3DIEA

Domain swapping of staphylococcus aureus thioredoxin w28a mutant
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
106
structure length
106
Chain Sequence
b'SHMAIVKVTDADFDSKVESGVQLVDFWATACGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Coupling of domain swapping to kinetic stability in a thioredoxin mutant
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Electron transport
total genus 22
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3dieA01
4HU9A 3DXBA 1I9DA 1XW5A 3WT1A 4POKA 3H79A 2AJQB 1EZKA 1E6BA 1G7OA 1BQ7A 2PERA 2C0EA 3SBCA 5A4VA 1PGTA 4E8HA 6GSYA 2HXKA 3KXOA 5G5EA 3L78A 3A5WA 2P0GA 2L5LA 1F37A 3J7Yk 4NAXA 3MDKA 4IELA 1Z6MA 5HFGA 4AJ8A 2H1GA 4ZBAA 3VPTA 2GSSA 2JACA 1SU9A 3HVSA 4HU7A 1AW9A 6GSVA 2DMMA 3FYGA 2H8LA 2D2ZA 2LQQA 2ZCTA 3BBYA 2V41A 4MZWA 1OYJA 4NV2A 1TI3A 2FCHA 4L8EA 3APSA 1JLVA 4D73A 2O85A 5IM9A 5E59A 3SWLA 3DD3A 4PQ1A 4N10A 1USBA 4XRDA 3CXGA 3QR6A 1VF1A 2PN8A 5AN1A 1PKZA 2H6ZA 3CTGA 3GL3A 4KCAA 3QD9A 3L4NA 4PXOA 4ULXA 3GHAA 3I69A 2VLTA 2YOIA 1XOBA 3P8WA 4HOJA 2PU9C 2BMXA 4XRAA 4F82A 5F06A 3D4TA 3IK7A 3J7Yb 4TVEA 3DIEA 2K8SA 1N8JA 1ZL9A 1RQMA 4MZCA 2GZPA 1TRWA 3F6FA 5ECRB 2FHEA 1IYIA 1UN2A 5ECSA 1FVJA 1OC8A 2JL4A 3GKKA 4MLYA 2L4QA 1X5EA 1GH2A 1PD21 2ON5A 2CX4A 5G30A 4GSSA 1SENA 4EXJA 3HHVA 4KDYA 2WB9A 4K7OA 4QL7A 1KBNA 5EL8A 1Q4JA 1XVWA 1EEJA 14GSA 5CREA 1I5GA 4L5OA 5ECOB 1XWGA 1SKRB 4ZIJA 3MAKA 3KTBA 2ZUPA 2KHPA 2LSTA 3KMOA 3GKNA 3WYWA 1V9WA 3U5RE 4EDZA 2V32A 4WF4A 2AUVA 4KGIA 4YQUA 4MK3A 4KH7A 3F0IA 1U6TA 1XCCA 1DUGA 1V2AA 2YJHA 3CSHA 4XS4A 4O5RA 3GYKA 1K3YA 1AXDA 3ZVJD 2YZUA 3GFKA 1F3BA 1SD9A 4PUFC 5D9TA 1K0AA 3IK9A 1ZYQB 3IC4A 2YNXA 4IVFA 3C8EA 2GT5A 2VM1A 1WOUA 1KEBA 4ECCA 1F9MA 2IN3A 1T1VA 3H8QA 1XOAA 3BJ5A 3WD6A 4AF2A 4O92A 4POMA 2PUKC 4OO4A 4JU5A 3TKSC 3W8SA 2K8VA 4F0CA 3IE3A 5ECPB 1FG4A 4LL4B 2WULA 2CVBA 1J0FA 1TDIA 4MZBA 3CMIA 2I1UA 3C71A 2LNTA 4OMVA 2HFDA 3UBKA 4F03A 2VIMA 1XWBA 2XBQA 3DKSA 2WCIA 1Q98A 1Z6NA 4NV5A 3BCKA 3FZAA 1GTAA 3GURA 1GTBA 4ECJA 5DDLA 2LNSA 3TKPA 4K0GA 3EWLA 1VF4A 3ZIVA 5IO2A 4IJ3A 3V1WA 4MPFA 7GSSA 4KUNA 1XW6A 5LD0A 4KSOA 3M9JA 5G5FA 3C73A 2R3XA 3P2AA 1ZYEA 1GSUA 2AAWA 1MD4A 4HQSA 1O8WA 4BA7A 2O8VB 1NW2A 4JR4A 3L9SA 2VL9A 2JZTA 3IRAA 3C1RA 2B5EA 2DC5A 5D9WA 4HS1A 3ISOA 3LQ7A 2GZZA 3ZL5A 1TK5B 2XHFA 1VGLA 5DQSA 1G6YA 1VRSD 3GKMA 4E8EA 3FR3A 3MNGA 1JZWA 3GH6A 1GSSA 1F2EA 3BOAA 3EC3A 3D6IA 2LKUA 2IPAA 4EO3A 1TRVA 1JZOA 2V6OA 2ZNMA 1EV9A 2GLRA 1PN9A 4N0ZA 3U6VA 4J57E 3PGTA 4KW6A 3FR6A 1GTIA 2J23A 1FO5A 3FY7A 1M9AA 2V6KA 1YJ6A 4Q5NA 2ES7A 3RBTA 1ABAA 3C1SA 2DIYA 3TRQA 2H76A 4FYBA 3HY2A 2LS5A 4HDEA 4OFMA 20GSA 2FNOA 3DGQA 4PQIA 4PNGA 4WXTA 1U3AA 4I2UA 2AB6A 2F3MA 4YAVA 1ERTA 4ACSA 2CVKA 3FKFA 1M2BA 5IOWA 4POLA 5KEJA 4MABA 1GNEA 3FRCA 2H6XA 1JHBA 4RUVA 5H5SA 2H0IA 3F8UA 1FW1A 3P90A 2CVDA 1O6JA 2HRNA 4WKWA 2MYGA 4HI7A 2DJ1A 5ECQB 1Z5YE 2GS3A 1V98A 1YY7A 2H30A 5H5RA 4IGJA 1YF0A 5ELAA 3A3TA 4WF5A 2KLXA 1A8YA 4KE3A 1A23A 3QFAC 1H4OA 5J9CA 1M2AA 5IQYA 2H1AA 3LYKA 2VCWA 2A4VA 4NHZA 2GQLA 2YWNA 1DBYA 4O32A 2C3NA 2YN1A 2E2MA 1PX7A 5D93A 4K2DA 5CAXA 1YZXA 3TKSA 1BAYA 3HD5A 4ZL7A 1YQ1A 2X8GA 3CRUA 3F4RA 4TW5A 4WEYA 1MDIA 3O3TA 1YDKA 3GKXA 3TJBA 4V2LA 5D9XA 1SYXA 5IMAA 2OA7A 4HUAA 4L0WA 3DMLA 3PH9A 2VCVA 2IL3A 5IMFA 2GTUA 3KMNA 4PNFA 1VF3A 1WRYA 3TRXA 3EMXA 5B6MA 3CBUA 3A2XA 4FYCA 3RPPA 1NSWA 1ERWA 2LRTA 3ZMLA 2JZSA 3EYTA 1W89A 1T7PB 1B4QA 2QC7A 4ISDA 5F0GA 2IFQA 1EP8A 3UVTA 1SL1B 5F05A 1GSEA 2HE3A 4ZILA 1YKCA 4PQHA 2HI7A 4AGSA 1X9WB 1YEXA 1OE8A 18GSA 3GRXA 1R26A 4EL1A 4N11A 1K3OA 1R4WA 3RHCA 1PX6A 1GULA 3GTUA 1OC3A 3I6AA 4GF0A 2PWJA 2MMAA 1MEKA 4I6XA 1AAZA 4PURA 2IIYA 1OVNA 1AUCA 3R2QA 5ENUA 1AQWA 3IXRA 2L6DA 5J9BA 4BVXA 5HR2A 2PPTA 1KNGA 9GSSA 4I2TA 2OADA 3Q19A 2E7PA 3FK8A 4L5LA 3TGZA 2TRCP 1K0BA 4MP4A 1EOHA 3ZVJA 4NWYA 2R4VA 4TKYA 3CSIA 4ZB6A 2C0DA 1R7HA 2GGTA 5CNWA 1PL2A 3TJFA 8GSSA 2C80A 2H72A 1THXA 1H75A 2CX3A 2J9HA 4FIWA 5HFIA 2FUG2 2AHEA 2H75A 2H01A 3VLNA 3LSZA 5KN3A 5JWQB 4IQ1A 1WIKA 2NDOA 1V57A 2MZCA 2L59A 2L5OA 2R5GA 2TRXA 4TXVA 3P7XA 1U87A 1BX9A 4D73B 3W6GA 4QQ7A 5HQPA 4GRFA 2C3TA 4GTUA 5C00A 4V1Ap 6GSSA 2RLIA 2JU5A 4OO5A 1V40A 2F8FA 5G1LA 3ZREA 4G2EA 4MCUA 4HJMA 5EPFA 5GZZB 4DSQA 2VCXA 5A4UA 2N5AA 3ZZXA 5IO0A 3HCZA 2H6YA 2AV4A 3M1GA 4GLTA 5ID2A 3VWXA 1GUHA 2KOKA 3GIXA 2GSTA 2P31A 6GSTA 3FZ5A 5J5NA 1Z9HA 3F3QA 2PGTA 2C3QA 5CYYA 2M80A 2NBSA 4GSTA 2WS2A 2LQOA 3D0ZA 2DJJA 2GQMA 5GAPD 2FY6A 5CRGA 2FWEA 2FGXA 2E2GA 4EKZA 4ZL9A 1SL0B 1EWXA 4IHUA 2R6KA 1PA3A 3WT2A 4G10A 5DVBA 3EINA 2KP2A 16GSA 3KJYA 2DJ0A 2JSZA 2GSQA 1MDKA 5COHA 3HZ8A 3Q74A 2H74A 2NVLA 3HJPA 1FB0A 3EU4A 1PL1A 3ZMKA 1FAAA 4KSMA 4WBJA 2OACA 4JZQA 1ST9A 4ML1A 1T00A 3GUSA 2LV3A 5GSTA 1U88A 2CZ3A 4LMVA 4XS4B 5ECLB 2I9HA 2B7KA 1THOA 1SK2A 1B9YC 4OFNA 3KD0A 1AC1A 3KTLA 2HZEA 4IN0A 3M9KA 3VPQA 5LCZA 2FWHA 2OE0A 1LJRA 3IA1A 1V58A 1IYHA 5E4WA 2CAIA 1FOVA 1B8XA 1HNBA 4GQCA 5A5KA 1W4VA 2H0GA 5G1KA 2AYTA 3ZRDA 1EGOA 1XZOA 4IBPA 1GWCA 1WMJA 2WGRA 1OE7A 2YP6A 1TU7A 2OE3A 4WR5A 2OJLA 1QK8A 1GTUA 3WGXA 5DAKA 6GSWA 4P3YB 3VK9A 4DSSA 4X43A 2VLVA 3KEBA 1EEMA 3KIJA 3TCOA 4EDYA 1X5DA 3IAS2 3FEUA 2MBTA 4HZ2A 1SJIA 4Q5RA 3GSSA 3IOSA 1GUMA 1XBSA 1G6WA 3ZFLA 4YAPA 2YZHA 1M99A 4MJCA 3O6TA 3LXZA 1G7EA 5JCWA 3QMXA 1ON4A 2CQ9A 5HR0A 2HSHA 3IPZA 1FB6A 5DJLA 1SKSB 3M8NA 4K1FA 1Y25A 1ZCPA 1OKDA 1TW9A 4IW9A 6GSXA 1GLQA 3L0HA 1ML6A 3AY8A 2TIRA 3ERGA 4PGTA 2H19A 4RI6A 2GDRA 2LJKA 1JZDA 3GNJA 3QPMA 2L57A 2IMDA 5KN0A 2GT6A 5HR3A 4OCFA 1X5CA 4K7NA 3UARA 1HD2A 1WE0A 4GCIA 3FZ9A 1QQ2A 5B6NA 1ILOA 2XPEA 4RI7A 4V2NA 2FWGA 2LRCA 4ID0A 5J4UA 2HRFA 1GSQA 4F9ZA 2IMIA 1HNCA 4J56E 2DIZA 3H93A 3ED3A 3NIVA 4MJAA 4CW9A 4ZB9A 1O7UA 1JFUA 4KB3A 4WR4A 2CAQA 2HLSA 2IJYA 3ERWA 1K0OA 5JWRB 5JWOB 3N5OA 4EC0A 4WETA 2O89A 3LYPA 3GL5A 2C8UA 3RHBA 1XIYA 3ME7A 3BCIA 4TOPA 1C72A 5ECHB 1A2JA 1M2DA 2Z9SA 4EF0A 1X0RA 3TKQA 3F4SA 5G2ZA 3FHKA 11GSA 1QFNA 1B4PA 1FHEA 1CQHA 4I8BA 2VL2C 4N30A 1R5PA 4TR1A 3UBLA 3LJRA 4F2IA 2BJXA 4TR1B 1BJXA 1PMTA 2K9FA 5B8AA 2EIRA 3GX0A 3LWAA 3C7MA 3CRTA 5IOXA 4HQZA 2C4JA 3NZNA 4I5QA 1AQVA 4TR3A 5JCGA 1TI1A 3HJOA 5IPGA 3KP8A 4G19A 3BD2A 5FWGA 4X1UA 2HYXA 5B8BA 4KDUA 4JRRA 4EVMA 5CRWA 1GSFA 1T3BA 5IMZA 4EUYA 4MF6A 5INYA 4XIHA 3ZIJA 1A24A 4J2FA 1UVZA 1TJDA 2B5XA 4BPYA 3Q18A 4L0UA 1QXHA 3TUEA 1OKTA 5HFKA 1DE2A 5J41A 2P5RA 5G31A 5CRDA 5IMVA 1MDJA 1URMA 4GQFA 4OWYA 1SYRA 3UOMA 2E0QA 4BWQA 1EV4A 3GA4A 2IMFA 5DCGA 2LTKA 1ZOFA 2I4AA 1PSQA 2RIIA 5CP1A 1JZRA 3G7JA 2GZYA 4MA9A 4LMWA 3N9JA 3ZLPA 2OKAA 2YWMA 4ZL8A 3DRNA 2HT9A 5D9VA 3IBHA 3PR8A 2CV4A 1OAZA 1S3AA 2F51A 2IFQB 4TR4A 4TN8A 1QGVA 4IQAA 3JCML 1A2MA 3DVXA 22GSA 19GSA 4XS6A 5DBQA 1EGRA 2XC2A 5GSSA 2HZFA 1RK4A 5F07A 3US3A 3G7YA 3APQA 3GTUB 2BTOT 4HEA2 3E0UA 1ZGNA 2VOCA 3VI7A 2QGVA 4RQRA 1Z7PA 2VCTA 4GWRA 2A2RA 1A8LA 2X99A 1TOFA 3K8NA 2OE1A 4AJ7A 2LUSA 4FO5A 3UL3A 1HQOA 3TOUA 3S9FA 3M0FA 3TB2A 3QAWA 3L9UA 2VM2A 1B48A 1B9XC 4IS0A 1FVKA 4MMMA 1GUKA 1YKAA 3I43A 4GSNA 4HJ2A 5D8IA 3LFLA 3DYRA 1A0FA 4LA1A 3E9JB 2VL2A 3G9BA 4CHSA 3FW2A 5F8BA 2MMZA 2VUPA 4NMUA 3QCPA 1HNAA 2MMOA 1PRXA 4WBRD 3TOTA 1LU4A 2VO4A 1R5AA 3F6DA 4KX4A 2WFCA 2O7KA 1S3DA 2QSIA 5EVOA 1SK0A 1EP7A 2YPMA 4IKHA 1K3LA 1MD3A 3FZ4A 4DEJA 4MF5A 1GRXA 6GSUA 3QDNA 4CDOA 2WZ9A 12GSA 1AIUA 2XBIA 3F9UA 3WGEA 3TJKA 1X9MB 2VL3A 3O76A 5ID2B 1F3AA 1Y6EA 3F3RA 4ZB8A 2EIQA 2C1YA 1YF1A 2LRNA 2LJRA 3MWHA 3ZTLA 3IV4A 2GSRA 3QFBC 1TK8B 2FA8A 1RW1A 4MH2A 1DSBA 5B7CA 2X8CA 4DVCA 5ELGA 3HKRA 1VF2A 5ECIB 2P5QA 1XWKA 17GSA 1X9SB 1O8XA 4IJIA 4KDXA 3CSJA 4KNDA 2K6VA 2DJ3A 4YH2A 1TRUA 4Q5QA 3DVWA 4ECIA 4JR6A 5IMDA 2B1KA 5DJMA 4ML6A 3E3EA 4ZBDA 3UVHA 2RUFA 2HNLA 2VAFA 5L71A 3D21A 10GSA 1MTCA 2N5FA 4ZXGA 1TK0B 2NTOA 2G2QA 3HXSA 1BEDA 4MJBA 1XWAA 2GVPA 4KCEA 1PKWA 1T4YA 3G7IA 2L6CA 1K0DA 5KN2A 1Z7RA 2H1DA 4PX1A 3TRPA 2H70A 4X0XA 2R37A 4F0BA 5J3RA 3ERFA 1TRSA 4DSRA 2HZEB 4I97A 3VFIA 5DQYA 4OD7A 4LL1B 3EU3A 5ECMB 4QL9A 1GL8A 4AJ6A 1M9BA 5FHIA 2L4CA 1J08A 2CT6A 2IWTA 5ECNB 3EMPA 1GNWA 2DSAA 1GP1A 1EOGA 1TP9A 1WWJA 3ME8A 3HYPA 2RUEA 1ZZYA 3KCMA 2B6MA 2B3SA 2YANA 3GMFA 3L9VA 2GQKA 3HA9A 2FLSA 4PUAA 3ZITA 4XCSA 1XVQA 5DAKB 3IAM2 4DSSB 2RM6A 3I9V2 4IP6A 5CO3A 1M7TA 4LLRA 2DJKA 4BL7A 2LEGA 5KN1A 3RPNA 2JSYA 5ABRA 1TKDB 2R2JA 3TKSE 1KTEA 5JCUA 3VWUA 3HZ4A 4ILFA 4H86A 3LG6A 5GAND 4ECBA 3HVVA 2H1BA 2HSYA 2PVQA 5DCHA 1XW9A 4K8MA 3H1NA 2OBKA 2MBSA 4OCEA 3IR4A 3OR5A 3HJMA 1ERUA 5D73A 1S3CA 4O7HA 2YWOA 4MPGA 1WPIA 1AQXA 5AIVA 4V1Ag 1SD8A 1SJZA 4JEDA 3LEFA 1K0CA 2IMKA 5DALA 1U3IA 4MH3A 2YV7A 5DALB 5HR1A 5H5QA 3A2WA 3KH9A 2CA8A 2WRTA 1XXUA 3EE2A 4N0VA 2B1LA 1M0UA 1F6MC 1XPVA 2M72A 3IDVA 3UEMA 2H66A 3VWVA 4IP1A 3ZYWA 3KH7A 1QMVA 2B7JA 3M3MA 4KAEA 1HYUA 3H4KA 1TU8A 2PMTA 3VURA 3QOUA 3F4TA 3QAGA 1XWCA 2K18A 1UC7A 3KP9A 3TJJA 2PBJA 3D4MA 3IHQA 1GLPA 1WJKA 4XHMA 4YQVA 1TXXA 2REMA 3W8JA 3LORA 2LJAA 13GSA 3EVIA 2ALBA 1O73A 1UA5A 1YEPA 2V1MA 1ERVA 2DLXA 1K0MA 2VCQA 1GSYA 2FWFA 2NPBA 1N2AA 3TJGA 2VD1A 1BG5A 1A0RP 1NHYA 3MSZA 4K6XA 2H0HA 3KGKA 3Q6OA 2I3YA 2KUCA 2I81A 2H73A 3FR9A 1NM3A 2OBIA 2O87A 2KP1A 4FYUA 2YJ7A 2N5BA 3CTFA 4ZBBA 2DBCA 3HDCA 4MF7A 3RAZA 2A2SA 2IMEA 3TDGA 2WDUA 2WJUA 4JE1A 1WP0A 3D22A 1JLWA 1SJ6A 3GSTA 3HVXA 3GX8A 4BVYA 2QKEA 4KA0A 3UMAA 5IIZA 4BWSA 5A4WA 3LXTA 3A2VA 1T8EB 2VD0A 1ZMAA 3DWVA 1E2YA 2FD3A 5AGYA 2F8AA 3KM6A 5ECKB 1DE1A 3EURA 4Z7XA 3VI5A 4MJEA 5AISA 4XTSA 1T4ZA 2YCDA 3UIWA 1GSDA 1LBKA 1SL2B 2PVOC 2M46A 3WGDA 3DEXA 1CQGA 2C0FA 4EE0A 4RQXA 3CYNA 3LGCA 4TXOA 4NHWA 4NPBA 4TXOB 1XFLA 2B5YA 2C0GA 3UAPA 4V2MA 1TTZA 3RDWA 1OC9A 4Q5FA 4GXZA 2G0FA 4OFTA 1OC9B 5IMCA 5LNKe 1O81A 2EC4A 1K0NA 3GN3A 2RM5A 5CRHA 3NOFA 1SKWB 2YV9A 4TRXA 2X8HA 3D5JA 4K7IA 3UJ1A 3VWWA 3TKRA 2MMNA 5AIXA 2X64A 4POBA 2CZ2A 2VLUA 5EY6A 2F9SA 2FA4A 2DMLA 2H71A 1J9BA 1QUWA 2V2GA 2XPDA 3APOA 5FT3A 3F63A 2JZRA 3QAVA 2ON7A 4TR0A 1BYEA 1PQNA 1Z3EA 2JADA 3KZQA 2DJ2A 4MDCA 1NHOA 3GH9A 2VCZA 2YWIA 5D96A 2EIOA 1A2LA 4JBBA 1SK1A 4K9ZA 3ZFBA 1G0TA 5IPHA 5C04A 4NXIA 1ACVA 4HZ4A 4FH8A 3PINA 4G9HA 4YQMA 4K0NA 1O85A 3GV1A 4XS1A
chains in the Genus database with same CATH superfamily
4HU9A 3DXBA 1I9DA 1XW5A 3WT1A 4POKA 3H79A 2AJQB 1EZKA 1E6BA 1G7OA 1BQ7A 2PERA 2C0EA 3SBCA 5A4VA 1PGTA 4E8HA 6GSYA 4EIPA 2HXKA 3KXOA 5G5EA 3L78A 3A5WA 2P0GA 2L5LA 1F37A 3J7Yk 4NAXA 3MDKA 4IELA 1Z6MA 5HFGA 4AJ8A 2H1GA 4ZBAA 3VPTA 2GSSA 1M3JA 2JACA 1SU9A 3HVSA 4HU7A 1AW9A 6GSVA 2DMMA 3FYGA 2H8LA 2D2ZA 2LQQA 2ZCTA 3BBYA 2V41A 4MZWA 1OYJA 4NV2A 1TI3A 2FCHA 4L8EA 3APSA 1JLVA 4D73A 2O85A 5IM9A 5E59A 2QA2A 3SWLA 3DD3A 4PQ1A 4N10A 1USBA 4XRDA 3CXGA 3QR6A 1VF1A 2PN8A 5AN1A 1PKZA 2H6ZA 3CTGA 3GL3A 4KCAA 3QD9A 3L4NA 4PXOA 4ULXA 3GHAA 3I69A 4A5PA 2VLTA 2YOIA 1XOBA 3P8WA 4HOJA 2PU9C 2BMXA 4XRAA 4F82A 5F06A 3D4TA 3IK7A 1XG8A 3J7Yb 4TVEA 3DIEA 2K8SA 1N8JA 1ZL9A 1RQMA 4MZCA 2GZPA 1TRWA 3F6FA 5ECRB 2FHEA 1IYIA 1UN2A 5ECSA 1FVJA 1OC8A 2JL4A 3GKKA 4MLYA 2L4QA 1X5EA 1GH2A 1PD21 2ON5A 2CX4A 5G30A 4GSSA 1SENA 4EXJA 3HHVA 4KDYA 2WB9A 4K7OA 4QL7A 1KBNA 5EL8A 1Q4JA 1XVWA 1EEJA 14GSA 5CREA 1I5GA 4L5OA 5ECOB 1XWGA 1SKRB 4ZIJA 3MAKA 3KTBA 2ZUPA 2KHPA 2LSTA 3KMOA 3GKNA 3WYWA 1V9WA 3U5RE 4ICYA 4EDZA 2V32A 4WF4A 2AUVA 4KGIA 4YQUA 4MK3A 4KH7A 3F0IA 1U6TA 1XCCA 1DUGA 1V2AA 2YJHA 3CSHA 4XS4A 4O5RA 3GYKA 1K3YA 1AXDA 3ZVJD 2YZUA 3GFKA 1F3BA 1SD9A 4PUFC 5D9TA 1K0AA 3IK9A 1ZYQB 3IC4A 2YNXA 4IVFA 3C8EA 2GT5A 4CY6A 2VM1A 1WOUA 1KEBA 4ECCA 1F9MA 2DKHA 2IN3A 1T1VA 3H8QA 1XOAA 3BJ5A 3WD6A 4AF2A 4O92A 4BL7B 4POMA 2PUKC 4OO4A 4JU5A 3TKSC 3W8SA 2K8VA 4F0CA 3IE3A 5ECPB 1FG4A 4LL4B 2WULA 2CVBA 1J0FA 1TDIA 4MZBA 4G0IA 3CMIA 2I1UA 3C71A 2LNTA 4OMVA 2HFDA 3UBKA 4F03A 2VIMA 1XWBA 2XBQA 3DKSA 2WCIA 1Q98A 1Z6NA 4NV5A 3BCKA 3FZAA 1GTAA 3GURA 1GTBA 3A5IA 4ECJA 5DDLA 2LNSA 3TKPA 4K0GA 3EWLA 1VF4A 3ZIVA 5IO2A 4IJ3A 3V1WA 4MPFA 7GSSA 4KUNA 1XW6A 5LD0A 4KSOA 3M9JA 5G5FA 3C73A 2R3XA 3P2AA 1ZYEA 1GSUA 2AAWA 1MD4A 4HQSA 1O8WA 4BA7A 2O8VB 1NW2A 4JR4A 3L9SA 2VL9A 2JZTA 3IRAA 3C1RA 2B5EA 2DC5A 5D9WA 4HS1A 3ISOA 3LQ7A 2GZZA 3ZL5A 1TK5B 2XHFA 1VGLA 5DQSA 1G6YA 1VRSD 3GKMA 4E8EA 3FR3A 3MNGA 1JZWA 3GH6A 1GSSA 1F2EA 3BOAA 3EC3A 3D6IA 2LKUA 2IPAA 4EO3A 1TRVA 1JZOA 2V6OA 2ZNMA 1EV9A 2GLRA 1PN9A 4N0ZA 3U6VA 4J57E 3PGTA 4KW6A 3FR6A 1GTIA 2J23A 1FO5A 3FY7A 1M9AA 2V6KA 1YJ6A 4Q5NA 2ES7A 3RBTA 1ABAA 3C1SA 2DIYA 3TRQA 2H76A 4FYBA 3HY2A 2LS5A 4HDEA 4OFMA 20GSA 2FNOA 2DKIA 3DGQA 4PQIA 4PNGA 4WXTA 1U3AA 4I2UA 2AB6A 3HVNA 2F3MA 4YAVA 1ERTA 4ACSA 2CVKA 3FKFA 1M2BA 5IOWA 4POLA 5KEJA 4MABA 4MNNA 1GNEA 3FRCA 2H6XA 1JHBA 4RUVA 5H5SA 2H0IA 3F8UA 1FW1A 3P90A 2CVDA 1O6JA 4BVYB 2HRNA 4WKWA 2MYGA 4HI7A 2DJ1A 5ECQB 1Z5YE 2GS3A 1V98A 1YY7A 2H30A 5H5RA 4IGJA 1YF0A 5ELAA 3A3TA 4WF5A 2KLXA 1A8YA 4KE3A 1A23A 3QFAC 1H4OA 5J9CA 1M2AA 5IQYA 2H1AA 3LYKA 2VCWA 2A4VA 2QA1A 4NHZA 2GQLA 2YWNA 1DBYA 4O32A 2C3NA 2YN1A 2E2MA 1PX7A 3LW9A 5D93A 4K2DA 5CAXA 1YZXA 3TKSA 1BAYA 3HD5A 4ZL7A 1YQ1A 2X8GA 3CRUA 3F4RA 4TW5A 4WEYA 1MDIA 3O3TA 1YDKA 3GKXA 3TJBA 4V2LA 5D9XA 1SYXA 5IMAA 2OA7A 4HUAA 4L0WA 3DMLA 3PH9A 2VCVA 2IL3A 5IMFA 4FQUA 2A2PA 2GTUA 3KMNA 4PNFA 1VF3A 1WRYA 3TRXA 3EMXA 5B6MA 3CBUA 3A2XA 4FYCA 3RPPA 1NSWA 1ERWA 2LRTA 3ZMLA 2JZSA 3EYTA 1W89A 2UZ8A 1T7PB 1B4QA 2QC7A 4ISDA 5F0GA 2IFQA 1EP8A 3UVTA 1SL1B 5F05A 4G0KA 1GSEA 2HE3A 2R0PA 1YKCA 4ZILA 4PQHA 2HI7A 4AGSA 1X9WB 1YEXA 1OE8A 18GSA 3GRXA 1R26A 4EL1A 4N11A 1K3OA 1R4WA 3RHCA 1PX6A 1S3RA 1GULA 3GTUA 1OC3A 3I6AA 4GF0A 2PWJA 2MMAA 1MEKA 4I6XA 1AAZA 4PURA 2IIYA 1OVNA 1AUCA 3R2QA 5ENUA 1AQWA 3IXRA 2L6DA 5J9BA 4BVXA 5HR2A 2PPTA 1KNGA 9GSSA 4I2TA 4BVXB 2OADA 3Q19A 2E7PA 3FK8A 4L5LA 3TGZA 2TRCP 1K0BA 4MP4A 1EOHA 3ZVJA 4NWYA 2R4VA 4TKYA 3CSIA 4ZB6A 2C0DA 1R7HA 2GGTA 5CNWA 1PL2A 3TJFA 8GSSA 2C80A 2H72A 1THXA 1H75A 2CX3A 2J9HA 4FIWA 5HFIA 4O5UA 2FUG2 2AHEA 2H75A 2H01A 3VLNA 3LSZA 5KN3A 5JWQB 4IQ1A 1WIKA 2NDOA 1V57A 2MZCA 2L59A 2L5OA 2R5GA 2TRXA 4TXVA 3P7XA 1U87A 1BX9A 4D73B 3W6GA 4QQ7A 5HQPA 4GRFA 2C3TA 4GTUA 5C00A 4V1Ap 6GSSA 2RLIA 2JU5A 4OO5A 1V40A 2F8FA 5G1LA 3ZREA 4G2EA 4MCUA 4HJMA 5EPFA 5GZZB 4DSQA 2VCXA 5A4UA 2N5AA 3ZZXA 5IO0A 3HCZA 2H6YA 2AV4A 1ZYPA 3M1GA 4GLTA 5ID2A 3VWXA 1GUHA 2KOKA 3GIXA 2GSTA 2P31A 6GSTA 4K2XA 3FZ5A 5J5NA 1Z9HA 3F3QA 2PGTA 2C3QA 2R0CA 5CYYA 2M80A 2NBSA 4GSTA 2WS2A 4Z2RA 2LQOA 3D0ZA 2DJJA 2GQMA 5GAPD 2FY6A 5CRGA 2FWEA 2FGXA 2E2GA 4EKZA 4ZL9A 1SL0B 1EWXA 4IHUA 2R6KA 1PA3A 3WT2A 4G10A 5DVBA 3EINA 2KP2A 16GSA 4O5QA 3KJYA 2DJ0A 2JSZA 2GSQA 1MDKA 5COHA 3HZ8A 3Q74A 2H74A 2NVLA 3HJPA 1FB0A 3EU4A 1PL1A 3ZMKA 1FAAA 4KSMA 4WBJA 2OACA 4JZQA 1ST9A 4ML1A 1T00A 3GUSA 2LV3A 5GSTA 1U88A 2CZ3A 4LMVA 4XS4B 5ECLB 2I9HA 2B7KA 1THOA 1SK2A 1B9YC 4OFNA 3KD0A 1AC1A 3KTLA 2HZEA 4IN0A 3M9KA 3VPQA 5LCZA 2FWHA 2OE0A 1LJRA 3IA1A 1V58A 1IYHA 5E4WA 2CAIA 1FOVA 2R0GA 1B8XA 1HNBA 5KOXA 4GQCA 5A5KA 1W4VA 2H0GA 5G1KA 2AYTA 3ZRDA 1EGOA 1XZOA 4IBPA 1GWCA 1WMJA 2WGRA 1OE7A 2YP6A 1TU7A 2OE3A 4WR5A 2OJLA 1QK8A 1GTUA 3WGXA 5DAKA 6GSWA 4P3YB 3VK9A 4DSSA 4X43A 2VLVA 3KEBA 1EEMA 4PTSA 3KIJA 3TCOA 4EDYA 1X5DA 3IAS2 3FEUA 2MBTA 4HZ2A 4YKFA 4Q5RA 1SJIA 3GSSA 1GUMA 1XBSA 1G6WA 3IOSA 3ZFLA 4YAPA 4EIQA 2YZHA 1M99A 4MJCA 3O6TA 3LXZA 1G7EA 3EPTA 3IC8A 5JCWA 3QMXA 1ON4A 2CQ9A 5HR0A 2HSHA 5KOWA 3IPZA 1FB6A 5DJLA 1SKSB 3M8NA 4K1FA 1Y25A 1ZCPA 1OKDA 1TW9A 4IW9A 6GSXA 1GLQA 3L0HA 1ML6A 3AY8A 2TIRA 3ERGA 4PGTA 2H19A 4RI6A 2GDRA 2LJKA 1JZDA 3GNJA 3QPMA 2L57A 2IMDA 5KN0A 2GT6A 5HR3A 4OCFA 1X5CA 4K7NA 3UARA 1HD2A 1WE0A 4GCIA 3FZ9A 1QQ2A 5B6NA 1ILOA 2XPEA 4RI7A 4V2NA 2FWGA 2LRCA 4ID0A 5J4UA 2HRFA 1GSQA 3CQFA 4F9ZA 2IMIA 1HNCA 4J56E 2DIZA 3H93A 3ED3A 3NIVA 4MJAA 4CW9A 4ZB9A 1O7UA 1JFUA 4KB3A 4WR4A 2CAQA 2HLSA 2IJYA 3ERWA 1K0OA 5JWRB 5JWOB 3N5OA 4EC0A 4WETA 2O89A 3LYPA 3GL5A 2C8UA 3RHBA 1XIYA 3ME7A 3BCIA 4TOPA 1C72A 5ECHB 1A2JA 1M2DA 2Z9SA 4EF0A 1X0RA 3TKQA 5BMUA 3F4SA 5G2ZA 3FHKA 11GSA 1QFNA 1B4PA 1FHEA 1PFOA 1CQHA 4I8BA 2VL2C 4N30A 1R5PA 4TR1A 3UBLA 3LJRA 4F2IA 2BJXA 4TR1B 1BJXA 1PMTA 2K9FA 5B8AA 2EIRA 3GX0A 3LWAA 3C7MA 3CRTA 5IOXA 4HQZA 2C4JA 3NZNA 4I5QA 1AQVA 4TR3A 5JCGA 1TI1A 3HJOA 5IPGA 3KP8A 4G19A 3BD2A 5FWGA 4X1UA 2HYXA 5B8BA 4KDUA 4JRRA 4EVMA 5CRWA 1GSFA 1T3BA 5IMZA 4EUYA 4MF6A 5INYA 4XIHA 3ZIJA 1A24A 4J2FA 1UVZA 1TJDA 2B5XA 4BPYA 3Q18A 4L0UA 1QXHA 3TUEA 1OKTA 5HFKA 1DE2A 5J41A 2P5RA 5G31A 5CRDA 5IMVA 1MDJA 1URMA 4GQFA 4OWYA 1SYRA 3UOMA 2E0QA 4BWQA 1EV4A 3GA4A 2IMFA 5DCGA 2LTKA 1ZOFA 2I4AA 1PSQA 2RIIA 5CP1A 1JZRA 3G7JA 2GZYA 4MA9A 4LMWA 3N9JA 3ZLPA 2OKAA 2YWMA 4ZL8A 3DRNA 2HT9A 5D9VA 3IBHA 3PR8A 2CV4A 1OAZA 1S3AA 2F51A 2IFQB 4TR4A 4TN8A 1QGVA 4IQAA 3JCML 1A2MA 3DVXA 22GSA 19GSA 4XS6A 5DBQA 1EGRA 2XC2A 5GSSA 2HZFA 1RK4A 5F07A 3MYDA 3US3A 3G7YA 3APQA 3GTUB 2BTOT 4KF9A 4HEA2 3E0UA 1ZGNA 2VOCA 3VI7A 2QGVA 4RQRA 1Z7PA 2VCTA 4GWRA 4X4JA 2A2RA 1A8LA 2X99A 1TOFA 3K8NA 2OE1A 4AJ7A 2LUSA 4FO5A 3UL3A 1HQOA 3TOUA 3S9FA 3M0FA 3TB2A 3QAWA 3L9UA 2VM2A 1B48A 1B9XC 4IS0A 1FVKA 4MMMA 1GUKA 1YKAA 3I43A 4GSNA 4HJ2A 5D8IA 3LFLA 3DYRA 1A0FA 4LA1A 3E9JB 2VL2A 3G9BA 4CHSA 3FW2A 5F8BA 2MMZA 4K5SA 2VUPA 4NMUA 3QCPA 1HNAA 2MMOA 1PRXA 2HRAA 4WBRD 3TOTA 1LU4A 2VO4A 1R5AA 3F6DA 4KX4A 2WFCA 2O7KA 1S3DA 2QSIA 5EVOA 1SK0A 1PN0A 4CY8A 1EP7A 2YPMA 4IKHA 1K3LA 1MD3A 4Z2UA 3FZ4A 4G0LA 4DEJA 4MF5A 1GRXA 6GSUA 3QDNA 4CDOA 2WZ9A 12GSA 1AIUA 2XBIA 3F9UA 3WGEA 3TJKA 1X9MB 2VL3A 3O76A 5ID2B 3PPUA 1F3AA 1Y6EA 3F3RA 4ZB8A 2EIQA 5BRTA 2C1YA 1YF1A 2LRNA 2LJRA 3MWHA 3ZTLA 3IV4A 2GSRA 3QFBC 1TK8B 2FA8A 1RW1A 4MH2A 1DSBA 5B7CA 2X8CA 4DVCA 5ELGA 3HKRA 1VF2A 5ECIB 2P5QA 1XWKA 17GSA 1X9SB 1O8XA 4IJIA 4KDXA 3CSJA 4KNDA 2K6VA 2DJ3A 4YH2A 1ZYNA 1TRUA 4Q5QA 3DVWA 4ECIA 4JR6A 5IMDA 2B1KA 5DJMA 4ML6A 3E3EA 4ZBDA 3UVHA 2RUFA 2HNLA 2VAFA 5L71A 3FMWA 2HSMA 3D21A 10GSA 1MTCA 2N5FA 4ZXGA 1TK0B 2NTOA 2G2QA 3HXSA 1BEDA 4MJBA 1XWAA 2GVPA 4KCEA 1PKWA 1T4YA 3G7IA 2L6CA 1K0DA 5KN2A 1Z7RA 2H1DA 4PX1A 3TRPA 2H70A 4X0XA 2R37A 4F0BA 5J3RA 3ERFA 1TRSA 4DSRA 2HZEB 4I97A 3VFIA 5DQYA 4OD7A 4LL1B 3EU3A 5ECMB 4QL9A 1GL8A 4AJ6A 1M9BA 5FHIA 2L4CA 1J08A 2CT6A 2IWTA 5ECNB 3EMPA 1GNWA 2DSAA 1GP1A 1EOGA 1TP9A 1WWJA 3ME8A 3HYPA 2RUEA 1ZZYA 3KCMA 2B6MA 2B3SA 2YANA 3GMFA 3L9VA 2GQKA 3HA9A 2FLSA 4PUAA 3ZITA 4XCSA 1XVQA 5DAKB 3IAM2 4DSSB 2RM6A 4USSA 3I9V2 4IP6A 5CO3A 1M7TA 4LLRA 2DJKA 4BL7A 2LEGA 5KN1A 3RPNA 2JSYA 5ABRA 1TKDB 2R2JA 3TKSE 1KTEA 5JCUA 3VWUA 3HZ4A 4ILFA 4H86A 3LG6A 5GAND 4ECBA 3HVVA 2H1BA 2HSYA 2PVQA 5DCHA 1XW9A 4K8MA 3H1NA 2OBKA 2MBSA 4OCEA 3IR4A 3OR5A 3HJMA 1ERUA 5D73A 1S3CA 4O7HA 1M3IA 2YWOA 4MPGA 1WPIA 1AQXA 5AIVA 4V1Ag 1SD8A 1SJZA 4JEDA 3LEFA 1K0CA 2IMKA 5DALA 1U3IA 4MH3A 2YV7A 5DALB 5HR1A 5H5QA 3A2WA 3KH9A 2CA8A 2WRTA 1XXUA 3EE2A 4N0VA 2B1LA 1M0UA 1F6MC 1XPVA 2M72A 3IDVA 3UEMA 2H66A 3VWVA 4IP1A 3ZYWA 2HRKA 3KH7A 1QMVA 2B7JA 3M3MA 4KAEA 1HYUA 3H4KA 1TU8A 2PMTA 3VURA 3QOUA 3F4TA 3QAGA 1XWCA 2K18A 1UC7A 4BIKA 3KP9A 3TJJA 2PBJA 3D4MA 3IHQA 1GLPA 1WJKA 4XHMA 4YQVA 1TXXA 2REMA 3W8JA 3LORA 2LJAA 13GSA 3EVIA 2ALBA 1O73A 1UA5A 1YEPA 2V1MA 1ERVA 2DLXA 1K0MA 2VCQA 1GSYA 2FWFA 3IHGA 2NPBA 1N2AA 3TJGA 2VD1A 1BG5A 1A0RP 1NHYA 3MSZA 4K6XA 2H0HA 3KGKA 3Q6OA 2I3YA 2KUCA 2I81A 2H73A 3FR9A 1NM3A 2OBIA 2O87A 2KP1A 4K5RA 4FYUA 2YJ7A 2N5BA 3CTFA 4ZBBA 2DBCA 4YKGA 3HDCA 4MF7A 3RAZA 2A2SA 2IMEA 3TDGA 2WDUA 2WJUA 2X4AA 4JE1A 1WP0A 3D22A 1JLWA 1SJ6A 3GSTA 3HVXA 3GX8A 4BVYA 2QKEA 4KA0A 3UMAA 5IIZA 4BWSA 5A4WA 3LXTA 3A2VA 1T8EB 2VD0A 1ZMAA 3DWVA 1E2YA 2FD3A 5AGYA 2F8AA 3KM6A 5ECKB 1DE1A 3R3EA 3EURA 4Z7XA 3VI5A 4MJEA 5AISA 4XTSA 1T4ZA 2YCDA 3UIWA 1GSDA 1LBKA 1SL2B 2PVOC 2M46A 3WGDA 3DEXA 1CQGA 2C0FA 4EE0A 4RQXA 3CYNA 3LGCA 4TXOA 4HSCX 4NHWA 4NPBA 4TXOB 1XFLA 2B5YA 2C0GA 3UAPA 2X49A 4V2MA 1TTZA 3RDWA 1OC9A 4Q5FA 4Z2TA 4GXZA 2G0FA 4OFTA 1OC9B 5IMCA 5LNKe 1O81A 2EC4A 1K0NA 3GN3A 2RM5A 5CRHA 2A4HA 3NOFA 1SKWB 2YV9A 4TRXA 2X8HA 3D5JA 4K7IA 3UJ1A 3VWWA 3TKRA 2MMNA 2X64A 5AIXA 4POBA 2CZ2A 2VLUA 5EY6A 2F9SA 2FA4A 1FOHA 2DMLA 2H71A 1J9BA 1QUWA 2V2GA 2XPDA 3APOA 5FT3A 3F63A 2JZRA 3QAVA 2ON7A 4TR0A 1BYEA 1PQNA 1Z3EA 2JADA 3KZQA 2DJ2A 4MDCA 1NHOA 3GH9A 2VCZA 2YWIA 5D96A 2EIOA 1A2LA 4JBBA 1SK1A 4K9ZA 3ZFBA 1G0TA 5IPHA 5C04A 4NXIA 1ACVA 4HZ4A 4FH8A 3MIXA 3PINA 4G9HA 4YQMA 4K0NA 1O85A 3GV1A 4XS1A
chains in the Genus database with same CATH topology
4HU9A 3DXBA 1I9DA 1XW5A 3WT1A 4POKA 3H79A 2AJQB 1EZKA 1E6BA 1G7OA 1BQ7A 2PERA 2C0EA 3SBCA 5A4VA 1PGTA 4E8HA 6GSYA 4EIPA 2HXKA 3KXOA 5G5EA 3L78A 3A5WA 2P0GA 2L5LA 1F37A 3J7Yk 4NAXA 3MDKA 4IELA 1Z6MA 5HFGA 4AJ8A 2H1GA 4ZBAA 3VPTA 2GSSA 2JACA 1SU9A 3HVSA 4HU7A 1AW9A 6GSVA 2DMMA 3FYGA 2H8LA 2D2ZA 2LQQA 2ZCTA 3BBYA 2V41A 4MZWA 1OYJA 4NV2A 1TI3A 2FCHA 4L8EA 3APSA 1JLVA 4D73A 2O85A 5IM9A 5E59A 2QA2A 3SWLA 3DD3A 4PQ1A 4N10A 1USBA 4XRDA 3CXGA 3QR6A 1VF1A 2PN8A 5AN1A 1PKZA 2H6ZA 3CTGA 3GL3A 4KCAA 3QD9A 3L4NA 4PXOA 4ULXA 3GHAA 3I69A 4A5PA 2VLTA 2YOIA 1XOBA 3P8WA 4HOJA 2PU9C 2BMXA 4XRAA 4F82A 5F06A 3D4TA 3IK7A 3J7Yb 4TVEA 3DIEA 2K8SA 1N8JA 1ZL9A 1RQMA 4MZCA 2GZPA 1TRWA 3F6FA 5ECRB 2FHEA 1IYIA 1UN2A 5ECSA 1FVJA 1OC8A 2JL4A 3GKKA 4MLYA 2L4QA 1X5EA 1GH2A 1PD21 2ON5A 2CX4A 5G30A 4GSSA 1SENA 4EXJA 3HHVA 4KDYA 2WB9A 4K7OA 4QL7A 1KBNA 5EL8A 1Q4JA 1XVWA 1EEJA 14GSA 5CREA 1I5GA 4L5OA 5ECOB 1XWGA 1SKRB 4ZIJA 3MAKA 3KTBA 2ZUPA 2KHPA 2LSTA 3KMOA 3GKNA 3WYWA 1V9WA 3U5RE 4ICYA 4EDZA 2V32A 4WF4A 2AUVA 4KGIA 4YQUA 4MK3A 4KH7A 3F0IA 1U6TA 1XCCA 1DUGA 1V2AA 2YJHA 3CSHA 4XS4A 4O5RA 3GYKA 1K3YA 1AXDA 3ZVJD 2YZUA 3GFKA 1F3BA 1SD9A 4PUFC 5D9TA 1K0AA 3IK9A 1ZYQB 3IC4A 2YNXA 4IVFA 3C8EA 2GT5A 4CY6A 2VM1A 1WOUA 1KEBA 4ECCA 1F9MA 2DKHA 2IN3A 1T1VA 3H8QA 1XOAA 3BJ5A 3WD6A 4AF2A 4O92A 4BL7B 4POMA 2PUKC 4OO4A 4JU5A 3TKSC 3W8SA 2K8VA 4F0CA 3IE3A 5ECPB 1FG4A 4LL4B 2WULA 2CVBA 1J0FA 1TDIA 4MZBA 4G0IA 3CMIA 2I1UA 3C71A 2LNTA 4OMVA 2HFDA 3UBKA 4F03A 2VIMA 1XWBA 2XBQA 3DKSA 2WCIA 1Q98A 1Z6NA 4NV5A 3BCKA 3FZAA 1GTAA 3GURA 1GTBA 3A5IA 4ECJA 5DDLA 2LNSA 3TKPA 4K0GA 3EWLA 1VF4A 3ZIVA 5IO2A 4IJ3A 3V1WA 4MPFA 7GSSA 4KUNA 1XW6A 5LD0A 4KSOA 3M9JA 5G5FA 3C73A 2R3XA 3P2AA 1ZYEA 1GSUA 2AAWA 1MD4A 4HQSA 1O8WA 4BA7A 2O8VB 1NW2A 4JR4A 3L9SA 2VL9A 2JZTA 3IRAA 3C1RA 2B5EA 2DC5A 5D9WA 4HS1A 3ISOA 3LQ7A 2GZZA 3ZL5A 1TK5B 2XHFA 1VGLA 5DQSA 1G6YA 1VRSD 3GKMA 4E8EA 3FR3A 3MNGA 1JZWA 3GH6A 1GSSA 1F2EA 3BOAA 3EC3A 3D6IA 2LKUA 2IPAA 4EO3A 1TRVA 1JZOA 2V6OA 2ZNMA 1EV9A 2GLRA 1PN9A 4N0ZA 3U6VA 4J57E 3PGTA 4KW6A 3FR6A 1GTIA 2J23A 1FO5A 3FY7A 1M9AA 2V6KA 1YJ6A 4Q5NA 2ES7A 3RBTA 1ABAA 3C1SA 2DIYA 3TRQA 2H76A 4FYBA 3HY2A 2LS5A 4HDEA 4OFMA 20GSA 2FNOA 2DKIA 3DGQA 4PQIA 4PNGA 4WXTA 1U3AA 4I2UA 2AB6A 2F3MA 4YAVA 1ERTA 4ACSA 2CVKA 3FKFA 1M2BA 5IOWA 4POLA 5KEJA 4MABA 4MNNA 1GNEA 3FRCA 2H6XA 1JHBA 4RUVA 5H5SA 2H0IA 3F8UA 1FW1A 3P90A 2CVDA 1O6JA 4BVYB 2HRNA 4WKWA 2MYGA 4HI7A 2DJ1A 5ECQB 1Z5YE 2GS3A 1V98A 1YY7A 2H30A 5H5RA 4IGJA 1YF0A 5ELAA 3A3TA 4WF5A 2KLXA 1A8YA 4KE3A 1A23A 3QFAC 1H4OA 5J9CA 1M2AA 5IQYA 2H1AA 3LYKA 2VCWA 2A4VA 2QA1A 4NHZA 2GQLA 2YWNA 1DBYA 4O32A 2C3NA 2YN1A 2E2MA 1PX7A 3LW9A 5D93A 4K2DA 5CAXA 1YZXA 3TKSA 1BAYA 3HD5A 4ZL7A 1YQ1A 2X8GA 3CRUA 3F4RA 4TW5A 4WEYA 1MDIA 3O3TA 1YDKA 3GKXA 3TJBA 4V2LA 5D9XA 1SYXA 5IMAA 2OA7A 4HUAA 4L0WA 3DMLA 3PH9A 2VCVA 2IL3A 5IMFA 4FQUA 2A2PA 2GTUA 3KMNA 4PNFA 1VF3A 1WRYA 3TRXA 3EMXA 5B6MA 3CBUA 3A2XA 4FYCA 3RPPA 1NSWA 1ERWA 2LRTA 3ZMLA 2JZSA 3EYTA 1W89A 2UZ8A 1T7PB 1B4QA 2QC7A 4ISDA 5F0GA 2IFQA 1EP8A 3UVTA 1SL1B 5F05A 4G0KA 1GSEA 2HE3A 2R0PA 1YKCA 4ZILA 4PQHA 2HI7A 4AGSA 1X9WB 1YEXA 1OE8A 18GSA 3GRXA 1R26A 4EL1A 4N11A 1K3OA 1R4WA 3RHCA 1PX6A 1GULA 3GTUA 1OC3A 3I6AA 4GF0A 2PWJA 2MMAA 1MEKA 4I6XA 1AAZA 4PURA 2IIYA 1OVNA 1AUCA 3R2QA 5ENUA 1AQWA 3IXRA 2L6DA 5J9BA 4BVXA 5HR2A 2PPTA 1KNGA 9GSSA 4I2TA 4BVXB 2OADA 3Q19A 2E7PA 3FK8A 4L5LA 3TGZA 2TRCP 1K0BA 4MP4A 1EOHA 3ZVJA 4NWYA 2R4VA 4TKYA 3CSIA 4ZB6A 2C0DA 1R7HA 2GGTA 5CNWA 1PL2A 3TJFA 8GSSA 2C80A 2H72A 1THXA 1H75A 2CX3A 2J9HA 4FIWA 5HFIA 4O5UA 2FUG2 2AHEA 2H75A 2H01A 3VLNA 3LSZA 5KN3A 5JWQB 4IQ1A 1WIKA 2NDOA 1V57A 2MZCA 2L59A 2L5OA 2R5GA 2TRXA 4TXVA 3P7XA 1U87A 1BX9A 4D73B 3W6GA 4QQ7A 5HQPA 4GRFA 2C3TA 4GTUA 5C00A 4V1Ap 6GSSA 2RLIA 2JU5A 4OO5A 1V40A 2F8FA 5G1LA 3ZREA 4G2EA 4MCUA 4HJMA 5EPFA 5GZZB 4DSQA 2VCXA 5A4UA 2N5AA 3ZZXA 5IO0A 3HCZA 2H6YA 2AV4A 1ZYPA 3M1GA 4GLTA 5ID2A 3VWXA 1GUHA 2KOKA 3GIXA 2GSTA 2P31A 6GSTA 4K2XA 3FZ5A 5J5NA 1Z9HA 3F3QA 2PGTA 2C3QA 2R0CA 5CYYA 2M80A 2NBSA 4GSTA 2WS2A 4Z2RA 2LQOA 3D0ZA 2DJJA 2GQMA 5GAPD 2FY6A 5CRGA 2FWEA 2FGXA 2E2GA 4EKZA 4ZL9A 1SL0B 1EWXA 4IHUA 2R6KA 1PA3A 3WT2A 4G10A 5DVBA 3EINA 2KP2A 16GSA 4O5QA 3KJYA 2DJ0A 2JSZA 2GSQA 1MDKA 5COHA 3HZ8A 3Q74A 2H74A 2NVLA 3HJPA 1FB0A 3EU4A 1PL1A 3ZMKA 1FAAA 4KSMA 4WBJA 2OACA 4JZQA 1ST9A 4ML1A 1T00A 3GUSA 2LV3A 5GSTA 1U88A 2CZ3A 4LMVA 4XS4B 5ECLB 2I9HA 2B7KA 1THOA 1SK2A 1B9YC 4OFNA 3KD0A 1AC1A 3KTLA 2HZEA 4IN0A 3M9KA 3VPQA 5LCZA 2FWHA 2OE0A 1LJRA 3IA1A 1V58A 1IYHA 5E4WA 2CAIA 1FOVA 2R0GA 1B8XA 1HNBA 5KOXA 4GQCA 5A5KA 1W4VA 2H0GA 5G1KA 2AYTA 3ZRDA 1EGOA 1XZOA 4IBPA 1GWCA 1WMJA 2WGRA 1OE7A 2YP6A 1TU7A 2OE3A 4WR5A 2OJLA 1QK8A 1GTUA 3WGXA 5DAKA 6GSWA 4P3YB 3VK9A 4DSSA 4X43A 2VLVA 3KEBA 1EEMA 4PTSA 3KIJA 3TCOA 4EDYA 1X5DA 3IAS2 3FEUA 2MBTA 4HZ2A 4YKFA 4Q5RA 1SJIA 3GSSA 1GUMA 1XBSA 1G6WA 3IOSA 3ZFLA 4YAPA 4EIQA 2YZHA 1M99A 4MJCA 3O6TA 3LXZA 1G7EA 3EPTA 3IC8A 5JCWA 3QMXA 1ON4A 2CQ9A 5HR0A 2HSHA 5KOWA 3IPZA 1FB6A 5DJLA 1SKSB 3M8NA 4K1FA 1Y25A 1ZCPA 1OKDA 1TW9A 4IW9A 6GSXA 1GLQA 3L0HA 1ML6A 3AY8A 2TIRA 3ERGA 4PGTA 2H19A 4RI6A 2GDRA 2LJKA 1JZDA 3GNJA 3QPMA 2L57A 2IMDA 5KN0A 2GT6A 5HR3A 4OCFA 1X5CA 4K7NA 3UARA 1HD2A 1WE0A 4GCIA 3FZ9A 1QQ2A 5B6NA 1ILOA 2XPEA 4RI7A 4V2NA 2FWGA 2LRCA 4ID0A 5J4UA 2HRFA 1GSQA 4F9ZA 2IMIA 1HNCA 4J56E 2DIZA 3H93A 3ED3A 3NIVA 4MJAA 4CW9A 4ZB9A 1O7UA 1JFUA 4KB3A 4WR4A 2CAQA 2HLSA 2IJYA 3ERWA 1K0OA 5JWRB 5JWOB 3N5OA 4EC0A 4WETA 2O89A 3LYPA 3GL5A 2C8UA 3RHBA 1XIYA 3ME7A 3BCIA 4TOPA 1C72A 5ECHB 1A2JA 1M2DA 2Z9SA 4EF0A 1X0RA 3TKQA 5BMUA 3F4SA 5G2ZA 3FHKA 11GSA 1QFNA 1B4PA 1FHEA 1CQHA 4I8BA 2VL2C 4N30A 1R5PA 4TR1A 3UBLA 3LJRA 4F2IA 2BJXA 4TR1B 1BJXA 1PMTA 2K9FA 5B8AA 2EIRA 3GX0A 3LWAA 3C7MA 3CRTA 5IOXA 4HQZA 2C4JA 3NZNA 4I5QA 1AQVA 4TR3A 5JCGA 1TI1A 3HJOA 5IPGA 3KP8A 4G19A 3BD2A 5FWGA 4X1UA 2HYXA 5B8BA 4KDUA 4JRRA 4EVMA 5CRWA 1GSFA 1T3BA 5IMZA 4EUYA 4MF6A 5INYA 4XIHA 3ZIJA 1A24A 4J2FA 1UVZA 1TJDA 2B5XA 4BPYA 3Q18A 4L0UA 1QXHA 3TUEA 1OKTA 5HFKA 1DE2A 5J41A 2P5RA 5G31A 5CRDA 5IMVA 1MDJA 1URMA 4GQFA 4OWYA 1SYRA 3UOMA 2E0QA 4BWQA 1EV4A 3GA4A 2IMFA 5DCGA 2LTKA 1ZOFA 2I4AA 1PSQA 2RIIA 5CP1A 1JZRA 3G7JA 2GZYA 4MA9A 4LMWA 3N9JA 3ZLPA 2OKAA 2YWMA 4ZL8A 3DRNA 2HT9A 5D9VA 3IBHA 3PR8A 2CV4A 1OAZA 1S3AA 2F51A 2IFQB 4TR4A 4TN8A 1QGVA 4IQAA 3JCML 1A2MA 3DVXA 22GSA 19GSA 4XS6A 5DBQA 1EGRA 2XC2A 5GSSA 2HZFA 1RK4A 5F07A 3MYDA 3US3A 3G7YA 3APQA 3GTUB 2BTOT 4KF9A 4HEA2 3E0UA 1ZGNA 2VOCA 3VI7A 2QGVA 4RQRA 1Z7PA 2VCTA 4GWRA 4X4JA 2A2RA 1A8LA 2X99A 1TOFA 3K8NA 2OE1A 4AJ7A 2LUSA 4FO5A 3UL3A 1HQOA 3TOUA 3S9FA 3M0FA 3TB2A 3QAWA 3L9UA 2VM2A 1B48A 1B9XC 4IS0A 1FVKA 4MMMA 1GUKA 1YKAA 3I43A 4GSNA 4HJ2A 5D8IA 3LFLA 3DYRA 1A0FA 4LA1A 3E9JB 2VL2A 3G9BA 4CHSA 3FW2A 5F8BA 2MMZA 4K5SA 2VUPA 4NMUA 3QCPA 1HNAA 2MMOA 1PRXA 2HRAA 4WBRD 3TOTA 1LU4A 2VO4A 1R5AA 3F6DA 4KX4A 2WFCA 2O7KA 1S3DA 2QSIA 5EVOA 1SK0A 1PN0A 4CY8A 1EP7A 2YPMA 4IKHA 1K3LA 1MD3A 4Z2UA 3FZ4A 4G0LA 4DEJA 4MF5A 1GRXA 6GSUA 3QDNA 4CDOA 2WZ9A 12GSA 1AIUA 2XBIA 3F9UA 3WGEA 3TJKA 1X9MB 2VL3A 3O76A 5ID2B 3PPUA 1F3AA 1Y6EA 3F3RA 4ZB8A 2EIQA 5BRTA 2C1YA 1YF1A 2LRNA 2LJRA 3MWHA 3ZTLA 3IV4A 2GSRA 3QFBC 1TK8B 2FA8A 1RW1A 4MH2A 1DSBA 5B7CA 2X8CA 4DVCA 5ELGA 3HKRA 1VF2A 5ECIB 2P5QA 1XWKA 17GSA 1X9SB 1O8XA 4IJIA 4KDXA 3CSJA 4KNDA 2K6VA 2DJ3A 4YH2A 1ZYNA 1TRUA 4Q5QA 3DVWA 4ECIA 4JR6A 5IMDA 2B1KA 5DJMA 4ML6A 3E3EA 4ZBDA 3UVHA 2RUFA 2HNLA 2VAFA 5L71A 3FMWA 2HSMA 3D21A 10GSA 1MTCA 2N5FA 4ZXGA 1TK0B 2NTOA 2G2QA 3HXSA 1BEDA 4MJBA 1XWAA 2GVPA 4KCEA 1PKWA 1T4YA 3G7IA 2L6CA 1K0DA 5KN2A 1Z7RA 2H1DA 4PX1A 3TRPA 2H70A 4X0XA 2R37A 4F0BA 5J3RA 3ERFA 1TRSA 4DSRA 2HZEB 4I97A 3VFIA 5DQYA 4OD7A 4LL1B 3EU3A 5ECMB 4QL9A 1GL8A 4AJ6A 1M9BA 5FHIA 2L4CA 1J08A 2CT6A 2IWTA 5ECNB 3EMPA 1GNWA 2DSAA 1GP1A 1EOGA 1TP9A 1WWJA 3ME8A 3HYPA 2RUEA 1ZZYA 3KCMA 2B6MA 2B3SA 2YANA 3GMFA 3L9VA 2GQKA 3HA9A 2FLSA 4PUAA 3ZITA 4XCSA 1XVQA 5DAKB 3IAM2 4DSSB 2RM6A 4USSA 3I9V2 4IP6A 5CO3A 1M7TA 4LLRA 2DJKA 4BL7A 2LEGA 5KN1A 3RPNA 2JSYA 5ABRA 1TKDB 2R2JA 3TKSE 1KTEA 5JCUA 3VWUA 3HZ4A 4ILFA 4H86A 3LG6A 5GAND 4ECBA 3HVVA 2H1BA 2HSYA 2PVQA 5DCHA 1XW9A 4K8MA 3H1NA 2OBKA 2MBSA 4OCEA 3IR4A 3OR5A 3HJMA 1ERUA 5D73A 1S3CA 4O7HA 2YWOA 4MPGA 1WPIA 1AQXA 5AIVA 4V1Ag 1SD8A 1SJZA 4JEDA 3LEFA 1K0CA 2IMKA 5DALA 1U3IA 4MH3A 2YV7A 5DALB 5HR1A 5H5QA 3A2WA 3KH9A 2CA8A 2WRTA 1XXUA 3EE2A 4N0VA 2B1LA 1M0UA 1F6MC 1XPVA 2M72A 3IDVA 3UEMA 2H66A 3VWVA 4IP1A 3ZYWA 2HRKA 3KH7A 1QMVA 2B7JA 3M3MA 4KAEA 1HYUA 3H4KA 1TU8A 2PMTA 3VURA 3QOUA 3F4TA 3QAGA 1XWCA 2K18A 1UC7A 3KP9A 3TJJA 2PBJA 3D4MA 3IHQA 1GLPA 1WJKA 4XHMA 4YQVA 1TXXA 2REMA 3W8JA 3LORA 2LJAA 13GSA 3EVIA 2ALBA 1O73A 1UA5A 1YEPA 2V1MA 1ERVA 2DLXA 1K0MA 2VCQA 1GSYA 2FWFA 3IHGA 2NPBA 1N2AA 3TJGA 2VD1A 1BG5A 1A0RP 1NHYA 3MSZA 4K6XA 2H0HA 3KGKA 3Q6OA 2I3YA 2KUCA 2I81A 2H73A 3FR9A 1NM3A 2OBIA 2O87A 2KP1A 4K5RA 4FYUA 2YJ7A 2N5BA 3CTFA 4ZBBA 2DBCA 4YKGA 3HDCA 4MF7A 3RAZA 2A2SA 2IMEA 3TDGA 2WDUA 2WJUA 2X4AA 4JE1A 1WP0A 3D22A 1JLWA 1SJ6A 3GSTA 3HVXA 3GX8A 4BVYA 2QKEA 4KA0A 3UMAA 5IIZA 4BWSA 5A4WA 3LXTA 3A2VA 1T8EB 2VD0A 1ZMAA 3DWVA 1E2YA 2FD3A 5AGYA 2F8AA 3KM6A 5ECKB 1DE1A 3R3EA 3EURA 4Z7XA 3VI5A 4MJEA 5AISA 4XTSA 1T4ZA 2YCDA 3UIWA 1GSDA 1LBKA 1SL2B 2PVOC 2M46A 3WGDA 3DEXA 1CQGA 2C0FA 4EE0A 4RQXA 3CYNA 3LGCA 4TXOA 4NHWA 4NPBA 4TXOB 1XFLA 2B5YA 2C0GA 3UAPA 2X49A 4V2MA 1TTZA 3RDWA 1OC9A 4Q5FA 4Z2TA 4GXZA 2G0FA 4OFTA 1OC9B 5IMCA 5LNKe 1O81A 2EC4A 1K0NA 3GN3A 2RM5A 5CRHA 2A4HA 3NOFA 1SKWB 2YV9A 4TRXA 2X8HA 3D5JA 4K7IA 3UJ1A 3VWWA 3TKRA 2MMNA 5AIXA 2X64A 4POBA 2CZ2A 2VLUA 5EY6A 2F9SA 2FA4A 1FOHA 2DMLA 2H71A 1J9BA 1QUWA 2V2GA 2XPDA 3APOA 5FT3A 3F63A 2JZRA 3QAVA 2ON7A 4TR0A 1BYEA 1PQNA 1Z3EA 2JADA 3KZQA 2DJ2A 4MDCA 1NHOA 3GH9A 2VCZA 2YWIA 5D96A 2EIOA 1A2LA 4JBBA 1SK1A 4K9ZA 3ZFBA 1G0TA 5IPHA 5C04A 4NXIA 1ACVA 4HZ4A 4FH8A 3MIXA 3PINA 4G9HA 4YQMA 4K0NA 1O85A 3GV1A 4XS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HU9 A;  3DXB A;  1I9D A;  1XW5 A;  3WT1 A;  4POK A;  3H79 A;  2AJQ B;  1EZK A;  1E6B A;  1G7O A;  1BQ7 A;  2PER A;  2C0E A;  3SBC A;  5A4V A;  1PGT A;  4E8H A;  6GSY A;  2HXK A;  3KXO A;  5G5E A;  3L78 A;  3A5W A;  2P0G A;  2L5L A;  1F37 A;  3J7Y k;  4NAX A;  3MDK A;  4IEL A;  1Z6M A;  5HFG A;  4AJ8 A;  2H1G A;  4ZBA A;  3VPT A;  2GSS A;  2JAC A;  1SU9 A;  3HVS A;  4HU7 A;  1AW9 A;  6GSV A;  2DMM A;  3FYG A;  2H8L A;  2D2Z A;  2LQQ A;  2ZCT A;  3BBY A;  2V41 A;  4MZW A;  1OYJ A;  4NV2 A;  1TI3 A;  2FCH A;  4L8E A;  3APS A;  1JLV A;  4D73 A;  2O85 A;  5IM9 A;  5E59 A;  3SWL A;  3DD3 A;  4PQ1 A;  4N10 A;  1USB A;  4XRD A;  3CXG A;  3QR6 A;  1VF1 A;  2PN8 A;  5AN1 A;  1PKZ A;  2H6Z A;  3CTG A;  3GL3 A;  4KCA A;  3QD9 A;  3L4N A;  4PXO A;  4ULX A;  3GHA A;  3I69 A;  2VLT A;  2YOI A;  1XOB A;  3P8W A;  4HOJ A;  2PU9 C;  2BMX A;  4XRA A;  4F82 A;  5F06 A;  3D4T A;  3IK7 A;  3J7Y b;  4TVE A;  3DIE A;  2K8S A;  1N8J A;  1ZL9 A;  1RQM A;  4MZC A;  2GZP A;  1TRW A;  3F6F A;  5ECR B;  2FHE A;  1IYI A;  1UN2 A;  5ECS A;  1FVJ A;  1OC8 A;  2JL4 A;  3GKK A;  4MLY A;  2L4Q A;  1X5E A;  1GH2 A;  1PD2 1;  2ON5 A;  2CX4 A;  5G30 A;  4GSS A;  1SEN A;  4EXJ A;  3HHV A;  4KDY A;  2WB9 A;  4K7O A;  4QL7 A;  1KBN A;  5EL8 A;  1Q4J A;  1XVW A;  1EEJ A;  14GS A;  5CRE A;  1I5G A;  4L5O A;  5ECO B;  1XWG A;  1SKR B;  4ZIJ A;  3MAK A;  3KTB A;  2ZUP A;  2KHP A;  2LST A;  3KMO A;  3GKN A;  3WYW A;  1V9W A;  3U5R E;  4EDZ A;  2V32 A;  4WF4 A;  2AUV A;  4KGI A;  4YQU A;  4MK3 A;  4KH7 A;  3F0I A;  1U6T A;  1XCC A;  1DUG A;  1V2A A;  2YJH A;  3CSH A;  4XS4 A;  4O5R A;  3GYK A;  1K3Y A;  1AXD A;  3ZVJ D;  2YZU A;  3GFK A;  1F3B A;  1SD9 A;  4PUF C;  5D9T A;  1K0A A;  3IK9 A;  1ZYQ B;  3IC4 A;  2YNX A;  4IVF A;  3C8E A;  2GT5 A;  2VM1 A;  1WOU A;  1KEB A;  4ECC A;  1F9M A;  2IN3 A;  1T1V A;  3H8Q A;  1XOA A;  3BJ5 A;  3WD6 A;  4AF2 A;  4O92 A;  4POM A;  2PUK C;  4OO4 A;  4JU5 A;  3TKS C;  3W8S A;  2K8V A;  4F0C A;  3IE3 A;  5ECP B;  1FG4 A;  4LL4 B;  2WUL A;  2CVB A;  1J0F A;  1TDI A;  4MZB A;  3CMI A;  2I1U A;  3C71 A;  2LNT A;  4OMV A;  2HFD A;  3UBK A;  4F03 A;  2VIM A;  1XWB A;  2XBQ A;  3DKS A;  2WCI A;  1Q98 A;  1Z6N A;  4NV5 A;  3BCK A;  3FZA A;  1GTA A;  3GUR A;  1GTB A;  4ECJ A;  5DDL A;  2LNS A;  3TKP A;  4K0G A;  3EWL A;  1VF4 A;  3ZIV A;  5IO2 A;  4IJ3 A;  3V1W A;  4MPF A;  7GSS A;  4KUN A;  1XW6 A;  5LD0 A;  4KSO A;  3M9J A;  5G5F A;  3C73 A;  2R3X A;  3P2A A;  1ZYE A;  1GSU A;  2AAW A;  1MD4 A;  4HQS A;  1O8W A;  4BA7 A;  2O8V B;  1NW2 A;  4JR4 A;  3L9S A;  2VL9 A;  2JZT A;  3IRA A;  3C1R A;  2B5E A;  2DC5 A;  5D9W A;  4HS1 A;  3ISO A;  3LQ7 A;  2GZZ A;  3ZL5 A;  1TK5 B;  2XHF A;  1VGL A;  5DQS A;  1G6Y A;  1VRS D;  3GKM A;  4E8E A;  3FR3 A;  3MNG A;  1JZW A;  3GH6 A;  1GSS A;  1F2E A;  3BOA A;  3EC3 A;  3D6I A;  2LKU A;  2IPA A;  4EO3 A;  1TRV A;  1JZO A;  2V6O A;  2ZNM A;  1EV9 A;  2GLR A;  1PN9 A;  4N0Z A;  3U6V A;  4J57 E;  3PGT A;  4KW6 A;  3FR6 A;  1GTI A;  2J23 A;  1FO5 A;  3FY7 A;  1M9A A;  2V6K A;  1YJ6 A;  4Q5N A;  2ES7 A;  3RBT A;  1ABA A;  3C1S A;  2DIY A;  3TRQ A;  2H76 A;  4FYB A;  3HY2 A;  2LS5 A;  4HDE A;  4OFM A;  20GS A;  2FNO A;  3DGQ A;  4PQI A;  4PNG A;  4WXT A;  1U3A A;  4I2U A;  2AB6 A;  2F3M A;  4YAV A;  1ERT A;  4ACS A;  2CVK A;  3FKF A;  1M2B A;  5IOW A;  4POL A;  5KEJ A;  4MAB A;  1GNE A;  3FRC A;  2H6X A;  1JHB A;  4RUV A;  5H5S A;  2H0I A;  3F8U A;  1FW1 A;  3P90 A;  2CVD A;  1O6J A;  2HRN A;  4WKW A;  2MYG A;  4HI7 A;  2DJ1 A;  5ECQ B;  1Z5Y E;  2GS3 A;  1V98 A;  1YY7 A;  2H30 A;  5H5R A;  4IGJ A;  1YF0 A;  5ELA A;  3A3T A;  4WF5 A;  2KLX A;  1A8Y A;  4KE3 A;  1A23 A;  3QFA C;  1H4O A;  5J9C A;  1M2A A;  5IQY A;  2H1A A;  3LYK A;  2VCW A;  2A4V A;  4NHZ A;  2GQL A;  2YWN A;  1DBY A;  4O32 A;  2C3N A;  2YN1 A;  2E2M A;  1PX7 A;  5D93 A;  4K2D A;  5CAX A;  1YZX A;  3TKS A;  1BAY A;  3HD5 A;  4ZL7 A;  1YQ1 A;  2X8G A;  3CRU A;  3F4R A;  4TW5 A;  4WEY A;  1MDI A;  3O3T A;  1YDK A;  3GKX A;  3TJB A;  4V2L A;  5D9X A;  1SYX A;  5IMA A;  2OA7 A;  4HUA A;  4L0W A;  3DML A;  3PH9 A;  2VCV A;  2IL3 A;  5IMF A;  2GTU A;  3KMN A;  4PNF A;  1VF3 A;  1WRY A;  3TRX A;  3EMX A;  5B6M A;  3CBU A;  3A2X A;  4FYC A;  3RPP A;  1NSW A;  1ERW A;  2LRT A;  3ZML A;  2JZS A;  3EYT A;  1W89 A;  1T7P B;  1B4Q A;  2QC7 A;  4ISD A;  5F0G A;  2IFQ A;  1EP8 A;  3UVT A;  1SL1 B;  5F05 A;  1GSE A;  2HE3 A;  4ZIL A;  1YKC A;  4PQH A;  2HI7 A;  4AGS A;  1X9W B;  1YEX A;  1OE8 A;  18GS A;  3GRX A;  1R26 A;  4EL1 A;  4N11 A;  1K3O A;  1R4W A;  3RHC A;  1PX6 A;  1GUL A;  3GTU A;  1OC3 A;  3I6A A;  4GF0 A;  2PWJ A;  2MMA A;  1MEK A;  4I6X A;  1AAZ A;  4PUR A;  2IIY A;  1OVN A;  1AUC A;  3R2Q A;  5ENU A;  1AQW A;  3IXR A;  2L6D A;  5J9B A;  4BVX A;  5HR2 A;  2PPT A;  1KNG A;  9GSS A;  4I2T A;  2OAD A;  3Q19 A;  2E7P A;  3FK8 A;  4L5L A;  3TGZ A;  2TRC P;  1K0B A;  4MP4 A;  1EOH A;  3ZVJ A;  4NWY A;  2R4V A;  4TKY A;  3CSI A;  4ZB6 A;  2C0D A;  1R7H A;  2GGT A;  5CNW A;  1PL2 A;  3TJF A;  8GSS A;  2C80 A;  2H72 A;  1THX A;  1H75 A;  2CX3 A;  2J9H A;  4FIW A;  5HFI A;  2FUG 2;  2AHE A;  2H75 A;  2H01 A;  3VLN A;  3LSZ A;  5KN3 A;  5JWQ B;  4IQ1 A;  1WIK A;  2NDO A;  1V57 A;  2MZC A;  2L59 A;  2L5O A;  2R5G A;  2TRX A;  4TXV A;  3P7X A;  1U87 A;  1BX9 A;  4D73 B;  3W6G A;  4QQ7 A;  5HQP A;  4GRF A;  2C3T A;  4GTU A;  5C00 A;  4V1A p;  6GSS A;  2RLI A;  2JU5 A;  4OO5 A;  1V40 A;  2F8F A;  5G1L A;  3ZRE A;  4G2E A;  4MCU A;  4HJM A;  5EPF A;  5GZZ B;  4DSQ A;  2VCX A;  5A4U A;  2N5A A;  3ZZX A;  5IO0 A;  3HCZ A;  2H6Y A;  2AV4 A;  3M1G A;  4GLT A;  5ID2 A;  3VWX A;  1GUH A;  2KOK A;  3GIX A;  2GST A;  2P31 A;  6GST A;  3FZ5 A;  5J5N A;  1Z9H A;  3F3Q A;  2PGT A;  2C3Q A;  5CYY A;  2M80 A;  2NBS A;  4GST A;  2WS2 A;  2LQO A;  3D0Z A;  2DJJ A;  2GQM A;  5GAP D;  2FY6 A;  5CRG A;  2FWE A;  2FGX A;  2E2G A;  4EKZ A;  4ZL9 A;  1SL0 B;  1EWX A;  4IHU A;  2R6K A;  1PA3 A;  3WT2 A;  4G10 A;  5DVB A;  3EIN A;  2KP2 A;  16GS A;  3KJY A;  2DJ0 A;  2JSZ A;  2GSQ A;  1MDK A;  5COH A;  3HZ8 A;  3Q74 A;  2H74 A;  2NVL A;  3HJP A;  1FB0 A;  3EU4 A;  1PL1 A;  3ZMK A;  1FAA A;  4KSM A;  4WBJ A;  2OAC A;  4JZQ A;  1ST9 A;  4ML1 A;  1T00 A;  3GUS A;  2LV3 A;  5GST A;  1U88 A;  2CZ3 A;  4LMV A;  4XS4 B;  5ECL B;  2I9H A;  2B7K A;  1THO A;  1SK2 A;  1B9Y C;  4OFN A;  3KD0 A;  1AC1 A;  3KTL A;  2HZE A;  4IN0 A;  3M9K A;  3VPQ A;  5LCZ A;  2FWH A;  2OE0 A;  1LJR A;  3IA1 A;  1V58 A;  1IYH A;  5E4W A;  2CAI A;  1FOV A;  1B8X A;  1HNB A;  4GQC A;  5A5K A;  1W4V A;  2H0G A;  5G1K A;  2AYT A;  3ZRD A;  1EGO A;  1XZO A;  4IBP A;  1GWC A;  1WMJ A;  2WGR A;  1OE7 A;  2YP6 A;  1TU7 A;  2OE3 A;  4WR5 A;  2OJL A;  1QK8 A;  1GTU A;  3WGX A;  5DAK A;  6GSW A;  4P3Y B;  3VK9 A;  4DSS A;  4X43 A;  2VLV A;  3KEB A;  1EEM A;  3KIJ A;  3TCO A;  4EDY A;  1X5D A;  3IAS 2;  3FEU A;  2MBT A;  4HZ2 A;  1SJI A;  4Q5R A;  3GSS A;  3IOS A;  1GUM A;  1XBS A;  1G6W A;  3ZFL A;  4YAP A;  2YZH A;  1M99 A;  4MJC A;  3O6T A;  3LXZ A;  1G7E A;  5JCW A;  3QMX A;  1ON4 A;  2CQ9 A;  5HR0 A;  2HSH A;  3IPZ A;  1FB6 A;  5DJL A;  1SKS B;  3M8N A;  4K1F A;  1Y25 A;  1ZCP A;  1OKD A;  1TW9 A;  4IW9 A;  6GSX A;  1GLQ A;  3L0H A;  1ML6 A;  3AY8 A;  2TIR A;  3ERG A;  4PGT A;  2H19 A;  4RI6 A;  2GDR A;  2LJK A;  1JZD A;  3GNJ A;  3QPM A;  2L57 A;  2IMD A;  5KN0 A;  2GT6 A;  5HR3 A;  4OCF A;  1X5C A;  4K7N A;  3UAR A;  1HD2 A;  1WE0 A;  4GCI A;  3FZ9 A;  1QQ2 A;  5B6N A;  1ILO A;  2XPE A;  4RI7 A;  4V2N A;  2FWG A;  2LRC A;  4ID0 A;  5J4U A;  2HRF A;  1GSQ A;  4F9Z A;  2IMI A;  1HNC A;  4J56 E;  2DIZ A;  3H93 A;  3ED3 A;  3NIV A;  4MJA A;  4CW9 A;  4ZB9 A;  1O7U A;  1JFU A;  4KB3 A;  4WR4 A;  2CAQ A;  2HLS A;  2IJY A;  3ERW A;  1K0O A;  5JWR B;  5JWO B;  3N5O A;  4EC0 A;  4WET A;  2O89 A;  3LYP A;  3GL5 A;  2C8U A;  3RHB A;  1XIY A;  3ME7 A;  3BCI A;  4TOP A;  1C72 A;  5ECH B;  1A2J A;  1M2D A;  2Z9S A;  4EF0 A;  1X0R A;  3TKQ A;  3F4S A;  5G2Z A;  3FHK A;  11GS A;  1QFN A;  1B4P A;  1FHE A;  1CQH A;  4I8B A;  2VL2 C;  4N30 A;  1R5P A;  4TR1 A;  3UBL A;  3LJR A;  4F2I A;  2BJX A;  4TR1 B;  1BJX A;  1PMT A;  2K9F A;  5B8A A;  2EIR A;  3GX0 A;  3LWA A;  3C7M A;  3CRT A;  5IOX A;  4HQZ A;  2C4J A;  3NZN A;  4I5Q A;  1AQV A;  4TR3 A;  5JCG A;  1TI1 A;  3HJO A;  5IPG A;  3KP8 A;  4G19 A;  3BD2 A;  5FWG A;  4X1U A;  2HYX A;  5B8B A;  4KDU A;  4JRR A;  4EVM A;  5CRW A;  1GSF A;  1T3B A;  5IMZ A;  4EUY A;  4MF6 A;  5INY A;  4XIH A;  3ZIJ A;  1A24 A;  4J2F A;  1UVZ A;  1TJD A;  2B5X A;  4BPY A;  3Q18 A;  4L0U A;  1QXH A;  3TUE A;  1OKT A;  5HFK A;  1DE2 A;  5J41 A;  2P5R A;  5G31 A;  5CRD A;  5IMV A;  1MDJ A;  1URM A;  4GQF A;  4OWY A;  1SYR A;  3UOM A;  2E0Q A;  4BWQ A;  1EV4 A;  3GA4 A;  2IMF A;  5DCG A;  2LTK A;  1ZOF A;  2I4A A;  1PSQ A;  2RII A;  5CP1 A;  1JZR A;  3G7J A;  2GZY A;  4MA9 A;  4LMW A;  3N9J A;  3ZLP A;  2OKA A;  2YWM A;  4ZL8 A;  3DRN A;  2HT9 A;  5D9V A;  3IBH A;  3PR8 A;  2CV4 A;  1OAZ A;  1S3A A;  2F51 A;  2IFQ B;  4TR4 A;  4TN8 A;  1QGV A;  4IQA A;  3JCM L;  1A2M A;  3DVX A;  22GS A;  19GS A;  4XS6 A;  5DBQ A;  1EGR A;  2XC2 A;  5GSS A;  2HZF A;  1RK4 A;  5F07 A;  3US3 A;  3G7Y A;  3APQ A;  3GTU B;  2BTO T;  4HEA 2;  3E0U A;  1ZGN A;  2VOC A;  3VI7 A;  2QGV A;  4RQR A;  1Z7P A;  2VCT A;  4GWR A;  2A2R A;  1A8L A;  2X99 A;  1TOF A;  3K8N A;  2OE1 A;  4AJ7 A;  2LUS A;  4FO5 A;  3UL3 A;  1HQO A;  3TOU A;  3S9F A;  3M0F A;  3TB2 A;  3QAW A;  3L9U A;  2VM2 A;  1B48 A;  1B9X C;  4IS0 A;  1FVK A;  4MMM A;  1GUK A;  1YKA A;  3I43 A;  4GSN A;  4HJ2 A;  5D8I A;  3LFL A;  3DYR A;  1A0F A;  4LA1 A;  3E9J B;  2VL2 A;  3G9B A;  4CHS A;  3FW2 A;  5F8B A;  2MMZ A;  2VUP A;  4NMU A;  3QCP A;  1HNA A;  2MMO A;  1PRX A;  4WBR D;  3TOT A;  1LU4 A;  2VO4 A;  1R5A A;  3F6D A;  4KX4 A;  2WFC A;  2O7K A;  1S3D A;  2QSI A;  5EVO A;  1SK0 A;  1EP7 A;  2YPM A;  4IKH A;  1K3L A;  1MD3 A;  3FZ4 A;  4DEJ A;  4MF5 A;  1GRX A;  6GSU A;  3QDN A;  4CDO A;  2WZ9 A;  12GS A;  1AIU A;  2XBI A;  3F9U A;  3WGE A;  3TJK A;  1X9M B;  2VL3 A;  3O76 A;  5ID2 B;  1F3A A;  1Y6E A;  3F3R A;  4ZB8 A;  2EIQ A;  2C1Y A;  1YF1 A;  2LRN A;  2LJR A;  3MWH A;  3ZTL A;  3IV4 A;  2GSR A;  3QFB C;  1TK8 B;  2FA8 A;  1RW1 A;  4MH2 A;  1DSB A;  5B7C A;  2X8C A;  4DVC A;  5ELG A;  3HKR A;  1VF2 A;  5ECI B;  2P5Q A;  1XWK A;  17GS A;  1X9S B;  1O8X A;  4IJI A;  4KDX A;  3CSJ A;  4KND A;  2K6V A;  2DJ3 A;  4YH2 A;  1TRU A;  4Q5Q A;  3DVW A;  4ECI A;  4JR6 A;  5IMD A;  2B1K A;  5DJM A;  4ML6 A;  3E3E A;  4ZBD A;  3UVH A;  2RUF A;  2HNL A;  2VAF A;  5L71 A;  3D21 A;  10GS A;  1MTC A;  2N5F A;  4ZXG A;  1TK0 B;  2NTO A;  2G2Q A;  3HXS A;  1BED A;  4MJB A;  1XWA A;  2GVP A;  4KCE A;  1PKW A;  1T4Y A;  3G7I A;  2L6C A;  1K0D A;  5KN2 A;  1Z7R A;  2H1D A;  4PX1 A;  3TRP A;  2H70 A;  4X0X A;  2R37 A;  4F0B A;  5J3R A;  3ERF A;  1TRS A;  4DSR A;  2HZE B;  4I97 A;  3VFI A;  5DQY A;  4OD7 A;  4LL1 B;  3EU3 A;  5ECM B;  4QL9 A;  1GL8 A;  4AJ6 A;  1M9B A;  5FHI A;  2L4C A;  1J08 A;  2CT6 A;  2IWT A;  5ECN B;  3EMP A;  1GNW A;  2DSA A;  1GP1 A;  1EOG A;  1TP9 A;  1WWJ A;  3ME8 A;  3HYP A;  2RUE A;  1ZZY A;  3KCM A;  2B6M A;  2B3S A;  2YAN A;  3GMF A;  3L9V A;  2GQK A;  3HA9 A;  2FLS A;  4PUA A;  3ZIT A;  4XCS A;  1XVQ A;  5DAK B;  3IAM 2;  4DSS B;  2RM6 A;  3I9V 2;  4IP6 A;  5CO3 A;  1M7T A;  4LLR A;  2DJK A;  4BL7 A;  2LEG A;  5KN1 A;  3RPN A;  2JSY A;  5ABR A;  1TKD B;  2R2J A;  3TKS E;  1KTE A;  5JCU A;  3VWU A;  3HZ4 A;  4ILF A;  4H86 A;  3LG6 A;  5GAN D;  4ECB A;  3HVV A;  2H1B A;  2HSY A;  2PVQ A;  5DCH A;  1XW9 A;  4K8M A;  3H1N A;  2OBK A;  2MBS A;  4OCE A;  3IR4 A;  3OR5 A;  3HJM A;  1ERU A;  5D73 A;  1S3C A;  4O7H A;  2YWO A;  4MPG A;  1WPI A;  1AQX A;  5AIV A;  4V1A g;  1SD8 A;  1SJZ A;  4JED A;  3LEF A;  1K0C A;  2IMK A;  5DAL A;  1U3I A;  4MH3 A;  2YV7 A;  5DAL B;  5HR1 A;  5H5Q A;  3A2W A;  3KH9 A;  2CA8 A;  2WRT A;  1XXU A;  3EE2 A;  4N0V A;  2B1L A;  1M0U A;  1F6M C;  1XPV A;  2M72 A;  3IDV A;  3UEM A;  2H66 A;  3VWV A;  4IP1 A;  3ZYW A;  3KH7 A;  1QMV A;  2B7J A;  3M3M A;  4KAE A;  1HYU A;  3H4K A;  1TU8 A;  2PMT A;  3VUR A;  3QOU A;  3F4T A;  3QAG A;  1XWC A;  2K18 A;  1UC7 A;  3KP9 A;  3TJJ A;  2PBJ A;  3D4M A;  3IHQ A;  1GLP A;  1WJK A;  4XHM A;  4YQV A;  1TXX A;  2REM A;  3W8J A;  3LOR A;  2LJA A;  13GS A;  3EVI A;  2ALB A;  1O73 A;  1UA5 A;  1YEP A;  2V1M A;  1ERV A;  2DLX A;  1K0M A;  2VCQ A;  1GSY A;  2FWF A;  2NPB A;  1N2A A;  3TJG A;  2VD1 A;  1BG5 A;  1A0R P;  1NHY A;  3MSZ A;  4K6X A;  2H0H A;  3KGK A;  3Q6O A;  2I3Y A;  2KUC A;  2I81 A;  2H73 A;  3FR9 A;  1NM3 A;  2OBI A;  2O87 A;  2KP1 A;  4FYU A;  2YJ7 A;  2N5B A;  3CTF A;  4ZBB A;  2DBC A;  3HDC A;  4MF7 A;  3RAZ A;  2A2S A;  2IME A;  3TDG A;  2WDU A;  2WJU A;  4JE1 A;  1WP0 A;  3D22 A;  1JLW A;  1SJ6 A;  3GST A;  3HVX A;  3GX8 A;  4BVY A;  2QKE A;  4KA0 A;  3UMA A;  5IIZ A;  4BWS A;  5A4W A;  3LXT A;  3A2V A;  1T8E B;  2VD0 A;  1ZMA A;  3DWV A;  1E2Y A;  2FD3 A;  5AGY A;  2F8A A;  3KM6 A;  5ECK B;  1DE1 A;  3EUR A;  4Z7X A;  3VI5 A;  4MJE A;  5AIS A;  4XTS A;  1T4Z A;  2YCD A;  3UIW A;  1GSD A;  1LBK A;  1SL2 B;  2PVO C;  2M46 A;  3WGD A;  3DEX A;  1CQG A;  2C0F A;  4EE0 A;  4RQX A;  3CYN A;  3LGC A;  4TXO A;  4NHW A;  4NPB A;  4TXO B;  1XFL A;  2B5Y A;  2C0G A;  3UAP A;  4V2M A;  1TTZ A;  3RDW A;  1OC9 A;  4Q5F A;  4GXZ A;  2G0F A;  4OFT A;  1OC9 B;  5IMC A;  5LNK e;  1O81 A;  2EC4 A;  1K0N A;  3GN3 A;  2RM5 A;  5CRH A;  3NOF A;  1SKW B;  2YV9 A;  4TRX A;  2X8H A;  3D5J A;  4K7I A;  3UJ1 A;  3VWW A;  3TKR A;  2MMN A;  5AIX A;  2X64 A;  4POB A;  2CZ2 A;  2VLU A;  5EY6 A;  2F9S A;  2FA4 A;  2DML A;  2H71 A;  1J9B A;  1QUW A;  2V2G A;  2XPD A;  3APO A;  5FT3 A;  3F63 A;  2JZR A;  3QAV A;  2ON7 A;  4TR0 A;  1BYE A;  1PQN A;  1Z3E A;  2JAD A;  3KZQ A;  2DJ2 A;  4MDC A;  1NHO A;  3GH9 A;  2VCZ A;  2YWI A;  5D96 A;  2EIO A;  1A2L A;  4JBB A;  1SK1 A;  4K9Z A;  3ZFB A;  1G0T A;  5IPH A;  5C04 A;  4NXI A;  1ACV A;  4HZ4 A;  4FH8 A;  3PIN A;  4G9H A;  4YQM A;  4K0N A;  1O85 A;  3GV1 A;  4XS1 A; 
#chains in the Genus database with same CATH topology
 4HU9 A;  3DXB A;  1I9D A;  1XW5 A;  3WT1 A;  4POK A;  3H79 A;  2AJQ B;  1EZK A;  1E6B A;  1G7O A;  1BQ7 A;  2PER A;  2C0E A;  3SBC A;  5A4V A;  1PGT A;  4E8H A;  6GSY A;  4EIP A;  2HXK A;  3KXO A;  5G5E A;  3L78 A;  3A5W A;  2P0G A;  2L5L A;  1F37 A;  3J7Y k;  4NAX A;  3MDK A;  4IEL A;  1Z6M A;  5HFG A;  4AJ8 A;  2H1G A;  4ZBA A;  3VPT A;  2GSS A;  1M3J A;  2JAC A;  1SU9 A;  3HVS A;  4HU7 A;  1AW9 A;  6GSV A;  2DMM A;  3FYG A;  2H8L A;  2D2Z A;  2LQQ A;  2ZCT A;  3BBY A;  2V41 A;  4MZW A;  1OYJ A;  4NV2 A;  1TI3 A;  2FCH A;  4L8E A;  3APS A;  1JLV A;  4D73 A;  2O85 A;  5IM9 A;  5E59 A;  2QA2 A;  3SWL A;  3DD3 A;  4PQ1 A;  4N10 A;  1USB A;  4XRD A;  3CXG A;  3QR6 A;  1VF1 A;  2PN8 A;  5AN1 A;  1PKZ A;  2H6Z A;  3CTG A;  3GL3 A;  4KCA A;  3QD9 A;  3L4N A;  4PXO A;  4ULX A;  3GHA A;  3I69 A;  4A5P A;  2VLT A;  2YOI A;  1XOB A;  3P8W A;  4HOJ A;  2PU9 C;  2BMX A;  4XRA A;  4F82 A;  5F06 A;  3D4T A;  3IK7 A;  1XG8 A;  3J7Y b;  4TVE A;  3DIE A;  2K8S A;  1N8J A;  1ZL9 A;  1RQM A;  4MZC A;  2GZP A;  1TRW A;  3F6F A;  5ECR B;  2FHE A;  1IYI A;  1UN2 A;  5ECS A;  1FVJ A;  1OC8 A;  2JL4 A;  3GKK A;  4MLY A;  2L4Q A;  1X5E A;  1GH2 A;  1PD2 1;  2ON5 A;  2CX4 A;  5G30 A;  4GSS A;  1SEN A;  4EXJ A;  3HHV A;  4KDY A;  2WB9 A;  4K7O A;  4QL7 A;  1KBN A;  5EL8 A;  1Q4J A;  1XVW A;  1EEJ A;  14GS A;  5CRE A;  1I5G A;  4L5O A;  5ECO B;  1XWG A;  1SKR B;  4ZIJ A;  3MAK A;  3KTB A;  2ZUP A;  2KHP A;  2LST A;  3KMO A;  3GKN A;  3WYW A;  1V9W A;  3U5R E;  4ICY A;  4EDZ A;  2V32 A;  4WF4 A;  2AUV A;  4KGI A;  4YQU A;  4MK3 A;  4KH7 A;  3F0I A;  1U6T A;  1XCC A;  1DUG A;  1V2A A;  2YJH A;  3CSH A;  4XS4 A;  4O5R A;  3GYK A;  1K3Y A;  1AXD A;  3ZVJ D;  2YZU A;  3GFK A;  1F3B A;  1SD9 A;  4PUF C;  5D9T A;  1K0A A;  3IK9 A;  1ZYQ B;  3IC4 A;  2YNX A;  4IVF A;  3C8E A;  2GT5 A;  4CY6 A;  2VM1 A;  1WOU A;  1KEB A;  4ECC A;  1F9M A;  2DKH A;  2IN3 A;  1T1V A;  3H8Q A;  1XOA A;  3BJ5 A;  3WD6 A;  4AF2 A;  4O92 A;  4BL7 B;  4POM A;  2PUK C;  4OO4 A;  4JU5 A;  3TKS C;  3W8S A;  2K8V A;  4F0C A;  3IE3 A;  5ECP B;  1FG4 A;  4LL4 B;  2WUL A;  2CVB A;  1J0F A;  1TDI A;  4MZB A;  4G0I A;  3CMI A;  2I1U A;  3C71 A;  2LNT A;  4OMV A;  2HFD A;  3UBK A;  4F03 A;  2VIM A;  1XWB A;  2XBQ A;  3DKS A;  2WCI A;  1Q98 A;  1Z6N A;  4NV5 A;  3BCK A;  3FZA A;  1GTA A;  3GUR A;  1GTB A;  3A5I A;  4ECJ A;  5DDL A;  2LNS A;  3TKP A;  4K0G A;  3EWL A;  1VF4 A;  3ZIV A;  5IO2 A;  4IJ3 A;  3V1W A;  4MPF A;  7GSS A;  4KUN A;  1XW6 A;  5LD0 A;  4KSO A;  3M9J A;  5G5F A;  3C73 A;  2R3X A;  3P2A A;  1ZYE A;  1GSU A;  2AAW A;  1MD4 A;  4HQS A;  1O8W A;  4BA7 A;  2O8V B;  1NW2 A;  4JR4 A;  3L9S A;  2VL9 A;  2JZT A;  3IRA A;  3C1R A;  2B5E A;  2DC5 A;  5D9W A;  4HS1 A;  3ISO A;  3LQ7 A;  2GZZ A;  3ZL5 A;  1TK5 B;  2XHF A;  1VGL A;  5DQS A;  1G6Y A;  1VRS D;  3GKM A;  4E8E A;  3FR3 A;  3MNG A;  1JZW A;  3GH6 A;  1GSS A;  1F2E A;  3BOA A;  3EC3 A;  3D6I A;  2LKU A;  2IPA A;  4EO3 A;  1TRV A;  1JZO A;  2V6O A;  2ZNM A;  1EV9 A;  2GLR A;  1PN9 A;  4N0Z A;  3U6V A;  4J57 E;  3PGT A;  4KW6 A;  3FR6 A;  1GTI A;  2J23 A;  1FO5 A;  3FY7 A;  1M9A A;  2V6K A;  1YJ6 A;  4Q5N A;  2ES7 A;  3RBT A;  1ABA A;  3C1S A;  2DIY A;  3TRQ A;  2H76 A;  4FYB A;  3HY2 A;  2LS5 A;  4HDE A;  4OFM A;  20GS A;  2FNO A;  2DKI A;  3DGQ A;  4PQI A;  4PNG A;  4WXT A;  1U3A A;  4I2U A;  2AB6 A;  3HVN A;  2F3M A;  4YAV A;  1ERT A;  4ACS A;  2CVK A;  3FKF A;  1M2B A;  5IOW A;  4POL A;  5KEJ A;  4MAB A;  4MNN A;  1GNE A;  3FRC A;  2H6X A;  1JHB A;  4RUV A;  5H5S A;  2H0I A;  3F8U A;  1FW1 A;  3P90 A;  2CVD A;  1O6J A;  4BVY B;  2HRN A;  4WKW A;  2MYG A;  4HI7 A;  2DJ1 A;  5ECQ B;  1Z5Y E;  2GS3 A;  1V98 A;  1YY7 A;  2H30 A;  5H5R A;  4IGJ A;  1YF0 A;  5ELA A;  3A3T A;  4WF5 A;  2KLX A;  1A8Y A;  4KE3 A;  1A23 A;  3QFA C;  1H4O A;  5J9C A;  1M2A A;  5IQY A;  2H1A A;  3LYK A;  2VCW A;  2A4V A;  2QA1 A;  4NHZ A;  2GQL A;  2YWN A;  1DBY A;  4O32 A;  2C3N A;  2YN1 A;  2E2M A;  1PX7 A;  3LW9 A;  5D93 A;  4K2D A;  5CAX A;  1YZX A;  3TKS A;  1BAY A;  3HD5 A;  4ZL7 A;  1YQ1 A;  2X8G A;  3CRU A;  3F4R A;  4TW5 A;  4WEY A;  1MDI A;  3O3T A;  1YDK A;  3GKX A;  3TJB A;  4V2L A;  5D9X A;  1SYX A;  5IMA A;  2OA7 A;  4HUA A;  4L0W A;  3DML A;  3PH9 A;  2VCV A;  2IL3 A;  5IMF A;  4FQU A;  2A2P A;  2GTU A;  3KMN A;  4PNF A;  1VF3 A;  1WRY A;  3TRX A;  3EMX A;  5B6M A;  3CBU A;  3A2X A;  4FYC A;  3RPP A;  1NSW A;  1ERW A;  2LRT A;  3ZML A;  2JZS A;  3EYT A;  1W89 A;  2UZ8 A;  1T7P B;  1B4Q A;  2QC7 A;  4ISD A;  5F0G A;  2IFQ A;  1EP8 A;  3UVT A;  1SL1 B;  5F05 A;  4G0K A;  1GSE A;  2HE3 A;  2R0P A;  1YKC A;  4ZIL A;  4PQH A;  2HI7 A;  4AGS A;  1X9W B;  1YEX A;  1OE8 A;  18GS A;  3GRX A;  1R26 A;  4EL1 A;  4N11 A;  1K3O A;  1R4W A;  3RHC A;  1PX6 A;  1S3R A;  1GUL A;  3GTU A;  1OC3 A;  3I6A A;  4GF0 A;  2PWJ A;  2MMA A;  1MEK A;  4I6X A;  1AAZ A;  4PUR A;  2IIY A;  1OVN A;  1AUC A;  3R2Q A;  5ENU A;  1AQW A;  3IXR A;  2L6D A;  5J9B A;  4BVX A;  5HR2 A;  2PPT A;  1KNG A;  9GSS A;  4I2T A;  4BVX B;  2OAD A;  3Q19 A;  2E7P A;  3FK8 A;  4L5L A;  3TGZ A;  2TRC P;  1K0B A;  4MP4 A;  1EOH A;  3ZVJ A;  4NWY A;  2R4V A;  4TKY A;  3CSI A;  4ZB6 A;  2C0D A;  1R7H A;  2GGT A;  5CNW A;  1PL2 A;  3TJF A;  8GSS A;  2C80 A;  2H72 A;  1THX A;  1H75 A;  2CX3 A;  2J9H A;  4FIW A;  5HFI A;  4O5U A;  2FUG 2;  2AHE A;  2H75 A;  2H01 A;  3VLN A;  3LSZ A;  5KN3 A;  5JWQ B;  4IQ1 A;  1WIK A;  2NDO A;  1V57 A;  2MZC A;  2L59 A;  2L5O A;  2R5G A;  2TRX A;  4TXV A;  3P7X A;  1U87 A;  1BX9 A;  4D73 B;  3W6G A;  4QQ7 A;  5HQP A;  4GRF A;  2C3T A;  4GTU A;  5C00 A;  4V1A p;  6GSS A;  2RLI A;  2JU5 A;  4OO5 A;  1V40 A;  2F8F A;  5G1L A;  3ZRE A;  4G2E A;  4MCU A;  4HJM A;  5EPF A;  5GZZ B;  4DSQ A;  2VCX A;  5A4U A;  2N5A A;  3ZZX A;  5IO0 A;  3HCZ A;  2H6Y A;  2AV4 A;  1ZYP A;  3M1G A;  4GLT A;  5ID2 A;  3VWX A;  1GUH A;  2KOK A;  3GIX A;  2GST A;  2P31 A;  6GST A;  4K2X A;  3FZ5 A;  5J5N A;  1Z9H A;  3F3Q A;  2PGT A;  2C3Q A;  2R0C A;  5CYY A;  2M80 A;  2NBS A;  4GST A;  2WS2 A;  4Z2R A;  2LQO A;  3D0Z A;  2DJJ A;  2GQM A;  5GAP D;  2FY6 A;  5CRG A;  2FWE A;  2FGX A;  2E2G A;  4EKZ A;  4ZL9 A;  1SL0 B;  1EWX A;  4IHU A;  2R6K A;  1PA3 A;  3WT2 A;  4G10 A;  5DVB A;  3EIN A;  2KP2 A;  16GS A;  4O5Q A;  3KJY A;  2DJ0 A;  2JSZ A;  2GSQ A;  1MDK A;  5COH A;  3HZ8 A;  3Q74 A;  2H74 A;  2NVL A;  3HJP A;  1FB0 A;  3EU4 A;  1PL1 A;  3ZMK A;  1FAA A;  4KSM A;  4WBJ A;  2OAC A;  4JZQ A;  1ST9 A;  4ML1 A;  1T00 A;  3GUS A;  2LV3 A;  5GST A;  1U88 A;  2CZ3 A;  4LMV A;  4XS4 B;  5ECL B;  2I9H A;  2B7K A;  1THO A;  1SK2 A;  1B9Y C;  4OFN A;  3KD0 A;  1AC1 A;  3KTL A;  2HZE A;  4IN0 A;  3M9K A;  3VPQ A;  5LCZ A;  2FWH A;  2OE0 A;  1LJR A;  3IA1 A;  1V58 A;  1IYH A;  5E4W A;  2CAI A;  1FOV A;  2R0G A;  1B8X A;  1HNB A;  5KOX A;  4GQC A;  5A5K A;  1W4V A;  2H0G A;  5G1K A;  2AYT A;  3ZRD A;  1EGO A;  1XZO A;  4IBP A;  1GWC A;  1WMJ A;  2WGR A;  1OE7 A;  2YP6 A;  1TU7 A;  2OE3 A;  4WR5 A;  2OJL A;  1QK8 A;  1GTU A;  3WGX A;  5DAK A;  6GSW A;  4P3Y B;  3VK9 A;  4DSS A;  4X43 A;  2VLV A;  3KEB A;  1EEM A;  4PTS A;  3KIJ A;  3TCO A;  4EDY A;  1X5D A;  3IAS 2;  3FEU A;  2MBT A;  4HZ2 A;  4YKF A;  4Q5R A;  1SJI A;  3GSS A;  1GUM A;  1XBS A;  1G6W A;  3IOS A;  3ZFL A;  4YAP A;  4EIQ A;  2YZH A;  1M99 A;  4MJC A;  3O6T A;  3LXZ A;  1G7E A;  3EPT A;  3IC8 A;  5JCW A;  3QMX A;  1ON4 A;  2CQ9 A;  5HR0 A;  2HSH A;  5KOW A;  3IPZ A;  1FB6 A;  5DJL A;  1SKS B;  3M8N A;  4K1F A;  1Y25 A;  1ZCP A;  1OKD A;  1TW9 A;  4IW9 A;  6GSX A;  1GLQ A;  3L0H A;  1ML6 A;  3AY8 A;  2TIR A;  3ERG A;  4PGT A;  2H19 A;  4RI6 A;  2GDR A;  2LJK A;  1JZD A;  3GNJ A;  3QPM A;  2L57 A;  2IMD A;  5KN0 A;  2GT6 A;  5HR3 A;  4OCF A;  1X5C A;  4K7N A;  3UAR A;  1HD2 A;  1WE0 A;  4GCI A;  3FZ9 A;  1QQ2 A;  5B6N A;  1ILO A;  2XPE A;  4RI7 A;  4V2N A;  2FWG A;  2LRC A;  4ID0 A;  5J4U A;  2HRF A;  1GSQ A;  3CQF A;  4F9Z A;  2IMI A;  1HNC A;  4J56 E;  2DIZ A;  3H93 A;  3ED3 A;  3NIV A;  4MJA A;  4CW9 A;  4ZB9 A;  1O7U A;  1JFU A;  4KB3 A;  4WR4 A;  2CAQ A;  2HLS A;  2IJY A;  3ERW A;  1K0O A;  5JWR B;  5JWO B;  3N5O A;  4EC0 A;  4WET A;  2O89 A;  3LYP A;  3GL5 A;  2C8U A;  3RHB A;  1XIY A;  3ME7 A;  3BCI A;  4TOP A;  1C72 A;  5ECH B;  1A2J A;  1M2D A;  2Z9S A;  4EF0 A;  1X0R A;  3TKQ A;  5BMU A;  3F4S A;  5G2Z A;  3FHK A;  11GS A;  1QFN A;  1B4P A;  1FHE A;  1PFO A;  1CQH A;  4I8B A;  2VL2 C;  4N30 A;  1R5P A;  4TR1 A;  3UBL A;  3LJR A;  4F2I A;  2BJX A;  4TR1 B;  1BJX A;  1PMT A;  2K9F A;  5B8A A;  2EIR A;  3GX0 A;  3LWA A;  3C7M A;  3CRT A;  5IOX A;  4HQZ A;  2C4J A;  3NZN A;  4I5Q A;  1AQV A;  4TR3 A;  5JCG A;  1TI1 A;  3HJO A;  5IPG A;  3KP8 A;  4G19 A;  3BD2 A;  5FWG A;  4X1U A;  2HYX A;  5B8B A;  4KDU A;  4JRR A;  4EVM A;  5CRW A;  1GSF A;  1T3B A;  5IMZ A;  4EUY A;  4MF6 A;  5INY A;  4XIH A;  3ZIJ A;  1A24 A;  4J2F A;  1UVZ A;  1TJD A;  2B5X A;  4BPY A;  3Q18 A;  4L0U A;  1QXH A;  3TUE A;  1OKT A;  5HFK A;  1DE2 A;  5J41 A;  2P5R A;  5G31 A;  5CRD A;  5IMV A;  1MDJ A;  1URM A;  4GQF A;  4OWY A;  1SYR A;  3UOM A;  2E0Q A;  4BWQ A;  1EV4 A;  3GA4 A;  2IMF A;  5DCG A;  2LTK A;  1ZOF A;  2I4A A;  1PSQ A;  2RII A;  5CP1 A;  1JZR A;  3G7J A;  2GZY A;  4MA9 A;  4LMW A;  3N9J A;  3ZLP A;  2OKA A;  2YWM A;  4ZL8 A;  3DRN A;  2HT9 A;  5D9V A;  3IBH A;  3PR8 A;  2CV4 A;  1OAZ A;  1S3A A;  2F51 A;  2IFQ B;  4TR4 A;  4TN8 A;  1QGV A;  4IQA A;  3JCM L;  1A2M A;  3DVX A;  22GS A;  19GS A;  4XS6 A;  5DBQ A;  1EGR A;  2XC2 A;  5GSS A;  2HZF A;  1RK4 A;  5F07 A;  3MYD A;  3US3 A;  3G7Y A;  3APQ A;  3GTU B;  2BTO T;  4KF9 A;  4HEA 2;  3E0U A;  1ZGN A;  2VOC A;  3VI7 A;  2QGV A;  4RQR A;  1Z7P A;  2VCT A;  4GWR A;  4X4J A;  2A2R A;  1A8L A;  2X99 A;  1TOF A;  3K8N A;  2OE1 A;  4AJ7 A;  2LUS A;  4FO5 A;  3UL3 A;  1HQO A;  3TOU A;  3S9F A;  3M0F A;  3TB2 A;  3QAW A;  3L9U A;  2VM2 A;  1B48 A;  1B9X C;  4IS0 A;  1FVK A;  4MMM A;  1GUK A;  1YKA A;  3I43 A;  4GSN A;  4HJ2 A;  5D8I A;  3LFL A;  3DYR A;  1A0F A;  4LA1 A;  3E9J B;  2VL2 A;  3G9B A;  4CHS A;  3FW2 A;  5F8B A;  2MMZ A;  4K5S A;  2VUP A;  4NMU A;  3QCP A;  1HNA A;  2MMO A;  1PRX A;  2HRA A;  4WBR D;  3TOT A;  1LU4 A;  2VO4 A;  1R5A A;  3F6D A;  4KX4 A;  2WFC A;  2O7K A;  1S3D A;  2QSI A;  5EVO A;  1SK0 A;  1PN0 A;  4CY8 A;  1EP7 A;  2YPM A;  4IKH A;  1K3L A;  1MD3 A;  4Z2U A;  3FZ4 A;  4G0L A;  4DEJ A;  4MF5 A;  1GRX A;  6GSU A;  3QDN A;  4CDO A;  2WZ9 A;  12GS A;  1AIU A;  2XBI A;  3F9U A;  3WGE A;  3TJK A;  1X9M B;  2VL3 A;  3O76 A;  5ID2 B;  3PPU A;  1F3A A;  1Y6E A;  3F3R A;  4ZB8 A;  2EIQ A;  5BRT A;  2C1Y A;  1YF1 A;  2LRN A;  2LJR A;  3MWH A;  3ZTL A;  3IV4 A;  2GSR A;  3QFB C;  1TK8 B;  2FA8 A;  1RW1 A;  4MH2 A;  1DSB A;  5B7C A;  2X8C A;  4DVC A;  5ELG A;  3HKR A;  1VF2 A;  5ECI B;  2P5Q A;  1XWK A;  17GS A;  1X9S B;  1O8X A;  4IJI A;  4KDX A;  3CSJ A;  4KND A;  2K6V A;  2DJ3 A;  4YH2 A;  1ZYN A;  1TRU A;  4Q5Q A;  3DVW A;  4ECI A;  4JR6 A;  5IMD A;  2B1K A;  5DJM A;  4ML6 A;  3E3E A;  4ZBD A;  3UVH A;  2RUF A;  2HNL A;  2VAF A;  5L71 A;  3FMW A;  2HSM A;  3D21 A;  10GS A;  1MTC A;  2N5F A;  4ZXG A;  1TK0 B;  2NTO A;  2G2Q A;  3HXS A;  1BED A;  4MJB A;  1XWA A;  2GVP A;  4KCE A;  1PKW A;  1T4Y A;  3G7I A;  2L6C A;  1K0D A;  5KN2 A;  1Z7R A;  2H1D A;  4PX1 A;  3TRP A;  2H70 A;  4X0X A;  2R37 A;  4F0B A;  5J3R A;  3ERF A;  1TRS A;  4DSR A;  2HZE B;  4I97 A;  3VFI A;  5DQY A;  4OD7 A;  4LL1 B;  3EU3 A;  5ECM B;  4QL9 A;  1GL8 A;  4AJ6 A;  1M9B A;  5FHI A;  2L4C A;  1J08 A;  2CT6 A;  2IWT A;  5ECN B;  3EMP A;  1GNW A;  2DSA A;  1GP1 A;  1EOG A;  1TP9 A;  1WWJ A;  3ME8 A;  3HYP A;  2RUE A;  1ZZY A;  3KCM A;  2B6M A;  2B3S A;  2YAN A;  3GMF A;  3L9V A;  2GQK A;  3HA9 A;  2FLS A;  4PUA A;  3ZIT A;  4XCS A;  1XVQ A;  5DAK B;  3IAM 2;  4DSS B;  2RM6 A;  4USS A;  3I9V 2;  4IP6 A;  5CO3 A;  1M7T A;  4LLR A;  2DJK A;  4BL7 A;  2LEG A;  5KN1 A;  3RPN A;  2JSY A;  5ABR A;  1TKD B;  2R2J A;  3TKS E;  1KTE A;  5JCU A;  3VWU A;  3HZ4 A;  4ILF A;  4H86 A;  3LG6 A;  5GAN D;  4ECB A;  3HVV A;  2H1B A;  2HSY A;  2PVQ A;  5DCH A;  1XW9 A;  4K8M A;  3H1N A;  2OBK A;  2MBS A;  4OCE A;  3IR4 A;  3OR5 A;  3HJM A;  1ERU A;  5D73 A;  1S3C A;  4O7H A;  1M3I A;  2YWO A;  4MPG A;  1WPI A;  1AQX A;  5AIV A;  4V1A g;  1SD8 A;  1SJZ A;  4JED A;  3LEF A;  1K0C A;  2IMK A;  5DAL A;  1U3I A;  4MH3 A;  2YV7 A;  5DAL B;  5HR1 A;  5H5Q A;  3A2W A;  3KH9 A;  2CA8 A;  2WRT A;  1XXU A;  3EE2 A;  4N0V A;  2B1L A;  1M0U A;  1F6M C;  1XPV A;  2M72 A;  3IDV A;  3UEM A;  2H66 A;  3VWV A;  4IP1 A;  3ZYW A;  2HRK A;  3KH7 A;  1QMV A;  2B7J A;  3M3M A;  4KAE A;  1HYU A;  3H4K A;  1TU8 A;  2PMT A;  3VUR A;  3QOU A;  3F4T A;  3QAG A;  1XWC A;  2K18 A;  1UC7 A;  4BIK A;  3KP9 A;  3TJJ A;  2PBJ A;  3D4M A;  3IHQ A;  1GLP A;  1WJK A;  4XHM A;  4YQV A;  1TXX A;  2REM A;  3W8J A;  3LOR A;  2LJA A;  13GS A;  3EVI A;  2ALB A;  1O73 A;  1UA5 A;  1YEP A;  2V1M A;  1ERV A;  2DLX A;  1K0M A;  2VCQ A;  1GSY A;  2FWF A;  3IHG A;  2NPB A;  1N2A A;  3TJG A;  2VD1 A;  1BG5 A;  1A0R P;  1NHY A;  3MSZ A;  4K6X A;  2H0H A;  3KGK A;  3Q6O A;  2I3Y A;  2KUC A;  2I81 A;  2H73 A;  3FR9 A;  1NM3 A;  2OBI A;  2O87 A;  2KP1 A;  4K5R A;  4FYU A;  2YJ7 A;  2N5B A;  3CTF A;  4ZBB A;  2DBC A;  4YKG A;  3HDC A;  4MF7 A;  3RAZ A;  2A2S A;  2IME A;  3TDG A;  2WDU A;  2WJU A;  2X4A A;  4JE1 A;  1WP0 A;  3D22 A;  1JLW A;  1SJ6 A;  3GST A;  3HVX A;  3GX8 A;  4BVY A;  2QKE A;  4KA0 A;  3UMA A;  5IIZ A;  4BWS A;  5A4W A;  3LXT A;  3A2V A;  1T8E B;  2VD0 A;  1ZMA A;  3DWV A;  1E2Y A;  2FD3 A;  5AGY A;  2F8A A;  3KM6 A;  5ECK B;  1DE1 A;  3R3E A;  3EUR A;  4Z7X A;  3VI5 A;  4MJE A;  5AIS A;  4XTS A;  1T4Z A;  2YCD A;  3UIW A;  1GSD A;  1LBK A;  1SL2 B;  2PVO C;  2M46 A;  3WGD A;  3DEX A;  1CQG A;  2C0F A;  4EE0 A;  4RQX A;  3CYN A;  3LGC A;  4TXO A;  4HSC X;  4NHW A;  4NPB A;  4TXO B;  1XFL A;  2B5Y A;  2C0G A;  3UAP A;  2X49 A;  4V2M A;  1TTZ A;  3RDW A;  1OC9 A;  4Q5F A;  4Z2T A;  4GXZ A;  2G0F A;  4OFT A;  1OC9 B;  5IMC A;  5LNK e;  1O81 A;  2EC4 A;  1K0N A;  3GN3 A;  2RM5 A;  5CRH A;  2A4H A;  3NOF A;  1SKW B;  2YV9 A;  4TRX A;  2X8H A;  3D5J A;  4K7I A;  3UJ1 A;  3VWW A;  3TKR A;  2MMN A;  2X64 A;  5AIX A;  4POB A;  2CZ2 A;  2VLU A;  5EY6 A;  2F9S A;  2FA4 A;  1FOH A;  2DML A;  2H71 A;  1J9B A;  1QUW A;  2V2G A;  2XPD A;  3APO A;  5FT3 A;  3F63 A;  2JZR A;  3QAV A;  2ON7 A;  4TR0 A;  1BYE A;  1PQN A;  1Z3E A;  2JAD A;  3KZQ A;  2DJ2 A;  4MDC A;  1NHO A;  3GH9 A;  2VCZ A;  2YWI A;  5D96 A;  2EIO A;  1A2L A;  4JBB A;  1SK1 A;  4K9Z A;  3ZFB A;  1G0T A;  5IPH A;  5C04 A;  4NXI A;  1ACV A;  4HZ4 A;  4FH8 A;  3MIX A;  3PIN A;  4G9H A;  4YQM A;  4K0N A;  1O85 A;  3GV1 A;  4XS1 A; 
#chains in the Genus database with same CATH homology
 4HU9 A;  3DXB A;  1I9D A;  1XW5 A;  3WT1 A;  4POK A;  3H79 A;  2AJQ B;  1EZK A;  1E6B A;  1G7O A;  1BQ7 A;  2PER A;  2C0E A;  3SBC A;  5A4V A;  1PGT A;  4E8H A;  6GSY A;  4EIP A;  2HXK A;  3KXO A;  5G5E A;  3L78 A;  3A5W A;  2P0G A;  2L5L A;  1F37 A;  3J7Y k;  4NAX A;  3MDK A;  4IEL A;  1Z6M A;  5HFG A;  4AJ8 A;  2H1G A;  4ZBA A;  3VPT A;  2GSS A;  2JAC A;  1SU9 A;  3HVS A;  4HU7 A;  1AW9 A;  6GSV A;  2DMM A;  3FYG A;  2H8L A;  2D2Z A;  2LQQ A;  2ZCT A;  3BBY A;  2V41 A;  4MZW A;  1OYJ A;  4NV2 A;  1TI3 A;  2FCH A;  4L8E A;  3APS A;  1JLV A;  4D73 A;  2O85 A;  5IM9 A;  5E59 A;  2QA2 A;  3SWL A;  3DD3 A;  4PQ1 A;  4N10 A;  1USB A;  4XRD A;  3CXG A;  3QR6 A;  1VF1 A;  2PN8 A;  5AN1 A;  1PKZ A;  2H6Z A;  3CTG A;  3GL3 A;  4KCA A;  3QD9 A;  3L4N A;  4PXO A;  4ULX A;  3GHA A;  3I69 A;  4A5P A;  2VLT A;  2YOI A;  1XOB A;  3P8W A;  4HOJ A;  2PU9 C;  2BMX A;  4XRA A;  4F82 A;  5F06 A;  3D4T A;  3IK7 A;  3J7Y b;  4TVE A;  3DIE A;  2K8S A;  1N8J A;  1ZL9 A;  1RQM A;  4MZC A;  2GZP A;  1TRW A;  3F6F A;  5ECR B;  2FHE A;  1IYI A;  1UN2 A;  5ECS A;  1FVJ A;  1OC8 A;  2JL4 A;  3GKK A;  4MLY A;  2L4Q A;  1X5E A;  1GH2 A;  1PD2 1;  2ON5 A;  2CX4 A;  5G30 A;  4GSS A;  1SEN A;  4EXJ A;  3HHV A;  4KDY A;  2WB9 A;  4K7O A;  4QL7 A;  1KBN A;  5EL8 A;  1Q4J A;  1XVW A;  1EEJ A;  14GS A;  5CRE A;  1I5G A;  4L5O A;  5ECO B;  1XWG A;  1SKR B;  4ZIJ A;  3MAK A;  3KTB A;  2ZUP A;  2KHP A;  2LST A;  3KMO A;  3GKN A;  3WYW A;  1V9W A;  3U5R E;  4ICY A;  4EDZ A;  2V32 A;  4WF4 A;  2AUV A;  4KGI A;  4YQU A;  4MK3 A;  4KH7 A;  3F0I A;  1U6T A;  1XCC A;  1DUG A;  1V2A A;  2YJH A;  3CSH A;  4XS4 A;  4O5R A;  3GYK A;  1K3Y A;  1AXD A;  3ZVJ D;  2YZU A;  3GFK A;  1F3B A;  1SD9 A;  4PUF C;  5D9T A;  1K0A A;  3IK9 A;  1ZYQ B;  3IC4 A;  2YNX A;  4IVF A;  3C8E A;  2GT5 A;  4CY6 A;  2VM1 A;  1WOU A;  1KEB A;  4ECC A;  1F9M A;  2DKH A;  2IN3 A;  1T1V A;  3H8Q A;  1XOA A;  3BJ5 A;  3WD6 A;  4AF2 A;  4O92 A;  4BL7 B;  4POM A;  2PUK C;  4OO4 A;  4JU5 A;  3TKS C;  3W8S A;  2K8V A;  4F0C A;  3IE3 A;  5ECP B;  1FG4 A;  4LL4 B;  2WUL A;  2CVB A;  1J0F A;  1TDI A;  4MZB A;  4G0I A;  3CMI A;  2I1U A;  3C71 A;  2LNT A;  4OMV A;  2HFD A;  3UBK A;  4F03 A;  2VIM A;  1XWB A;  2XBQ A;  3DKS A;  2WCI A;  1Q98 A;  1Z6N A;  4NV5 A;  3BCK A;  3FZA A;  1GTA A;  3GUR A;  1GTB A;  3A5I A;  4ECJ A;  5DDL A;  2LNS A;  3TKP A;  4K0G A;  3EWL A;  1VF4 A;  3ZIV A;  5IO2 A;  4IJ3 A;  3V1W A;  4MPF A;  7GSS A;  4KUN A;  1XW6 A;  5LD0 A;  4KSO A;  3M9J A;  5G5F A;  3C73 A;  2R3X A;  3P2A A;  1ZYE A;  1GSU A;  2AAW A;  1MD4 A;  4HQS A;  1O8W A;  4BA7 A;  2O8V B;  1NW2 A;  4JR4 A;  3L9S A;  2VL9 A;  2JZT A;  3IRA A;  3C1R A;  2B5E A;  2DC5 A;  5D9W A;  4HS1 A;  3ISO A;  3LQ7 A;  2GZZ A;  3ZL5 A;  1TK5 B;  2XHF A;  1VGL A;  5DQS A;  1G6Y A;  1VRS D;  3GKM A;  4E8E A;  3FR3 A;  3MNG A;  1JZW A;  3GH6 A;  1GSS A;  1F2E A;  3BOA A;  3EC3 A;  3D6I A;  2LKU A;  2IPA A;  4EO3 A;  1TRV A;  1JZO A;  2V6O A;  2ZNM A;  1EV9 A;  2GLR A;  1PN9 A;  4N0Z A;  3U6V A;  4J57 E;  3PGT A;  4KW6 A;  3FR6 A;  1GTI A;  2J23 A;  1FO5 A;  3FY7 A;  1M9A A;  2V6K A;  1YJ6 A;  4Q5N A;  2ES7 A;  3RBT A;  1ABA A;  3C1S A;  2DIY A;  3TRQ A;  2H76 A;  4FYB A;  3HY2 A;  2LS5 A;  4HDE A;  4OFM A;  20GS A;  2FNO A;  2DKI A;  3DGQ A;  4PQI A;  4PNG A;  4WXT A;  1U3A A;  4I2U A;  2AB6 A;  2F3M A;  4YAV A;  1ERT A;  4ACS A;  2CVK A;  3FKF A;  1M2B A;  5IOW A;  4POL A;  5KEJ A;  4MAB A;  4MNN A;  1GNE A;  3FRC A;  2H6X A;  1JHB A;  4RUV A;  5H5S A;  2H0I A;  3F8U A;  1FW1 A;  3P90 A;  2CVD A;  1O6J A;  4BVY B;  2HRN A;  4WKW A;  2MYG A;  4HI7 A;  2DJ1 A;  5ECQ B;  1Z5Y E;  2GS3 A;  1V98 A;  1YY7 A;  2H30 A;  5H5R A;  4IGJ A;  1YF0 A;  5ELA A;  3A3T A;  4WF5 A;  2KLX A;  1A8Y A;  4KE3 A;  1A23 A;  3QFA C;  1H4O A;  5J9C A;  1M2A A;  5IQY A;  2H1A A;  3LYK A;  2VCW A;  2A4V A;  2QA1 A;  4NHZ A;  2GQL A;  2YWN A;  1DBY A;  4O32 A;  2C3N A;  2YN1 A;  2E2M A;  1PX7 A;  3LW9 A;  5D93 A;  4K2D A;  5CAX A;  1YZX A;  3TKS A;  1BAY A;  3HD5 A;  4ZL7 A;  1YQ1 A;  2X8G A;  3CRU A;  3F4R A;  4TW5 A;  4WEY A;  1MDI A;  3O3T A;  1YDK A;  3GKX A;  3TJB A;  4V2L A;  5D9X A;  1SYX A;  5IMA A;  2OA7 A;  4HUA A;  4L0W A;  3DML A;  3PH9 A;  2VCV A;  2IL3 A;  5IMF A;  4FQU A;  2A2P A;  2GTU A;  3KMN A;  4PNF A;  1VF3 A;  1WRY A;  3TRX A;  3EMX A;  5B6M A;  3CBU A;  3A2X A;  4FYC A;  3RPP A;  1NSW A;  1ERW A;  2LRT A;  3ZML A;  2JZS A;  3EYT A;  1W89 A;  2UZ8 A;  1T7P B;  1B4Q A;  2QC7 A;  4ISD A;  5F0G A;  2IFQ A;  1EP8 A;  3UVT A;  1SL1 B;  5F05 A;  4G0K A;  1GSE A;  2HE3 A;  2R0P A;  1YKC A;  4ZIL A;  4PQH A;  2HI7 A;  4AGS A;  1X9W B;  1YEX A;  1OE8 A;  18GS A;  3GRX A;  1R26 A;  4EL1 A;  4N11 A;  1K3O A;  1R4W A;  3RHC A;  1PX6 A;  1GUL A;  3GTU A;  1OC3 A;  3I6A A;  4GF0 A;  2PWJ A;  2MMA A;  1MEK A;  4I6X A;  1AAZ A;  4PUR A;  2IIY A;  1OVN A;  1AUC A;  3R2Q A;  5ENU A;  1AQW A;  3IXR A;  2L6D A;  5J9B A;  4BVX A;  5HR2 A;  2PPT A;  1KNG A;  9GSS A;  4I2T A;  4BVX B;  2OAD A;  3Q19 A;  2E7P A;  3FK8 A;  4L5L A;  3TGZ A;  2TRC P;  1K0B A;  4MP4 A;  1EOH A;  3ZVJ A;  4NWY A;  2R4V A;  4TKY A;  3CSI A;  4ZB6 A;  2C0D A;  1R7H A;  2GGT A;  5CNW A;  1PL2 A;  3TJF A;  8GSS A;  2C80 A;  2H72 A;  1THX A;  1H75 A;  2CX3 A;  2J9H A;  4FIW A;  5HFI A;  4O5U A;  2FUG 2;  2AHE A;  2H75 A;  2H01 A;  3VLN A;  3LSZ A;  5KN3 A;  5JWQ B;  4IQ1 A;  1WIK A;  2NDO A;  1V57 A;  2MZC A;  2L59 A;  2L5O A;  2R5G A;  2TRX A;  4TXV A;  3P7X A;  1U87 A;  1BX9 A;  4D73 B;  3W6G A;  4QQ7 A;  5HQP A;  4GRF A;  2C3T A;  4GTU A;  5C00 A;  4V1A p;  6GSS A;  2RLI A;  2JU5 A;  4OO5 A;  1V40 A;  2F8F A;  5G1L A;  3ZRE A;  4G2E A;  4MCU A;  4HJM A;  5EPF A;  5GZZ B;  4DSQ A;  2VCX A;  5A4U A;  2N5A A;  3ZZX A;  5IO0 A;  3HCZ A;  2H6Y A;  2AV4 A;  1ZYP A;  3M1G A;  4GLT A;  5ID2 A;  3VWX A;  1GUH A;  2KOK A;  3GIX A;  2GST A;  2P31 A;  6GST A;  4K2X A;  3FZ5 A;  5J5N A;  1Z9H A;  3F3Q A;  2PGT A;  2C3Q A;  2R0C A;  5CYY A;  2M80 A;  2NBS A;  4GST A;  2WS2 A;  4Z2R A;  2LQO A;  3D0Z A;  2DJJ A;  2GQM A;  5GAP D;  2FY6 A;  5CRG A;  2FWE A;  2FGX A;  2E2G A;  4EKZ A;  4ZL9 A;  1SL0 B;  1EWX A;  4IHU A;  2R6K A;  1PA3 A;  3WT2 A;  4G10 A;  5DVB A;  3EIN A;  2KP2 A;  16GS A;  4O5Q A;  3KJY A;  2DJ0 A;  2JSZ A;  2GSQ A;  1MDK A;  5COH A;  3HZ8 A;  3Q74 A;  2H74 A;  2NVL A;  3HJP A;  1FB0 A;  3EU4 A;  1PL1 A;  3ZMK A;  1FAA A;  4KSM A;  4WBJ A;  2OAC A;  4JZQ A;  1ST9 A;  4ML1 A;  1T00 A;  3GUS A;  2LV3 A;  5GST A;  1U88 A;  2CZ3 A;  4LMV A;  4XS4 B;  5ECL B;  2I9H A;  2B7K A;  1THO A;  1SK2 A;  1B9Y C;  4OFN A;  3KD0 A;  1AC1 A;  3KTL A;  2HZE A;  4IN0 A;  3M9K A;  3VPQ A;  5LCZ A;  2FWH A;  2OE0 A;  1LJR A;  3IA1 A;  1V58 A;  1IYH A;  5E4W A;  2CAI A;  1FOV A;  2R0G A;  1B8X A;  1HNB A;  5KOX A;  4GQC A;  5A5K A;  1W4V A;  2H0G A;  5G1K A;  2AYT A;  3ZRD A;  1EGO A;  1XZO A;  4IBP A;  1GWC A;  1WMJ A;  2WGR A;  1OE7 A;  2YP6 A;  1TU7 A;  2OE3 A;  4WR5 A;  2OJL A;  1QK8 A;  1GTU A;  3WGX A;  5DAK A;  6GSW A;  4P3Y B;  3VK9 A;  4DSS A;  4X43 A;  2VLV A;  3KEB A;  1EEM A;  4PTS A;  3KIJ A;  3TCO A;  4EDY A;  1X5D A;  3IAS 2;  3FEU A;  2MBT A;  4HZ2 A;  4YKF A;  4Q5R A;  1SJI A;  3GSS A;  1GUM A;  1XBS A;  1G6W A;  3IOS A;  3ZFL A;  4YAP A;  4EIQ A;  2YZH A;  1M99 A;  4MJC A;  3O6T A;  3LXZ A;  1G7E A;  3EPT A;  3IC8 A;  5JCW A;  3QMX A;  1ON4 A;  2CQ9 A;  5HR0 A;  2HSH A;  5KOW A;  3IPZ A;  1FB6 A;  5DJL A;  1SKS B;  3M8N A;  4K1F A;  1Y25 A;  1ZCP A;  1OKD A;  1TW9 A;  4IW9 A;  6GSX A;  1GLQ A;  3L0H A;  1ML6 A;  3AY8 A;  2TIR A;  3ERG A;  4PGT A;  2H19 A;  4RI6 A;  2GDR A;  2LJK A;  1JZD A;  3GNJ A;  3QPM A;  2L57 A;  2IMD A;  5KN0 A;  2GT6 A;  5HR3 A;  4OCF A;  1X5C A;  4K7N A;  3UAR A;  1HD2 A;  1WE0 A;  4GCI A;  3FZ9 A;  1QQ2 A;  5B6N A;  1ILO A;  2XPE A;  4RI7 A;  4V2N A;  2FWG A;  2LRC A;  4ID0 A;  5J4U A;  2HRF A;  1GSQ A;  4F9Z A;  2IMI A;  1HNC A;  4J56 E;  2DIZ A;  3H93 A;  3ED3 A;  3NIV A;  4MJA A;  4CW9 A;  4ZB9 A;  1O7U A;  1JFU A;  4KB3 A;  4WR4 A;  2CAQ A;  2HLS A;  2IJY A;  3ERW A;  1K0O A;  5JWR B;  5JWO B;  3N5O A;  4EC0 A;  4WET A;  2O89 A;  3LYP A;  3GL5 A;  2C8U A;  3RHB A;  1XIY A;  3ME7 A;  3BCI A;  4TOP A;  1C72 A;  5ECH B;  1A2J A;  1M2D A;  2Z9S A;  4EF0 A;  1X0R A;  3TKQ A;  5BMU A;  3F4S A;  5G2Z A;  3FHK A;  11GS A;  1QFN A;  1B4P A;  1FHE A;  1CQH A;  4I8B A;  2VL2 C;  4N30 A;  1R5P A;  4TR1 A;  3UBL A;  3LJR A;  4F2I A;  2BJX A;  4TR1 B;  1BJX A;  1PMT A;  2K9F A;  5B8A A;  2EIR A;  3GX0 A;  3LWA A;  3C7M A;  3CRT A;  5IOX A;  4HQZ A;  2C4J A;  3NZN A;  4I5Q A;  1AQV A;  4TR3 A;  5JCG A;  1TI1 A;  3HJO A;  5IPG A;  3KP8 A;  4G19 A;  3BD2 A;  5FWG A;  4X1U A;  2HYX A;  5B8B A;  4KDU A;  4JRR A;  4EVM A;  5CRW A;  1GSF A;  1T3B A;  5IMZ A;  4EUY A;  4MF6 A;  5INY A;  4XIH A;  3ZIJ A;  1A24 A;  4J2F A;  1UVZ A;  1TJD A;  2B5X A;  4BPY A;  3Q18 A;  4L0U A;  1QXH A;  3TUE A;  1OKT A;  5HFK A;  1DE2 A;  5J41 A;  2P5R A;  5G31 A;  5CRD A;  5IMV A;  1MDJ A;  1URM A;  4GQF A;  4OWY A;  1SYR A;  3UOM A;  2E0Q A;  4BWQ A;  1EV4 A;  3GA4 A;  2IMF A;  5DCG A;  2LTK A;  1ZOF A;  2I4A A;  1PSQ A;  2RII A;  5CP1 A;  1JZR A;  3G7J A;  2GZY A;  4MA9 A;  4LMW A;  3N9J A;  3ZLP A;  2OKA A;  2YWM A;  4ZL8 A;  3DRN A;  2HT9 A;  5D9V A;  3IBH A;  3PR8 A;  2CV4 A;  1OAZ A;  1S3A A;  2F51 A;  2IFQ B;  4TR4 A;  4TN8 A;  1QGV A;  4IQA A;  3JCM L;  1A2M A;  3DVX A;  22GS A;  19GS A;  4XS6 A;  5DBQ A;  1EGR A;  2XC2 A;  5GSS A;  2HZF A;  1RK4 A;  5F07 A;  3MYD A;  3US3 A;  3G7Y A;  3APQ A;  3GTU B;  2BTO T;  4KF9 A;  4HEA 2;  3E0U A;  1ZGN A;  2VOC A;  3VI7 A;  2QGV A;  4RQR A;  1Z7P A;  2VCT A;  4GWR A;  4X4J A;  2A2R A;  1A8L A;  2X99 A;  1TOF A;  3K8N A;  2OE1 A;  4AJ7 A;  2LUS A;  4FO5 A;  3UL3 A;  1HQO A;  3TOU A;  3S9F A;  3M0F A;  3TB2 A;  3QAW A;  3L9U A;  2VM2 A;  1B48 A;  1B9X C;  4IS0 A;  1FVK A;  4MMM A;  1GUK A;  1YKA A;  3I43 A;  4GSN A;  4HJ2 A;  5D8I A;  3LFL A;  3DYR A;  1A0F A;  4LA1 A;  3E9J B;  2VL2 A;  3G9B A;  4CHS A;  3FW2 A;  5F8B A;  2MMZ A;  4K5S A;  2VUP A;  4NMU A;  3QCP A;  1HNA A;  2MMO A;  1PRX A;  2HRA A;  4WBR D;  3TOT A;  1LU4 A;  2VO4 A;  1R5A A;  3F6D A;  4KX4 A;  2WFC A;  2O7K A;  1S3D A;  2QSI A;  5EVO A;  1SK0 A;  1PN0 A;  4CY8 A;  1EP7 A;  2YPM A;  4IKH A;  1K3L A;  1MD3 A;  4Z2U A;  3FZ4 A;  4G0L A;  4DEJ A;  4MF5 A;  1GRX A;  6GSU A;  3QDN A;  4CDO A;  2WZ9 A;  12GS A;  1AIU A;  2XBI A;  3F9U A;  3WGE A;  3TJK A;  1X9M B;  2VL3 A;  3O76 A;  5ID2 B;  3PPU A;  1F3A A;  1Y6E A;  3F3R A;  4ZB8 A;  2EIQ A;  5BRT A;  2C1Y A;  1YF1 A;  2LRN A;  2LJR A;  3MWH A;  3ZTL A;  3IV4 A;  2GSR A;  3QFB C;  1TK8 B;  2FA8 A;  1RW1 A;  4MH2 A;  1DSB A;  5B7C A;  2X8C A;  4DVC A;  5ELG A;  3HKR A;  1VF2 A;  5ECI B;  2P5Q A;  1XWK A;  17GS A;  1X9S B;  1O8X A;  4IJI A;  4KDX A;  3CSJ A;  4KND A;  2K6V A;  2DJ3 A;  4YH2 A;  1ZYN A;  1TRU A;  4Q5Q A;  3DVW A;  4ECI A;  4JR6 A;  5IMD A;  2B1K A;  5DJM A;  4ML6 A;  3E3E A;  4ZBD A;  3UVH A;  2RUF A;  2HNL A;  2VAF A;  5L71 A;  3FMW A;  2HSM A;  3D21 A;  10GS A;  1MTC A;  2N5F A;  4ZXG A;  1TK0 B;  2NTO A;  2G2Q A;  3HXS A;  1BED A;  4MJB A;  1XWA A;  2GVP A;  4KCE A;  1PKW A;  1T4Y A;  3G7I A;  2L6C A;  1K0D A;  5KN2 A;  1Z7R A;  2H1D A;  4PX1 A;  3TRP A;  2H70 A;  4X0X A;  2R37 A;  4F0B A;  5J3R A;  3ERF A;  1TRS A;  4DSR A;  2HZE B;  4I97 A;  3VFI A;  5DQY A;  4OD7 A;  4LL1 B;  3EU3 A;  5ECM B;  4QL9 A;  1GL8 A;  4AJ6 A;  1M9B A;  5FHI A;  2L4C A;  1J08 A;  2CT6 A;  2IWT A;  5ECN B;  3EMP A;  1GNW A;  2DSA A;  1GP1 A;  1EOG A;  1TP9 A;  1WWJ A;  3ME8 A;  3HYP A;  2RUE A;  1ZZY A;  3KCM A;  2B6M A;  2B3S A;  2YAN A;  3GMF A;  3L9V A;  2GQK A;  3HA9 A;  2FLS A;  4PUA A;  3ZIT A;  4XCS A;  1XVQ A;  5DAK B;  3IAM 2;  4DSS B;  2RM6 A;  4USS A;  3I9V 2;  4IP6 A;  5CO3 A;  1M7T A;  4LLR A;  2DJK A;  4BL7 A;  2LEG A;  5KN1 A;  3RPN A;  2JSY A;  5ABR A;  1TKD B;  2R2J A;  3TKS E;  1KTE A;  5JCU A;  3VWU A;  3HZ4 A;  4ILF A;  4H86 A;  3LG6 A;  5GAN D;  4ECB A;  3HVV A;  2H1B A;  2HSY A;  2PVQ A;  5DCH A;  1XW9 A;  4K8M A;  3H1N A;  2OBK A;  2MBS A;  4OCE A;  3IR4 A;  3OR5 A;  3HJM A;  1ERU A;  5D73 A;  1S3C A;  4O7H A;  2YWO A;  4MPG A;  1WPI A;  1AQX A;  5AIV A;  4V1A g;  1SD8 A;  1SJZ A;  4JED A;  3LEF A;  1K0C A;  2IMK A;  5DAL A;  1U3I A;  4MH3 A;  2YV7 A;  5DAL B;  5HR1 A;  5H5Q A;  3A2W A;  3KH9 A;  2CA8 A;  2WRT A;  1XXU A;  3EE2 A;  4N0V A;  2B1L A;  1M0U A;  1F6M C;  1XPV A;  2M72 A;  3IDV A;  3UEM A;  2H66 A;  3VWV A;  4IP1 A;  3ZYW A;  2HRK A;  3KH7 A;  1QMV A;  2B7J A;  3M3M A;  4KAE A;  1HYU A;  3H4K A;  1TU8 A;  2PMT A;  3VUR A;  3QOU A;  3F4T A;  3QAG A;  1XWC A;  2K18 A;  1UC7 A;  3KP9 A;  3TJJ A;  2PBJ A;  3D4M A;  3IHQ A;  1GLP A;  1WJK A;  4XHM A;  4YQV A;  1TXX A;  2REM A;  3W8J A;  3LOR A;  2LJA A;  13GS A;  3EVI A;  2ALB A;  1O73 A;  1UA5 A;  1YEP A;  2V1M A;  1ERV A;  2DLX A;  1K0M A;  2VCQ A;  1GSY A;  2FWF A;  3IHG A;  2NPB A;  1N2A A;  3TJG A;  2VD1 A;  1BG5 A;  1A0R P;  1NHY A;  3MSZ A;  4K6X A;  2H0H A;  3KGK A;  3Q6O A;  2I3Y A;  2KUC A;  2I81 A;  2H73 A;  3FR9 A;  1NM3 A;  2OBI A;  2O87 A;  2KP1 A;  4K5R A;  4FYU A;  2YJ7 A;  2N5B A;  3CTF A;  4ZBB A;  2DBC A;  4YKG A;  3HDC A;  4MF7 A;  3RAZ A;  2A2S A;  2IME A;  3TDG A;  2WDU A;  2WJU A;  2X4A A;  4JE1 A;  1WP0 A;  3D22 A;  1JLW A;  1SJ6 A;  3GST A;  3HVX A;  3GX8 A;  4BVY A;  2QKE A;  4KA0 A;  3UMA A;  5IIZ A;  4BWS A;  5A4W A;  3LXT A;  3A2V A;  1T8E B;  2VD0 A;  1ZMA A;  3DWV A;  1E2Y A;  2FD3 A;  5AGY A;  2F8A A;  3KM6 A;  5ECK B;  1DE1 A;  3R3E A;  3EUR A;  4Z7X A;  3VI5 A;  4MJE A;  5AIS A;  4XTS A;  1T4Z A;  2YCD A;  3UIW A;  1GSD A;  1LBK A;  1SL2 B;  2PVO C;  2M46 A;  3WGD A;  3DEX A;  1CQG A;  2C0F A;  4EE0 A;  4RQX A;  3CYN A;  3LGC A;  4TXO A;  4NHW A;  4NPB A;  4TXO B;  1XFL A;  2B5Y A;  2C0G A;  3UAP A;  2X49 A;  4V2M A;  1TTZ A;  3RDW A;  1OC9 A;  4Q5F A;  4Z2T A;  4GXZ A;  2G0F A;  4OFT A;  1OC9 B;  5IMC A;  5LNK e;  1O81 A;  2EC4 A;  1K0N A;  3GN3 A;  2RM5 A;  5CRH A;  2A4H A;  3NOF A;  1SKW B;  2YV9 A;  4TRX A;  2X8H A;  3D5J A;  4K7I A;  3UJ1 A;  3VWW A;  3TKR A;  2MMN A;  5AIX A;  2X64 A;  4POB A;  2CZ2 A;  2VLU A;  5EY6 A;  2F9S A;  2FA4 A;  1FOH A;  2DML A;  2H71 A;  1J9B A;  1QUW A;  2V2G A;  2XPD A;  3APO A;  5FT3 A;  3F63 A;  2JZR A;  3QAV A;  2ON7 A;  4TR0 A;  1BYE A;  1PQN A;  1Z3E A;  2JAD A;  3KZQ A;  2DJ2 A;  4MDC A;  1NHO A;  3GH9 A;  2VCZ A;  2YWI A;  5D96 A;  2EIO A;  1A2L A;  4JBB A;  1SK1 A;  4K9Z A;  3ZFB A;  1G0T A;  5IPH A;  5C04 A;  4NXI A;  1ACV A;  4HZ4 A;  4FH8 A;  3MIX A;  3PIN A;  4G9H A;  4YQM A;  4K0N A;  1O85 A;  3GV1 A;  4XS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...