMM A;  18GS A;  5JWR B;  3KEB A;  1PA3 A;  2PER A;  2QC7 A;  1G7O A;  1KEB A;  4FO5 A;  1G0T A;  2DJ0 A;  4BIK A;  2VCW A;  4IS0 A;  1DSB A;  2H75 A;  2RM6 A;  2ON7 A;  4MF6 A;  4IGJ A;  4E8H A;  3KTL A;  2YAN A;  7GSS A;  1QFN A;  1SYX A;  3A2X A;  4PQI A;  2Z9S A;  3APO A;  1TP9 A;  2RM5 A;  4MZW A;  3P90 A;  4MNN A;  4EL1 A;  2HSM A;  3UBK A;  3KZQ A;  1FOV A;  2JAC A;  3S9F A;  2OE1 A;  2PVQ A;  4F2I A;  4PX1 A;  3KP8 A;  4G10 A;  2H0G A;  4K7N A;  5JWQ B;  3GA4 A;  5DQY A;  1N2A A;  1TU7 A;  3MWH A;  3IXR A;  3HDC A;  3DWV A;  5IO2 A;  1THO A;  3NZN A;  4K7I A;  2VOC A;  11GS A;  5D9X A;  1ML6 A;  5ELG A;  3D5J A;  4V2M A;  2O87 A;  2LRC A;  4OFT A;  4KDU A;  3TDG A;  1GH2 A;  4D73 A;  1OC3 A;  4MMM A;  3BCI A;  4K8M A;  5ELA A;  1BYE A;  1GUM A;  1AQX A;  1ZCP A;  3UAR A;  3KIJ A;  2JSZ A;  2RLI A;  1OE7 A;  5DAL A;  4WF5 A;  5LD0 A;  2PU9 C;  1G7E A;  4NPB A;  2B6M A;  4QL7 A;  2B7J A;  3VWW A;  4F9Z A;  3CSI A;  1X0R A;  3BBY A;  3QR6 A;  3CSJ A;  3ZML A;  4FIW A;  1Y6E A;  1GSU A;  2IJY A;  2PBJ A;  3JCM L;  3TJF A;  3TUE A;  1FVJ A;  2EIQ A;  2IFQ A;  4POM A;  2H72 A;  2YJH A;  1WMJ A;  4J56 E;  1FW1 A;  3GTU A;  4EC0 A;  1HD2 A;  1A8Y A;  2H70 A;  4Q5R A;  2PVO C;  1O81 A;  1ZGN A;  2L6C A;  1SJI A;  3VWU A;  1VF1 A;  4XCS A;  4OWY A;  3LYP A;  1MD3 A;  1M2A A;  6GSW A;  3IA1 A;  1XVQ A;  2K18 A;  1K3Y A;  4JR4 A;  4HI7 A;  4RUV A;  3EC3 A;  2AUV A;  1NW2 A;  2X49 A;  20GS A;  1V40 A;  1O85 A;  3TOT A;  3QAV A;  5ENU A;  4EKZ A;  2REM A;  4I2U A;  3ZFB A;  2ON5 A;  2AV4 A;  5E59 A;  1AUC A;  5G1K A;  3UOM A;  5EY6 A;  4K0N A;  4FYU A;  4E8E A;  2X64 A;  2WJU A;  3N5O A;  3P8W A;  4G0L A;  4AF2 A;  1JHB A;  2AYT A;  4KAE A;  4OFN A;  3GNJ A;  3IDV A;  2HRN A;  2YWN A;  2XPE A;  3HY2 A;  2MMA A;  4MF7 A;  3IOS A;  5HQP A;  1G6Y A;  3H8Q A;  5DDL A;  2MMO A;  3KXO A;  1XOB A;  3F9U A;  4IJ3 A;  5IMF A;  5IO0 A;  3RAZ A;  4TR4 A;  2DJ3 A;  4IW9 A;  1GUL A;  1T00 A;  1YDK A;  5D9W A;  3HVX A;  22GS A;  2F8A A;  4MZC A;  4I6X A;  4XRD A;  2I3Y A;  3CSH A;  4TR3 A;  4X4J A;  5CYY A;  3FZ9 A;  5ECM B;  2GGT A;  3US3 A;  2NDO A;  3F4T A;  2WFC A;  2YPM A;  4I5Q A;  2YCD A;  3UIW A;  3UJ1 A;  2O89 A;  2FWG A;  3BD2 A;  4ICY A;  5IMZ A;  3ERF A;  3KMO A;  1DUG A;  2D2Z A;  1EP8 A;  1V9W A;  3V1W A;  4Z2R A;  1ZL9 A;  1ZYP A;  4YKF A;  2CV4 A;  2YZU A;  1TRS A;  3F4R A;  1Y25 A;  4OCE A;  3F63 A;  2V2G A;  3Q74 A;  4MJC A;  3EIN A;  1Z3E A;  4RQX A;  2HI7 A;  2H1D A;  2CVD A;  2VLV A;  4DSS A;  1QQ2 A;  1R26 A;  5D93 A;  2TRC P;  1GNE A;  3A2V A;  4ECI A;  1GSY A;  2IME A;  2H66 A;  4LLR A;  2B5E A;  3W8S A;  5ID2 B;  1H75 A;  4TR1 B;  4POK A;  4P3Y B;  3HJO A;  1PN9 A;  2QA2 A;  2H01 A;  4J57 E;  2RUF A;  2RUE A;  3O76 A;  4IVF A;  4IEL A;  3EUR A;  1M9B A;  4NV2 A;  5IOX A;  1V58 A;  5F8B A;  4KW6 A;  1XXU A;  3TCO A;  5HFG A;  2C3N A;  2LTK A;  3QMX A;  1O6J A;  2LUS A;  2PN8 A;  1FO5 A;  2VL9 A;  4WKW A;  5B6M A;  2L4Q A;  3RHB A;  1KTE A;  1K0N A;  4WF4 A;  1YF1 A;  4GST A;  2DKI A;  4MJA A;  2DJ2 A;  1B9X C;  1S3R A;  4ZB8 A;  1GTA A;  5IPH A;  2C8U A;  2R5G A;  5DJL A;  3N9J A;  1OVN A;  4G9H A;  4MPF A;  4K9Z A;  4ZBB A;  1XZO A;  2A2S A;  2B1K A;  1SD8 A;  3U6V A;  2R4V A;  2R37 A;  3LFL A;  1W89 A;  4WEY A;  3HZ4 A;  3I9V 2;  2WZ9 A;  5G30 A;  2CAQ A;  5KOX A;  3L4N A;  5CO3 A;  3HJM A;  2CVB A;  2ZNM A;  3P2A A;  4BL7 B;  2JL4 A;  2BMX A;  1RK4 A;  4OMV A;  1EGO A;  4MZB A;  4OD7 A;  3PIN A;  3VK9 A;  4PUR A;  2TRX A;  2R0G A;  2VCQ A;  1JZW A;  3LQ7 A;  1XWK A;  1GL8 A;  1FG4 A;  4EDY A;  4L8E A;  1DBY A;  3VWX A;  5A5K A;  1SJ6 A;  4YQU A;  4RQR A;  4V1A p;  4XIH A;  2KHP A;  2C0F A;  2H19 A;  2L6D A;  1O8X A;  3FHK A;  2KUC A;  5CAX A;  1M2B A;  1T4Z A;  2HRK A;  2DKH A;  3F0I A;  2DBC A;  5IMV A;  3ZRD A;  3LJR A;  4GXZ A;  4XS1 A;  4EIP A;  1A0R P;  1AQW A;  1IYI A;  4BVX B;  2PUK C;  4HU9 A;  1RQM A;  1X9W B;  4K1F A;  6GSY A;  4GWR A;  4PUA A;  1ZZY A;  1GSE A;  3C71 A;  2P0G A;  4O5U A;  1TU8 A;  1F3B A;  3UBL A;  6GSV A;  2R3X A;  4ECB A;  1PFO A;  2VD1 A;  4N30 A;  1N8J A;  3WGE A;  1PN0 A;  3HYP A;  2NTO A;  4AJ6 A;  1TOF A;  2MBT A;  4K0G A;  3VUR A;  4AJ7 A;  4CDO A;  3ERG A;  1GSF A;  2H6X A;  3G9B A;  2X8H A;  5HFI A;  3IAS 2;  4LMW A;  3KP9 A;  2LNS A;  4IKH A;  1X5C A;  1K3O A;  1HNB A;  2A4H A;  4O5R A;  2GST A;  4G0I A;  1XWB A;  3HD5 A;  2VL2 C;  2AHE A;  3UVH A;  4NHW A;  3IBH A;  1XFL A;  3GL3 A;  2GDR A;  4KND A;  1WOU A;  3G7Y A;  1O7U A;  1URM A;  1YEX A;  3FEU A;  4DSR A;  4HEA 2;  1M3J A;  3PR8 A;  3FR9 A;  1K0C A;  4ZL8 A;  2PWJ A;  1VGL A;  4K7O A;  4XS4 A;  5B7C A;  2H73 A;  5E4W A;  4X0X A;  1XG8 A;  3TJJ A;  2E0Q A;  2YWI A;  5J4U A;  1ACV A;  4KSM A;  1FHE A;  1SL1 B;  3WYW A;  4MH2 A;  4L5O A;  3CRU A;  3QAG A;  5C00 A;  3UEM A;  4EO3 A;  2N5B A;  3L78 A;  1ERW A;  3F6F A;  2C80 A;  2PGT A;  4L5L A;  2YN1 A;  2G0F A;  5IOW A;  5J5N A;  1PL2 A;  2V41 A;  1DE1 A;  5LCZ A;  2DIY A;  2VCZ A;  5DAK B;  1GLP A;  2HYX A;  3F3R A;  4FH8 A;  2WCI A;  3D6I A;  3ME7 A;  1A8L A;  4G2E A;  3HA9 A;  2C0D A;  2GQK A;  2L5O A;  2RII A;  4JED A;  4EVM A;  1AW9 A;  1AXD A;  2FGX A;  1EEJ A;  5ECN B;  4TXO B;  4O32 A;  5ECK B;  3C7M A;  5EVO A;  1HNA A;  2X8G A;  5DAL B;  1H4O A;  3IR4 A;  2MMN A;  10GS A;  3EU3 A;  3P7X A;  4KH7 A;  5J41 A;  2F51 A;  4HQZ A;  5EPF A;  1SKS B;  1ERV A;  1MEK A;  5DJM A;  5G1L A;  2VL3 A;  2WDU A;  1QMV A;  2XC2 A;  1TK5 B;  3FMW A;  1VF3 A;  4KGI A;  2MZC A;  1GUK A;  1PRX A;  4PNF A;  1XWA A;  1T4Y A;  4ZBA A;  3HVN A;  1GTU A;  5KOW A;  5CRH A;  2I1U A;  2HXK A;  1JLW A;  1B4P A;  1OKT A;  3GX8 A;  1I5G A;  1OC9 B;  1R7H A;  4IQA A;  1A0F A;  1XW6 A;  2GT5 A;  2L57 A;  3HZ8 A;  9GSS A;  4HJ2 A;  1WE0 A;  2JAD A;  3C8E A;  5CRD A;  3FZ4 A;  6GST A;  5AIV A;  4X43 A;  3FR3 A;  1SKR B;  4MCU A;  1SYR A;  3ERW A;  1X5D A;  2A2P A;  4J2F A;  4YQV A;  1QK8 A;  2H30 A;  3L9S A;  5GAP D;  1Z6N A;  1BED A;  2FCH A;  1YQ1 A;  4POL A;  2F8F A;  5ABR A;  5F0G A;  1F9M A;  1ERT A;  4BVY A;  2FD3 A;  4NMU A;  3A2W A;  1J0F A;  2G2Q A;  3GKN A;  2QA1 A;  5AGY A;  3H93 A;  5FWG A;  4PNG A;  3ZL5 A;  2M46 A;  4TW5 A;  2KLX A;  3F8U A;  3TJK A;  1TXX A;  4OO4 A;  1SJZ A;  1EOH A;  1SL2 B;  5DBQ A;  3VPT A;  3M1G A;  1KBN A;  1U6T A;  4TKY A;  4V2N A;  2YJ7 A;  1T8E B;  4EE0 A;  5AN1 A;  1XWC A;  3HHV A;  2QKE A;  3VPQ A;  2OJL A;  3ED3 A;  1R5P A;  3GUS A;  1YY7 A;  3GKK A;  2AAW A;  3DIE A;  2AJQ B;  4JU5 A;  4OFM A;  1Z6M A;  3GL5 A;  5B6N A;  1AQV A;  4KX4 A;  1MD4 A;  2VCV A;  2HT9 A;  3CYN A;  2LJK A;  4PUF C;  4N11 A;  1USB A;  4TVE A;  2L4C A;  5A4W A;  1Z5Y E;  3IE3 A;  4DVC A;  2QGV A;  3MDK A;  4PGT A;  3D21 A;  3GST A;  8GSS A;  3M8N A;  4TN8 A;  5GAN D;  4JE1 A;  1TTZ A;  4I2T A;  3U5R E;  3ZLP A;  4GLT A;  2IPA A;  1HYU A;  2FWE A;  1TJD A;  6GSS A;  4ZL9 A;  3VWV A;  2VM2 A;  3J7Y k;  1UC7 A;  3ZIT A;  1LBK A;  4DSS B;  3WT2 A;  3TRX A;  13GS A;  4EF0 A;  3LG6 A;  6GSU A;  3VFI A;  2KP2 A;  4TOP A;  2YOI A;  5H5S A;  2H8L A;  4G0K A;  4KDX A;  1XW9 A;  3RBT A;  4ZXG A;  3E9J B;  2ZUP A;  1M99 A;  2KOK A;  2DSA A;  3LWA A;  1OE8 A;  1PQN A;  3TJG A;  4USS A;  4G19 A;  4ECJ A;  5D9T A;  3LXZ A;  3ZMK A;  2H1A A;  2GZZ A;  1GSQ A;  1U87 A;  4K5S A;  4TRX A;  1PL1 A;  4V1A g;  4BPY A;  2FA4 A;  4HSC X;  3F4S A;  1S3A A;  2C4J A;  2CZ3 A;  5CRG A;  2YZH A;  1WPI A;  3AY8 A;  3QFB C;  4H86 A;  4JBB A;  3GHA A;  1OC8 A;  1EZK A;  4KUN A;  1JZO A;  5LNK e;  1XIY A;  1K0M A;  1XWG A;  3OR5 A;  3HKR A;  1V57 A;  3DD3 A;  3H79 A;  1JZD A;  2KP1 A;  1T7P B;  2L59 A;  4MH3 A;  3FKF A;  2WS2 A;  2LEG A;  3K8N A;  2PMT A;  5ID2 A;  1SK1 A;  4TR1 A;  2OKA A;  4CHS A;  4ZL7 A;  1YKC A;  1MDK A;  5IMA A;  2R6K A;  1S3D A;  4GQF A;  3CXG A;  1IYH A;  1OKD A;  1PD2 1;  3EMP A;  1R5A A;  2CVK A;  2X99 A;  3GFK A;  4F0C A;  3IK7 A;  2J23 A;  4L0W A;  2OAC A;  5G2Z A;  2EIO A;  3VI7 A;  3GRX A;  1T3B A;  1PKW A;  1WP0 A;  2IN3 A;  2P5R A;  1HQO A;  3QDN A;  1OYJ A;  2LJA A;  4F0B A;  3SWL A;  4WXT A;  1WJK A;  4L0U A;  3IC4 A;  1X9S B;  3HXS A;  4LMV A;  1Z7R A;  4Q5Q A;  4N10 A;  5IMD A;  4NV5 A;  3ZIV A;  5JCG A;  2LKU A;  2M80 A;  3TKP A;  2HZE B;  5ECQ B;  2FUG 2;  5HR3 A;  3GMF A;  1ABA A;  1W4V A;  3IHQ A;  3EWL A;  1F3A A;  3DKS A;  1XOA A;  4PQ1 A;  5ECS A;  1M0U A;  3I6A A;  3Q6O A;  3E0U A;  4OO5 A;  1GWC A;  4BL7 A;  4IP1 A;  3TJB A;  2BTO T;  2HRA A;  3IC8 A;  3WGD A;  3TKQ A;  3R3E A;  3I69 A;  2XHF A;  2WB9 A;  3CRT A;  2K6V A;  2NBS A;  4ML6 A;  1GTI A;  2LQQ A;  3ME8 A;  4BWS A;  14GS A;  3PPU A;  4GQC A;  3SBC A;  4WET A;  5KN0 A;  3TRP A;  1F2E A;  1EGR A;  1AAZ A;  5HR2 A;  1V2A A;  1YEP A;  2R0C A;  4QQ7 A;  5J9C A;  1ON4 A;  4YAV A;  2X8C A;  1K0D A;  1TW9 A;  2F3M A;  3EYT A;  2I9H A;  1MDI A;  3FK8 A;  5AIS A;  3A5I A;  4PQH A;  3Q18 A;  3PGT A;  1BJX A;  2YV9 A;  2VIM A;  2LRT A;  3W8J A;  4I8B A;  2ZCT A;  2PPT A;  3DRN A;  1O73 A;  4Z7X A;  1NHO A;  1GSD A;  3APQ A;  3M9J A;  4RI6 A;  3EE2 A;  4O5Q A;  2GQL A;  2GT6 A;  3TOU A;  1M2D A;  3G7I A;  2MBS A;  2GVP A;  3ZFL A;  4POB A;  4ZIJ A;  4PTS A;  1LJR A;  2LJR A;  1F6M C;  2N5A A;  4KF9 A;  19GS A;  4PXO A;  4K5R A;  3DXB A;  4HUA A;  5H5R A;  3KH7 A;  1PKZ A;  4Z2T A;  2GLR A;  4AJ8 A;  2GTU A;  1Z9H A;  1XW5 A;  2HLS A;  3ZYW A;  4YH2 A;  3VLN A;  4RI7 A;  2FA8 A;  1A23 A;  2F9S A;  3L9V A;  2GSQ A;  1HNC A;  4KSO A;  1SD9 A;  1EEM A;  2IMD A;  1C72 A;  4KDY A;  1XPV A;  5FT3 A;  1ST9 A;  4NXI A;  4F03 A;  1J08 A;  1UVZ A;  5G31 A;  5DVB A;  3CMI A;  4KCE A;  3PH9 A;  4IJI A;  2N5F A;  2B5X A;  1WWJ A;  1OAZ A;  4GSN A;  2JZT A;  1TK8 B;  1NHY A;  5B8B A;  1B8X A;  3GV1 A;  5DCH A;  3R2Q A;  1ZYQ B;  4JRR A;  1Q4J A;  3CTF A;  3KTB A;  4Q5F A;  4IQ1 A;  2OE3 A;  2JZS A;  2FY6 A;  5KN3 A;  3DML A;  3DVX A;  1K0O A;  2DLX A;  3MAK A;  3Q19 A;  4ML1 A;  2VLT A;  3H4K A;  1EP7 A;  3FRC A;  3QPM A;  4D73 B;  2DIZ A;  2IL3 A;  1WRY A;  3FY7 A;  5KN2 A;  3ZRE A;  4JZQ A;  5D96 A;  1PMT A;  3FW2 A;  1CQG A;  4F82 A;  3C1S A;  5DQS A;  1K0A A;  3APS A;  4BA7 A;  5DAK A;  1EV4 A;  5D73 A;  3IRA A;  4X1U A;  1CQH A;  3GSS A;  3HCZ A;  3QCP A;  1BQ7 A;  1DE2 A;  1MTC A;  2BJX A;  1GNW A;  4NHZ A;  1FVK A;  5ECP B;  1TDI A;  4EXJ A;  3HVV A;  4IP6 A;  4ZIL A;  2A2R A;  4OCF A;  5COH A;  4HZ2 A;  4ULX A;  2IFQ B;  2IMF A;  3FR6 A;  1TRW A;  5IMC A;  2O7K A;  4TXO A;  1SL0 B;  4QL9 A;  1E6B A;  3GTU B;  2GZY A;  4YAP A;  2MYG A;  2CA8 A;  2K8V A;  3DGQ A;  1SK0 A;  5CRW A;  5HR0 A;  4MK3 A;  4FYB A;  5ECH B;  3UMA A;  2R0P A;  3UVT A;  3TGZ A;  4K6X A;  4YQM A;  1J9B A;  5DCG A;  5KEJ A;  4EIQ A;  1K3L A;  5BRT A;  2GS3 A;  2H76 A;  3D4M A;  2LRN A;  3MYD A;  3M0F A;  3L9U A;  3A3T A;  3TKS E;  4Q5N A;  4BVY B;  5JCW A;  2HFD A;  2VO4 A;  3MIX A;  3NIV A;  3CQF A;  1I9D A;  2VM1 A;  4WBJ A;  1TI1 A;  1UA5 A;  3WT1 A;  1A2J A;  4IBP A;  2O8V B;  3LOR A;  2NVL A;  2GSS A;  3FZ5 A;  2GSR A;  2HE3 A;  2XBI A;  5JWO B;  12GS A;  2JZR A;  1OC9 A;  3E3E A;  4K2D A;  1AC1 A;  3VI5 A;  2P5Q A;  1RW1 A;  2H6Y A;  5ECR B;  3QOU A;  1A2M A;  3ISO A;  3TRQ A;  2J9H A;  1ZYN A;  2VD0 A;  5ECI B;  3O6T A;  4HS1 A;  1ZOF A;  2WGR A;  1V98 A;  1UN2 A;  3RHC A;  5FHI A;  5F07 A;  3KMN A;  4XRA A;  4WBR D;  3ZZX A;  4GCI A;  2DC5 A;  3EPT A;  1GSS A;  3MNG A;  4ECC A;  3J7Y b;  1S3C A;  4HU7 A;  5CP1 A;  2C1Y A;  3GYK A;  1XVW A;  5HR1 A;  1GLQ A;  1XCC A;  2CZ2 A;  1JLV A;  2L5L A;  3KH9 A;  2XBQ A;  2LV3 A;  3FZA A;  5KN1 A;  4KB3 A;  1U3I A;  1VRS D;  3IV4 A;  2B7K A;  4FYC A;  1VF4 A;  2OA7 A;  4MAB A;  3ZVJ D;  5BMU A;  6GSX A;  2H0H A;  5B8A A;  1YJ6 A;  1G6W A;  1M3I A;  3GX0 A;  4DEJ A;  4GF0 A;  2EIR A;  2C3Q A;  2I4A A;  4NWY A;  1FB0 A;  5INY A;  3GH6 A;  3LGC A;  2LS5 A;  4N0V A;  4IN0 A;  5F06 A;  3ZTL A;  3BJ5 A;  4WR5 A;  1Z7P A;  1GUH A;  3TB2 A;  2M72 A;  1M9A A;  3D0Z A;  3GH9 A;  4CY8 A;  1SKW B;  3GKM A;  4HZ4 A;  1QXH A;  2YWM A;  3KM6 A;  3MSZ A;  4Z2U A;  2GQM A;  3IHG A;  4HDE A;  2DJK A;  4KE3 A;  2CX4 A;  1TI3 A;  2I81 A;  3DEX A;  4XHM A;  2VLU A;  3IK9 A;  5CNW A;  2CQ9 A;  4ZB6 A;  3EMX A;  1A24 A;  1GTB A;  2VUP A;  3DYR A;  1FOH A;  3GIX A;  4XTS A;  2E2M A;  1AIU A;  1E2Y A;  2H71 A;  2DJ1 A;  2R2J A;  5JCU A;  2HSY A;  1M7T A;  1GP1 A;  3TKR A;  1EV9 A;  3UL3 A;  1FAA A;  1NM3 A;  3TKS A;  3D22 A;  4O92 A;  4MLY A;  3LXT A;  4V2L A;  2VCT A;  1YF0 A;  1T1V A;  2H1B A;  3QFA C;  3KD0 A;  3LYK A;  2IMK A;  2OE0 A;  3KJY A;  1R4W A;  4I97 A;  4A5P A;  3D4T A;  1X9M B;  2HZF A;  2JSY A;  3C73 A;  3RDW A;  2X4A A;  4ISD A;  1FB6 A;  4EDZ A;  1ZMA A;  4ZBD A;  3H1N A;  4MDC A;  2LQO A;  3HJP A;  2VL2 A;  3EVI A;  1ERU A;  1BAY A;  2ES7 A;  4EUY A;  1TK0 B;  2B3S A;  2JU5 A;  2CAI A;  2HNL A;  4LL1 B;  1JZR A;  3QD9 A;  1EOG A;  2YWO A;  1YKA A;  1EWX A;  5HFK A;  2B5Y A;  3DVW A;  5J9B A;  2UZ8 A;  2FHE A;  2H6Z A;  5D9V A;  2K9F A;  4DSQ A;  5F05 A;  5IPG A;  4KCA A;  2IIY A;  1QUW A;  5C04 A;  3FYG A;  3M3M A;  2LNT A;  5ECO B;  2A4V A;  3BOA A;  4HQS A;  2C0G A;  1B48 A;  2EC4 A;  1Q98 A;  2HSH A;  5IQY A;  4TR0 A;  1U88 A;  2E2G A;  5GSS A;  4GSS A;  2V6K A;  5AIX A;  5GST A;  2C0E A;  4FQU A;  4MPG A;  2FWH A;  3QAW A;  3LEF A;  2GZP A;  2H74 A;  4MP4 A;  4MA9 A;  5IM9 A;  2FLS A;  4N0Z A;  1LU4 A;  2NPB A;  1U3A A;  3G7J A;  2P31 A;  1QGV A;  5H5Q A;  4LL4 B;  3I43 A;  1A2L A;  2H1G A;  1JFU A;  4MJB A;  3ZVJ A;  2OAD A;  3M9K A;  3EU4 A;  4IHU A;  3UAP A;  3BCK A;  2C3T A;  3IPZ A;  4BWQ A;  2K8S A;  2DJJ A;  1MDJ A;  1NSW A;  2AB6 A;  1SK2 A;  4AGS A;  1O8W A;  2CX3 A;  3W6G A;  1YZX A;  2LST A;  1F37 A;  4LA1 A;  3C1R A;  3GKX A;  1ILO A;  1B4Q A;  2TIR A;  3NOF A;  3KCM A;  4KA0 A;  3WGX A;  2V1M A;  1TKD B;  5IIZ A;  2HZE A;  1K0B A;  1PX7 A;  3RPN A;  2VCX A;  16GS A;  2DML A;  1PGT A;  4ID0 A;  2MMZ A;  5GZZ B;  1BG5 A;  1ZYE A;  3LSZ A;  3GUR A;  3WD6 A;  1SEN A;  5A4U A;  2YNX A;  4TXV A;  4WR4 A;  3HVS A;  2QSI A;  2FWF A;  3L0H A;  1THX A;  2B1L A;  1BX9 A;  2OBK A;  5EL8 A;  5D8I A;  3TKS C;  4K2X A;  4ZB9 A;  2IWT A;  4BVX A;  3LW9 A;  5G5F A;  1X5E A;  5L71 A;  2O85 A;  4YKG A; 
#chains in the Genus database with same CATH homology
 4ACS A;  1WIK A;  1PX6 A;  2H0I A;  5ECL B;  4XS6 A;  4CY6 A;  4O7H A;  2IMI A;  2YP6 A;  1PSQ A;  2XPD A;  2HRF A;  3A5W A;  1B9Y C;  1KNG A;  4XS4 B;  1XBS A;  2E7P A;  2ALB A;  2VAF A;  4CW9 A;  2OBI A;  3GN3 A;  4GTU A;  3F3Q A;  2FNO A;  4MJE A;  3KGK A;  4MF5 A;  1SU9 A;  1TRV A;  17GS A;  2V32 A;  3O3T A;  3CBU A;  2WRT A;  3RPP A;  3IAM 2;  3ZIJ A;  3CTG A;  5G5E A;  5J3R A;  1VF2 A;  5CRE A;  2WUL A;  4NAX A;  1TRU A;  4ILF A;  2CT6 A;  2YV7 A;  5A4V A;  4GRF A;  4HOJ A;  2V6O A;  1GRX A;  4HJM A;  3F6D A;  4JR6 A;  2DMM A;  18GS A;  5JWR B;  3KEB A;  1PA3 A;  2PER A;  2QC7 A;  1G7O A;  1KEB A;  4FO5 A;  1G0T A;  2DJ0 A;  2VCW A;  4IS0 A;  1DSB A;  2H75 A;  2RM6 A;  2ON7 A;  4MF6 A;  4IGJ A;  4E8H A;  3KTL A;  2YAN A;  7GSS A;  1QFN A;  1SYX A;  3A2X A;  4PQI A;  2Z9S A;  3APO A;  1TP9 A;  2RM5 A;  4MZW A;  3P90 A;  4MNN A;  4EL1 A;  2HSM A;  3UBK A;  3KZQ A;  1FOV A;  2JAC A;  3S9F A;  2OE1 A;  2PVQ A;  4F2I A;  4PX1 A;  3KP8 A;  4G10 A;  2H0G A;  4K7N A;  5JWQ B;  3GA4 A;  5DQY A;  1N2A A;  1TU7 A;  3MWH A;  3IXR A;  3HDC A;  3DWV A;  5IO2 A;  1THO A;  3NZN A;  4K7I A;  2VOC A;  11GS A;  5D9X A;  1ML6 A;  5ELG A;  3D5J A;  4V2M A;  2O87 A;  2LRC A;  4OFT A;  4KDU A;  3TDG A;  1GH2 A;  4D73 A;  1OC3 A;  4MMM A;  3BCI A;  4K8M A;  5ELA A;  1BYE A;  1GUM A;  1AQX A;  1ZCP A;  3UAR A;  3KIJ A;  2JSZ A;  2RLI A;  1OE7 A;  5DAL A;  4WF5 A;  5LD0 A;  2PU9 C;  1G7E A;  4NPB A;  2B6M A;  4QL7 A;  2B7J A;  3VWW A;  4F9Z A;  3CSI A;  1X0R A;  3BBY A;  3QR6 A;  3CSJ A;  3ZML A;  4FIW A;  1Y6E A;  1GSU A;  2IJY A;  2PBJ A;  3JCM L;  3TJF A;  3TUE A;  1FVJ A;  2EIQ A;  2IFQ A;  4POM A;  2H72 A;  2YJH A;  1WMJ A;  4J56 E;  1FW1 A;  3GTU A;  4EC0 A;  1HD2 A;  1A8Y A;  2H70 A;  4Q5R A;  2PVO C;  1O81 A;  1ZGN A;  2L6C A;  1SJI A;  3VWU A;  1VF1 A;  4XCS A;  4OWY A;  3LYP A;  1MD3 A;  1M2A A;  6GSW A;  3IA1 A;  1XVQ A;  2K18 A;  1K3Y A;  4JR4 A;  4HI7 A;  4RUV A;  3EC3 A;  2AUV A;  1NW2 A;  2X49 A;  20GS A;  1V40 A;  1O85 A;  3TOT A;  3QAV A;  5ENU A;  4EKZ A;  2REM A;  4I2U A;  3ZFB A;  2ON5 A;  2AV4 A;  5E59 A;  1AUC A;  5G1K A;  3UOM A;  5EY6 A;  4K0N A;  4FYU A;  4E8E A;  2X64 A;  2WJU A;  3N5O A;  3P8W A;  4G0L A;  4AF2 A;  1JHB A;  2AYT A;  4KAE A;  4OFN A;  3GNJ A;  3IDV A;  2HRN A;  2YWN A;  2XPE A;  3HY2 A;  2MMA A;  4MF7 A;  3IOS A;  5HQP A;  1G6Y A;  3H8Q A;  5DDL A;  2MMO A;  3KXO A;  1XOB A;  3F9U A;  4IJ3 A;  5IMF A;  5IO0 A;  3RAZ A;  4TR4 A;  2DJ3 A;  4IW9 A;  1GUL A;  1T00 A;  1YDK A;  5D9W A;  3HVX A;  22GS A;  2F8A A;  4MZC A;  4I6X A;  4XRD A;  2I3Y A;  3CSH A;  4TR3 A;  4X4J A;  5CYY A;  3FZ9 A;  5ECM B;  2GGT A;  3US3 A;  2NDO A;  3F4T A;  2WFC A;  2YPM A;  4I5Q A;  2YCD A;  3UIW A;  3UJ1 A;  2O89 A;  2FWG A;  3BD2 A;  4ICY A;  5IMZ A;  3ERF A;  3KMO A;  1DUG A;  2D2Z A;  1EP8 A;  1V9W A;  3V1W A;  4Z2R A;  1ZL9 A;  1ZYP A;  4YKF A;  2CV4 A;  2YZU A;  1TRS A;  3F4R A;  1Y25 A;  4OCE A;  3F63 A;  2V2G A;  3Q74 A;  4MJC A;  3EIN A;  1Z3E A;  4RQX A;  2HI7 A;  2H1D A;  2CVD A;  2VLV A;  4DSS A;  1QQ2 A;  1R26 A;  5D93 A;  2TRC P;  1GNE A;  3A2V A;  4ECI A;  1GSY A;  2IME A;  2H66 A;  4LLR A;  2B5E A;  3W8S A;  5ID2 B;  1H75 A;  4TR1 B;  4POK A;  4P3Y B;  3HJO A;  1PN9 A;  2QA2 A;  2H01 A;  4J57 E;  2RUF A;  2RUE A;  3O76 A;  4IVF A;  4IEL A;  3EUR A;  1M9B A;  4NV2 A;  5IOX A;  1V58 A;  5F8B A;  4KW6 A;  1XXU A;  3TCO A;  5HFG A;  2C3N A;  2LTK A;  3QMX A;  1O6J A;  2LUS A;  2PN8 A;  1FO5 A;  2VL9 A;  4WKW A;  5B6M A;  2L4Q A;  3RHB A;  1KTE A;  1K0N A;  4WF4 A;  1YF1 A;  4GST A;  2DKI A;  4MJA A;  2DJ2 A;  1B9X C;  4ZB8 A;  1GTA A;  5IPH A;  2C8U A;  2R5G A;  5DJL A;  3N9J A;  1OVN A;  4G9H A;  4MPF A;  4K9Z A;  4ZBB A;  1XZO A;  2A2S A;  2B1K A;  1SD8 A;  3U6V A;  2R4V A;  2R37 A;  3LFL A;  1W89 A;  4WEY A;  3HZ4 A;  3I9V 2;  2WZ9 A;  5G30 A;  2CAQ A;  5KOX A;  3L4N A;  5CO3 A;  3HJM A;  2CVB A;  2ZNM A;  3P2A A;  4BL7 B;  2JL4 A;  2BMX A;  1RK4 A;  4OMV A;  1EGO A;  4MZB A;  4OD7 A;  3PIN A;  3VK9 A;  4PUR A;  2TRX A;  2R0G A;  2VCQ A;  1JZW A;  3LQ7 A;  1XWK A;  1GL8 A;  1FG4 A;  4EDY A;  4L8E A;  1DBY A;  3VWX A;  5A5K A;  1SJ6 A;  4YQU A;  4RQR A;  4V1A p;  4XIH A;  2KHP A;  2C0F A;  2H19 A;  2L6D A;  1O8X A;  3FHK A;  2KUC A;  5CAX A;  1M2B A;  1T4Z A;  2HRK A;  2DKH A;  3F0I A;  2DBC A;  5IMV A;  3ZRD A;  3LJR A;  4GXZ A;  4XS1 A;  4EIP A;  1A0R P;  1AQW A;  1IYI A;  4BVX B;  2PUK C;  4HU9 A;  1RQM A;  1X9W B;  4K1F A;  6GSY A;  4GWR A;  4PUA A;  1ZZY A;  1GSE A;  3C71 A;  2P0G A;  4O5U A;  1TU8 A;  1F3B A;  3UBL A;  6GSV A;  2R3X A;  4ECB A;  2VD1 A;  4N30 A;  1N8J A;  3WGE A;  1PN0 A;  3HYP A;  2NTO A;  4AJ6 A;  1TOF A;  2MBT A;  4K0G A;  3VUR A;  4AJ7 A;  4CDO A;  3ERG A;  1GSF A;  2H6X A;  3G9B A;  2X8H A;  5HFI A;  3IAS 2;  4LMW A;  3KP9 A;  2LNS A;  4IKH A;  1X5C A;  1K3O A;  1HNB A;  2A4H A;  4O5R A;  2GST A;  4G0I A;  1XWB A;  3HD5 A;  2VL2 C;  2AHE A;  3UVH A;  4NHW A;  3IBH A;  1XFL A;  3GL3 A;  2GDR A;  4KND A;  1WOU A;  3G7Y A;  1O7U A;  1URM A;  1YEX A;  3FEU A;  4DSR A;  4HEA 2;  3PR8 A;  3FR9 A;  1K0C A;  4ZL8 A;  2PWJ A;  1VGL A;  4K7O A;  4XS4 A;  5B7C A;  2H73 A;  5E4W A;  4X0X A;  3TJJ A;  2E0Q A;  2YWI A;  5J4U A;  1ACV A;  4KSM A;  1FHE A;  1SL1 B;  3WYW A;  4MH2 A;  4L5O A;  3CRU A;  3QAG A;  5C00 A;  3UEM A;  4EO3 A;  2N5B A;  3L78 A;  1ERW A;  3F6F A;  2C80 A;  2PGT A;  4L5L A;  2YN1 A;  2G0F A;  5IOW A;  5J5N A;  1PL2 A;  2V41 A;  1DE1 A;  5LCZ A;  2DIY A;  2VCZ A;  5DAK B;  1GLP A;  2HYX A;  3F3R A;  4FH8 A;  2WCI A;  3D6I A;  3ME7 A;  1A8L A;  4G2E A;  3HA9 A;  2C0D A;  2GQK A;  2L5O A;  2RII A;  4JED A;  4EVM A;  1AW9 A;  1AXD A;  2FGX A;  1EEJ A;  5ECN B;  4TXO B;  4O32 A;  5ECK B;  3C7M A;  5EVO A;  1HNA A;  2X8G A;  5DAL B;  1H4O A;  3IR4 A;  2MMN A;  10GS A;  3EU3 A;  3P7X A;  4KH7 A;  5J41 A;  2F51 A;  4HQZ A;  5EPF A;  1SKS B;  1ERV A;  1MEK A;  5DJM A;  5G1L A;  2VL3 A;  2WDU A;  1QMV A;  2XC2 A;  1TK5 B;  3FMW A;  1VF3 A;  4KGI A;  2MZC A;  1GUK A;  1PRX A;  4PNF A;  1XWA A;  1T4Y A;  4ZBA A;  1GTU A;  5KOW A;  5CRH A;  2I1U A;  2HXK A;  1JLW A;  1B4P A;  1OKT A;  3GX8 A;  1I5G A;  1OC9 B;  1R7H A;  4IQA A;  1A0F A;  1XW6 A;  2GT5 A;  2L57 A;  3HZ8 A;  9GSS A;  4HJ2 A;  1WE0 A;  2JAD A;  3C8E A;  5CRD A;  3FZ4 A;  6GST A;  5AIV A;  4X43 A;  3FR3 A;  1SKR B;  4MCU A;  1SYR A;  3ERW A;  1X5D A;  2A2P A;  4J2F A;  4YQV A;  1QK8 A;  2H30 A;  3L9S A;  5GAP D;  1Z6N A;  1BED A;  2FCH A;  1YQ1 A;  4POL A;  2F8F A;  5ABR A;  5F0G A;  1F9M A;  1ERT A;  4BVY A;  2FD3 A;  4NMU A;  3A2W A;  1J0F A;  2G2Q A;  3GKN A;  2QA1 A;  5AGY A;  3H93 A;  5FWG A;  4PNG A;  3ZL5 A;  2M46 A;  4TW5 A;  2KLX A;  3F8U A;  3TJK A;  1TXX A;  4OO4 A;  1SJZ A;  1EOH A;  1SL2 B;  5DBQ A;  3VPT A;  3M1G A;  1KBN A;  1U6T A;  4TKY A;  4V2N A;  2YJ7 A;  1T8E B;  4EE0 A;  5AN1 A;  1XWC A;  3HHV A;  2QKE A;  3VPQ A;  2OJL A;  3ED3 A;  1R5P A;  3GUS A;  1YY7 A;  3GKK A;  2AAW A;  3DIE A;  2AJQ B;  4JU5 A;  4OFM A;  1Z6M A;  3GL5 A;  5B6N A;  1AQV A;  4KX4 A;  1MD4 A;  2VCV A;  2HT9 A;  3CYN A;  2LJK A;  4PUF C;  4N11 A;  1USB A;  4TVE A;  2L4C A;  5A4W A;  1Z5Y E;  3IE3 A;  4DVC A;  2QGV A;  3MDK A;  4PGT A;  3D21 A;  3GST A;  8GSS A;  3M8N A;  4TN8 A;  5GAN D;  4JE1 A;  1TTZ A;  4I2T A;  3U5R E;  3ZLP A;  4GLT A;  2IPA A;  1HYU A;  2FWE A;  1TJD A;  6GSS A;  4ZL9 A;  3VWV A;  2VM2 A;  3J7Y k;  1UC7 A;  3ZIT A;  1LBK A;  4DSS B;  3WT2 A;  3TRX A;  13GS A;  4EF0 A;  3LG6 A;  6GSU A;  3VFI A;  2KP2 A;  4TOP A;  2YOI A;  5H5S A;  2H8L A;  4G0K A;  4KDX A;  1XW9 A;  3RBT A;  4ZXG A;  3E9J B;  2ZUP A;  1M99 A;  2KOK A;  2DSA A;  3LWA A;  1OE8 A;  1PQN A;  3TJG A;  4USS A;  4G19 A;  4ECJ A;  5D9T A;  3LXZ A;  3ZMK A;  2H1A A;  2GZZ A;  1GSQ A;  1U87 A;  4K5S A;  4TRX A;  1PL1 A;  4V1A g;  4BPY A;  2FA4 A;  3F4S A;  1S3A A;  2C4J A;  2CZ3 A;  5CRG A;  2YZH A;  1WPI A;  3AY8 A;  3QFB C;  4H86 A;  4JBB A;  3GHA A;  1OC8 A;  1EZK A;  4KUN A;  1JZO A;  5LNK e;  1XIY A;  1K0M A;  1XWG A;  3OR5 A;  3HKR A;  1V57 A;  3DD3 A;  3H79 A;  1JZD A;  2KP1 A;  1T7P B;  2L59 A;  4MH3 A;  3FKF A;  2WS2 A;  2LEG A;  3K8N A;  2PMT A;  5ID2 A;  1SK1 A;  4TR1 A;  2OKA A;  4CHS A;  4ZL7 A;  1YKC A;  1MDK A;  5IMA A;  2R6K A;  1S3D A;  4GQF A;  3CXG A;  1IYH A;  1OKD A;  1PD2 1;  3EMP A;  1R5A A;  2CVK A;  2X99 A;  3GFK A;  4F0C A;  3IK7 A;  2J23 A;  4L0W A;  2OAC A;  5G2Z A;  2EIO A;  3VI7 A;  3GRX A;  1T3B A;  1PKW A;  1WP0 A;  2IN3 A;  2P5R A;  1HQO A;  3QDN A;  1OYJ A;  2LJA A;  4F0B A;  3SWL A;  4WXT A;  1WJK A;  4L0U A;  3IC4 A;  1X9S B;  3HXS A;  4LMV A;  1Z7R A;  4Q5Q A;  4N10 A;  5IMD A;  4NV5 A;  3ZIV A;  5JCG A;  2LKU A;  2M80 A;  3TKP A;  2HZE B;  5ECQ B;  2FUG 2;  5HR3 A;  3GMF A;  1ABA A;  1W4V A;  3IHQ A;  3EWL A;  1F3A A;  3DKS A;  1XOA A;  4PQ1 A;  5ECS A;  1M0U A;  3I6A A;  3Q6O A;  3E0U A;  4OO5 A;  1GWC A;  4BL7 A;  4IP1 A;  3TJB A;  2BTO T;  2HRA A;  3IC8 A;  3WGD A;  3TKQ A;  3R3E A;  3I69 A;  2XHF A;  2WB9 A;  3CRT A;  2K6V A;  2NBS A;  4ML6 A;  1GTI A;  2LQQ A;  3ME8 A;  4BWS A;  14GS A;  3PPU A;  4GQC A;  3SBC A;  4WET A;  5KN0 A;  3TRP A;  1F2E A;  1EGR A;  1AAZ A;  5HR2 A;  1V2A A;  1YEP A;  2R0C A;  4QQ7 A;  5J9C A;  1ON4 A;  4YAV A;  2X8C A;  1K0D A;  1TW9 A;  2F3M A;  3EYT A;  2I9H A;  1MDI A;  3FK8 A;  5AIS A;  3A5I A;  4PQH A;  3Q18 A;  3PGT A;  1BJX A;  2YV9 A;  2VIM A;  2LRT A;  3W8J A;  4I8B A;  2ZCT A;  2PPT A;  3DRN A;  1O73 A;  4Z7X A;  1NHO A;  1GSD A;  3APQ A;  3M9J A;  4RI6 A;  3EE2 A;  4O5Q A;  2GQL A;  2GT6 A;  3TOU A;  1M2D A;  3G7I A;  2MBS A;  2GVP A;  3ZFL A;  4POB A;  4ZIJ A;  4PTS A;  1LJR A;  2LJR A;  1F6M C;  2N5A A;  4KF9 A;  19GS A;  4PXO A;  4K5R A;  3DXB A;  4HUA A;  5H5R A;  3KH7 A;  1PKZ A;  4Z2T A;  2GLR A;  4AJ8 A;  2GTU A;  1Z9H A;  1XW5 A;  2HLS A;  3ZYW A;  4YH2 A;  3VLN A;  4RI7 A;  2FA8 A;  1A23 A;  2F9S A;  3L9V A;  2GSQ A;  1HNC A;  4KSO A;  1SD9 A;  1EEM A;  2IMD A;  1C72 A;  4KDY A;  1XPV A;  5FT3 A;  1ST9 A;  4NXI A;  4F03 A;  1J08 A;  1UVZ A;  5G31 A;  5DVB A;  3CMI A;  4KCE A;  3PH9 A;  4IJI A;  2N5F A;  2B5X A;  1WWJ A;  1OAZ A;  4GSN A;  2JZT A;  1TK8 B;  1NHY A;  5B8B A;  1B8X A;  3GV1 A;  5DCH A;  3R2Q A;  1ZYQ B;  4JRR A;  1Q4J A;  3CTF A;  3KTB A;  4Q5F A;  4IQ1 A;  2OE3 A;  2JZS A;  2FY6 A;  5KN3 A;  3DML A;  3DVX A;  1K0O A;  2DLX A;  3MAK A;  3Q19 A;  4ML1 A;  2VLT A;  3H4K A;  1EP7 A;  3FRC A;  3QPM A;  4D73 B;  2DIZ A;  2IL3 A;  1WRY A;  3FY7 A;  5KN2 A;  3ZRE A;  4JZQ A;  5D96 A;  1PMT A;  3FW2 A;  1CQG A;  4F82 A;  3C1S A;  5DQS A;  1K0A A;  3APS A;  4BA7 A;  5DAK A;  1EV4 A;  5D73 A;  3IRA A;  4X1U A;  1CQH A;  3GSS A;  3HCZ A;  3QCP A;  1BQ7 A;  1DE2 A;  1MTC A;  2BJX A;  1GNW A;  4NHZ A;  1FVK A;  5ECP B;  1TDI A;  4EXJ A;  3HVV A;  4IP6 A;  4ZIL A;  2A2R A;  4OCF A;  5COH A;  4HZ2 A;  4ULX A;  2IFQ B;  2IMF A;  3FR6 A;  1TRW A;  5IMC A;  2O7K A;  4TXO A;  1SL0 B;  4QL9 A;  1E6B A;  3GTU B;  2GZY A;  4YAP A;  2MYG A;  2CA8 A;  2K8V A;  3DGQ A;  1SK0 A;  5CRW A;  5HR0 A;  4MK3 A;  4FYB A;  5ECH B;  3UMA A;  2R0P A;  3UVT A;  3TGZ A;  4K6X A;  4YQM A;  1J9B A;  5DCG A;  5KEJ A;  4EIQ A;  1K3L A;  5BRT A;  2GS3 A;  2H76 A;  3D4M A;  2LRN A;  3MYD A;  3M0F A;  3L9U A;  3A3T A;  3TKS E;  4Q5N A;  4BVY B;  5JCW A;  2HFD A;  2VO4 A;  3MIX A;  3NIV A;  1I9D A;  2VM1 A;  4WBJ A;  1TI1 A;  1UA5 A;  3WT1 A;  1A2J A;  4IBP A;  2O8V B;  3LOR A;  2NVL A;  2GSS A;  3FZ5 A;  2GSR A;  2HE3 A;  2XBI A;  5JWO B;  12GS A;  2JZR A;  1OC9 A;  3E3E A;  4K2D A;  1AC1 A;  3VI5 A;  2P5Q A;  1RW1 A;  2H6Y A;  5ECR B;  3QOU A;  1A2M A;  3ISO A;  3TRQ A;  2J9H A;  1ZYN A;  2VD0 A;  5ECI B;  3O6T A;  4HS1 A;  1ZOF A;  2WGR A;  1V98 A;  1UN2 A;  3RHC A;  5FHI A;  5F07 A;  3KMN A;  4XRA A;  4WBR D;  3ZZX A;  4GCI A;  2DC5 A;  3EPT A;  1GSS A;  3MNG A;  4ECC A;  3J7Y b;  1S3C A;  4HU7 A;  5CP1 A;  2C1Y A;  3GYK A;  1XVW A;  5HR1 A;  1GLQ A;  1XCC A;  2CZ2 A;  1JLV A;  2L5L A;  3KH9 A;  2XBQ A;  2LV3 A;  3FZA A;  5KN1 A;  4KB3 A;  1U3I A;  1VRS D;  3IV4 A;  2B7K A;  4FYC A;  1VF4 A;  2OA7 A;  4MAB A;  3ZVJ D;  5BMU A;  6GSX A;  2H0H A;  5B8A A;  1YJ6 A;  1G6W A;  3GX0 A;  4DEJ A;  4GF0 A;  2EIR A;  2C3Q A;  2I4A A;  4NWY A;  1FB0 A;  5INY A;  3GH6 A;  3LGC A;  2LS5 A;  4N0V A;  4IN0 A;  5F06 A;  3ZTL A;  3BJ5 A;  4WR5 A;  1Z7P A;  1GUH A;  3TB2 A;  2M72 A;  1M9A A;  3D0Z A;  3GH9 A;  4CY8 A;  1SKW B;  3GKM A;  4HZ4 A;  1QXH A;  2YWM A;  3KM6 A;  3MSZ A;  4Z2U A;  2GQM A;  3IHG A;  4HDE A;  2DJK A;  4KE3 A;  2CX4 A;  1TI3 A;  2I81 A;  3DEX A;  4XHM A;  2VLU A;  3IK9 A;  5CNW A;  2CQ9 A;  4ZB6 A;  3EMX A;  1A24 A;  1GTB A;  2VUP A;  3DYR A;  1FOH A;  3GIX A;  4XTS A;  2E2M A;  1AIU A;  1E2Y A;  2H71 A;  2DJ1 A;  2R2J A;  5JCU A;  2HSY A;  1M7T A;  1GP1 A;  3TKR A;  1EV9 A;  3UL3 A;  1FAA A;  1NM3 A;  3TKS A;  3D22 A;  4O92 A;  4MLY A;  3LXT A;  4V2L A;  2VCT A;  1YF0 A;  1T1V A;  2H1B A;  3QFA C;  3KD0 A;  3LYK A;  2IMK A;  2OE0 A;  3KJY A;  1R4W A;  4I97 A;  4A5P A;  3D4T A;  1X9M B;  2HZF A;  2JSY A;  3C73 A;  3RDW A;  2X4A A;  4ISD A;  1FB6 A;  4EDZ A;  1ZMA A;  4ZBD A;  3H1N A;  4MDC A;  2LQO A;  3HJP A;  2VL2 A;  3EVI A;  1ERU A;  1BAY A;  2ES7 A;  4EUY A;  1TK0 B;  2B3S A;  2JU5 A;  2CAI A;  2HNL A;  4LL1 B;  1JZR A;  3QD9 A;  1EOG A;  2YWO A;  1YKA A;  1EWX A;  5HFK A;  2B5Y A;  3DVW A;  5J9B A;  2UZ8 A;  2FHE A;  2H6Z A;  5D9V A;  2K9F A;  4DSQ A;  5F05 A;  5IPG A;  4KCA A;  2IIY A;  1QUW A;  5C04 A;  3FYG A;  3M3M A;  2LNT A;  5ECO B;  2A4V A;  3BOA A;  4HQS A;  2C0G A;  1B48 A;  2EC4 A;  1Q98 A;  2HSH A;  5IQY A;  4TR0 A;  1U88 A;  2E2G A;  5GSS A;  4GSS A;  2V6K A;  5AIX A;  5GST A;  2C0E A;  4FQU A;  4MPG A;  2FWH A;  3QAW A;  3LEF A;  2GZP A;  2H74 A;  4MP4 A;  4MA9 A;  5IM9 A;  2FLS A;  4N0Z A;  1LU4 A;  2NPB A;  1U3A A;  3G7J A;  2P31 A;  1QGV A;  5H5Q A;  4LL4 B;  3I43 A;  1A2L A;  2H1G A;  1JFU A;  4MJB A;  3ZVJ A;  2OAD A;  3M9K A;  3EU4 A;  4IHU A;  3UAP A;  3BCK A;  2C3T A;  3IPZ A;  4BWQ A;  2K8S A;  2DJJ A;  1MDJ A;  1NSW A;  2AB6 A;  1SK2 A;  4AGS A;  1O8W A;  2CX3 A;  3W6G A;  1YZX A;  2LST A;  1F37 A;  4LA1 A;  3C1R A;  3GKX A;  1ILO A;  1B4Q A;  2TIR A;  3NOF A;  3KCM A;  4KA0 A;  3WGX A;  2V1M A;  1TKD B;  5IIZ A;  2HZE A;  1K0B A;  1PX7 A;  3RPN A;  2VCX A;  16GS A;  2DML A;  1PGT A;  4ID0 A;  2MMZ A;  5GZZ B;  1BG5 A;  1ZYE A;  3LSZ A;  3GUR A;  3WD6 A;  1SEN A;  5A4U A;  2YNX A;  4TXV A;  4WR4 A;  3HVS A;  2QSI A;  2FWF A;  3L0H A;  1THX A;  2B1L A;  1BX9 A;  2OBK A;  5EL8 A;  5D8I A;  3TKS C;  4K2X A;  4ZB9 A;  2IWT A;  4BVX A;  3LW9 A;  5G5F A;  1X5E A;  5L71 A;  2O85 A;  4YKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...