2I3YA

Crystal structure of human glutathione peroxidase 5
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
188
structure length
188
Chain Sequence
DCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPELNALQEELKPYGLVVLGFPCNQFGKQEPGDNKEILPGLKYVRPGGGFVPSFQLFEKGDVNGEKEQKVFSFLKHSCPHPSEILGTFKSISWDPVKVHDIRWNFEKFLVGPDGIPVMRWSHRATVSSVKTDILAYLKQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epididymal secretory glutathione peroxidase
publication title Crystal structure of human glutathione peroxidase 5
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 54
structure length 188
sequence length 188
ec nomenclature ec 1.11.1.9: Glutathione peroxidase.
pdb deposition date 2006-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00255 GSHPx Glutathione peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2i3yA01
1W4VA 2CX4A 3GX0A 1TTZA 2VUPA 3KD0A 5J5NA 1A0FA 2IJYA 1THOA 1R5PA 10GSA 1BAYA 2K8VA 3LQ7A 1O8WA 2DJ0A 1EP7A 3UVTA 5IIZA 3D0ZA 2YOIA 3R2QA 1V40A 3HD5A 2OBKA 1T00A 3ZITA 1JLVA 4TKYA 2VLVA 4KH7A 3G7IA 1XW9A 1GTBA 3EINA 3Q6OA 2NDOA 2ZCTA 4HEA2 5JWRB 16GSA 2DJ1A 4L0WA 1SK1A 1QFNA 4WXTA 1AAZA 1SL2B 4GQFA 1ABAA 1GH2A 2AAWA 1GULA 5G30A 5CREA 2E0QA 2WB9A 3LXZA 2CQ9A 2PVQA 1YF1A 4X43A 2VCVA 1B8XA 2IIYA 2VCQA 4TN8A 1ERVA 1ZOFA 4I6XA 1OKDA 2PPTA 5ECHB 1SK2A 3ZRDA 4N11A 4JR4A 2AB6A 4MH2A 5DBQA 3CRUA 2YZUA 3M1GA 1ZYEA 4IHUA 2VL9A 1DE2A 2A2SA 3EC3A 1K3OA 4TR1B 3VPTA 2B5YA 2PERA 4ML6A 3TDGA 3D6IA 1BQ7A 3GSSA 1SL1B 3BBYA 4L5OA 2HE3A 3C71A 4MH3A 2ZNMA 4TR1A 2FWHA 4WKWA 3LG6A 1K0NA 4D73B 4O5RA 2R2JA 5JCGA 3QAWA 3IK9A 1M2AA 2J9HA 3FYGA 3ZLPA 3M0FA 5IPGA 3TJJA 2V41A 1GLQA 4TXOA 4F9ZA 4D73A 2VLTA 2VCXA 3GH6A 4Q5NA 2N5AA 3A2VA 1MEKA 4BL7A 5GSSA 2MBTA 2B5EA 1GRXA 2CAIA 4KNDA 4RUVA 4F0BA 2L59A 2PVOC 2GT5A 3LFLA 3A2WA 2P5QA 2BTOT 4MLYA 1TW9A 1Y6EA 1XOAA 3F4RA 1X5EA 2B1LA 5IMVA 2ON7A 3FZ9A 2XBIA 1A2LA 3L9VA 4RI7A 2G0FA 1B4PA 4ECJA 1BYEA 2K18A 4IJ3A 1SJZA 2H71A 3CMIA 2H72A 4GSSA 4HZ2A 4I97A 3ZTLA 2OE1A 2MMZA 4QQ7A 4K0NA 2KP2A 4GWRA 3UAPA 2JL4A 3GUSA 2WFCA 4PQIA 2H30A 1SJIA 2B1KA 2VAFA 4CW9A 1MDJA 1K3YA 3DXBA 1MTCA 3NIVA 3CXGA 5HFGA 1VGLA 1OVNA 5B6MA 1HYUA 4DSSB 4ECIA 3ZMKA 1O81A 4PQHA 2C0FA 5ECMB 3VK9A 4OCFA 4IJIA 1XOBA 4KSOA 2FY6A 3PINA 2AV4A 3UEMA 5DJMA 3UBKA 4XS1A 2FWFA 5IO2A 2JSYA 3UJ1A 4DSSA 2CA8A 1N8JA 5B8AA 3VLNA 8GSSA 4KAEA 2VCZA 1GWCA 2YPMA 1JFUA 1AIUA 2F9SA 3HYPA 3UMAA 1VRSD 4KDYA 2KP1A 4PNGA 1G0TA 2X8CA 3QDNA 4BWSA 4HU9A 1YKCA 2FA8A 3TKRA 2WRTA 4AGSA 3L9UA 2LQOA 3Q19A 4HDEA 1F3AA 4MABA 3ZIVA 4EDYA 4IP1A 5G1KA 4XS4B 2R4VA 2YCDA 2VD1A 5D8IA 4G10A 5G2ZA 5FHIA 5E4WA 3TGZA 3TJKA 1V2AA 1XWAA 4JBBA 2H1DA 1JZWA 3QCPA 4XS4A 4E8EA 2VM2A 1RQMA 2P31A 1OYJA 5EPFA 2HSYA 3APOA 3NOFA 1GTUA 4DVCA 3KTLA 4OFNA 1U87A 2LRTA 2V6KA 2FHEA 1FB6A 4NXIA 1RK4A 3L9SA 14GSA 3IXRA 1F3BA 3VWXA 3W8SA 2ALBA 2V2GA 1EZKA 2I81A 2VL2C 4ACSA 4FYBA 3GH9A 2VCWA 2E7PA 2P0GA 3P90A 4KB3A 3DEXA 1OC3A 2Z9SA 1SL0B 4HUAA 2OE3A 4I8BA 3IOSA 2HZFA 5ECNB 3RHBA 3VWUA 3FEUA 1Z7PA 1BG5A 4XRAA 3LORA 2MMOA 2VIMA 3LSZA 1GLPA 20GSA 2PGTA 1J9BA 1HNAA 2A4VA 5DQYA 1SENA 4LLRA 5ABRA 3G7YA 1F9MA 1H75A 3KMOA 5AN1A 1EEMA 2V6OA 4IP6A 4XRDA 1DSBA 1PL2A 4MJAA 3P2AA 4PXOA 2XPDA 4X0XA 4ZBDA 4ZL8A 3TKPA 5DDLA 1EOHA 3DIEA 4KCAA 5CRGA 3TJGA 3G7JA 3ZIJA 1TDIA 4MJCA 3RBTA 1TI1A 2CVDA 1G6YA 4ZB8A 5HQPA 3DWVA 4EC0A 2H76A 5IOXA 4PUFC 1MDKA 1GUHA 2FCHA 4AF2A 1Z6NA 4F2IA 2OA7A 4WR5A 3P7XA 6GSUA 1BJXA 2YN1A 2VL2A 3HXSA 4EDZA 4IS0A 2QSIA 4F0CA 1S3AA 4MF5A 5C04A 2H74A 4GRFA 2YWOA 1Y25A 2M46A 3EURA 4EL1A 5A4UA 1SKRB 2C80A 2FUG2 2M72A 2CX3A 5ID2B 18GSA 3TKSE 5H5RA 2R37A 1YQ1A 3W8JA 2MMAA 2H8LA 5HR1A 1OE7A 2LSTA 4OO5A 5ID2A 1O73A 4MPFA 1SD9A 2GZPA 3KJYA 3DD3A 3H79A 3F63A 2G2QA 2XHFA 4ML1A 1TOFA 3ZL5A 1X9MB 5IMZA 1GP1A 1WRYA 1NM3A 5IMAA 1G7OA 4XTSA 1JZDA 1ZZYA 3D21A 1HNBA 4MA9A 3FW2A 2IMIA 4KX4A 1YJ6A 4HJ2A 1Q4JA 3M9JA 1T1VA 3FZ5A 2ZUPA 3QAGA 2ON5A 4GTUA 1UVZA 2YJ7A 3EMPA 1Z9HA 4O7HA 5A4VA 1GTIA 2GGTA 1PD21 4ZXGA 2CVBA 4V2LA 3ZVJA 2JACA 4V1Ap 2PU9C 3O6TA 5HFKA 3GL3A 5IPHA 3KH7A 4J57E 4IELA 1EP8A 4GSTA 4HZ4A 2WDUA 2QGVA 1RW1A 2WZ9A 5IQYA 3GKNA 2YWNA 3QOUA 4J2FA 4DEJA 1PX7A 3WGDA 4ZB9A 3VI7A 4HI7A 3CTGA 1GNWA 3US3A 4G9HA 4LMWA 2GSSA 1PQNA 4BA7A 1FVKA 2R6KA 2XC2A 2GLRA 4ECBA 4HS1A 4NHZA 1WP0A 5G5FA 4IQ1A 2VLUA 4ZB6A 3QD9A 4NWYA 5CNWA 3LYKA 5JCWA 3DYRA 1J08A 5G5EA 3ZZXA 1W89A 1T4ZA 4TRXA 2H6YA 4KUNA 1EV4A 2C0DA 1CQGA 1HD2A 3IA1A 2H0HA 1M0UA 3GKMA 3HCZA 2HXKA 2GSTA 17GSA 1MD4A 2C3TA 5HR3A 3NZNA 5EVOA 4GF0A 2YP6A 2REMA 2PN8A 2C0GA 2H0GA 5CYYA 3F3QA 3KH9A 2FWGA 5A5KA 4EVMA 2EIQA 2HZEB 3GTUB 3UVHA 4PX1A 2L6CA 12GSA 4G2EA 2N5FA 5C00A 2D2ZA 2YV7A 2NPBA 5D9TA 2HZEA 22GSA 4NMUA 3GTUA 1U3IA 2LUSA 1EV9A 1TU7A 4TXOB 1TU8A 4K7IA 1M99A 4IN0A 3KTBA 2OJLA 1TXXA 2PUKC 3E9JB 4XS6A 5D9WA 5E59A 3EU3A 2TRXA 3D4TA 4YQUA 3CBUA 1FW1A 3GKXA 3F4TA 3IK7A 3JCML 2H6ZA 3VFIA 3M9KA 1KNGA 3GL5A 3EYTA 3WYWA 1NHYA 3TJFA 5G1LA 1A23A 2VD0A 1B9XC 4YAPA 1X5CA 1GTAA 4V2MA 5CRHA 1GUKA 1O8XA 3W6GA 4LA1A 5F05A 1M2DA 4I2TA 3FY7A 1EGOA 1T7PB 1C72A 1VF4A 3TKQA 4K1FA 5ECLB 5GAND 2IFQB 5AISA 1NHOA 2DC5A 1FB0A 1TKDB 2N5BA 3VPQA 4MZBA 3IE3A 4WR4A 2E2MA 3VI5A 2IFQA 4MCUA 3UIWA 2LRCA 3GIXA 1XVWA 2FWEA 6GSTA 3TUEA 4MF7A 5KEJA 5IM9A 5FWGA 3KM6A 5DJLA 2P5RA 3QMXA 5COHA 5F8BA 3S9FA 3IAM2 1WE0A 3WT1A 5B8BA 4NHWA 4IQAA 5AIXA 1K0CA 1R4WA 2YWIA 1SD8A 2XPEA 3HDCA 3C73A 2DIYA 3GKKA 4MF6A 3HZ8A 1TK5B 5KN2A 3GFKA 5F07A 4N0ZA 2X8GA 4Q5QA 2FNOA 1AC1A 1LBKA 1GSDA 11GSA 1DBYA 1KTEA 2I4AA 2GT6A 5FT3A 13GSA 5ECRB 4IVFA 1YY7A 2L4CA 1WPIA 5DALB 5GZZB 3MNGA 1VF2A 3TB2A 2KHPA 2OADA 4KCEA 1AQVA 2GDRA 4ISDA 2C3QA 5DALA 1O6JA 3I6AA 1XWBA 2WJUA 3ERGA 3I43A 1EGRA 5LCZA 4EO3A 3Q18A 2YWMA 4YAVA 7GSSA 1OE8A 1ACVA 2H73A 5F0GA 3C1RA 4HJMA 3LJRA 5J4UA 3TRXA 1XXUA 1ML6A 1QGVA 4J56E 1WMJA 1PA3A 1QUWA 4OCEA 1U3AA 1ERUA 2C0EA 4OD7A 4KSMA 2H01A 5JWQB 1U6TA 1M9AA 4TR4A 1O7UA 4POLA 3F0IA 3EE2A 3GHAA 3TOTA 6GSSA 4BVXA 2RM6A 1T4YA 19GSA 4FIWA 3FR9A 2E2GA 4X1UA 4K2DA 1AQWA 2LJKA 2LKUA 3KGKA 1A8YA 2VL3A 2LJAA 3ZMLA 2VM1A 2JU5A 2DJJA 2GQLA 2H1BA 2JSZA 1AUCA 4OO4A 3N9JA 1YF0A 3EWLA 4IKHA 4YH2A 5CO3A 2DSAA 1F2EA 3FZAA 2GSQA 2PBJA 3HJMA 2YV9A 3ERFA 1ON4A 2ES7A 1ZMAA 5J9BA 1K0DA 2BJXA 4Q5RA 1Z5YE 2YJHA 3WGXA 1GNEA 1TRVA 4TR0A 1X0RA 5CP1A 3DKSA 3MWHA 4K0GA 3TJBA 3E3EA 1E2YA 5D73A 3H8QA 3I9V2 2IMFA 1ILOA 1XBSA 4PNFA 1DUGA 4O32A 4PURA 4ID0A 3C8EA 2JZTA 4N10A 1ZGNA 3VURA 4FO5A 1FAAA 4MPGA 1SKSB 1UC7A 3EMXA 2YANA 4HQSA 4YQVA 1XW6A 2RUEA 2HT9A 2BMXA 4RQXA 4MZWA 2KLXA 3GRXA 4POBA 2TIRA 1KEBA 2I1UA 2B5XA 1GL8A 2F8AA 3WGEA 3OR5A 1URMA 1MD3A 3DGQA 1JHBA 4KA0A 2EIRA 6GSWA 4EE0A 1V98A 3MDKA 4FH8A 2JZRA 2K6VA 3H1NA 1G7EA 3DRNA 3VWWA 3IAS2 1HQOA 4CDOA 4POMA 2IWTA 4JRRA 3HKRA 1K3LA 1M9BA 2B3SA 3FKFA 1B4QA 2RUFA 1Z6MA 1WOUA 2O7KA 3ME8A 4BVYA 4GLTA 1SU9A 4QL9A 2M80A 5IOWA 1YEPA 1R5AA 4TOPA 3IC4A 4LMVA 4MDCA 4WF5A 2RLIA 2F51A 3UBLA 1XPVA 1PGTA 1FOVA 5CRWA 2O8VB 4PQ1A 1XFLA 4WETA 1XIYA 2PWJA 4ZL9A 2H19A 2WULA 1H4OA 3L4NA 2LNSA 1FHEA 2H1GA 1ST9A 4MZCA 1V9WA 2GSRA 3GYKA 2FLSA 3CRTA 1GSQA 3GN3A 4XIHA 1PRXA 2MYGA 3J7Yb 2I3YA 3L0HA 1I9DA 3D5JA 1U88A 1YEXA 3Q74A 3FR3A 3MSZA 4HQZA 1E6BA 3EU4A 4MK3A 3A2XA 3KEBA 4ZBAA 2FD3A 2HRFA 5KN1A 3HZ4A 5IMDA 2L57A 3FRCA 3LXTA 1EWXA 2DBCA 3BD2A 4FYCA 2IN3A 3L78A 1X9SB 1NSWA 2HLSA 2LJRA 4GSNA 1K0OA 1WIKA 2RM5A 2CAQA 1X9WB 3BJ5A 2HYXA 2AYTA 2LEGA 3A3TA 1KBNA 4DSQA 3EVIA 5IO0A 4ZBBA 2LQQA 3F6FA 2GQKA 3M3MA 4NV2A 2K8SA 3RPNA 3O76A 2O89A 3O3TA 5B6NA 1BEDA 3ED3A 1WJKA 1K0AA 2B6MA 2OE0A 4IBPA 4F82A 1SK0A 5AIVA 4JEDA 1XWKA 2C8UA 5EY6A 1EEJA 1DE1A 2GZZA 5GAPD 1JZRA 3GNJA 3LWAA 3IRAA 2H6XA 4NV5A 2WGRA 2OBIA 1QQ2A 2OKAA 3KIJA 3VWVA 2H1AA 3HJOA 3DMLA 3DVXA 1IYIA 5JCUA 1THXA 4IGJA 2L6DA 3APQA 4EKZA 3V1WA 2HSHA 3RPPA 2IMDA 3RHCA 3HA9A 4MJBA 4FYUA 4BWQA 1UA5A 2NVLA 4TVEA 1LJRA 1OC8A 3ZREA 5ECSA 1V57A 4GXZA 1XCCA 2FGXA 2X8HA 4CHSA 1B48A 3FZ4A 2QC7A 2EC4A 1TI3A 3UOMA 4TR3A 4JZQA 5ECKB 2K9FA 1A8LA 3ZVJD 3QR6A 4HOJA 3FK8A 2GQMA 3I69A 3DVWA 3KMNA 2C3NA 1OKTA 1Q98A 2KUCA 5LNKe 4ECCA 6GSXA 4GQCA 2CVKA 5L71A 1YZXA 3H93A 5CAXA 5ECPB 3F3RA 1ZCPA 1TRSA 1XZOA 2PMTA 4XHMA 1GSSA 5HR0A 1GSUA 3CSIA 4N30A 1K0BA 4NAXA 3PGTA 3TKSC 4YQMA 2A2RA 4K7OA 2DLXA 2IPAA 3IDVA 2AHEA 2DJ3A 2VOCA 5GSTA 2GS3A 3E0UA 2DMMA 2CZ2A 5D96A 4LL4B 4ZILA 2H75A 3IR4A 2B7KA 3F9UA 5B7CA 1TK0B 2JADA 3GSTA 5H5QA 5D9XA 1G6WA 3FR6A 1HNCA 2MBSA 4TXVA 1LU4A 2LS5A 3J7Yk 1AQXA 5KN3A 3ME7A 1VF3A 3AY8A 3UARA 1QMVA 1X5DA 5ELAA 5HR2A 4EXJA 2QKEA 3WD6A 5D93A 1Z7RA 5DVBA 2MZCA 4ZIJA 3SWLA 1SJ6A 1GSEA 1A2MA 4MMMA 3HY2A 1XW5A 1VF1A 1QXHA 1GUMA 1QK8A 1SYXA 1O85A 2L4QA 2WS2A 2GZYA 3QFBC 3KXOA 2IL3A 2L5LA 2V1MA 3GURA 2LRNA 2HFDA 5DCGA 3APSA 2KOKA 5H5SA 4N0VA 4Z7XA 1OC9B 4WBJA 2LV3A 1M2BA 2TRCP 3D22A 4AJ8A 3TKSA 5LD0A 1WWJA 2DMLA 3TRQA 4K9ZA 4RQRA 1ERWA 5ECIB 2CT6A 4F03A 2DJ2A 1OC9A 3C7MA 1JLWA 1T3BA 2L5OA 5EL8A 1PKWA 2NTOA 2LNTA 3F4SA 5ECOB 5IMFA 4XCSA 3GA4A 2X99A 3CTFA 2DJKA 5ENUA 1UN2A 2EIOA 3UL3A 2O87A 3CSHA 4L5LA 3HHVA 1PMTA 4KGIA 2B7JA 1GSFA 4KW6A 1ZYQB 3PR8A 1TK8B 2I9HA 3LGCA 2H66A 4OFTA 1ERTA 1SYRA 2O85A 1GSYA 2IMEA 3GV1A 3IBHA 1F6MC 1S3CA 1AXDA 1A2JA 2HRNA 1T8EB 3BOAA 3P8WA 1K0MA 4KE3A 1JZOA 1PL1A 4I5QA 4HU7A 5AGYA 5ECQB 3IPZA 3TOUA 1XVQA 2LTKA 3D4MA 4QL7A 2J23A 1R26A 1B9YC 3TRPA 4WEYA 4O92A 1A24A 3ZFBA 4E8HA 4KDUA 3IHQA 3G9BA 4JR6A 2X64A 3F8UA 2YNXA 2GTUA 3QFAC 2F3MA 3CYNA 5KN0A 2MMNA 3GX8A 3PH9A 3BCKA 3C1SA 1USBA 2HI7A 1XWGA 3KP9A 4WF4A 4K6XA 3KCMA 4EF0A 5DQSA 4IW9A 5DCHA 3WT2A 1CQHA 1YKAA 5CRDA 4AJ7A 4PGTA 3IV4A 3TCOA 1FO5A 2YZHA 3ISOA 2C1YA 2VO4A 4WBRD 1BX9A 3HVSA 2IMKA 2XBQA 3LYPA 4Q5FA 3SBCA 3HVXA 6GSVA 3CSJA 4TW5A 1MDIA 2V32A 4ULXA 1SKWB 4POKA 4P3YB 2WCIA 3LEFA 4BPYA 2FA4A 2R5GA 2H0IA 3N5OA 5ELGA 4H86A 3BCIA 1TRUA 3HVVA 2CZ3A 1Z3EA 4K8MA 4RI6A 4EUYA 3KZQA 2JZSA 1FVJA 1PX6A 3ZFLA 5J9CA 4OFMA 4JE1A 4ILFA 4MJEA 2R3XA 1YDKA 3F6DA 1N2AA 3RDWA 4OWYA 5J3RA 3KP8A 4K7NA 4JU5A 1A0RP 4MP4A 1OAZA 2C4JA 3M8NA 4DSRA 3ZYWA 5HFIA 4I2UA 1PKZA 4NPBA 4PUAA 6GSYA 3K8NA 3RAZA 4LL1B 4AJ6A 2DIZA 1TJDA 4G19A 1I5GA 2OACA 3QAVA 5INYA 2H70A 3H4KA 1PSQA 1TRWA 9GSSA 1R7HA 3U5RE 1V58A 1NW2A 1TP9A 1PN9A 3U6VA 5JWOB 4L0UA 3MAKA 3FHKA 2GVPA 3ERWA 4GCIA 5A4WA 2AJQB 4ZL7A 5J41A 5IMCA 4V1Ag 1AW9A 5D9VA 5G31A 2AUVA 1IYHA 2NBSA 4KDXA 3HJPA 3A5WA 5DAKB 1F37A 1J0FA 2RIIA 2F8FA 2CV4A 1S3DA 2HNLA 3QPMA 5DAKA 1FG4A 1EOGA 1M7TA 3GMFA 5F06A 4OMVA 4V2NA 1XWCA 2VCTA 1ZL9A 4L8EA
chains in the Genus database with same CATH superfamily
1W4VA 2CX4A 3GX0A 1TTZA 2VUPA 3KD0A 5J5NA 1A0FA 2IJYA 1THOA 1R5PA 3LW9A 10GSA 1BAYA 2K8VA 3LQ7A 1O8WA 2DJ0A 1EP7A 3UVTA 5IIZA 3D0ZA 2YOIA 3R2QA 1V40A 3HD5A 2OBKA 1T00A 3ZITA 1JLVA 4TKYA 2VLVA 4KH7A 3G7IA 1XW9A 1GTBA 3EINA 3Q6OA 2NDOA 2ZCTA 4HEA2 5JWRB 16GSA 2DJ1A 4L0WA 1SK1A 1QFNA 4WXTA 1AAZA 1SL2B 4GQFA 1ABAA 1GH2A 2AAWA 1GULA 5G30A 5CREA 2E0QA 2WB9A 3LXZA 2CQ9A 2PVQA 1YF1A 4X43A 2VCVA 1B8XA 2IIYA 2VCQA 4G0LA 4TN8A 1ERVA 1ZOFA 4I6XA 1OKDA 2PPTA 5ECHB 1SK2A 3ZRDA 4N11A 4JR4A 2AB6A 4MH2A 5DBQA 3CRUA 2YZUA 3M1GA 1ZYEA 4IHUA 2VL9A 1DE2A 2A2SA 3EC3A 1K3OA 4TR1B 3VPTA 2B5YA 2PERA 4ML6A 3TDGA 3D6IA 1BQ7A 3GSSA 1SL1B 3BBYA 4L5OA 2HE3A 3C71A 4MH3A 2ZNMA 4TR1A 2FWHA 4WKWA 3LG6A 1K0NA 4D73B 4O5RA 2R2JA 5JCGA 3QAWA 3IK9A 1M2AA 1XG8A 2J9HA 3FYGA 3ZLPA 3M0FA 5IPGA 3TJJA 2V41A 1GLQA 4TXOA 4F9ZA 4D73A 2VLTA 2VCXA 3GH6A 4Q5NA 2N5AA 1S3RA 3A2VA 1MEKA 4BL7A 5GSSA 2MBTA 2B5EA 1GRXA 2CAIA 4KNDA 4RUVA 4F0BA 2L59A 2PVOC 2GT5A 3LFLA 3A2WA 2P5QA 2BTOT 4MLYA 1TW9A 1Y6EA 1XOAA 3F4RA 1X5EA 2B1LA 5IMVA 2ON7A 3FZ9A 2XBIA 1A2LA 3L9VA 4RI7A 2G0FA 1B4PA 4ECJA 1BYEA 2K18A 4IJ3A 1SJZA 2H71A 3CMIA 2H72A 4GSSA 4HZ2A 4I97A 3ZTLA 2OE1A 2MMZA 4QQ7A 4K0NA 2KP2A 4GWRA 3UAPA 2JL4A 3GUSA 2WFCA 4PQIA 2H30A 1SJIA 2B1KA 2VAFA 4CW9A 1MDJA 1K3YA 3DXBA 1MTCA 3NIVA 3CXGA 5HFGA 1VGLA 1OVNA 5B6MA 1HYUA 4DSSB 4ECIA 3ZMKA 1O81A 4PQHA 2C0FA 5ECMB 3VK9A 4OCFA 4IJIA 1XOBA 4KSOA 4YKGA 2FY6A 3PINA 2AV4A 3UEMA 5DJMA 3UBKA 4XS1A 2FWFA 5IO2A 2JSYA 3UJ1A 4A5PA 4DSSA 2CA8A 1N8JA 5B8AA 3VLNA 8GSSA 4KAEA 2VCZA 1GWCA 2YPMA 1JFUA 1AIUA 2F9SA 3HYPA 3UMAA 1VRSD 4KDYA 2KP1A 4PNGA 1G0TA 2X8CA 3QDNA 4ICYA 4BWSA 4HU9A 1YKCA 2FA8A 3TKRA 2WRTA 4AGSA 3L9UA 2LQOA 3Q19A 4HDEA 1F3AA 4MABA 3ZIVA 4EDYA 4IP1A 5G1KA 4XS4B 2R4VA 2YCDA 2VD1A 5D8IA 4G10A 5G2ZA 5FHIA 5E4WA 3TGZA 3TJKA 4KF9A 1V2AA 1XWAA 4JBBA 2H1DA 1JZWA 3QCPA 4XS4A 4E8EA 2VM2A 1RQMA 2P31A 1OYJA 5EPFA 2HSYA 3APOA 3NOFA 1GTUA 4DVCA 3KTLA 4OFNA 1U87A 2LRTA 2V6KA 2FHEA 1FB6A 4NXIA 1RK4A 3L9SA 14GSA 3IXRA 1F3BA 3VWXA 3W8SA 2ALBA 2V2GA 1EZKA 2I81A 2VL2C 4ACSA 4FYBA 3GH9A 2VCWA 2E7PA 2P0GA 3P90A 4KB3A 3DEXA 1OC3A 2Z9SA 1SL0B 4HUAA 2OE3A 4I8BA 3IOSA 2HZFA 4K5RA 5ECNB 3RHBA 3VWUA 3FEUA 1Z7PA 1BG5A 4XRAA 3LORA 2MMOA 2VIMA 3LSZA 1GLPA 20GSA 4O5UA 2PGTA 1J9BA 1HNAA 2A4VA 5DQYA 1SENA 4LLRA 5ABRA 3G7YA 1F9MA 1H75A 3KMOA 5AN1A 1EEMA 2V6OA 4IP6A 4XRDA 1DSBA 1PL2A 4MJAA 3P2AA 4PXOA 2XPDA 4X0XA 4ZBDA 4ZL8A 3TKPA 5DDLA 1EOHA 3DIEA 4KCAA 5CRGA 3TJGA 3G7JA 3ZIJA 1TDIA 4MJCA 3RBTA 1TI1A 2CVDA 1G6YA 4ZB8A 5HQPA 3DWVA 4EC0A 2H76A 5IOXA 4PUFC 1MDKA 1GUHA 2FCHA 4AF2A 1Z6NA 4F2IA 2OA7A 4WR5A 3P7XA 6GSUA 1BJXA 2YN1A 2VL2A 3HXSA 4EDZA 4IS0A 2QSIA 4F0CA 1S3AA 4MF5A 5C04A 2H74A 4GRFA 2YWOA 1Y25A 2M46A 3EURA 4EL1A 5A4UA 1SKRB 2C80A 2FUG2 2M72A 5BMUA 2CX3A 5ID2B 18GSA 3TKSE 5H5RA 2R37A 1YQ1A 3W8JA 2MMAA 2H8LA 5HR1A 1OE7A 2DKHA 4G0KA 2LSTA 4OO5A 5ID2A 1ZYNA 1O73A 4MPFA 1SD9A 4MNNA 2GZPA 3KJYA 3DD3A 3H79A 3F63A 2G2QA 2XHFA 4ML1A 1TOFA 3ZL5A 1X9MB 5IMZA 1GP1A 1WRYA 1NM3A 5IMAA 1G7OA 4XTSA 1JZDA 1ZZYA 3D21A 1HNBA 3IC8A 4MA9A 3FW2A 2IMIA 4KX4A 1YJ6A 4HJ2A 2DKIA 1Q4JA 3M9JA 1T1VA 3FZ5A 2ZUPA 2UZ8A 3QAGA 2ON5A 4GTUA 1UVZA 2YJ7A 3EMPA 1Z9HA 4O7HA 5A4VA 1ZYPA 1GTIA 2GGTA 1PD21 4ZXGA 2CVBA 4V2LA 3ZVJA 3A5IA 2JACA 4V1Ap 2PU9C 3O6TA 5HFKA 3GL3A 5IPHA 3KH7A 4J57E 2X4AA 4IELA 1EP8A 4GSTA 4O5QA 4HZ4A 2WDUA 2QGVA 1RW1A 2WZ9A 5IQYA 2HRAA 3GKNA 2YWNA 3QOUA 4J2FA 4DEJA 1PX7A 3WGDA 4ZB9A 4FQUA 3VI7A 4HI7A 3CTGA 1GNWA 3US3A 4G9HA 4LMWA 2GSSA 1PQNA 4BA7A 1FVKA 2R6KA 2XC2A 2GLRA 4ECBA 4HS1A 4NHZA 1WP0A 5G5FA 4IQ1A 2VLUA 4YKFA 4ZB6A 3QD9A 4NWYA 5CNWA 3LYKA 5JCWA 3DYRA 1J08A 5G5EA 3ZZXA 1W89A 1T4ZA 4TRXA 2H6YA 4KUNA 1EV4A 2C0DA 1CQGA 1HD2A 3IA1A 3R3EA 1M0UA 2H0HA 3GKMA 3HCZA 2HXKA 2GSTA 17GSA 1MD4A 2C3TA 2R0CA 5HR3A 3NZNA 5EVOA 4GF0A 2YP6A 2REMA 2PN8A 2C0GA 2H0GA 5CYYA 3F3QA 3KH9A 2FWGA 5A5KA 4EVMA 2EIQA 2HZEB 3GTUB 3UVHA 4PX1A 2L6CA 12GSA 4G2EA 2N5FA 5C00A 2D2ZA 2YV7A 2NPBA 5D9TA 2HZEA 22GSA 4NMUA 3GTUA 1U3IA 2LUSA 1EV9A 1TU7A 4TXOB 1TU8A 4K7IA 1M99A 2R0PA 4IN0A 3KTBA 2OJLA 1TXXA 2PUKC 3E9JB 4XS6A 5D9WA 5E59A 3EU3A 2TRXA 3D4TA 4YQUA 3CBUA 1FW1A 4BL7B 3GKXA 3F4TA 3IK7A 3JCML 4Z2TA 2H6ZA 3VFIA 3M9KA 1KNGA 3GL5A 3EYTA 3WYWA 1NHYA 3TJFA 5G1LA 1A23A 2VD0A 1B9XC 4YAPA 1X5CA 1GTAA 4V2MA 5CRHA 1GUKA 1O8XA 3W6GA 4LA1A 5F05A 1M2DA 4I2TA 3EPTA 3FY7A 1EGOA 1T7PB 1C72A 1VF4A 3TKQA 4K1FA 5ECLB 5GAND 2IFQB 5AISA 1NHOA 2DC5A 1FB0A 1TKDB 2N5BA 3VPQA 4MZBA 3IE3A 4WR4A 2E2MA 3VI5A 2IFQA 4MCUA 3UIWA 2LRCA 3GIXA 1XVWA 2FWEA 6GSTA 3TUEA 4MF7A 5KEJA 2A4HA 5IM9A 5FWGA 3KM6A 5DJLA 2P5RA 3QMXA 5COHA 5F8BA 3S9FA 3IAM2 1WE0A 3WT1A 5B8BA 4NHWA 4IQAA 5AIXA 1K0CA 1R4WA 2YWIA 1SD8A 2XPEA 4BIKA 3HDCA 3C73A 4CY6A 2DIYA 1PN0A 3GKKA 1M3IA 4MF6A 3HZ8A 1TK5B 5KN2A 3GFKA 5F07A 4N0ZA 2X8GA 4Q5QA 2FNOA 1AC1A 1LBKA 1GSDA 11GSA 1DBYA 1KTEA 2I4AA 2GT6A 5FT3A 13GSA 5ECRB 5KOWA 4IVFA 1YY7A 2L4CA 1WPIA 5DALB 5GZZB 3MNGA 1VF2A 3TB2A 2KHPA 2OADA 4KCEA 1AQVA 2GDRA 4ISDA 2C3QA 5DALA 1O6JA 3I6AA 1XWBA 2WJUA 3ERGA 3I43A 1EGRA 5LCZA 4EO3A 3Q18A 2YWMA 4YAVA 7GSSA 1OE8A 1ACVA 2H73A 5F0GA 3C1RA 4HJMA 3LJRA 5J4UA 3TRXA 1XXUA 1ML6A 1QGVA 4J56E 1WMJA 1PA3A 1QUWA 4OCEA 1U3AA 1ERUA 2C0EA 4BVXB 4OD7A 4KSMA 2H01A 5JWQB 1U6TA 1M9AA 4TR4A 1O7UA 4POLA 3F0IA 3EE2A 3GHAA 3TOTA 6GSSA 4BVXA 2RM6A 1T4YA 19GSA 4FIWA 3FR9A 2E2GA 4X1UA 4K2DA 1AQWA 2LJKA 2LKUA 3KGKA 1A8YA 2VL3A 2LJAA 3ZMLA 2VM1A 2JU5A 2DJJA 2GQLA 2H1BA 2JSZA 1AUCA 4OO4A 3N9JA 1YF0A 3EWLA 4IKHA 4YH2A 5CO3A 2DSAA 1F2EA 3FZAA 2GSQA 2PBJA 3HJMA 3PPUA 2YV9A 3ERFA 1ON4A 2ES7A 1ZMAA 5J9BA 1K0DA 2BJXA 4Q5RA 1PFOA 1Z5YE 2YJHA 3WGXA 1GNEA 1TRVA 4TR0A 1X0RA 5CP1A 3DKSA 3MWHA 4K0GA 3TJBA 3E3EA 1E2YA 5D73A 2A2PA 3H8QA 3I9V2 2IMFA 1ILOA 1XBSA 4PNFA 1DUGA 4O32A 4PURA 4ID0A 3C8EA 2JZTA 4N10A 1ZGNA 3IHGA 3VURA 4FO5A 1FAAA 4MPGA 1SKSB 1UC7A 3EMXA 2YANA 4HQSA 4YQVA 1XW6A 2RUEA 2HT9A 2BMXA 1M3JA 4RQXA 4MZWA 2KLXA 3GRXA 4POBA 2TIRA 1KEBA 2I1UA 2B5XA 1GL8A 2F8AA 3WGEA 3OR5A 1URMA 1MD3A 3DGQA 1JHBA 4KA0A 2EIRA 6GSWA 4EE0A 1V98A 3MDKA 3CQFA 4FH8A 4HSCX 2JZRA 2K6VA 3H1NA 1G7EA 3DRNA 3VWWA 3IAS2 1HQOA 4CDOA 4POMA 2IWTA 4JRRA 3HKRA 4BVYB 1K3LA 1M9BA 2B3SA 3FKFA 2HSMA 1B4QA 2RUFA 1Z6MA 1WOUA 2O7KA 3ME8A 4BVYA 4GLTA 1SU9A 4QL9A 2M80A 5IOWA 1YEPA 1R5AA 4TOPA 3IC4A 4LMVA 4MDCA 4WF5A 2RLIA 2F51A 4EIPA 3UBLA 1XPVA 1PGTA 1FOVA 5CRWA 2O8VB 4PQ1A 1XFLA 4WETA 1XIYA 2PWJA 4ZL9A 2H19A 2WULA 1H4OA 3L4NA 2LNSA 1FHEA 2H1GA 1ST9A 4MZCA 4Z2UA 1V9WA 2GSRA 4X4JA 3GYKA 2FLSA 3CRTA 1GSQA 3GN3A 4XIHA 1PRXA 2MYGA 3J7Yb 2I3YA 3L0HA 1I9DA 3D5JA 1U88A 1YEXA 3Q74A 3FR3A 3MSZA 4HQZA 1E6BA 3EU4A 4MK3A 3A2XA 3KEBA 4ZBAA 2FD3A 2HRFA 5KN1A 3HZ4A 5IMDA 2L57A 3FRCA 3LXTA 1EWXA 2DBCA 3BD2A 4FYCA 2IN3A 3L78A 1X9SB 1NSWA 2HLSA 2LJRA 4GSNA 1K0OA 1WIKA 2RM5A 3FMWA 2CAQA 1X9WB 3BJ5A 2HYXA 2AYTA 2LEGA 3A3TA 1KBNA 3MIXA 4DSQA 3EVIA 5IO0A 4ZBBA 2LQQA 3F6FA 2GQKA 3M3MA 4NV2A 2K8SA 3RPNA 3O76A 2O89A 3O3TA 5B6NA 1BEDA 3ED3A 1WJKA 1K0AA 2B6MA 2OE0A 4IBPA 4F82A 1SK0A 5AIVA 4JEDA 1XWKA 2C8UA 5EY6A 1EEJA 1DE1A 2GZZA 5GAPD 1JZRA 3GNJA 3LWAA 3IRAA 2H6XA 4NV5A 2WGRA 2OBIA 1QQ2A 2OKAA 3KIJA 3VWVA 2H1AA 3HJOA 3DMLA 3DVXA 1IYIA 5JCUA 1THXA 4IGJA 2L6DA 3APQA 4EKZA 3V1WA 2HSHA 3RPPA 2IMDA 5BRTA 3RHCA 3HA9A 4MJBA 4FYUA 4BWQA 1UA5A 2NVLA 4TVEA 1LJRA 1OC8A 3ZREA 5ECSA 1V57A 2HRKA 4GXZA 1XCCA 2FGXA 2X8HA 4CHSA 1B48A 3FZ4A 2QC7A 2EC4A 1TI3A 3UOMA 4TR3A 1FOHA 4K5SA 4JZQA 5ECKB 2K9FA 1A8LA 3ZVJD 3QR6A 4HOJA 3FK8A 2GQMA 3I69A 3DVWA 3KMNA 2C3NA 1OKTA 1Q98A 2KUCA 5LNKe 4USSA 3MYDA 4ECCA 6GSXA 4GQCA 2CVKA 5L71A 1YZXA 3H93A 5CAXA 5ECPB 3F3RA 1ZCPA 1TRSA 1XZOA 2PMTA 4XHMA 1GSSA 5HR0A 1GSUA 3CSIA 4N30A 1K0BA 4NAXA 3PGTA 3TKSC 4YQMA 2A2RA 4K7OA 2DLXA 2IPAA 3IDVA 2AHEA 2DJ3A 2VOCA 5GSTA 2GS3A 3E0UA 2DMMA 2CZ2A 5D96A 4LL4B 4ZILA 2X49A 2H75A 3IR4A 2B7KA 3F9UA 5B7CA 1TK0B 2JADA 3GSTA 5H5QA 5D9XA 1G6WA 3FR6A 4G0IA 1HNCA 2MBSA 4TXVA 1LU4A 2LS5A 3J7Yk 1AQXA 5KN3A 3ME7A 1VF3A 3AY8A 3UARA 1QMVA 1X5DA 5ELAA 5HR2A 4EXJA 2QKEA 3WD6A 5D93A 1Z7RA 5DVBA 2MZCA 4ZIJA 3SWLA 1SJ6A 1GSEA 1A2MA 4MMMA 3HY2A 1XW5A 1VF1A 1QXHA 1GUMA 1QK8A 1SYXA 1O85A 2L4QA 2WS2A 2GZYA 3QFBC 3KXOA 2IL3A 2L5LA 2V1MA 3GURA 5KOXA 2LRNA 2HFDA 5DCGA 3APSA 2KOKA 5H5SA 4N0VA 4Z7XA 1OC9B 4WBJA 2LV3A 1M2BA 2TRCP 3D22A 4AJ8A 3TKSA 5LD0A 1WWJA 2DMLA 3TRQA 4K9ZA 4RQRA 1ERWA 5ECIB 2CT6A 4F03A 2DJ2A 1OC9A 3C7MA 1JLWA 1T3BA 2L5OA 5EL8A 1PKWA 2NTOA 2LNTA 3F4SA 5ECOB 5IMFA 4XCSA 2R0GA 3GA4A 2X99A 2QA2A 4Z2RA 3CTFA 2DJKA 5ENUA 1UN2A 2EIOA 3UL3A 2O87A 3CSHA 4L5LA 3HHVA 1PMTA 4KGIA 2B7JA 1GSFA 4KW6A 1ZYQB 3PR8A 1TK8B 2I9HA 3LGCA 2H66A 4OFTA 1ERTA 1SYRA 2O85A 1GSYA 2IMEA 3GV1A 3IBHA 1F6MC 1S3CA 1AXDA 1A2JA 2HRNA 1T8EB 3BOAA 3P8WA 1K0MA 4KE3A 1JZOA 1PL1A 4I5QA 4HU7A 3HVNA 5AGYA 5ECQB 3IPZA 3TOUA 1XVQA 2LTKA 3D4MA 4QL7A 2J23A 1R26A 1B9YC 3TRPA 4WEYA 4O92A 1A24A 3ZFBA 4E8HA 4KDUA 3IHQA 3G9BA 4JR6A 2X64A 3F8UA 2YNXA 2GTUA 3QFAC 2F3MA 3CYNA 5KN0A 2MMNA 3GX8A 2QA1A 3PH9A 3BCKA 3C1SA 1USBA 2HI7A 1XWGA 3KP9A 4WF4A 4K6XA 4PTSA 3KCMA 4EF0A 5DQSA 4IW9A 5DCHA 3WT2A 1CQHA 1YKAA 5CRDA 4AJ7A 4EIQA 4PGTA 3IV4A 3TCOA 1FO5A 2YZHA 3ISOA 2C1YA 2VO4A 4WBRD 1BX9A 3HVSA 2IMKA 2XBQA 3LYPA 4Q5FA 3SBCA 3HVXA 6GSVA 3CSJA 4TW5A 1MDIA 2V32A 4ULXA 1SKWB 4POKA 4P3YB 2WCIA 3LEFA 4BPYA 2FA4A 2R5GA 2H0IA 3N5OA 5ELGA 4H86A 3BCIA 1TRUA 3HVVA 2CZ3A 1Z3EA 4K8MA 4RI6A 4EUYA 3KZQA 2JZSA 1FVJA 1PX6A 3ZFLA 5J9CA 4OFMA 4JE1A 4K2XA 4ILFA 4MJEA 2R3XA 1YDKA 3F6DA 1N2AA 3RDWA 4OWYA 5J3RA 3KP8A 4K7NA 4JU5A 1A0RP 4MP4A 1OAZA 2C4JA 3M8NA 4DSRA 3ZYWA 5HFIA 4I2UA 1PKZA 4NPBA 4PUAA 6GSYA 3K8NA 3RAZA 4LL1B 4AJ6A 2DIZA 1TJDA 4G19A 1I5GA 2OACA 3QAVA 5INYA 2H70A 3H4KA 1PSQA 1TRWA 9GSSA 1R7HA 3U5RE 1V58A 1NW2A 1TP9A 1PN9A 3U6VA 5JWOB 4L0UA 3MAKA 3FHKA 2GVPA 3ERWA 4GCIA 5A4WA 2AJQB 4ZL7A 5J41A 5IMCA 4V1Ag 1AW9A 5D9VA 5G31A 2AUVA 1IYHA 2NBSA 4CY8A 4KDXA 3HJPA 3A5WA 5DAKB 1F37A 1J0FA 2RIIA 2F8FA 2CV4A 1S3DA 2HNLA 3QPMA 5DAKA 1FG4A 1EOGA 1M7TA 3GMFA 5F06A 4OMVA 4V2NA 1XWCA 2VCTA 1ZL9A 4L8EA
chains in the Genus database with same CATH topology
1W4VA 2CX4A 3GX0A 1TTZA 2VUPA 3KD0A 5J5NA 1A0FA 2IJYA 1THOA 1R5PA 3LW9A 10GSA 1BAYA 2K8VA 3LQ7A 1O8WA 2DJ0A 1EP7A 3UVTA 5IIZA 3D0ZA 2YOIA 3R2QA 1V40A 3HD5A 2OBKA 1T00A 3ZITA 1JLVA 4TKYA 2VLVA 4KH7A 3G7IA 1XW9A 1GTBA 3EINA 3Q6OA 2NDOA 2ZCTA 4HEA2 5JWRB 16GSA 2DJ1A 4L0WA 1SK1A 1QFNA 4WXTA 1AAZA 1SL2B 4GQFA 1ABAA 1GH2A 2AAWA 1GULA 5G30A 5CREA 2E0QA 2WB9A 3LXZA 2CQ9A 2PVQA 1YF1A 4X43A 2VCVA 1B8XA 2IIYA 2VCQA 4G0LA 4TN8A 1ERVA 1ZOFA 4I6XA 1OKDA 2PPTA 5ECHB 1SK2A 3ZRDA 4N11A 4JR4A 2AB6A 4MH2A 5DBQA 3CRUA 2YZUA 3M1GA 1ZYEA 4IHUA 2VL9A 1DE2A 2A2SA 3EC3A 1K3OA 4TR1B 3VPTA 2B5YA 2PERA 4ML6A 3TDGA 3D6IA 1BQ7A 3GSSA 1SL1B 3BBYA 4L5OA 2HE3A 3C71A 4MH3A 2ZNMA 4TR1A 2FWHA 4WKWA 3LG6A 1K0NA 4D73B 4O5RA 2R2JA 5JCGA 3QAWA 3IK9A 1M2AA 2J9HA 3FYGA 3ZLPA 3M0FA 5IPGA 3TJJA 2V41A 1GLQA 4TXOA 4F9ZA 4D73A 2VLTA 2VCXA 3GH6A 4Q5NA 2N5AA 3A2VA 1MEKA 4BL7A 5GSSA 2MBTA 2B5EA 1GRXA 2CAIA 4KNDA 4RUVA 4F0BA 2L59A 2PVOC 2GT5A 3LFLA 3A2WA 2P5QA 2BTOT 4MLYA 1TW9A 1Y6EA 1XOAA 3F4RA 1X5EA 2B1LA 5IMVA 2ON7A 3FZ9A 2XBIA 1A2LA 3L9VA 4RI7A 2G0FA 1B4PA 4ECJA 1BYEA 2K18A 4IJ3A 1SJZA 2H71A 3CMIA 2H72A 4GSSA 4HZ2A 4I97A 3ZTLA 2OE1A 2MMZA 4QQ7A 4K0NA 2KP2A 4GWRA 3UAPA 2JL4A 3GUSA 2WFCA 4PQIA 2H30A 1SJIA 2B1KA 2VAFA 4CW9A 1MDJA 1K3YA 3DXBA 1MTCA 3NIVA 3CXGA 5HFGA 1VGLA 1OVNA 5B6MA 1HYUA 4DSSB 4ECIA 3ZMKA 1O81A 4PQHA 2C0FA 5ECMB 3VK9A 4OCFA 4IJIA 1XOBA 4KSOA 4YKGA 2FY6A 3PINA 2AV4A 3UEMA 5DJMA 3UBKA 4XS1A 2FWFA 5IO2A 2JSYA 3UJ1A 4A5PA 4DSSA 2CA8A 1N8JA 5B8AA 3VLNA 8GSSA 4KAEA 2VCZA 1GWCA 2YPMA 1JFUA 1AIUA 2F9SA 3HYPA 3UMAA 1VRSD 4KDYA 2KP1A 4PNGA 1G0TA 2X8CA 3QDNA 4ICYA 4BWSA 4HU9A 1YKCA 2FA8A 3TKRA 2WRTA 4AGSA 3L9UA 2LQOA 3Q19A 4HDEA 1F3AA 4MABA 3ZIVA 4EDYA 4IP1A 5G1KA 4XS4B 2R4VA 2YCDA 2VD1A 5D8IA 4G10A 5G2ZA 5FHIA 5E4WA 3TGZA 3TJKA 4KF9A 1V2AA 1XWAA 4JBBA 2H1DA 1JZWA 3QCPA 4XS4A 4E8EA 2VM2A 1RQMA 2P31A 1OYJA 5EPFA 2HSYA 3APOA 3NOFA 1GTUA 4DVCA 3KTLA 4OFNA 1U87A 2LRTA 2V6KA 2FHEA 1FB6A 4NXIA 1RK4A 3L9SA 14GSA 3IXRA 1F3BA 3VWXA 3W8SA 2ALBA 2V2GA 1EZKA 2I81A 2VL2C 4ACSA 4FYBA 3GH9A 2VCWA 2E7PA 2P0GA 3P90A 4KB3A 3DEXA 1OC3A 2Z9SA 1SL0B 4HUAA 2OE3A 4I8BA 3IOSA 2HZFA 4K5RA 5ECNB 3RHBA 3VWUA 3FEUA 1Z7PA 1BG5A 4XRAA 3LORA 2MMOA 2VIMA 3LSZA 1GLPA 20GSA 4O5UA 2PGTA 1J9BA 1HNAA 2A4VA 5DQYA 1SENA 4LLRA 5ABRA 3G7YA 1F9MA 1H75A 3KMOA 5AN1A 1EEMA 2V6OA 4IP6A 4XRDA 1DSBA 1PL2A 4MJAA 3P2AA 4PXOA 2XPDA 4X0XA 4ZBDA 4ZL8A 3TKPA 5DDLA 1EOHA 3DIEA 4KCAA 5CRGA 3TJGA 3G7JA 3ZIJA 1TDIA 4MJCA 3RBTA 1TI1A 2CVDA 1G6YA 4ZB8A 5HQPA 3DWVA 4EC0A 2H76A 5IOXA 4PUFC 1MDKA 1GUHA 2FCHA 4AF2A 1Z6NA 4F2IA 2OA7A 4WR5A 3P7XA 6GSUA 1BJXA 2YN1A 2VL2A 3HXSA 4EDZA 4IS0A 2QSIA 4F0CA 1S3AA 4MF5A 5C04A 2H74A 4GRFA 2YWOA 1Y25A 2M46A 3EURA 4EL1A 5A4UA 1SKRB 2C80A 2FUG2 2M72A 5BMUA 2CX3A 5ID2B 18GSA 3TKSE 5H5RA 2R37A 1YQ1A 3W8JA 2MMAA 2H8LA 5HR1A 1OE7A 2DKHA 4G0KA 2LSTA 4OO5A 5ID2A 1ZYNA 1O73A 4MPFA 1SD9A 4MNNA 2GZPA 3KJYA 3DD3A 3H79A 3F63A 2G2QA 2XHFA 4ML1A 1TOFA 3ZL5A 1X9MB 5IMZA 1GP1A 1WRYA 1NM3A 5IMAA 1G7OA 4XTSA 1JZDA 1ZZYA 3D21A 1HNBA 3IC8A 4MA9A 3FW2A 2IMIA 4KX4A 1YJ6A 4HJ2A 2DKIA 1Q4JA 3M9JA 1T1VA 3FZ5A 2ZUPA 2UZ8A 3QAGA 2ON5A 4GTUA 1UVZA 2YJ7A 3EMPA 1Z9HA 4O7HA 5A4VA 1ZYPA 1GTIA 2GGTA 1PD21 4ZXGA 2CVBA 4V2LA 3ZVJA 3A5IA 2JACA 4V1Ap 2PU9C 3O6TA 5HFKA 3GL3A 5IPHA 3KH7A 4J57E 2X4AA 4IELA 1EP8A 4GSTA 4O5QA 4HZ4A 2WDUA 2QGVA 1RW1A 2WZ9A 5IQYA 2HRAA 3GKNA 2YWNA 3QOUA 4J2FA 4DEJA 1PX7A 3WGDA 4ZB9A 4FQUA 3VI7A 4HI7A 3CTGA 1GNWA 3US3A 4G9HA 4LMWA 2GSSA 1PQNA 4BA7A 1FVKA 2R6KA 2XC2A 2GLRA 4ECBA 4HS1A 4NHZA 1WP0A 5G5FA 4IQ1A 2VLUA 4YKFA 4ZB6A 3QD9A 4NWYA 5CNWA 3LYKA 5JCWA 3DYRA 1J08A 5G5EA 3ZZXA 1W89A 1T4ZA 4TRXA 2H6YA 4KUNA 1EV4A 2C0DA 1CQGA 1HD2A 3IA1A 3R3EA 1M0UA 2H0HA 3GKMA 3HCZA 2HXKA 2GSTA 17GSA 1MD4A 2C3TA 2R0CA 5HR3A 3NZNA 5EVOA 4GF0A 2YP6A 2REMA 2PN8A 2C0GA 2H0GA 5CYYA 3F3QA 3KH9A 2FWGA 5A5KA 4EVMA 2EIQA 2HZEB 3GTUB 3UVHA 4PX1A 2L6CA 12GSA 4G2EA 2N5FA 5C00A 2D2ZA 2YV7A 2NPBA 5D9TA 2HZEA 22GSA 4NMUA 3GTUA 1U3IA 2LUSA 1EV9A 1TU7A 4TXOB 1TU8A 4K7IA 1M99A 2R0PA 4IN0A 3KTBA 2OJLA 1TXXA 2PUKC 3E9JB 4XS6A 5D9WA 5E59A 3EU3A 2TRXA 3D4TA 4YQUA 3CBUA 1FW1A 4BL7B 3GKXA 3F4TA 3IK7A 3JCML 4Z2TA 2H6ZA 3VFIA 3M9KA 1KNGA 3GL5A 3EYTA 3WYWA 1NHYA 3TJFA 5G1LA 1A23A 2VD0A 1B9XC 4YAPA 1X5CA 1GTAA 4V2MA 5CRHA 1GUKA 1O8XA 3W6GA 4LA1A 5F05A 1M2DA 4I2TA 3EPTA 3FY7A 1EGOA 1T7PB 1C72A 1VF4A 3TKQA 4K1FA 5ECLB 5GAND 2IFQB 5AISA 1NHOA 2DC5A 1FB0A 1TKDB 2N5BA 3VPQA 4MZBA 3IE3A 4WR4A 2E2MA 3VI5A 2IFQA 4MCUA 3UIWA 2LRCA 3GIXA 1XVWA 2FWEA 6GSTA 3TUEA 4MF7A 5KEJA 2A4HA 5IM9A 5FWGA 3KM6A 5DJLA 2P5RA 3QMXA 5COHA 5F8BA 3S9FA 3IAM2 1WE0A 3WT1A 5B8BA 4NHWA 4IQAA 5AIXA 1K0CA 1R4WA 2YWIA 1SD8A 2XPEA 3HDCA 3C73A 4CY6A 2DIYA 1PN0A 3GKKA 4MF6A 3HZ8A 1TK5B 5KN2A 3GFKA 5F07A 4N0ZA 2X8GA 4Q5QA 2FNOA 1AC1A 1LBKA 1GSDA 11GSA 1DBYA 1KTEA 2I4AA 2GT6A 5FT3A 13GSA 5ECRB 5KOWA 4IVFA 1YY7A 2L4CA 1WPIA 5DALB 5GZZB 3MNGA 1VF2A 3TB2A 2KHPA 2OADA 4KCEA 1AQVA 2GDRA 4ISDA 2C3QA 5DALA 1O6JA 3I6AA 1XWBA 2WJUA 3ERGA 3I43A 1EGRA 5LCZA 4EO3A 3Q18A 2YWMA 4YAVA 7GSSA 1OE8A 1ACVA 2H73A 5F0GA 3C1RA 4HJMA 3LJRA 5J4UA 3TRXA 1XXUA 1ML6A 1QGVA 4J56E 1WMJA 1PA3A 1QUWA 4OCEA 1U3AA 1ERUA 2C0EA 4BVXB 4OD7A 4KSMA 2H01A 5JWQB 1U6TA 1M9AA 4TR4A 1O7UA 4POLA 3F0IA 3EE2A 3GHAA 3TOTA 6GSSA 4BVXA 2RM6A 1T4YA 19GSA 4FIWA 3FR9A 2E2GA 4X1UA 4K2DA 1AQWA 2LJKA 2LKUA 3KGKA 1A8YA 2VL3A 2LJAA 3ZMLA 2VM1A 2JU5A 2DJJA 2GQLA 2H1BA 2JSZA 1AUCA 4OO4A 3N9JA 1YF0A 3EWLA 4IKHA 4YH2A 5CO3A 2DSAA 1F2EA 3FZAA 2GSQA 2PBJA 3HJMA 3PPUA 2YV9A 3ERFA 1ON4A 2ES7A 1ZMAA 5J9BA 1K0DA 2BJXA 4Q5RA 1Z5YE 2YJHA 3WGXA 1GNEA 1TRVA 4TR0A 1X0RA 5CP1A 3DKSA 3MWHA 4K0GA 3TJBA 3E3EA 1E2YA 5D73A 2A2PA 3H8QA 3I9V2 2IMFA 1ILOA 1XBSA 4PNFA 1DUGA 4O32A 4PURA 4ID0A 3C8EA 2JZTA 4N10A 1ZGNA 3IHGA 3VURA 4FO5A 1FAAA 4MPGA 1SKSB 1UC7A 3EMXA 2YANA 4HQSA 4YQVA 1XW6A 2RUEA 2HT9A 2BMXA 4RQXA 4MZWA 2KLXA 3GRXA 4POBA 2TIRA 1KEBA 2I1UA 2B5XA 1GL8A 2F8AA 3WGEA 3OR5A 1URMA 1MD3A 3DGQA 1JHBA 4KA0A 2EIRA 6GSWA 4EE0A 1V98A 3MDKA 4FH8A 2JZRA 2K6VA 3H1NA 1G7EA 3DRNA 3VWWA 3IAS2 1HQOA 4CDOA 4POMA 2IWTA 4JRRA 3HKRA 4BVYB 1K3LA 1M9BA 2B3SA 3FKFA 2HSMA 1B4QA 2RUFA 1Z6MA 1WOUA 2O7KA 3ME8A 4BVYA 4GLTA 1SU9A 4QL9A 2M80A 5IOWA 1YEPA 1R5AA 4TOPA 3IC4A 4LMVA 4MDCA 4WF5A 2RLIA 2F51A 4EIPA 3UBLA 1XPVA 1PGTA 1FOVA 5CRWA 2O8VB 4PQ1A 1XFLA 4WETA 1XIYA 2PWJA 4ZL9A 2H19A 2WULA 1H4OA 3L4NA 2LNSA 1FHEA 2H1GA 1ST9A 4MZCA 4Z2UA 1V9WA 2GSRA 4X4JA 3GYKA 2FLSA 3CRTA 1GSQA 3GN3A 4XIHA 1PRXA 2MYGA 3J7Yb 2I3YA 3L0HA 1I9DA 3D5JA 1U88A 1YEXA 3Q74A 3FR3A 3MSZA 4HQZA 1E6BA 3EU4A 4MK3A 3A2XA 3KEBA 4ZBAA 2FD3A 2HRFA 5KN1A 3HZ4A 5IMDA 2L57A 3FRCA 3LXTA 1EWXA 2DBCA 3BD2A 4FYCA 2IN3A 3L78A 1X9SB 1NSWA 2HLSA 2LJRA 4GSNA 1K0OA 1WIKA 2RM5A 3FMWA 2CAQA 1X9WB 3BJ5A 2HYXA 2AYTA 2LEGA 3A3TA 1KBNA 3MIXA 4DSQA 3EVIA 5IO0A 4ZBBA 2LQQA 3F6FA 2GQKA 3M3MA 4NV2A 2K8SA 3RPNA 3O76A 2O89A 3O3TA 5B6NA 1BEDA 3ED3A 1WJKA 1K0AA 2B6MA 2OE0A 4IBPA 4F82A 1SK0A 5AIVA 4JEDA 1XWKA 2C8UA 5EY6A 1EEJA 1DE1A 2GZZA 5GAPD 1JZRA 3GNJA 3LWAA 3IRAA 2H6XA 4NV5A 2WGRA 2OBIA 1QQ2A 2OKAA 3KIJA 3VWVA 2H1AA 3HJOA 3DMLA 3DVXA 1IYIA 5JCUA 1THXA 4IGJA 2L6DA 3APQA 4EKZA 3V1WA 2HSHA 3RPPA 2IMDA 5BRTA 3RHCA 3HA9A 4MJBA 4FYUA 4BWQA 1UA5A 2NVLA 4TVEA 1LJRA 1OC8A 3ZREA 5ECSA 1V57A 2HRKA 4GXZA 1XCCA 2FGXA 2X8HA 4CHSA 1B48A 3FZ4A 2QC7A 2EC4A 1TI3A 3UOMA 4TR3A 1FOHA 4K5SA 4JZQA 5ECKB 2K9FA 1A8LA 3ZVJD 3QR6A 4HOJA 3FK8A 2GQMA 3I69A 3DVWA 3KMNA 2C3NA 1OKTA 1Q98A 2KUCA 5LNKe 4USSA 3MYDA 4ECCA 6GSXA 4GQCA 2CVKA 5L71A 1YZXA 3H93A 5CAXA 5ECPB 3F3RA 1ZCPA 1TRSA 1XZOA 2PMTA 4XHMA 1GSSA 5HR0A 1GSUA 3CSIA 4N30A 1K0BA 4NAXA 3PGTA 3TKSC 4YQMA 2A2RA 4K7OA 2DLXA 2IPAA 3IDVA 2AHEA 2DJ3A 2VOCA 5GSTA 2GS3A 3E0UA 2DMMA 2CZ2A 5D96A 4LL4B 4ZILA 2X49A 2H75A 3IR4A 2B7KA 3F9UA 5B7CA 1TK0B 2JADA 3GSTA 5H5QA 5D9XA 1G6WA 3FR6A 4G0IA 1HNCA 2MBSA 4TXVA 1LU4A 2LS5A 3J7Yk 1AQXA 5KN3A 3ME7A 1VF3A 3AY8A 3UARA 1QMVA 1X5DA 5ELAA 5HR2A 4EXJA 2QKEA 3WD6A 5D93A 1Z7RA 5DVBA 2MZCA 4ZIJA 3SWLA 1SJ6A 1GSEA 1A2MA 4MMMA 3HY2A 1XW5A 1VF1A 1QXHA 1GUMA 1QK8A 1SYXA 1O85A 2L4QA 2WS2A 2GZYA 3QFBC 3KXOA 2IL3A 2L5LA 2V1MA 3GURA 5KOXA 2LRNA 2HFDA 5DCGA 3APSA 2KOKA 5H5SA 4N0VA 4Z7XA 1OC9B 4WBJA 2LV3A 1M2BA 2TRCP 3D22A 4AJ8A 3TKSA 5LD0A 1WWJA 2DMLA 3TRQA 4K9ZA 4RQRA 1ERWA 5ECIB 2CT6A 4F03A 2DJ2A 1OC9A 3C7MA 1JLWA 1T3BA 2L5OA 5EL8A 1PKWA 2NTOA 2LNTA 3F4SA 5ECOB 5IMFA 4XCSA 2R0GA 3GA4A 2X99A 2QA2A 4Z2RA 3CTFA 2DJKA 5ENUA 1UN2A 2EIOA 3UL3A 2O87A 3CSHA 4L5LA 3HHVA 1PMTA 4KGIA 2B7JA 1GSFA 4KW6A 1ZYQB 3PR8A 1TK8B 2I9HA 3LGCA 2H66A 4OFTA 1ERTA 1SYRA 2O85A 1GSYA 2IMEA 3GV1A 3IBHA 1F6MC 1S3CA 1AXDA 1A2JA 2HRNA 1T8EB 3BOAA 3P8WA 1K0MA 4KE3A 1JZOA 1PL1A 4I5QA 4HU7A 5AGYA 5ECQB 3IPZA 3TOUA 1XVQA 2LTKA 3D4MA 4QL7A 2J23A 1R26A 1B9YC 3TRPA 4WEYA 4O92A 1A24A 3ZFBA 4E8HA 4KDUA 3IHQA 3G9BA 4JR6A 2X64A 3F8UA 2YNXA 2GTUA 3QFAC 2F3MA 3CYNA 5KN0A 2MMNA 3GX8A 2QA1A 3PH9A 3BCKA 3C1SA 1USBA 2HI7A 1XWGA 3KP9A 4WF4A 4K6XA 4PTSA 3KCMA 4EF0A 5DQSA 4IW9A 5DCHA 3WT2A 1CQHA 1YKAA 5CRDA 4AJ7A 4EIQA 4PGTA 3IV4A 3TCOA 1FO5A 2YZHA 3ISOA 2C1YA 2VO4A 4WBRD 1BX9A 3HVSA 2IMKA 2XBQA 3LYPA 4Q5FA 3SBCA 3HVXA 6GSVA 3CSJA 4TW5A 1MDIA 2V32A 4ULXA 1SKWB 4POKA 4P3YB 2WCIA 3LEFA 4BPYA 2FA4A 2R5GA 2H0IA 3N5OA 5ELGA 4H86A 3BCIA 1TRUA 3HVVA 2CZ3A 1Z3EA 4K8MA 4RI6A 4EUYA 3KZQA 2JZSA 1FVJA 1PX6A 3ZFLA 5J9CA 4OFMA 4JE1A 4K2XA 4ILFA 4MJEA 2R3XA 1YDKA 3F6DA 1N2AA 3RDWA 4OWYA 5J3RA 3KP8A 4K7NA 4JU5A 1A0RP 4MP4A 1OAZA 2C4JA 3M8NA 4DSRA 3ZYWA 5HFIA 4I2UA 1PKZA 4NPBA 4PUAA 6GSYA 3K8NA 3RAZA 4LL1B 4AJ6A 2DIZA 1TJDA 4G19A 1I5GA 2OACA 3QAVA 5INYA 2H70A 3H4KA 1PSQA 1TRWA 9GSSA 1R7HA 3U5RE 1V58A 1NW2A 1TP9A 1PN9A 3U6VA 5JWOB 4L0UA 3MAKA 3FHKA 2GVPA 3ERWA 4GCIA 5A4WA 2AJQB 4ZL7A 5J41A 5IMCA 4V1Ag 1AW9A 5D9VA 5G31A 2AUVA 1IYHA 2NBSA 4CY8A 4KDXA 3HJPA 3A5WA 5DAKB 1F37A 1J0FA 2RIIA 2F8FA 2CV4A 1S3DA 2HNLA 3QPMA 5DAKA 1FG4A 1EOGA 1M7TA 3GMFA 5F06A 4OMVA 4V2NA 1XWCA 2VCTA 1ZL9A 4L8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W4V A;  2CX4 A;  3GX0 A;  1TTZ A;  2VUP A;  3KD0 A;  5J5N A;  1A0F A;  2IJY A;  1THO A;  1R5P A;  10GS A;  1BAY A;  2K8V A;  3LQ7 A;  1O8W A;  2DJ0 A;  1EP7 A;  3UVT A;  5IIZ A;  3D0Z A;  2YOI A;  3R2Q A;  1V40 A;  3HD5 A;  2OBK A;  1T00 A;  3ZIT A;  1JLV A;  4TKY A;  2VLV A;  4KH7 A;  3G7I A;  1XW9 A;  1GTB A;  3EIN A;  3Q6O A;  2NDO A;  2ZCT A;  4HEA 2;  5JWR B;  16GS A;  2DJ1 A;  4L0W A;  1SK1 A;  1QFN A;  4WXT A;  1AAZ A;  1SL2 B;  4GQF A;  1ABA A;  1GH2 A;  2AAW A;  1GUL A;  5G30 A;  5CRE A;  2E0Q A;  2WB9 A;  3LXZ A;  2CQ9 A;  2PVQ A;  1YF1 A;  4X43 A;  2VCV A;  1B8X A;  2IIY A;  2VCQ A;  4TN8 A;  1ERV A;  1ZOF A;  4I6X A;  1OKD A;  2PPT A;  5ECH B;  1SK2 A;  3ZRD A;  4N11 A;  4JR4 A;  2AB6 A;  4MH2 A;  5DBQ A;  3CRU A;  2YZU A;  3M1G A;  1ZYE A;  4IHU A;  2VL9 A;  1DE2 A;  2A2S A;  3EC3 A;  1K3O A;  4TR1 B;  3VPT A;  2B5Y A;  2PER A;  4ML6 A;  3TDG A;  3D6I A;  1BQ7 A;  3GSS A;  1SL1 B;  3BBY A;  4L5O A;  2HE3 A;  3C71 A;  4MH3 A;  2ZNM A;  4TR1 A;  2FWH A;  4WKW A;  3LG6 A;  1K0N A;  4D73 B;  4O5R A;  2R2J A;  5JCG A;  3QAW A;  3IK9 A;  1M2A A;  2J9H A;  3FYG A;  3ZLP A;  3M0F A;  5IPG A;  3TJJ A;  2V41 A;  1GLQ A;  4TXO A;  4F9Z A;  4D73 A;  2VLT A;  2VCX A;  3GH6 A;  4Q5N A;  2N5A A;  3A2V A;  1MEK A;  4BL7 A;  5GSS A;  2MBT A;  2B5E A;  1GRX A;  2CAI A;  4KND A;  4RUV A;  4F0B A;  2L59 A;  2PVO C;  2GT5 A;  3LFL A;  3A2W A;  2P5Q A;  2BTO T;  4MLY A;  1TW9 A;  1Y6E A;  1XOA A;  3F4R A;  1X5E A;  2B1L A;  5IMV A;  2ON7 A;  3FZ9 A;  2XBI A;  1A2L A;  3L9V A;  4RI7 A;  2G0F A;  1B4P A;  4ECJ A;  1BYE A;  2K18 A;  4IJ3 A;  1SJZ A;  2H71 A;  3CMI A;  2H72 A;  4GSS A;  4HZ2 A;  4I97 A;  3ZTL A;  2OE1 A;  2MMZ A;  4QQ7 A;  4K0N A;  2KP2 A;  4GWR A;  3UAP A;  2JL4 A;  3GUS A;  2WFC A;  4PQI A;  2H30 A;  1SJI A;  2B1K A;  2VAF A;  4CW9 A;  1MDJ A;  1K3Y A;  3DXB A;  1MTC A;  3NIV A;  3CXG A;  5HFG A;  1VGL A;  1OVN A;  5B6M A;  1HYU A;  4DSS B;  4ECI A;  3ZMK A;  1O81 A;  4PQH A;  2C0F A;  5ECM B;  3VK9 A;  4OCF A;  4IJI A;  1XOB A;  4KSO A;  2FY6 A;  3PIN A;  2AV4 A;  3UEM A;  5DJM A;  3UBK A;  4XS1 A;  2FWF A;  5IO2 A;  2JSY A;  3UJ1 A;  4DSS A;  2CA8 A;  1N8J A;  5B8A A;  3VLN A;  8GSS A;  4KAE A;  2VCZ A;  1GWC A;  2YPM A;  1JFU A;  1AIU A;  2F9S A;  3HYP A;  3UMA A;  1VRS D;  4KDY A;  2KP1 A;  4PNG A;  1G0T A;  2X8C A;  3QDN A;  4BWS A;  4HU9 A;  1YKC A;  2FA8 A;  3TKR A;  2WRT A;  4AGS A;  3L9U A;  2LQO A;  3Q19 A;  4HDE A;  1F3A A;  4MAB A;  3ZIV A;  4EDY A;  4IP1 A;  5G1K A;  4XS4 B;  2R4V A;  2YCD A;  2VD1 A;  5D8I A;  4G10 A;  5G2Z A;  5FHI A;  5E4W A;  3TGZ A;  3TJK A;  1V2A A;  1XWA A;  4JBB A;  2H1D A;  1JZW A;  3QCP A;  4XS4 A;  4E8E A;  2VM2 A;  1RQM A;  2P31 A;  1OYJ A;  5EPF A;  2HSY A;  3APO A;  3NOF A;  1GTU A;  4DVC A;  3KTL A;  4OFN A;  1U87 A;  2LRT A;  2V6K A;  2FHE A;  1FB6 A;  4NXI A;  1RK4 A;  3L9S A;  14GS A;  3IXR A;  1F3B A;  3VWX A;  3W8S A;  2ALB A;  2V2G A;  1EZK A;  2I81 A;  2VL2 C;  4ACS A;  4FYB A;  3GH9 A;  2VCW A;  2E7P A;  2P0G A;  3P90 A;  4KB3 A;  3DEX A;  1OC3 A;  2Z9S A;  1SL0 B;  4HUA A;  2OE3 A;  4I8B A;  3IOS A;  2HZF A;  5ECN B;  3RHB A;  3VWU A;  3FEU A;  1Z7P A;  1BG5 A;  4XRA A;  3LOR A;  2MMO A;  2VIM A;  3LSZ A;  1GLP A;  20GS A;  2PGT A;  1J9B A;  1HNA A;  2A4V A;  5DQY A;  1SEN A;  4LLR A;  5ABR A;  3G7Y A;  1F9M A;  1H75 A;  3KMO A;  5AN1 A;  1EEM A;  2V6O A;  4IP6 A;  4XRD A;  1DSB A;  1PL2 A;  4MJA A;  3P2A A;  4PXO A;  2XPD A;  4X0X A;  4ZBD A;  4ZL8 A;  3TKP A;  5DDL A;  1EOH A;  3DIE A;  4KCA A;  5CRG A;  3TJG A;  3G7J A;  3ZIJ A;  1TDI A;  4MJC A;  3RBT A;  1TI1 A;  2CVD A;  1G6Y A;  4ZB8 A;  5HQP A;  3DWV A;  4EC0 A;  2H76 A;  5IOX A;  4PUF C;  1MDK A;  1GUH A;  2FCH A;  4AF2 A;  1Z6N A;  4F2I A;  2OA7 A;  4WR5 A;  3P7X A;  6GSU A;  1BJX A;  2YN1 A;  2VL2 A;  3HXS A;  4EDZ A;  4IS0 A;  2QSI A;  4F0C A;  1S3A A;  4MF5 A;  5C04 A;  2H74 A;  4GRF A;  2YWO A;  1Y25 A;  2M46 A;  3EUR A;  4EL1 A;  5A4U A;  1SKR B;  2C80 A;  2FUG 2;  2M72 A;  2CX3 A;  5ID2 B;  18GS A;  3TKS E;  5H5R A;  2R37 A;  1YQ1 A;  3W8J A;  2MMA A;  2H8L A;  5HR1 A;  1OE7 A;  2LST A;  4OO5 A;  5ID2 A;  1O73 A;  4MPF A;  1SD9 A;  2GZP A;  3KJY A;  3DD3 A;  3H79 A;  3F63 A;  2G2Q A;  2XHF A;  4ML1 A;  1TOF A;  3ZL5 A;  1X9M B;  5IMZ A;  1GP1 A;  1WRY A;  1NM3 A;  5IMA A;  1G7O A;  4XTS A;  1JZD A;  1ZZY A;  3D21 A;  1HNB A;  4MA9 A;  3FW2 A;  2IMI A;  4KX4 A;  1YJ6 A;  4HJ2 A;  1Q4J A;  3M9J A;  1T1V A;  3FZ5 A;  2ZUP A;  3QAG A;  2ON5 A;  4GTU A;  1UVZ A;  2YJ7 A;  3EMP A;  1Z9H A;  4O7H A;  5A4V A;  1GTI A;  2GGT A;  1PD2 1;  4ZXG A;  2CVB A;  4V2L A;  3ZVJ A;  2JAC A;  4V1A p;  2PU9 C;  3O6T A;  5HFK A;  3GL3 A;  5IPH A;  3KH7 A;  4J57 E;  4IEL A;  1EP8 A;  4GST A;  4HZ4 A;  2WDU A;  2QGV A;  1RW1 A;  2WZ9 A;  5IQY A;  3GKN A;  2YWN A;  3QOU A;  4J2F A;  4DEJ A;  1PX7 A;  3WGD A;  4ZB9 A;  3VI7 A;  4HI7 A;  3CTG A;  1GNW A;  3US3 A;  4G9H A;  4LMW A;  2GSS A;  1PQN A;  4BA7 A;  1FVK A;  2R6K A;  2XC2 A;  2GLR A;  4ECB A;  4HS1 A;  4NHZ A;  1WP0 A;  5G5F A;  4IQ1 A;  2VLU A;  4ZB6 A;  3QD9 A;  4NWY A;  5CNW A;  3LYK A;  5JCW A;  3DYR A;  1J08 A;  5G5E A;  3ZZX A;  1W89 A;  1T4Z A;  4TRX A;  2H6Y A;  4KUN A;  1EV4 A;  2C0D A;  1CQG A;  1HD2 A;  3IA1 A;  2H0H A;  1M0U A;  3GKM A;  3HCZ A;  2HXK A;  2GST A;  17GS A;  1MD4 A;  2C3T A;  5HR3 A;  3NZN A;  5EVO A;  4GF0 A;  2YP6 A;  2REM A;  2PN8 A;  2C0G A;  2H0G A;  5CYY A;  3F3Q A;  3KH9 A;  2FWG A;  5A5K A;  4EVM A;  2EIQ A;  2HZE B;  3GTU B;  3UVH A;  4PX1 A;  2L6C A;  12GS A;  4G2E A;  2N5F A;  5C00 A;  2D2Z A;  2YV7 A;  2NPB A;  5D9T A;  2HZE A;  22GS A;  4NMU A;  3GTU A;  1U3I A;  2LUS A;  1EV9 A;  1TU7 A;  4TXO B;  1TU8 A;  4K7I A;  1M99 A;  4IN0 A;  3KTB A;  2OJL A;  1TXX A;  2PUK C;  3E9J B;  4XS6 A;  5D9W A;  5E59 A;  3EU3 A;  2TRX A;  3D4T A;  4YQU A;  3CBU A;  1FW1 A;  3GKX A;  3F4T A;  3IK7 A;  3JCM L;  2H6Z A;  3VFI A;  3M9K A;  1KNG A;  3GL5 A;  3EYT A;  3WYW A;  1NHY A;  3TJF A;  5G1L A;  1A23 A;  2VD0 A;  1B9X C;  4YAP A;  1X5C A;  1GTA A;  4V2M A;  5CRH A;  1GUK A;  1O8X A;  3W6G A;  4LA1 A;  5F05 A;  1M2D A;  4I2T A;  3FY7 A;  1EGO A;  1T7P B;  1C72 A;  1VF4 A;  3TKQ A;  4K1F A;  5ECL B;  5GAN D;  2IFQ B;  5AIS A;  1NHO A;  2DC5 A;  1FB0 A;  1TKD B;  2N5B A;  3VPQ A;  4MZB A;  3IE3 A;  4WR4 A;  2E2M A;  3VI5 A;  2IFQ A;  4MCU A;  3UIW A;  2LRC A;  3GIX A;  1XVW A;  2FWE A;  6GST A;  3TUE A;  4MF7 A;  5KEJ A;  5IM9 A;  5FWG A;  3KM6 A;  5DJL A;  2P5R A;  3QMX A;  5COH A;  5F8B A;  3S9F A;  3IAM 2;  1WE0 A;  3WT1 A;  5B8B A;  4NHW A;  4IQA A;  5AIX A;  1K0C A;  1R4W A;  2YWI A;  1SD8 A;  2XPE A;  3HDC A;  3C73 A;  2DIY A;  3GKK A;  4MF6 A;  3HZ8 A;  1TK5 B;  5KN2 A;  3GFK A;  5F07 A;  4N0Z A;  2X8G A;  4Q5Q A;  2FNO A;  1AC1 A;  1LBK A;  1GSD A;  11GS A;  1DBY A;  1KTE A;  2I4A A;  2GT6 A;  5FT3 A;  13GS A;  5ECR B;  4IVF A;  1YY7 A;  2L4C A;  1WPI A;  5DAL B;  5GZZ B;  3MNG A;  1VF2 A;  3TB2 A;  2KHP A;  2OAD A;  4KCE A;  1AQV A;  2GDR A;  4ISD A;  2C3Q A;  5DAL A;  1O6J A;  3I6A A;  1XWB A;  2WJU A;  3ERG A;  3I43 A;  1EGR A;  5LCZ A;  4EO3 A;  3Q18 A;  2YWM A;  4YAV A;  7GSS A;  1OE8 A;  1ACV A;  2H73 A;  5F0G A;  3C1R A;  4HJM A;  3LJR A;  5J4U A;  3TRX A;  1XXU A;  1ML6 A;  1QGV A;  4J56 E;  1WMJ A;  1PA3 A;  1QUW A;  4OCE A;  1U3A A;  1ERU A;  2C0E A;  4OD7 A;  4KSM A;  2H01 A;  5JWQ B;  1U6T A;  1M9A A;  4TR4 A;  1O7U A;  4POL A;  3F0I A;  3EE2 A;  3GHA A;  3TOT A;  6GSS A;  4BVX A;  2RM6 A;  1T4Y A;  19GS A;  4FIW A;  3FR9 A;  2E2G A;  4X1U A;  4K2D A;  1AQW A;  2LJK A;  2LKU A;  3KGK A;  1A8Y A;  2VL3 A;  2LJA A;  3ZML A;  2VM1 A;  2JU5 A;  2DJJ A;  2GQL A;  2H1B A;  2JSZ A;  1AUC A;  4OO4 A;  3N9J A;  1YF0 A;  3EWL A;  4IKH A;  4YH2 A;  5CO3 A;  2DSA A;  1F2E A;  3FZA A;  2GSQ A;  2PBJ A;  3HJM A;  2YV9 A;  3ERF A;  1ON4 A;  2ES7 A;  1ZMA A;  5J9B A;  1K0D A;  2BJX A;  4Q5R A;  1Z5Y E;  2YJH A;  3WGX A;  1GNE A;  1TRV A;  4TR0 A;  1X0R A;  5CP1 A;  3DKS A;  3MWH A;  4K0G A;  3TJB A;  3E3E A;  1E2Y A;  5D73 A;  3H8Q A;  3I9V 2;  2IMF A;  1ILO A;  1XBS A;  4PNF A;  1DUG A;  4O32 A;  4PUR A;  4ID0 A;  3C8E A;  2JZT A;  4N10 A;  1ZGN A;  3VUR A;  4FO5 A;  1FAA A;  4MPG A;  1SKS B;  1UC7 A;  3EMX A;  2YAN A;  4HQS A;  4YQV A;  1XW6 A;  2RUE A;  2HT9 A;  2BMX A;  4RQX A;  4MZW A;  2KLX A;  3GRX A;  4POB A;  2TIR A;  1KEB A;  2I1U A;  2B5X A;  1GL8 A;  2F8A A;  3WGE A;  3OR5 A;  1URM A;  1MD3 A;  3DGQ A;  1JHB A;  4KA0 A;  2EIR A;  6GSW A;  4EE0 A;  1V98 A;  3MDK A;  4FH8 A;  2JZR A;  2K6V A;  3H1N A;  1G7E A;  3DRN A;  3VWW A;  3IAS 2;  1HQO A;  4CDO A;  4POM A;  2IWT A;  4JRR A;  3HKR A;  1K3L A;  1M9B A;  2B3S A;  3FKF A;  1B4Q A;  2RUF A;  1Z6M A;  1WOU A;  2O7K A;  3ME8 A;  4BVY A;  4GLT A;  1SU9 A;  4QL9 A;  2M80 A;  5IOW A;  1YEP A;  1R5A A;  4TOP A;  3IC4 A;  4LMV A;  4MDC A;  4WF5 A;  2RLI A;  2F51 A;  3UBL A;  1XPV A;  1PGT A;  1FOV A;  5CRW A;  2O8V B;  4PQ1 A;  1XFL A;  4WET A;  1XIY A;  2PWJ A;  4ZL9 A;  2H19 A;  2WUL A;  1H4O A;  3L4N A;  2LNS A;  1FHE A;  2H1G A;  1ST9 A;  4MZC A;  1V9W A;  2GSR A;  3GYK A;  2FLS A;  3CRT A;  1GSQ A;  3GN3 A;  4XIH A;  1PRX A;  2MYG A;  3J7Y b;  2I3Y A;  3L0H A;  1I9D A;  3D5J A;  1U88 A;  1YEX A;  3Q74 A;  3FR3 A;  3MSZ A;  4HQZ A;  1E6B A;  3EU4 A;  4MK3 A;  3A2X A;  3KEB A;  4ZBA A;  2FD3 A;  2HRF A;  5KN1 A;  3HZ4 A;  5IMD A;  2L57 A;  3FRC A;  3LXT A;  1EWX A;  2DBC A;  3BD2 A;  4FYC A;  2IN3 A;  3L78 A;  1X9S B;  1NSW A;  2HLS A;  2LJR A;  4GSN A;  1K0O A;  1WIK A;  2RM5 A;  2CAQ A;  1X9W B;  3BJ5 A;  2HYX A;  2AYT A;  2LEG A;  3A3T A;  1KBN A;  4DSQ A;  3EVI A;  5IO0 A;  4ZBB A;  2LQQ A;  3F6F A;  2GQK A;  3M3M A;  4NV2 A;  2K8S A;  3RPN A;  3O76 A;  2O89 A;  3O3T A;  5B6N A;  1BED A;  3ED3 A;  1WJK A;  1K0A A;  2B6M A;  2OE0 A;  4IBP A;  4F82 A;  1SK0 A;  5AIV A;  4JED A;  1XWK A;  2C8U A;  5EY6 A;  1EEJ A;  1DE1 A;  2GZZ A;  5GAP D;  1JZR A;  3GNJ A;  3LWA A;  3IRA A;  2H6X A;  4NV5 A;  2WGR A;  2OBI A;  1QQ2 A;  2OKA A;  3KIJ A;  3VWV A;  2H1A A;  3HJO A;  3DML A;  3DVX A;  1IYI A;  5JCU A;  1THX A;  4IGJ A;  2L6D A;  3APQ A;  4EKZ A;  3V1W A;  2HSH A;  3RPP A;  2IMD A;  3RHC A;  3HA9 A;  4MJB A;  4FYU A;  4BWQ A;  1UA5 A;  2NVL A;  4TVE A;  1LJR A;  1OC8 A;  3ZRE A;  5ECS A;  1V57 A;  4GXZ A;  1XCC A;  2FGX A;  2X8H A;  4CHS A;  1B48 A;  3FZ4 A;  2QC7 A;  2EC4 A;  1TI3 A;  3UOM A;  4TR3 A;  4JZQ A;  5ECK B;  2K9F A;  1A8L A;  3ZVJ D;  3QR6 A;  4HOJ A;  3FK8 A;  2GQM A;  3I69 A;  3DVW A;  3KMN A;  2C3N A;  1OKT A;  1Q98 A;  2KUC A;  5LNK e;  4ECC A;  6GSX A;  4GQC A;  2CVK A;  5L71 A;  1YZX A;  3H93 A;  5CAX A;  5ECP B;  3F3R A;  1ZCP A;  1TRS A;  1XZO A;  2PMT A;  4XHM A;  1GSS A;  5HR0 A;  1GSU A;  3CSI A;  4N30 A;  1K0B A;  4NAX A;  3PGT A;  3TKS C;  4YQM A;  2A2R A;  4K7O A;  2DLX A;  2IPA A;  3IDV A;  2AHE A;  2DJ3 A;  2VOC A;  5GST A;  2GS3 A;  3E0U A;  2DMM A;  2CZ2 A;  5D96 A;  4LL4 B;  4ZIL A;  2H75 A;  3IR4 A;  2B7K A;  3F9U A;  5B7C A;  1TK0 B;  2JAD A;  3GST A;  5H5Q A;  5D9X A;  1G6W A;  3FR6 A;  1HNC A;  2MBS A;  4TXV A;  1LU4 A;  2LS5 A;  3J7Y k;  1AQX A;  5KN3 A;  3ME7 A;  1VF3 A;  3AY8 A;  3UAR A;  1QMV A;  1X5D A;  5ELA A;  5HR2 A;  4EXJ A;  2QKE A;  3WD6 A;  5D93 A;  1Z7R A;  5DVB A;  2MZC A;  4ZIJ A;  3SWL A;  1SJ6 A;  1GSE A;  1A2M A;  4MMM A;  3HY2 A;  1XW5 A;  1VF1 A;  1QXH A;  1GUM A;  1QK8 A;  1SYX A;  1O85 A;  2L4Q A;  2WS2 A;  2GZY A;  3QFB C;  3KXO A;  2IL3 A;  2L5L A;  2V1M A;  3GUR A;  2LRN A;  2HFD A;  5DCG A;  3APS A;  2KOK A;  5H5S A;  4N0V A;  4Z7X A;  1OC9 B;  4WBJ A;  2LV3 A;  1M2B A;  2TRC P;  3D22 A;  4AJ8 A;  3TKS A;  5LD0 A;  1WWJ A;  2DML A;  3TRQ A;  4K9Z A;  4RQR A;  1ERW A;  5ECI B;  2CT6 A;  4F03 A;  2DJ2 A;  1OC9 A;  3C7M A;  1JLW A;  1T3B A;  2L5O A;  5EL8 A;  1PKW A;  2NTO A;  2LNT A;  3F4S A;  5ECO B;  5IMF A;  4XCS A;  3GA4 A;  2X99 A;  3CTF A;  2DJK A;  5ENU A;  1UN2 A;  2EIO A;  3UL3 A;  2O87 A;  3CSH A;  4L5L A;  3HHV A;  1PMT A;  4KGI A;  2B7J A;  1GSF A;  4KW6 A;  1ZYQ B;  3PR8 A;  1TK8 B;  2I9H A;  3LGC A;  2H66 A;  4OFT A;  1ERT A;  1SYR A;  2O85 A;  1GSY A;  2IME A;  3GV1 A;  3IBH A;  1F6M C;  1S3C A;  1AXD A;  1A2J A;  2HRN A;  1T8E B;  3BOA A;  3P8W A;  1K0M A;  4KE3 A;  1JZO A;  1PL1 A;  4I5Q A;  4HU7 A;  5AGY A;  5ECQ B;  3IPZ A;  3TOU A;  1XVQ A;  2LTK A;  3D4M A;  4QL7 A;  2J23 A;  1R26 A;  1B9Y C;  3TRP A;  4WEY A;  4O92 A;  1A24 A;  3ZFB A;  4E8H A;  4KDU A;  3IHQ A;  3G9B A;  4JR6 A;  2X64 A;  3F8U A;  2YNX A;  2GTU A;  3QFA C;  2F3M A;  3CYN A;  5KN0 A;  2MMN A;  3GX8 A;  3PH9 A;  3BCK A;  3C1S A;  1USB A;  2HI7 A;  1XWG A;  3KP9 A;  4WF4 A;  4K6X A;  3KCM A;  4EF0 A;  5DQS A;  4IW9 A;  5DCH A;  3WT2 A;  1CQH A;  1YKA A;  5CRD A;  4AJ7 A;  4PGT A;  3IV4 A;  3TCO A;  1FO5 A;  2YZH A;  3ISO A;  2C1Y A;  2VO4 A;  4WBR D;  1BX9 A;  3HVS A;  2IMK A;  2XBQ A;  3LYP A;  4Q5F A;  3SBC A;  3HVX A;  6GSV A;  3CSJ A;  4TW5 A;  1MDI A;  2V32 A;  4ULX A;  1SKW B;  4POK A;  4P3Y B;  2WCI A;  3LEF A;  4BPY A;  2FA4 A;  2R5G A;  2H0I A;  3N5O A;  5ELG A;  4H86 A;  3BCI A;  1TRU A;  3HVV A;  2CZ3 A;  1Z3E A;  4K8M A;  4RI6 A;  4EUY A;  3KZQ A;  2JZS A;  1FVJ A;  1PX6 A;  3ZFL A;  5J9C A;  4OFM A;  4JE1 A;  4ILF A;  4MJE A;  2R3X A;  1YDK A;  3F6D A;  1N2A A;  3RDW A;  4OWY A;  5J3R A;  3KP8 A;  4K7N A;  4JU5 A;  1A0R P;  4MP4 A;  1OAZ A;  2C4J A;  3M8N A;  4DSR A;  3ZYW A;  5HFI A;  4I2U A;  1PKZ A;  4NPB A;  4PUA A;  6GSY A;  3K8N A;  3RAZ A;  4LL1 B;  4AJ6 A;  2DIZ A;  1TJD A;  4G19 A;  1I5G A;  2OAC A;  3QAV A;  5INY A;  2H70 A;  3H4K A;  1PSQ A;  1TRW A;  9GSS A;  1R7H A;  3U5R E;  1V58 A;  1NW2 A;  1TP9 A;  1PN9 A;  3U6V A;  5JWO B;  4L0U A;  3MAK A;  3FHK A;  2GVP A;  3ERW A;  4GCI A;  5A4W A;  2AJQ B;  4ZL7 A;  5J41 A;  5IMC A;  4V1A g;  1AW9 A;  5D9V A;  5G31 A;  2AUV A;  1IYH A;  2NBS A;  4KDX A;  3HJP A;  3A5W A;  5DAK B;  1F37 A;  1J0F A;  2RII A;  2F8F A;  2CV4 A;  1S3D A;  2HNL A;  3QPM A;  5DAK A;  1FG4 A;  1EOG A;  1M7T A;  3GMF A;  5F06 A;  4OMV A;  4V2N A;  1XWC A;  2VCT A;  1ZL9 A;  4L8E A; 
#chains in the Genus database with same CATH topology
 1W4V A;  2CX4 A;  3GX0 A;  1TTZ A;  2VUP A;  3KD0 A;  5J5N A;  1A0F A;  2IJY A;  1THO A;  1R5P A;  3LW9 A;  10GS A;  1BAY A;  2K8V A;  3LQ7 A;  1O8W A;  2DJ0 A;  1EP7 A;  3UVT A;  5IIZ A;  3D0Z A;  2YOI A;  3R2Q A;  1V40 A;  3HD5 A;  2OBK A;  1T00 A;  3ZIT A;  1JLV A;  4TKY A;  2VLV A;  4KH7 A;  3G7I A;  1XW9 A;  1GTB A;  3EIN A;  3Q6O A;  2NDO A;  2ZCT A;  4HEA 2;  5JWR B;  16GS A;  2DJ1 A;  4L0W A;  1SK1 A;  1QFN A;  4WXT A;  1AAZ A;  1SL2 B;  4GQF A;  1ABA A;  1GH2 A;  2AAW A;  1GUL A;  5G30 A;  5CRE A;  2E0Q A;  2WB9 A;  3LXZ A;  2CQ9 A;  2PVQ A;  1YF1 A;  4X43 A;  2VCV A;  1B8X A;  2IIY A;  2VCQ A;  4G0L A;  4TN8 A;  1ERV A;  1ZOF A;  4I6X A;  1OKD A;  2PPT A;  5ECH B;  1SK2 A;  3ZRD A;  4N11 A;  4JR4 A;  2AB6 A;  4MH2 A;  5DBQ A;  3CRU A;  2YZU A;  3M1G A;  1ZYE A;  4IHU A;  2VL9 A;  1DE2 A;  2A2S A;  3EC3 A;  1K3O A;  4TR1 B;  3VPT A;  2B5Y A;  2PER A;  4ML6 A;  3TDG A;  3D6I A;  1BQ7 A;  3GSS A;  1SL1 B;  3BBY A;  4L5O A;  2HE3 A;  3C71 A;  4MH3 A;  2ZNM A;  4TR1 A;  2FWH A;  4WKW A;  3LG6 A;  1K0N A;  4D73 B;  4O5R A;  2R2J A;  5JCG A;  3QAW A;  3IK9 A;  1M2A A;  1XG8 A;  2J9H A;  3FYG A;  3ZLP A;  3M0F A;  5IPG A;  3TJJ A;  2V41 A;  1GLQ A;  4TXO A;  4F9Z A;  4D73 A;  2VLT A;  2VCX A;  3GH6 A;  4Q5N A;  2N5A A;  1S3R A;  3A2V A;  1MEK A;  4BL7 A;  5GSS A;  2MBT A;  2B5E A;  1GRX A;  2CAI A;  4KND A;  4RUV A;  4F0B A;  2L59 A;  2PVO C;  2GT5 A;  3LFL A;  3A2W A;  2P5Q A;  2BTO T;  4MLY A;  1TW9 A;  1Y6E A;  1XOA A;  3F4R A;  1X5E A;  2B1L A;  5IMV A;  2ON7 A;  3FZ9 A;  2XBI A;  1A2L A;  3L9V A;  4RI7 A;  2G0F A;  1B4P A;  4ECJ A;  1BYE A;  2K18 A;  4IJ3 A;  1SJZ A;  2H71 A;  3CMI A;  2H72 A;  4GSS A;  4HZ2 A;  4I97 A;  3ZTL A;  2OE1 A;  2MMZ A;  4QQ7 A;  4K0N A;  2KP2 A;  4GWR A;  3UAP A;  2JL4 A;  3GUS A;  2WFC A;  4PQI A;  2H30 A;  1SJI A;  2B1K A;  2VAF A;  4CW9 A;  1MDJ A;  1K3Y A;  3DXB A;  1MTC A;  3NIV A;  3CXG A;  5HFG A;  1VGL A;  1OVN A;  5B6M A;  1HYU A;  4DSS B;  4ECI A;  3ZMK A;  1O81 A;  4PQH A;  2C0F A;  5ECM B;  3VK9 A;  4OCF A;  4IJI A;  1XOB A;  4KSO A;  4YKG A;  2FY6 A;  3PIN A;  2AV4 A;  3UEM A;  5DJM A;  3UBK A;  4XS1 A;  2FWF A;  5IO2 A;  2JSY A;  3UJ1 A;  4A5P A;  4DSS A;  2CA8 A;  1N8J A;  5B8A A;  3VLN A;  8GSS A;  4KAE A;  2VCZ A;  1GWC A;  2YPM A;  1JFU A;  1AIU A;  2F9S A;  3HYP A;  3UMA A;  1VRS D;  4KDY A;  2KP1 A;  4PNG A;  1G0T A;  2X8C A;  3QDN A;  4ICY A;  4BWS A;  4HU9 A;  1YKC A;  2FA8 A;  3TKR A;  2WRT A;  4AGS A;  3L9U A;  2LQO A;  3Q19 A;  4HDE A;  1F3A A;  4MAB A;  3ZIV A;  4EDY A;  4IP1 A;  5G1K A;  4XS4 B;  2R4V A;  2YCD A;  2VD1 A;  5D8I A;  4G10 A;  5G2Z A;  5FHI A;  5E4W A;  3TGZ A;  3TJK A;  4KF9 A;  1V2A A;  1XWA A;  4JBB A;  2H1D A;  1JZW A;  3QCP A;  4XS4 A;  4E8E A;  2VM2 A;  1RQM A;  2P31 A;  1OYJ A;  5EPF A;  2HSY A;  3APO A;  3NOF A;  1GTU A;  4DVC A;  3KTL A;  4OFN A;  1U87 A;  2LRT A;  2V6K A;  2FHE A;  1FB6 A;  4NXI A;  1RK4 A;  3L9S A;  14GS A;  3IXR A;  1F3B A;  3VWX A;  3W8S A;  2ALB A;  2V2G A;  1EZK A;  2I81 A;  2VL2 C;  4ACS A;  4FYB A;  3GH9 A;  2VCW A;  2E7P A;  2P0G A;  3P90 A;  4KB3 A;  3DEX A;  1OC3 A;  2Z9S A;  1SL0 B;  4HUA A;  2OE3 A;  4I8B A;  3IOS A;  2HZF A;  4K5R A;  5ECN B;  3RHB A;  3VWU A;  3FEU A;  1Z7P A;  1BG5 A;  4XRA A;  3LOR A;  2MMO A;  2VIM A;  3LSZ A;  1GLP A;  20GS A;  4O5U A;  2PGT A;  1J9B A;  1HNA A;  2A4V A;  5DQY A;  1SEN A;  4LLR A;  5ABR A;  3G7Y A;  1F9M A;  1H75 A;  3KMO A;  5AN1 A;  1EEM A;  2V6O A;  4IP6 A;  4XRD A;  1DSB A;  1PL2 A;  4MJA A;  3P2A A;  4PXO A;  2XPD A;  4X0X A;  4ZBD A;  4ZL8 A;  3TKP A;  5DDL A;  1EOH A;  3DIE A;  4KCA A;  5CRG A;  3TJG A;  3G7J A;  3ZIJ A;  1TDI A;  4MJC A;  3RBT A;  1TI1 A;  2CVD A;  1G6Y A;  4ZB8 A;  5HQP A;  3DWV A;  4EC0 A;  2H76 A;  5IOX A;  4PUF C;  1MDK A;  1GUH A;  2FCH A;  4AF2 A;  1Z6N A;  4F2I A;  2OA7 A;  4WR5 A;  3P7X A;  6GSU A;  1BJX A;  2YN1 A;  2VL2 A;  3HXS A;  4EDZ A;  4IS0 A;  2QSI A;  4F0C A;  1S3A A;  4MF5 A;  5C04 A;  2H74 A;  4GRF A;  2YWO A;  1Y25 A;  2M46 A;  3EUR A;  4EL1 A;  5A4U A;  1SKR B;  2C80 A;  2FUG 2;  2M72 A;  5BMU A;  2CX3 A;  5ID2 B;  18GS A;  3TKS E;  5H5R A;  2R37 A;  1YQ1 A;  3W8J A;  2MMA A;  2H8L A;  5HR1 A;  1OE7 A;  2DKH A;  4G0K A;  2LST A;  4OO5 A;  5ID2 A;  1ZYN A;  1O73 A;  4MPF A;  1SD9 A;  4MNN A;  2GZP A;  3KJY A;  3DD3 A;  3H79 A;  3F63 A;  2G2Q A;  2XHF A;  4ML1 A;  1TOF A;  3ZL5 A;  1X9M B;  5IMZ A;  1GP1 A;  1WRY A;  1NM3 A;  5IMA A;  1G7O A;  4XTS A;  1JZD A;  1ZZY A;  3D21 A;  1HNB A;  3IC8 A;  4MA9 A;  3FW2 A;  2IMI A;  4KX4 A;  1YJ6 A;  4HJ2 A;  2DKI A;  1Q4J A;  3M9J A;  1T1V A;  3FZ5 A;  2ZUP A;  2UZ8 A;  3QAG A;  2ON5 A;  4GTU A;  1UVZ A;  2YJ7 A;  3EMP A;  1Z9H A;  4O7H A;  5A4V A;  1ZYP A;  1GTI A;  2GGT A;  1PD2 1;  4ZXG A;  2CVB A;  4V2L A;  3ZVJ A;  3A5I A;  2JAC A;  4V1A p;  2PU9 C;  3O6T A;  5HFK A;  3GL3 A;  5IPH A;  3KH7 A;  4J57 E;  2X4A A;  4IEL A;  1EP8 A;  4GST A;  4O5Q A;  4HZ4 A;  2WDU A;  2QGV A;  1RW1 A;  2WZ9 A;  5IQY A;  2HRA A;  3GKN A;  2YWN A;  3QOU A;  4J2F A;  4DEJ A;  1PX7 A;  3WGD A;  4ZB9 A;  4FQU A;  3VI7 A;  4HI7 A;  3CTG A;  1GNW A;  3US3 A;  4G9H A;  4LMW A;  2GSS A;  1PQN A;  4BA7 A;  1FVK A;  2R6K A;  2XC2 A;  2GLR A;  4ECB A;  4HS1 A;  4NHZ A;  1WP0 A;  5G5F A;  4IQ1 A;  2VLU A;  4YKF A;  4ZB6 A;  3QD9 A;  4NWY A;  5CNW A;  3LYK A;  5JCW A;  3DYR A;  1J08 A;  5G5E A;  3ZZX A;  1W89 A;  1T4Z A;  4TRX A;  2H6Y A;  4KUN A;  1EV4 A;  2C0D A;  1CQG A;  1HD2 A;  3IA1 A;  3R3E A;  1M0U A;  2H0H A;  3GKM A;  3HCZ A;  2HXK A;  2GST A;  17GS A;  1MD4 A;  2C3T A;  2R0C A;  5HR3 A;  3NZN A;  5EVO A;  4GF0 A;  2YP6 A;  2REM A;  2PN8 A;  2C0G A;  2H0G A;  5CYY A;  3F3Q A;  3KH9 A;  2FWG A;  5A5K A;  4EVM A;  2EIQ A;  2HZE B;  3GTU B;  3UVH A;  4PX1 A;  2L6C A;  12GS A;  4G2E A;  2N5F A;  5C00 A;  2D2Z A;  2YV7 A;  2NPB A;  5D9T A;  2HZE A;  22GS A;  4NMU A;  3GTU A;  1U3I A;  2LUS A;  1EV9 A;  1TU7 A;  4TXO B;  1TU8 A;  4K7I A;  1M99 A;  2R0P A;  4IN0 A;  3KTB A;  2OJL A;  1TXX A;  2PUK C;  3E9J B;  4XS6 A;  5D9W A;  5E59 A;  3EU3 A;  2TRX A;  3D4T A;  4YQU A;  3CBU A;  1FW1 A;  4BL7 B;  3GKX A;  3F4T A;  3IK7 A;  3JCM L;  4Z2T A;  2H6Z A;  3VFI A;  3M9K A;  1KNG A;  3GL5 A;  3EYT A;  3WYW A;  1NHY A;  3TJF A;  5G1L A;  1A23 A;  2VD0 A;  1B9X C;  4YAP A;  1X5C A;  1GTA A;  4V2M A;  5CRH A;  1GUK A;  1O8X A;  3W6G A;  4LA1 A;  5F05 A;  1M2D A;  4I2T A;  3EPT A;  3FY7 A;  1EGO A;  1T7P B;  1C72 A;  1VF4 A;  3TKQ A;  4K1F A;  5ECL B;  5GAN D;  2IFQ B;  5AIS A;  1NHO A;  2DC5 A;  1FB0 A;  1TKD B;  2N5B A;  3VPQ A;  4MZB A;  3IE3 A;  4WR4 A;  2E2M A;  3VI5 A;  2IFQ A;  4MCU A;  3UIW A;  2LRC A;  3GIX A;  1XVW A;  2FWE A;  6GST A;  3TUE A;  4MF7 A;  5KEJ A;  2A4H A;  5IM9 A;  5FWG A;  3KM6 A;  5DJL A;  2P5R A;  3QMX A;  5COH A;  5F8B A;  3S9F A;  3IAM 2;  1WE0 A;  3WT1 A;  5B8B A;  4NHW A;  4IQA A;  5AIX A;  1K0C A;  1R4W A;  2YWI A;  1SD8 A;  2XPE A;  4BIK A;  3HDC A;  3C73 A;  4CY6 A;  2DIY A;  1PN0 A;  3GKK A;  1M3I A;  4MF6 A;  3HZ8 A;  1TK5 B;  5KN2 A;  3GFK A;  5F07 A;  4N0Z A;  2X8G A;  4Q5Q A;  2FNO A;  1AC1 A;  1LBK A;  1GSD A;  11GS A;  1DBY A;  1KTE A;  2I4A A;  2GT6 A;  5FT3 A;  13GS A;  5ECR B;  5KOW A;  4IVF A;  1YY7 A;  2L4C A;  1WPI A;  5DAL B;  5GZZ B;  3MNG A;  1VF2 A;  3TB2 A;  2KHP A;  2OAD A;  4KCE A;  1AQV A;  2GDR A;  4ISD A;  2C3Q A;  5DAL A;  1O6J A;  3I6A A;  1XWB A;  2WJU A;  3ERG A;  3I43 A;  1EGR A;  5LCZ A;  4EO3 A;  3Q18 A;  2YWM A;  4YAV A;  7GSS A;  1OE8 A;  1ACV A;  2H73 A;  5F0G A;  3C1R A;  4HJM A;  3LJR A;  5J4U A;  3TRX A;  1XXU A;  1ML6 A;  1QGV A;  4J56 E;  1WMJ A;  1PA3 A;  1QUW A;  4OCE A;  1U3A A;  1ERU A;  2C0E A;  4BVX B;  4OD7 A;  4KSM A;  2H01 A;  5JWQ B;  1U6T A;  1M9A A;  4TR4 A;  1O7U A;  4POL A;  3F0I A;  3EE2 A;  3GHA A;  3TOT A;  6GSS A;  4BVX A;  2RM6 A;  1T4Y A;  19GS A;  4FIW A;  3FR9 A;  2E2G A;  4X1U A;  4K2D A;  1AQW A;  2LJK A;  2LKU A;  3KGK A;  1A8Y A;  2VL3 A;  2LJA A;  3ZML A;  2VM1 A;  2JU5 A;  2DJJ A;  2GQL A;  2H1B A;  2JSZ A;  1AUC A;  4OO4 A;  3N9J A;  1YF0 A;  3EWL A;  4IKH A;  4YH2 A;  5CO3 A;  2DSA A;  1F2E A;  3FZA A;  2GSQ A;  2PBJ A;  3HJM A;  3PPU A;  2YV9 A;  3ERF A;  1ON4 A;  2ES7 A;  1ZMA A;  5J9B A;  1K0D A;  2BJX A;  4Q5R A;  1PFO A;  1Z5Y E;  2YJH A;  3WGX A;  1GNE A;  1TRV A;  4TR0 A;  1X0R A;  5CP1 A;  3DKS A;  3MWH A;  4K0G A;  3TJB A;  3E3E A;  1E2Y A;  5D73 A;  2A2P A;  3H8Q A;  3I9V 2;  2IMF A;  1ILO A;  1XBS A;  4PNF A;  1DUG A;  4O32 A;  4PUR A;  4ID0 A;  3C8E A;  2JZT A;  4N10 A;  1ZGN A;  3IHG A;  3VUR A;  4FO5 A;  1FAA A;  4MPG A;  1SKS B;  1UC7 A;  3EMX A;  2YAN A;  4HQS A;  4YQV A;  1XW6 A;  2RUE A;  2HT9 A;  2BMX A;  1M3J A;  4RQX A;  4MZW A;  2KLX A;  3GRX A;  4POB A;  2TIR A;  1KEB A;  2I1U A;  2B5X A;  1GL8 A;  2F8A A;  3WGE A;  3OR5 A;  1URM A;  1MD3 A;  3DGQ A;  1JHB A;  4KA0 A;  2EIR A;  6GSW A;  4EE0 A;  1V98 A;  3MDK A;  3CQF A;  4FH8 A;  4HSC X;  2JZR A;  2K6V A;  3H1N A;  1G7E A;  3DRN A;  3VWW A;  3IAS 2;  1HQO A;  4CDO A;  4POM A;  2IWT A;  4JRR A;  3HKR A;  4BVY B;  1K3L A;  1M9B A;  2B3S A;  3FKF A;  2HSM A;  1B4Q A;  2RUF A;  1Z6M A;  1WOU A;  2O7K A;  3ME8 A;  4BVY A;  4GLT A;  1SU9 A;  4QL9 A;  2M80 A;  5IOW A;  1YEP A;  1R5A A;  4TOP A;  3IC4 A;  4LMV A;  4MDC A;  4WF5 A;  2RLI A;  2F51 A;  4EIP A;  3UBL A;  1XPV A;  1PGT A;  1FOV A;  5CRW A;  2O8V B;  4PQ1 A;  1XFL A;  4WET A;  1XIY A;  2PWJ A;  4ZL9 A;  2H19 A;  2WUL A;  1H4O A;  3L4N A;  2LNS A;  1FHE A;  2H1G A;  1ST9 A;  4MZC A;  4Z2U A;  1V9W A;  2GSR A;  4X4J A;  3GYK A;  2FLS A;  3CRT A;  1GSQ A;  3GN3 A;  4XIH A;  1PRX A;  2MYG A;  3J7Y b;  2I3Y A;  3L0H A;  1I9D A;  3D5J A;  1U88 A;  1YEX A;  3Q74 A;  3FR3 A;  3MSZ A;  4HQZ A;  1E6B A;  3EU4 A;  4MK3 A;  3A2X A;  3KEB A;  4ZBA A;  2FD3 A;  2HRF A;  5KN1 A;  3HZ4 A;  5IMD A;  2L57 A;  3FRC A;  3LXT A;  1EWX A;  2DBC A;  3BD2 A;  4FYC A;  2IN3 A;  3L78 A;  1X9S B;  1NSW A;  2HLS A;  2LJR A;  4GSN A;  1K0O A;  1WIK A;  2RM5 A;  3FMW A;  2CAQ A;  1X9W B;  3BJ5 A;  2HYX A;  2AYT A;  2LEG A;  3A3T A;  1KBN A;  3MIX A;  4DSQ A;  3EVI A;  5IO0 A;  4ZBB A;  2LQQ A;  3F6F A;  2GQK A;  3M3M A;  4NV2 A;  2K8S A;  3RPN A;  3O76 A;  2O89 A;  3O3T A;  5B6N A;  1BED A;  3ED3 A;  1WJK A;  1K0A A;  2B6M A;  2OE0 A;  4IBP A;  4F82 A;  1SK0 A;  5AIV A;  4JED A;  1XWK A;  2C8U A;  5EY6 A;  1EEJ A;  1DE1 A;  2GZZ A;  5GAP D;  1JZR A;  3GNJ A;  3LWA A;  3IRA A;  2H6X A;  4NV5 A;  2WGR A;  2OBI A;  1QQ2 A;  2OKA A;  3KIJ A;  3VWV A;  2H1A A;  3HJO A;  3DML A;  3DVX A;  1IYI A;  5JCU A;  1THX A;  4IGJ A;  2L6D A;  3APQ A;  4EKZ A;  3V1W A;  2HSH A;  3RPP A;  2IMD A;  5BRT A;  3RHC A;  3HA9 A;  4MJB A;  4FYU A;  4BWQ A;  1UA5 A;  2NVL A;  4TVE A;  1LJR A;  1OC8 A;  3ZRE A;  5ECS A;  1V57 A;  2HRK A;  4GXZ A;  1XCC A;  2FGX A;  2X8H A;  4CHS A;  1B48 A;  3FZ4 A;  2QC7 A;  2EC4 A;  1TI3 A;  3UOM A;  4TR3 A;  1FOH A;  4K5S A;  4JZQ A;  5ECK B;  2K9F A;  1A8L A;  3ZVJ D;  3QR6 A;  4HOJ A;  3FK8 A;  2GQM A;  3I69 A;  3DVW A;  3KMN A;  2C3N A;  1OKT A;  1Q98 A;  2KUC A;  5LNK e;  4USS A;  3MYD A;  4ECC A;  6GSX A;  4GQC A;  2CVK A;  5L71 A;  1YZX A;  3H93 A;  5CAX A;  5ECP B;  3F3R A;  1ZCP A;  1TRS A;  1XZO A;  2PMT A;  4XHM A;  1GSS A;  5HR0 A;  1GSU A;  3CSI A;  4N30 A;  1K0B A;  4NAX A;  3PGT A;  3TKS C;  4YQM A;  2A2R A;  4K7O A;  2DLX A;  2IPA A;  3IDV A;  2AHE A;  2DJ3 A;  2VOC A;  5GST A;  2GS3 A;  3E0U A;  2DMM A;  2CZ2 A;  5D96 A;  4LL4 B;  4ZIL A;  2X49 A;  2H75 A;  3IR4 A;  2B7K A;  3F9U A;  5B7C A;  1TK0 B;  2JAD A;  3GST A;  5H5Q A;  5D9X A;  1G6W A;  3FR6 A;  4G0I A;  1HNC A;  2MBS A;  4TXV A;  1LU4 A;  2LS5 A;  3J7Y k;  1AQX A;  5KN3 A;  3ME7 A;  1VF3 A;  3AY8 A;  3UAR A;  1QMV A;  1X5D A;  5ELA A;  5HR2 A;  4EXJ A;  2QKE A;  3WD6 A;  5D93 A;  1Z7R A;  5DVB A;  2MZC A;  4ZIJ A;  3SWL A;  1SJ6 A;  1GSE A;  1A2M A;  4MMM A;  3HY2 A;  1XW5 A;  1VF1 A;  1QXH A;  1GUM A;  1QK8 A;  1SYX A;  1O85 A;  2L4Q A;  2WS2 A;  2GZY A;  3QFB C;  3KXO A;  2IL3 A;  2L5L A;  2V1M A;  3GUR A;  5KOX A;  2LRN A;  2HFD A;  5DCG A;  3APS A;  2KOK A;  5H5S A;  4N0V A;  4Z7X A;  1OC9 B;  4WBJ A;  2LV3 A;  1M2B A;  2TRC P;  3D22 A;  4AJ8 A;  3TKS A;  5LD0 A;  1WWJ A;  2DML A;  3TRQ A;  4K9Z A;  4RQR A;  1ERW A;  5ECI B;  2CT6 A;  4F03 A;  2DJ2 A;  1OC9 A;  3C7M A;  1JLW A;  1T3B A;  2L5O A;  5EL8 A;  1PKW A;  2NTO A;  2LNT A;  3F4S A;  5ECO B;  5IMF A;  4XCS A;  2R0G A;  3GA4 A;  2X99 A;  2QA2 A;  4Z2R A;  3CTF A;  2DJK A;  5ENU A;  1UN2 A;  2EIO A;  3UL3 A;  2O87 A;  3CSH A;  4L5L A;  3HHV A;  1PMT A;  4KGI A;  2B7J A;  1GSF A;  4KW6 A;  1ZYQ B;  3PR8 A;  1TK8 B;  2I9H A;  3LGC A;  2H66 A;  4OFT A;  1ERT A;  1SYR A;  2O85 A;  1GSY A;  2IME A;  3GV1 A;  3IBH A;  1F6M C;  1S3C A;  1AXD A;  1A2J A;  2HRN A;  1T8E B;  3BOA A;  3P8W A;  1K0M A;  4KE3 A;  1JZO A;  1PL1 A;  4I5Q A;  4HU7 A;  3HVN A;  5AGY A;  5ECQ B;  3IPZ A;  3TOU A;  1XVQ A;  2LTK A;  3D4M A;  4QL7 A;  2J23 A;  1R26 A;  1B9Y C;  3TRP A;  4WEY A;  4O92 A;  1A24 A;  3ZFB A;  4E8H A;  4KDU A;  3IHQ A;  3G9B A;  4JR6 A;  2X64 A;  3F8U A;  2YNX A;  2GTU A;  3QFA C;  2F3M A;  3CYN A;  5KN0 A;  2MMN A;  3GX8 A;  2QA1 A;  3PH9 A;  3BCK A;  3C1S A;  1USB A;  2HI7 A;  1XWG A;  3KP9 A;  4WF4 A;  4K6X A;  4PTS A;  3KCM A;  4EF0 A;  5DQS A;  4IW9 A;  5DCH A;  3WT2 A;  1CQH A;  1YKA A;  5CRD A;  4AJ7 A;  4EIQ A;  4PGT A;  3IV4 A;  3TCO A;  1FO5 A;  2YZH A;  3ISO A;  2C1Y A;  2VO4 A;  4WBR D;  1BX9 A;  3HVS A;  2IMK A;  2XBQ A;  3LYP A;  4Q5F A;  3SBC A;  3HVX A;  6GSV A;  3CSJ A;  4TW5 A;  1MDI A;  2V32 A;  4ULX A;  1SKW B;  4POK A;  4P3Y B;  2WCI A;  3LEF A;  4BPY A;  2FA4 A;  2R5G A;  2H0I A;  3N5O A;  5ELG A;  4H86 A;  3BCI A;  1TRU A;  3HVV A;  2CZ3 A;  1Z3E A;  4K8M A;  4RI6 A;  4EUY A;  3KZQ A;  2JZS A;  1FVJ A;  1PX6 A;  3ZFL A;  5J9C A;  4OFM A;  4JE1 A;  4K2X A;  4ILF A;  4MJE A;  2R3X A;  1YDK A;  3F6D A;  1N2A A;  3RDW A;  4OWY A;  5J3R A;  3KP8 A;  4K7N A;  4JU5 A;  1A0R P;  4MP4 A;  1OAZ A;  2C4J A;  3M8N A;  4DSR A;  3ZYW A;  5HFI A;  4I2U A;  1PKZ A;  4NPB A;  4PUA A;  6GSY A;  3K8N A;  3RAZ A;  4LL1 B;  4AJ6 A;  2DIZ A;  1TJD A;  4G19 A;  1I5G A;  2OAC A;  3QAV A;  5INY A;  2H70 A;  3H4K A;  1PSQ A;  1TRW A;  9GSS A;  1R7H A;  3U5R E;  1V58 A;  1NW2 A;  1TP9 A;  1PN9 A;  3U6V A;  5JWO B;  4L0U A;  3MAK A;  3FHK A;  2GVP A;  3ERW A;  4GCI A;  5A4W A;  2AJQ B;  4ZL7 A;  5J41 A;  5IMC A;  4V1A g;  1AW9 A;  5D9V A;  5G31 A;  2AUV A;  1IYH A;  2NBS A;  4CY8 A;  4KDX A;  3HJP A;  3A5W A;  5DAK B;  1F37 A;  1J0F A;  2RII A;  2F8F A;  2CV4 A;  1S3D A;  2HNL A;  3QPM A;  5DAK A;  1FG4 A;  1EOG A;  1M7T A;  3GMF A;  5F06 A;  4OMV A;  4V2N A;  1XWC A;  2VCT A;  1ZL9 A;  4L8E A; 
#chains in the Genus database with same CATH homology
 1W4V A;  2CX4 A;  3GX0 A;  1TTZ A;  2VUP A;  3KD0 A;  5J5N A;  1A0F A;  2IJY A;  1THO A;  1R5P A;  3LW9 A;  10GS A;  1BAY A;  2K8V A;  3LQ7 A;  1O8W A;  2DJ0 A;  1EP7 A;  3UVT A;  5IIZ A;  3D0Z A;  2YOI A;  3R2Q A;  1V40 A;  3HD5 A;  2OBK A;  1T00 A;  3ZIT A;  1JLV A;  4TKY A;  2VLV A;  4KH7 A;  3G7I A;  1XW9 A;  1GTB A;  3EIN A;  3Q6O A;  2NDO A;  2ZCT A;  4HEA 2;  5JWR B;  16GS A;  2DJ1 A;  4L0W A;  1SK1 A;  1QFN A;  4WXT A;  1AAZ A;  1SL2 B;  4GQF A;  1ABA A;  1GH2 A;  2AAW A;  1GUL A;  5G30 A;  5CRE A;  2E0Q A;  2WB9 A;  3LXZ A;  2CQ9 A;  2PVQ A;  1YF1 A;  4X43 A;  2VCV A;  1B8X A;  2IIY A;  2VCQ A;  4G0L A;  4TN8 A;  1ERV A;  1ZOF A;  4I6X A;  1OKD A;  2PPT A;  5ECH B;  1SK2 A;  3ZRD A;  4N11 A;  4JR4 A;  2AB6 A;  4MH2 A;  5DBQ A;  3CRU A;  2YZU A;  3M1G A;  1ZYE A;  4IHU A;  2VL9 A;  1DE2 A;  2A2S A;  3EC3 A;  1K3O A;  4TR1 B;  3VPT A;  2B5Y A;  2PER A;  4ML6 A;  3TDG A;  3D6I A;  1BQ7 A;  3GSS A;  1SL1 B;  3BBY A;  4L5O A;  2HE3 A;  3C71 A;  4MH3 A;  2ZNM A;  4TR1 A;  2FWH A;  4WKW A;  3LG6 A;  1K0N A;  4D73 B;  4O5R A;  2R2J A;  5JCG A;  3QAW A;  3IK9 A;  1M2A A;  2J9H A;  3FYG A;  3ZLP A;  3M0F A;  5IPG A;  3TJJ A;  2V41 A;  1GLQ A;  4TXO A;  4F9Z A;  4D73 A;  2VLT A;  2VCX A;  3GH6 A;  4Q5N A;  2N5A A;  3A2V A;  1MEK A;  4BL7 A;  5GSS A;  2MBT A;  2B5E A;  1GRX A;  2CAI A;  4KND A;  4RUV A;  4F0B A;  2L59 A;  2PVO C;  2GT5 A;  3LFL A;  3A2W A;  2P5Q A;  2BTO T;  4MLY A;  1TW9 A;  1Y6E A;  1XOA A;  3F4R A;  1X5E A;  2B1L A;  5IMV A;  2ON7 A;  3FZ9 A;  2XBI A;  1A2L A;  3L9V A;  4RI7 A;  2G0F A;  1B4P A;  4ECJ A;  1BYE A;  2K18 A;  4IJ3 A;  1SJZ A;  2H71 A;  3CMI A;  2H72 A;  4GSS A;  4HZ2 A;  4I97 A;  3ZTL A;  2OE1 A;  2MMZ A;  4QQ7 A;  4K0N A;  2KP2 A;  4GWR A;  3UAP A;  2JL4 A;  3GUS A;  2WFC A;  4PQI A;  2H30 A;  1SJI A;  2B1K A;  2VAF A;  4CW9 A;  1MDJ A;  1K3Y A;  3DXB A;  1MTC A;  3NIV A;  3CXG A;  5HFG A;  1VGL A;  1OVN A;  5B6M A;  1HYU A;  4DSS B;  4ECI A;  3ZMK A;  1O81 A;  4PQH A;  2C0F A;  5ECM B;  3VK9 A;  4OCF A;  4IJI A;  1XOB A;  4KSO A;  4YKG A;  2FY6 A;  3PIN A;  2AV4 A;  3UEM A;  5DJM A;  3UBK A;  4XS1 A;  2FWF A;  5IO2 A;  2JSY A;  3UJ1 A;  4A5P A;  4DSS A;  2CA8 A;  1N8J A;  5B8A A;  3VLN A;  8GSS A;  4KAE A;  2VCZ A;  1GWC A;  2YPM A;  1JFU A;  1AIU A;  2F9S A;  3HYP A;  3UMA A;  1VRS D;  4KDY A;  2KP1 A;  4PNG A;  1G0T A;  2X8C A;  3QDN A;  4ICY A;  4BWS A;  4HU9 A;  1YKC A;  2FA8 A;  3TKR A;  2WRT A;  4AGS A;  3L9U A;  2LQO A;  3Q19 A;  4HDE A;  1F3A A;  4MAB A;  3ZIV A;  4EDY A;  4IP1 A;  5G1K A;  4XS4 B;  2R4V A;  2YCD A;  2VD1 A;  5D8I A;  4G10 A;  5G2Z A;  5FHI A;  5E4W A;  3TGZ A;  3TJK A;  4KF9 A;  1V2A A;  1XWA A;  4JBB A;  2H1D A;  1JZW A;  3QCP A;  4XS4 A;  4E8E A;  2VM2 A;  1RQM A;  2P31 A;  1OYJ A;  5EPF A;  2HSY A;  3APO A;  3NOF A;  1GTU A;  4DVC A;  3KTL A;  4OFN A;  1U87 A;  2LRT A;  2V6K A;  2FHE A;  1FB6 A;  4NXI A;  1RK4 A;  3L9S A;  14GS A;  3IXR A;  1F3B A;  3VWX A;  3W8S A;  2ALB A;  2V2G A;  1EZK A;  2I81 A;  2VL2 C;  4ACS A;  4FYB A;  3GH9 A;  2VCW A;  2E7P A;  2P0G A;  3P90 A;  4KB3 A;  3DEX A;  1OC3 A;  2Z9S A;  1SL0 B;  4HUA A;  2OE3 A;  4I8B A;  3IOS A;  2HZF A;  4K5R A;  5ECN B;  3RHB A;  3VWU A;  3FEU A;  1Z7P A;  1BG5 A;  4XRA A;  3LOR A;  2MMO A;  2VIM A;  3LSZ A;  1GLP A;  20GS A;  4O5U A;  2PGT A;  1J9B A;  1HNA A;  2A4V A;  5DQY A;  1SEN A;  4LLR A;  5ABR A;  3G7Y A;  1F9M A;  1H75 A;  3KMO A;  5AN1 A;  1EEM A;  2V6O A;  4IP6 A;  4XRD A;  1DSB A;  1PL2 A;  4MJA A;  3P2A A;  4PXO A;  2XPD A;  4X0X A;  4ZBD A;  4ZL8 A;  3TKP A;  5DDL A;  1EOH A;  3DIE A;  4KCA A;  5CRG A;  3TJG A;  3G7J A;  3ZIJ A;  1TDI A;  4MJC A;  3RBT A;  1TI1 A;  2CVD A;  1G6Y A;  4ZB8 A;  5HQP A;  3DWV A;  4EC0 A;  2H76 A;  5IOX A;  4PUF C;  1MDK A;  1GUH A;  2FCH A;  4AF2 A;  1Z6N A;  4F2I A;  2OA7 A;  4WR5 A;  3P7X A;  6GSU A;  1BJX A;  2YN1 A;  2VL2 A;  3HXS A;  4EDZ A;  4IS0 A;  2QSI A;  4F0C A;  1S3A A;  4MF5 A;  5C04 A;  2H74 A;  4GRF A;  2YWO A;  1Y25 A;  2M46 A;  3EUR A;  4EL1 A;  5A4U A;  1SKR B;  2C80 A;  2FUG 2;  2M72 A;  5BMU A;  2CX3 A;  5ID2 B;  18GS A;  3TKS E;  5H5R A;  2R37 A;  1YQ1 A;  3W8J A;  2MMA A;  2H8L A;  5HR1 A;  1OE7 A;  2DKH A;  4G0K A;  2LST A;  4OO5 A;  5ID2 A;  1ZYN A;  1O73 A;  4MPF A;  1SD9 A;  4MNN A;  2GZP A;  3KJY A;  3DD3 A;  3H79 A;  3F63 A;  2G2Q A;  2XHF A;  4ML1 A;  1TOF A;  3ZL5 A;  1X9M B;  5IMZ A;  1GP1 A;  1WRY A;  1NM3 A;  5IMA A;  1G7O A;  4XTS A;  1JZD A;  1ZZY A;  3D21 A;  1HNB A;  3IC8 A;  4MA9 A;  3FW2 A;  2IMI A;  4KX4 A;  1YJ6 A;  4HJ2 A;  2DKI A;  1Q4J A;  3M9J A;  1T1V A;  3FZ5 A;  2ZUP A;  2UZ8 A;  3QAG A;  2ON5 A;  4GTU A;  1UVZ A;  2YJ7 A;  3EMP A;  1Z9H A;  4O7H A;  5A4V A;  1ZYP A;  1GTI A;  2GGT A;  1PD2 1;  4ZXG A;  2CVB A;  4V2L A;  3ZVJ A;  3A5I A;  2JAC A;  4V1A p;  2PU9 C;  3O6T A;  5HFK A;  3GL3 A;  5IPH A;  3KH7 A;  4J57 E;  2X4A A;  4IEL A;  1EP8 A;  4GST A;  4O5Q A;  4HZ4 A;  2WDU A;  2QGV A;  1RW1 A;  2WZ9 A;  5IQY A;  2HRA A;  3GKN A;  2YWN A;  3QOU A;  4J2F A;  4DEJ A;  1PX7 A;  3WGD A;  4ZB9 A;  4FQU A;  3VI7 A;  4HI7 A;  3CTG A;  1GNW A;  3US3 A;  4G9H A;  4LMW A;  2GSS A;  1PQN A;  4BA7 A;  1FVK A;  2R6K A;  2XC2 A;  2GLR A;  4ECB A;  4HS1 A;  4NHZ A;  1WP0 A;  5G5F A;  4IQ1 A;  2VLU A;  4YKF A;  4ZB6 A;  3QD9 A;  4NWY A;  5CNW A;  3LYK A;  5JCW A;  3DYR A;  1J08 A;  5G5E A;  3ZZX A;  1W89 A;  1T4Z A;  4TRX A;  2H6Y A;  4KUN A;  1EV4 A;  2C0D A;  1CQG A;  1HD2 A;  3IA1 A;  3R3E A;  1M0U A;  2H0H A;  3GKM A;  3HCZ A;  2HXK A;  2GST A;  17GS A;  1MD4 A;  2C3T A;  2R0C A;  5HR3 A;  3NZN A;  5EVO A;  4GF0 A;  2YP6 A;  2REM A;  2PN8 A;  2C0G A;  2H0G A;  5CYY A;  3F3Q A;  3KH9 A;  2FWG A;  5A5K A;  4EVM A;  2EIQ A;  2HZE B;  3GTU B;  3UVH A;  4PX1 A;  2L6C A;  12GS A;  4G2E A;  2N5F A;  5C00 A;  2D2Z A;  2YV7 A;  2NPB A;  5D9T A;  2HZE A;  22GS A;  4NMU A;  3GTU A;  1U3I A;  2LUS A;  1EV9 A;  1TU7 A;  4TXO B;  1TU8 A;  4K7I A;  1M99 A;  2R0P A;  4IN0 A;  3KTB A;  2OJL A;  1TXX A;  2PUK C;  3E9J B;  4XS6 A;  5D9W A;  5E59 A;  3EU3 A;  2TRX A;  3D4T A;  4YQU A;  3CBU A;  1FW1 A;  4BL7 B;  3GKX A;  3F4T A;  3IK7 A;  3JCM L;  4Z2T A;  2H6Z A;  3VFI A;  3M9K A;  1KNG A;  3GL5 A;  3EYT A;  3WYW A;  1NHY A;  3TJF A;  5G1L A;  1A23 A;  2VD0 A;  1B9X C;  4YAP A;  1X5C A;  1GTA A;  4V2M A;  5CRH A;  1GUK A;  1O8X A;  3W6G A;  4LA1 A;  5F05 A;  1M2D A;  4I2T A;  3EPT A;  3FY7 A;  1EGO A;  1T7P B;  1C72 A;  1VF4 A;  3TKQ A;  4K1F A;  5ECL B;  5GAN D;  2IFQ B;  5AIS A;  1NHO A;  2DC5 A;  1FB0 A;  1TKD B;  2N5B A;  3VPQ A;  4MZB A;  3IE3 A;  4WR4 A;  2E2M A;  3VI5 A;  2IFQ A;  4MCU A;  3UIW A;  2LRC A;  3GIX A;  1XVW A;  2FWE A;  6GST A;  3TUE A;  4MF7 A;  5KEJ A;  2A4H A;  5IM9 A;  5FWG A;  3KM6 A;  5DJL A;  2P5R A;  3QMX A;  5COH A;  5F8B A;  3S9F A;  3IAM 2;  1WE0 A;  3WT1 A;  5B8B A;  4NHW A;  4IQA A;  5AIX A;  1K0C A;  1R4W A;  2YWI A;  1SD8 A;  2XPE A;  3HDC A;  3C73 A;  4CY6 A;  2DIY A;  1PN0 A;  3GKK A;  4MF6 A;  3HZ8 A;  1TK5 B;  5KN2 A;  3GFK A;  5F07 A;  4N0Z A;  2X8G A;  4Q5Q A;  2FNO A;  1AC1 A;  1LBK A;  1GSD A;  11GS A;  1DBY A;  1KTE A;  2I4A A;  2GT6 A;  5FT3 A;  13GS A;  5ECR B;  5KOW A;  4IVF A;  1YY7 A;  2L4C A;  1WPI A;  5DAL B;  5GZZ B;  3MNG A;  1VF2 A;  3TB2 A;  2KHP A;  2OAD A;  4KCE A;  1AQV A;  2GDR A;  4ISD A;  2C3Q A;  5DAL A;  1O6J A;  3I6A A;  1XWB A;  2WJU A;  3ERG A;  3I43 A;  1EGR A;  5LCZ A;  4EO3 A;  3Q18 A;  2YWM A;  4YAV A;  7GSS A;  1OE8 A;  1ACV A;  2H73 A;  5F0G A;  3C1R A;  4HJM A;  3LJR A;  5J4U A;  3TRX A;  1XXU A;  1ML6 A;  1QGV A;  4J56 E;  1WMJ A;  1PA3 A;  1QUW A;  4OCE A;  1U3A A;  1ERU A;  2C0E A;  4BVX B;  4OD7 A;  4KSM A;  2H01 A;  5JWQ B;  1U6T A;  1M9A A;  4TR4 A;  1O7U A;  4POL A;  3F0I A;  3EE2 A;  3GHA A;  3TOT A;  6GSS A;  4BVX A;  2RM6 A;  1T4Y A;  19GS A;  4FIW A;  3FR9 A;  2E2G A;  4X1U A;  4K2D A;  1AQW A;  2LJK A;  2LKU A;  3KGK A;  1A8Y A;  2VL3 A;  2LJA A;  3ZML A;  2VM1 A;  2JU5 A;  2DJJ A;  2GQL A;  2H1B A;  2JSZ A;  1AUC A;  4OO4 A;  3N9J A;  1YF0 A;  3EWL A;  4IKH A;  4YH2 A;  5CO3 A;  2DSA A;  1F2E A;  3FZA A;  2GSQ A;  2PBJ A;  3HJM A;  3PPU A;  2YV9 A;  3ERF A;  1ON4 A;  2ES7 A;  1ZMA A;  5J9B A;  1K0D A;  2BJX A;  4Q5R A;  1Z5Y E;  2YJH A;  3WGX A;  1GNE A;  1TRV A;  4TR0 A;  1X0R A;  5CP1 A;  3DKS A;  3MWH A;  4K0G A;  3TJB A;  3E3E A;  1E2Y A;  5D73 A;  2A2P A;  3H8Q A;  3I9V 2;  2IMF A;  1ILO A;  1XBS A;  4PNF A;  1DUG A;  4O32 A;  4PUR A;  4ID0 A;  3C8E A;  2JZT A;  4N10 A;  1ZGN A;  3IHG A;  3VUR A;  4FO5 A;  1FAA A;  4MPG A;  1SKS B;  1UC7 A;  3EMX A;  2YAN A;  4HQS A;  4YQV A;  1XW6 A;  2RUE A;  2HT9 A;  2BMX A;  4RQX A;  4MZW A;  2KLX A;  3GRX A;  4POB A;  2TIR A;  1KEB A;  2I1U A;  2B5X A;  1GL8 A;  2F8A A;  3WGE A;  3OR5 A;  1URM A;  1MD3 A;  3DGQ A;  1JHB A;  4KA0 A;  2EIR A;  6GSW A;  4EE0 A;  1V98 A;  3MDK A;  4FH8 A;  2JZR A;  2K6V A;  3H1N A;  1G7E A;  3DRN A;  3VWW A;  3IAS 2;  1HQO A;  4CDO A;  4POM A;  2IWT A;  4JRR A;  3HKR A;  4BVY B;  1K3L A;  1M9B A;  2B3S A;  3FKF A;  2HSM A;  1B4Q A;  2RUF A;  1Z6M A;  1WOU A;  2O7K A;  3ME8 A;  4BVY A;  4GLT A;  1SU9 A;  4QL9 A;  2M80 A;  5IOW A;  1YEP A;  1R5A A;  4TOP A;  3IC4 A;  4LMV A;  4MDC A;  4WF5 A;  2RLI A;  2F51 A;  4EIP A;  3UBL A;  1XPV A;  1PGT A;  1FOV A;  5CRW A;  2O8V B;  4PQ1 A;  1XFL A;  4WET A;  1XIY A;  2PWJ A;  4ZL9 A;  2H19 A;  2WUL A;  1H4O A;  3L4N A;  2LNS A;  1FHE A;  2H1G A;  1ST9 A;  4MZC A;  4Z2U A;  1V9W A;  2GSR A;  4X4J A;  3GYK A;  2FLS A;  3CRT A;  1GSQ A;  3GN3 A;  4XIH A;  1PRX A;  2MYG A;  3J7Y b;  2I3Y A;  3L0H A;  1I9D A;  3D5J A;  1U88 A;  1YEX A;  3Q74 A;  3FR3 A;  3MSZ A;  4HQZ A;  1E6B A;  3EU4 A;  4MK3 A;  3A2X A;  3KEB A;  4ZBA A;  2FD3 A;  2HRF A;  5KN1 A;  3HZ4 A;  5IMD A;  2L57 A;  3FRC A;  3LXT A;  1EWX A;  2DBC A;  3BD2 A;  4FYC A;  2IN3 A;  3L78 A;  1X9S B;  1NSW A;  2HLS A;  2LJR A;  4GSN A;  1K0O A;  1WIK A;  2RM5 A;  3FMW A;  2CAQ A;  1X9W B;  3BJ5 A;  2HYX A;  2AYT A;  2LEG A;  3A3T A;  1KBN A;  3MIX A;  4DSQ A;  3EVI A;  5IO0 A;  4ZBB A;  2LQQ A;  3F6F A;  2GQK A;  3M3M A;  4NV2 A;  2K8S A;  3RPN A;  3O76 A;  2O89 A;  3O3T A;  5B6N A;  1BED A;  3ED3 A;  1WJK A;  1K0A A;  2B6M A;  2OE0 A;  4IBP A;  4F82 A;  1SK0 A;  5AIV A;  4JED A;  1XWK A;  2C8U A;  5EY6 A;  1EEJ A;  1DE1 A;  2GZZ A;  5GAP D;  1JZR A;  3GNJ A;  3LWA A;  3IRA A;  2H6X A;  4NV5 A;  2WGR A;  2OBI A;  1QQ2 A;  2OKA A;  3KIJ A;  3VWV A;  2H1A A;  3HJO A;  3DML A;  3DVX A;  1IYI A;  5JCU A;  1THX A;  4IGJ A;  2L6D A;  3APQ A;  4EKZ A;  3V1W A;  2HSH A;  3RPP A;  2IMD A;  5BRT A;  3RHC A;  3HA9 A;  4MJB A;  4FYU A;  4BWQ A;  1UA5 A;  2NVL A;  4TVE A;  1LJR A;  1OC8 A;  3ZRE A;  5ECS A;  1V57 A;  2HRK A;  4GXZ A;  1XCC A;  2FGX A;  2X8H A;  4CHS A;  1B48 A;  3FZ4 A;  2QC7 A;  2EC4 A;  1TI3 A;  3UOM A;  4TR3 A;  1FOH A;  4K5S A;  4JZQ A;  5ECK B;  2K9F A;  1A8L A;  3ZVJ D;  3QR6 A;  4HOJ A;  3FK8 A;  2GQM A;  3I69 A;  3DVW A;  3KMN A;  2C3N A;  1OKT A;  1Q98 A;  2KUC A;  5LNK e;  4USS A;  3MYD A;  4ECC A;  6GSX A;  4GQC A;  2CVK A;  5L71 A;  1YZX A;  3H93 A;  5CAX A;  5ECP B;  3F3R A;  1ZCP A;  1TRS A;  1XZO A;  2PMT A;  4XHM A;  1GSS A;  5HR0 A;  1GSU A;  3CSI A;  4N30 A;  1K0B A;  4NAX A;  3PGT A;  3TKS C;  4YQM A;  2A2R A;  4K7O A;  2DLX A;  2IPA A;  3IDV A;  2AHE A;  2DJ3 A;  2VOC A;  5GST A;  2GS3 A;  3E0U A;  2DMM A;  2CZ2 A;  5D96 A;  4LL4 B;  4ZIL A;  2X49 A;  2H75 A;  3IR4 A;  2B7K A;  3F9U A;  5B7C A;  1TK0 B;  2JAD A;  3GST A;  5H5Q A;  5D9X A;  1G6W A;  3FR6 A;  4G0I A;  1HNC A;  2MBS A;  4TXV A;  1LU4 A;  2LS5 A;  3J7Y k;  1AQX A;  5KN3 A;  3ME7 A;  1VF3 A;  3AY8 A;  3UAR A;  1QMV A;  1X5D A;  5ELA A;  5HR2 A;  4EXJ A;  2QKE A;  3WD6 A;  5D93 A;  1Z7R A;  5DVB A;  2MZC A;  4ZIJ A;  3SWL A;  1SJ6 A;  1GSE A;  1A2M A;  4MMM A;  3HY2 A;  1XW5 A;  1VF1 A;  1QXH A;  1GUM A;  1QK8 A;  1SYX A;  1O85 A;  2L4Q A;  2WS2 A;  2GZY A;  3QFB C;  3KXO A;  2IL3 A;  2L5L A;  2V1M A;  3GUR A;  5KOX A;  2LRN A;  2HFD A;  5DCG A;  3APS A;  2KOK A;  5H5S A;  4N0V A;  4Z7X A;  1OC9 B;  4WBJ A;  2LV3 A;  1M2B A;  2TRC P;  3D22 A;  4AJ8 A;  3TKS A;  5LD0 A;  1WWJ A;  2DML A;  3TRQ A;  4K9Z A;  4RQR A;  1ERW A;  5ECI B;  2CT6 A;  4F03 A;  2DJ2 A;  1OC9 A;  3C7M A;  1JLW A;  1T3B A;  2L5O A;  5EL8 A;  1PKW A;  2NTO A;  2LNT A;  3F4S A;  5ECO B;  5IMF A;  4XCS A;  2R0G A;  3GA4 A;  2X99 A;  2QA2 A;  4Z2R A;  3CTF A;  2DJK A;  5ENU A;  1UN2 A;  2EIO A;  3UL3 A;  2O87 A;  3CSH A;  4L5L A;  3HHV A;  1PMT A;  4KGI A;  2B7J A;  1GSF A;  4KW6 A;  1ZYQ B;  3PR8 A;  1TK8 B;  2I9H A;  3LGC A;  2H66 A;  4OFT A;  1ERT A;  1SYR A;  2O85 A;  1GSY A;  2IME A;  3GV1 A;  3IBH A;  1F6M C;  1S3C A;  1AXD A;  1A2J A;  2HRN A;  1T8E B;  3BOA A;  3P8W A;  1K0M A;  4KE3 A;  1JZO A;  1PL1 A;  4I5Q A;  4HU7 A;  5AGY A;  5ECQ B;  3IPZ A;  3TOU A;  1XVQ A;  2LTK A;  3D4M A;  4QL7 A;  2J23 A;  1R26 A;  1B9Y C;  3TRP A;  4WEY A;  4O92 A;  1A24 A;  3ZFB A;  4E8H A;  4KDU A;  3IHQ A;  3G9B A;  4JR6 A;  2X64 A;  3F8U A;  2YNX A;  2GTU A;  3QFA C;  2F3M A;  3CYN A;  5KN0 A;  2MMN A;  3GX8 A;  2QA1 A;  3PH9 A;  3BCK A;  3C1S A;  1USB A;  2HI7 A;  1XWG A;  3KP9 A;  4WF4 A;  4K6X A;  4PTS A;  3KCM A;  4EF0 A;  5DQS A;  4IW9 A;  5DCH A;  3WT2 A;  1CQH A;  1YKA A;  5CRD A;  4AJ7 A;  4EIQ A;  4PGT A;  3IV4 A;  3TCO A;  1FO5 A;  2YZH A;  3ISO A;  2C1Y A;  2VO4 A;  4WBR D;  1BX9 A;  3HVS A;  2IMK A;  2XBQ A;  3LYP A;  4Q5F A;  3SBC A;  3HVX A;  6GSV A;  3CSJ A;  4TW5 A;  1MDI A;  2V32 A;  4ULX A;  1SKW B;  4POK A;  4P3Y B;  2WCI A;  3LEF A;  4BPY A;  2FA4 A;  2R5G A;  2H0I A;  3N5O A;  5ELG A;  4H86 A;  3BCI A;  1TRU A;  3HVV A;  2CZ3 A;  1Z3E A;  4K8M A;  4RI6 A;  4EUY A;  3KZQ A;  2JZS A;  1FVJ A;  1PX6 A;  3ZFL A;  5J9C A;  4OFM A;  4JE1 A;  4K2X A;  4ILF A;  4MJE A;  2R3X A;  1YDK A;  3F6D A;  1N2A A;  3RDW A;  4OWY A;  5J3R A;  3KP8 A;  4K7N A;  4JU5 A;  1A0R P;  4MP4 A;  1OAZ A;  2C4J A;  3M8N A;  4DSR A;  3ZYW A;  5HFI A;  4I2U A;  1PKZ A;  4NPB A;  4PUA A;  6GSY A;  3K8N A;  3RAZ A;  4LL1 B;  4AJ6 A;  2DIZ A;  1TJD A;  4G19 A;  1I5G A;  2OAC A;  3QAV A;  5INY A;  2H70 A;  3H4K A;  1PSQ A;  1TRW A;  9GSS A;  1R7H A;  3U5R E;  1V58 A;  1NW2 A;  1TP9 A;  1PN9 A;  3U6V A;  5JWO B;  4L0U A;  3MAK A;  3FHK A;  2GVP A;  3ERW A;  4GCI A;  5A4W A;  2AJQ B;  4ZL7 A;  5J41 A;  5IMC A;  4V1A g;  1AW9 A;  5D9V A;  5G31 A;  2AUV A;  1IYH A;  2NBS A;  4CY8 A;  4KDX A;  3HJP A;  3A5W A;  5DAK B;  1F37 A;  1J0F A;  2RII A;  2F8F A;  2CV4 A;  1S3D A;  2HNL A;  3QPM A;  5DAK A;  1FG4 A;  1EOG A;  1M7T A;  3GMF A;  5F06 A;  4OMV A;  4V2N A;  1XWC A;  2VCT A;  1ZL9 A;  4L8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...