3DIEA

Domain swapping of staphylococcus aureus thioredoxin w28a mutant
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
106
structure length
106
Chain Sequence
SHMAIVKVTDADFDSKVESGVQLVDFWATACGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Thioredoxin
publication title Coupling of domain swapping to kinetic stability in a thioredoxin mutant
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 22
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3dieA01
3DVXA 1XOAA 5G2ZA 2HFDA 1FB6A 2K9FA 3GH6A 1WMJA 2DJKA 4NAXA 5LCZA 2VL2C 4MZWA 3LGCA 1U6TA 4KDXA 1UN2A 3FR6A 2WDUA 3IV4A 3QD9A 5ELAA 2VCTA 5IMZA 6GSYA 3M8NA 1TU7A 5AN1A 3ZRDA 2GVPA 2OADA 5KN3A 3I6AA 3UL3A 3TRXA 2AHEA 4KW6A 3FEUA 4XS4A 2L4CA 5CREA 3TJBA 2DLXA 4O32A 1Q4JA 1J08A 1X5CA 2LNTA 1AQWA 4QL7A 2LJRA 1NHOA 4ECBA 2FWEA 2JU5A 1SJ6A 2CZ3A 2H72A 3MDKA 4BA7A 4E8HA 2R2JA 2VLVA 1WWJA 4YAPA 5A5KA 3VWVA 3AY8A 2K18A 3MWHA 1TW9A 3KP9A 3TOTA 1MD3A 3TKSA 3ERWA 3G7JA 1Z6NA 5ECSA 1SD8A 3QAWA 2VIMA 2WCIA 3GKNA 1THXA 2NTOA 1VGLA 1DE2A 4FYUA 2FNOA 1FB0A 5DQSA 4N30A 1XVWA 3P8WA 2R37A 5JWRB 1VF2A 3UARA 2B7KA 2PVOC 3GKXA 4CW9A 2EC4A 1QUWA 2KOKA 4MJAA 5CO3A 3TJFA 2EIOA 1GSUA 3HVXA 3EMPA 2GZPA 19GSA 4OMVA 1BYEA 3ZL5A 5ABRA 3IHQA 4IKHA 4BL7A 3ME7A 4WR4A 1GRXA 5FWGA 4HQZA 4XS4B 3QAVA 3WGXA 1HNCA 3DGQA 2B5XA 4I2UA 1EEJA 1GTAA 1W4VA 2CT6A 4MPGA 3TJKA 4BVXA 1XXUA 2F8AA 2ZCTA 4YQVA 12GSA 1VF4A 3QR6A 1Z3EA 1ZCPA 1YF0A 4HZ4A 1Y6EA 2H6YA 1S3CA 4ML1A 1U88A 5E59A 5B8BA 4WKWA 2IN3A 1EOGA 3A3TA 3O76A 1H4OA 4EC0A 4PGTA 4XRDA 4X43A 2XC2A 5ECHB 5IIZA 1GNEA 1GULA 1Z9HA 3A2VA 1ERVA 4FH8A 3U5RE 3JCML 2RUFA 1FAAA 3IOSA 3RHBA 3BJ5A 1LBKA 1J0FA 4OFTA 4HU7A 1V58A 5B7CA 2B1KA 1TK8B 1MD4A 2CVBA 5D9WA 2DJ1A 4F0CA 2IIYA 4OFNA 1A2LA 2L4QA 4TRXA 3EU3A 3BCKA 1V57A 2NPBA 5F8BA 4KDYA 2H19A 1EZKA 3VWUA 4WF5A 4XHMA 3MAKA 1MDKA 4G2EA 1GLPA 2B1LA 4KX4A 4WEYA 2A4VA 4ZILA 5A4UA 3K8NA 1GWCA 1O6JA 4EUYA 4OO5A 5DCGA 3TJJA 1U3AA 2HXKA 1C72A 3UJ1A 5G5EA 4TXOB 4KAEA 2KP2A 1PL2A 2F51A 2HZEA 1OC8A 1KNGA 3HZ4A 4TR1A 3HY2A 3VI5A 1BG5A 1ZOFA 3HJPA 1YF1A 3TDGA 1E2YA 4AJ6A 2C3TA 4RI6A 5EY6A 2IL3A 3EE2A 2F3MA 5KEJA 1A8LA 1TDIA 2N5AA 2LQOA 5D9VA 1SU9A 3VPQA 2XBQA 5D9TA 3APOA 3O6TA 3H8QA 2R4VA 3UMAA 2O7KA 1K3OA 2PWJA 1EGOA 1YDKA 2CVKA 1BQ7A 4OFMA 2OA7A 2V2GA 2LV3A 4F0BA 1GUHA 4PQHA 1OKDA 3DVWA 3F9UA 1SENA 2VL2A 3ERGA 4MF7A 4NHZA 1ST9A 1GSFA 2O85A 2H1DA 2H0HA 2LSTA 1PN9A 2I4AA 2NVLA 4DSQA 1M9BA 3L9SA 4L0WA 4KUNA 5J5NA 6GSUA 3CTGA 1E6BA 4HQSA 1QMVA 5GSSA 4EVMA 1WRYA 2WS2A 2M80A 2VLTA 1SK1A 4K6XA 1WOUA 5J41A 3ME8A 3IR4A 2HYXA 2YP6A 1GH2A 2HZEB 1B8XA 4TR1B 3FZ9A 3TJGA 2H74A 3C71A 2C0EA 2R6KA 5LNKe 1F3BA 5IO0A 4G19A 1PA3A 1YJ6A 3H93A 3HA9A 2I81A 4Z7XA 1GTBA 1KTEA 1M0UA 4X1UA 2GQKA 4P3YB 5ID2B 2P0GA 2LRTA 1PD21 3ZVJD 2VCQA 4JR6A 3KEBA 3RAZA 1M7TA 3HVVA 1MEKA 2TIRA 3RPPA 5AGYA 2HSHA 1X9WB 1XW6A 4V1Ag 1K3LA 3TKPA 2E7PA 2C0DA 2REMA 1T7PB 4DSSA 1JZDA 3IXRA 2IPAA 2OKAA 3HHVA 5FT3A 2H30A 2K8VA 3D6IA 2YCDA 4ZB9A 4ECJA 3IK9A 3C73A 4KNDA 1DE1A 1FHEA 4YAVA 4PQIA 2OBIA 1BJXA 3ERFA 5L71A 3VLNA 1QFNA 1K0AA 4RI7A 1SYRA 3M9JA 2GT5A 1BAYA 3H79A 2C0GA 2E2GA 3KCMA 4ZBAA 2AB6A 5IMFA 3KD0A 1MTCA 3F3QA 4FYBA 5IQYA 1TRUA 3U6VA 4X0XA 2GGTA 2FD3A 4HS1A 1AQXA 2P5QA 2MMZA 2KLXA 4POLA 3W6GA 3F0IA 3F4SA 3HXSA 4GCIA 1GL8A 3GKMA 2CAQA 4K7NA 5D96A 1K0CA 1B9XC 1YQ1A 3D0ZA 2CZ2A 2IMIA 5IPGA 3QPMA 4IP1A 2IMEA 3ED3A 1GSYA 1ABAA 1R5PA 1OC9A 3N9JA 1JZOA 4GSSA 1SL0B 2GTUA 3M3MA 2OBKA 3KJYA 3GMFA 1B9YC 2GZZA 3LEFA 4OCEA 1XOBA 2VD1A 3P7XA 4PUFC 3FKFA 4ZL7A 3UAPA 4IJ3A 1R4WA 1AQVA 6GSTA 3ZMKA 4EO3A 2BTOT 4DSSB 2L5OA 4BWQA 2A2SA 2L57A 2ON7A 2H75A 4NWYA 4ZL8A 4POKA 2I1UA 2AJQB 5ECKB 3S9FA 3F63A 2C80A 1TI1A 4IS0A 1ON4A 3F4TA 2ALBA 4MH2A 2GS3A 2HRFA 4OD7A 1EP8A 4GLTA 1F6MC 4XCSA 5ECOB 1ZZYA 4GF0A 2ZNMA 1EV9A 1HYUA 4TR3A 4F2IA 2CVDA 3O3TA 4PNGA 5JWOB 2DSAA 1O81A 1V2AA 2V41A 1TTZA 1Q98A 1SKWB 2H73A 1M2AA 5J9BA 4ZL9A 5G1LA 1G7OA 2K8SA 1A0RP 3FZ4A 4I6XA 2LTKA 2M46A 3UEMA 2PGTA 22GSA 4NMUA 1OC9B 1X5EA 3DXBA 3TGZA 3D22A 6GSXA 4K2DA 2WGRA 3CBUA 13GSA 3CRUA 4PQ1A 3VURA 3LXTA 5IO2A 4ML6A 1U87A 4WF4A 3GSTA 4ZB6A 2CAIA 4MPFA 1XCCA 1OE7A 1SKSB 1A2MA 4MZCA 4POBA 2TRCP 5CRHA 3A2WA 1CQGA 1CQHA 1M9AA 2CV4A 2KP1A 3LYKA 2PMTA 2QC7A 3TB2A 2JZSA 4MP4A 2KHPA 1ACVA 4WXTA 4IJIA 3EMXA 4TXOA 3Q19A 1K0NA 4GQFA 1XIYA 1HNAA 1JZRA 5DBQA 1RW1A 2JADA 2HNLA 4H86A 4AF2A 4V1Ap 2X64A 4WETA 3E0UA 2VCXA 2OACA 4FYCA 3QMXA 2RLIA 5HFGA 2RM5A 5EL8A 3ZYWA 1ZMAA 3HJOA 5J4UA 3ZIVA 1ZL9A 2LKUA 3GUSA 1TOFA 4Q5QA 1F9MA 3BCIA 4HI7A 3EWLA 2JL4A 2O87A 1R26A 3GNJA 1GTIA 3VWWA 4NXIA 1JFUA 1YKAA 2B5YA 1HQOA 3C1SA 3E9JB 4KCEA 4JU5A 4DEJA 2B6MA 1GP1A 1FVJA 2LNSA 4V2MA 5IM9A 5H5RA 1GUKA 3TCOA 3F6FA 4YQUA 2FUG2 2MBSA 3V1WA 5A4WA 1SJZA 3BOAA 7GSSA 2LJKA 3M1GA 5H5QA 3GURA 3F4RA 5DDLA 2YJHA 2C1YA 3WGDA 1WP0A 2FGXA 4K7OA 1VF1A 1K0MA 2PERA 2IFQA 3CSIA 1S3AA 4G10A 1YY7A 2VCZA 4MDCA 1EV4A 1MDIA 2GSQA 3FK8A 4N10A 4AGSA 1TI3A 6GSSA 2OE1A 3GRXA 1GLQA 1PX6A 2G2QA 2OE3A 4IVFA 2OE0A 3QCPA 1SK2A 4ZIJA 3IRAA 2H66A 1O8XA 2HSYA 6GSWA 4I2TA 4TN8A 2HRNA 5ID2A 4ULXA 4KB3A 5ELGA 2MMOA 5IPHA 3EU4A 3WD6A 4ISDA 3GL5A 4MABA 1XWKA 1NSWA 5DJMA 1S3DA 5F0GA 2VCWA 1TKDB 2DBCA 3BBYA 1ERTA 3TKSC 1GSQA 5DJLA 2DC5A 5IMDA 5CRDA 3KH7A 4O92A 4TW5A 2X99A 2GDRA 4ECIA 1RQMA 1QQ2A 4F82A 3P90A 2YV7A 4PURA 2YJ7A 1PKWA 4K0GA 4IBPA 1X5DA 4HDEA 5ECRB 3RDWA 4L0UA 1M2DA 4EDYA 5ENUA 1B4QA 2H70A 2N5FA 2I9HA 3VFIA 20GSA 3HD5A 3D4TA 1RK4A 3CMIA 5GZZB 4BPYA 4EE0A 1ILOA 2IFQB 3N5OA 3NZNA 3IE3A 3FR9A 3Q74A 4EKZA 4XS1A 3L9UA 4IHUA 5G31A 4HU9A 4BWSA 2LRCA 2JZTA 3F3RA 1A23A 2H6XA 5E4WA 4MJBA 3KM6A 2NBSA 5ECLB 4JEDA 1UA5A 1OC3A 4XRAA 1GNWA 2HI7A 2C0FA 2LQQA 3L4NA 1ZGNA 2JACA 4MLYA 1XFLA 2VL9A 4MF6A 4KH7A 1A2JA 2I3YA 4NV5A 5HR0A 5ECIB 4TXVA 4GRFA 1T3BA 4I8BA 1URMA 3WYWA 2JSZA 5A4VA 1Z6MA 5ECNB 2B7JA 4MMMA 2DJJA 4NHWA 3GHAA 3GTUA 3L78A 5KN1A 1QGVA 3IA1A 2WZ9A 4OO4A 3F8UA 2XBIA 3VI7A 1ERUA 3IAS2 1XZOA 16GSA 1MDJA 2H0IA 2L6CA 5CRWA 3SWLA 1K0DA 1XWCA 4HUAA 3ZZXA 3WT1A 9GSSA 2H76A 2LRNA 3KH9A 5DCHA 1HNBA 4IN0A 3M9KA 1T4ZA 1YKCA 2B3SA 4L8EA 2BJXA 18GSA 1HD2A 4KA0A 1O7UA 2YZUA 2GQLA 4GSNA 2VAFA 2L5LA 3GSSA 5JCWA 5AIXA 3KP8A 4K9ZA 1EP7A 3PINA 3MSZA 3LORA 1F2EA 1N8JA 2DJ0A 1YZXA 4MZBA 4IP6A 2F9SA 1XPVA 4IQAA 2VM1A 3G7IA 2V1MA 1IYHA 2V6OA 4MK3A 2VCVA 1O85A 2AV4A 3LQ7A 5GAPD 2MBTA 2BMXA 5CRGA 3UBKA 4NPBA 4IELA 2ES7A 2VUPA 3L9VA 4HJ2A 5IMCA 3HZ8A 4BVYA 2C3QA 1THOA 1N2AA 5H5SA 5HR2A 1Y25A 4D73A 3GIXA 3GTUB 3PH9A 3A2XA 1SJIA 1LJRA 4LLRA 1QK8A 4E8EA 4J56E 1PGTA 1XWGA 1WE0A 1EGRA 1G6YA 3IC4A 3CSHA 3J7Yb 1YEXA 1DSBA 2J23A 3NIVA 1WJKA 2P5RA 3APSA 4XTSA 4LA1A 5HFIA 5HR1A 1F37A 2Z9SA 5FHIA 1UVZA 4N0VA 5AISA 5HFKA 2O8VB 4LL1B 2IMKA 2GSRA 2YZHA 1G7EA 3HCZA 3EVIA 3FYGA 4OCFA 5D9XA 5ECQB 2HLSA 2CQ9A 4IGJA 2WJUA 2VOCA 2HT9A 4PUAA 2J9HA 3CTFA 3OR5A 1SL1B 2GQMA 1TXXA 2P31A 2C8UA 2AYTA 10GSA 3Q18A 3HDCA 4ZXGA 2H0GA 1K0OA 2EIQA 4K1FA 2WRTA 3FRCA 3FW2A 3LWAA 3KMNA 1I9DA 2YWMA 2FLSA 2YN1A 2H6ZA 4V2NA 4QL9A 3US3A 1SD9A 1TK0B 3GN3A 3UIWA 4GQCA 4YH2A 1GSSA 2DJ2A 1T00A 3Q6OA 3UOMA 2L59A 3C7MA 3LYPA 3TRPA 1SYXA 2PU9C 5CAXA 3FY7A 2OJLA 2LJAA 3I69A 1G6WA 2X8CA 1IYIA 2MYGA 2VL3A 5G30A 1W89A 4D73B 4F9ZA 5EPFA 1TRSA 4V2LA 2O89A 4KDUA 3QOUA 2E2MA 4MH3A 2FCHA 5D93A 1OVNA 4G9HA 5IOXA 4NV2A 4EXJA 2C4JA 2XPDA 2RIIA 4N11A 3KTBA 2FY6A 1X9SB 2HZFA 3GH9A 1XVQA 3EINA 4KE3A 1FW1A 1PQNA 3VWXA 1NM3A 3D5JA 4GWRA 3UVTA 2WB9A 1Z7RA 2GSTA 1J9BA 1GTUA 3NOFA 3FZ5A 3GX8A 4EDZA 2PVQA 3GA4A 4MF5A 4PXOA 1XBSA 2DIZA 2WULA 1X9MB 5JCUA 2IWTA 4EF0A 2WFCA 4HJMA 1GUMA 11GSA 2XPEA 3TRQA 3D21A 3MNGA 4L5LA 1PSQA 4IW9A 3GX0A 2KUCA 4J2FA 5J3RA 5JCGA 4XS6A 1SL2B 1TK5B 4POMA 2H1AA 5F06A 1UC7A 4WBJA 2DJ3A 2H01A 2E0QA 2CX3A 2GLRA 3LFLA 4MA9A 1TJDA 2C3NA 1AAZA 4Q5FA 1WPIA 4TR0A 3QFBC 3CSJA 3DYRA 1XW5A 5DALA 3KGKA 2YWNA 3GFKA 4OWYA 1ML6A 4LMVA 1EWXA 1TU8A 4TKYA 4O5RA 1V9WA 3IDVA 1PKZA 5DQYA 4PNFA 3TKSE 4MJEA 2R3XA 4LMWA 4F03A 2FA8A 1BX9A 4TR4A 3IAM2 3FR3A 4ZB8A 2JZRA 2B5EA 2RM6A 2GT6A 4K0NA 2MMNA 5GAND 3KTLA 3PR8A 4QQ7A 2FWHA 3D4MA 4EL1A 2QKEA 1X0RA 3R2QA 2ZUPA 4ACSA 2ON5A 4MJCA 1M99A 2DIYA 2YWOA 2QGVA 2A2RA 2H1BA 4ILFA 1SKRB 1R7HA 2FHEA 2YANA 3ZLPA 1V98A 3H4KA 17GSA 4O7HA 3WT2A 1T4YA 3ISOA 4JE1A 3GKKA 1T8EB 3RBTA 2NDOA 3IK7A 3P2AA 1O8WA 3APQA 5B6MA 3FHKA 8GSSA 4WR5A 1M2BA 3RHCA 1FOVA 3G7YA 1NHYA 2AAWA 5DAKA 2R5GA 2DMLA 2PUKC 5INYA 2VD0A 3DMLA 2H71A 3DKSA 5IMVA 4IQ1A 5ECPB 3RPNA 2IJYA 1JLVA 1GSEA 5LD0A 3QDNA 1JHBA 1XWAA 3J7Yk 1XW9A 1B48A 5G5FA 4WBRD 1YEPA 4HEA2 3H1NA 5B6NA 5B8AA 2M72A 1OYJA 3DEXA 4KSMA 3GYKA 5GSTA 1PX7A 1WIKA 1FG4A 3VPTA 4HZ2A 5AIVA 2YNXA 5DALB 1PRXA 1R5AA 2X8GA 2LEGA 1LU4A 4CHSA 5C04A 5D73A 2FA4A 3TUEA 3LSZA 1AXDA 3G9BA 1JLWA 3UVHA 3HVSA 2VO4A 3CYNA 1FVKA 5COHA 5HR3A 2RUEA 1I5GA 1TRVA 2V6KA 1A8YA 1U3IA 3LJRA 1O73A 2YWIA 2GZYA 4K8MA 1ZYQB 4AJ8A 1T1VA 3UBLA 4TOPA 3SBCA 5KN0A 5HQPA 5DVBA 2L6DA 5IMAA 3PGTA 4YQMA 1PL1A 1H75A 2YV9A 4FIWA 3QAGA 3KMOA 1OAZA 5C00A 1K3YA 4HOJA 2GSSA 4Q5NA 3F6DA 2IMDA 3ZIJA 3C1RA 4XIHA 3ZFLA 4DSRA 2F8FA 4ID0A 2YPMA 5JWQB 3E3EA 2TRXA 4RUVA 2XHFA 1XWBA 3QFAC 2K6VA 3KIJA 2V32A 3LG6A 2MMAA 5DAKB 1DBYA 3TOUA 1TP9A 4CDOA 1BEDA 2PN8A 2VM2A 3ZMLA 3ZTLA 3W8JA 5G1KA 1JZWA 2N5BA 1QXHA 3ZITA 3TKRA 5F05A 4GXZA 4ECCA 3DD3A 1EEMA 5D8IA 2YOIA 3KXOA 1F3AA 1TRWA 4K7IA 5F07A 1ERWA 3EYTA 4JR4A 5KN2A 3DRNA 4I5QA 4ZBDA 4L5OA 3BD2A 4I97A 1USBA 3IPZA 1OE8A 4FO5A 2VLUA 1KBNA 4PX1A 1B4PA 14GSA 3CRTA 4J57E 1DUGA 4GSTA 1K0BA 3GL3A 4RQRA 1SK0A 3VK9A 2QSIA 4GTUA 1ZYEA 1FO5A 6GSVA 2JSYA 1Z5YE 1A24A 4KCAA 4MCUA 2EIRA 4JRRA 1KEBA 4RQXA 3HYPA 5EVOA 5J9CA 1PMTA 1AIUA 3ZVJA 3I43A 2D2ZA 2HE3A 2FWGA 2CA8A 3L0HA 2G0FA 2X8HA 2FWFA 1VF3A 3KZQA 3W8SA 1Z7PA 4KGIA 4DVCA 1VRSD 2MZCA 1G0TA 2PBJA 1V40A 2DMMA 2IMFA 4ZBBA 1A0FA 3TKQA 2PPTA 3ZFBA 3EC3A 3IBHA 5CNWA 4N0ZA 1AUCA 3ZREA 2CX4A 1AW9A 3CXGA 3DWVA 3A5WA 3M0FA 3WGEA 1AC1A 5CP1A 3HJMA 5IOWA 4TVEA 1EOHA 4AJ7A 3I9V2 2LS5A 4KSOA 4LL4B 3C8EA 4Q5RA 3FZAA 3HKRA 2AUVA 2H8LA 4JZQA 3LXZA 3DIEA 2H1GA 2LUSA 5CYYA 1GSDA 3EURA 5ECMB 4JBBA 3GV1A 1NW2A 1OKTA
chains in the Genus database with same CATH superfamily
3DVXA 1XOAA 5G2ZA 2HFDA 1FB6A 2K9FA 3GH6A 1WMJA 2DJKA 4NAXA 5LCZA 2VL2C 4MZWA 3LGCA 1U6TA 4KDXA 1UN2A 4HSCX 3FR6A 2WDUA 3IV4A 3QD9A 5ELAA 2VCTA 5IMZA 6GSYA 3M8NA 1TU7A 5AN1A 3ZRDA 2GVPA 2OADA 5KN3A 3I6AA 4X4JA 3UL3A 3TRXA 2AHEA 4KW6A 3FEUA 4XS4A 2L4CA 5CREA 3TJBA 2DLXA 4O32A 1Q4JA 1J08A 1X5CA 2LNTA 1AQWA 4QL7A 2LJRA 1NHOA 4ECBA 2FWEA 2JU5A 1SJ6A 2CZ3A 2H72A 3MDKA 4BA7A 4E8HA 2R2JA 2VLVA 1WWJA 4YAPA 5A5KA 3VWVA 3AY8A 2K18A 3MWHA 1TW9A 3KP9A 3TOTA 1MD3A 3TKSA 3ERWA 3G7JA 3PPUA 1Z6NA 5ECSA 1S3RA 1SD8A 3QAWA 2VIMA 2WCIA 3GKNA 1THXA 2NTOA 1VGLA 1DE2A 4FYUA 2FNOA 1FB0A 5DQSA 4N30A 1XVWA 3P8WA 2R37A 5JWRB 1VF2A 3UARA 2B7KA 2PVOC 3GKXA 4CW9A 2EC4A 1QUWA 2KOKA 4MJAA 5CO3A 3TJFA 2EIOA 1GSUA 3HVXA 3EMPA 1PN0A 19GSA 2GZPA 1BYEA 4OMVA 3ZL5A 5ABRA 3IHQA 4IKHA 4BL7A 3ME7A 4WR4A 1GRXA 5FWGA 4HQZA 4XS4B 2A2PA 3QAVA 3WGXA 1HNCA 3DGQA 2B5XA 4I2UA 1EEJA 1GTAA 4PTSA 1W4VA 2CT6A 5KOWA 4MPGA 3TJKA 4BVXA 1XXUA 2F8AA 2ZCTA 4YQVA 12GSA 1VF4A 3QR6A 1Z3EA 1ZCPA 1YF0A 4HZ4A 1Y6EA 2H6YA 1S3CA 4ML1A 1U88A 5E59A 5B8BA 4WKWA 2IN3A 1EOGA 3A3TA 3O76A 1H4OA 4EC0A 4PGTA 4XRDA 4X43A 2XC2A 5ECHB 5IIZA 1GNEA 1GULA 1Z9HA 3A2VA 1ERVA 4FH8A 3U5RE 3JCML 2RUFA 1FAAA 3IOSA 3RHBA 3BJ5A 1LBKA 1J0FA 4OFTA 4HU7A 1V58A 5B7CA 2B1KA 1TK8B 1MD4A 2CVBA 5D9WA 2DJ1A 4F0CA 2IIYA 4OFNA 1A2LA 2L4QA 4TRXA 3EU3A 3BCKA 3HVNA 1V57A 2NPBA 5F8BA 4KDYA 2H19A 1EZKA 3VWUA 4WF5A 4XHMA 3MAKA 1MDKA 4G2EA 1GLPA 2B1LA 4KX4A 4WEYA 2A4VA 4ZILA 5A4UA 3K8NA 1GWCA 1O6JA 4EUYA 4OO5A 5DCGA 3TJJA 1U3AA 4BL7B 2HXKA 1C72A 3UJ1A 5G5EA 4TXOB 4KAEA 2KP2A 1PL2A 2F51A 2HZEA 1OC8A 1KNGA 3HZ4A 4TR1A 3HY2A 3VI5A 1BG5A 1ZOFA 3HJPA 1YF1A 3TDGA 1E2YA 4AJ6A 2C3TA 4RI6A 5EY6A 4BVXB 2IL3A 4BIKA 3EE2A 2F3MA 2R0CA 5KEJA 1A8LA 1TDIA 2N5AA 2LQOA 5D9VA 1SU9A 3VPQA 2XBQA 5D9TA 3APOA 3O6TA 3H8QA 2R4VA 3UMAA 2O7KA 1K3OA 2PWJA 1EGOA 1YDKA 2CVKA 1BQ7A 4MNNA 4OFMA 2OA7A 2V2GA 2LV3A 4F0BA 1GUHA 4PQHA 1OKDA 3DVWA 3F9UA 1SENA 2VL2A 3ERGA 4MF7A 4G0LA 4NHZA 1ST9A 1GSFA 2O85A 2H1DA 2H0HA 2LSTA 1PN9A 2I4AA 2NVLA 4DSQA 1M9BA 3L9SA 4L0WA 4KUNA 5J5NA 6GSUA 3CTGA 1E6BA 4HQSA 1QMVA 5GSSA 4EVMA 1PFOA 1WRYA 2WS2A 2M80A 2VLTA 1SK1A 4K6XA 1WOUA 5J41A 3ME8A 3IR4A 2HYXA 2YP6A 1GH2A 2HZEB 1B8XA 4TR1B 3FZ9A 3TJGA 2H74A 3C71A 2C0EA 2R6KA 5LNKe 1F3BA 5IO0A 4G19A 1PA3A 1YJ6A 3H93A 3HA9A 2I81A 4Z7XA 1GTBA 1KTEA 1M0UA 3MIXA 4X1UA 2GQKA 4P3YB 5ID2B 2P0GA 2LRTA 1PD21 3ZVJD 2VCQA 4JR6A 3KEBA 3RAZA 1M7TA 3HVVA 1MEKA 2TIRA 3RPPA 5AGYA 2HSHA 1X9WB 1XW6A 4V1Ag 1K3LA 3TKPA 2E7PA 2C0DA 2REMA 1T7PB 4DSSA 1JZDA 3IXRA 2IPAA 2OKAA 3HHVA 5FT3A 2H30A 2K8VA 3D6IA 2YCDA 4ZB9A 4ECJA 3IK9A 3C73A 4KNDA 1DE1A 1FHEA 4YAVA 4PQIA 2OBIA 1BJXA 3ERFA 5L71A 3VLNA 1QFNA 4K5SA 1K0AA 4RI7A 1SYRA 3M9JA 2GT5A 1BAYA 3H79A 2C0GA 2E2GA 3KCMA 4ZBAA 2AB6A 5IMFA 3KD0A 1MTCA 3F3QA 4FYBA 5IQYA 1TRUA 3U6VA 4X0XA 2GGTA 2FD3A 4HS1A 1AQXA 2P5QA 2MMZA 2KLXA 4POLA 3W6GA 3F0IA 3F4SA 3HXSA 4ICYA 4GCIA 1GL8A 3GKMA 2CAQA 4K7NA 5D96A 1K0CA 1B9XC 1YQ1A 3D0ZA 4O5UA 2CZ2A 2IMIA 5IPGA 3QPMA 4IP1A 2IMEA 3ED3A 1GSYA 1ABAA 1R5PA 1OC9A 3N9JA 1JZOA 4GSSA 1SL0B 2GTUA 3M3MA 2OBKA 5KOXA 3KJYA 3GMFA 1B9YC 2GZZA 3LEFA 4OCEA 1XOBA 2VD1A 3P7XA 4PUFC 3FKFA 4Z2RA 4A5PA 4ZL7A 2QA2A 1XG8A 3UAPA 4IJ3A 1R4WA 1AQVA 6GSTA 3ZMKA 4EO3A 2BTOT 4DSSB 2L5OA 4BWQA 2A2SA 2L57A 2ON7A 2H75A 4KF9A 4NWYA 4ZL8A 1FOHA 4POKA 2I1UA 2AJQB 5ECKB 3S9FA 3F63A 2C80A 1TI1A 4IS0A 1ON4A 3F4TA 2ALBA 4MH2A 2GS3A 2HRFA 4OD7A 1EP8A 4GLTA 1F6MC 4XCSA 5ECOB 1ZZYA 4GF0A 2ZNMA 1EV9A 1HYUA 4TR3A 4F2IA 2CVDA 3O3TA 4PNGA 5JWOB 2DSAA 1O81A 1V2AA 4EIPA 2V41A 1TTZA 1Q98A 1SKWB 2H73A 1M2AA 5J9BA 4ZL9A 5G1LA 1G7OA 2K8SA 2R0GA 1A0RP 3FZ4A 4I6XA 2LTKA 2M46A 3UEMA 2PGTA 22GSA 4NMUA 1OC9B 1X5EA 3DXBA 3TGZA 3D22A 3FMWA 4K2DA 6GSXA 2WGRA 3CBUA 13GSA 3CRUA 2A4HA 4PQ1A 3VURA 3LXTA 5IO2A 4ML6A 1U87A 4WF4A 3GSTA 4ZB6A 2CAIA 4MPFA 1XCCA 1OE7A 1SKSB 1A2MA 4MZCA 4POBA 2TRCP 5CRHA 3A2WA 1CQGA 1CQHA 1M9AA 2CV4A 2KP1A 3LYKA 2PMTA 2QC7A 3TB2A 2JZSA 4MP4A 2KHPA 3IHGA 1ACVA 4WXTA 4IJIA 3EMXA 4TXOA 3Q19A 1K0NA 4GQFA 1XIYA 1HNAA 1JZRA 5DBQA 1RW1A 2JADA 2HNLA 4H86A 4AF2A 4V1Ap 2X64A 4WETA 3E0UA 2VCXA 2OACA 4FYCA 3QMXA 2RLIA 5HFGA 2RM5A 5EL8A 3ZYWA 1ZMAA 3HJOA 5J4UA 3ZIVA 1ZL9A 2LKUA 3GUSA 1TOFA 4Q5QA 1F9MA 2HSMA 3BCIA 4HI7A 3EWLA 2JL4A 2O87A 1R26A 3GNJA 1GTIA 3VWWA 4NXIA 1JFUA 1YKAA 2B5YA 1HQOA 3C1SA 3E9JB 2X4AA 4KCEA 4JU5A 4DEJA 2B6MA 1GP1A 1FVJA 2LNSA 4V2MA 5IM9A 5H5RA 1GUKA 3TCOA 3F6FA 4YQUA 2FUG2 2MBSA 3V1WA 5A4WA 1SJZA 3BOAA 7GSSA 2LJKA 3M1GA 5H5QA 3GURA 3F4RA 5DDLA 2YJHA 2C1YA 3WGDA 1WP0A 2FGXA 4K7OA 1VF1A 1K0MA 2PERA 2IFQA 3CSIA 1S3AA 4G10A 1YY7A 2VCZA 4MDCA 1EV4A 1MDIA 2GSQA 3FK8A 4N10A 4AGSA 1TI3A 6GSSA 2OE1A 3GRXA 1GLQA 1PX6A 2G2QA 2OE3A 4IVFA 2OE0A 3QCPA 1SK2A 4ZIJA 3IRAA 2H66A 1O8XA 2HSYA 6GSWA 4I2TA 4TN8A 2HRNA 5ID2A 4ULXA 4KB3A 5ELGA 2MMOA 5IPHA 3EU4A 3WD6A 4ISDA 3GL5A 4MABA 1XWKA 1NSWA 5DJMA 1S3DA 5F0GA 2VCWA 1TKDB 5BMUA 2DBCA 3BBYA 1ERTA 3TKSC 1GSQA 5DJLA 2DC5A 5IMDA 5CRDA 3KH7A 4O92A 4TW5A 2X99A 2GDRA 4ECIA 1RQMA 1QQ2A 4F82A 3P90A 2YV7A 4PURA 2YJ7A 4G0KA 1PKWA 4Z2UA 4K0GA 4IBPA 1X5DA 4HDEA 5ECRB 3RDWA 4L0UA 1M2DA 4EDYA 5ENUA 1B4QA 2H70A 2N5FA 2I9HA 3VFIA 20GSA 3HD5A 3D4TA 1RK4A 3CMIA 5GZZB 4BPYA 4EE0A 1ILOA 2IFQB 3N5OA 3NZNA 3IE3A 3FR9A 3Q74A 4EKZA 4XS1A 3L9UA 4IHUA 5G31A 4HU9A 4BWSA 2LRCA 2JZTA 3F3RA 1A23A 2H6XA 5E4WA 4MJBA 3KM6A 2NBSA 5BRTA 5ECLB 4JEDA 1UA5A 1OC3A 4XRAA 1GNWA 2HI7A 2C0FA 4K2XA 2LQQA 3L4NA 1ZGNA 2JACA 4MLYA 1XFLA 2VL9A 4MF6A 4KH7A 1A2JA 2I3YA 4NV5A 5HR0A 5ECIB 4TXVA 4GRFA 1T3BA 4I8BA 1URMA 3WYWA 2JSZA 5A4VA 1Z6MA 5ECNB 2B7JA 4MMMA 2DJJA 4NHWA 3GHAA 3GTUA 3L78A 4FQUA 5KN1A 1QGVA 3IA1A 2WZ9A 4OO4A 4CY6A 3F8UA 2XBIA 3VI7A 1ERUA 3IAS2 4USSA 1XZOA 16GSA 1MDJA 2H0IA 2L6CA 5CRWA 3SWLA 1K0DA 1XWCA 4HUAA 3ZZXA 3WT1A 9GSSA 2H76A 2LRNA 4G0IA 3KH9A 5DCHA 1HNBA 4IN0A 3M9KA 1T4ZA 1YKCA 3MYDA 2B3SA 4L8EA 2BJXA 18GSA 1HD2A 4KA0A 1O7UA 2YZUA 2GQLA 4GSNA 2VAFA 2L5LA 3GSSA 5JCWA 5AIXA 3KP8A 4K9ZA 1EP7A 3PINA 3MSZA 3LORA 1F2EA 1N8JA 2DJ0A 1YZXA 4MZBA 4IP6A 2F9SA 1XPVA 4IQAA 2VM1A 3G7IA 2V1MA 1IYHA 2V6OA 4MK3A 2VCVA 1O85A 2AV4A 3LQ7A 5GAPD 2MBTA 2BMXA 5CRGA 3UBKA 4NPBA 4IELA 2ES7A 2VUPA 3L9VA 4HJ2A 5IMCA 2DKHA 3HZ8A 4BVYA 2C3QA 1THOA 1N2AA 1ZYPA 5H5SA 5HR2A 1Y25A 4D73A 3GIXA 3GTUB 3PH9A 3A2XA 1SJIA 1LJRA 4LLRA 1QK8A 4E8EA 4J56E 1PGTA 1XWGA 1WE0A 1EGRA 1G6YA 3IC4A 3CSHA 3J7Yb 1YEXA 3IC8A 1DSBA 2J23A 2QA1A 3NIVA 1WJKA 2P5RA 3APSA 4XTSA 4LA1A 5HFIA 5HR1A 1F37A 2Z9SA 5FHIA 1UVZA 4N0VA 5AISA 5HFKA 2O8VB 4LL1B 2IMKA 2GSRA 2YZHA 1G7EA 3HCZA 3EVIA 3FYGA 4OCFA 5D9XA 5ECQB 2HLSA 2CQ9A 4IGJA 2WJUA 2VOCA 2HT9A 4PUAA 2J9HA 3CTFA 3OR5A 1SL1B 2GQMA 1TXXA 2P31A 2C8UA 2AYTA 10GSA 3Q18A 3HDCA 4ZXGA 2H0GA 1K0OA 2EIQA 4K1FA 2WRTA 1M3JA 3FRCA 3FW2A 3LWAA 3KMNA 1I9DA 2YWMA 2R0PA 2FLSA 2YN1A 2HRAA 2H6ZA 4V2NA 4QL9A 3US3A 1SD9A 1TK0B 3GN3A 3UIWA 4GQCA 4YH2A 1GSSA 2DJ2A 1T00A 3Q6OA 3UOMA 2L59A 3C7MA 3LYPA 3TRPA 1SYXA 2PU9C 5CAXA 3FY7A 2OJLA 2LJAA 3I69A 4BVYB 1G6WA 2X8CA 1IYIA 2MYGA 2VL3A 5G30A 1W89A 4D73B 4F9ZA 5EPFA 1TRSA 4V2LA 2O89A 1ZYNA 4KDUA 3QOUA 2E2MA 4MH3A 2FCHA 5D93A 1OVNA 4G9HA 5IOXA 4NV2A 4EXJA 2C4JA 2XPDA 2RIIA 4N11A 3KTBA 2FY6A 1X9SB 2HZFA 3GH9A 1XVQA 3EINA 4KE3A 1FW1A 1PQNA 3VWXA 1NM3A 3D5JA 4GWRA 3UVTA 2WB9A 1Z7RA 2GSTA 1J9BA 1GTUA 3NOFA 3FZ5A 3GX8A 3CQFA 4EDZA 2PVQA 3GA4A 4MF5A 4PXOA 1XBSA 2DIZA 2HRKA 2WULA 1X9MB 5JCUA 2IWTA 4EF0A 2WFCA 4HJMA 1GUMA 11GSA 2XPEA 3TRQA 4K5RA 3D21A 3MNGA 4L5LA 1PSQA 4IW9A 3GX0A 2KUCA 4J2FA 5J3RA 5JCGA 4XS6A 1SL2B 1TK5B 4POMA 2H1AA 5F06A 1UC7A 4WBJA 2DJ3A 2H01A 2E0QA 2CX3A 2GLRA 3LFLA 4MA9A 1TJDA 2C3NA 1AAZA 4Q5FA 1WPIA 4TR0A 3QFBC 3CSJA 3DYRA 1XW5A 5DALA 3KGKA 2YWNA 3GFKA 4CY8A 4OWYA 1ML6A 4LMVA 1EWXA 1TU8A 4TKYA 3EPTA 4O5RA 1V9WA 3IDVA 1PKZA 5DQYA 4PNFA 3TKSE 4MJEA 2R3XA 4LMWA 4F03A 2FA8A 1BX9A 4TR4A 3IAM2 3FR3A 4ZB8A 2JZRA 2B5EA 2RM6A 2GT6A 4K0NA 2MMNA 5GAND 3KTLA 3PR8A 4QQ7A 2FWHA 3D4MA 4EL1A 2QKEA 1X0RA 3R2QA 2ZUPA 4ACSA 2ON5A 4MJCA 1M99A 2DIYA 2YWOA 2QGVA 2A2RA 2H1BA 4ILFA 1SKRB 1R7HA 2FHEA 2YANA 3ZLPA 1V98A 3H4KA 17GSA 4O7HA 3WT2A 1T4YA 3ISOA 4JE1A 3GKKA 1T8EB 3RBTA 2NDOA 3IK7A 3P2AA 1O8WA 3APQA 5B6MA 3FHKA 2UZ8A 4WR5A 1M2BA 3RHCA 8GSSA 1FOVA 3G7YA 1NHYA 2AAWA 5DAKA 2R5GA 2DMLA 2PUKC 5INYA 2VD0A 3DMLA 2H71A 3DKSA 5IMVA 4IQ1A 5ECPB 3RPNA 2IJYA 1JLVA 1GSEA 5LD0A 3QDNA 3A5IA 1XWAA 3J7Yk 1JHBA 1XW9A 1B48A 5G5FA 2X49A 1YEPA 4HEA2 4WBRD 3H1NA 5B6NA 5B8AA 2M72A 1OYJA 3DEXA 4KSMA 3GYKA 5GSTA 1PX7A 1WIKA 1FG4A 2DKIA 3VPTA 4HZ2A 5AIVA 2YNXA 5DALB 1PRXA 1R5AA 2X8GA 2LEGA 1LU4A 4CHSA 5C04A 5D73A 2FA4A 3TUEA 3LSZA 1AXDA 3G9BA 1JLWA 3UVHA 3HVSA 2VO4A 3CYNA 1FVKA 5COHA 5HR3A 2RUEA 1I5GA 1TRVA 2V6KA 1A8YA 1U3IA 3LJRA 1O73A 2YWIA 2GZYA 4K8MA 1ZYQB 4AJ8A 1T1VA 3UBLA 4TOPA 3SBCA 5KN0A 5HQPA 5DVBA 2L6DA 5IMAA 3PGTA 4YQMA 1PL1A 1H75A 2YV9A 4FIWA 3QAGA 3KMOA 1OAZA 5C00A 4EIQA 1K3YA 4HOJA 2GSSA 4Q5NA 3F6DA 2IMDA 3ZIJA 3C1RA 4XIHA 3ZFLA 4DSRA 2F8FA 4ID0A 2YPMA 5JWQB 4Z2TA 3E3EA 2TRXA 4YKFA 4RUVA 2XHFA 4YKGA 1XWBA 3QFAC 2K6VA 3KIJA 2V32A 3LG6A 2MMAA 5DAKB 1DBYA 3TOUA 1TP9A 4CDOA 3LW9A 1BEDA 2PN8A 2VM2A 3ZMLA 3ZTLA 3W8JA 5G1KA 1JZWA 2N5BA 1QXHA 3ZITA 3TKRA 5F05A 4GXZA 4ECCA 3DD3A 1EEMA 5D8IA 4O5QA 2YOIA 3KXOA 1F3AA 1TRWA 4K7IA 5F07A 1ERWA 3EYTA 4JR4A 5KN2A 3DRNA 4I5QA 4ZBDA 4L5OA 3BD2A 4I97A 1M3IA 1USBA 3IPZA 1OE8A 4FO5A 2VLUA 1KBNA 4PX1A 1B4PA 14GSA 3CRTA 4J57E 1DUGA 4GSTA 1K0BA 3GL3A 4RQRA 1SK0A 3VK9A 2QSIA 4GTUA 1ZYEA 1FO5A 6GSVA 2JSYA 1Z5YE 1A24A 4KCAA 4MCUA 2EIRA 4JRRA 1KEBA 4RQXA 3HYPA 5EVOA 5J9CA 1PMTA 1AIUA 3ZVJA 3I43A 2D2ZA 2HE3A 2FWGA 2CA8A 3L0HA 2G0FA 2X8HA 2FWFA 1VF3A 3R3EA 3KZQA 3W8SA 1Z7PA 4KGIA 4DVCA 1VRSD 2MZCA 1G0TA 2PBJA 1V40A 2DMMA 2IMFA 4ZBBA 1A0FA 3TKQA 2PPTA 3ZFBA 3EC3A 3IBHA 5CNWA 4N0ZA 1AUCA 3ZREA 2CX4A 1AW9A 3CXGA 3DWVA 3A5WA 3M0FA 3WGEA 1AC1A 5CP1A 3HJMA 5IOWA 4TVEA 1EOHA 4AJ7A 3I9V2 2LS5A 4KSOA 4LL4B 3C8EA 4Q5RA 3FZAA 3HKRA 2AUVA 2H8LA 4JZQA 3LXZA 3DIEA 2H1GA 2LUSA 5CYYA 1GSDA 3EURA 5ECMB 4JBBA 3GV1A 1NW2A 1OKTA
chains in the Genus database with same CATH topology
3DVXA 1XOAA 5G2ZA 2HFDA 1FB6A 2K9FA 3GH6A 1WMJA 2DJKA 4NAXA 5LCZA 2VL2C 4MZWA 3LGCA 1U6TA 4KDXA 1UN2A 3FR6A 2WDUA 3IV4A 3QD9A 5ELAA 2VCTA 5IMZA 6GSYA 3M8NA 1TU7A 5AN1A 3ZRDA 2GVPA 2OADA 5KN3A 3I6AA 4X4JA 3UL3A 3TRXA 2AHEA 4KW6A 3FEUA 4XS4A 2L4CA 5CREA 3TJBA 2DLXA 4O32A 1Q4JA 1J08A 1X5CA 2LNTA 1AQWA 4QL7A 2LJRA 1NHOA 4ECBA 2FWEA 2JU5A 1SJ6A 2CZ3A 2H72A 3MDKA 4BA7A 4E8HA 2R2JA 2VLVA 1WWJA 4YAPA 5A5KA 3VWVA 3AY8A 2K18A 3MWHA 1TW9A 3KP9A 3TOTA 1MD3A 3TKSA 3ERWA 3G7JA 3PPUA 1Z6NA 5ECSA 1SD8A 3QAWA 2VIMA 2WCIA 3GKNA 1THXA 2NTOA 1VGLA 1DE2A 4FYUA 2FNOA 1FB0A 5DQSA 4N30A 1XVWA 3P8WA 2R37A 5JWRB 1VF2A 3UARA 2B7KA 2PVOC 3GKXA 4CW9A 2EC4A 1QUWA 2KOKA 4MJAA 5CO3A 3TJFA 2EIOA 1GSUA 3HVXA 3EMPA 1PN0A 19GSA 2GZPA 1BYEA 4OMVA 3ZL5A 5ABRA 3IHQA 4IKHA 4BL7A 3ME7A 4WR4A 1GRXA 5FWGA 4HQZA 4XS4B 2A2PA 3QAVA 3WGXA 1HNCA 3DGQA 2B5XA 4I2UA 1EEJA 1GTAA 4PTSA 1W4VA 2CT6A 5KOWA 4MPGA 3TJKA 4BVXA 1XXUA 2F8AA 2ZCTA 4YQVA 12GSA 1VF4A 3QR6A 1Z3EA 1ZCPA 1YF0A 4HZ4A 1Y6EA 2H6YA 1S3CA 4ML1A 1U88A 5E59A 5B8BA 4WKWA 2IN3A 1EOGA 3A3TA 3O76A 1H4OA 4EC0A 4PGTA 4XRDA 4X43A 2XC2A 5ECHB 5IIZA 1GNEA 1GULA 1Z9HA 3A2VA 1ERVA 4FH8A 3U5RE 3JCML 2RUFA 1FAAA 3IOSA 3RHBA 3BJ5A 1LBKA 1J0FA 4OFTA 4HU7A 1V58A 5B7CA 2B1KA 1TK8B 1MD4A 2CVBA 5D9WA 2DJ1A 4F0CA 2IIYA 4OFNA 1A2LA 2L4QA 4TRXA 3EU3A 3BCKA 1V57A 2NPBA 5F8BA 4KDYA 2H19A 1EZKA 3VWUA 4WF5A 4XHMA 3MAKA 1MDKA 4G2EA 1GLPA 2B1LA 4KX4A 4WEYA 2A4VA 4ZILA 5A4UA 3K8NA 1GWCA 1O6JA 4EUYA 4OO5A 5DCGA 3TJJA 1U3AA 4BL7B 2HXKA 1C72A 3UJ1A 5G5EA 4TXOB 4KAEA 2KP2A 1PL2A 2F51A 2HZEA 1OC8A 1KNGA 3HZ4A 4TR1A 3HY2A 3VI5A 1BG5A 1ZOFA 3HJPA 1YF1A 3TDGA 1E2YA 4AJ6A 2C3TA 4RI6A 5EY6A 4BVXB 2IL3A 3EE2A 2F3MA 2R0CA 5KEJA 1A8LA 1TDIA 2N5AA 2LQOA 5D9VA 1SU9A 3VPQA 2XBQA 5D9TA 3APOA 3O6TA 3H8QA 2R4VA 3UMAA 2O7KA 1K3OA 2PWJA 1EGOA 1YDKA 2CVKA 1BQ7A 4MNNA 4OFMA 2OA7A 2V2GA 2LV3A 4F0BA 1GUHA 4PQHA 1OKDA 3DVWA 3F9UA 1SENA 2VL2A 3ERGA 4MF7A 4G0LA 4NHZA 1ST9A 1GSFA 2O85A 2H1DA 2H0HA 2LSTA 1PN9A 2I4AA 2NVLA 4DSQA 1M9BA 3L9SA 4L0WA 4KUNA 5J5NA 6GSUA 3CTGA 1E6BA 4HQSA 1QMVA 5GSSA 4EVMA 1WRYA 2WS2A 2M80A 2VLTA 1SK1A 4K6XA 1WOUA 5J41A 3ME8A 3IR4A 2HYXA 2YP6A 1GH2A 2HZEB 1B8XA 4TR1B 3FZ9A 3TJGA 2H74A 3C71A 2C0EA 2R6KA 5LNKe 1F3BA 5IO0A 4G19A 1PA3A 1YJ6A 3H93A 3HA9A 2I81A 4Z7XA 1GTBA 1KTEA 1M0UA 3MIXA 4X1UA 2GQKA 4P3YB 5ID2B 2P0GA 2LRTA 1PD21 3ZVJD 2VCQA 4JR6A 3KEBA 3RAZA 1M7TA 3HVVA 1MEKA 2TIRA 3RPPA 5AGYA 2HSHA 1X9WB 1XW6A 4V1Ag 1K3LA 3TKPA 2E7PA 2C0DA 2REMA 1T7PB 4DSSA 1JZDA 3IXRA 2IPAA 2OKAA 3HHVA 5FT3A 2H30A 2K8VA 3D6IA 2YCDA 4ZB9A 4ECJA 3IK9A 3C73A 4KNDA 1DE1A 1FHEA 4YAVA 4PQIA 2OBIA 1BJXA 3ERFA 5L71A 3VLNA 1QFNA 4K5SA 1K0AA 4RI7A 1SYRA 3M9JA 2GT5A 1BAYA 3H79A 2C0GA 2E2GA 3KCMA 4ZBAA 2AB6A 5IMFA 3KD0A 1MTCA 3F3QA 4FYBA 5IQYA 1TRUA 3U6VA 4X0XA 2GGTA 2FD3A 4HS1A 1AQXA 2P5QA 2MMZA 2KLXA 4POLA 3W6GA 3F0IA 3F4SA 3HXSA 4ICYA 4GCIA 1GL8A 3GKMA 2CAQA 4K7NA 5D96A 1K0CA 1B9XC 1YQ1A 3D0ZA 4O5UA 2CZ2A 2IMIA 5IPGA 3QPMA 4IP1A 2IMEA 3ED3A 1GSYA 1ABAA 1R5PA 1OC9A 3N9JA 1JZOA 4GSSA 1SL0B 2GTUA 3M3MA 2OBKA 5KOXA 3KJYA 3GMFA 1B9YC 2GZZA 3LEFA 4OCEA 1XOBA 2VD1A 3P7XA 4PUFC 3FKFA 4Z2RA 4A5PA 4ZL7A 2QA2A 3UAPA 4IJ3A 1R4WA 1AQVA 6GSTA 3ZMKA 4EO3A 2BTOT 4DSSB 2L5OA 4BWQA 2A2SA 2L57A 2ON7A 2H75A 4KF9A 4NWYA 4ZL8A 1FOHA 4POKA 2I1UA 2AJQB 5ECKB 3S9FA 3F63A 2C80A 1TI1A 4IS0A 1ON4A 3F4TA 2ALBA 4MH2A 2GS3A 2HRFA 4OD7A 1EP8A 4GLTA 1F6MC 4XCSA 5ECOB 1ZZYA 4GF0A 2ZNMA 1EV9A 1HYUA 4TR3A 4F2IA 2CVDA 3O3TA 4PNGA 5JWOB 2DSAA 1O81A 1V2AA 4EIPA 2V41A 1TTZA 1Q98A 1SKWB 2H73A 1M2AA 5J9BA 4ZL9A 5G1LA 1G7OA 2K8SA 2R0GA 1A0RP 3FZ4A 4I6XA 2LTKA 2M46A 3UEMA 2PGTA 22GSA 4NMUA 1OC9B 1X5EA 3DXBA 3TGZA 3D22A 3FMWA 4K2DA 6GSXA 2WGRA 3CBUA 13GSA 3CRUA 2A4HA 4PQ1A 3VURA 3LXTA 5IO2A 4ML6A 1U87A 4WF4A 3GSTA 4ZB6A 2CAIA 4MPFA 1XCCA 1OE7A 1SKSB 1A2MA 4MZCA 4POBA 2TRCP 5CRHA 3A2WA 1CQGA 1CQHA 1M9AA 2CV4A 2KP1A 3LYKA 2PMTA 2QC7A 3TB2A 2JZSA 4MP4A 2KHPA 3IHGA 1ACVA 4WXTA 4IJIA 3EMXA 4TXOA 3Q19A 1K0NA 4GQFA 1XIYA 1HNAA 1JZRA 5DBQA 1RW1A 2JADA 2HNLA 4H86A 4AF2A 4V1Ap 2X64A 4WETA 3E0UA 2VCXA 2OACA 4FYCA 3QMXA 2RLIA 5HFGA 2RM5A 5EL8A 3ZYWA 1ZMAA 3HJOA 5J4UA 3ZIVA 1ZL9A 2LKUA 3GUSA 1TOFA 4Q5QA 1F9MA 2HSMA 3BCIA 4HI7A 3EWLA 2JL4A 2O87A 1R26A 3GNJA 1GTIA 3VWWA 4NXIA 1JFUA 1YKAA 2B5YA 1HQOA 3C1SA 3E9JB 2X4AA 4KCEA 4JU5A 4DEJA 2B6MA 1GP1A 1FVJA 2LNSA 4V2MA 5IM9A 5H5RA 1GUKA 3TCOA 3F6FA 4YQUA 2FUG2 2MBSA 3V1WA 5A4WA 1SJZA 3BOAA 7GSSA 2LJKA 3M1GA 5H5QA 3GURA 3F4RA 5DDLA 2YJHA 2C1YA 3WGDA 1WP0A 2FGXA 4K7OA 1VF1A 1K0MA 2PERA 2IFQA 3CSIA 1S3AA 4G10A 1YY7A 2VCZA 4MDCA 1EV4A 1MDIA 2GSQA 3FK8A 4N10A 4AGSA 1TI3A 6GSSA 2OE1A 3GRXA 1GLQA 1PX6A 2G2QA 2OE3A 4IVFA 2OE0A 3QCPA 1SK2A 4ZIJA 3IRAA 2H66A 1O8XA 2HSYA 6GSWA 4I2TA 4TN8A 2HRNA 5ID2A 4ULXA 4KB3A 5ELGA 2MMOA 5IPHA 3EU4A 3WD6A 4ISDA 3GL5A 4MABA 1XWKA 1NSWA 5DJMA 1S3DA 5F0GA 2VCWA 1TKDB 5BMUA 2DBCA 3BBYA 1ERTA 3TKSC 1GSQA 5DJLA 2DC5A 5IMDA 5CRDA 3KH7A 4O92A 4TW5A 2X99A 2GDRA 4ECIA 1RQMA 1QQ2A 4F82A 3P90A 2YV7A 4PURA 2YJ7A 4G0KA 1PKWA 4Z2UA 4K0GA 4IBPA 1X5DA 4HDEA 5ECRB 3RDWA 4L0UA 1M2DA 4EDYA 5ENUA 1B4QA 2H70A 2N5FA 2I9HA 3VFIA 20GSA 3HD5A 3D4TA 1RK4A 3CMIA 5GZZB 4BPYA 4EE0A 1ILOA 2IFQB 3N5OA 3NZNA 3IE3A 3FR9A 3Q74A 4EKZA 4XS1A 3L9UA 4IHUA 5G31A 4HU9A 4BWSA 2LRCA 2JZTA 3F3RA 1A23A 2H6XA 5E4WA 4MJBA 3KM6A 2NBSA 5BRTA 5ECLB 4JEDA 1UA5A 1OC3A 4XRAA 1GNWA 2HI7A 2C0FA 4K2XA 2LQQA 3L4NA 1ZGNA 2JACA 4MLYA 1XFLA 2VL9A 4MF6A 4KH7A 1A2JA 2I3YA 4NV5A 5HR0A 5ECIB 4TXVA 4GRFA 1T3BA 4I8BA 1URMA 3WYWA 2JSZA 5A4VA 1Z6MA 5ECNB 2B7JA 4MMMA 2DJJA 4NHWA 3GHAA 3GTUA 3L78A 4FQUA 5KN1A 1QGVA 3IA1A 2WZ9A 4OO4A 4CY6A 3F8UA 2XBIA 3VI7A 1ERUA 3IAS2 4USSA 1XZOA 16GSA 1MDJA 2H0IA 2L6CA 5CRWA 3SWLA 1K0DA 1XWCA 4HUAA 3ZZXA 3WT1A 9GSSA 2H76A 2LRNA 4G0IA 3KH9A 5DCHA 1HNBA 4IN0A 3M9KA 1T4ZA 1YKCA 3MYDA 2B3SA 4L8EA 2BJXA 18GSA 1HD2A 4KA0A 1O7UA 2YZUA 2GQLA 4GSNA 2VAFA 2L5LA 3GSSA 5JCWA 5AIXA 3KP8A 4K9ZA 1EP7A 3PINA 3MSZA 3LORA 1F2EA 1N8JA 2DJ0A 1YZXA 4MZBA 4IP6A 2F9SA 1XPVA 4IQAA 2VM1A 3G7IA 2V1MA 1IYHA 2V6OA 4MK3A 2VCVA 1O85A 2AV4A 3LQ7A 5GAPD 2MBTA 2BMXA 5CRGA 3UBKA 4NPBA 4IELA 2ES7A 2VUPA 3L9VA 4HJ2A 5IMCA 2DKHA 3HZ8A 4BVYA 2C3QA 1THOA 1N2AA 1ZYPA 5H5SA 5HR2A 1Y25A 4D73A 3GIXA 3GTUB 3PH9A 3A2XA 1SJIA 1LJRA 4LLRA 1QK8A 4E8EA 4J56E 1PGTA 1XWGA 1WE0A 1EGRA 1G6YA 3IC4A 3CSHA 3J7Yb 1YEXA 3IC8A 1DSBA 2J23A 2QA1A 3NIVA 1WJKA 2P5RA 3APSA 4XTSA 4LA1A 5HFIA 5HR1A 1F37A 2Z9SA 5FHIA 1UVZA 4N0VA 5AISA 5HFKA 2O8VB 4LL1B 2IMKA 2GSRA 2YZHA 1G7EA 3HCZA 3EVIA 3FYGA 4OCFA 5D9XA 5ECQB 2HLSA 2CQ9A 4IGJA 2WJUA 2VOCA 2HT9A 4PUAA 2J9HA 3CTFA 3OR5A 1SL1B 2GQMA 1TXXA 2P31A 2C8UA 2AYTA 10GSA 3Q18A 3HDCA 4ZXGA 2H0GA 1K0OA 2EIQA 4K1FA 2WRTA 3FRCA 3FW2A 3LWAA 3KMNA 1I9DA 2YWMA 2R0PA 2FLSA 2YN1A 2HRAA 2H6ZA 4V2NA 4QL9A 3US3A 1SD9A 1TK0B 3GN3A 3UIWA 4GQCA 4YH2A 1GSSA 2DJ2A 1T00A 3Q6OA 3UOMA 2L59A 3C7MA 3LYPA 3TRPA 1SYXA 2PU9C 5CAXA 3FY7A 2OJLA 2LJAA 3I69A 4BVYB 1G6WA 2X8CA 1IYIA 2MYGA 2VL3A 5G30A 1W89A 4D73B 4F9ZA 5EPFA 1TRSA 4V2LA 2O89A 1ZYNA 4KDUA 3QOUA 2E2MA 4MH3A 2FCHA 5D93A 1OVNA 4G9HA 5IOXA 4NV2A 4EXJA 2C4JA 2XPDA 2RIIA 4N11A 3KTBA 2FY6A 1X9SB 2HZFA 3GH9A 1XVQA 3EINA 4KE3A 1FW1A 1PQNA 3VWXA 1NM3A 3D5JA 4GWRA 3UVTA 2WB9A 1Z7RA 2GSTA 1J9BA 1GTUA 3NOFA 3FZ5A 3GX8A 4EDZA 2PVQA 3GA4A 4MF5A 4PXOA 1XBSA 2DIZA 2HRKA 2WULA 1X9MB 5JCUA 2IWTA 4EF0A 2WFCA 4HJMA 1GUMA 11GSA 2XPEA 3TRQA 4K5RA 3D21A 3MNGA 4L5LA 1PSQA 4IW9A 3GX0A 2KUCA 4J2FA 5J3RA 5JCGA 4XS6A 1SL2B 1TK5B 4POMA 2H1AA 5F06A 1UC7A 4WBJA 2DJ3A 2H01A 2E0QA 2CX3A 2GLRA 3LFLA 4MA9A 1TJDA 2C3NA 1AAZA 4Q5FA 1WPIA 4TR0A 3QFBC 3CSJA 3DYRA 1XW5A 5DALA 3KGKA 2YWNA 3GFKA 4CY8A 4OWYA 1ML6A 4LMVA 1EWXA 1TU8A 4TKYA 3EPTA 4O5RA 1V9WA 3IDVA 1PKZA 5DQYA 4PNFA 3TKSE 4MJEA 2R3XA 4LMWA 4F03A 2FA8A 1BX9A 4TR4A 3IAM2 3FR3A 4ZB8A 2JZRA 2B5EA 2RM6A 2GT6A 4K0NA 2MMNA 5GAND 3KTLA 3PR8A 4QQ7A 2FWHA 3D4MA 4EL1A 2QKEA 1X0RA 3R2QA 2ZUPA 4ACSA 2ON5A 4MJCA 1M99A 2DIYA 2YWOA 2QGVA 2A2RA 2H1BA 4ILFA 1SKRB 1R7HA 2FHEA 2YANA 3ZLPA 1V98A 3H4KA 17GSA 4O7HA 3WT2A 1T4YA 3ISOA 4JE1A 3GKKA 1T8EB 3RBTA 2NDOA 3IK7A 3P2AA 1O8WA 3APQA 5B6MA 3FHKA 2UZ8A 4WR5A 1M2BA 3RHCA 8GSSA 1FOVA 3G7YA 1NHYA 2AAWA 5DAKA 2R5GA 2DMLA 2PUKC 5INYA 2VD0A 3DMLA 2H71A 3DKSA 5IMVA 4IQ1A 5ECPB 3RPNA 2IJYA 1JLVA 1GSEA 5LD0A 3QDNA 3A5IA 1XWAA 3J7Yk 1JHBA 1XW9A 1B48A 5G5FA 2X49A 1YEPA 4HEA2 4WBRD 3H1NA 5B6NA 5B8AA 2M72A 1OYJA 3DEXA 4KSMA 3GYKA 5GSTA 1PX7A 1WIKA 1FG4A 2DKIA 3VPTA 4HZ2A 5AIVA 2YNXA 5DALB 1PRXA 1R5AA 2X8GA 2LEGA 1LU4A 4CHSA 5C04A 5D73A 2FA4A 3TUEA 3LSZA 1AXDA 3G9BA 1JLWA 3UVHA 3HVSA 2VO4A 3CYNA 1FVKA 5COHA 5HR3A 2RUEA 1I5GA 1TRVA 2V6KA 1A8YA 1U3IA 3LJRA 1O73A 2YWIA 2GZYA 4K8MA 1ZYQB 4AJ8A 1T1VA 3UBLA 4TOPA 3SBCA 5KN0A 5HQPA 5DVBA 2L6DA 5IMAA 3PGTA 4YQMA 1PL1A 1H75A 2YV9A 4FIWA 3QAGA 3KMOA 1OAZA 5C00A 4EIQA 1K3YA 4HOJA 2GSSA 4Q5NA 3F6DA 2IMDA 3ZIJA 3C1RA 4XIHA 3ZFLA 4DSRA 2F8FA 4ID0A 2YPMA 5JWQB 4Z2TA 3E3EA 2TRXA 4YKFA 4RUVA 2XHFA 4YKGA 1XWBA 3QFAC 2K6VA 3KIJA 2V32A 3LG6A 2MMAA 5DAKB 1DBYA 3TOUA 1TP9A 4CDOA 3LW9A 1BEDA 2PN8A 2VM2A 3ZMLA 3ZTLA 3W8JA 5G1KA 1JZWA 2N5BA 1QXHA 3ZITA 3TKRA 5F05A 4GXZA 4ECCA 3DD3A 1EEMA 5D8IA 4O5QA 2YOIA 3KXOA 1F3AA 1TRWA 4K7IA 5F07A 1ERWA 3EYTA 4JR4A 5KN2A 3DRNA 4I5QA 4ZBDA 4L5OA 3BD2A 4I97A 1USBA 3IPZA 1OE8A 4FO5A 2VLUA 1KBNA 4PX1A 1B4PA 14GSA 3CRTA 4J57E 1DUGA 4GSTA 1K0BA 3GL3A 4RQRA 1SK0A 3VK9A 2QSIA 4GTUA 1ZYEA 1FO5A 6GSVA 2JSYA 1Z5YE 1A24A 4KCAA 4MCUA 2EIRA 4JRRA 1KEBA 4RQXA 3HYPA 5EVOA 5J9CA 1PMTA 1AIUA 3ZVJA 3I43A 2D2ZA 2HE3A 2FWGA 2CA8A 3L0HA 2G0FA 2X8HA 2FWFA 1VF3A 3R3EA 3KZQA 3W8SA 1Z7PA 4KGIA 4DVCA 1VRSD 2MZCA 1G0TA 2PBJA 1V40A 2DMMA 2IMFA 4ZBBA 1A0FA 3TKQA 2PPTA 3ZFBA 3EC3A 3IBHA 5CNWA 4N0ZA 1AUCA 3ZREA 2CX4A 1AW9A 3CXGA 3DWVA 3A5WA 3M0FA 3WGEA 1AC1A 5CP1A 3HJMA 5IOWA 4TVEA 1EOHA 4AJ7A 3I9V2 2LS5A 4KSOA 4LL4B 3C8EA 4Q5RA 3FZAA 3HKRA 2AUVA 2H8LA 4JZQA 3LXZA 3DIEA 2H1GA 2LUSA 5CYYA 1GSDA 3EURA 5ECMB 4JBBA 3GV1A 1NW2A 1OKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DVX A;  1XOA A;  5G2Z A;  2HFD A;  1FB6 A;  2K9F A;  3GH6 A;  1WMJ A;  2DJK A;  4NAX A;  5LCZ A;  2VL2 C;  4MZW A;  3LGC A;  1U6T A;  4KDX A;  1UN2 A;  3FR6 A;  2WDU A;  3IV4 A;  3QD9 A;  5ELA A;  2VCT A;  5IMZ A;  6GSY A;  3M8N A;  1TU7 A;  5AN1 A;  3ZRD A;  2GVP A;  2OAD A;  5KN3 A;  3I6A A;  3UL3 A;  3TRX A;  2AHE A;  4KW6 A;  3FEU A;  4XS4 A;  2L4C A;  5CRE A;  3TJB A;  2DLX A;  4O32 A;  1Q4J A;  1J08 A;  1X5C A;  2LNT A;  1AQW A;  4QL7 A;  2LJR A;  1NHO A;  4ECB A;  2FWE A;  2JU5 A;  1SJ6 A;  2CZ3 A;  2H72 A;  3MDK A;  4BA7 A;  4E8H A;  2R2J A;  2VLV A;  1WWJ A;  4YAP A;  5A5K A;  3VWV A;  3AY8 A;  2K18 A;  3MWH A;  1TW9 A;  3KP9 A;  3TOT A;  1MD3 A;  3TKS A;  3ERW A;  3G7J A;  1Z6N A;  5ECS A;  1SD8 A;  3QAW A;  2VIM A;  2WCI A;  3GKN A;  1THX A;  2NTO A;  1VGL A;  1DE2 A;  4FYU A;  2FNO A;  1FB0 A;  5DQS A;  4N30 A;  1XVW A;  3P8W A;  2R37 A;  5JWR B;  1VF2 A;  3UAR A;  2B7K A;  2PVO C;  3GKX A;  4CW9 A;  2EC4 A;  1QUW A;  2KOK A;  4MJA A;  5CO3 A;  3TJF A;  2EIO A;  1GSU A;  3HVX A;  3EMP A;  2GZP A;  19GS A;  4OMV A;  1BYE A;  3ZL5 A;  5ABR A;  3IHQ A;  4IKH A;  4BL7 A;  3ME7 A;  4WR4 A;  1GRX A;  5FWG A;  4HQZ A;  4XS4 B;  3QAV A;  3WGX A;  1HNC A;  3DGQ A;  2B5X A;  4I2U A;  1EEJ A;  1GTA A;  1W4V A;  2CT6 A;  4MPG A;  3TJK A;  4BVX A;  1XXU A;  2F8A A;  2ZCT A;  4YQV A;  12GS A;  1VF4 A;  3QR6 A;  1Z3E A;  1ZCP A;  1YF0 A;  4HZ4 A;  1Y6E A;  2H6Y A;  1S3C A;  4ML1 A;  1U88 A;  5E59 A;  5B8B A;  4WKW A;  2IN3 A;  1EOG A;  3A3T A;  3O76 A;  1H4O A;  4EC0 A;  4PGT A;  4XRD A;  4X43 A;  2XC2 A;  5ECH B;  5IIZ A;  1GNE A;  1GUL A;  1Z9H A;  3A2V A;  1ERV A;  4FH8 A;  3U5R E;  3JCM L;  2RUF A;  1FAA A;  3IOS A;  3RHB A;  3BJ5 A;  1LBK A;  1J0F A;  4OFT A;  4HU7 A;  1V58 A;  5B7C A;  2B1K A;  1TK8 B;  1MD4 A;  2CVB A;  5D9W A;  2DJ1 A;  4F0C A;  2IIY A;  4OFN A;  1A2L A;  2L4Q A;  4TRX A;  3EU3 A;  3BCK A;  1V57 A;  2NPB A;  5F8B A;  4KDY A;  2H19 A;  1EZK A;  3VWU A;  4WF5 A;  4XHM A;  3MAK A;  1MDK A;  4G2E A;  1GLP A;  2B1L A;  4KX4 A;  4WEY A;  2A4V A;  4ZIL A;  5A4U A;  3K8N A;  1GWC A;  1O6J A;  4EUY A;  4OO5 A;  5DCG A;  3TJJ A;  1U3A A;  2HXK A;  1C72 A;  3UJ1 A;  5G5E A;  4TXO B;  4KAE A;  2KP2 A;  1PL2 A;  2F51 A;  2HZE A;  1OC8 A;  1KNG A;  3HZ4 A;  4TR1 A;  3HY2 A;  3VI5 A;  1BG5 A;  1ZOF A;  3HJP A;  1YF1 A;  3TDG A;  1E2Y A;  4AJ6 A;  2C3T A;  4RI6 A;  5EY6 A;  2IL3 A;  3EE2 A;  2F3M A;  5KEJ A;  1A8L A;  1TDI A;  2N5A A;  2LQO A;  5D9V A;  1SU9 A;  3VPQ A;  2XBQ A;  5D9T A;  3APO A;  3O6T A;  3H8Q A;  2R4V A;  3UMA A;  2O7K A;  1K3O A;  2PWJ A;  1EGO A;  1YDK A;  2CVK A;  1BQ7 A;  4OFM A;  2OA7 A;  2V2G A;  2LV3 A;  4F0B A;  1GUH A;  4PQH A;  1OKD A;  3DVW A;  3F9U A;  1SEN A;  2VL2 A;  3ERG A;  4MF7 A;  4NHZ A;  1ST9 A;  1GSF A;  2O85 A;  2H1D A;  2H0H A;  2LST A;  1PN9 A;  2I4A A;  2NVL A;  4DSQ A;  1M9B A;  3L9S A;  4L0W A;  4KUN A;  5J5N A;  6GSU A;  3CTG A;  1E6B A;  4HQS A;  1QMV A;  5GSS A;  4EVM A;  1WRY A;  2WS2 A;  2M80 A;  2VLT A;  1SK1 A;  4K6X A;  1WOU A;  5J41 A;  3ME8 A;  3IR4 A;  2HYX A;  2YP6 A;  1GH2 A;  2HZE B;  1B8X A;  4TR1 B;  3FZ9 A;  3TJG A;  2H74 A;  3C71 A;  2C0E A;  2R6K A;  5LNK e;  1F3B A;  5IO0 A;  4G19 A;  1PA3 A;  1YJ6 A;  3H93 A;  3HA9 A;  2I81 A;  4Z7X A;  1GTB A;  1KTE A;  1M0U A;  4X1U A;  2GQK A;  4P3Y B;  5ID2 B;  2P0G A;  2LRT A;  1PD2 1;  3ZVJ D;  2VCQ A;  4JR6 A;  3KEB A;  3RAZ A;  1M7T A;  3HVV A;  1MEK A;  2TIR A;  3RPP A;  5AGY A;  2HSH A;  1X9W B;  1XW6 A;  4V1A g;  1K3L A;  3TKP A;  2E7P A;  2C0D A;  2REM A;  1T7P B;  4DSS A;  1JZD A;  3IXR A;  2IPA A;  2OKA A;  3HHV A;  5FT3 A;  2H30 A;  2K8V A;  3D6I A;  2YCD A;  4ZB9 A;  4ECJ A;  3IK9 A;  3C73 A;  4KND A;  1DE1 A;  1FHE A;  4YAV A;  4PQI A;  2OBI A;  1BJX A;  3ERF A;  5L71 A;  3VLN A;  1QFN A;  1K0A A;  4RI7 A;  1SYR A;  3M9J A;  2GT5 A;  1BAY A;  3H79 A;  2C0G A;  2E2G A;  3KCM A;  4ZBA A;  2AB6 A;  5IMF A;  3KD0 A;  1MTC A;  3F3Q A;  4FYB A;  5IQY A;  1TRU A;  3U6V A;  4X0X A;  2GGT A;  2FD3 A;  4HS1 A;  1AQX A;  2P5Q A;  2MMZ A;  2KLX A;  4POL A;  3W6G A;  3F0I A;  3F4S A;  3HXS A;  4GCI A;  1GL8 A;  3GKM A;  2CAQ A;  4K7N A;  5D96 A;  1K0C A;  1B9X C;  1YQ1 A;  3D0Z A;  2CZ2 A;  2IMI A;  5IPG A;  3QPM A;  4IP1 A;  2IME A;  3ED3 A;  1GSY A;  1ABA A;  1R5P A;  1OC9 A;  3N9J A;  1JZO A;  4GSS A;  1SL0 B;  2GTU A;  3M3M A;  2OBK A;  3KJY A;  3GMF A;  1B9Y C;  2GZZ A;  3LEF A;  4OCE A;  1XOB A;  2VD1 A;  3P7X A;  4PUF C;  3FKF A;  4ZL7 A;  3UAP A;  4IJ3 A;  1R4W A;  1AQV A;  6GST A;  3ZMK A;  4EO3 A;  2BTO T;  4DSS B;  2L5O A;  4BWQ A;  2A2S A;  2L57 A;  2ON7 A;  2H75 A;  4NWY A;  4ZL8 A;  4POK A;  2I1U A;  2AJQ B;  5ECK B;  3S9F A;  3F63 A;  2C80 A;  1TI1 A;  4IS0 A;  1ON4 A;  3F4T A;  2ALB A;  4MH2 A;  2GS3 A;  2HRF A;  4OD7 A;  1EP8 A;  4GLT A;  1F6M C;  4XCS A;  5ECO B;  1ZZY A;  4GF0 A;  2ZNM A;  1EV9 A;  1HYU A;  4TR3 A;  4F2I A;  2CVD A;  3O3T A;  4PNG A;  5JWO B;  2DSA A;  1O81 A;  1V2A A;  2V41 A;  1TTZ A;  1Q98 A;  1SKW B;  2H73 A;  1M2A A;  5J9B A;  4ZL9 A;  5G1L A;  1G7O A;  2K8S A;  1A0R P;  3FZ4 A;  4I6X A;  2LTK A;  2M46 A;  3UEM A;  2PGT A;  22GS A;  4NMU A;  1OC9 B;  1X5E A;  3DXB A;  3TGZ A;  3D22 A;  6GSX A;  4K2D A;  2WGR A;  3CBU A;  13GS A;  3CRU A;  4PQ1 A;  3VUR A;  3LXT A;  5IO2 A;  4ML6 A;  1U87 A;  4WF4 A;  3GST A;  4ZB6 A;  2CAI A;  4MPF A;  1XCC A;  1OE7 A;  1SKS B;  1A2M A;  4MZC A;  4POB A;  2TRC P;  5CRH A;  3A2W A;  1CQG A;  1CQH A;  1M9A A;  2CV4 A;  2KP1 A;  3LYK A;  2PMT A;  2QC7 A;  3TB2 A;  2JZS A;  4MP4 A;  2KHP A;  1ACV A;  4WXT A;  4IJI A;  3EMX A;  4TXO A;  3Q19 A;  1K0N A;  4GQF A;  1XIY A;  1HNA A;  1JZR A;  5DBQ A;  1RW1 A;  2JAD A;  2HNL A;  4H86 A;  4AF2 A;  4V1A p;  2X64 A;  4WET A;  3E0U A;  2VCX A;  2OAC A;  4FYC A;  3QMX A;  2RLI A;  5HFG A;  2RM5 A;  5EL8 A;  3ZYW A;  1ZMA A;  3HJO A;  5J4U A;  3ZIV A;  1ZL9 A;  2LKU A;  3GUS A;  1TOF A;  4Q5Q A;  1F9M A;  3BCI A;  4HI7 A;  3EWL A;  2JL4 A;  2O87 A;  1R26 A;  3GNJ A;  1GTI A;  3VWW A;  4NXI A;  1JFU A;  1YKA A;  2B5Y A;  1HQO A;  3C1S A;  3E9J B;  4KCE A;  4JU5 A;  4DEJ A;  2B6M A;  1GP1 A;  1FVJ A;  2LNS A;  4V2M A;  5IM9 A;  5H5R A;  1GUK A;  3TCO A;  3F6F A;  4YQU A;  2FUG 2;  2MBS A;  3V1W A;  5A4W A;  1SJZ A;  3BOA A;  7GSS A;  2LJK A;  3M1G A;  5H5Q A;  3GUR A;  3F4R A;  5DDL A;  2YJH A;  2C1Y A;  3WGD A;  1WP0 A;  2FGX A;  4K7O A;  1VF1 A;  1K0M A;  2PER A;  2IFQ A;  3CSI A;  1S3A A;  4G10 A;  1YY7 A;  2VCZ A;  4MDC A;  1EV4 A;  1MDI A;  2GSQ A;  3FK8 A;  4N10 A;  4AGS A;  1TI3 A;  6GSS A;  2OE1 A;  3GRX A;  1GLQ A;  1PX6 A;  2G2Q A;  2OE3 A;  4IVF A;  2OE0 A;  3QCP A;  1SK2 A;  4ZIJ A;  3IRA A;  2H66 A;  1O8X A;  2HSY A;  6GSW A;  4I2T A;  4TN8 A;  2HRN A;  5ID2 A;  4ULX A;  4KB3 A;  5ELG A;  2MMO A;  5IPH A;  3EU4 A;  3WD6 A;  4ISD A;  3GL5 A;  4MAB A;  1XWK A;  1NSW A;  5DJM A;  1S3D A;  5F0G A;  2VCW A;  1TKD B;  2DBC A;  3BBY A;  1ERT A;  3TKS C;  1GSQ A;  5DJL A;  2DC5 A;  5IMD A;  5CRD A;  3KH7 A;  4O92 A;  4TW5 A;  2X99 A;  2GDR A;  4ECI A;  1RQM A;  1QQ2 A;  4F82 A;  3P90 A;  2YV7 A;  4PUR A;  2YJ7 A;  1PKW A;  4K0G A;  4IBP A;  1X5D A;  4HDE A;  5ECR B;  3RDW A;  4L0U A;  1M2D A;  4EDY A;  5ENU A;  1B4Q A;  2H70 A;  2N5F A;  2I9H A;  3VFI A;  20GS A;  3HD5 A;  3D4T A;  1RK4 A;  3CMI A;  5GZZ B;  4BPY A;  4EE0 A;  1ILO A;  2IFQ B;  3N5O A;  3NZN A;  3IE3 A;  3FR9 A;  3Q74 A;  4EKZ A;  4XS1 A;  3L9U A;  4IHU A;  5G31 A;  4HU9 A;  4BWS A;  2LRC A;  2JZT A;  3F3R A;  1A23 A;  2H6X A;  5E4W A;  4MJB A;  3KM6 A;  2NBS A;  5ECL B;  4JED A;  1UA5 A;  1OC3 A;  4XRA A;  1GNW A;  2HI7 A;  2C0F A;  2LQQ A;  3L4N A;  1ZGN A;  2JAC A;  4MLY A;  1XFL A;  2VL9 A;  4MF6 A;  4KH7 A;  1A2J A;  2I3Y A;  4NV5 A;  5HR0 A;  5ECI B;  4TXV A;  4GRF A;  1T3B A;  4I8B A;  1URM A;  3WYW A;  2JSZ A;  5A4V A;  1Z6M A;  5ECN B;  2B7J A;  4MMM A;  2DJJ A;  4NHW A;  3GHA A;  3GTU A;  3L78 A;  5KN1 A;  1QGV A;  3IA1 A;  2WZ9 A;  4OO4 A;  3F8U A;  2XBI A;  3VI7 A;  1ERU A;  3IAS 2;  1XZO A;  16GS A;  1MDJ A;  2H0I A;  2L6C A;  5CRW A;  3SWL A;  1K0D A;  1XWC A;  4HUA A;  3ZZX A;  3WT1 A;  9GSS A;  2H76 A;  2LRN A;  3KH9 A;  5DCH A;  1HNB A;  4IN0 A;  3M9K A;  1T4Z A;  1YKC A;  2B3S A;  4L8E A;  2BJX A;  18GS A;  1HD2 A;  4KA0 A;  1O7U A;  2YZU A;  2GQL A;  4GSN A;  2VAF A;  2L5L A;  3GSS A;  5JCW A;  5AIX A;  3KP8 A;  4K9Z A;  1EP7 A;  3PIN A;  3MSZ A;  3LOR A;  1F2E A;  1N8J A;  2DJ0 A;  1YZX A;  4MZB A;  4IP6 A;  2F9S A;  1XPV A;  4IQA A;  2VM1 A;  3G7I A;  2V1M A;  1IYH A;  2V6O A;  4MK3 A;  2VCV A;  1O85 A;  2AV4 A;  3LQ7 A;  5GAP D;  2MBT A;  2BMX A;  5CRG A;  3UBK A;  4NPB A;  4IEL A;  2ES7 A;  2VUP A;  3L9V A;  4HJ2 A;  5IMC A;  3HZ8 A;  4BVY A;  2C3Q A;  1THO A;  1N2A A;  5H5S A;  5HR2 A;  1Y25 A;  4D73 A;  3GIX A;  3GTU B;  3PH9 A;  3A2X A;  1SJI A;  1LJR A;  4LLR A;  1QK8 A;  4E8E A;  4J56 E;  1PGT A;  1XWG A;  1WE0 A;  1EGR A;  1G6Y A;  3IC4 A;  3CSH A;  3J7Y b;  1YEX A;  1DSB A;  2J23 A;  3NIV A;  1WJK A;  2P5R A;  3APS A;  4XTS A;  4LA1 A;  5HFI A;  5HR1 A;  1F37 A;  2Z9S A;  5FHI A;  1UVZ A;  4N0V A;  5AIS A;  5HFK A;  2O8V B;  4LL1 B;  2IMK A;  2GSR A;  2YZH A;  1G7E A;  3HCZ A;  3EVI A;  3FYG A;  4OCF A;  5D9X A;  5ECQ B;  2HLS A;  2CQ9 A;  4IGJ A;  2WJU A;  2VOC A;  2HT9 A;  4PUA A;  2J9H A;  3CTF A;  3OR5 A;  1SL1 B;  2GQM A;  1TXX A;  2P31 A;  2C8U A;  2AYT A;  10GS A;  3Q18 A;  3HDC A;  4ZXG A;  2H0G A;  1K0O A;  2EIQ A;  4K1F A;  2WRT A;  3FRC A;  3FW2 A;  3LWA A;  3KMN A;  1I9D A;  2YWM A;  2FLS A;  2YN1 A;  2H6Z A;  4V2N A;  4QL9 A;  3US3 A;  1SD9 A;  1TK0 B;  3GN3 A;  3UIW A;  4GQC A;  4YH2 A;  1GSS A;  2DJ2 A;  1T00 A;  3Q6O A;  3UOM A;  2L59 A;  3C7M A;  3LYP A;  3TRP A;  1SYX A;  2PU9 C;  5CAX A;  3FY7 A;  2OJL A;  2LJA A;  3I69 A;  1G6W A;  2X8C A;  1IYI A;  2MYG A;  2VL3 A;  5G30 A;  1W89 A;  4D73 B;  4F9Z A;  5EPF A;  1TRS A;  4V2L A;  2O89 A;  4KDU A;  3QOU A;  2E2M A;  4MH3 A;  2FCH A;  5D93 A;  1OVN A;  4G9H A;  5IOX A;  4NV2 A;  4EXJ A;  2C4J A;  2XPD A;  2RII A;  4N11 A;  3KTB A;  2FY6 A;  1X9S B;  2HZF A;  3GH9 A;  1XVQ A;  3EIN A;  4KE3 A;  1FW1 A;  1PQN A;  3VWX A;  1NM3 A;  3D5J A;  4GWR A;  3UVT A;  2WB9 A;  1Z7R A;  2GST A;  1J9B A;  1GTU A;  3NOF A;  3FZ5 A;  3GX8 A;  4EDZ A;  2PVQ A;  3GA4 A;  4MF5 A;  4PXO A;  1XBS A;  2DIZ A;  2WUL A;  1X9M B;  5JCU A;  2IWT A;  4EF0 A;  2WFC A;  4HJM A;  1GUM A;  11GS A;  2XPE A;  3TRQ A;  3D21 A;  3MNG A;  4L5L A;  1PSQ A;  4IW9 A;  3GX0 A;  2KUC A;  4J2F A;  5J3R A;  5JCG A;  4XS6 A;  1SL2 B;  1TK5 B;  4POM A;  2H1A A;  5F06 A;  1UC7 A;  4WBJ A;  2DJ3 A;  2H01 A;  2E0Q A;  2CX3 A;  2GLR A;  3LFL A;  4MA9 A;  1TJD A;  2C3N A;  1AAZ A;  4Q5F A;  1WPI A;  4TR0 A;  3QFB C;  3CSJ A;  3DYR A;  1XW5 A;  5DAL A;  3KGK A;  2YWN A;  3GFK A;  4OWY A;  1ML6 A;  4LMV A;  1EWX A;  1TU8 A;  4TKY A;  4O5R A;  1V9W A;  3IDV A;  1PKZ A;  5DQY A;  4PNF A;  3TKS E;  4MJE A;  2R3X A;  4LMW A;  4F03 A;  2FA8 A;  1BX9 A;  4TR4 A;  3IAM 2;  3FR3 A;  4ZB8 A;  2JZR A;  2B5E A;  2RM6 A;  2GT6 A;  4K0N A;  2MMN A;  5GAN D;  3KTL A;  3PR8 A;  4QQ7 A;  2FWH A;  3D4M A;  4EL1 A;  2QKE A;  1X0R A;  3R2Q A;  2ZUP A;  4ACS A;  2ON5 A;  4MJC A;  1M99 A;  2DIY A;  2YWO A;  2QGV A;  2A2R A;  2H1B A;  4ILF A;  1SKR B;  1R7H A;  2FHE A;  2YAN A;  3ZLP A;  1V98 A;  3H4K A;  17GS A;  4O7H A;  3WT2 A;  1T4Y A;  3ISO A;  4JE1 A;  3GKK A;  1T8E B;  3RBT A;  2NDO A;  3IK7 A;  3P2A A;  1O8W A;  3APQ A;  5B6M A;  3FHK A;  8GSS A;  4WR5 A;  1M2B A;  3RHC A;  1FOV A;  3G7Y A;  1NHY A;  2AAW A;  5DAK A;  2R5G A;  2DML A;  2PUK C;  5INY A;  2VD0 A;  3DML A;  2H71 A;  3DKS A;  5IMV A;  4IQ1 A;  5ECP B;  3RPN A;  2IJY A;  1JLV A;  1GSE A;  5LD0 A;  3QDN A;  1JHB A;  1XWA A;  3J7Y k;  1XW9 A;  1B48 A;  5G5F A;  4WBR D;  1YEP A;  4HEA 2;  3H1N A;  5B6N A;  5B8A A;  2M72 A;  1OYJ A;  3DEX A;  4KSM A;  3GYK A;  5GST A;  1PX7 A;  1WIK A;  1FG4 A;  3VPT A;  4HZ2 A;  5AIV A;  2YNX A;  5DAL B;  1PRX A;  1R5A A;  2X8G A;  2LEG A;  1LU4 A;  4CHS A;  5C04 A;  5D73 A;  2FA4 A;  3TUE A;  3LSZ A;  1AXD A;  3G9B A;  1JLW A;  3UVH A;  3HVS A;  2VO4 A;  3CYN A;  1FVK A;  5COH A;  5HR3 A;  2RUE A;  1I5G A;  1TRV A;  2V6K A;  1A8Y A;  1U3I A;  3LJR A;  1O73 A;  2YWI A;  2GZY A;  4K8M A;  1ZYQ B;  4AJ8 A;  1T1V A;  3UBL A;  4TOP A;  3SBC A;  5KN0 A;  5HQP A;  5DVB A;  2L6D A;  5IMA A;  3PGT A;  4YQM A;  1PL1 A;  1H75 A;  2YV9 A;  4FIW A;  3QAG A;  3KMO A;  1OAZ A;  5C00 A;  1K3Y A;  4HOJ A;  2GSS A;  4Q5N A;  3F6D A;  2IMD A;  3ZIJ A;  3C1R A;  4XIH A;  3ZFL A;  4DSR A;  2F8F A;  4ID0 A;  2YPM A;  5JWQ B;  3E3E A;  2TRX A;  4RUV A;  2XHF A;  1XWB A;  3QFA C;  2K6V A;  3KIJ A;  2V32 A;  3LG6 A;  2MMA A;  5DAK B;  1DBY A;  3TOU A;  1TP9 A;  4CDO A;  1BED A;  2PN8 A;  2VM2 A;  3ZML A;  3ZTL A;  3W8J A;  5G1K A;  1JZW A;  2N5B A;  1QXH A;  3ZIT A;  3TKR A;  5F05 A;  4GXZ A;  4ECC A;  3DD3 A;  1EEM A;  5D8I A;  2YOI A;  3KXO A;  1F3A A;  1TRW A;  4K7I A;  5F07 A;  1ERW A;  3EYT A;  4JR4 A;  5KN2 A;  3DRN A;  4I5Q A;  4ZBD A;  4L5O A;  3BD2 A;  4I97 A;  1USB A;  3IPZ A;  1OE8 A;  4FO5 A;  2VLU A;  1KBN A;  4PX1 A;  1B4P A;  14GS A;  3CRT A;  4J57 E;  1DUG A;  4GST A;  1K0B A;  3GL3 A;  4RQR A;  1SK0 A;  3VK9 A;  2QSI A;  4GTU A;  1ZYE A;  1FO5 A;  6GSV A;  2JSY A;  1Z5Y E;  1A24 A;  4KCA A;  4MCU A;  2EIR A;  4JRR A;  1KEB A;  4RQX A;  3HYP A;  5EVO A;  5J9C A;  1PMT A;  1AIU A;  3ZVJ A;  3I43 A;  2D2Z A;  2HE3 A;  2FWG A;  2CA8 A;  3L0H A;  2G0F A;  2X8H A;  2FWF A;  1VF3 A;  3KZQ A;  3W8S A;  1Z7P A;  4KGI A;  4DVC A;  1VRS D;  2MZC A;  1G0T A;  2PBJ A;  1V40 A;  2DMM A;  2IMF A;  4ZBB A;  1A0F A;  3TKQ A;  2PPT A;  3ZFB A;  3EC3 A;  3IBH A;  5CNW A;  4N0Z A;  1AUC A;  3ZRE A;  2CX4 A;  1AW9 A;  3CXG A;  3DWV A;  3A5W A;  3M0F A;  3WGE A;  1AC1 A;  5CP1 A;  3HJM A;  5IOW A;  4TVE A;  1EOH A;  4AJ7 A;  3I9V 2;  2LS5 A;  4KSO A;  4LL4 B;  3C8E A;  4Q5R A;  3FZA A;  3HKR A;  2AUV A;  2H8L A;  4JZQ A;  3LXZ A;  3DIE A;  2H1G A;  2LUS A;  5CYY A;  1GSD A;  3EUR A;  5ECM B;  4JBB A;  3GV1 A;  1NW2 A;  1OKT A; 
#chains in the Genus database with same CATH topology
 3DVX A;  1XOA A;  5G2Z A;  2HFD A;  1FB6 A;  2K9F A;  3GH6 A;  1WMJ A;  2DJK A;  4NAX A;  5LCZ A;  2VL2 C;  4MZW A;  3LGC A;  1U6T A;  4KDX A;  1UN2 A;  4HSC X;  3FR6 A;  2WDU A;  3IV4 A;  3QD9 A;  5ELA A;  2VCT A;  5IMZ A;  6GSY A;  3M8N A;  1TU7 A;  5AN1 A;  3ZRD A;  2GVP A;  2OAD A;  5KN3 A;  3I6A A;  4X4J A;  3UL3 A;  3TRX A;  2AHE A;  4KW6 A;  3FEU A;  4XS4 A;  2L4C A;  5CRE A;  3TJB A;  2DLX A;  4O32 A;  1Q4J A;  1J08 A;  1X5C A;  2LNT A;  1AQW A;  4QL7 A;  2LJR A;  1NHO A;  4ECB A;  2FWE A;  2JU5 A;  1SJ6 A;  2CZ3 A;  2H72 A;  3MDK A;  4BA7 A;  4E8H A;  2R2J A;  2VLV A;  1WWJ A;  4YAP A;  5A5K A;  3VWV A;  3AY8 A;  2K18 A;  3MWH A;  1TW9 A;  3KP9 A;  3TOT A;  1MD3 A;  3TKS A;  3ERW A;  3G7J A;  3PPU A;  1Z6N A;  5ECS A;  1S3R A;  1SD8 A;  3QAW A;  2VIM A;  2WCI A;  3GKN A;  1THX A;  2NTO A;  1VGL A;  1DE2 A;  4FYU A;  2FNO A;  1FB0 A;  5DQS A;  4N30 A;  1XVW A;  3P8W A;  2R37 A;  5JWR B;  1VF2 A;  3UAR A;  2B7K A;  2PVO C;  3GKX A;  4CW9 A;  2EC4 A;  1QUW A;  2KOK A;  4MJA A;  5CO3 A;  3TJF A;  2EIO A;  1GSU A;  3HVX A;  3EMP A;  1PN0 A;  19GS A;  2GZP A;  1BYE A;  4OMV A;  3ZL5 A;  5ABR A;  3IHQ A;  4IKH A;  4BL7 A;  3ME7 A;  4WR4 A;  1GRX A;  5FWG A;  4HQZ A;  4XS4 B;  2A2P A;  3QAV A;  3WGX A;  1HNC A;  3DGQ A;  2B5X A;  4I2U A;  1EEJ A;  1GTA A;  4PTS A;  1W4V A;  2CT6 A;  5KOW A;  4MPG A;  3TJK A;  4BVX A;  1XXU A;  2F8A A;  2ZCT A;  4YQV A;  12GS A;  1VF4 A;  3QR6 A;  1Z3E A;  1ZCP A;  1YF0 A;  4HZ4 A;  1Y6E A;  2H6Y A;  1S3C A;  4ML1 A;  1U88 A;  5E59 A;  5B8B A;  4WKW A;  2IN3 A;  1EOG A;  3A3T A;  3O76 A;  1H4O A;  4EC0 A;  4PGT A;  4XRD A;  4X43 A;  2XC2 A;  5ECH B;  5IIZ A;  1GNE A;  1GUL A;  1Z9H A;  3A2V A;  1ERV A;  4FH8 A;  3U5R E;  3JCM L;  2RUF A;  1FAA A;  3IOS A;  3RHB A;  3BJ5 A;  1LBK A;  1J0F A;  4OFT A;  4HU7 A;  1V58 A;  5B7C A;  2B1K A;  1TK8 B;  1MD4 A;  2CVB A;  5D9W A;  2DJ1 A;  4F0C A;  2IIY A;  4OFN A;  1A2L A;  2L4Q A;  4TRX A;  3EU3 A;  3BCK A;  3HVN A;  1V57 A;  2NPB A;  5F8B A;  4KDY A;  2H19 A;  1EZK A;  3VWU A;  4WF5 A;  4XHM A;  3MAK A;  1MDK A;  4G2E A;  1GLP A;  2B1L A;  4KX4 A;  4WEY A;  2A4V A;  4ZIL A;  5A4U A;  3K8N A;  1GWC A;  1O6J A;  4EUY A;  4OO5 A;  5DCG A;  3TJJ A;  1U3A A;  4BL7 B;  2HXK A;  1C72 A;  3UJ1 A;  5G5E A;  4TXO B;  4KAE A;  2KP2 A;  1PL2 A;  2F51 A;  2HZE A;  1OC8 A;  1KNG A;  3HZ4 A;  4TR1 A;  3HY2 A;  3VI5 A;  1BG5 A;  1ZOF A;  3HJP A;  1YF1 A;  3TDG A;  1E2Y A;  4AJ6 A;  2C3T A;  4RI6 A;  5EY6 A;  4BVX B;  2IL3 A;  4BIK A;  3EE2 A;  2F3M A;  2R0C A;  5KEJ A;  1A8L A;  1TDI A;  2N5A A;  2LQO A;  5D9V A;  1SU9 A;  3VPQ A;  2XBQ A;  5D9T A;  3APO A;  3O6T A;  3H8Q A;  2R4V A;  3UMA A;  2O7K A;  1K3O A;  2PWJ A;  1EGO A;  1YDK A;  2CVK A;  1BQ7 A;  4MNN A;  4OFM A;  2OA7 A;  2V2G A;  2LV3 A;  4F0B A;  1GUH A;  4PQH A;  1OKD A;  3DVW A;  3F9U A;  1SEN A;  2VL2 A;  3ERG A;  4MF7 A;  4G0L A;  4NHZ A;  1ST9 A;  1GSF A;  2O85 A;  2H1D A;  2H0H A;  2LST A;  1PN9 A;  2I4A A;  2NVL A;  4DSQ A;  1M9B A;  3L9S A;  4L0W A;  4KUN A;  5J5N A;  6GSU A;  3CTG A;  1E6B A;  4HQS A;  1QMV A;  5GSS A;  4EVM A;  1PFO A;  1WRY A;  2WS2 A;  2M80 A;  2VLT A;  1SK1 A;  4K6X A;  1WOU A;  5J41 A;  3ME8 A;  3IR4 A;  2HYX A;  2YP6 A;  1GH2 A;  2HZE B;  1B8X A;  4TR1 B;  3FZ9 A;  3TJG A;  2H74 A;  3C71 A;  2C0E A;  2R6K A;  5LNK e;  1F3B A;  5IO0 A;  4G19 A;  1PA3 A;  1YJ6 A;  3H93 A;  3HA9 A;  2I81 A;  4Z7X A;  1GTB A;  1KTE A;  1M0U A;  3MIX A;  4X1U A;  2GQK A;  4P3Y B;  5ID2 B;  2P0G A;  2LRT A;  1PD2 1;  3ZVJ D;  2VCQ A;  4JR6 A;  3KEB A;  3RAZ A;  1M7T A;  3HVV A;  1MEK A;  2TIR A;  3RPP A;  5AGY A;  2HSH A;  1X9W B;  1XW6 A;  4V1A g;  1K3L A;  3TKP A;  2E7P A;  2C0D A;  2REM A;  1T7P B;  4DSS A;  1JZD A;  3IXR A;  2IPA A;  2OKA A;  3HHV A;  5FT3 A;  2H30 A;  2K8V A;  3D6I A;  2YCD A;  4ZB9 A;  4ECJ A;  3IK9 A;  3C73 A;  4KND A;  1DE1 A;  1FHE A;  4YAV A;  4PQI A;  2OBI A;  1BJX A;  3ERF A;  5L71 A;  3VLN A;  1QFN A;  4K5S A;  1K0A A;  4RI7 A;  1SYR A;  3M9J A;  2GT5 A;  1BAY A;  3H79 A;  2C0G A;  2E2G A;  3KCM A;  4ZBA A;  2AB6 A;  5IMF A;  3KD0 A;  1MTC A;  3F3Q A;  4FYB A;  5IQY A;  1TRU A;  3U6V A;  4X0X A;  2GGT A;  2FD3 A;  4HS1 A;  1AQX A;  2P5Q A;  2MMZ A;  2KLX A;  4POL A;  3W6G A;  3F0I A;  3F4S A;  3HXS A;  4ICY A;  4GCI A;  1GL8 A;  3GKM A;  2CAQ A;  4K7N A;  5D96 A;  1K0C A;  1B9X C;  1YQ1 A;  3D0Z A;  4O5U A;  2CZ2 A;  2IMI A;  5IPG A;  3QPM A;  4IP1 A;  2IME A;  3ED3 A;  1GSY A;  1ABA A;  1R5P A;  1OC9 A;  3N9J A;  1JZO A;  4GSS A;  1SL0 B;  2GTU A;  3M3M A;  2OBK A;  5KOX A;  3KJY A;  3GMF A;  1B9Y C;  2GZZ A;  3LEF A;  4OCE A;  1XOB A;  2VD1 A;  3P7X A;  4PUF C;  3FKF A;  4Z2R A;  4A5P A;  4ZL7 A;  2QA2 A;  1XG8 A;  3UAP A;  4IJ3 A;  1R4W A;  1AQV A;  6GST A;  3ZMK A;  4EO3 A;  2BTO T;  4DSS B;  2L5O A;  4BWQ A;  2A2S A;  2L57 A;  2ON7 A;  2H75 A;  4KF9 A;  4NWY A;  4ZL8 A;  1FOH A;  4POK A;  2I1U A;  2AJQ B;  5ECK B;  3S9F A;  3F63 A;  2C80 A;  1TI1 A;  4IS0 A;  1ON4 A;  3F4T A;  2ALB A;  4MH2 A;  2GS3 A;  2HRF A;  4OD7 A;  1EP8 A;  4GLT A;  1F6M C;  4XCS A;  5ECO B;  1ZZY A;  4GF0 A;  2ZNM A;  1EV9 A;  1HYU A;  4TR3 A;  4F2I A;  2CVD A;  3O3T A;  4PNG A;  5JWO B;  2DSA A;  1O81 A;  1V2A A;  4EIP A;  2V41 A;  1TTZ A;  1Q98 A;  1SKW B;  2H73 A;  1M2A A;  5J9B A;  4ZL9 A;  5G1L A;  1G7O A;  2K8S A;  2R0G A;  1A0R P;  3FZ4 A;  4I6X A;  2LTK A;  2M46 A;  3UEM A;  2PGT A;  22GS A;  4NMU A;  1OC9 B;  1X5E A;  3DXB A;  3TGZ A;  3D22 A;  3FMW A;  4K2D A;  6GSX A;  2WGR A;  3CBU A;  13GS A;  3CRU A;  2A4H A;  4PQ1 A;  3VUR A;  3LXT A;  5IO2 A;  4ML6 A;  1U87 A;  4WF4 A;  3GST A;  4ZB6 A;  2CAI A;  4MPF A;  1XCC A;  1OE7 A;  1SKS B;  1A2M A;  4MZC A;  4POB A;  2TRC P;  5CRH A;  3A2W A;  1CQG A;  1CQH A;  1M9A A;  2CV4 A;  2KP1 A;  3LYK A;  2PMT A;  2QC7 A;  3TB2 A;  2JZS A;  4MP4 A;  2KHP A;  3IHG A;  1ACV A;  4WXT A;  4IJI A;  3EMX A;  4TXO A;  3Q19 A;  1K0N A;  4GQF A;  1XIY A;  1HNA A;  1JZR A;  5DBQ A;  1RW1 A;  2JAD A;  2HNL A;  4H86 A;  4AF2 A;  4V1A p;  2X64 A;  4WET A;  3E0U A;  2VCX A;  2OAC A;  4FYC A;  3QMX A;  2RLI A;  5HFG A;  2RM5 A;  5EL8 A;  3ZYW A;  1ZMA A;  3HJO A;  5J4U A;  3ZIV A;  1ZL9 A;  2LKU A;  3GUS A;  1TOF A;  4Q5Q A;  1F9M A;  2HSM A;  3BCI A;  4HI7 A;  3EWL A;  2JL4 A;  2O87 A;  1R26 A;  3GNJ A;  1GTI A;  3VWW A;  4NXI A;  1JFU A;  1YKA A;  2B5Y A;  1HQO A;  3C1S A;  3E9J B;  2X4A A;  4KCE A;  4JU5 A;  4DEJ A;  2B6M A;  1GP1 A;  1FVJ A;  2LNS A;  4V2M A;  5IM9 A;  5H5R A;  1GUK A;  3TCO A;  3F6F A;  4YQU A;  2FUG 2;  2MBS A;  3V1W A;  5A4W A;  1SJZ A;  3BOA A;  7GSS A;  2LJK A;  3M1G A;  5H5Q A;  3GUR A;  3F4R A;  5DDL A;  2YJH A;  2C1Y A;  3WGD A;  1WP0 A;  2FGX A;  4K7O A;  1VF1 A;  1K0M A;  2PER A;  2IFQ A;  3CSI A;  1S3A A;  4G10 A;  1YY7 A;  2VCZ A;  4MDC A;  1EV4 A;  1MDI A;  2GSQ A;  3FK8 A;  4N10 A;  4AGS A;  1TI3 A;  6GSS A;  2OE1 A;  3GRX A;  1GLQ A;  1PX6 A;  2G2Q A;  2OE3 A;  4IVF A;  2OE0 A;  3QCP A;  1SK2 A;  4ZIJ A;  3IRA A;  2H66 A;  1O8X A;  2HSY A;  6GSW A;  4I2T A;  4TN8 A;  2HRN A;  5ID2 A;  4ULX A;  4KB3 A;  5ELG A;  2MMO A;  5IPH A;  3EU4 A;  3WD6 A;  4ISD A;  3GL5 A;  4MAB A;  1XWK A;  1NSW A;  5DJM A;  1S3D A;  5F0G A;  2VCW A;  1TKD B;  5BMU A;  2DBC A;  3BBY A;  1ERT A;  3TKS C;  1GSQ A;  5DJL A;  2DC5 A;  5IMD A;  5CRD A;  3KH7 A;  4O92 A;  4TW5 A;  2X99 A;  2GDR A;  4ECI A;  1RQM A;  1QQ2 A;  4F82 A;  3P90 A;  2YV7 A;  4PUR A;  2YJ7 A;  4G0K A;  1PKW A;  4Z2U A;  4K0G A;  4IBP A;  1X5D A;  4HDE A;  5ECR B;  3RDW A;  4L0U A;  1M2D A;  4EDY A;  5ENU A;  1B4Q A;  2H70 A;  2N5F A;  2I9H A;  3VFI A;  20GS A;  3HD5 A;  3D4T A;  1RK4 A;  3CMI A;  5GZZ B;  4BPY A;  4EE0 A;  1ILO A;  2IFQ B;  3N5O A;  3NZN A;  3IE3 A;  3FR9 A;  3Q74 A;  4EKZ A;  4XS1 A;  3L9U A;  4IHU A;  5G31 A;  4HU9 A;  4BWS A;  2LRC A;  2JZT A;  3F3R A;  1A23 A;  2H6X A;  5E4W A;  4MJB A;  3KM6 A;  2NBS A;  5BRT A;  5ECL B;  4JED A;  1UA5 A;  1OC3 A;  4XRA A;  1GNW A;  2HI7 A;  2C0F A;  4K2X A;  2LQQ A;  3L4N A;  1ZGN A;  2JAC A;  4MLY A;  1XFL A;  2VL9 A;  4MF6 A;  4KH7 A;  1A2J A;  2I3Y A;  4NV5 A;  5HR0 A;  5ECI B;  4TXV A;  4GRF A;  1T3B A;  4I8B A;  1URM A;  3WYW A;  2JSZ A;  5A4V A;  1Z6M A;  5ECN B;  2B7J A;  4MMM A;  2DJJ A;  4NHW A;  3GHA A;  3GTU A;  3L78 A;  4FQU A;  5KN1 A;  1QGV A;  3IA1 A;  2WZ9 A;  4OO4 A;  4CY6 A;  3F8U A;  2XBI A;  3VI7 A;  1ERU A;  3IAS 2;  4USS A;  1XZO A;  16GS A;  1MDJ A;  2H0I A;  2L6C A;  5CRW A;  3SWL A;  1K0D A;  1XWC A;  4HUA A;  3ZZX A;  3WT1 A;  9GSS A;  2H76 A;  2LRN A;  4G0I A;  3KH9 A;  5DCH A;  1HNB A;  4IN0 A;  3M9K A;  1T4Z A;  1YKC A;  3MYD A;  2B3S A;  4L8E A;  2BJX A;  18GS A;  1HD2 A;  4KA0 A;  1O7U A;  2YZU A;  2GQL A;  4GSN A;  2VAF A;  2L5L A;  3GSS A;  5JCW A;  5AIX A;  3KP8 A;  4K9Z A;  1EP7 A;  3PIN A;  3MSZ A;  3LOR A;  1F2E A;  1N8J A;  2DJ0 A;  1YZX A;  4MZB A;  4IP6 A;  2F9S A;  1XPV A;  4IQA A;  2VM1 A;  3G7I A;  2V1M A;  1IYH A;  2V6O A;  4MK3 A;  2VCV A;  1O85 A;  2AV4 A;  3LQ7 A;  5GAP D;  2MBT A;  2BMX A;  5CRG A;  3UBK A;  4NPB A;  4IEL A;  2ES7 A;  2VUP A;  3L9V A;  4HJ2 A;  5IMC A;  2DKH A;  3HZ8 A;  4BVY A;  2C3Q A;  1THO A;  1N2A A;  1ZYP A;  5H5S A;  5HR2 A;  1Y25 A;  4D73 A;  3GIX A;  3GTU B;  3PH9 A;  3A2X A;  1SJI A;  1LJR A;  4LLR A;  1QK8 A;  4E8E A;  4J56 E;  1PGT A;  1XWG A;  1WE0 A;  1EGR A;  1G6Y A;  3IC4 A;  3CSH A;  3J7Y b;  1YEX A;  3IC8 A;  1DSB A;  2J23 A;  2QA1 A;  3NIV A;  1WJK A;  2P5R A;  3APS A;  4XTS A;  4LA1 A;  5HFI A;  5HR1 A;  1F37 A;  2Z9S A;  5FHI A;  1UVZ A;  4N0V A;  5AIS A;  5HFK A;  2O8V B;  4LL1 B;  2IMK A;  2GSR A;  2YZH A;  1G7E A;  3HCZ A;  3EVI A;  3FYG A;  4OCF A;  5D9X A;  5ECQ B;  2HLS A;  2CQ9 A;  4IGJ A;  2WJU A;  2VOC A;  2HT9 A;  4PUA A;  2J9H A;  3CTF A;  3OR5 A;  1SL1 B;  2GQM A;  1TXX A;  2P31 A;  2C8U A;  2AYT A;  10GS A;  3Q18 A;  3HDC A;  4ZXG A;  2H0G A;  1K0O A;  2EIQ A;  4K1F A;  2WRT A;  1M3J A;  3FRC A;  3FW2 A;  3LWA A;  3KMN A;  1I9D A;  2YWM A;  2R0P A;  2FLS A;  2YN1 A;  2HRA A;  2H6Z A;  4V2N A;  4QL9 A;  3US3 A;  1SD9 A;  1TK0 B;  3GN3 A;  3UIW A;  4GQC A;  4YH2 A;  1GSS A;  2DJ2 A;  1T00 A;  3Q6O A;  3UOM A;  2L59 A;  3C7M A;  3LYP A;  3TRP A;  1SYX A;  2PU9 C;  5CAX A;  3FY7 A;  2OJL A;  2LJA A;  3I69 A;  4BVY B;  1G6W A;  2X8C A;  1IYI A;  2MYG A;  2VL3 A;  5G30 A;  1W89 A;  4D73 B;  4F9Z A;  5EPF A;  1TRS A;  4V2L A;  2O89 A;  1ZYN A;  4KDU A;  3QOU A;  2E2M A;  4MH3 A;  2FCH A;  5D93 A;  1OVN A;  4G9H A;  5IOX A;  4NV2 A;  4EXJ A;  2C4J A;  2XPD A;  2RII A;  4N11 A;  3KTB A;  2FY6 A;  1X9S B;  2HZF A;  3GH9 A;  1XVQ A;  3EIN A;  4KE3 A;  1FW1 A;  1PQN A;  3VWX A;  1NM3 A;  3D5J A;  4GWR A;  3UVT A;  2WB9 A;  1Z7R A;  2GST A;  1J9B A;  1GTU A;  3NOF A;  3FZ5 A;  3GX8 A;  3CQF A;  4EDZ A;  2PVQ A;  3GA4 A;  4MF5 A;  4PXO A;  1XBS A;  2DIZ A;  2HRK A;  2WUL A;  1X9M B;  5JCU A;  2IWT A;  4EF0 A;  2WFC A;  4HJM A;  1GUM A;  11GS A;  2XPE A;  3TRQ A;  4K5R A;  3D21 A;  3MNG A;  4L5L A;  1PSQ A;  4IW9 A;  3GX0 A;  2KUC A;  4J2F A;  5J3R A;  5JCG A;  4XS6 A;  1SL2 B;  1TK5 B;  4POM A;  2H1A A;  5F06 A;  1UC7 A;  4WBJ A;  2DJ3 A;  2H01 A;  2E0Q A;  2CX3 A;  2GLR A;  3LFL A;  4MA9 A;  1TJD A;  2C3N A;  1AAZ A;  4Q5F A;  1WPI A;  4TR0 A;  3QFB C;  3CSJ A;  3DYR A;  1XW5 A;  5DAL A;  3KGK A;  2YWN A;  3GFK A;  4CY8 A;  4OWY A;  1ML6 A;  4LMV A;  1EWX A;  1TU8 A;  4TKY A;  3EPT A;  4O5R A;  1V9W A;  3IDV A;  1PKZ A;  5DQY A;  4PNF A;  3TKS E;  4MJE A;  2R3X A;  4LMW A;  4F03 A;  2FA8 A;  1BX9 A;  4TR4 A;  3IAM 2;  3FR3 A;  4ZB8 A;  2JZR A;  2B5E A;  2RM6 A;  2GT6 A;  4K0N A;  2MMN A;  5GAN D;  3KTL A;  3PR8 A;  4QQ7 A;  2FWH A;  3D4M A;  4EL1 A;  2QKE A;  1X0R A;  3R2Q A;  2ZUP A;  4ACS A;  2ON5 A;  4MJC A;  1M99 A;  2DIY A;  2YWO A;  2QGV A;  2A2R A;  2H1B A;  4ILF A;  1SKR B;  1R7H A;  2FHE A;  2YAN A;  3ZLP A;  1V98 A;  3H4K A;  17GS A;  4O7H A;  3WT2 A;  1T4Y A;  3ISO A;  4JE1 A;  3GKK A;  1T8E B;  3RBT A;  2NDO A;  3IK7 A;  3P2A A;  1O8W A;  3APQ A;  5B6M A;  3FHK A;  2UZ8 A;  4WR5 A;  1M2B A;  3RHC A;  8GSS A;  1FOV A;  3G7Y A;  1NHY A;  2AAW A;  5DAK A;  2R5G A;  2DML A;  2PUK C;  5INY A;  2VD0 A;  3DML A;  2H71 A;  3DKS A;  5IMV A;  4IQ1 A;  5ECP B;  3RPN A;  2IJY A;  1JLV A;  1GSE A;  5LD0 A;  3QDN A;  3A5I A;  1XWA A;  3J7Y k;  1JHB A;  1XW9 A;  1B48 A;  5G5F A;  2X49 A;  1YEP A;  4HEA 2;  4WBR D;  3H1N A;  5B6N A;  5B8A A;  2M72 A;  1OYJ A;  3DEX A;  4KSM A;  3GYK A;  5GST A;  1PX7 A;  1WIK A;  1FG4 A;  2DKI A;  3VPT A;  4HZ2 A;  5AIV A;  2YNX A;  5DAL B;  1PRX A;  1R5A A;  2X8G A;  2LEG A;  1LU4 A;  4CHS A;  5C04 A;  5D73 A;  2FA4 A;  3TUE A;  3LSZ A;  1AXD A;  3G9B A;  1JLW A;  3UVH A;  3HVS A;  2VO4 A;  3CYN A;  1FVK A;  5COH A;  5HR3 A;  2RUE A;  1I5G A;  1TRV A;  2V6K A;  1A8Y A;  1U3I A;  3LJR A;  1O73 A;  2YWI A;  2GZY A;  4K8M A;  1ZYQ B;  4AJ8 A;  1T1V A;  3UBL A;  4TOP A;  3SBC A;  5KN0 A;  5HQP A;  5DVB A;  2L6D A;  5IMA A;  3PGT A;  4YQM A;  1PL1 A;  1H75 A;  2YV9 A;  4FIW A;  3QAG A;  3KMO A;  1OAZ A;  5C00 A;  4EIQ A;  1K3Y A;  4HOJ A;  2GSS A;  4Q5N A;  3F6D A;  2IMD A;  3ZIJ A;  3C1R A;  4XIH A;  3ZFL A;  4DSR A;  2F8F A;  4ID0 A;  2YPM A;  5JWQ B;  4Z2T A;  3E3E A;  2TRX A;  4YKF A;  4RUV A;  2XHF A;  4YKG A;  1XWB A;  3QFA C;  2K6V A;  3KIJ A;  2V32 A;  3LG6 A;  2MMA A;  5DAK B;  1DBY A;  3TOU A;  1TP9 A;  4CDO A;  3LW9 A;  1BED A;  2PN8 A;  2VM2 A;  3ZML A;  3ZTL A;  3W8J A;  5G1K A;  1JZW A;  2N5B A;  1QXH A;  3ZIT A;  3TKR A;  5F05 A;  4GXZ A;  4ECC A;  3DD3 A;  1EEM A;  5D8I A;  4O5Q A;  2YOI A;  3KXO A;  1F3A A;  1TRW A;  4K7I A;  5F07 A;  1ERW A;  3EYT A;  4JR4 A;  5KN2 A;  3DRN A;  4I5Q A;  4ZBD A;  4L5O A;  3BD2 A;  4I97 A;  1M3I A;  1USB A;  3IPZ A;  1OE8 A;  4FO5 A;  2VLU A;  1KBN A;  4PX1 A;  1B4P A;  14GS A;  3CRT A;  4J57 E;  1DUG A;  4GST A;  1K0B A;  3GL3 A;  4RQR A;  1SK0 A;  3VK9 A;  2QSI A;  4GTU A;  1ZYE A;  1FO5 A;  6GSV A;  2JSY A;  1Z5Y E;  1A24 A;  4KCA A;  4MCU A;  2EIR A;  4JRR A;  1KEB A;  4RQX A;  3HYP A;  5EVO A;  5J9C A;  1PMT A;  1AIU A;  3ZVJ A;  3I43 A;  2D2Z A;  2HE3 A;  2FWG A;  2CA8 A;  3L0H A;  2G0F A;  2X8H A;  2FWF A;  1VF3 A;  3R3E A;  3KZQ A;  3W8S A;  1Z7P A;  4KGI A;  4DVC A;  1VRS D;  2MZC A;  1G0T A;  2PBJ A;  1V40 A;  2DMM A;  2IMF A;  4ZBB A;  1A0F A;  3TKQ A;  2PPT A;  3ZFB A;  3EC3 A;  3IBH A;  5CNW A;  4N0Z A;  1AUC A;  3ZRE A;  2CX4 A;  1AW9 A;  3CXG A;  3DWV A;  3A5W A;  3M0F A;  3WGE A;  1AC1 A;  5CP1 A;  3HJM A;  5IOW A;  4TVE A;  1EOH A;  4AJ7 A;  3I9V 2;  2LS5 A;  4KSO A;  4LL4 B;  3C8E A;  4Q5R A;  3FZA A;  3HKR A;  2AUV A;  2H8L A;  4JZQ A;  3LXZ A;  3DIE A;  2H1G A;  2LUS A;  5CYY A;  1GSD A;  3EUR A;  5ECM B;  4JBB A;  3GV1 A;  1NW2 A;  1OKT A; 
#chains in the Genus database with same CATH homology
 3DVX A;  1XOA A;  5G2Z A;  2HFD A;  1FB6 A;  2K9F A;  3GH6 A;  1WMJ A;  2DJK A;  4NAX A;  5LCZ A;  2VL2 C;  4MZW A;  3LGC A;  1U6T A;  4KDX A;  1UN2 A;  3FR6 A;  2WDU A;  3IV4 A;  3QD9 A;  5ELA A;  2VCT A;  5IMZ A;  6GSY A;  3M8N A;  1TU7 A;  5AN1 A;  3ZRD A;  2GVP A;  2OAD A;  5KN3 A;  3I6A A;  4X4J A;  3UL3 A;  3TRX A;  2AHE A;  4KW6 A;  3FEU A;  4XS4 A;  2L4C A;  5CRE A;  3TJB A;  2DLX A;  4O32 A;  1Q4J A;  1J08 A;  1X5C A;  2LNT A;  1AQW A;  4QL7 A;  2LJR A;  1NHO A;  4ECB A;  2FWE A;  2JU5 A;  1SJ6 A;  2CZ3 A;  2H72 A;  3MDK A;  4BA7 A;  4E8H A;  2R2J A;  2VLV A;  1WWJ A;  4YAP A;  5A5K A;  3VWV A;  3AY8 A;  2K18 A;  3MWH A;  1TW9 A;  3KP9 A;  3TOT A;  1MD3 A;  3TKS A;  3ERW A;  3G7J A;  3PPU A;  1Z6N A;  5ECS A;  1SD8 A;  3QAW A;  2VIM A;  2WCI A;  3GKN A;  1THX A;  2NTO A;  1VGL A;  1DE2 A;  4FYU A;  2FNO A;  1FB0 A;  5DQS A;  4N30 A;  1XVW A;  3P8W A;  2R37 A;  5JWR B;  1VF2 A;  3UAR A;  2B7K A;  2PVO C;  3GKX A;  4CW9 A;  2EC4 A;  1QUW A;  2KOK A;  4MJA A;  5CO3 A;  3TJF A;  2EIO A;  1GSU A;  3HVX A;  3EMP A;  1PN0 A;  19GS A;  2GZP A;  1BYE A;  4OMV A;  3ZL5 A;  5ABR A;  3IHQ A;  4IKH A;  4BL7 A;  3ME7 A;  4WR4 A;  1GRX A;  5FWG A;  4HQZ A;  4XS4 B;  2A2P A;  3QAV A;  3WGX A;  1HNC A;  3DGQ A;  2B5X A;  4I2U A;  1EEJ A;  1GTA A;  4PTS A;  1W4V A;  2CT6 A;  5KOW A;  4MPG A;  3TJK A;  4BVX A;  1XXU A;  2F8A A;  2ZCT A;  4YQV A;  12GS A;  1VF4 A;  3QR6 A;  1Z3E A;  1ZCP A;  1YF0 A;  4HZ4 A;  1Y6E A;  2H6Y A;  1S3C A;  4ML1 A;  1U88 A;  5E59 A;  5B8B A;  4WKW A;  2IN3 A;  1EOG A;  3A3T A;  3O76 A;  1H4O A;  4EC0 A;  4PGT A;  4XRD A;  4X43 A;  2XC2 A;  5ECH B;  5IIZ A;  1GNE A;  1GUL A;  1Z9H A;  3A2V A;  1ERV A;  4FH8 A;  3U5R E;  3JCM L;  2RUF A;  1FAA A;  3IOS A;  3RHB A;  3BJ5 A;  1LBK A;  1J0F A;  4OFT A;  4HU7 A;  1V58 A;  5B7C A;  2B1K A;  1TK8 B;  1MD4 A;  2CVB A;  5D9W A;  2DJ1 A;  4F0C A;  2IIY A;  4OFN A;  1A2L A;  2L4Q A;  4TRX A;  3EU3 A;  3BCK A;  1V57 A;  2NPB A;  5F8B A;  4KDY A;  2H19 A;  1EZK A;  3VWU A;  4WF5 A;  4XHM A;  3MAK A;  1MDK A;  4G2E A;  1GLP A;  2B1L A;  4KX4 A;  4WEY A;  2A4V A;  4ZIL A;  5A4U A;  3K8N A;  1GWC A;  1O6J A;  4EUY A;  4OO5 A;  5DCG A;  3TJJ A;  1U3A A;  4BL7 B;  2HXK A;  1C72 A;  3UJ1 A;  5G5E A;  4TXO B;  4KAE A;  2KP2 A;  1PL2 A;  2F51 A;  2HZE A;  1OC8 A;  1KNG A;  3HZ4 A;  4TR1 A;  3HY2 A;  3VI5 A;  1BG5 A;  1ZOF A;  3HJP A;  1YF1 A;  3TDG A;  1E2Y A;  4AJ6 A;  2C3T A;  4RI6 A;  5EY6 A;  4BVX B;  2IL3 A;  3EE2 A;  2F3M A;  2R0C A;  5KEJ A;  1A8L A;  1TDI A;  2N5A A;  2LQO A;  5D9V A;  1SU9 A;  3VPQ A;  2XBQ A;  5D9T A;  3APO A;  3O6T A;  3H8Q A;  2R4V A;  3UMA A;  2O7K A;  1K3O A;  2PWJ A;  1EGO A;  1YDK A;  2CVK A;  1BQ7 A;  4MNN A;  4OFM A;  2OA7 A;  2V2G A;  2LV3 A;  4F0B A;  1GUH A;  4PQH A;  1OKD A;  3DVW A;  3F9U A;  1SEN A;  2VL2 A;  3ERG A;  4MF7 A;  4G0L A;  4NHZ A;  1ST9 A;  1GSF A;  2O85 A;  2H1D A;  2H0H A;  2LST A;  1PN9 A;  2I4A A;  2NVL A;  4DSQ A;  1M9B A;  3L9S A;  4L0W A;  4KUN A;  5J5N A;  6GSU A;  3CTG A;  1E6B A;  4HQS A;  1QMV A;  5GSS A;  4EVM A;  1WRY A;  2WS2 A;  2M80 A;  2VLT A;  1SK1 A;  4K6X A;  1WOU A;  5J41 A;  3ME8 A;  3IR4 A;  2HYX A;  2YP6 A;  1GH2 A;  2HZE B;  1B8X A;  4TR1 B;  3FZ9 A;  3TJG A;  2H74 A;  3C71 A;  2C0E A;  2R6K A;  5LNK e;  1F3B A;  5IO0 A;  4G19 A;  1PA3 A;  1YJ6 A;  3H93 A;  3HA9 A;  2I81 A;  4Z7X A;  1GTB A;  1KTE A;  1M0U A;  3MIX A;  4X1U A;  2GQK A;  4P3Y B;  5ID2 B;  2P0G A;  2LRT A;  1PD2 1;  3ZVJ D;  2VCQ A;  4JR6 A;  3KEB A;  3RAZ A;  1M7T A;  3HVV A;  1MEK A;  2TIR A;  3RPP A;  5AGY A;  2HSH A;  1X9W B;  1XW6 A;  4V1A g;  1K3L A;  3TKP A;  2E7P A;  2C0D A;  2REM A;  1T7P B;  4DSS A;  1JZD A;  3IXR A;  2IPA A;  2OKA A;  3HHV A;  5FT3 A;  2H30 A;  2K8V A;  3D6I A;  2YCD A;  4ZB9 A;  4ECJ A;  3IK9 A;  3C73 A;  4KND A;  1DE1 A;  1FHE A;  4YAV A;  4PQI A;  2OBI A;  1BJX A;  3ERF A;  5L71 A;  3VLN A;  1QFN A;  4K5S A;  1K0A A;  4RI7 A;  1SYR A;  3M9J A;  2GT5 A;  1BAY A;  3H79 A;  2C0G A;  2E2G A;  3KCM A;  4ZBA A;  2AB6 A;  5IMF A;  3KD0 A;  1MTC A;  3F3Q A;  4FYB A;  5IQY A;  1TRU A;  3U6V A;  4X0X A;  2GGT A;  2FD3 A;  4HS1 A;  1AQX A;  2P5Q A;  2MMZ A;  2KLX A;  4POL A;  3W6G A;  3F0I A;  3F4S A;  3HXS A;  4ICY A;  4GCI A;  1GL8 A;  3GKM A;  2CAQ A;  4K7N A;  5D96 A;  1K0C A;  1B9X C;  1YQ1 A;  3D0Z A;  4O5U A;  2CZ2 A;  2IMI A;  5IPG A;  3QPM A;  4IP1 A;  2IME A;  3ED3 A;  1GSY A;  1ABA A;  1R5P A;  1OC9 A;  3N9J A;  1JZO A;  4GSS A;  1SL0 B;  2GTU A;  3M3M A;  2OBK A;  5KOX A;  3KJY A;  3GMF A;  1B9Y C;  2GZZ A;  3LEF A;  4OCE A;  1XOB A;  2VD1 A;  3P7X A;  4PUF C;  3FKF A;  4Z2R A;  4A5P A;  4ZL7 A;  2QA2 A;  3UAP A;  4IJ3 A;  1R4W A;  1AQV A;  6GST A;  3ZMK A;  4EO3 A;  2BTO T;  4DSS B;  2L5O A;  4BWQ A;  2A2S A;  2L57 A;  2ON7 A;  2H75 A;  4KF9 A;  4NWY A;  4ZL8 A;  1FOH A;  4POK A;  2I1U A;  2AJQ B;  5ECK B;  3S9F A;  3F63 A;  2C80 A;  1TI1 A;  4IS0 A;  1ON4 A;  3F4T A;  2ALB A;  4MH2 A;  2GS3 A;  2HRF A;  4OD7 A;  1EP8 A;  4GLT A;  1F6M C;  4XCS A;  5ECO B;  1ZZY A;  4GF0 A;  2ZNM A;  1EV9 A;  1HYU A;  4TR3 A;  4F2I A;  2CVD A;  3O3T A;  4PNG A;  5JWO B;  2DSA A;  1O81 A;  1V2A A;  4EIP A;  2V41 A;  1TTZ A;  1Q98 A;  1SKW B;  2H73 A;  1M2A A;  5J9B A;  4ZL9 A;  5G1L A;  1G7O A;  2K8S A;  2R0G A;  1A0R P;  3FZ4 A;  4I6X A;  2LTK A;  2M46 A;  3UEM A;  2PGT A;  22GS A;  4NMU A;  1OC9 B;  1X5E A;  3DXB A;  3TGZ A;  3D22 A;  3FMW A;  4K2D A;  6GSX A;  2WGR A;  3CBU A;  13GS A;  3CRU A;  2A4H A;  4PQ1 A;  3VUR A;  3LXT A;  5IO2 A;  4ML6 A;  1U87 A;  4WF4 A;  3GST A;  4ZB6 A;  2CAI A;  4MPF A;  1XCC A;  1OE7 A;  1SKS B;  1A2M A;  4MZC A;  4POB A;  2TRC P;  5CRH A;  3A2W A;  1CQG A;  1CQH A;  1M9A A;  2CV4 A;  2KP1 A;  3LYK A;  2PMT A;  2QC7 A;  3TB2 A;  2JZS A;  4MP4 A;  2KHP A;  3IHG A;  1ACV A;  4WXT A;  4IJI A;  3EMX A;  4TXO A;  3Q19 A;  1K0N A;  4GQF A;  1XIY A;  1HNA A;  1JZR A;  5DBQ A;  1RW1 A;  2JAD A;  2HNL A;  4H86 A;  4AF2 A;  4V1A p;  2X64 A;  4WET A;  3E0U A;  2VCX A;  2OAC A;  4FYC A;  3QMX A;  2RLI A;  5HFG A;  2RM5 A;  5EL8 A;  3ZYW A;  1ZMA A;  3HJO A;  5J4U A;  3ZIV A;  1ZL9 A;  2LKU A;  3GUS A;  1TOF A;  4Q5Q A;  1F9M A;  2HSM A;  3BCI A;  4HI7 A;  3EWL A;  2JL4 A;  2O87 A;  1R26 A;  3GNJ A;  1GTI A;  3VWW A;  4NXI A;  1JFU A;  1YKA A;  2B5Y A;  1HQO A;  3C1S A;  3E9J B;  2X4A A;  4KCE A;  4JU5 A;  4DEJ A;  2B6M A;  1GP1 A;  1FVJ A;  2LNS A;  4V2M A;  5IM9 A;  5H5R A;  1GUK A;  3TCO A;  3F6F A;  4YQU A;  2FUG 2;  2MBS A;  3V1W A;  5A4W A;  1SJZ A;  3BOA A;  7GSS A;  2LJK A;  3M1G A;  5H5Q A;  3GUR A;  3F4R A;  5DDL A;  2YJH A;  2C1Y A;  3WGD A;  1WP0 A;  2FGX A;  4K7O A;  1VF1 A;  1K0M A;  2PER A;  2IFQ A;  3CSI A;  1S3A A;  4G10 A;  1YY7 A;  2VCZ A;  4MDC A;  1EV4 A;  1MDI A;  2GSQ A;  3FK8 A;  4N10 A;  4AGS A;  1TI3 A;  6GSS A;  2OE1 A;  3GRX A;  1GLQ A;  1PX6 A;  2G2Q A;  2OE3 A;  4IVF A;  2OE0 A;  3QCP A;  1SK2 A;  4ZIJ A;  3IRA A;  2H66 A;  1O8X A;  2HSY A;  6GSW A;  4I2T A;  4TN8 A;  2HRN A;  5ID2 A;  4ULX A;  4KB3 A;  5ELG A;  2MMO A;  5IPH A;  3EU4 A;  3WD6 A;  4ISD A;  3GL5 A;  4MAB A;  1XWK A;  1NSW A;  5DJM A;  1S3D A;  5F0G A;  2VCW A;  1TKD B;  5BMU A;  2DBC A;  3BBY A;  1ERT A;  3TKS C;  1GSQ A;  5DJL A;  2DC5 A;  5IMD A;  5CRD A;  3KH7 A;  4O92 A;  4TW5 A;  2X99 A;  2GDR A;  4ECI A;  1RQM A;  1QQ2 A;  4F82 A;  3P90 A;  2YV7 A;  4PUR A;  2YJ7 A;  4G0K A;  1PKW A;  4Z2U A;  4K0G A;  4IBP A;  1X5D A;  4HDE A;  5ECR B;  3RDW A;  4L0U A;  1M2D A;  4EDY A;  5ENU A;  1B4Q A;  2H70 A;  2N5F A;  2I9H A;  3VFI A;  20GS A;  3HD5 A;  3D4T A;  1RK4 A;  3CMI A;  5GZZ B;  4BPY A;  4EE0 A;  1ILO A;  2IFQ B;  3N5O A;  3NZN A;  3IE3 A;  3FR9 A;  3Q74 A;  4EKZ A;  4XS1 A;  3L9U A;  4IHU A;  5G31 A;  4HU9 A;  4BWS A;  2LRC A;  2JZT A;  3F3R A;  1A23 A;  2H6X A;  5E4W A;  4MJB A;  3KM6 A;  2NBS A;  5BRT A;  5ECL B;  4JED A;  1UA5 A;  1OC3 A;  4XRA A;  1GNW A;  2HI7 A;  2C0F A;  4K2X A;  2LQQ A;  3L4N A;  1ZGN A;  2JAC A;  4MLY A;  1XFL A;  2VL9 A;  4MF6 A;  4KH7 A;  1A2J A;  2I3Y A;  4NV5 A;  5HR0 A;  5ECI B;  4TXV A;  4GRF A;  1T3B A;  4I8B A;  1URM A;  3WYW A;  2JSZ A;  5A4V A;  1Z6M A;  5ECN B;  2B7J A;  4MMM A;  2DJJ A;  4NHW A;  3GHA A;  3GTU A;  3L78 A;  4FQU A;  5KN1 A;  1QGV A;  3IA1 A;  2WZ9 A;  4OO4 A;  4CY6 A;  3F8U A;  2XBI A;  3VI7 A;  1ERU A;  3IAS 2;  4USS A;  1XZO A;  16GS A;  1MDJ A;  2H0I A;  2L6C A;  5CRW A;  3SWL A;  1K0D A;  1XWC A;  4HUA A;  3ZZX A;  3WT1 A;  9GSS A;  2H76 A;  2LRN A;  4G0I A;  3KH9 A;  5DCH A;  1HNB A;  4IN0 A;  3M9K A;  1T4Z A;  1YKC A;  3MYD A;  2B3S A;  4L8E A;  2BJX A;  18GS A;  1HD2 A;  4KA0 A;  1O7U A;  2YZU A;  2GQL A;  4GSN A;  2VAF A;  2L5L A;  3GSS A;  5JCW A;  5AIX A;  3KP8 A;  4K9Z A;  1EP7 A;  3PIN A;  3MSZ A;  3LOR A;  1F2E A;  1N8J A;  2DJ0 A;  1YZX A;  4MZB A;  4IP6 A;  2F9S A;  1XPV A;  4IQA A;  2VM1 A;  3G7I A;  2V1M A;  1IYH A;  2V6O A;  4MK3 A;  2VCV A;  1O85 A;  2AV4 A;  3LQ7 A;  5GAP D;  2MBT A;  2BMX A;  5CRG A;  3UBK A;  4NPB A;  4IEL A;  2ES7 A;  2VUP A;  3L9V A;  4HJ2 A;  5IMC A;  2DKH A;  3HZ8 A;  4BVY A;  2C3Q A;  1THO A;  1N2A A;  1ZYP A;  5H5S A;  5HR2 A;  1Y25 A;  4D73 A;  3GIX A;  3GTU B;  3PH9 A;  3A2X A;  1SJI A;  1LJR A;  4LLR A;  1QK8 A;  4E8E A;  4J56 E;  1PGT A;  1XWG A;  1WE0 A;  1EGR A;  1G6Y A;  3IC4 A;  3CSH A;  3J7Y b;  1YEX A;  3IC8 A;  1DSB A;  2J23 A;  2QA1 A;  3NIV A;  1WJK A;  2P5R A;  3APS A;  4XTS A;  4LA1 A;  5HFI A;  5HR1 A;  1F37 A;  2Z9S A;  5FHI A;  1UVZ A;  4N0V A;  5AIS A;  5HFK A;  2O8V B;  4LL1 B;  2IMK A;  2GSR A;  2YZH A;  1G7E A;  3HCZ A;  3EVI A;  3FYG A;  4OCF A;  5D9X A;  5ECQ B;  2HLS A;  2CQ9 A;  4IGJ A;  2WJU A;  2VOC A;  2HT9 A;  4PUA A;  2J9H A;  3CTF A;  3OR5 A;  1SL1 B;  2GQM A;  1TXX A;  2P31 A;  2C8U A;  2AYT A;  10GS A;  3Q18 A;  3HDC A;  4ZXG A;  2H0G A;  1K0O A;  2EIQ A;  4K1F A;  2WRT A;  3FRC A;  3FW2 A;  3LWA A;  3KMN A;  1I9D A;  2YWM A;  2R0P A;  2FLS A;  2YN1 A;  2HRA A;  2H6Z A;  4V2N A;  4QL9 A;  3US3 A;  1SD9 A;  1TK0 B;  3GN3 A;  3UIW A;  4GQC A;  4YH2 A;  1GSS A;  2DJ2 A;  1T00 A;  3Q6O A;  3UOM A;  2L59 A;  3C7M A;  3LYP A;  3TRP A;  1SYX A;  2PU9 C;  5CAX A;  3FY7 A;  2OJL A;  2LJA A;  3I69 A;  4BVY B;  1G6W A;  2X8C A;  1IYI A;  2MYG A;  2VL3 A;  5G30 A;  1W89 A;  4D73 B;  4F9Z A;  5EPF A;  1TRS A;  4V2L A;  2O89 A;  1ZYN A;  4KDU A;  3QOU A;  2E2M A;  4MH3 A;  2FCH A;  5D93 A;  1OVN A;  4G9H A;  5IOX A;  4NV2 A;  4EXJ A;  2C4J A;  2XPD A;  2RII A;  4N11 A;  3KTB A;  2FY6 A;  1X9S B;  2HZF A;  3GH9 A;  1XVQ A;  3EIN A;  4KE3 A;  1FW1 A;  1PQN A;  3VWX A;  1NM3 A;  3D5J A;  4GWR A;  3UVT A;  2WB9 A;  1Z7R A;  2GST A;  1J9B A;  1GTU A;  3NOF A;  3FZ5 A;  3GX8 A;  4EDZ A;  2PVQ A;  3GA4 A;  4MF5 A;  4PXO A;  1XBS A;  2DIZ A;  2HRK A;  2WUL A;  1X9M B;  5JCU A;  2IWT A;  4EF0 A;  2WFC A;  4HJM A;  1GUM A;  11GS A;  2XPE A;  3TRQ A;  4K5R A;  3D21 A;  3MNG A;  4L5L A;  1PSQ A;  4IW9 A;  3GX0 A;  2KUC A;  4J2F A;  5J3R A;  5JCG A;  4XS6 A;  1SL2 B;  1TK5 B;  4POM A;  2H1A A;  5F06 A;  1UC7 A;  4WBJ A;  2DJ3 A;  2H01 A;  2E0Q A;  2CX3 A;  2GLR A;  3LFL A;  4MA9 A;  1TJD A;  2C3N A;  1AAZ A;  4Q5F A;  1WPI A;  4TR0 A;  3QFB C;  3CSJ A;  3DYR A;  1XW5 A;  5DAL A;  3KGK A;  2YWN A;  3GFK A;  4CY8 A;  4OWY A;  1ML6 A;  4LMV A;  1EWX A;  1TU8 A;  4TKY A;  3EPT A;  4O5R A;  1V9W A;  3IDV A;  1PKZ A;  5DQY A;  4PNF A;  3TKS E;  4MJE A;  2R3X A;  4LMW A;  4F03 A;  2FA8 A;  1BX9 A;  4TR4 A;  3IAM 2;  3FR3 A;  4ZB8 A;  2JZR A;  2B5E A;  2RM6 A;  2GT6 A;  4K0N A;  2MMN A;  5GAN D;  3KTL A;  3PR8 A;  4QQ7 A;  2FWH A;  3D4M A;  4EL1 A;  2QKE A;  1X0R A;  3R2Q A;  2ZUP A;  4ACS A;  2ON5 A;  4MJC A;  1M99 A;  2DIY A;  2YWO A;  2QGV A;  2A2R A;  2H1B A;  4ILF A;  1SKR B;  1R7H A;  2FHE A;  2YAN A;  3ZLP A;  1V98 A;  3H4K A;  17GS A;  4O7H A;  3WT2 A;  1T4Y A;  3ISO A;  4JE1 A;  3GKK A;  1T8E B;  3RBT A;  2NDO A;  3IK7 A;  3P2A A;  1O8W A;  3APQ A;  5B6M A;  3FHK A;  2UZ8 A;  4WR5 A;  1M2B A;  3RHC A;  8GSS A;  1FOV A;  3G7Y A;  1NHY A;  2AAW A;  5DAK A;  2R5G A;  2DML A;  2PUK C;  5INY A;  2VD0 A;  3DML A;  2H71 A;  3DKS A;  5IMV A;  4IQ1 A;  5ECP B;  3RPN A;  2IJY A;  1JLV A;  1GSE A;  5LD0 A;  3QDN A;  3A5I A;  1XWA A;  3J7Y k;  1JHB A;  1XW9 A;  1B48 A;  5G5F A;  2X49 A;  1YEP A;  4HEA 2;  4WBR D;  3H1N A;  5B6N A;  5B8A A;  2M72 A;  1OYJ A;  3DEX A;  4KSM A;  3GYK A;  5GST A;  1PX7 A;  1WIK A;  1FG4 A;  2DKI A;  3VPT A;  4HZ2 A;  5AIV A;  2YNX A;  5DAL B;  1PRX A;  1R5A A;  2X8G A;  2LEG A;  1LU4 A;  4CHS A;  5C04 A;  5D73 A;  2FA4 A;  3TUE A;  3LSZ A;  1AXD A;  3G9B A;  1JLW A;  3UVH A;  3HVS A;  2VO4 A;  3CYN A;  1FVK A;  5COH A;  5HR3 A;  2RUE A;  1I5G A;  1TRV A;  2V6K A;  1A8Y A;  1U3I A;  3LJR A;  1O73 A;  2YWI A;  2GZY A;  4K8M A;  1ZYQ B;  4AJ8 A;  1T1V A;  3UBL A;  4TOP A;  3SBC A;  5KN0 A;  5HQP A;  5DVB A;  2L6D A;  5IMA A;  3PGT A;  4YQM A;  1PL1 A;  1H75 A;  2YV9 A;  4FIW A;  3QAG A;  3KMO A;  1OAZ A;  5C00 A;  4EIQ A;  1K3Y A;  4HOJ A;  2GSS A;  4Q5N A;  3F6D A;  2IMD A;  3ZIJ A;  3C1R A;  4XIH A;  3ZFL A;  4DSR A;  2F8F A;  4ID0 A;  2YPM A;  5JWQ B;  4Z2T A;  3E3E A;  2TRX A;  4YKF A;  4RUV A;  2XHF A;  4YKG A;  1XWB A;  3QFA C;  2K6V A;  3KIJ A;  2V32 A;  3LG6 A;  2MMA A;  5DAK B;  1DBY A;  3TOU A;  1TP9 A;  4CDO A;  3LW9 A;  1BED A;  2PN8 A;  2VM2 A;  3ZML A;  3ZTL A;  3W8J A;  5G1K A;  1JZW A;  2N5B A;  1QXH A;  3ZIT A;  3TKR A;  5F05 A;  4GXZ A;  4ECC A;  3DD3 A;  1EEM A;  5D8I A;  4O5Q A;  2YOI A;  3KXO A;  1F3A A;  1TRW A;  4K7I A;  5F07 A;  1ERW A;  3EYT A;  4JR4 A;  5KN2 A;  3DRN A;  4I5Q A;  4ZBD A;  4L5O A;  3BD2 A;  4I97 A;  1USB A;  3IPZ A;  1OE8 A;  4FO5 A;  2VLU A;  1KBN A;  4PX1 A;  1B4P A;  14GS A;  3CRT A;  4J57 E;  1DUG A;  4GST A;  1K0B A;  3GL3 A;  4RQR A;  1SK0 A;  3VK9 A;  2QSI A;  4GTU A;  1ZYE A;  1FO5 A;  6GSV A;  2JSY A;  1Z5Y E;  1A24 A;  4KCA A;  4MCU A;  2EIR A;  4JRR A;  1KEB A;  4RQX A;  3HYP A;  5EVO A;  5J9C A;  1PMT A;  1AIU A;  3ZVJ A;  3I43 A;  2D2Z A;  2HE3 A;  2FWG A;  2CA8 A;  3L0H A;  2G0F A;  2X8H A;  2FWF A;  1VF3 A;  3R3E A;  3KZQ A;  3W8S A;  1Z7P A;  4KGI A;  4DVC A;  1VRS D;  2MZC A;  1G0T A;  2PBJ A;  1V40 A;  2DMM A;  2IMF A;  4ZBB A;  1A0F A;  3TKQ A;  2PPT A;  3ZFB A;  3EC3 A;  3IBH A;  5CNW A;  4N0Z A;  1AUC A;  3ZRE A;  2CX4 A;  1AW9 A;  3CXG A;  3DWV A;  3A5W A;  3M0F A;  3WGE A;  1AC1 A;  5CP1 A;  3HJM A;  5IOW A;  4TVE A;  1EOH A;  4AJ7 A;  3I9V 2;  2LS5 A;  4KSO A;  4LL4 B;  3C8E A;  4Q5R A;  3FZA A;  3HKR A;  2AUV A;  2H8L A;  4JZQ A;  3LXZ A;  3DIE A;  2H1G A;  2LUS A;  5CYY A;  1GSD A;  3EUR A;  5ECM B;  4JBB A;  3GV1 A;  1NW2 A;  1OKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...