2I3YA

Crystal structure of human glutathione peroxidase 5
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
188
structure length
188
Chain Sequence
DCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPELNALQEELKPYGLVVLGFPCNQFGKQEPGDNKEILPGLKYVRPGGGFVPSFQLFEKGDVNGEKEQKVFSFLKHSCPHPSEILGTFKSISWDPVKVHDIRWNFEKFLVGPDGIPVMRWSHRATVSSVKTDILAYLKQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epididymal secretory glutathione peroxidase
publication title Crystal structure of human glutathione peroxidase 5
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 54
structure length 188
sequence length 188
ec nomenclature ec 1.11.1.9: Glutathione peroxidase.
pdb deposition date 2006-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00255 GSHPx Glutathione peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2i3yA01
5HQPA 1TDIA 2YP6A 5J9CA 5J4UA 3UAPA 2YCDA 1X5DA 1TU8A 2K8SA 3QPMA 4PX1A 1M0UA 2DLXA 3PH9A 4OO4A 3HYPA 3DKSA 5GZZB 1SJ6A 1B48A 2R3XA 5L71A 1ZCPA 3EC3A 1O6JA 4X0XA 3GHAA 3ZLPA 1WPIA 4MABA 1QQ2A 2NVLA 3ZL5A 4K6XA 4XCSA 3PR8A 3IXRA 2V41A 2HRNA 4BA7A 4ECIA 4KCAA 3IDVA 3F9UA 2JL4A 4CW9A 2MMAA 1OKDA 2GLRA 3L0HA 4MJCA 3Q19A 5JWQB 1J9BA 2RLIA 4AF2A 4ECBA 3DIEA 1MDKA 4FYCA 4HQZA 2KUCA 1ON4A 2LJKA 2GQKA 1A2JA 5CO3A 1AAZA 3ZZXA 3Q6OA 1OC3A 2NPBA 5D96A 3W8SA 2CAIA 3TOTA 2DMLA 4PQHA 1EOGA 3KTLA 3A2XA 1PKWA 5A4VA 4ZILA 1WWJA 3GKMA 1B4PA 3KEBA 2L57A 1PD21 2EC4A 5ELAA 2Z9SA 3D4MA 2PN8A 3DVWA 3FR9A 3U6VA 4OCEA 4DVCA 4BPYA 4WF5A 1S3CA 1JLWA 1FB6A 2B1KA 4ZBAA 2L6CA 1JHBA 1UC7A 5KN2A 4MDCA 1GSUA 2H66A 2FWHA 5EVOA 3GKNA 4MF7A 1LJRA 3IRAA 5ECNB 3LGCA 2FGXA 1XVQA 1AC1A 3TDGA 3KTBA 3IK9A 2LSTA 3GMFA 5IIZA 2J23A 1TJDA 4AJ7A 1UVZA 4NPBA 3F3QA 4DSSA 2E0QA 2V32A 4OFTA 1Y6EA 5DDLA 2DJ3A 3EURA 3ERFA 3HD5A 4J2FA 5A5KA 5HFGA 5HR3A 1VGLA 3HXSA 2LV3A 1YEPA 2J9HA 2K18A 3KJYA 2O85A 4ML1A 1JLVA 3QFBC 5ECIB 2VCZA 2PMTA 5B8AA 4GWRA 1TRVA 1ERWA 3KH9A 3HCZA 5JCUA 3P90A 14GSA 2GDRA 4MLYA 3FEUA 19GSA 2FWFA 5KN0A 2DJKA 1GP1A 2OBIA 2AJQB 3SWLA 1BAYA 2OACA 1PX7A 5IMVA 2H75A 5F06A 3VWUA 4OFNA 1YF1A 2N5FA 3OR5A 4GXZA 4G10A 3WD6A 2M80A 1HQOA 3H4KA 2F51A 3FZ4A 2GSSA 1V9WA 2GS3A 1H75A 1R4WA 3VWXA 5HFIA 4TXOA 1U88A 2H1AA 3CSIA 2CQ9A 2EIQA 3AY8A 3P7XA 3TJJA 1A24A 4POBA 4KX4A 5INYA 4XS6A 1MD4A 1R5PA 1OVNA 1EV9A 1OC9B 3UBKA 4G9HA 3TRQA 1XXUA 1F2EA 3US3A 3VURA 4KH7A 4MPGA 5ID2B 3DYRA 3HVSA 4I6XA 1KBNA 5KN3A 1DSBA 3F63A 2MBTA 4J57E 1U3IA 3GN3A 2VD1A 2YPMA 3D6IA 4PXOA 3VI7A 2IN3A 3CYNA 3MSZA 4F0BA 4MH2A 4OCFA 1MDJA 4QL7A 1T4ZA 1GSYA 2KP1A 1W89A 5G5FA 3C1RA 1M7TA 2AV4A 1WMJA 1EV4A 2YWOA 4K0GA 1HNCA 4ZL8A 1PMTA 2DC5A 4ULXA 3HY2A 4WETA 2HYXA 3VI5A 4V1Ap 2XPDA 1R26A 3M9JA 1AQVA 2HLSA 2LQQA 3UBLA 5IPHA 1K3OA 3A2WA 1SK2A 3FZ5A 4K1FA 1KEBA 1Z6NA 1GTIA 1JZOA 3I9V2 3E0UA 2H70A 4ZB9A 3VWWA 3ISOA 5ENUA 4FYUA 1K0OA 4LL1B 1MEKA 4IHUA 2R2JA 2VLUA 3GL3A 4V2MA 4ILFA 3H79A 3FR3A 4ISDA 3ZVJD 4XS1A 1EGRA 3DRNA 4KSOA 1ZGNA 2HT9A 4XHMA 1WRYA 4MZWA 2OJLA 2B6MA 5G1KA 1PL2A 1FG4A 5B7CA 5DCGA 1MDIA 3WGEA 1NM3A 1XWBA 2WS2A 4GQCA 3IV4A 2TRCP 3KCMA 4KGIA 3F3RA 3EYTA 4JR6A 1EOHA 4QL9A 3IPZA 1YF0A 2B1LA 4NHWA 3CBUA 3GV1A 2GVPA 4MZCA 2PERA 2VD0A 5DQYA 3GSSA 1TW9A 4ZL9A 2YZUA 2DJ2A 3GTUA 5J9BA 5DCHA 4HJMA 2YWNA 5F05A 4TXVA 2BMXA 2AYTA 3RHBA 3LYKA 4PGTA 3IE3A 3HKRA 5IM9A 2H76A 3DEXA 3KMNA 2FWGA 1PX6A 1MTCA 1URMA 3HJMA 2E7PA 2YN1A 5CP1A 3EE2A 4MA9A 5J5NA 3M8NA 5CNWA 1LBKA 2DJ0A 4GF0A 4ZBBA 4ML6A 1O8XA 2FCHA 2REMA 2AB6A 2IWTA 2A2RA 5ECHB 4XS4A 2VO4A 4KDUA 2R37A 1AW9A 1JZRA 3ERWA 1QUWA 1PKZA 4TR0A 1Q98A 1X9WB 2IMIA 4MJBA 5EY6A 3NIVA 5CRDA 1AXDA 3GL5A 4OO5A 4POKA 1EEJA 1Q4JA 5DQSA 3J7Yk 4PQ1A 3E3EA 2KOKA 4YAVA 2M46A 2HXKA 4EL1A 5FT3A 4MJAA 1VF1A 1PRXA 1FOVA 3LYPA 2GZPA 5HFKA 2VCTA 4IVFA 2ZCTA 4I8BA 4F82A 3IK7A 4IQ1A 3ZIJA 2CVKA 1XIYA 3GURA 2R6KA 1XWAA 3LQ7A 2DBCA 4QQ7A 1ILOA 2JADA 1TKDB 3N5OA 5ECKB 4YQVA 1X0RA 2IMFA 3TUEA 1TK5B 4KUNA 1GTBA 1SJIA 2PU9C 4BWSA 3DMLA 1A8YA 2MMNA 1OE8A 1WJKA 2FA4A 5F8BA 3IBHA 2HFDA 1M2AA 3RBTA 5HR0A 4MF5A 1GNEA 1Z3EA 4EDZA 2F9SA 5D9WA 1DUGA 6GSUA 1M9AA 1SKSB 4HUAA 4Q5NA 2VL2A 1XW6A 2H6YA 2RUFA 1ZMAA 5IO0A 3FHKA 1XBSA 4O92A 1NHOA 1X5CA 2YANA 4MH3A 1TK8B 2GT6A 3M1GA 3FY7A 3MDKA 3QAVA 2B7KA 3RAZA 5GSSA 5AIXA 3UVTA 1Z5YE 4FH8A 2FLSA 4PUFC 3GA4A 2H1BA 2RM5A 1GSQA 3P8WA 4TW5A 2ZUPA 4L5LA 4OD7A 9GSSA 5B8BA 1GUKA 2ON5A 3GX0A 1XCCA 1GLQA 3NZNA 2N5AA 3K8NA 3UOMA 2H0GA 2GT5A 4V1Ag 4ZB8A 2RUEA 1SK1A 2IL3A 2ALBA 3GRXA 5IPGA 3CSHA 2NDOA 4NMUA 1YDKA 1E6BA 4N0ZA 2LRNA 4F2IA 2H6ZA 1G6YA 4POLA 2VM1A 3LORA 2LQOA 1IYIA 3APQA 3Q18A 4HDEA 3GYKA 3HDCA 4GQFA 1XW9A 4BVYA 1GSSA 3QFAC 1GTAA 4GSSA 2V6OA 4ACSA 1GSEA 4HQSA 5ECSA 6GSTA 4IQAA 1C72A 5GAND 4WF4A 1U6TA 3BCKA 1RQMA 1XOAA 2N5BA 3PGTA 2YWIA 3W8JA 3JCML 1MD3A 1F6MC 3QCPA 2MMOA 1TU7A 5DAKA 5F07A 4IJIA 2GTUA 1Z6MA 17GSA 2I81A 3V1WA 5E59A 2ES7A 2KLXA 2K8VA 4XRAA 3F4TA 1X9SB 2WZ9A 1O73A 5G1LA 1ZOFA 1GSFA 5D73A 6GSVA 2C0EA 4NAXA 5ECMB 1PL1A 18GSA 1SYXA 3ZVJA 1QMVA 2JZSA 4HI7A 4K8MA 3ZRDA 3F8UA 2TRXA 2O89A 1PN9A 2FA8A 3VPQA 6GSWA 5JWRB 2WDUA 5F0GA 4GSNA 8GSSA 3L78A 4OMVA 1VRSD 1HNBA 3UL3A 3UIWA 5ABRA 4JZQA 5HR1A 1GNWA 3ZFLA 2L6DA 3ZITA 4TOPA 3APSA 5EL8A 2B5EA 2XBIA 1X5EA 2CZ3A 5JCWA 1SYRA 3O6TA 1K3LA 3WT2A 1ST9A 2FWEA 3G7JA 3GH6A 2FD3A 2YV7A 5AGYA 3QMXA 1YKCA 5ID2A 3TKSA 2C3NA 5H5SA 1PQNA 4K9ZA 1RW1A 2MYGA 3GNJA 4NWYA 3RDWA 5JWOB 4JEDA 2I9HA 4GRFA 3F4RA 1Y25A 1YKAA 3RHCA 2PPTA 4XTSA 2YNXA 2V1MA 2PVQA 3ZIVA 4HOJA 1U87A 3P2AA 4J56E 3G9BA 1B8XA 1V98A 4KAEA 1ERVA 3FYGA 4X43A 4I5QA 2G2QA 2LNTA 1FAAA 2M72A 4PUAA 1FVJA 2I3YA 5IOXA 5DVBA 3C1SA 2CVDA 4KE3A 4NV2A 2E2GA 4TXOB 4AJ8A 3VLNA 5G31A 1G7EA 3BCIA 4V2LA 1ERTA 2L4QA 4TKYA 1AQWA 2GZYA 1T00A 1HNAA 2FUG2 2C8UA 5H5QA 1YJ6A 3ZMKA 3ED3A 1G6WA 2CAQA 4POMA 2C0FA 2HE3A 4BWQA 2KP2A 5A4WA 1UN2A 1H4OA 4MZBA 3GKKA 3I43A 5D9TA 1XWGA 5IMFA 11GSA 5AN1A 1A0FA 1ZZYA 1V40A 4DSQA 2VL9A 2H01A 3FW2A 3WGDA 2QKEA 3D5JA 4K0NA 4N0VA 2HNLA 1FW1A 1WP0A 4V2NA 3QD9A 1TRSA 1TTZA 3F6DA 3IA1A 2GSRA 1OAZA 1HYUA 5FHIA 2L5LA 1USBA 3J7Yb 1K0BA 1XZOA 2H8LA 4I2TA 1ML6A 4TR1B 4EDYA 3Q74A 2HZEA 4ZBDA 6GSXA 5ELGA 2BTOT 1DBYA 4AJ6A 4D73B 2VUPA 3TRPA 1TK0B 3TJFA 2OBKA 1I9DA 3TJKA 3HA9A 2PBJA 4L0WA 3LSZA 3DXBA 2MMZA 4ZB6A 4ZXGA 1OYJA 2FNOA 1VF3A 2JZRA 5D93A 4EO3A 4GLTA 3D22A 4PNGA 2H1DA 3SBCA 2B5YA 2LUSA 3GX8A 2E2MA 1S3AA 3TKSC 4EKZA 5G2ZA 4HS1A 5KN1A 3TKSE 1A23A 1U3AA 3TKPA 4RUVA 1K0CA 1EWXA 2A4VA 5IMCA 2I4AA 1GRXA 4I97A 1Z9HA 5EPFA 1NW2A 2AUVA 2VM2A 4ZL7A 2CVBA 2MZCA 4NV5A 5GAPD 2OE0A 1QGVA 1AIUA 4MJEA 3KD0A 1GL8A 3LEFA 1O85A 2O87A 1OC8A 2QC7A 3GIXA 2CA8A 1KNGA 3VPTA 3KIJA 2YJHA 2KHPA 3O3TA 4TVEA 3DWVA 2A2SA 3G7YA 5LD0A 4JR4A 1X9MB 4RQRA 4IGJA 1YY7A 2H19A 2X8GA 3HVVA 2OKAA 2EIOA 4NXIA 4ECJA 4KCEA 3FR6A 4PURA 1T3BA 5AISA 2CZ2A 2OE1A 5G30A 1W4VA 1Z7PA 4YH2A 1N8JA 2OA7A 3EU3A 1SK0A 5CRGA 4IS0A 2F8AA 4N11A 4RI6A 3L9VA 4L5OA 1SL0B 2PGTA 3G7IA 2YZHA 4KNDA 2WB9A 2NBSA 2H74A 1K0AA 1G0TA 2GQLA 5DJMA 5IMZA 1ERUA 2P0GA 1ABAA 1PA3A 4CDOA 1QFNA 2IFQB 3FK8A 3H93A 5D9VA 2JZTA 4F03A 4TN8A 1CQGA 2H0IA 4XS4B 2WFCA 1M9BA 5DALB 3ZREA 3F4SA 1K0MA 3F0IA 2YWMA 4LLRA 1S3DA 5CYYA 4IBPA 1EZKA 2IPAA 3KZQA 2X8CA 4FYBA 4EXJA 1ZYQB 3EMPA 3BOAA 1FO5A 3EWLA 1ZYEA 2LKUA 3ME8A 1XWCA 3HZ8A 4OFMA 6GSYA 4IW9A 2IIYA 1A8LA 3M3MA 2HSHA 4I2UA 1DE2A 1IYHA 3C8EA 2DSAA 2C0DA 2C0GA 3S9FA 2VIMA 4BL7A 3GFKA 4TRXA 4E8HA 4F9ZA 3H8QA 2YV9A 2DJJA 3M0FA 4MP4A 2OE3A 2WCIA 10GSA 4K2DA 4E8EA 3VWVA 3PINA 2K6VA 4JE1A 1ZL9A 2O7KA 2V2GA 4Q5RA 2GSTA 2LTKA 3A5WA 2JSZA 4LMVA 2HZFA 3GSTA 4PQIA 3U5RE 4KDXA 4KW6A 1DE1A 5IOWA 2F8FA 2B3SA 3TKQA 3VFIA 1FHEA 3M9KA 3UJ1A 1LU4A 3TJBA 2PVOC 3RPNA 4MPFA 3E9JB 4Z7XA 4K7IA 2AAWA 5B6MA 3EVIA 3UMAA 1A2MA 4ZIJA 3HZ4A 1M2BA 3MAKA 13GSA 1GUMA 5J3RA 1WE0A 2GZZA 4HZ4A 12GSA 4KSMA 1B9XC 3C7MA 1Z7RA 1SD9A 3WT1A 3QAGA 5ECPB 1HD2A 4G2EA 2LJRA 3IHQA 2P31A 3A3TA 5FWGA 1YZXA 2C80A 4PNFA 3KGKA 4HZ2A 4IELA 2GSQA 1XOBA 2LRTA 4EF0A 4G19A 4GTUA 2GGTA 3ZFBA 4DSRA 4F0CA 4IP6A 1K0DA 4XRDA 4X1UA 5CRHA 1BEDA 2IMKA 5DJLA 1SKWB 4YQMA 2CT6A 3CXGA 3APOA 1SD8A 2VOCA 5B6NA 3CTGA 1O7UA 2VCXA 1TRWA 1SL1B 3KM6A 4AGSA 1K3YA 1N2AA 3UARA 2YJ7A 3TJGA 1TI1A 1SENA 2X64A 3EU4A 1JZWA 3LFLA 2EIRA 2WGRA 3RPPA 3HVXA 2R4VA 2MBSA 2ON7A 3QAWA 3BJ5A 2C3TA 2JSYA 4GCIA 1SL2B 2XHFA 3I69A 4XIHA 1NHYA 2FY6A 4DSSB 5C04A 2VL2C 1YQ1A 3LXZA 1J08A 5AIVA 2B5XA 2H6XA 1V57A 5DAKB 1OC9A 4FIWA 1BX9A 1J0FA 1G7OA 1RK4A 3IOSA 3W6GA 2HI7A 4IKHA 5G5EA 2LRCA 3C73A 3LWAA 2P5QA 1VF4A 4IP1A 3KP8A 1AQXA 3IAM2 4LL4B 1PSQA 1EP8A 5LCZA 4FO5A 3HJOA 1TOFA 4P3YB 4EC0A 1GTUA 3IC4A 16GSA 3TRXA 2XBQA 2ZNMA 1T7PB 4HU9A 1SU9A 3L9SA 3IR4A 2IMEA 2H72A 2LEGA 4RQXA 4TR3A 4JRRA 1QXHA 5COHA 1ACVA 3CSJA 2HRFA 4ECCA 3ZMLA 1SKRB 3FZAA 1GH2A 2VLVA 5CRWA 5ECOB 5IMDA 3L9UA 4WBRD 1EP7A 4HU7A 2H30A 2B7JA 4IJ3A 4WR4A 3GKXA 1O8WA 4MMMA 2O8VB 3QOUA 4LMWA 1GLPA 2L4CA 2QSIA 1TXXA 3MWHA 3BD2A 1NSWA 3DVXA 2C4JA 1AUCA 3WYWA 1OKTA 3DGQA 1THXA 3WGXA 1JFUA 4WXTA 3LXTA 3TGZA 2X8HA 3FKFA 3F6FA 3CTFA 5ECQB 4Q5QA 1PGTA 1EEMA 1T1VA 4K7OA 1SJZA 1EGOA 5CAXA 3D4TA 3KXOA 3IAS2 20GSA 2RIIA 2FHEA 2VAFA 1GUHA 5DBQA 4YQUA 2VLTA 3I6AA 2TIRA 2QGVA 2YOIA 2GQMA 1TI3A 1BQ7A 1BYEA 4Q5FA 4TR1A 2LJAA 4MF6A 1GULA 4K7NA 2H0HA 4LA1A 2XC2A 2OADA 4D73A 1M99A 2C3QA 2JU5A 4KB3A 2PUKC 1E2YA 2PWJA 3H1NA 4N30A 2VCVA 22GSA 5JCGA 3O76A 2NTOA 2V6KA 4HJ2A 4EE0A 3L4NA 7GSSA 4YAPA 4CHSA 1OE7A 1QK8A 2D2ZA 2DMMA 4MK3A 4WBJA 5D9XA 2BJXA 3NOFA 1KTEA 1THOA 5LNKe 4EUYA 1T4YA 3D0ZA 4O32A 5KEJA 3EINA 4BVXA 1GSDA 3KMOA 3TCOA 2LNSA 3N9JA 5ECLB 1B9YC 4JU5A 1B4QA 5IO2A 1VF2A 4HEA2 5IMAA 1I5GA 2RM6A 1TRUA 1XWKA 1R5AA 3VK9A 3GH9A 1A2LA 2H73A 5CREA 1M2DA 2H71A 2CX4A 4MCUA 2LS5A 3ZYWA 3FRCA 3QR6A 3KP9A 2VCQA 1XW5A 2L59A 1F37A 2DIZA 5J41A 5ECRB 2I1UA 4N10A 4WR5A 4ID0A 2WJUA 5D8IA 5IQYA 3A2VA 3C71A 1V2AA 1FB0A 3ERGA 4O5RA 4L8EA 2CX3A 1BJXA 2VL3A 2VCWA 2X99A 3FZ9A 4RI7A 2IJYA 2HZEB 4NHZA 3QDNA 5HR2A 3HHVA 3ZTLA 2G0FA 3CMIA 1JZDA 2HSYA 2WULA 3LG6A 2L5OA 1O81A 2F3MA 3R2QA 2DJ1A 3CRTA 1XVWA 1R7HA 3D21A 1F3AA 6GSSA 3GUSA 2WRTA 2DIYA 2P5RA 4KDYA 4WKWA 3BBYA 2CV4A 2IMDA 1GWCA 2XPEA 3CRUA 3TB2A 1YEXA 5GSTA 1V58A 2H1GA 5E4WA 1T8EB 3GTUB 1TP9A 5H5RA 1XFLA 3TOUA 3TKRA 3MNGA 4DEJA 2IFQA 1UA5A 4L0UA 2AHEA 1F9MA 1K0NA 1XPVA 3KH7A 5DALA 2C1YA 4IN0A 1A0RP 4JBBA 1WOUA 4EVMA 2R5GA 3EMXA 3UVHA 4O7HA 2K9FA 4OWYA 3LJRA 1BG5A 3DD3A 3ME7A 1F3BA 1FVKA 4WEYA 3UEMA 1WIKA 1CQHA 5C00A 5A4UA 3HJPA 4GSTA 2JACA 4H86A 4TR4A 4KA0A
chains in the Genus database with same CATH superfamily
5HQPA 1TDIA 2YP6A 5J9CA 5J4UA 3UAPA 2YCDA 1X5DA 1TU8A 2K8SA 3QPMA 4PX1A 1M0UA 2DLXA 3PH9A 4OO4A 3HYPA 3DKSA 5GZZB 1SJ6A 1B48A 2R3XA 5L71A 1ZCPA 3EC3A 1O6JA 4X0XA 3GHAA 3ZLPA 1WPIA 4MABA 1QQ2A 2NVLA 3ZL5A 4K6XA 4XCSA 3PR8A 3IXRA 2V41A 2HRNA 4BA7A 4ECIA 4KCAA 3IDVA 3F9UA 2JL4A 4CW9A 2MMAA 1OKDA 2GLRA 3L0HA 4MJCA 3Q19A 5JWQB 1J9BA 2RLIA 4AF2A 4ECBA 3DIEA 1MDKA 4FYCA 4G0LA 4HQZA 2KUCA 1ON4A 2LJKA 2GQKA 1A2JA 5CO3A 1AAZA 3ZZXA 3Q6OA 1OC3A 2NPBA 5D96A 3W8SA 2CAIA 3TOTA 2DMLA 4PQHA 1EOGA 3KTLA 3A2XA 1PKWA 5A4VA 4ZILA 1WWJA 3GKMA 1B4PA 3KEBA 2L57A 1PD21 2EC4A 5ELAA 2Z9SA 3D4MA 2PN8A 3DVWA 3FR9A 3U6VA 4OCEA 4DVCA 4BPYA 4WF5A 1S3CA 1JLWA 1FB6A 2B1KA 4ZBAA 2L6CA 1JHBA 1UC7A 5KN2A 4MDCA 1GSUA 2H66A 2FWHA 5EVOA 3GKNA 4MF7A 1LJRA 3IRAA 5ECNB 3LGCA 2FGXA 1XVQA 1AC1A 3IHGA 3TDGA 3KTBA 3IK9A 2LSTA 3GMFA 5IIZA 2J23A 1TJDA 4AJ7A 1UVZA 4NPBA 3F3QA 4DSSA 2E0QA 2V32A 4OFTA 1Y6EA 5DDLA 2DJ3A 3EURA 3ERFA 2R0PA 3HD5A 4J2FA 5A5KA 5HFGA 5HR3A 1VGLA 3HXSA 2LV3A 1YEPA 2J9HA 2K18A 3KJYA 2O85A 4ML1A 1JLVA 3QFBC 5ECIB 2VCZA 2PMTA 5B8AA 4A5PA 1M3JA 4GWRA 2A4HA 1TRVA 1ERWA 3KH9A 3HCZA 5JCUA 3P90A 14GSA 2GDRA 2HRKA 4MLYA 3FEUA 19GSA 2FWFA 5KN0A 2DJKA 1GP1A 2OBIA 2AJQB 3SWLA 1BAYA 2OACA 1PX7A 5IMVA 2H75A 5F06A 3VWUA 4OFNA 3PPUA 1YF1A 2N5FA 3OR5A 4GXZA 4G10A 3WD6A 2M80A 2UZ8A 1HQOA 3H4KA 2F51A 4YKGA 3FZ4A 2GSSA 1V9WA 2GS3A 1H75A 1R4WA 3VWXA 4Z2TA 5HFIA 4TXOA 1U88A 2H1AA 3CSIA 2CQ9A 2EIQA 3AY8A 3P7XA 3TJJA 1A24A 4POBA 4KX4A 5INYA 4XS6A 1MD4A 1R5PA 1OVNA 1EV9A 1OC9B 3UBKA 4G9HA 3TRQA 1XXUA 1F2EA 3US3A 3VURA 4EIPA 4KH7A 4MPGA 5ID2B 3DYRA 3HVSA 4I6XA 1KBNA 2HSMA 5KN3A 1DSBA 3F63A 2MBTA 4J57E 1U3IA 3GN3A 2VD1A 2YPMA 3D6IA 4PXOA 3VI7A 2IN3A 3CYNA 3MSZA 4F0BA 4MH2A 4OCFA 1MDJA 4QL7A 1T4ZA 1GSYA 2KP1A 1W89A 5G5FA 3C1RA 4Z2RA 1M7TA 2AV4A 1WMJA 1EV4A 2YWOA 4K0GA 1HNCA 4ZL8A 1PMTA 2DC5A 4ULXA 3HY2A 4WETA 2HYXA 3VI5A 4V1Ap 2XPDA 1R26A 3M9JA 1AQVA 2HLSA 2LQQA 3UBLA 5IPHA 1K3OA 3A2WA 1SK2A 3FZ5A 4K1FA 1KEBA 1Z6NA 1GTIA 1JZOA 3I9V2 3E0UA 2H70A 4ZB9A 3VWWA 3ISOA 5ENUA 4FYUA 1K0OA 4LL1B 1MEKA 4IHUA 2R2JA 2VLUA 3GL3A 4V2MA 4ILFA 3H79A 3FR3A 4ISDA 3ZVJD 4XS1A 1EGRA 3DRNA 4KSOA 1ZGNA 2HT9A 4XHMA 4FQUA 1WRYA 4MZWA 2OJLA 2B6MA 5G1KA 1PL2A 1FG4A 5B7CA 5DCGA 1MDIA 3WGEA 1NM3A 1XWBA 2WS2A 4GQCA 3IV4A 2TRCP 3KCMA 4KGIA 3F3RA 3EYTA 4JR6A 1EOHA 4QL9A 3IPZA 1YF0A 2B1LA 4NHWA 3CBUA 3GV1A 2GVPA 4MZCA 2PERA 2VD0A 5DQYA 3GSSA 1TW9A 4ZL9A 2YZUA 2DJ2A 3GTUA 5J9BA 5DCHA 4HJMA 2YWNA 5F05A 4TXVA 2BMXA 2AYTA 3RHBA 3LYKA 4PGTA 3IE3A 3HKRA 5IM9A 2H76A 3DEXA 4X4JA 3KMNA 2FWGA 1PX6A 1MTCA 1URMA 3HJMA 2E7PA 2YN1A 5CP1A 3EE2A 4MA9A 5J5NA 3M8NA 4CY6A 5CNWA 1LBKA 2DJ0A 4GF0A 4ZBBA 4ML6A 1O8XA 2FCHA 2REMA 2AB6A 2IWTA 2A2RA 5ECHB 4XS4A 2VO4A 4KDUA 2R37A 1AW9A 5BMUA 1S3RA 1JZRA 3ERWA 1QUWA 1PKZA 4K2XA 4TR0A 1Q98A 1X9WB 2HRAA 2IMIA 4MJBA 5EY6A 3NIVA 5CRDA 1AXDA 3GL5A 4OO5A 4POKA 1EEJA 1Q4JA 5DQSA 3J7Yk 4PQ1A 3E3EA 2KOKA 4YAVA 2M46A 2HXKA 4EL1A 5FT3A 4MJAA 1VF1A 1PRXA 1FOVA 3LYPA 2GZPA 5HFKA 2VCTA 4IVFA 2ZCTA 4I8BA 4F82A 3IK7A 4IQ1A 3ZIJA 2CVKA 1XIYA 3GURA 2R6KA 1XWAA 3LQ7A 2DBCA 4QQ7A 1ILOA 2JADA 1TKDB 3N5OA 5ECKB 4YQVA 1X0RA 2IMFA 3TUEA 1TK5B 4KUNA 1GTBA 1SJIA 2PU9C 4BWSA 3DMLA 1A8YA 2MMNA 1OE8A 1WJKA 2FA4A 5F8BA 3IBHA 2HFDA 1M2AA 3RBTA 5HR0A 4MF5A 1GNEA 1Z3EA 4EDZA 2F9SA 5D9WA 1XG8A 1DUGA 6GSUA 1M9AA 1SKSB 4HUAA 4Q5NA 2VL2A 1XW6A 2H6YA 2RUFA 1ZMAA 5IO0A 3FHKA 1XBSA 3HVNA 1NHOA 4O92A 1X5CA 2YANA 4MH3A 1TK8B 2GT6A 3M1GA 3FY7A 3MDKA 3QAVA 2B7KA 3RAZA 5GSSA 5AIXA 3UVTA 1Z5YE 4FH8A 2FLSA 4PUFC 2R0GA 3GA4A 2H1BA 2RM5A 1GSQA 3P8WA 4TW5A 2ZUPA 4L5LA 4K5SA 2X4AA 4OD7A 9GSSA 5B8BA 3IC8A 1GUKA 2ON5A 3GX0A 1XCCA 3EPTA 1GLQA 4USSA 3NZNA 2N5AA 3K8NA 3UOMA 2H0GA 2GT5A 4V1Ag 4ZB8A 2RUEA 1SK1A 2IL3A 2ALBA 3GRXA 5IPGA 3CSHA 2NDOA 4NMUA 1YDKA 1E6BA 4N0ZA 2LRNA 4F2IA 2H6ZA 1G6YA 4BL7B 4POLA 2VM1A 3LORA 2LQOA 1IYIA 3APQA 3Q18A 4HDEA 3GYKA 3HDCA 4GQFA 4KF9A 1XW9A 4BVYA 1GSSA 3QFAC 1GTAA 4GSSA 2V6OA 4ACSA 4MNNA 1GSEA 4HQSA 5ECSA 6GSTA 4IQAA 1C72A 5GAND 4WF4A 1U6TA 3BCKA 1RQMA 1XOAA 2N5BA 3PGTA 2YWIA 4G0IA 3W8JA 3JCML 1MD3A 1F6MC 3QCPA 2MMOA 1TU7A 5DAKA 5F07A 4IJIA 2GTUA 1Z6MA 17GSA 2I81A 3V1WA 5E59A 2ES7A 2KLXA 2K8VA 4XRAA 3F4TA 1X9SB 2WZ9A 1O73A 5G1LA 1ZOFA 1GSFA 5D73A 6GSVA 2C0EA 4NAXA 5ECMB 1PL1A 18GSA 1SYXA 3ZVJA 1QMVA 2JZSA 4HI7A 4K8MA 3ZRDA 3F8UA 2TRXA 2O89A 1PN9A 2FA8A 3VPQA 6GSWA 5JWRB 2WDUA 5F0GA 4GSNA 8GSSA 3L78A 4OMVA 1VRSD 1HNBA 3UL3A 3UIWA 5ABRA 4JZQA 5HR1A 1GNWA 3ZFLA 2L6DA 3ZITA 4TOPA 3APSA 5EL8A 2B5EA 2XBIA 1X5EA 2CZ3A 5JCWA 1SYRA 3O6TA 1K3LA 3WT2A 2A2PA 1ST9A 2FWEA 3G7JA 3GH6A 2FD3A 2YV7A 5AGYA 3QMXA 1YKCA 5ID2A 3TKSA 2C3NA 5H5SA 1PQNA 4K9ZA 1RW1A 2MYGA 3GNJA 4O5UA 4NWYA 3RDWA 5JWOB 4JEDA 2I9HA 4GRFA 3F4RA 1Y25A 1YKAA 3RHCA 2PPTA 4XTSA 2YNXA 2V1MA 2PVQA 3ZIVA 4HOJA 1U87A 3P2AA 4J56E 3G9BA 1B8XA 1V98A 4KAEA 1ERVA 3FYGA 4X43A 1M3IA 4I5QA 2G2QA 2LNTA 3A5IA 1FAAA 2M72A 1ZYNA 4PUAA 2DKIA 1FVJA 2I3YA 5IOXA 5DVBA 3C1SA 2CVDA 3FMWA 4KE3A 4NV2A 2E2GA 4TXOB 4AJ8A 3VLNA 5G31A 1G7EA 3BCIA 4V2LA 1ERTA 2L4QA 4TKYA 1AQWA 2GZYA 1T00A 1HNAA 2FUG2 2C8UA 5H5QA 1YJ6A 3ZMKA 3ED3A 1G6WA 2CAQA 2DKHA 4POMA 2C0FA 4BIKA 2HE3A 4BWQA 2KP2A 5KOWA 5A4WA 1UN2A 1H4OA 4MZBA 3GKKA 3I43A 5D9TA 1XWGA 5IMFA 11GSA 5AN1A 1A0FA 1ZZYA 1V40A 2QA2A 4DSQA 2VL9A 2H01A 3FW2A 3WGDA 2QKEA 4O5QA 3D5JA 4K0NA 4N0VA 2HNLA 1FW1A 1WP0A 4V2NA 3QD9A 1TRSA 1TTZA 3F6DA 3IA1A 2GSRA 1OAZA 1HYUA 5FHIA 2L5LA 1USBA 3J7Yb 1K0BA 1XZOA 2H8LA 4I2TA 1ML6A 4TR1B 4EDYA 3Q74A 2HZEA 4ZBDA 6GSXA 5ELGA 2BTOT 1DBYA 4AJ6A 4D73B 2VUPA 3TRPA 1TK0B 3TJFA 2OBKA 1I9DA 3TJKA 3HA9A 2PBJA 4L0WA 3LSZA 3DXBA 2MMZA 4ZB6A 4ZXGA 1OYJA 2FNOA 1VF3A 2JZRA 5D93A 4EO3A 4GLTA 3D22A 4PNGA 2H1DA 3SBCA 2B5YA 2LUSA 3GX8A 2E2MA 1S3AA 3TKSC 4EKZA 4G0KA 5G2ZA 4HS1A 5KN1A 3TKSE 1A23A 1U3AA 3TKPA 4RUVA 1K0CA 1EWXA 2A4VA 5IMCA 4BVXB 2I4AA 1GRXA 4I97A 1Z9HA 5EPFA 1NW2A 2AUVA 2VM2A 4ZL7A 2CVBA 2MZCA 4NV5A 5GAPD 2OE0A 1QGVA 1AIUA 4MJEA 3KD0A 1GL8A 3LEFA 1FOHA 1O85A 2O87A 1OC8A 2QC7A 3GIXA 2CA8A 1KNGA 3VPTA 3KIJA 2YJHA 2KHPA 3O3TA 4TVEA 3DWVA 2A2SA 3G7YA 5LD0A 4JR4A 1X9MB 4RQRA 4IGJA 1YY7A 2H19A 2X8GA 3HVVA 2OKAA 2EIOA 4NXIA 4ECJA 4KCEA 3FR6A 4CY8A 5BRTA 4PURA 1T3BA 5AISA 2CZ2A 2OE1A 5G30A 1W4VA 1Z7PA 4YH2A 1N8JA 2OA7A 3EU3A 1SK0A 5CRGA 4IS0A 2F8AA 4N11A 4RI6A 3L9VA 4L5OA 1SL0B 2PGTA 3G7IA 2YZHA 4KNDA 2WB9A 2NBSA 2H74A 1K0AA 1G0TA 2GQLA 5DJMA 5IMZA 1ERUA 2P0GA 1ABAA 1PA3A 4CDOA 1QFNA 3LW9A 2IFQB 3FK8A 3H93A 5D9VA 2JZTA 4F03A 4TN8A 1CQGA 2H0IA 4XS4B 2WFCA 1M9BA 5DALB 3ZREA 3F4SA 1K0MA 3F0IA 2YWMA 4LLRA 1S3DA 5CYYA 4IBPA 1EZKA 2IPAA 3KZQA 2X8CA 4FYBA 4EXJA 1ZYQB 4PTSA 3EMPA 3BOAA 1FO5A 3EWLA 1ZYEA 2LKUA 3ME8A 1XWCA 3HZ8A 4OFMA 6GSYA 4IW9A 2IIYA 1A8LA 3M3MA 2HSHA 4I2UA 1DE2A 1IYHA 3C8EA 2DSAA 2C0DA 2C0GA 3S9FA 2VIMA 4BL7A 3GFKA 4TRXA 4E8HA 4F9ZA 3H8QA 2YV9A 2DJJA 3M0FA 4MP4A 2OE3A 2WCIA 10GSA 4K2DA 1PN0A 4E8EA 3VWVA 3PINA 2K6VA 4JE1A 1ZL9A 2O7KA 2V2GA 4Q5RA 2GSTA 2LTKA 3A5WA 2JSZA 4LMVA 2HZFA 3GSTA 4PQIA 3U5RE 4KDXA 4KW6A 1DE1A 5IOWA 2F8FA 2B3SA 3TKQA 3MYDA 3VFIA 1FHEA 3M9KA 3UJ1A 1LU4A 3TJBA 2PVOC 3RPNA 4MPFA 3E9JB 4Z7XA 4K7IA 2AAWA 5B6MA 3EVIA 3UMAA 1A2MA 4ZIJA 3HZ4A 1M2BA 3MAKA 13GSA 1GUMA 5J3RA 1WE0A 2GZZA 1ZYPA 4HZ4A 12GSA 4KSMA 1B9XC 3C7MA 1Z7RA 3MIXA 1SD9A 3WT1A 3QAGA 5ECPB 1HD2A 4G2EA 2LJRA 3IHQA 2P31A 3A3TA 5FWGA 1YZXA 2C80A 4PNFA 3KGKA 4HZ2A 4IELA 2GSQA 1XOBA 1PFOA 2LRTA 4EF0A 4G19A 4GTUA 2GGTA 3ZFBA 4DSRA 4F0CA 4IP6A 1K0DA 4XRDA 4X1UA 5CRHA 1BEDA 2IMKA 5DJLA 1SKWB 4YQMA 2CT6A 3CXGA 3APOA 1SD8A 2VOCA 5B6NA 3CTGA 1O7UA 2VCXA 1TRWA 1SL1B 4BVYB 3KM6A 4AGSA 1K3YA 1N2AA 3UARA 2YJ7A 3TJGA 1TI1A 1SENA 2X64A 3EU4A 1JZWA 3LFLA 2EIRA 2WGRA 3RPPA 3HVXA 2R4VA 2MBSA 2ON7A 3QAWA 3BJ5A 2C3TA 2JSYA 4GCIA 1SL2B 2XHFA 3I69A 4XIHA 1NHYA 2FY6A 4DSSB 5C04A 2VL2C 1YQ1A 3LXZA 1J08A 5AIVA 2B5XA 2H6XA 1V57A 5DAKB 1OC9A 4FIWA 1BX9A 1J0FA 1G7OA 1RK4A 3IOSA 3W6GA 2HI7A 4IKHA 5G5EA 2LRCA 3C73A 3LWAA 2P5QA 1VF4A 4IP1A 3KP8A 1AQXA 3IAM2 4LL4B 1PSQA 1EP8A 5LCZA 4FO5A 3HJOA 1TOFA 4P3YB 4EC0A 1GTUA 3IC4A 16GSA 3TRXA 2XBQA 2ZNMA 1T7PB 4HU9A 1SU9A 3L9SA 3IR4A 2IMEA 2H72A 2LEGA 4RQXA 4TR3A 4JRRA 1QXHA 5COHA 1ACVA 3CSJA 2HRFA 4ECCA 3ZMLA 1SKRB 3FZAA 1GH2A 2VLVA 5CRWA 5ECOB 5IMDA 3L9UA 4WBRD 1EP7A 4HU7A 2H30A 2B7JA 4IJ3A 4WR4A 3GKXA 1O8WA 4MMMA 2O8VB 3QOUA 4LMWA 1GLPA 2L4CA 2QSIA 1TXXA 3MWHA 3BD2A 1NSWA 3DVXA 2C4JA 1AUCA 3WYWA 1OKTA 3DGQA 1THXA 3WGXA 1JFUA 4WXTA 3LXTA 4EIQA 3TGZA 2X8HA 3FKFA 3F6FA 3CTFA 5ECQB 4Q5QA 1PGTA 1EEMA 1T1VA 4K7OA 1SJZA 1EGOA 5CAXA 3D4TA 3KXOA 3IAS2 20GSA 2RIIA 2FHEA 2VAFA 1GUHA 5DBQA 4YQUA 2VLTA 3I6AA 2TIRA 2QGVA 2YOIA 2GQMA 1TI3A 1BQ7A 1BYEA 4Q5FA 4TR1A 2LJAA 4MF6A 1GULA 4K7NA 2H0HA 4LA1A 2XC2A 2OADA 4D73A 2R0CA 1M99A 2C3QA 2JU5A 4Z2UA 4KB3A 2PUKC 1E2YA 2PWJA 3H1NA 4N30A 2VCVA 3R3EA 22GSA 5JCGA 3O76A 2NTOA 2V6KA 4HJ2A 4EE0A 3L4NA 7GSSA 4YAPA 4CHSA 1OE7A 1QK8A 2D2ZA 2DMMA 4MK3A 4WBJA 5D9XA 2BJXA 3NOFA 1KTEA 1THOA 5LNKe 4EUYA 1T4YA 3D0ZA 4O32A 5KEJA 3EINA 4BVXA 1GSDA 3KMOA 3TCOA 2LNSA 3N9JA 5ECLB 1B9YC 4JU5A 1B4QA 5IO2A 1VF2A 4HEA2 5IMAA 1I5GA 2RM6A 1TRUA 1XWKA 1R5AA 3VK9A 3GH9A 1A2LA 2H73A 5CREA 2QA1A 1M2DA 2H71A 2CX4A 4MCUA 2LS5A 3ZYWA 3FRCA 3QR6A 3KP9A 2VCQA 1XW5A 2L59A 1F37A 2DIZA 3CQFA 5J41A 5ECRB 2I1UA 4N10A 4WR5A 2X49A 4ID0A 2WJUA 5D8IA 5IQYA 3A2VA 3C71A 1V2AA 1FB0A 3ERGA 4O5RA 4L8EA 2CX3A 1BJXA 2VL3A 2VCWA 2X99A 3FZ9A 4RI7A 2IJYA 2HZEB 4NHZA 3QDNA 5HR2A 3HHVA 3ZTLA 2G0FA 3CMIA 1JZDA 2HSYA 2WULA 3LG6A 4HSCX 2L5OA 1O81A 2F3MA 3R2QA 2DJ1A 3CRTA 1XVWA 1R7HA 3D21A 1F3AA 6GSSA 3GUSA 2WRTA 2DIYA 2P5RA 4KDYA 4WKWA 4YKFA 3BBYA 2CV4A 2IMDA 1GWCA 2XPEA 3CRUA 3TB2A 1YEXA 5GSTA 1V58A 2H1GA 5E4WA 1T8EB 3GTUB 1TP9A 5H5RA 1XFLA 3TOUA 3TKRA 3MNGA 4DEJA 4K5RA 2IFQA 1UA5A 4L0UA 2AHEA 1F9MA 1K0NA 1XPVA 3KH7A 5DALA 2C1YA 4IN0A 1A0RP 4JBBA 1WOUA 4EVMA 2R5GA 3EMXA 3UVHA 4O7HA 2K9FA 4OWYA 3LJRA 1BG5A 3DD3A 3ME7A 1F3BA 5KOXA 1FVKA 4WEYA 3UEMA 1WIKA 4ICYA 1CQHA 5C00A 5A4UA 3HJPA 4GSTA 2JACA 4H86A 4TR4A 4KA0A
chains in the Genus database with same CATH topology
5HQPA 1TDIA 2YP6A 5J9CA 5J4UA 3UAPA 2YCDA 1X5DA 1TU8A 2K8SA 3QPMA 4PX1A 1M0UA 2DLXA 3PH9A 4OO4A 3HYPA 3DKSA 5GZZB 1SJ6A 1B48A 2R3XA 5L71A 1ZCPA 3EC3A 1O6JA 4X0XA 3GHAA 3ZLPA 1WPIA 4MABA 1QQ2A 2NVLA 3ZL5A 4K6XA 4XCSA 3PR8A 3IXRA 2V41A 2HRNA 4BA7A 4ECIA 4KCAA 3IDVA 3F9UA 2JL4A 4CW9A 2MMAA 1OKDA 2GLRA 3L0HA 4MJCA 3Q19A 5JWQB 1J9BA 2RLIA 4AF2A 4ECBA 3DIEA 1MDKA 4FYCA 4G0LA 4HQZA 2KUCA 1ON4A 2LJKA 2GQKA 1A2JA 5CO3A 1AAZA 3ZZXA 3Q6OA 1OC3A 2NPBA 5D96A 3W8SA 2CAIA 3TOTA 2DMLA 4PQHA 1EOGA 3KTLA 3A2XA 1PKWA 5A4VA 4ZILA 1WWJA 3GKMA 1B4PA 3KEBA 2L57A 1PD21 2EC4A 5ELAA 2Z9SA 3D4MA 2PN8A 3DVWA 3FR9A 3U6VA 4OCEA 4DVCA 4BPYA 4WF5A 1S3CA 1JLWA 1FB6A 2B1KA 4ZBAA 2L6CA 1JHBA 1UC7A 5KN2A 4MDCA 1GSUA 2H66A 2FWHA 5EVOA 3GKNA 4MF7A 1LJRA 3IRAA 5ECNB 3LGCA 2FGXA 1XVQA 1AC1A 3IHGA 3TDGA 3KTBA 3IK9A 2LSTA 3GMFA 5IIZA 2J23A 1TJDA 4AJ7A 1UVZA 4NPBA 3F3QA 4DSSA 2E0QA 2V32A 4OFTA 1Y6EA 5DDLA 2DJ3A 3EURA 3ERFA 2R0PA 3HD5A 4J2FA 5A5KA 5HFGA 5HR3A 1VGLA 3HXSA 2LV3A 1YEPA 2J9HA 2K18A 3KJYA 2O85A 4ML1A 1JLVA 3QFBC 5ECIB 2VCZA 2PMTA 5B8AA 4A5PA 4GWRA 2A4HA 1TRVA 1ERWA 3KH9A 3HCZA 5JCUA 3P90A 14GSA 2GDRA 2HRKA 4MLYA 3FEUA 19GSA 2FWFA 5KN0A 2DJKA 1GP1A 2OBIA 2AJQB 3SWLA 1BAYA 2OACA 1PX7A 5IMVA 2H75A 5F06A 3VWUA 4OFNA 3PPUA 1YF1A 2N5FA 3OR5A 4GXZA 4G10A 3WD6A 2M80A 2UZ8A 1HQOA 3H4KA 2F51A 4YKGA 3FZ4A 2GSSA 1V9WA 2GS3A 1H75A 1R4WA 3VWXA 4Z2TA 5HFIA 4TXOA 1U88A 2H1AA 3CSIA 2CQ9A 2EIQA 3AY8A 3P7XA 3TJJA 1A24A 4POBA 4KX4A 5INYA 4XS6A 1MD4A 1R5PA 1OVNA 1EV9A 1OC9B 3UBKA 4G9HA 3TRQA 1XXUA 1F2EA 3US3A 3VURA 4EIPA 4KH7A 4MPGA 5ID2B 3DYRA 3HVSA 4I6XA 1KBNA 2HSMA 5KN3A 1DSBA 3F63A 2MBTA 4J57E 1U3IA 3GN3A 2VD1A 2YPMA 3D6IA 4PXOA 3VI7A 2IN3A 3CYNA 3MSZA 4F0BA 4MH2A 4OCFA 1MDJA 4QL7A 1T4ZA 1GSYA 2KP1A 1W89A 5G5FA 3C1RA 4Z2RA 1M7TA 2AV4A 1WMJA 1EV4A 2YWOA 4K0GA 1HNCA 4ZL8A 1PMTA 2DC5A 4ULXA 3HY2A 4WETA 2HYXA 3VI5A 4V1Ap 2XPDA 1R26A 3M9JA 1AQVA 2HLSA 2LQQA 3UBLA 5IPHA 1K3OA 3A2WA 1SK2A 3FZ5A 4K1FA 1KEBA 1Z6NA 1GTIA 1JZOA 3I9V2 3E0UA 2H70A 4ZB9A 3VWWA 3ISOA 5ENUA 4FYUA 1K0OA 4LL1B 1MEKA 4IHUA 2R2JA 2VLUA 3GL3A 4V2MA 4ILFA 3H79A 3FR3A 4ISDA 3ZVJD 4XS1A 1EGRA 3DRNA 4KSOA 1ZGNA 2HT9A 4XHMA 4FQUA 1WRYA 4MZWA 2OJLA 2B6MA 5G1KA 1PL2A 1FG4A 5B7CA 5DCGA 1MDIA 3WGEA 1NM3A 1XWBA 2WS2A 4GQCA 3IV4A 2TRCP 3KCMA 4KGIA 3F3RA 3EYTA 4JR6A 1EOHA 4QL9A 3IPZA 1YF0A 2B1LA 4NHWA 3CBUA 3GV1A 2GVPA 4MZCA 2PERA 2VD0A 5DQYA 3GSSA 1TW9A 4ZL9A 2YZUA 2DJ2A 3GTUA 5J9BA 5DCHA 4HJMA 2YWNA 5F05A 4TXVA 2BMXA 2AYTA 3RHBA 3LYKA 4PGTA 3IE3A 3HKRA 5IM9A 2H76A 3DEXA 4X4JA 3KMNA 2FWGA 1PX6A 1MTCA 1URMA 3HJMA 2E7PA 2YN1A 5CP1A 3EE2A 4MA9A 5J5NA 3M8NA 4CY6A 5CNWA 1LBKA 2DJ0A 4GF0A 4ZBBA 4ML6A 1O8XA 2FCHA 2REMA 2AB6A 2IWTA 2A2RA 5ECHB 4XS4A 2VO4A 4KDUA 2R37A 1AW9A 5BMUA 1JZRA 3ERWA 1QUWA 1PKZA 4K2XA 4TR0A 1Q98A 1X9WB 2HRAA 2IMIA 4MJBA 5EY6A 3NIVA 5CRDA 1AXDA 3GL5A 4OO5A 4POKA 1EEJA 1Q4JA 5DQSA 3J7Yk 4PQ1A 3E3EA 2KOKA 4YAVA 2M46A 2HXKA 4EL1A 5FT3A 4MJAA 1VF1A 1PRXA 1FOVA 3LYPA 2GZPA 5HFKA 2VCTA 4IVFA 2ZCTA 4I8BA 4F82A 3IK7A 4IQ1A 3ZIJA 2CVKA 1XIYA 3GURA 2R6KA 1XWAA 3LQ7A 2DBCA 4QQ7A 1ILOA 2JADA 1TKDB 3N5OA 5ECKB 4YQVA 1X0RA 2IMFA 3TUEA 1TK5B 4KUNA 1GTBA 1SJIA 2PU9C 4BWSA 3DMLA 1A8YA 2MMNA 1OE8A 1WJKA 2FA4A 5F8BA 3IBHA 2HFDA 1M2AA 3RBTA 5HR0A 4MF5A 1GNEA 1Z3EA 4EDZA 2F9SA 5D9WA 1DUGA 6GSUA 1M9AA 1SKSB 4HUAA 4Q5NA 2VL2A 1XW6A 2H6YA 2RUFA 1ZMAA 5IO0A 3FHKA 1XBSA 4O92A 1NHOA 1X5CA 2YANA 4MH3A 1TK8B 2GT6A 3M1GA 3FY7A 3MDKA 3QAVA 2B7KA 3RAZA 5GSSA 5AIXA 3UVTA 1Z5YE 4FH8A 2FLSA 4PUFC 2R0GA 3GA4A 2H1BA 2RM5A 1GSQA 3P8WA 4TW5A 2ZUPA 4L5LA 4K5SA 2X4AA 4OD7A 9GSSA 5B8BA 3IC8A 1GUKA 2ON5A 3GX0A 1XCCA 3EPTA 1GLQA 4USSA 3NZNA 2N5AA 3K8NA 3UOMA 2H0GA 2GT5A 4V1Ag 4ZB8A 2RUEA 1SK1A 2IL3A 2ALBA 3GRXA 5IPGA 3CSHA 2NDOA 4NMUA 1YDKA 1E6BA 4N0ZA 2LRNA 4F2IA 2H6ZA 1G6YA 4BL7B 4POLA 2VM1A 3LORA 2LQOA 1IYIA 3APQA 3Q18A 4HDEA 3GYKA 3HDCA 4GQFA 4KF9A 1XW9A 4BVYA 1GSSA 3QFAC 1GTAA 4GSSA 2V6OA 4ACSA 4MNNA 1GSEA 4HQSA 5ECSA 6GSTA 4IQAA 1C72A 5GAND 4WF4A 1U6TA 3BCKA 1RQMA 1XOAA 2N5BA 3PGTA 2YWIA 4G0IA 3W8JA 3JCML 1MD3A 1F6MC 3QCPA 2MMOA 1TU7A 5DAKA 5F07A 4IJIA 2GTUA 1Z6MA 17GSA 2I81A 3V1WA 5E59A 2ES7A 2KLXA 2K8VA 4XRAA 3F4TA 1X9SB 2WZ9A 1O73A 5G1LA 1ZOFA 1GSFA 5D73A 6GSVA 2C0EA 4NAXA 5ECMB 1PL1A 18GSA 1SYXA 3ZVJA 1QMVA 2JZSA 4HI7A 4K8MA 3ZRDA 3F8UA 2TRXA 2O89A 1PN9A 2FA8A 3VPQA 6GSWA 5JWRB 2WDUA 5F0GA 4GSNA 8GSSA 3L78A 4OMVA 1VRSD 1HNBA 3UL3A 3UIWA 5ABRA 4JZQA 5HR1A 1GNWA 3ZFLA 2L6DA 3ZITA 4TOPA 3APSA 5EL8A 2B5EA 2XBIA 1X5EA 2CZ3A 5JCWA 1SYRA 3O6TA 1K3LA 3WT2A 2A2PA 1ST9A 2FWEA 3G7JA 3GH6A 2FD3A 2YV7A 5AGYA 3QMXA 1YKCA 5ID2A 3TKSA 2C3NA 5H5SA 1PQNA 4K9ZA 1RW1A 2MYGA 3GNJA 4O5UA 4NWYA 3RDWA 5JWOB 4JEDA 2I9HA 4GRFA 3F4RA 1Y25A 1YKAA 3RHCA 2PPTA 4XTSA 2YNXA 2V1MA 2PVQA 3ZIVA 4HOJA 1U87A 3P2AA 4J56E 3G9BA 1B8XA 1V98A 4KAEA 1ERVA 3FYGA 4X43A 4I5QA 2G2QA 2LNTA 3A5IA 1FAAA 2M72A 1ZYNA 4PUAA 2DKIA 1FVJA 2I3YA 5IOXA 5DVBA 3C1SA 2CVDA 3FMWA 4KE3A 4NV2A 2E2GA 4TXOB 4AJ8A 3VLNA 5G31A 1G7EA 3BCIA 4V2LA 1ERTA 2L4QA 4TKYA 1AQWA 2GZYA 1T00A 1HNAA 2FUG2 2C8UA 5H5QA 1YJ6A 3ZMKA 3ED3A 1G6WA 2CAQA 2DKHA 4POMA 2C0FA 2HE3A 4BWQA 2KP2A 5KOWA 5A4WA 1UN2A 1H4OA 4MZBA 3GKKA 3I43A 5D9TA 1XWGA 5IMFA 11GSA 5AN1A 1A0FA 1ZZYA 1V40A 2QA2A 4DSQA 2VL9A 2H01A 3FW2A 3WGDA 2QKEA 4O5QA 3D5JA 4K0NA 4N0VA 2HNLA 1FW1A 1WP0A 4V2NA 3QD9A 1TRSA 1TTZA 3F6DA 3IA1A 2GSRA 1OAZA 1HYUA 5FHIA 2L5LA 1USBA 3J7Yb 1K0BA 1XZOA 2H8LA 4I2TA 1ML6A 4TR1B 4EDYA 3Q74A 2HZEA 4ZBDA 6GSXA 5ELGA 2BTOT 1DBYA 4AJ6A 4D73B 2VUPA 3TRPA 1TK0B 3TJFA 2OBKA 1I9DA 3TJKA 3HA9A 2PBJA 4L0WA 3LSZA 3DXBA 2MMZA 4ZB6A 4ZXGA 1OYJA 2FNOA 1VF3A 2JZRA 5D93A 4EO3A 4GLTA 3D22A 4PNGA 2H1DA 3SBCA 2B5YA 2LUSA 3GX8A 2E2MA 1S3AA 3TKSC 4EKZA 4G0KA 5G2ZA 4HS1A 5KN1A 3TKSE 1A23A 1U3AA 3TKPA 4RUVA 1K0CA 1EWXA 2A4VA 5IMCA 4BVXB 2I4AA 1GRXA 4I97A 1Z9HA 5EPFA 1NW2A 2AUVA 2VM2A 4ZL7A 2CVBA 2MZCA 4NV5A 5GAPD 2OE0A 1QGVA 1AIUA 4MJEA 3KD0A 1GL8A 3LEFA 1FOHA 1O85A 2O87A 1OC8A 2QC7A 3GIXA 2CA8A 1KNGA 3VPTA 3KIJA 2YJHA 2KHPA 3O3TA 4TVEA 3DWVA 2A2SA 3G7YA 5LD0A 4JR4A 1X9MB 4RQRA 4IGJA 1YY7A 2H19A 2X8GA 3HVVA 2OKAA 2EIOA 4NXIA 4ECJA 4KCEA 3FR6A 4CY8A 5BRTA 4PURA 1T3BA 5AISA 2CZ2A 2OE1A 5G30A 1W4VA 1Z7PA 4YH2A 1N8JA 2OA7A 3EU3A 1SK0A 5CRGA 4IS0A 2F8AA 4N11A 4RI6A 3L9VA 4L5OA 1SL0B 2PGTA 3G7IA 2YZHA 4KNDA 2WB9A 2NBSA 2H74A 1K0AA 1G0TA 2GQLA 5DJMA 5IMZA 1ERUA 2P0GA 1ABAA 1PA3A 4CDOA 1QFNA 3LW9A 2IFQB 3FK8A 3H93A 5D9VA 2JZTA 4F03A 4TN8A 1CQGA 2H0IA 4XS4B 2WFCA 1M9BA 5DALB 3ZREA 3F4SA 1K0MA 3F0IA 2YWMA 4LLRA 1S3DA 5CYYA 4IBPA 1EZKA 2IPAA 3KZQA 2X8CA 4FYBA 4EXJA 1ZYQB 4PTSA 3EMPA 3BOAA 1FO5A 3EWLA 1ZYEA 2LKUA 3ME8A 1XWCA 3HZ8A 4OFMA 6GSYA 4IW9A 2IIYA 1A8LA 3M3MA 2HSHA 4I2UA 1DE2A 1IYHA 3C8EA 2DSAA 2C0DA 2C0GA 3S9FA 2VIMA 4BL7A 3GFKA 4TRXA 4E8HA 4F9ZA 3H8QA 2YV9A 2DJJA 3M0FA 4MP4A 2OE3A 2WCIA 10GSA 4K2DA 1PN0A 4E8EA 3VWVA 3PINA 2K6VA 4JE1A 1ZL9A 2O7KA 2V2GA 4Q5RA 2GSTA 2LTKA 3A5WA 2JSZA 4LMVA 2HZFA 3GSTA 4PQIA 3U5RE 4KDXA 4KW6A 1DE1A 5IOWA 2F8FA 2B3SA 3TKQA 3MYDA 3VFIA 1FHEA 3M9KA 3UJ1A 1LU4A 3TJBA 2PVOC 3RPNA 4MPFA 3E9JB 4Z7XA 4K7IA 2AAWA 5B6MA 3EVIA 3UMAA 1A2MA 4ZIJA 3HZ4A 1M2BA 3MAKA 13GSA 1GUMA 5J3RA 1WE0A 2GZZA 1ZYPA 4HZ4A 12GSA 4KSMA 1B9XC 3C7MA 1Z7RA 3MIXA 1SD9A 3WT1A 3QAGA 5ECPB 1HD2A 4G2EA 2LJRA 3IHQA 2P31A 3A3TA 5FWGA 1YZXA 2C80A 4PNFA 3KGKA 4HZ2A 4IELA 2GSQA 1XOBA 2LRTA 4EF0A 4G19A 4GTUA 2GGTA 3ZFBA 4DSRA 4F0CA 4IP6A 1K0DA 4XRDA 4X1UA 5CRHA 1BEDA 2IMKA 5DJLA 1SKWB 4YQMA 2CT6A 3CXGA 3APOA 1SD8A 2VOCA 5B6NA 3CTGA 1O7UA 2VCXA 1TRWA 1SL1B 4BVYB 3KM6A 4AGSA 1K3YA 1N2AA 3UARA 2YJ7A 3TJGA 1TI1A 1SENA 2X64A 3EU4A 1JZWA 3LFLA 2EIRA 2WGRA 3RPPA 3HVXA 2R4VA 2MBSA 2ON7A 3QAWA 3BJ5A 2C3TA 2JSYA 4GCIA 1SL2B 2XHFA 3I69A 4XIHA 1NHYA 2FY6A 4DSSB 5C04A 2VL2C 1YQ1A 3LXZA 1J08A 5AIVA 2B5XA 2H6XA 1V57A 5DAKB 1OC9A 4FIWA 1BX9A 1J0FA 1G7OA 1RK4A 3IOSA 3W6GA 2HI7A 4IKHA 5G5EA 2LRCA 3C73A 3LWAA 2P5QA 1VF4A 4IP1A 3KP8A 1AQXA 3IAM2 4LL4B 1PSQA 1EP8A 5LCZA 4FO5A 3HJOA 1TOFA 4P3YB 4EC0A 1GTUA 3IC4A 16GSA 3TRXA 2XBQA 2ZNMA 1T7PB 4HU9A 1SU9A 3L9SA 3IR4A 2IMEA 2H72A 2LEGA 4RQXA 4TR3A 4JRRA 1QXHA 5COHA 1ACVA 3CSJA 2HRFA 4ECCA 3ZMLA 1SKRB 3FZAA 1GH2A 2VLVA 5CRWA 5ECOB 5IMDA 3L9UA 4WBRD 1EP7A 4HU7A 2H30A 2B7JA 4IJ3A 4WR4A 3GKXA 1O8WA 4MMMA 2O8VB 3QOUA 4LMWA 1GLPA 2L4CA 2QSIA 1TXXA 3MWHA 3BD2A 1NSWA 3DVXA 2C4JA 1AUCA 3WYWA 1OKTA 3DGQA 1THXA 3WGXA 1JFUA 4WXTA 3LXTA 4EIQA 3TGZA 2X8HA 3FKFA 3F6FA 3CTFA 5ECQB 4Q5QA 1PGTA 1EEMA 1T1VA 4K7OA 1SJZA 1EGOA 5CAXA 3D4TA 3KXOA 3IAS2 20GSA 2RIIA 2FHEA 2VAFA 1GUHA 5DBQA 4YQUA 2VLTA 3I6AA 2TIRA 2QGVA 2YOIA 2GQMA 1TI3A 1BQ7A 1BYEA 4Q5FA 4TR1A 2LJAA 4MF6A 1GULA 4K7NA 2H0HA 4LA1A 2XC2A 2OADA 4D73A 2R0CA 1M99A 2C3QA 2JU5A 4Z2UA 4KB3A 2PUKC 1E2YA 2PWJA 3H1NA 4N30A 2VCVA 3R3EA 22GSA 5JCGA 3O76A 2NTOA 2V6KA 4HJ2A 4EE0A 3L4NA 7GSSA 4YAPA 4CHSA 1OE7A 1QK8A 2D2ZA 2DMMA 4MK3A 4WBJA 5D9XA 2BJXA 3NOFA 1KTEA 1THOA 5LNKe 4EUYA 1T4YA 3D0ZA 4O32A 5KEJA 3EINA 4BVXA 1GSDA 3KMOA 3TCOA 2LNSA 3N9JA 5ECLB 1B9YC 4JU5A 1B4QA 5IO2A 1VF2A 4HEA2 5IMAA 1I5GA 2RM6A 1TRUA 1XWKA 1R5AA 3VK9A 3GH9A 1A2LA 2H73A 5CREA 2QA1A 1M2DA 2H71A 2CX4A 4MCUA 2LS5A 3ZYWA 3FRCA 3QR6A 3KP9A 2VCQA 1XW5A 2L59A 1F37A 2DIZA 5J41A 5ECRB 2I1UA 4N10A 4WR5A 2X49A 4ID0A 2WJUA 5D8IA 5IQYA 3A2VA 3C71A 1V2AA 1FB0A 3ERGA 4O5RA 4L8EA 2CX3A 1BJXA 2VL3A 2VCWA 2X99A 3FZ9A 4RI7A 2IJYA 2HZEB 4NHZA 3QDNA 5HR2A 3HHVA 3ZTLA 2G0FA 3CMIA 1JZDA 2HSYA 2WULA 3LG6A 2L5OA 1O81A 2F3MA 3R2QA 2DJ1A 3CRTA 1XVWA 1R7HA 3D21A 1F3AA 6GSSA 3GUSA 2WRTA 2DIYA 2P5RA 4KDYA 4WKWA 4YKFA 3BBYA 2CV4A 2IMDA 1GWCA 2XPEA 3CRUA 3TB2A 1YEXA 5GSTA 1V58A 2H1GA 5E4WA 1T8EB 3GTUB 1TP9A 5H5RA 1XFLA 3TOUA 3TKRA 3MNGA 4DEJA 4K5RA 2IFQA 1UA5A 4L0UA 2AHEA 1F9MA 1K0NA 1XPVA 3KH7A 5DALA 2C1YA 4IN0A 1A0RP 4JBBA 1WOUA 4EVMA 2R5GA 3EMXA 3UVHA 4O7HA 2K9FA 4OWYA 3LJRA 1BG5A 3DD3A 3ME7A 1F3BA 5KOXA 1FVKA 4WEYA 3UEMA 1WIKA 4ICYA 1CQHA 5C00A 5A4UA 3HJPA 4GSTA 2JACA 4H86A 4TR4A 4KA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HQP A;  1TDI A;  2YP6 A;  5J9C A;  5J4U A;  3UAP A;  2YCD A;  1X5D A;  1TU8 A;  2K8S A;  3QPM A;  4PX1 A;  1M0U A;  2DLX A;  3PH9 A;  4OO4 A;  3HYP A;  3DKS A;  5GZZ B;  1SJ6 A;  1B48 A;  2R3X A;  5L71 A;  1ZCP A;  3EC3 A;  1O6J A;  4X0X A;  3GHA A;  3ZLP A;  1WPI A;  4MAB A;  1QQ2 A;  2NVL A;  3ZL5 A;  4K6X A;  4XCS A;  3PR8 A;  3IXR A;  2V41 A;  2HRN A;  4BA7 A;  4ECI A;  4KCA A;  3IDV A;  3F9U A;  2JL4 A;  4CW9 A;  2MMA A;  1OKD A;  2GLR A;  3L0H A;  4MJC A;  3Q19 A;  5JWQ B;  1J9B A;  2RLI A;  4AF2 A;  4ECB A;  3DIE A;  1MDK A;  4FYC A;  4HQZ A;  2KUC A;  1ON4 A;  2LJK A;  2GQK A;  1A2J A;  5CO3 A;  1AAZ A;  3ZZX A;  3Q6O A;  1OC3 A;  2NPB A;  5D96 A;  3W8S A;  2CAI A;  3TOT A;  2DML A;  4PQH A;  1EOG A;  3KTL A;  3A2X A;  1PKW A;  5A4V A;  4ZIL A;  1WWJ A;  3GKM A;  1B4P A;  3KEB A;  2L57 A;  1PD2 1;  2EC4 A;  5ELA A;  2Z9S A;  3D4M A;  2PN8 A;  3DVW A;  3FR9 A;  3U6V A;  4OCE A;  4DVC A;  4BPY A;  4WF5 A;  1S3C A;  1JLW A;  1FB6 A;  2B1K A;  4ZBA A;  2L6C A;  1JHB A;  1UC7 A;  5KN2 A;  4MDC A;  1GSU A;  2H66 A;  2FWH A;  5EVO A;  3GKN A;  4MF7 A;  1LJR A;  3IRA A;  5ECN B;  3LGC A;  2FGX A;  1XVQ A;  1AC1 A;  3TDG A;  3KTB A;  3IK9 A;  2LST A;  3GMF A;  5IIZ A;  2J23 A;  1TJD A;  4AJ7 A;  1UVZ A;  4NPB A;  3F3Q A;  4DSS A;  2E0Q A;  2V32 A;  4OFT A;  1Y6E A;  5DDL A;  2DJ3 A;  3EUR A;  3ERF A;  3HD5 A;  4J2F A;  5A5K A;  5HFG A;  5HR3 A;  1VGL A;  3HXS A;  2LV3 A;  1YEP A;  2J9H A;  2K18 A;  3KJY A;  2O85 A;  4ML1 A;  1JLV A;  3QFB C;  5ECI B;  2VCZ A;  2PMT A;  5B8A A;  4GWR A;  1TRV A;  1ERW A;  3KH9 A;  3HCZ A;  5JCU A;  3P90 A;  14GS A;  2GDR A;  4MLY A;  3FEU A;  19GS A;  2FWF A;  5KN0 A;  2DJK A;  1GP1 A;  2OBI A;  2AJQ B;  3SWL A;  1BAY A;  2OAC A;  1PX7 A;  5IMV A;  2H75 A;  5F06 A;  3VWU A;  4OFN A;  1YF1 A;  2N5F A;  3OR5 A;  4GXZ A;  4G10 A;  3WD6 A;  2M80 A;  1HQO A;  3H4K A;  2F51 A;  3FZ4 A;  2GSS A;  1V9W A;  2GS3 A;  1H75 A;  1R4W A;  3VWX A;  5HFI A;  4TXO A;  1U88 A;  2H1A A;  3CSI A;  2CQ9 A;  2EIQ A;  3AY8 A;  3P7X A;  3TJJ A;  1A24 A;  4POB A;  4KX4 A;  5INY A;  4XS6 A;  1MD4 A;  1R5P A;  1OVN A;  1EV9 A;  1OC9 B;  3UBK A;  4G9H A;  3TRQ A;  1XXU A;  1F2E A;  3US3 A;  3VUR A;  4KH7 A;  4MPG A;  5ID2 B;  3DYR A;  3HVS A;  4I6X A;  1KBN A;  5KN3 A;  1DSB A;  3F63 A;  2MBT A;  4J57 E;  1U3I A;  3GN3 A;  2VD1 A;  2YPM A;  3D6I A;  4PXO A;  3VI7 A;  2IN3 A;  3CYN A;  3MSZ A;  4F0B A;  4MH2 A;  4OCF A;  1MDJ A;  4QL7 A;  1T4Z A;  1GSY A;  2KP1 A;  1W89 A;  5G5F A;  3C1R A;  1M7T A;  2AV4 A;  1WMJ A;  1EV4 A;  2YWO A;  4K0G A;  1HNC A;  4ZL8 A;  1PMT A;  2DC5 A;  4ULX A;  3HY2 A;  4WET A;  2HYX A;  3VI5 A;  4V1A p;  2XPD A;  1R26 A;  3M9J A;  1AQV A;  2HLS A;  2LQQ A;  3UBL A;  5IPH A;  1K3O A;  3A2W A;  1SK2 A;  3FZ5 A;  4K1F A;  1KEB A;  1Z6N A;  1GTI A;  1JZO A;  3I9V 2;  3E0U A;  2H70 A;  4ZB9 A;  3VWW A;  3ISO A;  5ENU A;  4FYU A;  1K0O A;  4LL1 B;  1MEK A;  4IHU A;  2R2J A;  2VLU A;  3GL3 A;  4V2M A;  4ILF A;  3H79 A;  3FR3 A;  4ISD A;  3ZVJ D;  4XS1 A;  1EGR A;  3DRN A;  4KSO A;  1ZGN A;  2HT9 A;  4XHM A;  1WRY A;  4MZW A;  2OJL A;  2B6M A;  5G1K A;  1PL2 A;  1FG4 A;  5B7C A;  5DCG A;  1MDI A;  3WGE A;  1NM3 A;  1XWB A;  2WS2 A;  4GQC A;  3IV4 A;  2TRC P;  3KCM A;  4KGI A;  3F3R A;  3EYT A;  4JR6 A;  1EOH A;  4QL9 A;  3IPZ A;  1YF0 A;  2B1L A;  4NHW A;  3CBU A;  3GV1 A;  2GVP A;  4MZC A;  2PER A;  2VD0 A;  5DQY A;  3GSS A;  1TW9 A;  4ZL9 A;  2YZU A;  2DJ2 A;  3GTU A;  5J9B A;  5DCH A;  4HJM A;  2YWN A;  5F05 A;  4TXV A;  2BMX A;  2AYT A;  3RHB A;  3LYK A;  4PGT A;  3IE3 A;  3HKR A;  5IM9 A;  2H76 A;  3DEX A;  3KMN A;  2FWG A;  1PX6 A;  1MTC A;  1URM A;  3HJM A;  2E7P A;  2YN1 A;  5CP1 A;  3EE2 A;  4MA9 A;  5J5N A;  3M8N A;  5CNW A;  1LBK A;  2DJ0 A;  4GF0 A;  4ZBB A;  4ML6 A;  1O8X A;  2FCH A;  2REM A;  2AB6 A;  2IWT A;  2A2R A;  5ECH B;  4XS4 A;  2VO4 A;  4KDU A;  2R37 A;  1AW9 A;  1JZR A;  3ERW A;  1QUW A;  1PKZ A;  4TR0 A;  1Q98 A;  1X9W B;  2IMI A;  4MJB A;  5EY6 A;  3NIV A;  5CRD A;  1AXD A;  3GL5 A;  4OO5 A;  4POK A;  1EEJ A;  1Q4J A;  5DQS A;  3J7Y k;  4PQ1 A;  3E3E A;  2KOK A;  4YAV A;  2M46 A;  2HXK A;  4EL1 A;  5FT3 A;  4MJA A;  1VF1 A;  1PRX A;  1FOV A;  3LYP A;  2GZP A;  5HFK A;  2VCT A;  4IVF A;  2ZCT A;  4I8B A;  4F82 A;  3IK7 A;  4IQ1 A;  3ZIJ A;  2CVK A;  1XIY A;  3GUR A;  2R6K A;  1XWA A;  3LQ7 A;  2DBC A;  4QQ7 A;  1ILO A;  2JAD A;  1TKD B;  3N5O A;  5ECK B;  4YQV A;  1X0R A;  2IMF A;  3TUE A;  1TK5 B;  4KUN A;  1GTB A;  1SJI A;  2PU9 C;  4BWS A;  3DML A;  1A8Y A;  2MMN A;  1OE8 A;  1WJK A;  2FA4 A;  5F8B A;  3IBH A;  2HFD A;  1M2A A;  3RBT A;  5HR0 A;  4MF5 A;  1GNE A;  1Z3E A;  4EDZ A;  2F9S A;  5D9W A;  1DUG A;  6GSU A;  1M9A A;  1SKS B;  4HUA A;  4Q5N A;  2VL2 A;  1XW6 A;  2H6Y A;  2RUF A;  1ZMA A;  5IO0 A;  3FHK A;  1XBS A;  4O92 A;  1NHO A;  1X5C A;  2YAN A;  4MH3 A;  1TK8 B;  2GT6 A;  3M1G A;  3FY7 A;  3MDK A;  3QAV A;  2B7K A;  3RAZ A;  5GSS A;  5AIX A;  3UVT A;  1Z5Y E;  4FH8 A;  2FLS A;  4PUF C;  3GA4 A;  2H1B A;  2RM5 A;  1GSQ A;  3P8W A;  4TW5 A;  2ZUP A;  4L5L A;  4OD7 A;  9GSS A;  5B8B A;  1GUK A;  2ON5 A;  3GX0 A;  1XCC A;  1GLQ A;  3NZN A;  2N5A A;  3K8N A;  3UOM A;  2H0G A;  2GT5 A;  4V1A g;  4ZB8 A;  2RUE A;  1SK1 A;  2IL3 A;  2ALB A;  3GRX A;  5IPG A;  3CSH A;  2NDO A;  4NMU A;  1YDK A;  1E6B A;  4N0Z A;  2LRN A;  4F2I A;  2H6Z A;  1G6Y A;  4POL A;  2VM1 A;  3LOR A;  2LQO A;  1IYI A;  3APQ A;  3Q18 A;  4HDE A;  3GYK A;  3HDC A;  4GQF A;  1XW9 A;  4BVY A;  1GSS A;  3QFA C;  1GTA A;  4GSS A;  2V6O A;  4ACS A;  1GSE A;  4HQS A;  5ECS A;  6GST A;  4IQA A;  1C72 A;  5GAN D;  4WF4 A;  1U6T A;  3BCK A;  1RQM A;  1XOA A;  2N5B A;  3PGT A;  2YWI A;  3W8J A;  3JCM L;  1MD3 A;  1F6M C;  3QCP A;  2MMO A;  1TU7 A;  5DAK A;  5F07 A;  4IJI A;  2GTU A;  1Z6M A;  17GS A;  2I81 A;  3V1W A;  5E59 A;  2ES7 A;  2KLX A;  2K8V A;  4XRA A;  3F4T A;  1X9S B;  2WZ9 A;  1O73 A;  5G1L A;  1ZOF A;  1GSF A;  5D73 A;  6GSV A;  2C0E A;  4NAX A;  5ECM B;  1PL1 A;  18GS A;  1SYX A;  3ZVJ A;  1QMV A;  2JZS A;  4HI7 A;  4K8M A;  3ZRD A;  3F8U A;  2TRX A;  2O89 A;  1PN9 A;  2FA8 A;  3VPQ A;  6GSW A;  5JWR B;  2WDU A;  5F0G A;  4GSN A;  8GSS A;  3L78 A;  4OMV A;  1VRS D;  1HNB A;  3UL3 A;  3UIW A;  5ABR A;  4JZQ A;  5HR1 A;  1GNW A;  3ZFL A;  2L6D A;  3ZIT A;  4TOP A;  3APS A;  5EL8 A;  2B5E A;  2XBI A;  1X5E A;  2CZ3 A;  5JCW A;  1SYR A;  3O6T A;  1K3L A;  3WT2 A;  1ST9 A;  2FWE A;  3G7J A;  3GH6 A;  2FD3 A;  2YV7 A;  5AGY A;  3QMX A;  1YKC A;  5ID2 A;  3TKS A;  2C3N A;  5H5S A;  1PQN A;  4K9Z A;  1RW1 A;  2MYG A;  3GNJ A;  4NWY A;  3RDW A;  5JWO B;  4JED A;  2I9H A;  4GRF A;  3F4R A;  1Y25 A;  1YKA A;  3RHC A;  2PPT A;  4XTS A;  2YNX A;  2V1M A;  2PVQ A;  3ZIV A;  4HOJ A;  1U87 A;  3P2A A;  4J56 E;  3G9B A;  1B8X A;  1V98 A;  4KAE A;  1ERV A;  3FYG A;  4X43 A;  4I5Q A;  2G2Q A;  2LNT A;  1FAA A;  2M72 A;  4PUA A;  1FVJ A;  2I3Y A;  5IOX A;  5DVB A;  3C1S A;  2CVD A;  4KE3 A;  4NV2 A;  2E2G A;  4TXO B;  4AJ8 A;  3VLN A;  5G31 A;  1G7E A;  3BCI A;  4V2L A;  1ERT A;  2L4Q A;  4TKY A;  1AQW A;  2GZY A;  1T00 A;  1HNA A;  2FUG 2;  2C8U A;  5H5Q A;  1YJ6 A;  3ZMK A;  3ED3 A;  1G6W A;  2CAQ A;  4POM A;  2C0F A;  2HE3 A;  4BWQ A;  2KP2 A;  5A4W A;  1UN2 A;  1H4O A;  4MZB A;  3GKK A;  3I43 A;  5D9T A;  1XWG A;  5IMF A;  11GS A;  5AN1 A;  1A0F A;  1ZZY A;  1V40 A;  4DSQ A;  2VL9 A;  2H01 A;  3FW2 A;  3WGD A;  2QKE A;  3D5J A;  4K0N A;  4N0V A;  2HNL A;  1FW1 A;  1WP0 A;  4V2N A;  3QD9 A;  1TRS A;  1TTZ A;  3F6D A;  3IA1 A;  2GSR A;  1OAZ A;  1HYU A;  5FHI A;  2L5L A;  1USB A;  3J7Y b;  1K0B A;  1XZO A;  2H8L A;  4I2T A;  1ML6 A;  4TR1 B;  4EDY A;  3Q74 A;  2HZE A;  4ZBD A;  6GSX A;  5ELG A;  2BTO T;  1DBY A;  4AJ6 A;  4D73 B;  2VUP A;  3TRP A;  1TK0 B;  3TJF A;  2OBK A;  1I9D A;  3TJK A;  3HA9 A;  2PBJ A;  4L0W A;  3LSZ A;  3DXB A;  2MMZ A;  4ZB6 A;  4ZXG A;  1OYJ A;  2FNO A;  1VF3 A;  2JZR A;  5D93 A;  4EO3 A;  4GLT A;  3D22 A;  4PNG A;  2H1D A;  3SBC A;  2B5Y A;  2LUS A;  3GX8 A;  2E2M A;  1S3A A;  3TKS C;  4EKZ A;  5G2Z A;  4HS1 A;  5KN1 A;  3TKS E;  1A23 A;  1U3A A;  3TKP A;  4RUV A;  1K0C A;  1EWX A;  2A4V A;  5IMC A;  2I4A A;  1GRX A;  4I97 A;  1Z9H A;  5EPF A;  1NW2 A;  2AUV A;  2VM2 A;  4ZL7 A;  2CVB A;  2MZC A;  4NV5 A;  5GAP D;  2OE0 A;  1QGV A;  1AIU A;  4MJE A;  3KD0 A;  1GL8 A;  3LEF A;  1O85 A;  2O87 A;  1OC8 A;  2QC7 A;  3GIX A;  2CA8 A;  1KNG A;  3VPT A;  3KIJ A;  2YJH A;  2KHP A;  3O3T A;  4TVE A;  3DWV A;  2A2S A;  3G7Y A;  5LD0 A;  4JR4 A;  1X9M B;  4RQR A;  4IGJ A;  1YY7 A;  2H19 A;  2X8G A;  3HVV A;  2OKA A;  2EIO A;  4NXI A;  4ECJ A;  4KCE A;  3FR6 A;  4PUR A;  1T3B A;  5AIS A;  2CZ2 A;  2OE1 A;  5G30 A;  1W4V A;  1Z7P A;  4YH2 A;  1N8J A;  2OA7 A;  3EU3 A;  1SK0 A;  5CRG A;  4IS0 A;  2F8A A;  4N11 A;  4RI6 A;  3L9V A;  4L5O A;  1SL0 B;  2PGT A;  3G7I A;  2YZH A;  4KND A;  2WB9 A;  2NBS A;  2H74 A;  1K0A A;  1G0T A;  2GQL A;  5DJM A;  5IMZ A;  1ERU A;  2P0G A;  1ABA A;  1PA3 A;  4CDO A;  1QFN A;  2IFQ B;  3FK8 A;  3H93 A;  5D9V A;  2JZT A;  4F03 A;  4TN8 A;  1CQG A;  2H0I A;  4XS4 B;  2WFC A;  1M9B A;  5DAL B;  3ZRE A;  3F4S A;  1K0M A;  3F0I A;  2YWM A;  4LLR A;  1S3D A;  5CYY A;  4IBP A;  1EZK A;  2IPA A;  3KZQ A;  2X8C A;  4FYB A;  4EXJ A;  1ZYQ B;  3EMP A;  3BOA A;  1FO5 A;  3EWL A;  1ZYE A;  2LKU A;  3ME8 A;  1XWC A;  3HZ8 A;  4OFM A;  6GSY A;  4IW9 A;  2IIY A;  1A8L A;  3M3M A;  2HSH A;  4I2U A;  1DE2 A;  1IYH A;  3C8E A;  2DSA A;  2C0D A;  2C0G A;  3S9F A;  2VIM A;  4BL7 A;  3GFK A;  4TRX A;  4E8H A;  4F9Z A;  3H8Q A;  2YV9 A;  2DJJ A;  3M0F A;  4MP4 A;  2OE3 A;  2WCI A;  10GS A;  4K2D A;  4E8E A;  3VWV A;  3PIN A;  2K6V A;  4JE1 A;  1ZL9 A;  2O7K A;  2V2G A;  4Q5R A;  2GST A;  2LTK A;  3A5W A;  2JSZ A;  4LMV A;  2HZF A;  3GST A;  4PQI A;  3U5R E;  4KDX A;  4KW6 A;  1DE1 A;  5IOW A;  2F8F A;  2B3S A;  3TKQ A;  3VFI A;  1FHE A;  3M9K A;  3UJ1 A;  1LU4 A;  3TJB A;  2PVO C;  3RPN A;  4MPF A;  3E9J B;  4Z7X A;  4K7I A;  2AAW A;  5B6M A;  3EVI A;  3UMA A;  1A2M A;  4ZIJ A;  3HZ4 A;  1M2B A;  3MAK A;  13GS A;  1GUM A;  5J3R A;  1WE0 A;  2GZZ A;  4HZ4 A;  12GS A;  4KSM A;  1B9X C;  3C7M A;  1Z7R A;  1SD9 A;  3WT1 A;  3QAG A;  5ECP B;  1HD2 A;  4G2E A;  2LJR A;  3IHQ A;  2P31 A;  3A3T A;  5FWG A;  1YZX A;  2C80 A;  4PNF A;  3KGK A;  4HZ2 A;  4IEL A;  2GSQ A;  1XOB A;  2LRT A;  4EF0 A;  4G19 A;  4GTU A;  2GGT A;  3ZFB A;  4DSR A;  4F0C A;  4IP6 A;  1K0D A;  4XRD A;  4X1U A;  5CRH A;  1BED A;  2IMK A;  5DJL A;  1SKW B;  4YQM A;  2CT6 A;  3CXG A;  3APO A;  1SD8 A;  2VOC A;  5B6N A;  3CTG A;  1O7U A;  2VCX A;  1TRW A;  1SL1 B;  3KM6 A;  4AGS A;  1K3Y A;  1N2A A;  3UAR A;  2YJ7 A;  3TJG A;  1TI1 A;  1SEN A;  2X64 A;  3EU4 A;  1JZW A;  3LFL A;  2EIR A;  2WGR A;  3RPP A;  3HVX A;  2R4V A;  2MBS A;  2ON7 A;  3QAW A;  3BJ5 A;  2C3T A;  2JSY A;  4GCI A;  1SL2 B;  2XHF A;  3I69 A;  4XIH A;  1NHY A;  2FY6 A;  4DSS B;  5C04 A;  2VL2 C;  1YQ1 A;  3LXZ A;  1J08 A;  5AIV A;  2B5X A;  2H6X A;  1V57 A;  5DAK B;  1OC9 A;  4FIW A;  1BX9 A;  1J0F A;  1G7O A;  1RK4 A;  3IOS A;  3W6G A;  2HI7 A;  4IKH A;  5G5E A;  2LRC A;  3C73 A;  3LWA A;  2P5Q A;  1VF4 A;  4IP1 A;  3KP8 A;  1AQX A;  3IAM 2;  4LL4 B;  1PSQ A;  1EP8 A;  5LCZ A;  4FO5 A;  3HJO A;  1TOF A;  4P3Y B;  4EC0 A;  1GTU A;  3IC4 A;  16GS A;  3TRX A;  2XBQ A;  2ZNM A;  1T7P B;  4HU9 A;  1SU9 A;  3L9S A;  3IR4 A;  2IME A;  2H72 A;  2LEG A;  4RQX A;  4TR3 A;  4JRR A;  1QXH A;  5COH A;  1ACV A;  3CSJ A;  2HRF A;  4ECC A;  3ZML A;  1SKR B;  3FZA A;  1GH2 A;  2VLV A;  5CRW A;  5ECO B;  5IMD A;  3L9U A;  4WBR D;  1EP7 A;  4HU7 A;  2H30 A;  2B7J A;  4IJ3 A;  4WR4 A;  3GKX A;  1O8W A;  4MMM A;  2O8V B;  3QOU A;  4LMW A;  1GLP A;  2L4C A;  2QSI A;  1TXX A;  3MWH A;  3BD2 A;  1NSW A;  3DVX A;  2C4J A;  1AUC A;  3WYW A;  1OKT A;  3DGQ A;  1THX A;  3WGX A;  1JFU A;  4WXT A;  3LXT A;  3TGZ A;  2X8H A;  3FKF A;  3F6F A;  3CTF A;  5ECQ B;  4Q5Q A;  1PGT A;  1EEM A;  1T1V A;  4K7O A;  1SJZ A;  1EGO A;  5CAX A;  3D4T A;  3KXO A;  3IAS 2;  20GS A;  2RII A;  2FHE A;  2VAF A;  1GUH A;  5DBQ A;  4YQU A;  2VLT A;  3I6A A;  2TIR A;  2QGV A;  2YOI A;  2GQM A;  1TI3 A;  1BQ7 A;  1BYE A;  4Q5F A;  4TR1 A;  2LJA A;  4MF6 A;  1GUL A;  4K7N A;  2H0H A;  4LA1 A;  2XC2 A;  2OAD A;  4D73 A;  1M99 A;  2C3Q A;  2JU5 A;  4KB3 A;  2PUK C;  1E2Y A;  2PWJ A;  3H1N A;  4N30 A;  2VCV A;  22GS A;  5JCG A;  3O76 A;  2NTO A;  2V6K A;  4HJ2 A;  4EE0 A;  3L4N A;  7GSS A;  4YAP A;  4CHS A;  1OE7 A;  1QK8 A;  2D2Z A;  2DMM A;  4MK3 A;  4WBJ A;  5D9X A;  2BJX A;  3NOF A;  1KTE A;  1THO A;  5LNK e;  4EUY A;  1T4Y A;  3D0Z A;  4O32 A;  5KEJ A;  3EIN A;  4BVX A;  1GSD A;  3KMO A;  3TCO A;  2LNS A;  3N9J A;  5ECL B;  1B9Y C;  4JU5 A;  1B4Q A;  5IO2 A;  1VF2 A;  4HEA 2;  5IMA A;  1I5G A;  2RM6 A;  1TRU A;  1XWK A;  1R5A A;  3VK9 A;  3GH9 A;  1A2L A;  2H73 A;  5CRE A;  1M2D A;  2H71 A;  2CX4 A;  4MCU A;  2LS5 A;  3ZYW A;  3FRC A;  3QR6 A;  3KP9 A;  2VCQ A;  1XW5 A;  2L59 A;  1F37 A;  2DIZ A;  5J41 A;  5ECR B;  2I1U A;  4N10 A;  4WR5 A;  4ID0 A;  2WJU A;  5D8I A;  5IQY A;  3A2V A;  3C71 A;  1V2A A;  1FB0 A;  3ERG A;  4O5R A;  4L8E A;  2CX3 A;  1BJX A;  2VL3 A;  2VCW A;  2X99 A;  3FZ9 A;  4RI7 A;  2IJY A;  2HZE B;  4NHZ A;  3QDN A;  5HR2 A;  3HHV A;  3ZTL A;  2G0F A;  3CMI A;  1JZD A;  2HSY A;  2WUL A;  3LG6 A;  2L5O A;  1O81 A;  2F3M A;  3R2Q A;  2DJ1 A;  3CRT A;  1XVW A;  1R7H A;  3D21 A;  1F3A A;  6GSS A;  3GUS A;  2WRT A;  2DIY A;  2P5R A;  4KDY A;  4WKW A;  3BBY A;  2CV4 A;  2IMD A;  1GWC A;  2XPE A;  3CRU A;  3TB2 A;  1YEX A;  5GST A;  1V58 A;  2H1G A;  5E4W A;  1T8E B;  3GTU B;  1TP9 A;  5H5R A;  1XFL A;  3TOU A;  3TKR A;  3MNG A;  4DEJ A;  2IFQ A;  1UA5 A;  4L0U A;  2AHE A;  1F9M A;  1K0N A;  1XPV A;  3KH7 A;  5DAL A;  2C1Y A;  4IN0 A;  1A0R P;  4JBB A;  1WOU A;  4EVM A;  2R5G A;  3EMX A;  3UVH A;  4O7H A;  2K9F A;  4OWY A;  3LJR A;  1BG5 A;  3DD3 A;  3ME7 A;  1F3B A;  1FVK A;  4WEY A;  3UEM A;  1WIK A;  1CQH A;  5C00 A;  5A4U A;  3HJP A;  4GST A;  2JAC A;  4H86 A;  4TR4 A;  4KA0 A; 
#chains in the Genus database with same CATH topology
 5HQP A;  1TDI A;  2YP6 A;  5J9C A;  5J4U A;  3UAP A;  2YCD A;  1X5D A;  1TU8 A;  2K8S A;  3QPM A;  4PX1 A;  1M0U A;  2DLX A;  3PH9 A;  4OO4 A;  3HYP A;  3DKS A;  5GZZ B;  1SJ6 A;  1B48 A;  2R3X A;  5L71 A;  1ZCP A;  3EC3 A;  1O6J A;  4X0X A;  3GHA A;  3ZLP A;  1WPI A;  4MAB A;  1QQ2 A;  2NVL A;  3ZL5 A;  4K6X A;  4XCS A;  3PR8 A;  3IXR A;  2V41 A;  2HRN A;  4BA7 A;  4ECI A;  4KCA A;  3IDV A;  3F9U A;  2JL4 A;  4CW9 A;  2MMA A;  1OKD A;  2GLR A;  3L0H A;  4MJC A;  3Q19 A;  5JWQ B;  1J9B A;  2RLI A;  4AF2 A;  4ECB A;  3DIE A;  1MDK A;  4FYC A;  4G0L A;  4HQZ A;  2KUC A;  1ON4 A;  2LJK A;  2GQK A;  1A2J A;  5CO3 A;  1AAZ A;  3ZZX A;  3Q6O A;  1OC3 A;  2NPB A;  5D96 A;  3W8S A;  2CAI A;  3TOT A;  2DML A;  4PQH A;  1EOG A;  3KTL A;  3A2X A;  1PKW A;  5A4V A;  4ZIL A;  1WWJ A;  3GKM A;  1B4P A;  3KEB A;  2L57 A;  1PD2 1;  2EC4 A;  5ELA A;  2Z9S A;  3D4M A;  2PN8 A;  3DVW A;  3FR9 A;  3U6V A;  4OCE A;  4DVC A;  4BPY A;  4WF5 A;  1S3C A;  1JLW A;  1FB6 A;  2B1K A;  4ZBA A;  2L6C A;  1JHB A;  1UC7 A;  5KN2 A;  4MDC A;  1GSU A;  2H66 A;  2FWH A;  5EVO A;  3GKN A;  4MF7 A;  1LJR A;  3IRA A;  5ECN B;  3LGC A;  2FGX A;  1XVQ A;  1AC1 A;  3IHG A;  3TDG A;  3KTB A;  3IK9 A;  2LST A;  3GMF A;  5IIZ A;  2J23 A;  1TJD A;  4AJ7 A;  1UVZ A;  4NPB A;  3F3Q A;  4DSS A;  2E0Q A;  2V32 A;  4OFT A;  1Y6E A;  5DDL A;  2DJ3 A;  3EUR A;  3ERF A;  2R0P A;  3HD5 A;  4J2F A;  5A5K A;  5HFG A;  5HR3 A;  1VGL A;  3HXS A;  2LV3 A;  1YEP A;  2J9H A;  2K18 A;  3KJY A;  2O85 A;  4ML1 A;  1JLV A;  3QFB C;  5ECI B;  2VCZ A;  2PMT A;  5B8A A;  4A5P A;  1M3J A;  4GWR A;  2A4H A;  1TRV A;  1ERW A;  3KH9 A;  3HCZ A;  5JCU A;  3P90 A;  14GS A;  2GDR A;  2HRK A;  4MLY A;  3FEU A;  19GS A;  2FWF A;  5KN0 A;  2DJK A;  1GP1 A;  2OBI A;  2AJQ B;  3SWL A;  1BAY A;  2OAC A;  1PX7 A;  5IMV A;  2H75 A;  5F06 A;  3VWU A;  4OFN A;  3PPU A;  1YF1 A;  2N5F A;  3OR5 A;  4GXZ A;  4G10 A;  3WD6 A;  2M80 A;  2UZ8 A;  1HQO A;  3H4K A;  2F51 A;  4YKG A;  3FZ4 A;  2GSS A;  1V9W A;  2GS3 A;  1H75 A;  1R4W A;  3VWX A;  4Z2T A;  5HFI A;  4TXO A;  1U88 A;  2H1A A;  3CSI A;  2CQ9 A;  2EIQ A;  3AY8 A;  3P7X A;  3TJJ A;  1A24 A;  4POB A;  4KX4 A;  5INY A;  4XS6 A;  1MD4 A;  1R5P A;  1OVN A;  1EV9 A;  1OC9 B;  3UBK A;  4G9H A;  3TRQ A;  1XXU A;  1F2E A;  3US3 A;  3VUR A;  4EIP A;  4KH7 A;  4MPG A;  5ID2 B;  3DYR A;  3HVS A;  4I6X A;  1KBN A;  2HSM A;  5KN3 A;  1DSB A;  3F63 A;  2MBT A;  4J57 E;  1U3I A;  3GN3 A;  2VD1 A;  2YPM A;  3D6I A;  4PXO A;  3VI7 A;  2IN3 A;  3CYN A;  3MSZ A;  4F0B A;  4MH2 A;  4OCF A;  1MDJ A;  4QL7 A;  1T4Z A;  1GSY A;  2KP1 A;  1W89 A;  5G5F A;  3C1R A;  4Z2R A;  1M7T A;  2AV4 A;  1WMJ A;  1EV4 A;  2YWO A;  4K0G A;  1HNC A;  4ZL8 A;  1PMT A;  2DC5 A;  4ULX A;  3HY2 A;  4WET A;  2HYX A;  3VI5 A;  4V1A p;  2XPD A;  1R26 A;  3M9J A;  1AQV A;  2HLS A;  2LQQ A;  3UBL A;  5IPH A;  1K3O A;  3A2W A;  1SK2 A;  3FZ5 A;  4K1F A;  1KEB A;  1Z6N A;  1GTI A;  1JZO A;  3I9V 2;  3E0U A;  2H70 A;  4ZB9 A;  3VWW A;  3ISO A;  5ENU A;  4FYU A;  1K0O A;  4LL1 B;  1MEK A;  4IHU A;  2R2J A;  2VLU A;  3GL3 A;  4V2M A;  4ILF A;  3H79 A;  3FR3 A;  4ISD A;  3ZVJ D;  4XS1 A;  1EGR A;  3DRN A;  4KSO A;  1ZGN A;  2HT9 A;  4XHM A;  4FQU A;  1WRY A;  4MZW A;  2OJL A;  2B6M A;  5G1K A;  1PL2 A;  1FG4 A;  5B7C A;  5DCG A;  1MDI A;  3WGE A;  1NM3 A;  1XWB A;  2WS2 A;  4GQC A;  3IV4 A;  2TRC P;  3KCM A;  4KGI A;  3F3R A;  3EYT A;  4JR6 A;  1EOH A;  4QL9 A;  3IPZ A;  1YF0 A;  2B1L A;  4NHW A;  3CBU A;  3GV1 A;  2GVP A;  4MZC A;  2PER A;  2VD0 A;  5DQY A;  3GSS A;  1TW9 A;  4ZL9 A;  2YZU A;  2DJ2 A;  3GTU A;  5J9B A;  5DCH A;  4HJM A;  2YWN A;  5F05 A;  4TXV A;  2BMX A;  2AYT A;  3RHB A;  3LYK A;  4PGT A;  3IE3 A;  3HKR A;  5IM9 A;  2H76 A;  3DEX A;  4X4J A;  3KMN A;  2FWG A;  1PX6 A;  1MTC A;  1URM A;  3HJM A;  2E7P A;  2YN1 A;  5CP1 A;  3EE2 A;  4MA9 A;  5J5N A;  3M8N A;  4CY6 A;  5CNW A;  1LBK A;  2DJ0 A;  4GF0 A;  4ZBB A;  4ML6 A;  1O8X A;  2FCH A;  2REM A;  2AB6 A;  2IWT A;  2A2R A;  5ECH B;  4XS4 A;  2VO4 A;  4KDU A;  2R37 A;  1AW9 A;  5BMU A;  1S3R A;  1JZR A;  3ERW A;  1QUW A;  1PKZ A;  4K2X A;  4TR0 A;  1Q98 A;  1X9W B;  2HRA A;  2IMI A;  4MJB A;  5EY6 A;  3NIV A;  5CRD A;  1AXD A;  3GL5 A;  4OO5 A;  4POK A;  1EEJ A;  1Q4J A;  5DQS A;  3J7Y k;  4PQ1 A;  3E3E A;  2KOK A;  4YAV A;  2M46 A;  2HXK A;  4EL1 A;  5FT3 A;  4MJA A;  1VF1 A;  1PRX A;  1FOV A;  3LYP A;  2GZP A;  5HFK A;  2VCT A;  4IVF A;  2ZCT A;  4I8B A;  4F82 A;  3IK7 A;  4IQ1 A;  3ZIJ A;  2CVK A;  1XIY A;  3GUR A;  2R6K A;  1XWA A;  3LQ7 A;  2DBC A;  4QQ7 A;  1ILO A;  2JAD A;  1TKD B;  3N5O A;  5ECK B;  4YQV A;  1X0R A;  2IMF A;  3TUE A;  1TK5 B;  4KUN A;  1GTB A;  1SJI A;  2PU9 C;  4BWS A;  3DML A;  1A8Y A;  2MMN A;  1OE8 A;  1WJK A;  2FA4 A;  5F8B A;  3IBH A;  2HFD A;  1M2A A;  3RBT A;  5HR0 A;  4MF5 A;  1GNE A;  1Z3E A;  4EDZ A;  2F9S A;  5D9W A;  1XG8 A;  1DUG A;  6GSU A;  1M9A A;  1SKS B;  4HUA A;  4Q5N A;  2VL2 A;  1XW6 A;  2H6Y A;  2RUF A;  1ZMA A;  5IO0 A;  3FHK A;  1XBS A;  3HVN A;  1NHO A;  4O92 A;  1X5C A;  2YAN A;  4MH3 A;  1TK8 B;  2GT6 A;  3M1G A;  3FY7 A;  3MDK A;  3QAV A;  2B7K A;  3RAZ A;  5GSS A;  5AIX A;  3UVT A;  1Z5Y E;  4FH8 A;  2FLS A;  4PUF C;  2R0G A;  3GA4 A;  2H1B A;  2RM5 A;  1GSQ A;  3P8W A;  4TW5 A;  2ZUP A;  4L5L A;  4K5S A;  2X4A A;  4OD7 A;  9GSS A;  5B8B A;  3IC8 A;  1GUK A;  2ON5 A;  3GX0 A;  1XCC A;  3EPT A;  1GLQ A;  4USS A;  3NZN A;  2N5A A;  3K8N A;  3UOM A;  2H0G A;  2GT5 A;  4V1A g;  4ZB8 A;  2RUE A;  1SK1 A;  2IL3 A;  2ALB A;  3GRX A;  5IPG A;  3CSH A;  2NDO A;  4NMU A;  1YDK A;  1E6B A;  4N0Z A;  2LRN A;  4F2I A;  2H6Z A;  1G6Y A;  4BL7 B;  4POL A;  2VM1 A;  3LOR A;  2LQO A;  1IYI A;  3APQ A;  3Q18 A;  4HDE A;  3GYK A;  3HDC A;  4GQF A;  4KF9 A;  1XW9 A;  4BVY A;  1GSS A;  3QFA C;  1GTA A;  4GSS A;  2V6O A;  4ACS A;  4MNN A;  1GSE A;  4HQS A;  5ECS A;  6GST A;  4IQA A;  1C72 A;  5GAN D;  4WF4 A;  1U6T A;  3BCK A;  1RQM A;  1XOA A;  2N5B A;  3PGT A;  2YWI A;  4G0I A;  3W8J A;  3JCM L;  1MD3 A;  1F6M C;  3QCP A;  2MMO A;  1TU7 A;  5DAK A;  5F07 A;  4IJI A;  2GTU A;  1Z6M A;  17GS A;  2I81 A;  3V1W A;  5E59 A;  2ES7 A;  2KLX A;  2K8V A;  4XRA A;  3F4T A;  1X9S B;  2WZ9 A;  1O73 A;  5G1L A;  1ZOF A;  1GSF A;  5D73 A;  6GSV A;  2C0E A;  4NAX A;  5ECM B;  1PL1 A;  18GS A;  1SYX A;  3ZVJ A;  1QMV A;  2JZS A;  4HI7 A;  4K8M A;  3ZRD A;  3F8U A;  2TRX A;  2O89 A;  1PN9 A;  2FA8 A;  3VPQ A;  6GSW A;  5JWR B;  2WDU A;  5F0G A;  4GSN A;  8GSS A;  3L78 A;  4OMV A;  1VRS D;  1HNB A;  3UL3 A;  3UIW A;  5ABR A;  4JZQ A;  5HR1 A;  1GNW A;  3ZFL A;  2L6D A;  3ZIT A;  4TOP A;  3APS A;  5EL8 A;  2B5E A;  2XBI A;  1X5E A;  2CZ3 A;  5JCW A;  1SYR A;  3O6T A;  1K3L A;  3WT2 A;  2A2P A;  1ST9 A;  2FWE A;  3G7J A;  3GH6 A;  2FD3 A;  2YV7 A;  5AGY A;  3QMX A;  1YKC A;  5ID2 A;  3TKS A;  2C3N A;  5H5S A;  1PQN A;  4K9Z A;  1RW1 A;  2MYG A;  3GNJ A;  4O5U A;  4NWY A;  3RDW A;  5JWO B;  4JED A;  2I9H A;  4GRF A;  3F4R A;  1Y25 A;  1YKA A;  3RHC A;  2PPT A;  4XTS A;  2YNX A;  2V1M A;  2PVQ A;  3ZIV A;  4HOJ A;  1U87 A;  3P2A A;  4J56 E;  3G9B A;  1B8X A;  1V98 A;  4KAE A;  1ERV A;  3FYG A;  4X43 A;  1M3I A;  4I5Q A;  2G2Q A;  2LNT A;  3A5I A;  1FAA A;  2M72 A;  1ZYN A;  4PUA A;  2DKI A;  1FVJ A;  2I3Y A;  5IOX A;  5DVB A;  3C1S A;  2CVD A;  3FMW A;  4KE3 A;  4NV2 A;  2E2G A;  4TXO B;  4AJ8 A;  3VLN A;  5G31 A;  1G7E A;  3BCI A;  4V2L A;  1ERT A;  2L4Q A;  4TKY A;  1AQW A;  2GZY A;  1T00 A;  1HNA A;  2FUG 2;  2C8U A;  5H5Q A;  1YJ6 A;  3ZMK A;  3ED3 A;  1G6W A;  2CAQ A;  2DKH A;  4POM A;  2C0F A;  4BIK A;  2HE3 A;  4BWQ A;  2KP2 A;  5KOW A;  5A4W A;  1UN2 A;  1H4O A;  4MZB A;  3GKK A;  3I43 A;  5D9T A;  1XWG A;  5IMF A;  11GS A;  5AN1 A;  1A0F A;  1ZZY A;  1V40 A;  2QA2 A;  4DSQ A;  2VL9 A;  2H01 A;  3FW2 A;  3WGD A;  2QKE A;  4O5Q A;  3D5J A;  4K0N A;  4N0V A;  2HNL A;  1FW1 A;  1WP0 A;  4V2N A;  3QD9 A;  1TRS A;  1TTZ A;  3F6D A;  3IA1 A;  2GSR A;  1OAZ A;  1HYU A;  5FHI A;  2L5L A;  1USB A;  3J7Y b;  1K0B A;  1XZO A;  2H8L A;  4I2T A;  1ML6 A;  4TR1 B;  4EDY A;  3Q74 A;  2HZE A;  4ZBD A;  6GSX A;  5ELG A;  2BTO T;  1DBY A;  4AJ6 A;  4D73 B;  2VUP A;  3TRP A;  1TK0 B;  3TJF A;  2OBK A;  1I9D A;  3TJK A;  3HA9 A;  2PBJ A;  4L0W A;  3LSZ A;  3DXB A;  2MMZ A;  4ZB6 A;  4ZXG A;  1OYJ A;  2FNO A;  1VF3 A;  2JZR A;  5D93 A;  4EO3 A;  4GLT A;  3D22 A;  4PNG A;  2H1D A;  3SBC A;  2B5Y A;  2LUS A;  3GX8 A;  2E2M A;  1S3A A;  3TKS C;  4EKZ A;  4G0K A;  5G2Z A;  4HS1 A;  5KN1 A;  3TKS E;  1A23 A;  1U3A A;  3TKP A;  4RUV A;  1K0C A;  1EWX A;  2A4V A;  5IMC A;  4BVX B;  2I4A A;  1GRX A;  4I97 A;  1Z9H A;  5EPF A;  1NW2 A;  2AUV A;  2VM2 A;  4ZL7 A;  2CVB A;  2MZC A;  4NV5 A;  5GAP D;  2OE0 A;  1QGV A;  1AIU A;  4MJE A;  3KD0 A;  1GL8 A;  3LEF A;  1FOH A;  1O85 A;  2O87 A;  1OC8 A;  2QC7 A;  3GIX A;  2CA8 A;  1KNG A;  3VPT A;  3KIJ A;  2YJH A;  2KHP A;  3O3T A;  4TVE A;  3DWV A;  2A2S A;  3G7Y A;  5LD0 A;  4JR4 A;  1X9M B;  4RQR A;  4IGJ A;  1YY7 A;  2H19 A;  2X8G A;  3HVV A;  2OKA A;  2EIO A;  4NXI A;  4ECJ A;  4KCE A;  3FR6 A;  4CY8 A;  5BRT A;  4PUR A;  1T3B A;  5AIS A;  2CZ2 A;  2OE1 A;  5G30 A;  1W4V A;  1Z7P A;  4YH2 A;  1N8J A;  2OA7 A;  3EU3 A;  1SK0 A;  5CRG A;  4IS0 A;  2F8A A;  4N11 A;  4RI6 A;  3L9V A;  4L5O A;  1SL0 B;  2PGT A;  3G7I A;  2YZH A;  4KND A;  2WB9 A;  2NBS A;  2H74 A;  1K0A A;  1G0T A;  2GQL A;  5DJM A;  5IMZ A;  1ERU A;  2P0G A;  1ABA A;  1PA3 A;  4CDO A;  1QFN A;  3LW9 A;  2IFQ B;  3FK8 A;  3H93 A;  5D9V A;  2JZT A;  4F03 A;  4TN8 A;  1CQG A;  2H0I A;  4XS4 B;  2WFC A;  1M9B A;  5DAL B;  3ZRE A;  3F4S A;  1K0M A;  3F0I A;  2YWM A;  4LLR A;  1S3D A;  5CYY A;  4IBP A;  1EZK A;  2IPA A;  3KZQ A;  2X8C A;  4FYB A;  4EXJ A;  1ZYQ B;  4PTS A;  3EMP A;  3BOA A;  1FO5 A;  3EWL A;  1ZYE A;  2LKU A;  3ME8 A;  1XWC A;  3HZ8 A;  4OFM A;  6GSY A;  4IW9 A;  2IIY A;  1A8L A;  3M3M A;  2HSH A;  4I2U A;  1DE2 A;  1IYH A;  3C8E A;  2DSA A;  2C0D A;  2C0G A;  3S9F A;  2VIM A;  4BL7 A;  3GFK A;  4TRX A;  4E8H A;  4F9Z A;  3H8Q A;  2YV9 A;  2DJJ A;  3M0F A;  4MP4 A;  2OE3 A;  2WCI A;  10GS A;  4K2D A;  1PN0 A;  4E8E A;  3VWV A;  3PIN A;  2K6V A;  4JE1 A;  1ZL9 A;  2O7K A;  2V2G A;  4Q5R A;  2GST A;  2LTK A;  3A5W A;  2JSZ A;  4LMV A;  2HZF A;  3GST A;  4PQI A;  3U5R E;  4KDX A;  4KW6 A;  1DE1 A;  5IOW A;  2F8F A;  2B3S A;  3TKQ A;  3MYD A;  3VFI A;  1FHE A;  3M9K A;  3UJ1 A;  1LU4 A;  3TJB A;  2PVO C;  3RPN A;  4MPF A;  3E9J B;  4Z7X A;  4K7I A;  2AAW A;  5B6M A;  3EVI A;  3UMA A;  1A2M A;  4ZIJ A;  3HZ4 A;  1M2B A;  3MAK A;  13GS A;  1GUM A;  5J3R A;  1WE0 A;  2GZZ A;  1ZYP A;  4HZ4 A;  12GS A;  4KSM A;  1B9X C;  3C7M A;  1Z7R A;  3MIX A;  1SD9 A;  3WT1 A;  3QAG A;  5ECP B;  1HD2 A;  4G2E A;  2LJR A;  3IHQ A;  2P31 A;  3A3T A;  5FWG A;  1YZX A;  2C80 A;  4PNF A;  3KGK A;  4HZ2 A;  4IEL A;  2GSQ A;  1XOB A;  1PFO A;  2LRT A;  4EF0 A;  4G19 A;  4GTU A;  2GGT A;  3ZFB A;  4DSR A;  4F0C A;  4IP6 A;  1K0D A;  4XRD A;  4X1U A;  5CRH A;  1BED A;  2IMK A;  5DJL A;  1SKW B;  4YQM A;  2CT6 A;  3CXG A;  3APO A;  1SD8 A;  2VOC A;  5B6N A;  3CTG A;  1O7U A;  2VCX A;  1TRW A;  1SL1 B;  4BVY B;  3KM6 A;  4AGS A;  1K3Y A;  1N2A A;  3UAR A;  2YJ7 A;  3TJG A;  1TI1 A;  1SEN A;  2X64 A;  3EU4 A;  1JZW A;  3LFL A;  2EIR A;  2WGR A;  3RPP A;  3HVX A;  2R4V A;  2MBS A;  2ON7 A;  3QAW A;  3BJ5 A;  2C3T A;  2JSY A;  4GCI A;  1SL2 B;  2XHF A;  3I69 A;  4XIH A;  1NHY A;  2FY6 A;  4DSS B;  5C04 A;  2VL2 C;  1YQ1 A;  3LXZ A;  1J08 A;  5AIV A;  2B5X A;  2H6X A;  1V57 A;  5DAK B;  1OC9 A;  4FIW A;  1BX9 A;  1J0F A;  1G7O A;  1RK4 A;  3IOS A;  3W6G A;  2HI7 A;  4IKH A;  5G5E A;  2LRC A;  3C73 A;  3LWA A;  2P5Q A;  1VF4 A;  4IP1 A;  3KP8 A;  1AQX A;  3IAM 2;  4LL4 B;  1PSQ A;  1EP8 A;  5LCZ A;  4FO5 A;  3HJO A;  1TOF A;  4P3Y B;  4EC0 A;  1GTU A;  3IC4 A;  16GS A;  3TRX A;  2XBQ A;  2ZNM A;  1T7P B;  4HU9 A;  1SU9 A;  3L9S A;  3IR4 A;  2IME A;  2H72 A;  2LEG A;  4RQX A;  4TR3 A;  4JRR A;  1QXH A;  5COH A;  1ACV A;  3CSJ A;  2HRF A;  4ECC A;  3ZML A;  1SKR B;  3FZA A;  1GH2 A;  2VLV A;  5CRW A;  5ECO B;  5IMD A;  3L9U A;  4WBR D;  1EP7 A;  4HU7 A;  2H30 A;  2B7J A;  4IJ3 A;  4WR4 A;  3GKX A;  1O8W A;  4MMM A;  2O8V B;  3QOU A;  4LMW A;  1GLP A;  2L4C A;  2QSI A;  1TXX A;  3MWH A;  3BD2 A;  1NSW A;  3DVX A;  2C4J A;  1AUC A;  3WYW A;  1OKT A;  3DGQ A;  1THX A;  3WGX A;  1JFU A;  4WXT A;  3LXT A;  4EIQ A;  3TGZ A;  2X8H A;  3FKF A;  3F6F A;  3CTF A;  5ECQ B;  4Q5Q A;  1PGT A;  1EEM A;  1T1V A;  4K7O A;  1SJZ A;  1EGO A;  5CAX A;  3D4T A;  3KXO A;  3IAS 2;  20GS A;  2RII A;  2FHE A;  2VAF A;  1GUH A;  5DBQ A;  4YQU A;  2VLT A;  3I6A A;  2TIR A;  2QGV A;  2YOI A;  2GQM A;  1TI3 A;  1BQ7 A;  1BYE A;  4Q5F A;  4TR1 A;  2LJA A;  4MF6 A;  1GUL A;  4K7N A;  2H0H A;  4LA1 A;  2XC2 A;  2OAD A;  4D73 A;  2R0C A;  1M99 A;  2C3Q A;  2JU5 A;  4Z2U A;  4KB3 A;  2PUK C;  1E2Y A;  2PWJ A;  3H1N A;  4N30 A;  2VCV A;  3R3E A;  22GS A;  5JCG A;  3O76 A;  2NTO A;  2V6K A;  4HJ2 A;  4EE0 A;  3L4N A;  7GSS A;  4YAP A;  4CHS A;  1OE7 A;  1QK8 A;  2D2Z A;  2DMM A;  4MK3 A;  4WBJ A;  5D9X A;  2BJX A;  3NOF A;  1KTE A;  1THO A;  5LNK e;  4EUY A;  1T4Y A;  3D0Z A;  4O32 A;  5KEJ A;  3EIN A;  4BVX A;  1GSD A;  3KMO A;  3TCO A;  2LNS A;  3N9J A;  5ECL B;  1B9Y C;  4JU5 A;  1B4Q A;  5IO2 A;  1VF2 A;  4HEA 2;  5IMA A;  1I5G A;  2RM6 A;  1TRU A;  1XWK A;  1R5A A;  3VK9 A;  3GH9 A;  1A2L A;  2H73 A;  5CRE A;  2QA1 A;  1M2D A;  2H71 A;  2CX4 A;  4MCU A;  2LS5 A;  3ZYW A;  3FRC A;  3QR6 A;  3KP9 A;  2VCQ A;  1XW5 A;  2L59 A;  1F37 A;  2DIZ A;  3CQF A;  5J41 A;  5ECR B;  2I1U A;  4N10 A;  4WR5 A;  2X49 A;  4ID0 A;  2WJU A;  5D8I A;  5IQY A;  3A2V A;  3C71 A;  1V2A A;  1FB0 A;  3ERG A;  4O5R A;  4L8E A;  2CX3 A;  1BJX A;  2VL3 A;  2VCW A;  2X99 A;  3FZ9 A;  4RI7 A;  2IJY A;  2HZE B;  4NHZ A;  3QDN A;  5HR2 A;  3HHV A;  3ZTL A;  2G0F A;  3CMI A;  1JZD A;  2HSY A;  2WUL A;  3LG6 A;  4HSC X;  2L5O A;  1O81 A;  2F3M A;  3R2Q A;  2DJ1 A;  3CRT A;  1XVW A;  1R7H A;  3D21 A;  1F3A A;  6GSS A;  3GUS A;  2WRT A;  2DIY A;  2P5R A;  4KDY A;  4WKW A;  4YKF A;  3BBY A;  2CV4 A;  2IMD A;  1GWC A;  2XPE A;  3CRU A;  3TB2 A;  1YEX A;  5GST A;  1V58 A;  2H1G A;  5E4W A;  1T8E B;  3GTU B;  1TP9 A;  5H5R A;  1XFL A;  3TOU A;  3TKR A;  3MNG A;  4DEJ A;  4K5R A;  2IFQ A;  1UA5 A;  4L0U A;  2AHE A;  1F9M A;  1K0N A;  1XPV A;  3KH7 A;  5DAL A;  2C1Y A;  4IN0 A;  1A0R P;  4JBB A;  1WOU A;  4EVM A;  2R5G A;  3EMX A;  3UVH A;  4O7H A;  2K9F A;  4OWY A;  3LJR A;  1BG5 A;  3DD3 A;  3ME7 A;  1F3B A;  5KOX A;  1FVK A;  4WEY A;  3UEM A;  1WIK A;  4ICY A;  1CQH A;  5C00 A;  5A4U A;  3HJP A;  4GST A;  2JAC A;  4H86 A;  4TR4 A;  4KA0 A; 
#chains in the Genus database with same CATH homology
 5HQP A;  1TDI A;  2YP6 A;  5J9C A;  5J4U A;  3UAP A;  2YCD A;  1X5D A;  1TU8 A;  2K8S A;  3QPM A;  4PX1 A;  1M0U A;  2DLX A;  3PH9 A;  4OO4 A;  3HYP A;  3DKS A;  5GZZ B;  1SJ6 A;  1B48 A;  2R3X A;  5L71 A;  1ZCP A;  3EC3 A;  1O6J A;  4X0X A;  3GHA A;  3ZLP A;  1WPI A;  4MAB A;  1QQ2 A;  2NVL A;  3ZL5 A;  4K6X A;  4XCS A;  3PR8 A;  3IXR A;  2V41 A;  2HRN A;  4BA7 A;  4ECI A;  4KCA A;  3IDV A;  3F9U A;  2JL4 A;  4CW9 A;  2MMA A;  1OKD A;  2GLR A;  3L0H A;  4MJC A;  3Q19 A;  5JWQ B;  1J9B A;  2RLI A;  4AF2 A;  4ECB A;  3DIE A;  1MDK A;  4FYC A;  4G0L A;  4HQZ A;  2KUC A;  1ON4 A;  2LJK A;  2GQK A;  1A2J A;  5CO3 A;  1AAZ A;  3ZZX A;  3Q6O A;  1OC3 A;  2NPB A;  5D96 A;  3W8S A;  2CAI A;  3TOT A;  2DML A;  4PQH A;  1EOG A;  3KTL A;  3A2X A;  1PKW A;  5A4V A;  4ZIL A;  1WWJ A;  3GKM A;  1B4P A;  3KEB A;  2L57 A;  1PD2 1;  2EC4 A;  5ELA A;  2Z9S A;  3D4M A;  2PN8 A;  3DVW A;  3FR9 A;  3U6V A;  4OCE A;  4DVC A;  4BPY A;  4WF5 A;  1S3C A;  1JLW A;  1FB6 A;  2B1K A;  4ZBA A;  2L6C A;  1JHB A;  1UC7 A;  5KN2 A;  4MDC A;  1GSU A;  2H66 A;  2FWH A;  5EVO A;  3GKN A;  4MF7 A;  1LJR A;  3IRA A;  5ECN B;  3LGC A;  2FGX A;  1XVQ A;  1AC1 A;  3IHG A;  3TDG A;  3KTB A;  3IK9 A;  2LST A;  3GMF A;  5IIZ A;  2J23 A;  1TJD A;  4AJ7 A;  1UVZ A;  4NPB A;  3F3Q A;  4DSS A;  2E0Q A;  2V32 A;  4OFT A;  1Y6E A;  5DDL A;  2DJ3 A;  3EUR A;  3ERF A;  2R0P A;  3HD5 A;  4J2F A;  5A5K A;  5HFG A;  5HR3 A;  1VGL A;  3HXS A;  2LV3 A;  1YEP A;  2J9H A;  2K18 A;  3KJY A;  2O85 A;  4ML1 A;  1JLV A;  3QFB C;  5ECI B;  2VCZ A;  2PMT A;  5B8A A;  4A5P A;  4GWR A;  2A4H A;  1TRV A;  1ERW A;  3KH9 A;  3HCZ A;  5JCU A;  3P90 A;  14GS A;  2GDR A;  2HRK A;  4MLY A;  3FEU A;  19GS A;  2FWF A;  5KN0 A;  2DJK A;  1GP1 A;  2OBI A;  2AJQ B;  3SWL A;  1BAY A;  2OAC A;  1PX7 A;  5IMV A;  2H75 A;  5F06 A;  3VWU A;  4OFN A;  3PPU A;  1YF1 A;  2N5F A;  3OR5 A;  4GXZ A;  4G10 A;  3WD6 A;  2M80 A;  2UZ8 A;  1HQO A;  3H4K A;  2F51 A;  4YKG A;  3FZ4 A;  2GSS A;  1V9W A;  2GS3 A;  1H75 A;  1R4W A;  3VWX A;  4Z2T A;  5HFI A;  4TXO A;  1U88 A;  2H1A A;  3CSI A;  2CQ9 A;  2EIQ A;  3AY8 A;  3P7X A;  3TJJ A;  1A24 A;  4POB A;  4KX4 A;  5INY A;  4XS6 A;  1MD4 A;  1R5P A;  1OVN A;  1EV9 A;  1OC9 B;  3UBK A;  4G9H A;  3TRQ A;  1XXU A;  1F2E A;  3US3 A;  3VUR A;  4EIP A;  4KH7 A;  4MPG A;  5ID2 B;  3DYR A;  3HVS A;  4I6X A;  1KBN A;  2HSM A;  5KN3 A;  1DSB A;  3F63 A;  2MBT A;  4J57 E;  1U3I A;  3GN3 A;  2VD1 A;  2YPM A;  3D6I A;  4PXO A;  3VI7 A;  2IN3 A;  3CYN A;  3MSZ A;  4F0B A;  4MH2 A;  4OCF A;  1MDJ A;  4QL7 A;  1T4Z A;  1GSY A;  2KP1 A;  1W89 A;  5G5F A;  3C1R A;  4Z2R A;  1M7T A;  2AV4 A;  1WMJ A;  1EV4 A;  2YWO A;  4K0G A;  1HNC A;  4ZL8 A;  1PMT A;  2DC5 A;  4ULX A;  3HY2 A;  4WET A;  2HYX A;  3VI5 A;  4V1A p;  2XPD A;  1R26 A;  3M9J A;  1AQV A;  2HLS A;  2LQQ A;  3UBL A;  5IPH A;  1K3O A;  3A2W A;  1SK2 A;  3FZ5 A;  4K1F A;  1KEB A;  1Z6N A;  1GTI A;  1JZO A;  3I9V 2;  3E0U A;  2H70 A;  4ZB9 A;  3VWW A;  3ISO A;  5ENU A;  4FYU A;  1K0O A;  4LL1 B;  1MEK A;  4IHU A;  2R2J A;  2VLU A;  3GL3 A;  4V2M A;  4ILF A;  3H79 A;  3FR3 A;  4ISD A;  3ZVJ D;  4XS1 A;  1EGR A;  3DRN A;  4KSO A;  1ZGN A;  2HT9 A;  4XHM A;  4FQU A;  1WRY A;  4MZW A;  2OJL A;  2B6M A;  5G1K A;  1PL2 A;  1FG4 A;  5B7C A;  5DCG A;  1MDI A;  3WGE A;  1NM3 A;  1XWB A;  2WS2 A;  4GQC A;  3IV4 A;  2TRC P;  3KCM A;  4KGI A;  3F3R A;  3EYT A;  4JR6 A;  1EOH A;  4QL9 A;  3IPZ A;  1YF0 A;  2B1L A;  4NHW A;  3CBU A;  3GV1 A;  2GVP A;  4MZC A;  2PER A;  2VD0 A;  5DQY A;  3GSS A;  1TW9 A;  4ZL9 A;  2YZU A;  2DJ2 A;  3GTU A;  5J9B A;  5DCH A;  4HJM A;  2YWN A;  5F05 A;  4TXV A;  2BMX A;  2AYT A;  3RHB A;  3LYK A;  4PGT A;  3IE3 A;  3HKR A;  5IM9 A;  2H76 A;  3DEX A;  4X4J A;  3KMN A;  2FWG A;  1PX6 A;  1MTC A;  1URM A;  3HJM A;  2E7P A;  2YN1 A;  5CP1 A;  3EE2 A;  4MA9 A;  5J5N A;  3M8N A;  4CY6 A;  5CNW A;  1LBK A;  2DJ0 A;  4GF0 A;  4ZBB A;  4ML6 A;  1O8X A;  2FCH A;  2REM A;  2AB6 A;  2IWT A;  2A2R A;  5ECH B;  4XS4 A;  2VO4 A;  4KDU A;  2R37 A;  1AW9 A;  5BMU A;  1JZR A;  3ERW A;  1QUW A;  1PKZ A;  4K2X A;  4TR0 A;  1Q98 A;  1X9W B;  2HRA A;  2IMI A;  4MJB A;  5EY6 A;  3NIV A;  5CRD A;  1AXD A;  3GL5 A;  4OO5 A;  4POK A;  1EEJ A;  1Q4J A;  5DQS A;  3J7Y k;  4PQ1 A;  3E3E A;  2KOK A;  4YAV A;  2M46 A;  2HXK A;  4EL1 A;  5FT3 A;  4MJA A;  1VF1 A;  1PRX A;  1FOV A;  3LYP A;  2GZP A;  5HFK A;  2VCT A;  4IVF A;  2ZCT A;  4I8B A;  4F82 A;  3IK7 A;  4IQ1 A;  3ZIJ A;  2CVK A;  1XIY A;  3GUR A;  2R6K A;  1XWA A;  3LQ7 A;  2DBC A;  4QQ7 A;  1ILO A;  2JAD A;  1TKD B;  3N5O A;  5ECK B;  4YQV A;  1X0R A;  2IMF A;  3TUE A;  1TK5 B;  4KUN A;  1GTB A;  1SJI A;  2PU9 C;  4BWS A;  3DML A;  1A8Y A;  2MMN A;  1OE8 A;  1WJK A;  2FA4 A;  5F8B A;  3IBH A;  2HFD A;  1M2A A;  3RBT A;  5HR0 A;  4MF5 A;  1GNE A;  1Z3E A;  4EDZ A;  2F9S A;  5D9W A;  1DUG A;  6GSU A;  1M9A A;  1SKS B;  4HUA A;  4Q5N A;  2VL2 A;  1XW6 A;  2H6Y A;  2RUF A;  1ZMA A;  5IO0 A;  3FHK A;  1XBS A;  4O92 A;  1NHO A;  1X5C A;  2YAN A;  4MH3 A;  1TK8 B;  2GT6 A;  3M1G A;  3FY7 A;  3MDK A;  3QAV A;  2B7K A;  3RAZ A;  5GSS A;  5AIX A;  3UVT A;  1Z5Y E;  4FH8 A;  2FLS A;  4PUF C;  2R0G A;  3GA4 A;  2H1B A;  2RM5 A;  1GSQ A;  3P8W A;  4TW5 A;  2ZUP A;  4L5L A;  4K5S A;  2X4A A;  4OD7 A;  9GSS A;  5B8B A;  3IC8 A;  1GUK A;  2ON5 A;  3GX0 A;  1XCC A;  3EPT A;  1GLQ A;  4USS A;  3NZN A;  2N5A A;  3K8N A;  3UOM A;  2H0G A;  2GT5 A;  4V1A g;  4ZB8 A;  2RUE A;  1SK1 A;  2IL3 A;  2ALB A;  3GRX A;  5IPG A;  3CSH A;  2NDO A;  4NMU A;  1YDK A;  1E6B A;  4N0Z A;  2LRN A;  4F2I A;  2H6Z A;  1G6Y A;  4BL7 B;  4POL A;  2VM1 A;  3LOR A;  2LQO A;  1IYI A;  3APQ A;  3Q18 A;  4HDE A;  3GYK A;  3HDC A;  4GQF A;  4KF9 A;  1XW9 A;  4BVY A;  1GSS A;  3QFA C;  1GTA A;  4GSS A;  2V6O A;  4ACS A;  4MNN A;  1GSE A;  4HQS A;  5ECS A;  6GST A;  4IQA A;  1C72 A;  5GAN D;  4WF4 A;  1U6T A;  3BCK A;  1RQM A;  1XOA A;  2N5B A;  3PGT A;  2YWI A;  4G0I A;  3W8J A;  3JCM L;  1MD3 A;  1F6M C;  3QCP A;  2MMO A;  1TU7 A;  5DAK A;  5F07 A;  4IJI A;  2GTU A;  1Z6M A;  17GS A;  2I81 A;  3V1W A;  5E59 A;  2ES7 A;  2KLX A;  2K8V A;  4XRA A;  3F4T A;  1X9S B;  2WZ9 A;  1O73 A;  5G1L A;  1ZOF A;  1GSF A;  5D73 A;  6GSV A;  2C0E A;  4NAX A;  5ECM B;  1PL1 A;  18GS A;  1SYX A;  3ZVJ A;  1QMV A;  2JZS A;  4HI7 A;  4K8M A;  3ZRD A;  3F8U A;  2TRX A;  2O89 A;  1PN9 A;  2FA8 A;  3VPQ A;  6GSW A;  5JWR B;  2WDU A;  5F0G A;  4GSN A;  8GSS A;  3L78 A;  4OMV A;  1VRS D;  1HNB A;  3UL3 A;  3UIW A;  5ABR A;  4JZQ A;  5HR1 A;  1GNW A;  3ZFL A;  2L6D A;  3ZIT A;  4TOP A;  3APS A;  5EL8 A;  2B5E A;  2XBI A;  1X5E A;  2CZ3 A;  5JCW A;  1SYR A;  3O6T A;  1K3L A;  3WT2 A;  2A2P A;  1ST9 A;  2FWE A;  3G7J A;  3GH6 A;  2FD3 A;  2YV7 A;  5AGY A;  3QMX A;  1YKC A;  5ID2 A;  3TKS A;  2C3N A;  5H5S A;  1PQN A;  4K9Z A;  1RW1 A;  2MYG A;  3GNJ A;  4O5U A;  4NWY A;  3RDW A;  5JWO B;  4JED A;  2I9H A;  4GRF A;  3F4R A;  1Y25 A;  1YKA A;  3RHC A;  2PPT A;  4XTS A;  2YNX A;  2V1M A;  2PVQ A;  3ZIV A;  4HOJ A;  1U87 A;  3P2A A;  4J56 E;  3G9B A;  1B8X A;  1V98 A;  4KAE A;  1ERV A;  3FYG A;  4X43 A;  4I5Q A;  2G2Q A;  2LNT A;  3A5I A;  1FAA A;  2M72 A;  1ZYN A;  4PUA A;  2DKI A;  1FVJ A;  2I3Y A;  5IOX A;  5DVB A;  3C1S A;  2CVD A;  3FMW A;  4KE3 A;  4NV2 A;  2E2G A;  4TXO B;  4AJ8 A;  3VLN A;  5G31 A;  1G7E A;  3BCI A;  4V2L A;  1ERT A;  2L4Q A;  4TKY A;  1AQW A;  2GZY A;  1T00 A;  1HNA A;  2FUG 2;  2C8U A;  5H5Q A;  1YJ6 A;  3ZMK A;  3ED3 A;  1G6W A;  2CAQ A;  2DKH A;  4POM A;  2C0F A;  2HE3 A;  4BWQ A;  2KP2 A;  5KOW A;  5A4W A;  1UN2 A;  1H4O A;  4MZB A;  3GKK A;  3I43 A;  5D9T A;  1XWG A;  5IMF A;  11GS A;  5AN1 A;  1A0F A;  1ZZY A;  1V40 A;  2QA2 A;  4DSQ A;  2VL9 A;  2H01 A;  3FW2 A;  3WGD A;  2QKE A;  4O5Q A;  3D5J A;  4K0N A;  4N0V A;  2HNL A;  1FW1 A;  1WP0 A;  4V2N A;  3QD9 A;  1TRS A;  1TTZ A;  3F6D A;  3IA1 A;  2GSR A;  1OAZ A;  1HYU A;  5FHI A;  2L5L A;  1USB A;  3J7Y b;  1K0B A;  1XZO A;  2H8L A;  4I2T A;  1ML6 A;  4TR1 B;  4EDY A;  3Q74 A;  2HZE A;  4ZBD A;  6GSX A;  5ELG A;  2BTO T;  1DBY A;  4AJ6 A;  4D73 B;  2VUP A;  3TRP A;  1TK0 B;  3TJF A;  2OBK A;  1I9D A;  3TJK A;  3HA9 A;  2PBJ A;  4L0W A;  3LSZ A;  3DXB A;  2MMZ A;  4ZB6 A;  4ZXG A;  1OYJ A;  2FNO A;  1VF3 A;  2JZR A;  5D93 A;  4EO3 A;  4GLT A;  3D22 A;  4PNG A;  2H1D A;  3SBC A;  2B5Y A;  2LUS A;  3GX8 A;  2E2M A;  1S3A A;  3TKS C;  4EKZ A;  4G0K A;  5G2Z A;  4HS1 A;  5KN1 A;  3TKS E;  1A23 A;  1U3A A;  3TKP A;  4RUV A;  1K0C A;  1EWX A;  2A4V A;  5IMC A;  4BVX B;  2I4A A;  1GRX A;  4I97 A;  1Z9H A;  5EPF A;  1NW2 A;  2AUV A;  2VM2 A;  4ZL7 A;  2CVB A;  2MZC A;  4NV5 A;  5GAP D;  2OE0 A;  1QGV A;  1AIU A;  4MJE A;  3KD0 A;  1GL8 A;  3LEF A;  1FOH A;  1O85 A;  2O87 A;  1OC8 A;  2QC7 A;  3GIX A;  2CA8 A;  1KNG A;  3VPT A;  3KIJ A;  2YJH A;  2KHP A;  3O3T A;  4TVE A;  3DWV A;  2A2S A;  3G7Y A;  5LD0 A;  4JR4 A;  1X9M B;  4RQR A;  4IGJ A;  1YY7 A;  2H19 A;  2X8G A;  3HVV A;  2OKA A;  2EIO A;  4NXI A;  4ECJ A;  4KCE A;  3FR6 A;  4CY8 A;  5BRT A;  4PUR A;  1T3B A;  5AIS A;  2CZ2 A;  2OE1 A;  5G30 A;  1W4V A;  1Z7P A;  4YH2 A;  1N8J A;  2OA7 A;  3EU3 A;  1SK0 A;  5CRG A;  4IS0 A;  2F8A A;  4N11 A;  4RI6 A;  3L9V A;  4L5O A;  1SL0 B;  2PGT A;  3G7I A;  2YZH A;  4KND A;  2WB9 A;  2NBS A;  2H74 A;  1K0A A;  1G0T A;  2GQL A;  5DJM A;  5IMZ A;  1ERU A;  2P0G A;  1ABA A;  1PA3 A;  4CDO A;  1QFN A;  3LW9 A;  2IFQ B;  3FK8 A;  3H93 A;  5D9V A;  2JZT A;  4F03 A;  4TN8 A;  1CQG A;  2H0I A;  4XS4 B;  2WFC A;  1M9B A;  5DAL B;  3ZRE A;  3F4S A;  1K0M A;  3F0I A;  2YWM A;  4LLR A;  1S3D A;  5CYY A;  4IBP A;  1EZK A;  2IPA A;  3KZQ A;  2X8C A;  4FYB A;  4EXJ A;  1ZYQ B;  4PTS A;  3EMP A;  3BOA A;  1FO5 A;  3EWL A;  1ZYE A;  2LKU A;  3ME8 A;  1XWC A;  3HZ8 A;  4OFM A;  6GSY A;  4IW9 A;  2IIY A;  1A8L A;  3M3M A;  2HSH A;  4I2U A;  1DE2 A;  1IYH A;  3C8E A;  2DSA A;  2C0D A;  2C0G A;  3S9F A;  2VIM A;  4BL7 A;  3GFK A;  4TRX A;  4E8H A;  4F9Z A;  3H8Q A;  2YV9 A;  2DJJ A;  3M0F A;  4MP4 A;  2OE3 A;  2WCI A;  10GS A;  4K2D A;  1PN0 A;  4E8E A;  3VWV A;  3PIN A;  2K6V A;  4JE1 A;  1ZL9 A;  2O7K A;  2V2G A;  4Q5R A;  2GST A;  2LTK A;  3A5W A;  2JSZ A;  4LMV A;  2HZF A;  3GST A;  4PQI A;  3U5R E;  4KDX A;  4KW6 A;  1DE1 A;  5IOW A;  2F8F A;  2B3S A;  3TKQ A;  3MYD A;  3VFI A;  1FHE A;  3M9K A;  3UJ1 A;  1LU4 A;  3TJB A;  2PVO C;  3RPN A;  4MPF A;  3E9J B;  4Z7X A;  4K7I A;  2AAW A;  5B6M A;  3EVI A;  3UMA A;  1A2M A;  4ZIJ A;  3HZ4 A;  1M2B A;  3MAK A;  13GS A;  1GUM A;  5J3R A;  1WE0 A;  2GZZ A;  1ZYP A;  4HZ4 A;  12GS A;  4KSM A;  1B9X C;  3C7M A;  1Z7R A;  3MIX A;  1SD9 A;  3WT1 A;  3QAG A;  5ECP B;  1HD2 A;  4G2E A;  2LJR A;  3IHQ A;  2P31 A;  3A3T A;  5FWG A;  1YZX A;  2C80 A;  4PNF A;  3KGK A;  4HZ2 A;  4IEL A;  2GSQ A;  1XOB A;  2LRT A;  4EF0 A;  4G19 A;  4GTU A;  2GGT A;  3ZFB A;  4DSR A;  4F0C A;  4IP6 A;  1K0D A;  4XRD A;  4X1U A;  5CRH A;  1BED A;  2IMK A;  5DJL A;  1SKW B;  4YQM A;  2CT6 A;  3CXG A;  3APO A;  1SD8 A;  2VOC A;  5B6N A;  3CTG A;  1O7U A;  2VCX A;  1TRW A;  1SL1 B;  4BVY B;  3KM6 A;  4AGS A;  1K3Y A;  1N2A A;  3UAR A;  2YJ7 A;  3TJG A;  1TI1 A;  1SEN A;  2X64 A;  3EU4 A;  1JZW A;  3LFL A;  2EIR A;  2WGR A;  3RPP A;  3HVX A;  2R4V A;  2MBS A;  2ON7 A;  3QAW A;  3BJ5 A;  2C3T A;  2JSY A;  4GCI A;  1SL2 B;  2XHF A;  3I69 A;  4XIH A;  1NHY A;  2FY6 A;  4DSS B;  5C04 A;  2VL2 C;  1YQ1 A;  3LXZ A;  1J08 A;  5AIV A;  2B5X A;  2H6X A;  1V57 A;  5DAK B;  1OC9 A;  4FIW A;  1BX9 A;  1J0F A;  1G7O A;  1RK4 A;  3IOS A;  3W6G A;  2HI7 A;  4IKH A;  5G5E A;  2LRC A;  3C73 A;  3LWA A;  2P5Q A;  1VF4 A;  4IP1 A;  3KP8 A;  1AQX A;  3IAM 2;  4LL4 B;  1PSQ A;  1EP8 A;  5LCZ A;  4FO5 A;  3HJO A;  1TOF A;  4P3Y B;  4EC0 A;  1GTU A;  3IC4 A;  16GS A;  3TRX A;  2XBQ A;  2ZNM A;  1T7P B;  4HU9 A;  1SU9 A;  3L9S A;  3IR4 A;  2IME A;  2H72 A;  2LEG A;  4RQX A;  4TR3 A;  4JRR A;  1QXH A;  5COH A;  1ACV A;  3CSJ A;  2HRF A;  4ECC A;  3ZML A;  1SKR B;  3FZA A;  1GH2 A;  2VLV A;  5CRW A;  5ECO B;  5IMD A;  3L9U A;  4WBR D;  1EP7 A;  4HU7 A;  2H30 A;  2B7J A;  4IJ3 A;  4WR4 A;  3GKX A;  1O8W A;  4MMM A;  2O8V B;  3QOU A;  4LMW A;  1GLP A;  2L4C A;  2QSI A;  1TXX A;  3MWH A;  3BD2 A;  1NSW A;  3DVX A;  2C4J A;  1AUC A;  3WYW A;  1OKT A;  3DGQ A;  1THX A;  3WGX A;  1JFU A;  4WXT A;  3LXT A;  4EIQ A;  3TGZ A;  2X8H A;  3FKF A;  3F6F A;  3CTF A;  5ECQ B;  4Q5Q A;  1PGT A;  1EEM A;  1T1V A;  4K7O A;  1SJZ A;  1EGO A;  5CAX A;  3D4T A;  3KXO A;  3IAS 2;  20GS A;  2RII A;  2FHE A;  2VAF A;  1GUH A;  5DBQ A;  4YQU A;  2VLT A;  3I6A A;  2TIR A;  2QGV A;  2YOI A;  2GQM A;  1TI3 A;  1BQ7 A;  1BYE A;  4Q5F A;  4TR1 A;  2LJA A;  4MF6 A;  1GUL A;  4K7N A;  2H0H A;  4LA1 A;  2XC2 A;  2OAD A;  4D73 A;  2R0C A;  1M99 A;  2C3Q A;  2JU5 A;  4Z2U A;  4KB3 A;  2PUK C;  1E2Y A;  2PWJ A;  3H1N A;  4N30 A;  2VCV A;  3R3E A;  22GS A;  5JCG A;  3O76 A;  2NTO A;  2V6K A;  4HJ2 A;  4EE0 A;  3L4N A;  7GSS A;  4YAP A;  4CHS A;  1OE7 A;  1QK8 A;  2D2Z A;  2DMM A;  4MK3 A;  4WBJ A;  5D9X A;  2BJX A;  3NOF A;  1KTE A;  1THO A;  5LNK e;  4EUY A;  1T4Y A;  3D0Z A;  4O32 A;  5KEJ A;  3EIN A;  4BVX A;  1GSD A;  3KMO A;  3TCO A;  2LNS A;  3N9J A;  5ECL B;  1B9Y C;  4JU5 A;  1B4Q A;  5IO2 A;  1VF2 A;  4HEA 2;  5IMA A;  1I5G A;  2RM6 A;  1TRU A;  1XWK A;  1R5A A;  3VK9 A;  3GH9 A;  1A2L A;  2H73 A;  5CRE A;  2QA1 A;  1M2D A;  2H71 A;  2CX4 A;  4MCU A;  2LS5 A;  3ZYW A;  3FRC A;  3QR6 A;  3KP9 A;  2VCQ A;  1XW5 A;  2L59 A;  1F37 A;  2DIZ A;  5J41 A;  5ECR B;  2I1U A;  4N10 A;  4WR5 A;  2X49 A;  4ID0 A;  2WJU A;  5D8I A;  5IQY A;  3A2V A;  3C71 A;  1V2A A;  1FB0 A;  3ERG A;  4O5R A;  4L8E A;  2CX3 A;  1BJX A;  2VL3 A;  2VCW A;  2X99 A;  3FZ9 A;  4RI7 A;  2IJY A;  2HZE B;  4NHZ A;  3QDN A;  5HR2 A;  3HHV A;  3ZTL A;  2G0F A;  3CMI A;  1JZD A;  2HSY A;  2WUL A;  3LG6 A;  2L5O A;  1O81 A;  2F3M A;  3R2Q A;  2DJ1 A;  3CRT A;  1XVW A;  1R7H A;  3D21 A;  1F3A A;  6GSS A;  3GUS A;  2WRT A;  2DIY A;  2P5R A;  4KDY A;  4WKW A;  4YKF A;  3BBY A;  2CV4 A;  2IMD A;  1GWC A;  2XPE A;  3CRU A;  3TB2 A;  1YEX A;  5GST A;  1V58 A;  2H1G A;  5E4W A;  1T8E B;  3GTU B;  1TP9 A;  5H5R A;  1XFL A;  3TOU A;  3TKR A;  3MNG A;  4DEJ A;  4K5R A;  2IFQ A;  1UA5 A;  4L0U A;  2AHE A;  1F9M A;  1K0N A;  1XPV A;  3KH7 A;  5DAL A;  2C1Y A;  4IN0 A;  1A0R P;  4JBB A;  1WOU A;  4EVM A;  2R5G A;  3EMX A;  3UVH A;  4O7H A;  2K9F A;  4OWY A;  3LJR A;  1BG5 A;  3DD3 A;  3ME7 A;  1F3B A;  5KOX A;  1FVK A;  4WEY A;  3UEM A;  1WIK A;  4ICY A;  1CQH A;  5C00 A;  5A4U A;  3HJP A;  4GST A;  2JAC A;  4H86 A;  4TR4 A;  4KA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...