3KP8A

The thioredoxin-like domain of a vkor homolog from synechococcus sp.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
94
structure length
94
Chain Sequence
SPLAVGLAAHLRQIGGTMYGAYWCPHCQDQKELFGAAFDQVPYVECSPNGPGTPQAQECTEAGITSYPTWIINGRTYTGVRSLEALAVASGYPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords VKORC1/thioredoxin domain protein
publication title Structure of a bacterial homologue of vitamin K epoxide reductase.
pubmed doi rcsb
source organism Synechococcus sp.
total genus 29
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2009-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3kp8A00
2B5XA 1BAYA 3BCIA 3F4TA 3N9JA 3EURA 1HYUA 2FA8A 3W8JA 4XRAA 4WBJA 2P5QA 1OC9B 3EVIA 1U87A 4KDUA 2VL2A 4KUNA 2R4VA 4TXOB 4EL1A 3QOUA 4ZBAA 1GL8A 1M2AA 1U88A 2LJKA 4PQ1A 5HFKA 1I5GA 4PUFC 4DSSA 1WWJA 4O32A 2D2ZA 2LUSA 2LQQA 3MAKA 4JE1A 1DE2A 7GSSA 2FWEA 1HNAA 3NOFA 2KHPA 2H6ZA 4HEA2 1GRXA 3P2AA 2HRNA 1NW2A 2GT5A 3DXBA 3TKSA 2LSTA 2GSRA 1A0FA 4TOPA 1FHEA 1CQHA 1YKAA 4IBPA 4JR4A 3H1NA 5IPHA 4NMUA 1OKTA 3C73A 2LNTA 3N5OA 5A4UA 6GSYA 5DCGA 4N0ZA 1T4YA 2WZ9A 2DLXA 3HZ4A 5E4WA 1XWCA 2DMMA 2GDRA 1GTBA 2OE1A 3UAPA 2I3YA 1OC3A 3BBYA 1Z9HA 2VL2C 2OE0A 1PX6A 4L5LA 3IOSA 4J57E 1HQOA 1OC8A 3GL5A 4HZ4A 4ZIJA 4XTSA 4KCAA 3UMAA 4KB3A 5JWRB 2PUKC 4KNDA 4L8EA 4TRXA 4NHWA 3RPNA 3VPQA 2P31A 5E59A 4XHMA 4TR1B 3LG6A 3GUSA 2GVPA 1E6BA 4LMVA 1M9AA 3KH9A 1LBKA 3VFIA 2NDOA 3TKSC 3ZVJD 1ZYQB 1XW5A 3D0ZA 4YH2A 3E9JB 3ZMKA 2M46A 1RW1A 5ECPB 1EGOA 2HYXA 1PN9A 1OC9A 4N0VA 3RHBA 1Z7PA 4CHSA 4WR5A 2OBKA 2AHEA 1JHBA 4TXOA 1SD9A 1EV9A 1FOVA 5J41A 1TJDA 3ZMLA 4K7NA 2B7KA 2MMNA 5D9TA 1NHOA 1MDJA 4L0UA 3IBHA 3GNJA 2DIYA 3U6VA 2AJQB 2IMFA 4H86A 1R4WA 2WRTA 2VL3A 3HKRA 3KXOA 3APOA 1V40A 3APQA 2HT9A 5DALA 4AJ8A 2VL9A 1ERTA 5G5FA 5CO3A 1TU8A 2CVKA 1F6MC 5ECOB 4FO5A 3Q18A 4E8HA 1XOBA 5DCHA 3TKRA 2QC7A 2VCQA 2XPDA 2V2GA 3GX8A 1BQ7A 3A2WA 3BJ5A 4BWQA 3EMXA 4MJCA 1ILOA 1FB6A 5HFGA 3PR8A 2DSAA 3U5RE 1OVNA 1J9BA 3CTFA 5IOWA 3FHKA 2HNLA 3IXRA 4P3YB 3M9KA 2L6DA 1GSFA 5F06A 3UVTA 3E3EA 3JCML 2ES7A 4G9HA 4IKHA 3A3TA 1X5DA 1DUGA 4F0BA 4XS1A 4MH3A 1XXUA 4XS4A 2K18A 4IJ3A 3D5JA 1PD21 2EIRA 2LEGA 2H1BA 4YAPA 4V2MA 4DVCA 3M1GA 1GNWA 2C8UA 2C1YA 3QAWA 2E7PA 2FWFA 3WGXA 4MP4A 2J9HA 2MBTA 3CSJA 1USBA 3VPTA 4TW5A 1XIYA 1YF1A 1XW6A 4K7IA 1TK5B 4LMWA 5COHA 4EDZA 4MABA 2H0IA 1S3AA 2AB6A 1V98A 4V1Ag 3ME8A 4ECJA 2GSSA 1ML6A 1TRUA 2VCVA 3G7JA 1K0BA 3C7MA 4KGIA 1S3CA 5GSTA 3H4KA 1GTUA 5IQYA 4ISDA 1T8EB 1MDKA 1PKZA 3FZ4A 5CP1A 2XHFA 4I2UA 4KX4A 4ILFA 1TRSA 2DC5A 1T4ZA 1M2BA 2YN1A 3DIEA 2X8CA 4J56E 3TRQA 3FYGA 1FB0A 1SYXA 2PN8A 5B8AA 2A2RA 4OWYA 1VGLA 5DAKB 2PERA 1XPVA 4POMA 2H8LA 4V2LA 1IYHA 4NWYA 20GSA 22GSA 2JL4A 2L5LA 2CZ2A 2C3NA 1SYRA 3EINA 2B1KA 2NVLA 2H0GA 4FIWA 5INYA 2RLIA 3D22A 1VF4A 1UVZA 2CV4A 1MEKA 3TB2A 2LRCA 3VURA 3FKFA 2B5YA 5EVOA 3GL3A 5AGYA 1Q98A 5KEJA 3BOAA 1FW1A 2V1MA 5GZZB 1S3DA 4GRFA 2DJ2A 1Z6MA 2C3TA 2N5AA 5J4UA 4KDXA 2G2QA 1TK8B 2RIIA 5A4WA 6GSSA 4RQXA 3ED3A 5D9XA 2X99A 3GKKA 1WRYA 3ZFBA 1JFUA 2O85A 4MH2A 2H30A 2C0FA 1XFLA 1Z5YE 1WIKA 1W4VA 3IAM2 3DEXA 3KTLA 3ZIVA 4JBBA 1SK2A 4ZILA 2H71A 1ZOFA 4OFNA 3MNGA 1GULA 3D6IA 2F9SA 4MPFA 5FT3A 5A4VA 1B9YC 3QFAC 1X9MB 3VWWA 3M0FA 3TJGA 1MDIA 1SJZA 5DQSA 1A23A 4PX1A 1ZGNA 1Z7RA 2JADA 3F6DA 3GKXA 1F2EA 4POBA 5DAKA 4HJMA 4HDEA 2OA7A 2VM1A 3IA1A 4TR3A 3RHCA 1BG5A 3HJOA 4GSSA 2PPTA 5IMVA 4I97A 4ZB8A 4DSQA 1GUMA 4I2TA 1URMA 2NPBA 2X64A 3KCMA 1TU7A 2A2SA 1EV4A 1M99A 3C71A 2BJXA 2K8SA 1GP1A 3I69A 4WXTA 3D4TA 1TRVA 2WB9A 3QPMA 2H72A 3DYRA 2GZYA 1X0RA 2R2JA 4MA9A 1A2LA 4PNFA 2R5GA 4OO5A 4DSRA 2PU9C 4ZL8A 5IOXA 2PMTA 1TI1A 4Q5RA 1C72A 1OKDA 2E0QA 1WE0A 1XWGA 1R26A 1G6YA 5GSSA 3GN3A 1R5PA 1SKWB 2NBSA 4KSMA 4GSTA 2CAQA 3ME7A 1PL2A 4ZL7A 4NV2A 5ECHB 3VLNA 4BVYA 1AXDA 4ML1A 2I9HA 2YWNA 1THOA 3D4MA 5IIZA 1DSBA 4OO4A 4ML6A 5IMCA 5F07A 4BL7A 4L0WA 4OCFA 4O7HA 4ID0A 1BYEA 2GQKA 4J2FA 5IO0A 4KH7A 1ZZYA 3ZZXA 1SL1B 1THXA 3UARA 3GTUA 5HR1A 5JCUA 4QQ7A 1SK1A 4ZBDA 3GRXA 3TKSE 4LLRA 1E2YA 4RI7A 1K3LA 1R7HA 4ZB9A 3EMPA 1KBNA 2LJAA 1SENA 3ISOA 4EKZA 1XWKA 2IMKA 1UA5A 1WP0A 1AQXA 2WULA 1B9XC 2H6XA 5C04A 4YQUA 2DIZA 5B6MA 4F0CA 2KP2A 3EYTA 2OBIA 5IM9A 1IYIA 1GTIA 2DJJA 1EP7A 2RUFA 2YWIA 1ACVA 1VF3A 2KP1A 4NAXA 8GSSA 4IN0A 1AAZA 2MMAA 4F82A 1SJIA 3VWVA 4NPBA 3H79A 4MPGA 3J7Yb 2JSYA 4BA7A 2WS2A 4JZQA 1SL2B 1ERWA 2GS3A 5G5EA 4IS0A 2FCHA 1R5AA 2VCXA 4K6XA 1AQWA 2GQLA 1ST9A 1AC1A 2ON5A 1AW9A 5CYYA 3TJBA 3I6AA 3RAZA 1GSQA 1PMTA 2YZHA 3O3TA 3OR5A 5ELGA 2L4CA 3P8WA 3AY8A 5J9CA 1JZOA 4QL9A 3I43A 3HJMA 2FUG2 4XS6A 4NXIA 3IPZA 2WGRA 4GWRA 6GSVA 4IGJA 5JWQB 4EO3A 2H74A 2MYGA 3EC3A 1O73A 3GH9A 1PGTA 1PSQA 3TRXA 4TR4A 3IR4A 3PGTA 5D96A 2CX3A 2CA8A 3DGQA 4FYBA 2WDUA 1A8LA 4EC0A 1F9MA 4EUYA 4HJ2A 1KNGA 1O8WA 4MJEA 3FR6A 3LXTA 4GQCA 2IMIA 1BJXA 1JLVA 4FYUA 3TOTA 17GSA 4ECIA 4LA1A 1X5EA 3M8NA 1WJKA 5G1KA 4ZL9A 1O7UA 5AISA 1YJ6A 1G7EA 5CRHA 3VI7A 4TN8A 12GSA 1G6WA 1GTAA 4PNGA 4XIHA 4MZBA 4FYCA 10GSA 1TRWA 3GV1A 5G2ZA 4F9ZA 4EVMA 5ECQB 1GSSA 4ZBBA 2PVQA 5ECSA 5ID2B 9GSSA 4FH8A 1QK8A 5IO2A 2YCDA 4DEJA 2X8HA 2LTKA 4JRRA 4MF7A 2DJ0A 3IK7A 1XWAA 1TKDB 4IP1A 3UEMA 2VCZA 2K8VA 1SK0A 3DVWA 5HR3A 4Q5QA 2BMXA 2NTOA 1XBSA 1OE8A 2LNSA 3F0IA 2OE3A 2FWGA 3EU4A 3D21A 5FWGA 5ECKB 3MWHA 2R37A 2GTUA 4IW9A 4TR1A 2WFCA 3GIXA 3GH6A 1GLPA 1FVJA 3UVHA 4MZCA 3P7XA 4ECCA 2FA4A 1SU9A 2H6YA 1BX9A 2C0DA 3H8QA 3FK8A 5G31A 3LXZA 1T3BA 3F8UA 13GSA 4MZWA 5B8BA 2H66A 3GKMA 1M2DA 6GSXA 3HVVA 4XRDA 3A5WA 3KM6A 1NSWA 5LNKe 1EWXA 4XCSA 4WEYA 1Z3EA 4HOJA 3MDKA 1X9SB 5DJMA 2I4AA 4HU7A 2GSTA 3GMFA 2JZTA 4X0XA 5AIVA 1NM3A 4N10A 2RM6A 5D9VA 3TGZA 18GSA 2VCTA 2AV4A 3F3QA 1ZL9A 1AUCA 5FHIA 1TI3A 3C8EA 1ON4A 1K0DA 2IMEA 2LS5A 4HQZA 5EY6A 5KN0A 1SL0B 3LSZA 1GWCA 3GURA 6GSWA 1Z6NA 2M80A 2REMA 3PINA 2HSHA 4O92A 2HZEB 2V41A 1VRSD 2YNXA 3IC4A 3M3MA 1JLWA 1V58A 2C3QA 5H5RA 1SD8A 3LQ7A 5F8BA 5ID2A 2ALBA 3FZAA 2L4QA 2GZPA 2HXKA 19GSA 3GKNA 4OFTA 3WT1A 3W6GA 1QUWA 5ECLB 16GSA 1EEJA 5ECNB 4WKWA 5A5KA 1TK0B 1F37A 4OCEA 14GSA 2GT6A 2LKUA 3O6TA 2LJRA 2QSIA 1RQMA 4ZB6A 3VWXA 3LWAA 4MDCA 5AIXA 1K0OA 2O89A 4RI6A 4N11A 3KGKA 3UL3A 1ZMAA 2H19A 4MK3A 1KTEA 1GNEA 4KW6A 1QFNA 4HI7A 3F6FA 4GXZA 11GSA 4HUAA 3A2VA 4L5OA 4Q5FA 2YP6A 5EPFA 1F3AA 2F8AA 1ZCPA 2XC2A 1W89A 5B7CA 1A24A 4TXVA 2C80A 2L6CA 1GSDA 1GSEA 2CAIA 2JZRA 4K0NA 4IHUA 4PURA 5CRGA 4MF5A 3WGDA 1QMVA 5KN1A 2PWJA 2A4VA 3HD5A 2L5OA 3G9BA 2AAWA 5G1LA 2B5EA 3FY7A 2R3XA 4PGTA 5J5NA 4WR4A 2X8GA 3TUEA 1X5CA 2R6KA 3HVXA 1GUKA 2VD0A 5D9WA 4OMVA 1EZKA 4RQRA 2MMZA 1M0UA 1Y25A 3FR9A 5HR2A 1YKCA 3RBTA 2VUPA 4F2IA 3ZITA 5CRWA 4AJ7A 1PX7A 2V6KA 2JU5A 3US3A 2ON7A 3RDWA 3SBCA 2HZEA 1PQNA 3C1RA 2CVDA 1XVQA 2YPMA 3UJ1A 1QGVA 5JCGA 1XVWA 2H1GA 4WF5A 3GYKA 3HXSA 4V2NA 2I81A 4MCUA 3KJYA 3ERGA 1OAZA 4D73B 1T7PB 2LRNA 2KUCA 4HZ2A 2H01A 4K9ZA 5IMZA 3ZLPA 2H0HA 2VD1A 3ZTLA 2MZCA 1CQGA 2JSZA 3KP9A 1HNBA 2DMLA 2RM5A 2ZCTA 5ECMB 2EC4A 1ERVA 5H5QA 1OYJA 1A2JA 4V1Ap 3KMOA 3F9UA 1YDKA 3ERFA 3TJKA 3C1SA 3WGEA 2VLVA 5ENUA 3MSZA 4G19A 2E2GA 2Z9SA 1O85A 1DE1A 3BD2A 4WETA 2YJ7A 1X9WB 3CTGA 3TJFA 1M7TA 2FNOA 3HJPA 2DJ3A 1GUHA 1O6JA 1WOUA 3TCOA 2XBQA 5L71A 2CZ3A 3P90A 1K3OA 4BVXA 1SKRB 4K7OA 3LYPA 2RUEA 1V2AA 2FD3A 2VO4A 3VK9A 1QXHA 2HI7A 1JZRA 2HRFA 2KLXA 3F4RA 1PA3A 1T00A 3KIJA 2K9FA 3UBLA 3HHVA 2OACA 4LL1B 1A2MA 3QMXA 1YF0A 3HDCA 3Q6OA 1EOHA 5IMAA 1EEMA 3CMIA 2O7KA 4GCIA 3IK9A 4IJIA 3GA4A 4MMMA 5DALB 1PL1A 2BTOT 5LCZA 1WPIA 2YWOA 2GGTA 3GX0A 5ELAA 1MD3A 2PGTA 4POKA 2YV9A 5IMDA 1JZDA 1MD4A 4POLA 4EXJA 2F8FA 5J3RA 2LQOA 2H76A 3TRPA 4YQMA 4N30A 1ABAA 3IHQA 4BWSA 4MF6A 5ECRB 4GQFA 1RK4A 2YANA 5C00A 2N5BA 4IELA 1J08A 4D73A 1NHYA 3L9UA 2ZUPA 2WCIA 1Q4JA 2TIRA 4G10A 1YEXA 5CAXA 1JZWA 2FWHA 2VLUA 3QD9A 1T1VA 2I1UA 5D73A 4KCEA 2B1LA 4ULXA 4K8MA 3QR6A 4XS4B 2H1DA 3Q74A 1VF1A 1G0TA 1UC7A 3V1WA 4GF0A 4LL4B 1AIUA 1V57A 3IAS2 4CW9A 5HR0A 4TKYA 1ERUA 5JCWA 3O76A 1O8XA 2YV7A 1U6TA 2C0GA 2V32A 4JR6A 4YAVA 3BCKA 5DQYA 4Q5NA 2GSQA 3ZFLA 3Q19A 3NZNA 5G30A 4WF4A 2HE3A 4KA0A 4ZXGA 2YZUA 3M9JA 5B6NA 2GZZA 3FW2A 4GSNA 3CSIA 2YJHA 2O87A 3QCPA 2HLSA 3H93A 1ZYEA 4JU5A 4ACSA 3FRCA 4JEDA 3R2QA 5DDLA 4IVFA 1PRXA 5CRDA 4RUVA 3FEUA 3ERWA 2QKEA 1FAAA 3DMLA 3APSA 1EP8A 2VM2A 2GQMA 1GLQA 3DVXA 2YWMA 1GH2A 3K8NA 3GHAA 3KH7A 5IMFA 5JWOB 3ZYWA 5IPGA 4MJAA 1O81A 5CNWA 2MBSA 3SWLA 2YOIA 1K0NA 4PXOA 3WD6A 3PH9A 2C4JA 4Z7XA 1K0CA 1YY7A 4X43A 1TDIA 3GSSA 1OE7A 3EU3A 3L4NA 3ZIJA 4EE0A 2VLTA 4I6XA 5CREA 5F05A 5GAND 4IQAA 1U3IA 2FLSA 3ZVJA 1AQVA 2DJ1A 3LORA 2CT6A 4PQIA 1YQ1A 3VWUA 1SJ6A 1UN2A 2IPAA 2C0EA 2IJYA 1FG4A 5LD0A 4EDYA 3EE2A 1HD2A 3G7YA 3G7IA 1U3AA 2CVBA 2P0GA 4WBRD 2KOKA 3DWVA 4I5QA 2OADA 1K0AA 2FY6A 2TRCP 2CX4A 1TTZA 2E2MA 4KDYA 4KSOA 5GAPD 2G0FA 2H73A 1LU4A 2B6MA 3LEFA 5DJLA 3TOUA 2H70A 1SKSB 1TOFA 2O8VB 4HS1A 2WJUA 4GTUA 2IMDA 1H75A 3TJJA 3KTBA 1G7OA 1XWBA 2JZSA 3KZQA 3IRAA 3L78A 1WMJA 1DBYA 2N5FA 3KP8A 3ZREA 1GSUA 1N2AA 3KD0A 1GSYA 4KE3A 2LRTA 6GSUA 2DBCA 3IDVA 1K3YA 3LGCA 2EIQA 2HZFA 4NHZA 1B4QA 2K6VA 3UBKA 5KN3A 1XCCA 5KN2A 3WT2A 3QFBC 4AGSA 3LYKA 3CRTA 2XBIA 4O5RA 1H4OA 2IFQB 2V6OA 4G2EA 2AYTA 4K1FA 3GSTA 3L9VA 2AUVA 2DJKA 1TP9A 4NV5A 2H1AA 3I9V2 1Y6EA 2CQ9A 4HU9A 2FHEA 4KAEA 3UIWA 4I8BA 2ZNMA 3F3RA 2FGXA 3QAGA 2HFDA 5H5SA 6GSTA 1YEPA 3A2XA 4PQHA 1HNCA 3KMNA 2VCWA 3IE3A 4AF2A 2IIYA 1B8XA 2IN3A 2QGVA 2JACA 3TKPA 3DD3A 4IP6A 4E8EA 4X1UA 3DKSA 5ECIB 2J23A 2EIOA 1XZOA 2PBJA 2H75A 1XOAA 3F4SA 4K0GA 4AJ6A 3TDGA 2PVOC 1B48A 1TXXA 5ABRA 2VIMA 1FO5A 3HA9A 1I9DA 2HSYA 3E0UA 3S9FA 4OD7A 3GFKA 3HVSA 5D8IA 2OJLA 1EOGA 5D93A 1N8JA 4IQ1A 2MMOA 3CBUA 1B4PA 3DRNA 4F03A 3HYPA 3QAVA 3CYNA 4MLYA 4QL7A 1YZXA 2F51A 4MJBA 1KEBA 4DSSB 3NIVA 1TW9A 2TRXA 3GTUB 3ZL5A 3FZ9A 3HY2A 5HFIA 5DBQA 3LJRA 1EGRA 1MTCA 4EF0A 3TKQA 4TR0A 2XPEA 3WYWA 3EWLA 3VI5A 3L0HA 1FVKA 3CRUA 2IFQA 1QQ2A 1LJRA 5F0GA 2F3MA 5DVBA 3UOMA 1XW9A 1J0FA 3CXGA 2P5RA 3CSHA 5J9BA 3QDNA 1VF2A 4CDOA 2L59A 3FR3A 1BEDA 5AN1A 4PUAA 3KEBA 4GLTA 5EL8A 3J7Yk 4ECBA 3F63A 3ZRDA 2VAFA 4K2DA 4OFMA 3IV4A 2OKAA 3L9SA 2L57A 2IWTA 2M72A 2LV3A 1M9BA 4BPYA 2VOCA 4YQVA 4TVEA 1K0MA 2B3SA 1A8YA 3W8SA 3RPPA 3LFLA 1PKWA 2IL3A 3HCZA 1F3BA 3HZ8A 1A0RP 5HQPA 2B7JA 1V9WA 4HQSA 3FZ5A 2GLRA
chains in the Genus database with same CATH superfamily
2B5XA 1BAYA 3BCIA 3F4TA 3N9JA 3EURA 1HYUA 2FA8A 3W8JA 4XRAA 4WBJA 2P5QA 1OC9B 3EVIA 1U87A 4KDUA 2VL2A 4KUNA 2R4VA 4TXOB 4EL1A 3QOUA 4ZBAA 1GL8A 1M2AA 1U88A 2LJKA 4PQ1A 5HFKA 1I5GA 4PUFC 4DSSA 1WWJA 4O32A 2D2ZA 2LUSA 2LQQA 3MAKA 4JE1A 1DE2A 7GSSA 2FWEA 1HNAA 3NOFA 2KHPA 2H6ZA 4HEA2 1GRXA 3P2AA 2HRNA 1NW2A 2GT5A 3DXBA 3TKSA 2LSTA 4CY6A 2GSRA 1XG8A 1A0FA 4TOPA 1FHEA 1CQHA 1YKAA 4IBPA 4JR4A 3H1NA 5IPHA 4NMUA 1OKTA 3C73A 2LNTA 3N5OA 5A4UA 6GSYA 5DCGA 4N0ZA 1T4YA 2WZ9A 2DLXA 3HZ4A 2QA2A 5E4WA 1XWCA 2DMMA 2GDRA 1GTBA 2OE1A 3UAPA 2I3YA 1OC3A 3BBYA 1Z9HA 2VL2C 2OE0A 1PX6A 4L5LA 3IOSA 4J57E 1HQOA 2HRKA 1OC8A 3GL5A 4HZ4A 4ZIJA 4XTSA 4KCAA 3UMAA 4KB3A 5JWRB 2PUKC 4KNDA 4L8EA 4TRXA 4NHWA 4YKFA 3RPNA 3VPQA 2P31A 5E59A 4XHMA 4TR1B 3LG6A 3GUSA 2GVPA 1E6BA 4LMVA 1M9AA 3KH9A 1LBKA 3VFIA 2NDOA 3TKSC 3ZVJD 1ZYQB 1XW5A 3D0ZA 4YH2A 3E9JB 3ZMKA 2M46A 1RW1A 5ECPB 1EGOA 2HYXA 1PN9A 1OC9A 4N0VA 3RHBA 1Z7PA 4CHSA 4WR5A 2OBKA 2AHEA 1JHBA 4TXOA 1SD9A 1EV9A 1FOVA 5J41A 1TJDA 3ZMLA 4K7NA 2B7KA 2MMNA 5D9TA 1NHOA 1MDJA 4L0UA 4Z2RA 3IBHA 3GNJA 2DIYA 3U6VA 2AJQB 2IMFA 4H86A 1R4WA 2WRTA 2VL3A 3HKRA 3KXOA 3APOA 1V40A 3APQA 2HT9A 5DALA 4AJ8A 2VL9A 1ERTA 5G5FA 5CO3A 1TU8A 2CVKA 1F6MC 5ECOB 4FO5A 3Q18A 4E8HA 1XOBA 5DCHA 3TKRA 2QC7A 2VCQA 2XPDA 2V2GA 1FOHA 3GX8A 1BQ7A 5KOWA 3A2WA 3BJ5A 4BWQA 3EMXA 4MJCA 1ILOA 1FB6A 5HFGA 3PR8A 2DSAA 3U5RE 1OVNA 1J9BA 3CTFA 5IOWA 3FHKA 2HNLA 3IXRA 4P3YB 3M9KA 2L6DA 1GSFA 5F06A 3UVTA 3E3EA 3JCML 2ES7A 4G9HA 4IKHA 3A3TA 1X5DA 4O5QA 1DUGA 4F0BA 4XS1A 4MH3A 1XXUA 4XS4A 2K18A 4IJ3A 3D5JA 1PD21 2EIRA 2LEGA 2H1BA 4YAPA 4V2MA 4DVCA 3M1GA 1GNWA 2C8UA 2C1YA 3QAWA 2E7PA 2FWFA 3WGXA 4MP4A 2J9HA 2MBTA 3CSJA 1USBA 3VPTA 4TW5A 1XIYA 1YF1A 1XW6A 4K7IA 1TK5B 4LMWA 5COHA 4EDZA 4MABA 2H0IA 1S3AA 2AB6A 1V98A 4V1Ag 3ME8A 4ECJA 2GSSA 1ML6A 1TRUA 2VCVA 3G7JA 1K0BA 3C7MA 4KGIA 1S3CA 5GSTA 3H4KA 1GTUA 5IQYA 4ISDA 1T8EB 1MDKA 1PKZA 3FZ4A 5CP1A 2XHFA 4I2UA 4KX4A 4ILFA 1TRSA 2DC5A 1T4ZA 1M2BA 2UZ8A 2YN1A 3DIEA 2X8CA 4J56E 3TRQA 3FYGA 1FB0A 1SYXA 2PN8A 5B8AA 2A2RA 4OWYA 1VGLA 5DAKB 3IC8A 2PERA 1XPVA 4POMA 2H8LA 4V2LA 1IYHA 4NWYA 20GSA 22GSA 2JL4A 2L5LA 2CZ2A 2C3NA 1SYRA 3EINA 2B1KA 2NVLA 2H0GA 4FIWA 5INYA 2RLIA 3D22A 4K2XA 1VF4A 1UVZA 2CV4A 1MEKA 3TB2A 2LRCA 3VURA 3FKFA 2B5YA 5EVOA 4HSCX 3GL3A 5AGYA 1Q98A 4ICYA 5KEJA 3BOAA 1FW1A 2V1MA 5GZZB 1S3DA 4GRFA 2DJ2A 1Z6MA 2C3TA 2N5AA 5J4UA 4KDXA 2G2QA 4K5RA 1TK8B 2RIIA 5A4WA 6GSSA 4RQXA 3ED3A 5D9XA 2X99A 3GKKA 1WRYA 1PN0A 4MNNA 4BVYB 3ZFBA 1JFUA 2O85A 4MH2A 4A5PA 2H30A 2C0FA 1XFLA 1Z5YE 1WIKA 1W4VA 3IAM2 3DEXA 3KTLA 4BL7B 3ZIVA 4JBBA 3MYDA 1SK2A 4ZILA 2H71A 1ZOFA 4OFNA 3MNGA 1GULA 3D6IA 2F9SA 4MPFA 5FT3A 5A4VA 1B9YC 3QFAC 3MIXA 1X9MB 3VWWA 3M0FA 3TJGA 1MDIA 1SJZA 5DQSA 1A23A 4PX1A 1ZGNA 1Z7RA 2JADA 3F6DA 3GKXA 1F2EA 4POBA 5DAKA 4HJMA 4HDEA 2OA7A 2VM1A 3IA1A 4TR3A 3RHCA 1BG5A 3HJOA 4GSSA 2PPTA 5IMVA 4I97A 4ZB8A 4DSQA 1GUMA 4I2TA 1URMA 2NPBA 2X64A 3KCMA 1TU7A 2A2SA 1EV4A 1M99A 3C71A 3IHGA 2BJXA 2K8SA 1GP1A 3I69A 4WXTA 3D4TA 1TRVA 2WB9A 3QPMA 2H72A 3DYRA 2GZYA 1X0RA 2R2JA 4MA9A 1A2LA 4PNFA 2R5GA 4OO5A 4DSRA 2PU9C 4ZL8A 5IOXA 2PMTA 1TI1A 4BIKA 4Q5RA 1C72A 1OKDA 2E0QA 1WE0A 1XWGA 1R26A 1G6YA 5GSSA 1M3JA 3GN3A 1R5PA 1SKWB 2NBSA 4KSMA 4GSTA 2CAQA 3ME7A 1PL2A 4ZL7A 4NV2A 5ECHB 3VLNA 4BVYA 1AXDA 4ML1A 2I9HA 2YWNA 1THOA 3D4MA 5IIZA 1DSBA 4OO4A 4ML6A 5IMCA 5F07A 4BL7A 4L0WA 4OCFA 4O7HA 4ID0A 1BYEA 2GQKA 4J2FA 5IO0A 4KH7A 1ZZYA 3ZZXA 1SL1B 1THXA 3UARA 3GTUA 5HR1A 5JCUA 4QQ7A 1SK1A 4ZBDA 3GRXA 3TKSE 4LLRA 1E2YA 4RI7A 1K3LA 1R7HA 4ZB9A 3EMPA 1KBNA 2LJAA 1SENA 3ISOA 4G0KA 4EKZA 1XWKA 2IMKA 1UA5A 1WP0A 1AQXA 2WULA 1B9XC 2H6XA 5C04A 4YQUA 2DIZA 5B6MA 4F0CA 2KP2A 3EYTA 2OBIA 5IM9A 1IYIA 1GTIA 2DJJA 1EP7A 2RUFA 2YWIA 1ACVA 2X4AA 1VF3A 2KP1A 4NAXA 8GSSA 4IN0A 1AAZA 2MMAA 4F82A 1SJIA 3VWVA 4NPBA 2A2PA 3H79A 4MPGA 3J7Yb 2JSYA 4BA7A 2WS2A 4JZQA 1SL2B 1ERWA 2GS3A 5G5EA 4IS0A 2FCHA 1R5AA 2VCXA 4K6XA 1AQWA 2GQLA 1ST9A 1AC1A 2ON5A 1AW9A 5CYYA 3TJBA 3I6AA 3RAZA 1GSQA 1PMTA 2YZHA 3O3TA 3OR5A 5ELGA 2L4CA 3P8WA 3AY8A 5J9CA 1JZOA 1S3RA 4QL9A 3I43A 3HJMA 2FUG2 4XS6A 4NXIA 3IPZA 2WGRA 4GWRA 6GSVA 4IGJA 5JWQB 4EO3A 2H74A 2MYGA 3EC3A 1O73A 1ZYNA 3GH9A 1PGTA 1PSQA 3TRXA 4TR4A 3IR4A 3PGTA 5D96A 2CX3A 2CA8A 3DGQA 4FYBA 2WDUA 1A8LA 4EC0A 1F9MA 4EUYA 4HJ2A 1KNGA 1O8WA 4MJEA 3FR6A 3LXTA 4GQCA 2IMIA 1BJXA 2X49A 1JLVA 4FYUA 3TOTA 17GSA 4ECIA 4LA1A 1X5EA 3M8NA 1WJKA 5G1KA 4ZL9A 1O7UA 5AISA 1YJ6A 1G7EA 5CRHA 3VI7A 4TN8A 12GSA 2HSMA 1G6WA 1GTAA 4PNGA 4XIHA 4MZBA 4FYCA 10GSA 1TRWA 3GV1A 5G2ZA 4F9ZA 4EVMA 5ECQB 1GSSA 4ZBBA 2PVQA 5ECSA 3LW9A 5ID2B 9GSSA 4FH8A 1QK8A 4FQUA 5IO2A 3EPTA 2YCDA 4DEJA 2X8HA 2LTKA 4JRRA 4MF7A 2DJ0A 3IK7A 1XWAA 1TKDB 4IP1A 3UEMA 2VCZA 2K8VA 1SK0A 3DVWA 5HR3A 4Q5QA 2BMXA 2NTOA 1XBSA 1OE8A 2LNSA 3F0IA 2OE3A 2FWGA 3EU4A 3D21A 5FWGA 5ECKB 3MWHA 2R37A 2GTUA 4IW9A 4TR1A 2WFCA 3GIXA 3GH6A 1GLPA 1FVJA 3UVHA 4MZCA 3P7XA 4ECCA 2FA4A 1SU9A 2H6YA 1BX9A 2C0DA 3H8QA 3FK8A 5G31A 3LXZA 1T3BA 3F8UA 13GSA 4MZWA 5B8BA 2H66A 2R0CA 3GKMA 1M2DA 6GSXA 3HVVA 4XRDA 3A5WA 3KM6A 1NSWA 5LNKe 1EWXA 4XCSA 4WEYA 1Z3EA 4HOJA 3MDKA 1X9SB 5DJMA 2I4AA 4HU7A 2GSTA 3GMFA 2JZTA 4X0XA 5AIVA 1NM3A 4N10A 2RM6A 5D9VA 3TGZA 18GSA 2VCTA 2AV4A 3F3QA 1ZL9A 1AUCA 5FHIA 1TI3A 3C8EA 1ON4A 1K0DA 2IMEA 2LS5A 4HQZA 5EY6A 5KN0A 1SL0B 3LSZA 1GWCA 3GURA 6GSWA 1Z6NA 2M80A 2REMA 3PINA 2HSHA 4O92A 2HZEB 2V41A 1VRSD 2YNXA 3IC4A 3M3MA 1JLWA 1V58A 2C3QA 5H5RA 5BMUA 1SD8A 3LQ7A 5F8BA 5ID2A 2ALBA 3FZAA 2L4QA 2GZPA 2HXKA 19GSA 3GKNA 3R3EA 4OFTA 3WT1A 3W6GA 1QUWA 5ECLB 1ZYPA 16GSA 1EEJA 5ECNB 4WKWA 5A5KA 1TK0B 1F37A 1PFOA 4OCEA 14GSA 2GT6A 2LKUA 3O6TA 2LJRA 2QSIA 1RQMA 4ZB6A 3VWXA 3LWAA 4MDCA 5AIXA 1K0OA 2O89A 4RI6A 4N11A 3KGKA 3UL3A 1ZMAA 2H19A 4MK3A 1KTEA 1GNEA 4KW6A 1QFNA 4HI7A 3F6FA 4GXZA 11GSA 4HUAA 3A2VA 4L5OA 4Q5FA 2YP6A 5EPFA 1F3AA 2F8AA 1ZCPA 2XC2A 1W89A 5B7CA 1A24A 4TXVA 2C80A 2L6CA 1GSDA 1GSEA 4K5SA 2CAIA 2JZRA 4K0NA 4IHUA 3A5IA 4PURA 5CRGA 4MF5A 3WGDA 4BVXB 1QMVA 5KN1A 2PWJA 2A4VA 3HD5A 2L5OA 3G9BA 2AAWA 5G1LA 2B5EA 3FY7A 2R3XA 4PGTA 5J5NA 4WR4A 2X8GA 3TUEA 1X5CA 2R6KA 3HVXA 1GUKA 2VD0A 5D9WA 4OMVA 1EZKA 4RQRA 2MMZA 1M0UA 1Y25A 3FR9A 5HR2A 1YKCA 3RBTA 2VUPA 4F2IA 3ZITA 5CRWA 4AJ7A 1PX7A 2V6KA 2JU5A 3US3A 2ON7A 3RDWA 3SBCA 2HZEA 1PQNA 3C1RA 2CVDA 1XVQA 2YPMA 3UJ1A 1QGVA 5JCGA 1XVWA 2H1GA 4WF5A 3GYKA 3HXSA 4V2NA 2I81A 4MCUA 3KJYA 3ERGA 1OAZA 4D73B 1T7PB 2LRNA 2KUCA 4HZ2A 2H01A 4K9ZA 4G0LA 5IMZA 3ZLPA 2H0HA 2VD1A 3ZTLA 2MZCA 1CQGA 2JSZA 3KP9A 1HNBA 2DMLA 2RM5A 2ZCTA 5ECMB 2EC4A 1ERVA 5H5QA 1OYJA 1A2JA 4V1Ap 3KMOA 3F9UA 1YDKA 3ERFA 3TJKA 4CY8A 3C1SA 3WGEA 2VLVA 5ENUA 3MSZA 4G19A 2E2GA 4USSA 2Z9SA 1O85A 1DE1A 3BD2A 4WETA 2YJ7A 1X9WB 3CTGA 3TJFA 1M7TA 2FNOA 3HJPA 2DJ3A 1GUHA 1O6JA 1WOUA 3TCOA 2XBQA 5L71A 2CZ3A 3P90A 1K3OA 4BVXA 1SKRB 4K7OA 3LYPA 2RUEA 1V2AA 2FD3A 2VO4A 3VK9A 1QXHA 2HI7A 1JZRA 2HRFA 2KLXA 3F4RA 1PA3A 1T00A 3KIJA 2K9FA 3UBLA 3HHVA 2OACA 4LL1B 1A2MA 3QMXA 1YF0A 3HDCA 3Q6OA 3PPUA 1EOHA 5IMAA 1EEMA 3CMIA 2O7KA 4GCIA 3IK9A 4IJIA 3GA4A 4MMMA 5DALB 1PL1A 2BTOT 5LCZA 1WPIA 2YWOA 2GGTA 3GX0A 5ELAA 1MD3A 2PGTA 4POKA 2YV9A 5IMDA 2DKHA 1JZDA 1MD4A 4POLA 4EXJA 2F8FA 5J3RA 2LQOA 2H76A 3TRPA 4YQMA 4N30A 1ABAA 3IHQA 4BWSA 4MF6A 5ECRB 4GQFA 1RK4A 2YANA 5C00A 2N5BA 4IELA 1J08A 4D73A 1NHYA 3L9UA 4EIPA 2ZUPA 2WCIA 1Q4JA 2TIRA 4G10A 1YEXA 5CAXA 1JZWA 2FWHA 2VLUA 3QD9A 1T1VA 2I1UA 5D73A 4KCEA 2B1LA 4ULXA 4K8MA 3QR6A 4XS4B 2H1DA 3Q74A 1VF1A 1G0TA 1UC7A 2QA1A 3V1WA 4GF0A 4LL4B 1AIUA 1V57A 3IAS2 4CW9A 5HR0A 4TKYA 1ERUA 5JCWA 1M3IA 3O76A 1O8XA 2YV7A 1U6TA 2C0GA 2V32A 4JR6A 4YAVA 3BCKA 5DQYA 4Q5NA 2GSQA 3ZFLA 2A4HA 3Q19A 3NZNA 5G30A 4WF4A 2HE3A 4KA0A 4ZXGA 2YZUA 3M9JA 5B6NA 2GZZA 3FW2A 4GSNA 3CSIA 2YJHA 2O87A 3QCPA 2HLSA 4Z2TA 3H93A 1ZYEA 4JU5A 4ACSA 3FRCA 4G0IA 4JEDA 3R2QA 5DDLA 4O5UA 4EIQA 4IVFA 1PRXA 5CRDA 4RUVA 3FEUA 3ERWA 2QKEA 1FAAA 3DMLA 3APSA 1EP8A 2VM2A 2GQMA 1GLQA 3DVXA 2YWMA 1GH2A 3K8NA 3GHAA 3KH7A 5IMFA 5JWOB 3ZYWA 4KF9A 5IPGA 4MJAA 3HVNA 1O81A 5CNWA 2MBSA 3SWLA 2YOIA 1K0NA 4PXOA 3WD6A 3PH9A 2C4JA 4Z7XA 1K0CA 1YY7A 4X43A 1TDIA 3GSSA 1OE7A 3EU3A 3L4NA 3ZIJA 4EE0A 2VLTA 4I6XA 5CREA 5F05A 5GAND 4IQAA 1U3IA 2FLSA 3ZVJA 1AQVA 2DJ1A 3LORA 2CT6A 4PQIA 1YQ1A 3VWUA 5KOXA 1SJ6A 1UN2A 2IPAA 2C0EA 2IJYA 1FG4A 5LD0A 4EDYA 3EE2A 1HD2A 3G7YA 3G7IA 1U3AA 2CVBA 2P0GA 4WBRD 2KOKA 3DWVA 4I5QA 2OADA 1K0AA 2FY6A 2TRCP 2CX4A 1TTZA 2E2MA 4KDYA 3FMWA 4KSOA 5GAPD 2G0FA 2H73A 1LU4A 2B6MA 3LEFA 5DJLA 3TOUA 2H70A 1SKSB 1TOFA 2O8VB 4HS1A 2WJUA 4GTUA 2IMDA 1H75A 3TJJA 3KTBA 1G7OA 1XWBA 2JZSA 3KZQA 3IRAA 3L78A 1WMJA 1DBYA 2N5FA 3KP8A 3ZREA 1GSUA 1N2AA 3KD0A 1GSYA 4KE3A 2LRTA 6GSUA 2DBCA 3IDVA 1K3YA 3LGCA 2EIQA 3CQFA 2HZFA 4NHZA 1B4QA 2K6VA 3UBKA 5KN3A 1XCCA 4X4JA 5KN2A 3WT2A 3QFBC 4AGSA 3LYKA 3CRTA 2XBIA 4O5RA 1H4OA 2IFQB 2V6OA 4G2EA 2AYTA 4K1FA 3GSTA 3L9VA 2AUVA 2DJKA 1TP9A 4NV5A 2H1AA 4YKGA 3I9V2 1Y6EA 2CQ9A 4HU9A 2FHEA 4KAEA 3UIWA 4I8BA 2ZNMA 3F3RA 2FGXA 3QAGA 2HFDA 5H5SA 6GSTA 1YEPA 3A2XA 4PQHA 1HNCA 3KMNA 2VCWA 3IE3A 4AF2A 2IIYA 1B8XA 2IN3A 2QGVA 2JACA 3TKPA 3DD3A 4IP6A 2HRAA 4E8EA 4X1UA 3DKSA 5ECIB 2J23A 2EIOA 1XZOA 2PBJA 2H75A 1XOAA 3F4SA 4K0GA 4AJ6A 3TDGA 2PVOC 1B48A 1TXXA 5ABRA 2VIMA 1FO5A 3HA9A 1I9DA 2HSYA 3E0UA 3S9FA 4OD7A 3GFKA 3HVSA 5D8IA 2OJLA 1EOGA 5D93A 1N8JA 4IQ1A 2MMOA 3CBUA 4Z2UA 1B4PA 3DRNA 4F03A 3HYPA 3QAVA 3CYNA 4MLYA 4QL7A 1YZXA 2F51A 2R0PA 4PTSA 4MJBA 2DKIA 1KEBA 4DSSB 3NIVA 1TW9A 2TRXA 3GTUB 3ZL5A 3FZ9A 3HY2A 5HFIA 5DBQA 3LJRA 1EGRA 1MTCA 4EF0A 3TKQA 4TR0A 2XPEA 3WYWA 3EWLA 3VI5A 3L0HA 5BRTA 1FVKA 3CRUA 2IFQA 1QQ2A 1LJRA 5F0GA 2F3MA 5DVBA 3UOMA 1XW9A 1J0FA 3CXGA 2P5RA 3CSHA 5J9BA 3QDNA 1VF2A 4CDOA 2L59A 3FR3A 1BEDA 5AN1A 4PUAA 3KEBA 4GLTA 5EL8A 3J7Yk 4ECBA 3F63A 3ZRDA 2VAFA 4K2DA 4OFMA 2R0GA 3IV4A 2OKAA 3L9SA 2L57A 2IWTA 2M72A 2LV3A 1M9BA 4BPYA 2VOCA 4YQVA 4TVEA 1K0MA 2B3SA 1A8YA 3W8SA 3RPPA 3LFLA 1PKWA 2IL3A 3HCZA 1F3BA 3HZ8A 1A0RP 5HQPA 2B7JA 1V9WA 4HQSA 3FZ5A 2GLRA
chains in the Genus database with same CATH topology
2B5XA 1BAYA 3BCIA 3F4TA 3N9JA 3EURA 1HYUA 2FA8A 3W8JA 4XRAA 4WBJA 2P5QA 1OC9B 3EVIA 1U87A 4KDUA 2VL2A 4KUNA 2R4VA 4TXOB 4EL1A 3QOUA 4ZBAA 1GL8A 1M2AA 1U88A 2LJKA 4PQ1A 5HFKA 1I5GA 4PUFC 4DSSA 1WWJA 4O32A 2D2ZA 2LUSA 2LQQA 3MAKA 4JE1A 1DE2A 7GSSA 2FWEA 1HNAA 3NOFA 2KHPA 2H6ZA 4HEA2 1GRXA 3P2AA 2HRNA 1NW2A 2GT5A 3DXBA 3TKSA 2LSTA 4CY6A 2GSRA 1A0FA 4TOPA 1FHEA 1CQHA 1YKAA 4IBPA 4JR4A 3H1NA 5IPHA 4NMUA 1OKTA 3C73A 2LNTA 3N5OA 5A4UA 6GSYA 5DCGA 4N0ZA 1T4YA 2WZ9A 2DLXA 3HZ4A 2QA2A 5E4WA 1XWCA 2DMMA 2GDRA 1GTBA 2OE1A 3UAPA 2I3YA 1OC3A 3BBYA 1Z9HA 2VL2C 2OE0A 1PX6A 4L5LA 3IOSA 4J57E 1HQOA 2HRKA 1OC8A 3GL5A 4HZ4A 4ZIJA 4XTSA 4KCAA 3UMAA 4KB3A 5JWRB 2PUKC 4KNDA 4L8EA 4TRXA 4NHWA 4YKFA 3RPNA 3VPQA 2P31A 5E59A 4XHMA 4TR1B 3LG6A 3GUSA 2GVPA 1E6BA 4LMVA 1M9AA 3KH9A 1LBKA 3VFIA 2NDOA 3TKSC 3ZVJD 1ZYQB 1XW5A 3D0ZA 4YH2A 3E9JB 3ZMKA 2M46A 1RW1A 5ECPB 1EGOA 2HYXA 1PN9A 1OC9A 4N0VA 3RHBA 1Z7PA 4CHSA 4WR5A 2OBKA 2AHEA 1JHBA 4TXOA 1SD9A 1EV9A 1FOVA 5J41A 1TJDA 3ZMLA 4K7NA 2B7KA 2MMNA 5D9TA 1NHOA 1MDJA 4L0UA 4Z2RA 3IBHA 3GNJA 2DIYA 3U6VA 2AJQB 2IMFA 4H86A 1R4WA 2WRTA 2VL3A 3HKRA 3KXOA 3APOA 1V40A 3APQA 2HT9A 5DALA 4AJ8A 2VL9A 1ERTA 5G5FA 5CO3A 1TU8A 2CVKA 1F6MC 5ECOB 4FO5A 3Q18A 4E8HA 1XOBA 5DCHA 3TKRA 2QC7A 2VCQA 2XPDA 2V2GA 1FOHA 3GX8A 1BQ7A 5KOWA 3A2WA 3BJ5A 4BWQA 3EMXA 4MJCA 1ILOA 1FB6A 5HFGA 3PR8A 2DSAA 3U5RE 1OVNA 1J9BA 3CTFA 5IOWA 3FHKA 2HNLA 3IXRA 4P3YB 3M9KA 2L6DA 1GSFA 5F06A 3UVTA 3E3EA 3JCML 2ES7A 4G9HA 4IKHA 3A3TA 1X5DA 4O5QA 1DUGA 4F0BA 4XS1A 4MH3A 1XXUA 4XS4A 2K18A 4IJ3A 3D5JA 1PD21 2EIRA 2LEGA 2H1BA 4YAPA 4V2MA 4DVCA 3M1GA 1GNWA 2C8UA 2C1YA 3QAWA 2E7PA 2FWFA 3WGXA 4MP4A 2J9HA 2MBTA 3CSJA 1USBA 3VPTA 4TW5A 1XIYA 1YF1A 1XW6A 4K7IA 1TK5B 4LMWA 5COHA 4EDZA 4MABA 2H0IA 1S3AA 2AB6A 1V98A 4V1Ag 3ME8A 4ECJA 2GSSA 1ML6A 1TRUA 2VCVA 3G7JA 1K0BA 3C7MA 4KGIA 1S3CA 5GSTA 3H4KA 1GTUA 5IQYA 4ISDA 1T8EB 1MDKA 1PKZA 3FZ4A 5CP1A 2XHFA 4I2UA 4KX4A 4ILFA 1TRSA 2DC5A 1T4ZA 1M2BA 2UZ8A 2YN1A 3DIEA 2X8CA 4J56E 3TRQA 3FYGA 1FB0A 1SYXA 2PN8A 5B8AA 2A2RA 4OWYA 1VGLA 5DAKB 3IC8A 2PERA 1XPVA 4POMA 2H8LA 4V2LA 1IYHA 4NWYA 20GSA 22GSA 2JL4A 2L5LA 2CZ2A 2C3NA 1SYRA 3EINA 2B1KA 2NVLA 2H0GA 4FIWA 5INYA 2RLIA 3D22A 4K2XA 1VF4A 1UVZA 2CV4A 1MEKA 3TB2A 2LRCA 3VURA 3FKFA 2B5YA 5EVOA 3GL3A 5AGYA 1Q98A 4ICYA 5KEJA 3BOAA 1FW1A 2V1MA 5GZZB 1S3DA 4GRFA 2DJ2A 1Z6MA 2C3TA 2N5AA 5J4UA 4KDXA 2G2QA 4K5RA 1TK8B 2RIIA 5A4WA 6GSSA 4RQXA 3ED3A 5D9XA 2X99A 3GKKA 1WRYA 1PN0A 4MNNA 4BVYB 3ZFBA 1JFUA 2O85A 4MH2A 4A5PA 2H30A 2C0FA 1XFLA 1Z5YE 1WIKA 1W4VA 3IAM2 3DEXA 3KTLA 4BL7B 3ZIVA 4JBBA 3MYDA 1SK2A 4ZILA 2H71A 1ZOFA 4OFNA 3MNGA 1GULA 3D6IA 2F9SA 4MPFA 5FT3A 5A4VA 1B9YC 3QFAC 3MIXA 1X9MB 3VWWA 3M0FA 3TJGA 1MDIA 1SJZA 5DQSA 1A23A 4PX1A 1ZGNA 1Z7RA 2JADA 3F6DA 3GKXA 1F2EA 4POBA 5DAKA 4HJMA 4HDEA 2OA7A 2VM1A 3IA1A 4TR3A 3RHCA 1BG5A 3HJOA 4GSSA 2PPTA 5IMVA 4I97A 4ZB8A 4DSQA 1GUMA 4I2TA 1URMA 2NPBA 2X64A 3KCMA 1TU7A 2A2SA 1EV4A 1M99A 3C71A 3IHGA 2BJXA 2K8SA 1GP1A 3I69A 4WXTA 3D4TA 1TRVA 2WB9A 3QPMA 2H72A 3DYRA 2GZYA 1X0RA 2R2JA 4MA9A 1A2LA 4PNFA 2R5GA 4OO5A 4DSRA 2PU9C 4ZL8A 5IOXA 2PMTA 1TI1A 4Q5RA 1C72A 1OKDA 2E0QA 1WE0A 1XWGA 1R26A 1G6YA 5GSSA 3GN3A 1R5PA 1SKWB 2NBSA 4KSMA 4GSTA 2CAQA 3ME7A 1PL2A 4ZL7A 4NV2A 5ECHB 3VLNA 4BVYA 1AXDA 4ML1A 2I9HA 2YWNA 1THOA 3D4MA 5IIZA 1DSBA 4OO4A 4ML6A 5IMCA 5F07A 4BL7A 4L0WA 4OCFA 4O7HA 4ID0A 1BYEA 2GQKA 4J2FA 5IO0A 4KH7A 1ZZYA 3ZZXA 1SL1B 1THXA 3UARA 3GTUA 5HR1A 5JCUA 4QQ7A 1SK1A 4ZBDA 3GRXA 3TKSE 4LLRA 1E2YA 4RI7A 1K3LA 1R7HA 4ZB9A 3EMPA 1KBNA 2LJAA 1SENA 3ISOA 4G0KA 4EKZA 1XWKA 2IMKA 1UA5A 1WP0A 1AQXA 2WULA 1B9XC 2H6XA 5C04A 4YQUA 2DIZA 5B6MA 4F0CA 2KP2A 3EYTA 2OBIA 5IM9A 1IYIA 1GTIA 2DJJA 1EP7A 2RUFA 2YWIA 1ACVA 2X4AA 1VF3A 2KP1A 4NAXA 8GSSA 4IN0A 1AAZA 2MMAA 4F82A 1SJIA 3VWVA 4NPBA 2A2PA 3H79A 4MPGA 3J7Yb 2JSYA 4BA7A 2WS2A 4JZQA 1SL2B 1ERWA 2GS3A 5G5EA 4IS0A 2FCHA 1R5AA 2VCXA 4K6XA 1AQWA 2GQLA 1ST9A 1AC1A 2ON5A 1AW9A 5CYYA 3TJBA 3I6AA 3RAZA 1GSQA 1PMTA 2YZHA 3O3TA 3OR5A 5ELGA 2L4CA 3P8WA 3AY8A 5J9CA 1JZOA 4QL9A 3I43A 3HJMA 2FUG2 4XS6A 4NXIA 3IPZA 2WGRA 4GWRA 6GSVA 4IGJA 5JWQB 4EO3A 2H74A 2MYGA 3EC3A 1O73A 1ZYNA 3GH9A 1PGTA 1PSQA 3TRXA 4TR4A 3IR4A 3PGTA 5D96A 2CX3A 2CA8A 3DGQA 4FYBA 2WDUA 1A8LA 4EC0A 1F9MA 4EUYA 4HJ2A 1KNGA 1O8WA 4MJEA 3FR6A 3LXTA 4GQCA 2IMIA 1BJXA 2X49A 1JLVA 4FYUA 3TOTA 17GSA 4ECIA 4LA1A 1X5EA 3M8NA 1WJKA 5G1KA 4ZL9A 1O7UA 5AISA 1YJ6A 1G7EA 5CRHA 3VI7A 4TN8A 12GSA 2HSMA 1G6WA 1GTAA 4PNGA 4XIHA 4MZBA 4FYCA 10GSA 1TRWA 3GV1A 5G2ZA 4F9ZA 4EVMA 5ECQB 1GSSA 4ZBBA 2PVQA 5ECSA 3LW9A 5ID2B 9GSSA 4FH8A 1QK8A 4FQUA 5IO2A 3EPTA 2YCDA 4DEJA 2X8HA 2LTKA 4JRRA 4MF7A 2DJ0A 3IK7A 1XWAA 1TKDB 4IP1A 3UEMA 2VCZA 2K8VA 1SK0A 3DVWA 5HR3A 4Q5QA 2BMXA 2NTOA 1XBSA 1OE8A 2LNSA 3F0IA 2OE3A 2FWGA 3EU4A 3D21A 5FWGA 5ECKB 3MWHA 2R37A 2GTUA 4IW9A 4TR1A 2WFCA 3GIXA 3GH6A 1GLPA 1FVJA 3UVHA 4MZCA 3P7XA 4ECCA 2FA4A 1SU9A 2H6YA 1BX9A 2C0DA 3H8QA 3FK8A 5G31A 3LXZA 1T3BA 3F8UA 13GSA 4MZWA 5B8BA 2H66A 2R0CA 3GKMA 1M2DA 6GSXA 3HVVA 4XRDA 3A5WA 3KM6A 1NSWA 5LNKe 1EWXA 4XCSA 4WEYA 1Z3EA 4HOJA 3MDKA 1X9SB 5DJMA 2I4AA 4HU7A 2GSTA 3GMFA 2JZTA 4X0XA 5AIVA 1NM3A 4N10A 2RM6A 5D9VA 3TGZA 18GSA 2VCTA 2AV4A 3F3QA 1ZL9A 1AUCA 5FHIA 1TI3A 3C8EA 1ON4A 1K0DA 2IMEA 2LS5A 4HQZA 5EY6A 5KN0A 1SL0B 3LSZA 1GWCA 3GURA 6GSWA 1Z6NA 2M80A 2REMA 3PINA 2HSHA 4O92A 2HZEB 2V41A 1VRSD 2YNXA 3IC4A 3M3MA 1JLWA 1V58A 2C3QA 5H5RA 5BMUA 1SD8A 3LQ7A 5F8BA 5ID2A 2ALBA 3FZAA 2L4QA 2GZPA 2HXKA 19GSA 3GKNA 3R3EA 4OFTA 3WT1A 3W6GA 1QUWA 5ECLB 1ZYPA 16GSA 1EEJA 5ECNB 4WKWA 5A5KA 1TK0B 1F37A 4OCEA 14GSA 2GT6A 2LKUA 3O6TA 2LJRA 2QSIA 1RQMA 4ZB6A 3VWXA 3LWAA 4MDCA 5AIXA 1K0OA 2O89A 4RI6A 4N11A 3KGKA 3UL3A 1ZMAA 2H19A 4MK3A 1KTEA 1GNEA 4KW6A 1QFNA 4HI7A 3F6FA 4GXZA 11GSA 4HUAA 3A2VA 4L5OA 4Q5FA 2YP6A 5EPFA 1F3AA 2F8AA 1ZCPA 2XC2A 1W89A 5B7CA 1A24A 4TXVA 2C80A 2L6CA 1GSDA 1GSEA 4K5SA 2CAIA 2JZRA 4K0NA 4IHUA 3A5IA 4PURA 5CRGA 4MF5A 3WGDA 4BVXB 1QMVA 5KN1A 2PWJA 2A4VA 3HD5A 2L5OA 3G9BA 2AAWA 5G1LA 2B5EA 3FY7A 2R3XA 4PGTA 5J5NA 4WR4A 2X8GA 3TUEA 1X5CA 2R6KA 3HVXA 1GUKA 2VD0A 5D9WA 4OMVA 1EZKA 4RQRA 2MMZA 1M0UA 1Y25A 3FR9A 5HR2A 1YKCA 3RBTA 2VUPA 4F2IA 3ZITA 5CRWA 4AJ7A 1PX7A 2V6KA 2JU5A 3US3A 2ON7A 3RDWA 3SBCA 2HZEA 1PQNA 3C1RA 2CVDA 1XVQA 2YPMA 3UJ1A 1QGVA 5JCGA 1XVWA 2H1GA 4WF5A 3GYKA 3HXSA 4V2NA 2I81A 4MCUA 3KJYA 3ERGA 1OAZA 4D73B 1T7PB 2LRNA 2KUCA 4HZ2A 2H01A 4K9ZA 4G0LA 5IMZA 3ZLPA 2H0HA 2VD1A 3ZTLA 2MZCA 1CQGA 2JSZA 3KP9A 1HNBA 2DMLA 2RM5A 2ZCTA 5ECMB 2EC4A 1ERVA 5H5QA 1OYJA 1A2JA 4V1Ap 3KMOA 3F9UA 1YDKA 3ERFA 3TJKA 4CY8A 3C1SA 3WGEA 2VLVA 5ENUA 3MSZA 4G19A 2E2GA 4USSA 2Z9SA 1O85A 1DE1A 3BD2A 4WETA 2YJ7A 1X9WB 3CTGA 3TJFA 1M7TA 2FNOA 3HJPA 2DJ3A 1GUHA 1O6JA 1WOUA 3TCOA 2XBQA 5L71A 2CZ3A 3P90A 1K3OA 4BVXA 1SKRB 4K7OA 3LYPA 2RUEA 1V2AA 2FD3A 2VO4A 3VK9A 1QXHA 2HI7A 1JZRA 2HRFA 2KLXA 3F4RA 1PA3A 1T00A 3KIJA 2K9FA 3UBLA 3HHVA 2OACA 4LL1B 1A2MA 3QMXA 1YF0A 3HDCA 3Q6OA 3PPUA 1EOHA 5IMAA 1EEMA 3CMIA 2O7KA 4GCIA 3IK9A 4IJIA 3GA4A 4MMMA 5DALB 1PL1A 2BTOT 5LCZA 1WPIA 2YWOA 2GGTA 3GX0A 5ELAA 1MD3A 2PGTA 4POKA 2YV9A 5IMDA 2DKHA 1JZDA 1MD4A 4POLA 4EXJA 2F8FA 5J3RA 2LQOA 2H76A 3TRPA 4YQMA 4N30A 1ABAA 3IHQA 4BWSA 4MF6A 5ECRB 4GQFA 1RK4A 2YANA 5C00A 2N5BA 4IELA 1J08A 4D73A 1NHYA 3L9UA 4EIPA 2ZUPA 2WCIA 1Q4JA 2TIRA 4G10A 1YEXA 5CAXA 1JZWA 2FWHA 2VLUA 3QD9A 1T1VA 2I1UA 5D73A 4KCEA 2B1LA 4ULXA 4K8MA 3QR6A 4XS4B 2H1DA 3Q74A 1VF1A 1G0TA 1UC7A 2QA1A 3V1WA 4GF0A 4LL4B 1AIUA 1V57A 3IAS2 4CW9A 5HR0A 4TKYA 1ERUA 5JCWA 3O76A 1O8XA 2YV7A 1U6TA 2C0GA 2V32A 4JR6A 4YAVA 3BCKA 5DQYA 4Q5NA 2GSQA 3ZFLA 2A4HA 3Q19A 3NZNA 5G30A 4WF4A 2HE3A 4KA0A 4ZXGA 2YZUA 3M9JA 5B6NA 2GZZA 3FW2A 4GSNA 3CSIA 2YJHA 2O87A 3QCPA 2HLSA 4Z2TA 3H93A 1ZYEA 4JU5A 4ACSA 3FRCA 4G0IA 4JEDA 3R2QA 5DDLA 4O5UA 4EIQA 4IVFA 1PRXA 5CRDA 4RUVA 3FEUA 3ERWA 2QKEA 1FAAA 3DMLA 3APSA 1EP8A 2VM2A 2GQMA 1GLQA 3DVXA 2YWMA 1GH2A 3K8NA 3GHAA 3KH7A 5IMFA 5JWOB 3ZYWA 4KF9A 5IPGA 4MJAA 1O81A 5CNWA 2MBSA 3SWLA 2YOIA 1K0NA 4PXOA 3WD6A 3PH9A 2C4JA 4Z7XA 1K0CA 1YY7A 4X43A 1TDIA 3GSSA 1OE7A 3EU3A 3L4NA 3ZIJA 4EE0A 2VLTA 4I6XA 5CREA 5F05A 5GAND 4IQAA 1U3IA 2FLSA 3ZVJA 1AQVA 2DJ1A 3LORA 2CT6A 4PQIA 1YQ1A 3VWUA 5KOXA 1SJ6A 1UN2A 2IPAA 2C0EA 2IJYA 1FG4A 5LD0A 4EDYA 3EE2A 1HD2A 3G7YA 3G7IA 1U3AA 2CVBA 2P0GA 4WBRD 2KOKA 3DWVA 4I5QA 2OADA 1K0AA 2FY6A 2TRCP 2CX4A 1TTZA 2E2MA 4KDYA 3FMWA 4KSOA 5GAPD 2G0FA 2H73A 1LU4A 2B6MA 3LEFA 5DJLA 3TOUA 2H70A 1SKSB 1TOFA 2O8VB 4HS1A 2WJUA 4GTUA 2IMDA 1H75A 3TJJA 3KTBA 1G7OA 1XWBA 2JZSA 3KZQA 3IRAA 3L78A 1WMJA 1DBYA 2N5FA 3KP8A 3ZREA 1GSUA 1N2AA 3KD0A 1GSYA 4KE3A 2LRTA 6GSUA 2DBCA 3IDVA 1K3YA 3LGCA 2EIQA 2HZFA 4NHZA 1B4QA 2K6VA 3UBKA 5KN3A 1XCCA 4X4JA 5KN2A 3WT2A 3QFBC 4AGSA 3LYKA 3CRTA 2XBIA 4O5RA 1H4OA 2IFQB 2V6OA 4G2EA 2AYTA 4K1FA 3GSTA 3L9VA 2AUVA 2DJKA 1TP9A 4NV5A 2H1AA 4YKGA 3I9V2 1Y6EA 2CQ9A 4HU9A 2FHEA 4KAEA 3UIWA 4I8BA 2ZNMA 3F3RA 2FGXA 3QAGA 2HFDA 5H5SA 6GSTA 1YEPA 3A2XA 4PQHA 1HNCA 3KMNA 2VCWA 3IE3A 4AF2A 2IIYA 1B8XA 2IN3A 2QGVA 2JACA 3TKPA 3DD3A 4IP6A 2HRAA 4E8EA 4X1UA 3DKSA 5ECIB 2J23A 2EIOA 1XZOA 2PBJA 2H75A 1XOAA 3F4SA 4K0GA 4AJ6A 3TDGA 2PVOC 1B48A 1TXXA 5ABRA 2VIMA 1FO5A 3HA9A 1I9DA 2HSYA 3E0UA 3S9FA 4OD7A 3GFKA 3HVSA 5D8IA 2OJLA 1EOGA 5D93A 1N8JA 4IQ1A 2MMOA 3CBUA 4Z2UA 1B4PA 3DRNA 4F03A 3HYPA 3QAVA 3CYNA 4MLYA 4QL7A 1YZXA 2F51A 2R0PA 4PTSA 4MJBA 2DKIA 1KEBA 4DSSB 3NIVA 1TW9A 2TRXA 3GTUB 3ZL5A 3FZ9A 3HY2A 5HFIA 5DBQA 3LJRA 1EGRA 1MTCA 4EF0A 3TKQA 4TR0A 2XPEA 3WYWA 3EWLA 3VI5A 3L0HA 5BRTA 1FVKA 3CRUA 2IFQA 1QQ2A 1LJRA 5F0GA 2F3MA 5DVBA 3UOMA 1XW9A 1J0FA 3CXGA 2P5RA 3CSHA 5J9BA 3QDNA 1VF2A 4CDOA 2L59A 3FR3A 1BEDA 5AN1A 4PUAA 3KEBA 4GLTA 5EL8A 3J7Yk 4ECBA 3F63A 3ZRDA 2VAFA 4K2DA 4OFMA 2R0GA 3IV4A 2OKAA 3L9SA 2L57A 2IWTA 2M72A 2LV3A 1M9BA 4BPYA 2VOCA 4YQVA 4TVEA 1K0MA 2B3SA 1A8YA 3W8SA 3RPPA 3LFLA 1PKWA 2IL3A 3HCZA 1F3BA 3HZ8A 1A0RP 5HQPA 2B7JA 1V9WA 4HQSA 3FZ5A 2GLRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5X A;  1BAY A;  3BCI A;  3F4T A;  3N9J A;  3EUR A;  1HYU A;  2FA8 A;  3W8J A;  4XRA A;  4WBJ A;  2P5Q A;  1OC9 B;  3EVI A;  1U87 A;  4KDU A;  2VL2 A;  4KUN A;  2R4V A;  4TXO B;  4EL1 A;  3QOU A;  4ZBA A;  1GL8 A;  1M2A A;  1U88 A;  2LJK A;  4PQ1 A;  5HFK A;  1I5G A;  4PUF C;  4DSS A;  1WWJ A;  4O32 A;  2D2Z A;  2LUS A;  2LQQ A;  3MAK A;  4JE1 A;  1DE2 A;  7GSS A;  2FWE A;  1HNA A;  3NOF A;  2KHP A;  2H6Z A;  4HEA 2;  1GRX A;  3P2A A;  2HRN A;  1NW2 A;  2GT5 A;  3DXB A;  3TKS A;  2LST A;  2GSR A;  1A0F A;  4TOP A;  1FHE A;  1CQH A;  1YKA A;  4IBP A;  4JR4 A;  3H1N A;  5IPH A;  4NMU A;  1OKT A;  3C73 A;  2LNT A;  3N5O A;  5A4U A;  6GSY A;  5DCG A;  4N0Z A;  1T4Y A;  2WZ9 A;  2DLX A;  3HZ4 A;  5E4W A;  1XWC A;  2DMM A;  2GDR A;  1GTB A;  2OE1 A;  3UAP A;  2I3Y A;  1OC3 A;  3BBY A;  1Z9H A;  2VL2 C;  2OE0 A;  1PX6 A;  4L5L A;  3IOS A;  4J57 E;  1HQO A;  1OC8 A;  3GL5 A;  4HZ4 A;  4ZIJ A;  4XTS A;  4KCA A;  3UMA A;  4KB3 A;  5JWR B;  2PUK C;  4KND A;  4L8E A;  4TRX A;  4NHW A;  3RPN A;  3VPQ A;  2P31 A;  5E59 A;  4XHM A;  4TR1 B;  3LG6 A;  3GUS A;  2GVP A;  1E6B A;  4LMV A;  1M9A A;  3KH9 A;  1LBK A;  3VFI A;  2NDO A;  3TKS C;  3ZVJ D;  1ZYQ B;  1XW5 A;  3D0Z A;  4YH2 A;  3E9J B;  3ZMK A;  2M46 A;  1RW1 A;  5ECP B;  1EGO A;  2HYX A;  1PN9 A;  1OC9 A;  4N0V A;  3RHB A;  1Z7P A;  4CHS A;  4WR5 A;  2OBK A;  2AHE A;  1JHB A;  4TXO A;  1SD9 A;  1EV9 A;  1FOV A;  5J41 A;  1TJD A;  3ZML A;  4K7N A;  2B7K A;  2MMN A;  5D9T A;  1NHO A;  1MDJ A;  4L0U A;  3IBH A;  3GNJ A;  2DIY A;  3U6V A;  2AJQ B;  2IMF A;  4H86 A;  1R4W A;  2WRT A;  2VL3 A;  3HKR A;  3KXO A;  3APO A;  1V40 A;  3APQ A;  2HT9 A;  5DAL A;  4AJ8 A;  2VL9 A;  1ERT A;  5G5F A;  5CO3 A;  1TU8 A;  2CVK A;  1F6M C;  5ECO B;  4FO5 A;  3Q18 A;  4E8H A;  1XOB A;  5DCH A;  3TKR A;  2QC7 A;  2VCQ A;  2XPD A;  2V2G A;  3GX8 A;  1BQ7 A;  3A2W A;  3BJ5 A;  4BWQ A;  3EMX A;  4MJC A;  1ILO A;  1FB6 A;  5HFG A;  3PR8 A;  2DSA A;  3U5R E;  1OVN A;  1J9B A;  3CTF A;  5IOW A;  3FHK A;  2HNL A;  3IXR A;  4P3Y B;  3M9K A;  2L6D A;  1GSF A;  5F06 A;  3UVT A;  3E3E A;  3JCM L;  2ES7 A;  4G9H A;  4IKH A;  3A3T A;  1X5D A;  1DUG A;  4F0B A;  4XS1 A;  4MH3 A;  1XXU A;  4XS4 A;  2K18 A;  4IJ3 A;  3D5J A;  1PD2 1;  2EIR A;  2LEG A;  2H1B A;  4YAP A;  4V2M A;  4DVC A;  3M1G A;  1GNW A;  2C8U A;  2C1Y A;  3QAW A;  2E7P A;  2FWF A;  3WGX A;  4MP4 A;  2J9H A;  2MBT A;  3CSJ A;  1USB A;  3VPT A;  4TW5 A;  1XIY A;  1YF1 A;  1XW6 A;  4K7I A;  1TK5 B;  4LMW A;  5COH A;  4EDZ A;  4MAB A;  2H0I A;  1S3A A;  2AB6 A;  1V98 A;  4V1A g;  3ME8 A;  4ECJ A;  2GSS A;  1ML6 A;  1TRU A;  2VCV A;  3G7J A;  1K0B A;  3C7M A;  4KGI A;  1S3C A;  5GST A;  3H4K A;  1GTU A;  5IQY A;  4ISD A;  1T8E B;  1MDK A;  1PKZ A;  3FZ4 A;  5CP1 A;  2XHF A;  4I2U A;  4KX4 A;  4ILF A;  1TRS A;  2DC5 A;  1T4Z A;  1M2B A;  2YN1 A;  3DIE A;  2X8C A;  4J56 E;  3TRQ A;  3FYG A;  1FB0 A;  1SYX A;  2PN8 A;  5B8A A;  2A2R A;  4OWY A;  1VGL A;  5DAK B;  2PER A;  1XPV A;  4POM A;  2H8L A;  4V2L A;  1IYH A;  4NWY A;  20GS A;  22GS A;  2JL4 A;  2L5L A;  2CZ2 A;  2C3N A;  1SYR A;  3EIN A;  2B1K A;  2NVL A;  2H0G A;  4FIW A;  5INY A;  2RLI A;  3D22 A;  1VF4 A;  1UVZ A;  2CV4 A;  1MEK A;  3TB2 A;  2LRC A;  3VUR A;  3FKF A;  2B5Y A;  5EVO A;  3GL3 A;  5AGY A;  1Q98 A;  5KEJ A;  3BOA A;  1FW1 A;  2V1M A;  5GZZ B;  1S3D A;  4GRF A;  2DJ2 A;  1Z6M A;  2C3T A;  2N5A A;  5J4U A;  4KDX A;  2G2Q A;  1TK8 B;  2RII A;  5A4W A;  6GSS A;  4RQX A;  3ED3 A;  5D9X A;  2X99 A;  3GKK A;  1WRY A;  3ZFB A;  1JFU A;  2O85 A;  4MH2 A;  2H30 A;  2C0F A;  1XFL A;  1Z5Y E;  1WIK A;  1W4V A;  3IAM 2;  3DEX A;  3KTL A;  3ZIV A;  4JBB A;  1SK2 A;  4ZIL A;  2H71 A;  1ZOF A;  4OFN A;  3MNG A;  1GUL A;  3D6I A;  2F9S A;  4MPF A;  5FT3 A;  5A4V A;  1B9Y C;  3QFA C;  1X9M B;  3VWW A;  3M0F A;  3TJG A;  1MDI A;  1SJZ A;  5DQS A;  1A23 A;  4PX1 A;  1ZGN A;  1Z7R A;  2JAD A;  3F6D A;  3GKX A;  1F2E A;  4POB A;  5DAK A;  4HJM A;  4HDE A;  2OA7 A;  2VM1 A;  3IA1 A;  4TR3 A;  3RHC A;  1BG5 A;  3HJO A;  4GSS A;  2PPT A;  5IMV A;  4I97 A;  4ZB8 A;  4DSQ A;  1GUM A;  4I2T A;  1URM A;  2NPB A;  2X64 A;  3KCM A;  1TU7 A;  2A2S A;  1EV4 A;  1M99 A;  3C71 A;  2BJX A;  2K8S A;  1GP1 A;  3I69 A;  4WXT A;  3D4T A;  1TRV A;  2WB9 A;  3QPM A;  2H72 A;  3DYR A;  2GZY A;  1X0R A;  2R2J A;  4MA9 A;  1A2L A;  4PNF A;  2R5G A;  4OO5 A;  4DSR A;  2PU9 C;  4ZL8 A;  5IOX A;  2PMT A;  1TI1 A;  4Q5R A;  1C72 A;  1OKD A;  2E0Q A;  1WE0 A;  1XWG A;  1R26 A;  1G6Y A;  5GSS A;  3GN3 A;  1R5P A;  1SKW B;  2NBS A;  4KSM A;  4GST A;  2CAQ A;  3ME7 A;  1PL2 A;  4ZL7 A;  4NV2 A;  5ECH B;  3VLN A;  4BVY A;  1AXD A;  4ML1 A;  2I9H A;  2YWN A;  1THO A;  3D4M A;  5IIZ A;  1DSB A;  4OO4 A;  4ML6 A;  5IMC A;  5F07 A;  4BL7 A;  4L0W A;  4OCF A;  4O7H A;  4ID0 A;  1BYE A;  2GQK A;  4J2F A;  5IO0 A;  4KH7 A;  1ZZY A;  3ZZX A;  1SL1 B;  1THX A;  3UAR A;  3GTU A;  5HR1 A;  5JCU A;  4QQ7 A;  1SK1 A;  4ZBD A;  3GRX A;  3TKS E;  4LLR A;  1E2Y A;  4RI7 A;  1K3L A;  1R7H A;  4ZB9 A;  3EMP A;  1KBN A;  2LJA A;  1SEN A;  3ISO A;  4EKZ A;  1XWK A;  2IMK A;  1UA5 A;  1WP0 A;  1AQX A;  2WUL A;  1B9X C;  2H6X A;  5C04 A;  4YQU A;  2DIZ A;  5B6M A;  4F0C A;  2KP2 A;  3EYT A;  2OBI A;  5IM9 A;  1IYI A;  1GTI A;  2DJJ A;  1EP7 A;  2RUF A;  2YWI A;  1ACV A;  1VF3 A;  2KP1 A;  4NAX A;  8GSS A;  4IN0 A;  1AAZ A;  2MMA A;  4F82 A;  1SJI A;  3VWV A;  4NPB A;  3H79 A;  4MPG A;  3J7Y b;  2JSY A;  4BA7 A;  2WS2 A;  4JZQ A;  1SL2 B;  1ERW A;  2GS3 A;  5G5E A;  4IS0 A;  2FCH A;  1R5A A;  2VCX A;  4K6X A;  1AQW A;  2GQL A;  1ST9 A;  1AC1 A;  2ON5 A;  1AW9 A;  5CYY A;  3TJB A;  3I6A A;  3RAZ A;  1GSQ A;  1PMT A;  2YZH A;  3O3T A;  3OR5 A;  5ELG A;  2L4C A;  3P8W A;  3AY8 A;  5J9C A;  1JZO A;  4QL9 A;  3I43 A;  3HJM A;  2FUG 2;  4XS6 A;  4NXI A;  3IPZ A;  2WGR A;  4GWR A;  6GSV A;  4IGJ A;  5JWQ B;  4EO3 A;  2H74 A;  2MYG A;  3EC3 A;  1O73 A;  3GH9 A;  1PGT A;  1PSQ A;  3TRX A;  4TR4 A;  3IR4 A;  3PGT A;  5D96 A;  2CX3 A;  2CA8 A;  3DGQ A;  4FYB A;  2WDU A;  1A8L A;  4EC0 A;  1F9M A;  4EUY A;  4HJ2 A;  1KNG A;  1O8W A;  4MJE A;  3FR6 A;  3LXT A;  4GQC A;  2IMI A;  1BJX A;  1JLV A;  4FYU A;  3TOT A;  17GS A;  4ECI A;  4LA1 A;  1X5E A;  3M8N A;  1WJK A;  5G1K A;  4ZL9 A;  1O7U A;  5AIS A;  1YJ6 A;  1G7E A;  5CRH A;  3VI7 A;  4TN8 A;  12GS A;  1G6W A;  1GTA A;  4PNG A;  4XIH A;  4MZB A;  4FYC A;  10GS A;  1TRW A;  3GV1 A;  5G2Z A;  4F9Z A;  4EVM A;  5ECQ B;  1GSS A;  4ZBB A;  2PVQ A;  5ECS A;  5ID2 B;  9GSS A;  4FH8 A;  1QK8 A;  5IO2 A;  2YCD A;  4DEJ A;  2X8H A;  2LTK A;  4JRR A;  4MF7 A;  2DJ0 A;  3IK7 A;  1XWA A;  1TKD B;  4IP1 A;  3UEM A;  2VCZ A;  2K8V A;  1SK0 A;  3DVW A;  5HR3 A;  4Q5Q A;  2BMX A;  2NTO A;  1XBS A;  1OE8 A;  2LNS A;  3F0I A;  2OE3 A;  2FWG A;  3EU4 A;  3D21 A;  5FWG A;  5ECK B;  3MWH A;  2R37 A;  2GTU A;  4IW9 A;  4TR1 A;  2WFC A;  3GIX A;  3GH6 A;  1GLP A;  1FVJ A;  3UVH A;  4MZC A;  3P7X A;  4ECC A;  2FA4 A;  1SU9 A;  2H6Y A;  1BX9 A;  2C0D A;  3H8Q A;  3FK8 A;  5G31 A;  3LXZ A;  1T3B A;  3F8U A;  13GS A;  4MZW A;  5B8B A;  2H66 A;  3GKM A;  1M2D A;  6GSX A;  3HVV A;  4XRD A;  3A5W A;  3KM6 A;  1NSW A;  5LNK e;  1EWX A;  4XCS A;  4WEY A;  1Z3E A;  4HOJ A;  3MDK A;  1X9S B;  5DJM A;  2I4A A;  4HU7 A;  2GST A;  3GMF A;  2JZT A;  4X0X A;  5AIV A;  1NM3 A;  4N10 A;  2RM6 A;  5D9V A;  3TGZ A;  18GS A;  2VCT A;  2AV4 A;  3F3Q A;  1ZL9 A;  1AUC A;  5FHI A;  1TI3 A;  3C8E A;  1ON4 A;  1K0D A;  2IME A;  2LS5 A;  4HQZ A;  5EY6 A;  5KN0 A;  1SL0 B;  3LSZ A;  1GWC A;  3GUR A;  6GSW A;  1Z6N A;  2M80 A;  2REM A;  3PIN A;  2HSH A;  4O92 A;  2HZE B;  2V41 A;  1VRS D;  2YNX A;  3IC4 A;  3M3M A;  1JLW A;  1V58 A;  2C3Q A;  5H5R A;  1SD8 A;  3LQ7 A;  5F8B A;  5ID2 A;  2ALB A;  3FZA A;  2L4Q A;  2GZP A;  2HXK A;  19GS A;  3GKN A;  4OFT A;  3WT1 A;  3W6G A;  1QUW A;  5ECL B;  16GS A;  1EEJ A;  5ECN B;  4WKW A;  5A5K A;  1TK0 B;  1F37 A;  4OCE A;  14GS A;  2GT6 A;  2LKU A;  3O6T A;  2LJR A;  2QSI A;  1RQM A;  4ZB6 A;  3VWX A;  3LWA A;  4MDC A;  5AIX A;  1K0O A;  2O89 A;  4RI6 A;  4N11 A;  3KGK A;  3UL3 A;  1ZMA A;  2H19 A;  4MK3 A;  1KTE A;  1GNE A;  4KW6 A;  1QFN A;  4HI7 A;  3F6F A;  4GXZ A;  11GS A;  4HUA A;  3A2V A;  4L5O A;  4Q5F A;  2YP6 A;  5EPF A;  1F3A A;  2F8A A;  1ZCP A;  2XC2 A;  1W89 A;  5B7C A;  1A24 A;  4TXV A;  2C80 A;  2L6C A;  1GSD A;  1GSE A;  2CAI A;  2JZR A;  4K0N A;  4IHU A;  4PUR A;  5CRG A;  4MF5 A;  3WGD A;  1QMV A;  5KN1 A;  2PWJ A;  2A4V A;  3HD5 A;  2L5O A;  3G9B A;  2AAW A;  5G1L A;  2B5E A;  3FY7 A;  2R3X A;  4PGT A;  5J5N A;  4WR4 A;  2X8G A;  3TUE A;  1X5C A;  2R6K A;  3HVX A;  1GUK A;  2VD0 A;  5D9W A;  4OMV A;  1EZK A;  4RQR A;  2MMZ A;  1M0U A;  1Y25 A;  3FR9 A;  5HR2 A;  1YKC A;  3RBT A;  2VUP A;  4F2I A;  3ZIT A;  5CRW A;  4AJ7 A;  1PX7 A;  2V6K A;  2JU5 A;  3US3 A;  2ON7 A;  3RDW A;  3SBC A;  2HZE A;  1PQN A;  3C1R A;  2CVD A;  1XVQ A;  2YPM A;  3UJ1 A;  1QGV A;  5JCG A;  1XVW A;  2H1G A;  4WF5 A;  3GYK A;  3HXS A;  4V2N A;  2I81 A;  4MCU A;  3KJY A;  3ERG A;  1OAZ A;  4D73 B;  1T7P B;  2LRN A;  2KUC A;  4HZ2 A;  2H01 A;  4K9Z A;  5IMZ A;  3ZLP A;  2H0H A;  2VD1 A;  3ZTL A;  2MZC A;  1CQG A;  2JSZ A;  3KP9 A;  1HNB A;  2DML A;  2RM5 A;  2ZCT A;  5ECM B;  2EC4 A;  1ERV A;  5H5Q A;  1OYJ A;  1A2J A;  4V1A p;  3KMO A;  3F9U A;  1YDK A;  3ERF A;  3TJK A;  3C1S A;  3WGE A;  2VLV A;  5ENU A;  3MSZ A;  4G19 A;  2E2G A;  2Z9S A;  1O85 A;  1DE1 A;  3BD2 A;  4WET A;  2YJ7 A;  1X9W B;  3CTG A;  3TJF A;  1M7T A;  2FNO A;  3HJP A;  2DJ3 A;  1GUH A;  1O6J A;  1WOU A;  3TCO A;  2XBQ A;  5L71 A;  2CZ3 A;  3P90 A;  1K3O A;  4BVX A;  1SKR B;  4K7O A;  3LYP A;  2RUE A;  1V2A A;  2FD3 A;  2VO4 A;  3VK9 A;  1QXH A;  2HI7 A;  1JZR A;  2HRF A;  2KLX A;  3F4R A;  1PA3 A;  1T00 A;  3KIJ A;  2K9F A;  3UBL A;  3HHV A;  2OAC A;  4LL1 B;  1A2M A;  3QMX A;  1YF0 A;  3HDC A;  3Q6O A;  1EOH A;  5IMA A;  1EEM A;  3CMI A;  2O7K A;  4GCI A;  3IK9 A;  4IJI A;  3GA4 A;  4MMM A;  5DAL B;  1PL1 A;  2BTO T;  5LCZ A;  1WPI A;  2YWO A;  2GGT A;  3GX0 A;  5ELA A;  1MD3 A;  2PGT A;  4POK A;  2YV9 A;  5IMD A;  1JZD A;  1MD4 A;  4POL A;  4EXJ A;  2F8F A;  5J3R A;  2LQO A;  2H76 A;  3TRP A;  4YQM A;  4N30 A;  1ABA A;  3IHQ A;  4BWS A;  4MF6 A;  5ECR B;  4GQF A;  1RK4 A;  2YAN A;  5C00 A;  2N5B A;  4IEL A;  1J08 A;  4D73 A;  1NHY A;  3L9U A;  2ZUP A;  2WCI A;  1Q4J A;  2TIR A;  4G10 A;  1YEX A;  5CAX A;  1JZW A;  2FWH A;  2VLU A;  3QD9 A;  1T1V A;  2I1U A;  5D73 A;  4KCE A;  2B1L A;  4ULX A;  4K8M A;  3QR6 A;  4XS4 B;  2H1D A;  3Q74 A;  1VF1 A;  1G0T A;  1UC7 A;  3V1W A;  4GF0 A;  4LL4 B;  1AIU A;  1V57 A;  3IAS 2;  4CW9 A;  5HR0 A;  4TKY A;  1ERU A;  5JCW A;  3O76 A;  1O8X A;  2YV7 A;  1U6T A;  2C0G A;  2V32 A;  4JR6 A;  4YAV A;  3BCK A;  5DQY A;  4Q5N A;  2GSQ A;  3ZFL A;  3Q19 A;  3NZN A;  5G30 A;  4WF4 A;  2HE3 A;  4KA0 A;  4ZXG A;  2YZU A;  3M9J A;  5B6N A;  2GZZ A;  3FW2 A;  4GSN A;  3CSI A;  2YJH A;  2O87 A;  3QCP A;  2HLS A;  3H93 A;  1ZYE A;  4JU5 A;  4ACS A;  3FRC A;  4JED A;  3R2Q A;  5DDL A;  4IVF A;  1PRX A;  5CRD A;  4RUV A;  3FEU A;  3ERW A;  2QKE A;  1FAA A;  3DML A;  3APS A;  1EP8 A;  2VM2 A;  2GQM A;  1GLQ A;  3DVX A;  2YWM A;  1GH2 A;  3K8N A;  3GHA A;  3KH7 A;  5IMF A;  5JWO B;  3ZYW A;  5IPG A;  4MJA A;  1O81 A;  5CNW A;  2MBS A;  3SWL A;  2YOI A;  1K0N A;  4PXO A;  3WD6 A;  3PH9 A;  2C4J A;  4Z7X A;  1K0C A;  1YY7 A;  4X43 A;  1TDI A;  3GSS A;  1OE7 A;  3EU3 A;  3L4N A;  3ZIJ A;  4EE0 A;  2VLT A;  4I6X A;  5CRE A;  5F05 A;  5GAN D;  4IQA A;  1U3I A;  2FLS A;  3ZVJ A;  1AQV A;  2DJ1 A;  3LOR A;  2CT6 A;  4PQI A;  1YQ1 A;  3VWU A;  1SJ6 A;  1UN2 A;  2IPA A;  2C0E A;  2IJY A;  1FG4 A;  5LD0 A;  4EDY A;  3EE2 A;  1HD2 A;  3G7Y A;  3G7I A;  1U3A A;  2CVB A;  2P0G A;  4WBR D;  2KOK A;  3DWV A;  4I5Q A;  2OAD A;  1K0A A;  2FY6 A;  2TRC P;  2CX4 A;  1TTZ A;  2E2M A;  4KDY A;  4KSO A;  5GAP D;  2G0F A;  2H73 A;  1LU4 A;  2B6M A;  3LEF A;  5DJL A;  3TOU A;  2H70 A;  1SKS B;  1TOF A;  2O8V B;  4HS1 A;  2WJU A;  4GTU A;  2IMD A;  1H75 A;  3TJJ A;  3KTB A;  1G7O A;  1XWB A;  2JZS A;  3KZQ A;  3IRA A;  3L78 A;  1WMJ A;  1DBY A;  2N5F A;  3KP8 A;  3ZRE A;  1GSU A;  1N2A A;  3KD0 A;  1GSY A;  4KE3 A;  2LRT A;  6GSU A;  2DBC A;  3IDV A;  1K3Y A;  3LGC A;  2EIQ A;  2HZF A;  4NHZ A;  1B4Q A;  2K6V A;  3UBK A;  5KN3 A;  1XCC A;  5KN2 A;  3WT2 A;  3QFB C;  4AGS A;  3LYK A;  3CRT A;  2XBI A;  4O5R A;  1H4O A;  2IFQ B;  2V6O A;  4G2E A;  2AYT A;  4K1F A;  3GST A;  3L9V A;  2AUV A;  2DJK A;  1TP9 A;  4NV5 A;  2H1A A;  3I9V 2;  1Y6E A;  2CQ9 A;  4HU9 A;  2FHE A;  4KAE A;  3UIW A;  4I8B A;  2ZNM A;  3F3R A;  2FGX A;  3QAG A;  2HFD A;  5H5S A;  6GST A;  1YEP A;  3A2X A;  4PQH A;  1HNC A;  3KMN A;  2VCW A;  3IE3 A;  4AF2 A;  2IIY A;  1B8X A;  2IN3 A;  2QGV A;  2JAC A;  3TKP A;  3DD3 A;  4IP6 A;  4E8E A;  4X1U A;  3DKS A;  5ECI B;  2J23 A;  2EIO A;  1XZO A;  2PBJ A;  2H75 A;  1XOA A;  3F4S A;  4K0G A;  4AJ6 A;  3TDG A;  2PVO C;  1B48 A;  1TXX A;  5ABR A;  2VIM A;  1FO5 A;  3HA9 A;  1I9D A;  2HSY A;  3E0U A;  3S9F A;  4OD7 A;  3GFK A;  3HVS A;  5D8I A;  2OJL A;  1EOG A;  5D93 A;  1N8J A;  4IQ1 A;  2MMO A;  3CBU A;  1B4P A;  3DRN A;  4F03 A;  3HYP A;  3QAV A;  3CYN A;  4MLY A;  4QL7 A;  1YZX A;  2F51 A;  4MJB A;  1KEB A;  4DSS B;  3NIV A;  1TW9 A;  2TRX A;  3GTU B;  3ZL5 A;  3FZ9 A;  3HY2 A;  5HFI A;  5DBQ A;  3LJR A;  1EGR A;  1MTC A;  4EF0 A;  3TKQ A;  4TR0 A;  2XPE A;  3WYW A;  3EWL A;  3VI5 A;  3L0H A;  1FVK A;  3CRU A;  2IFQ A;  1QQ2 A;  1LJR A;  5F0G A;  2F3M A;  5DVB A;  3UOM A;  1XW9 A;  1J0F A;  3CXG A;  2P5R A;  3CSH A;  5J9B A;  3QDN A;  1VF2 A;  4CDO A;  2L59 A;  3FR3 A;  1BED A;  5AN1 A;  4PUA A;  3KEB A;  4GLT A;  5EL8 A;  3J7Y k;  4ECB A;  3F63 A;  3ZRD A;  2VAF A;  4K2D A;  4OFM A;  3IV4 A;  2OKA A;  3L9S A;  2L57 A;  2IWT A;  2M72 A;  2LV3 A;  1M9B A;  4BPY A;  2VOC A;  4YQV A;  4TVE A;  1K0M A;  2B3S A;  1A8Y A;  3W8S A;  3RPP A;  3LFL A;  1PKW A;  2IL3 A;  3HCZ A;  1F3B A;  3HZ8 A;  1A0R P;  5HQP A;  2B7J A;  1V9W A;  4HQS A;  3FZ5 A;  2GLR A; 
#chains in the Genus database with same CATH topology
 2B5X A;  1BAY A;  3BCI A;  3F4T A;  3N9J A;  3EUR A;  1HYU A;  2FA8 A;  3W8J A;  4XRA A;  4WBJ A;  2P5Q A;  1OC9 B;  3EVI A;  1U87 A;  4KDU A;  2VL2 A;  4KUN A;  2R4V A;  4TXO B;  4EL1 A;  3QOU A;  4ZBA A;  1GL8 A;  1M2A A;  1U88 A;  2LJK A;  4PQ1 A;  5HFK A;  1I5G A;  4PUF C;  4DSS A;  1WWJ A;  4O32 A;  2D2Z A;  2LUS A;  2LQQ A;  3MAK A;  4JE1 A;  1DE2 A;  7GSS A;  2FWE A;  1HNA A;  3NOF A;  2KHP A;  2H6Z A;  4HEA 2;  1GRX A;  3P2A A;  2HRN A;  1NW2 A;  2GT5 A;  3DXB A;  3TKS A;  2LST A;  4CY6 A;  2GSR A;  1XG8 A;  1A0F A;  4TOP A;  1FHE A;  1CQH A;  1YKA A;  4IBP A;  4JR4 A;  3H1N A;  5IPH A;  4NMU A;  1OKT A;  3C73 A;  2LNT A;  3N5O A;  5A4U A;  6GSY A;  5DCG A;  4N0Z A;  1T4Y A;  2WZ9 A;  2DLX A;  3HZ4 A;  2QA2 A;  5E4W A;  1XWC A;  2DMM A;  2GDR A;  1GTB A;  2OE1 A;  3UAP A;  2I3Y A;  1OC3 A;  3BBY A;  1Z9H A;  2VL2 C;  2OE0 A;  1PX6 A;  4L5L A;  3IOS A;  4J57 E;  1HQO A;  2HRK A;  1OC8 A;  3GL5 A;  4HZ4 A;  4ZIJ A;  4XTS A;  4KCA A;  3UMA A;  4KB3 A;  5JWR B;  2PUK C;  4KND A;  4L8E A;  4TRX A;  4NHW A;  4YKF A;  3RPN A;  3VPQ A;  2P31 A;  5E59 A;  4XHM A;  4TR1 B;  3LG6 A;  3GUS A;  2GVP A;  1E6B A;  4LMV A;  1M9A A;  3KH9 A;  1LBK A;  3VFI A;  2NDO A;  3TKS C;  3ZVJ D;  1ZYQ B;  1XW5 A;  3D0Z A;  4YH2 A;  3E9J B;  3ZMK A;  2M46 A;  1RW1 A;  5ECP B;  1EGO A;  2HYX A;  1PN9 A;  1OC9 A;  4N0V A;  3RHB A;  1Z7P A;  4CHS A;  4WR5 A;  2OBK A;  2AHE A;  1JHB A;  4TXO A;  1SD9 A;  1EV9 A;  1FOV A;  5J41 A;  1TJD A;  3ZML A;  4K7N A;  2B7K A;  2MMN A;  5D9T A;  1NHO A;  1MDJ A;  4L0U A;  4Z2R A;  3IBH A;  3GNJ A;  2DIY A;  3U6V A;  2AJQ B;  2IMF A;  4H86 A;  1R4W A;  2WRT A;  2VL3 A;  3HKR A;  3KXO A;  3APO A;  1V40 A;  3APQ A;  2HT9 A;  5DAL A;  4AJ8 A;  2VL9 A;  1ERT A;  5G5F A;  5CO3 A;  1TU8 A;  2CVK A;  1F6M C;  5ECO B;  4FO5 A;  3Q18 A;  4E8H A;  1XOB A;  5DCH A;  3TKR A;  2QC7 A;  2VCQ A;  2XPD A;  2V2G A;  1FOH A;  3GX8 A;  1BQ7 A;  5KOW A;  3A2W A;  3BJ5 A;  4BWQ A;  3EMX A;  4MJC A;  1ILO A;  1FB6 A;  5HFG A;  3PR8 A;  2DSA A;  3U5R E;  1OVN A;  1J9B A;  3CTF A;  5IOW A;  3FHK A;  2HNL A;  3IXR A;  4P3Y B;  3M9K A;  2L6D A;  1GSF A;  5F06 A;  3UVT A;  3E3E A;  3JCM L;  2ES7 A;  4G9H A;  4IKH A;  3A3T A;  1X5D A;  4O5Q A;  1DUG A;  4F0B A;  4XS1 A;  4MH3 A;  1XXU A;  4XS4 A;  2K18 A;  4IJ3 A;  3D5J A;  1PD2 1;  2EIR A;  2LEG A;  2H1B A;  4YAP A;  4V2M A;  4DVC A;  3M1G A;  1GNW A;  2C8U A;  2C1Y A;  3QAW A;  2E7P A;  2FWF A;  3WGX A;  4MP4 A;  2J9H A;  2MBT A;  3CSJ A;  1USB A;  3VPT A;  4TW5 A;  1XIY A;  1YF1 A;  1XW6 A;  4K7I A;  1TK5 B;  4LMW A;  5COH A;  4EDZ A;  4MAB A;  2H0I A;  1S3A A;  2AB6 A;  1V98 A;  4V1A g;  3ME8 A;  4ECJ A;  2GSS A;  1ML6 A;  1TRU A;  2VCV A;  3G7J A;  1K0B A;  3C7M A;  4KGI A;  1S3C A;  5GST A;  3H4K A;  1GTU A;  5IQY A;  4ISD A;  1T8E B;  1MDK A;  1PKZ A;  3FZ4 A;  5CP1 A;  2XHF A;  4I2U A;  4KX4 A;  4ILF A;  1TRS A;  2DC5 A;  1T4Z A;  1M2B A;  2UZ8 A;  2YN1 A;  3DIE A;  2X8C A;  4J56 E;  3TRQ A;  3FYG A;  1FB0 A;  1SYX A;  2PN8 A;  5B8A A;  2A2R A;  4OWY A;  1VGL A;  5DAK B;  3IC8 A;  2PER A;  1XPV A;  4POM A;  2H8L A;  4V2L A;  1IYH A;  4NWY A;  20GS A;  22GS A;  2JL4 A;  2L5L A;  2CZ2 A;  2C3N A;  1SYR A;  3EIN A;  2B1K A;  2NVL A;  2H0G A;  4FIW A;  5INY A;  2RLI A;  3D22 A;  4K2X A;  1VF4 A;  1UVZ A;  2CV4 A;  1MEK A;  3TB2 A;  2LRC A;  3VUR A;  3FKF A;  2B5Y A;  5EVO A;  4HSC X;  3GL3 A;  5AGY A;  1Q98 A;  4ICY A;  5KEJ A;  3BOA A;  1FW1 A;  2V1M A;  5GZZ B;  1S3D A;  4GRF A;  2DJ2 A;  1Z6M A;  2C3T A;  2N5A A;  5J4U A;  4KDX A;  2G2Q A;  4K5R A;  1TK8 B;  2RII A;  5A4W A;  6GSS A;  4RQX A;  3ED3 A;  5D9X A;  2X99 A;  3GKK A;  1WRY A;  1PN0 A;  4MNN A;  4BVY B;  3ZFB A;  1JFU A;  2O85 A;  4MH2 A;  4A5P A;  2H30 A;  2C0F A;  1XFL A;  1Z5Y E;  1WIK A;  1W4V A;  3IAM 2;  3DEX A;  3KTL A;  4BL7 B;  3ZIV A;  4JBB A;  3MYD A;  1SK2 A;  4ZIL A;  2H71 A;  1ZOF A;  4OFN A;  3MNG A;  1GUL A;  3D6I A;  2F9S A;  4MPF A;  5FT3 A;  5A4V A;  1B9Y C;  3QFA C;  3MIX A;  1X9M B;  3VWW A;  3M0F A;  3TJG A;  1MDI A;  1SJZ A;  5DQS A;  1A23 A;  4PX1 A;  1ZGN A;  1Z7R A;  2JAD A;  3F6D A;  3GKX A;  1F2E A;  4POB A;  5DAK A;  4HJM A;  4HDE A;  2OA7 A;  2VM1 A;  3IA1 A;  4TR3 A;  3RHC A;  1BG5 A;  3HJO A;  4GSS A;  2PPT A;  5IMV A;  4I97 A;  4ZB8 A;  4DSQ A;  1GUM A;  4I2T A;  1URM A;  2NPB A;  2X64 A;  3KCM A;  1TU7 A;  2A2S A;  1EV4 A;  1M99 A;  3C71 A;  3IHG A;  2BJX A;  2K8S A;  1GP1 A;  3I69 A;  4WXT A;  3D4T A;  1TRV A;  2WB9 A;  3QPM A;  2H72 A;  3DYR A;  2GZY A;  1X0R A;  2R2J A;  4MA9 A;  1A2L A;  4PNF A;  2R5G A;  4OO5 A;  4DSR A;  2PU9 C;  4ZL8 A;  5IOX A;  2PMT A;  1TI1 A;  4BIK A;  4Q5R A;  1C72 A;  1OKD A;  2E0Q A;  1WE0 A;  1XWG A;  1R26 A;  1G6Y A;  5GSS A;  1M3J A;  3GN3 A;  1R5P A;  1SKW B;  2NBS A;  4KSM A;  4GST A;  2CAQ A;  3ME7 A;  1PL2 A;  4ZL7 A;  4NV2 A;  5ECH B;  3VLN A;  4BVY A;  1AXD A;  4ML1 A;  2I9H A;  2YWN A;  1THO A;  3D4M A;  5IIZ A;  1DSB A;  4OO4 A;  4ML6 A;  5IMC A;  5F07 A;  4BL7 A;  4L0W A;  4OCF A;  4O7H A;  4ID0 A;  1BYE A;  2GQK A;  4J2F A;  5IO0 A;  4KH7 A;  1ZZY A;  3ZZX A;  1SL1 B;  1THX A;  3UAR A;  3GTU A;  5HR1 A;  5JCU A;  4QQ7 A;  1SK1 A;  4ZBD A;  3GRX A;  3TKS E;  4LLR A;  1E2Y A;  4RI7 A;  1K3L A;  1R7H A;  4ZB9 A;  3EMP A;  1KBN A;  2LJA A;  1SEN A;  3ISO A;  4G0K A;  4EKZ A;  1XWK A;  2IMK A;  1UA5 A;  1WP0 A;  1AQX A;  2WUL A;  1B9X C;  2H6X A;  5C04 A;  4YQU A;  2DIZ A;  5B6M A;  4F0C A;  2KP2 A;  3EYT A;  2OBI A;  5IM9 A;  1IYI A;  1GTI A;  2DJJ A;  1EP7 A;  2RUF A;  2YWI A;  1ACV A;  2X4A A;  1VF3 A;  2KP1 A;  4NAX A;  8GSS A;  4IN0 A;  1AAZ A;  2MMA A;  4F82 A;  1SJI A;  3VWV A;  4NPB A;  2A2P A;  3H79 A;  4MPG A;  3J7Y b;  2JSY A;  4BA7 A;  2WS2 A;  4JZQ A;  1SL2 B;  1ERW A;  2GS3 A;  5G5E A;  4IS0 A;  2FCH A;  1R5A A;  2VCX A;  4K6X A;  1AQW A;  2GQL A;  1ST9 A;  1AC1 A;  2ON5 A;  1AW9 A;  5CYY A;  3TJB A;  3I6A A;  3RAZ A;  1GSQ A;  1PMT A;  2YZH A;  3O3T A;  3OR5 A;  5ELG A;  2L4C A;  3P8W A;  3AY8 A;  5J9C A;  1JZO A;  1S3R A;  4QL9 A;  3I43 A;  3HJM A;  2FUG 2;  4XS6 A;  4NXI A;  3IPZ A;  2WGR A;  4GWR A;  6GSV A;  4IGJ A;  5JWQ B;  4EO3 A;  2H74 A;  2MYG A;  3EC3 A;  1O73 A;  1ZYN A;  3GH9 A;  1PGT A;  1PSQ A;  3TRX A;  4TR4 A;  3IR4 A;  3PGT A;  5D96 A;  2CX3 A;  2CA8 A;  3DGQ A;  4FYB A;  2WDU A;  1A8L A;  4EC0 A;  1F9M A;  4EUY A;  4HJ2 A;  1KNG A;  1O8W A;  4MJE A;  3FR6 A;  3LXT A;  4GQC A;  2IMI A;  1BJX A;  2X49 A;  1JLV A;  4FYU A;  3TOT A;  17GS A;  4ECI A;  4LA1 A;  1X5E A;  3M8N A;  1WJK A;  5G1K A;  4ZL9 A;  1O7U A;  5AIS A;  1YJ6 A;  1G7E A;  5CRH A;  3VI7 A;  4TN8 A;  12GS A;  2HSM A;  1G6W A;  1GTA A;  4PNG A;  4XIH A;  4MZB A;  4FYC A;  10GS A;  1TRW A;  3GV1 A;  5G2Z A;  4F9Z A;  4EVM A;  5ECQ B;  1GSS A;  4ZBB A;  2PVQ A;  5ECS A;  3LW9 A;  5ID2 B;  9GSS A;  4FH8 A;  1QK8 A;  4FQU A;  5IO2 A;  3EPT A;  2YCD A;  4DEJ A;  2X8H A;  2LTK A;  4JRR A;  4MF7 A;  2DJ0 A;  3IK7 A;  1XWA A;  1TKD B;  4IP1 A;  3UEM A;  2VCZ A;  2K8V A;  1SK0 A;  3DVW A;  5HR3 A;  4Q5Q A;  2BMX A;  2NTO A;  1XBS A;  1OE8 A;  2LNS A;  3F0I A;  2OE3 A;  2FWG A;  3EU4 A;  3D21 A;  5FWG A;  5ECK B;  3MWH A;  2R37 A;  2GTU A;  4IW9 A;  4TR1 A;  2WFC A;  3GIX A;  3GH6 A;  1GLP A;  1FVJ A;  3UVH A;  4MZC A;  3P7X A;  4ECC A;  2FA4 A;  1SU9 A;  2H6Y A;  1BX9 A;  2C0D A;  3H8Q A;  3FK8 A;  5G31 A;  3LXZ A;  1T3B A;  3F8U A;  13GS A;  4MZW A;  5B8B A;  2H66 A;  2R0C A;  3GKM A;  1M2D A;  6GSX A;  3HVV A;  4XRD A;  3A5W A;  3KM6 A;  1NSW A;  5LNK e;  1EWX A;  4XCS A;  4WEY A;  1Z3E A;  4HOJ A;  3MDK A;  1X9S B;  5DJM A;  2I4A A;  4HU7 A;  2GST A;  3GMF A;  2JZT A;  4X0X A;  5AIV A;  1NM3 A;  4N10 A;  2RM6 A;  5D9V A;  3TGZ A;  18GS A;  2VCT A;  2AV4 A;  3F3Q A;  1ZL9 A;  1AUC A;  5FHI A;  1TI3 A;  3C8E A;  1ON4 A;  1K0D A;  2IME A;  2LS5 A;  4HQZ A;  5EY6 A;  5KN0 A;  1SL0 B;  3LSZ A;  1GWC A;  3GUR A;  6GSW A;  1Z6N A;  2M80 A;  2REM A;  3PIN A;  2HSH A;  4O92 A;  2HZE B;  2V41 A;  1VRS D;  2YNX A;  3IC4 A;  3M3M A;  1JLW A;  1V58 A;  2C3Q A;  5H5R A;  5BMU A;  1SD8 A;  3LQ7 A;  5F8B A;  5ID2 A;  2ALB A;  3FZA A;  2L4Q A;  2GZP A;  2HXK A;  19GS A;  3GKN A;  3R3E A;  4OFT A;  3WT1 A;  3W6G A;  1QUW A;  5ECL B;  1ZYP A;  16GS A;  1EEJ A;  5ECN B;  4WKW A;  5A5K A;  1TK0 B;  1F37 A;  1PFO A;  4OCE A;  14GS A;  2GT6 A;  2LKU A;  3O6T A;  2LJR A;  2QSI A;  1RQM A;  4ZB6 A;  3VWX A;  3LWA A;  4MDC A;  5AIX A;  1K0O A;  2O89 A;  4RI6 A;  4N11 A;  3KGK A;  3UL3 A;  1ZMA A;  2H19 A;  4MK3 A;  1KTE A;  1GNE A;  4KW6 A;  1QFN A;  4HI7 A;  3F6F A;  4GXZ A;  11GS A;  4HUA A;  3A2V A;  4L5O A;  4Q5F A;  2YP6 A;  5EPF A;  1F3A A;  2F8A A;  1ZCP A;  2XC2 A;  1W89 A;  5B7C A;  1A24 A;  4TXV A;  2C80 A;  2L6C A;  1GSD A;  1GSE A;  4K5S A;  2CAI A;  2JZR A;  4K0N A;  4IHU A;  3A5I A;  4PUR A;  5CRG A;  4MF5 A;  3WGD A;  4BVX B;  1QMV A;  5KN1 A;  2PWJ A;  2A4V A;  3HD5 A;  2L5O A;  3G9B A;  2AAW A;  5G1L A;  2B5E A;  3FY7 A;  2R3X A;  4PGT A;  5J5N A;  4WR4 A;  2X8G A;  3TUE A;  1X5C A;  2R6K A;  3HVX A;  1GUK A;  2VD0 A;  5D9W A;  4OMV A;  1EZK A;  4RQR A;  2MMZ A;  1M0U A;  1Y25 A;  3FR9 A;  5HR2 A;  1YKC A;  3RBT A;  2VUP A;  4F2I A;  3ZIT A;  5CRW A;  4AJ7 A;  1PX7 A;  2V6K A;  2JU5 A;  3US3 A;  2ON7 A;  3RDW A;  3SBC A;  2HZE A;  1PQN A;  3C1R A;  2CVD A;  1XVQ A;  2YPM A;  3UJ1 A;  1QGV A;  5JCG A;  1XVW A;  2H1G A;  4WF5 A;  3GYK A;  3HXS A;  4V2N A;  2I81 A;  4MCU A;  3KJY A;  3ERG A;  1OAZ A;  4D73 B;  1T7P B;  2LRN A;  2KUC A;  4HZ2 A;  2H01 A;  4K9Z A;  4G0L A;  5IMZ A;  3ZLP A;  2H0H A;  2VD1 A;  3ZTL A;  2MZC A;  1CQG A;  2JSZ A;  3KP9 A;  1HNB A;  2DML A;  2RM5 A;  2ZCT A;  5ECM B;  2EC4 A;  1ERV A;  5H5Q A;  1OYJ A;  1A2J A;  4V1A p;  3KMO A;  3F9U A;  1YDK A;  3ERF A;  3TJK A;  4CY8 A;  3C1S A;  3WGE A;  2VLV A;  5ENU A;  3MSZ A;  4G19 A;  2E2G A;  4USS A;  2Z9S A;  1O85 A;  1DE1 A;  3BD2 A;  4WET A;  2YJ7 A;  1X9W B;  3CTG A;  3TJF A;  1M7T A;  2FNO A;  3HJP A;  2DJ3 A;  1GUH A;  1O6J A;  1WOU A;  3TCO A;  2XBQ A;  5L71 A;  2CZ3 A;  3P90 A;  1K3O A;  4BVX A;  1SKR B;  4K7O A;  3LYP A;  2RUE A;  1V2A A;  2FD3 A;  2VO4 A;  3VK9 A;  1QXH A;  2HI7 A;  1JZR A;  2HRF A;  2KLX A;  3F4R A;  1PA3 A;  1T00 A;  3KIJ A;  2K9F A;  3UBL A;  3HHV A;  2OAC A;  4LL1 B;  1A2M A;  3QMX A;  1YF0 A;  3HDC A;  3Q6O A;  3PPU A;  1EOH A;  5IMA A;  1EEM A;  3CMI A;  2O7K A;  4GCI A;  3IK9 A;  4IJI A;  3GA4 A;  4MMM A;  5DAL B;  1PL1 A;  2BTO T;  5LCZ A;  1WPI A;  2YWO A;  2GGT A;  3GX0 A;  5ELA A;  1MD3 A;  2PGT A;  4POK A;  2YV9 A;  5IMD A;  2DKH A;  1JZD A;  1MD4 A;  4POL A;  4EXJ A;  2F8F A;  5J3R A;  2LQO A;  2H76 A;  3TRP A;  4YQM A;  4N30 A;  1ABA A;  3IHQ A;  4BWS A;  4MF6 A;  5ECR B;  4GQF A;  1RK4 A;  2YAN A;  5C00 A;  2N5B A;  4IEL A;  1J08 A;  4D73 A;  1NHY A;  3L9U A;  4EIP A;  2ZUP A;  2WCI A;  1Q4J A;  2TIR A;  4G10 A;  1YEX A;  5CAX A;  1JZW A;  2FWH A;  2VLU A;  3QD9 A;  1T1V A;  2I1U A;  5D73 A;  4KCE A;  2B1L A;  4ULX A;  4K8M A;  3QR6 A;  4XS4 B;  2H1D A;  3Q74 A;  1VF1 A;  1G0T A;  1UC7 A;  2QA1 A;  3V1W A;  4GF0 A;  4LL4 B;  1AIU A;  1V57 A;  3IAS 2;  4CW9 A;  5HR0 A;  4TKY A;  1ERU A;  5JCW A;  1M3I A;  3O76 A;  1O8X A;  2YV7 A;  1U6T A;  2C0G A;  2V32 A;  4JR6 A;  4YAV A;  3BCK A;  5DQY A;  4Q5N A;  2GSQ A;  3ZFL A;  2A4H A;  3Q19 A;  3NZN A;  5G30 A;  4WF4 A;  2HE3 A;  4KA0 A;  4ZXG A;  2YZU A;  3M9J A;  5B6N A;  2GZZ A;  3FW2 A;  4GSN A;  3CSI A;  2YJH A;  2O87 A;  3QCP A;  2HLS A;  4Z2T A;  3H93 A;  1ZYE A;  4JU5 A;  4ACS A;  3FRC A;  4G0I A;  4JED A;  3R2Q A;  5DDL A;  4O5U A;  4EIQ A;  4IVF A;  1PRX A;  5CRD A;  4RUV A;  3FEU A;  3ERW A;  2QKE A;  1FAA A;  3DML A;  3APS A;  1EP8 A;  2VM2 A;  2GQM A;  1GLQ A;  3DVX A;  2YWM A;  1GH2 A;  3K8N A;  3GHA A;  3KH7 A;  5IMF A;  5JWO B;  3ZYW A;  4KF9 A;  5IPG A;  4MJA A;  3HVN A;  1O81 A;  5CNW A;  2MBS A;  3SWL A;  2YOI A;  1K0N A;  4PXO A;  3WD6 A;  3PH9 A;  2C4J A;  4Z7X A;  1K0C A;  1YY7 A;  4X43 A;  1TDI A;  3GSS A;  1OE7 A;  3EU3 A;  3L4N A;  3ZIJ A;  4EE0 A;  2VLT A;  4I6X A;  5CRE A;  5F05 A;  5GAN D;  4IQA A;  1U3I A;  2FLS A;  3ZVJ A;  1AQV A;  2DJ1 A;  3LOR A;  2CT6 A;  4PQI A;  1YQ1 A;  3VWU A;  5KOX A;  1SJ6 A;  1UN2 A;  2IPA A;  2C0E A;  2IJY A;  1FG4 A;  5LD0 A;  4EDY A;  3EE2 A;  1HD2 A;  3G7Y A;  3G7I A;  1U3A A;  2CVB A;  2P0G A;  4WBR D;  2KOK A;  3DWV A;  4I5Q A;  2OAD A;  1K0A A;  2FY6 A;  2TRC P;  2CX4 A;  1TTZ A;  2E2M A;  4KDY A;  3FMW A;  4KSO A;  5GAP D;  2G0F A;  2H73 A;  1LU4 A;  2B6M A;  3LEF A;  5DJL A;  3TOU A;  2H70 A;  1SKS B;  1TOF A;  2O8V B;  4HS1 A;  2WJU A;  4GTU A;  2IMD A;  1H75 A;  3TJJ A;  3KTB A;  1G7O A;  1XWB A;  2JZS A;  3KZQ A;  3IRA A;  3L78 A;  1WMJ A;  1DBY A;  2N5F A;  3KP8 A;  3ZRE A;  1GSU A;  1N2A A;  3KD0 A;  1GSY A;  4KE3 A;  2LRT A;  6GSU A;  2DBC A;  3IDV A;  1K3Y A;  3LGC A;  2EIQ A;  3CQF A;  2HZF A;  4NHZ A;  1B4Q A;  2K6V A;  3UBK A;  5KN3 A;  1XCC A;  4X4J A;  5KN2 A;  3WT2 A;  3QFB C;  4AGS A;  3LYK A;  3CRT A;  2XBI A;  4O5R A;  1H4O A;  2IFQ B;  2V6O A;  4G2E A;  2AYT A;  4K1F A;  3GST A;  3L9V A;  2AUV A;  2DJK A;  1TP9 A;  4NV5 A;  2H1A A;  4YKG A;  3I9V 2;  1Y6E A;  2CQ9 A;  4HU9 A;  2FHE A;  4KAE A;  3UIW A;  4I8B A;  2ZNM A;  3F3R A;  2FGX A;  3QAG A;  2HFD A;  5H5S A;  6GST A;  1YEP A;  3A2X A;  4PQH A;  1HNC A;  3KMN A;  2VCW A;  3IE3 A;  4AF2 A;  2IIY A;  1B8X A;  2IN3 A;  2QGV A;  2JAC A;  3TKP A;  3DD3 A;  4IP6 A;  2HRA A;  4E8E A;  4X1U A;  3DKS A;  5ECI B;  2J23 A;  2EIO A;  1XZO A;  2PBJ A;  2H75 A;  1XOA A;  3F4S A;  4K0G A;  4AJ6 A;  3TDG A;  2PVO C;  1B48 A;  1TXX A;  5ABR A;  2VIM A;  1FO5 A;  3HA9 A;  1I9D A;  2HSY A;  3E0U A;  3S9F A;  4OD7 A;  3GFK A;  3HVS A;  5D8I A;  2OJL A;  1EOG A;  5D93 A;  1N8J A;  4IQ1 A;  2MMO A;  3CBU A;  4Z2U A;  1B4P A;  3DRN A;  4F03 A;  3HYP A;  3QAV A;  3CYN A;  4MLY A;  4QL7 A;  1YZX A;  2F51 A;  2R0P A;  4PTS A;  4MJB A;  2DKI A;  1KEB A;  4DSS B;  3NIV A;  1TW9 A;  2TRX A;  3GTU B;  3ZL5 A;  3FZ9 A;  3HY2 A;  5HFI A;  5DBQ A;  3LJR A;  1EGR A;  1MTC A;  4EF0 A;  3TKQ A;  4TR0 A;  2XPE A;  3WYW A;  3EWL A;  3VI5 A;  3L0H A;  5BRT A;  1FVK A;  3CRU A;  2IFQ A;  1QQ2 A;  1LJR A;  5F0G A;  2F3M A;  5DVB A;  3UOM A;  1XW9 A;  1J0F A;  3CXG A;  2P5R A;  3CSH A;  5J9B A;  3QDN A;  1VF2 A;  4CDO A;  2L59 A;  3FR3 A;  1BED A;  5AN1 A;  4PUA A;  3KEB A;  4GLT A;  5EL8 A;  3J7Y k;  4ECB A;  3F63 A;  3ZRD A;  2VAF A;  4K2D A;  4OFM A;  2R0G A;  3IV4 A;  2OKA A;  3L9S A;  2L57 A;  2IWT A;  2M72 A;  2LV3 A;  1M9B A;  4BPY A;  2VOC A;  4YQV A;  4TVE A;  1K0M A;  2B3S A;  1A8Y A;  3W8S A;  3RPP A;  3LFL A;  1PKW A;  2IL3 A;  3HCZ A;  1F3B A;  3HZ8 A;  1A0R P;  5HQP A;  2B7J A;  1V9W A;  4HQS A;  3FZ5 A;  2GLR A; 
#chains in the Genus database with same CATH homology
 2B5X A;  1BAY A;  3BCI A;  3F4T A;  3N9J A;  3EUR A;  1HYU A;  2FA8 A;  3W8J A;  4XRA A;  4WBJ A;  2P5Q A;  1OC9 B;  3EVI A;  1U87 A;  4KDU A;  2VL2 A;  4KUN A;  2R4V A;  4TXO B;  4EL1 A;  3QOU A;  4ZBA A;  1GL8 A;  1M2A A;  1U88 A;  2LJK A;  4PQ1 A;  5HFK A;  1I5G A;  4PUF C;  4DSS A;  1WWJ A;  4O32 A;  2D2Z A;  2LUS A;  2LQQ A;  3MAK A;  4JE1 A;  1DE2 A;  7GSS A;  2FWE A;  1HNA A;  3NOF A;  2KHP A;  2H6Z A;  4HEA 2;  1GRX A;  3P2A A;  2HRN A;  1NW2 A;  2GT5 A;  3DXB A;  3TKS A;  2LST A;  4CY6 A;  2GSR A;  1A0F A;  4TOP A;  1FHE A;  1CQH A;  1YKA A;  4IBP A;  4JR4 A;  3H1N A;  5IPH A;  4NMU A;  1OKT A;  3C73 A;  2LNT A;  3N5O A;  5A4U A;  6GSY A;  5DCG A;  4N0Z A;  1T4Y A;  2WZ9 A;  2DLX A;  3HZ4 A;  2QA2 A;  5E4W A;  1XWC A;  2DMM A;  2GDR A;  1GTB A;  2OE1 A;  3UAP A;  2I3Y A;  1OC3 A;  3BBY A;  1Z9H A;  2VL2 C;  2OE0 A;  1PX6 A;  4L5L A;  3IOS A;  4J57 E;  1HQO A;  2HRK A;  1OC8 A;  3GL5 A;  4HZ4 A;  4ZIJ A;  4XTS A;  4KCA A;  3UMA A;  4KB3 A;  5JWR B;  2PUK C;  4KND A;  4L8E A;  4TRX A;  4NHW A;  4YKF A;  3RPN A;  3VPQ A;  2P31 A;  5E59 A;  4XHM A;  4TR1 B;  3LG6 A;  3GUS A;  2GVP A;  1E6B A;  4LMV A;  1M9A A;  3KH9 A;  1LBK A;  3VFI A;  2NDO A;  3TKS C;  3ZVJ D;  1ZYQ B;  1XW5 A;  3D0Z A;  4YH2 A;  3E9J B;  3ZMK A;  2M46 A;  1RW1 A;  5ECP B;  1EGO A;  2HYX A;  1PN9 A;  1OC9 A;  4N0V A;  3RHB A;  1Z7P A;  4CHS A;  4WR5 A;  2OBK A;  2AHE A;  1JHB A;  4TXO A;  1SD9 A;  1EV9 A;  1FOV A;  5J41 A;  1TJD A;  3ZML A;  4K7N A;  2B7K A;  2MMN A;  5D9T A;  1NHO A;  1MDJ A;  4L0U A;  4Z2R A;  3IBH A;  3GNJ A;  2DIY A;  3U6V A;  2AJQ B;  2IMF A;  4H86 A;  1R4W A;  2WRT A;  2VL3 A;  3HKR A;  3KXO A;  3APO A;  1V40 A;  3APQ A;  2HT9 A;  5DAL A;  4AJ8 A;  2VL9 A;  1ERT A;  5G5F A;  5CO3 A;  1TU8 A;  2CVK A;  1F6M C;  5ECO B;  4FO5 A;  3Q18 A;  4E8H A;  1XOB A;  5DCH A;  3TKR A;  2QC7 A;  2VCQ A;  2XPD A;  2V2G A;  1FOH A;  3GX8 A;  1BQ7 A;  5KOW A;  3A2W A;  3BJ5 A;  4BWQ A;  3EMX A;  4MJC A;  1ILO A;  1FB6 A;  5HFG A;  3PR8 A;  2DSA A;  3U5R E;  1OVN A;  1J9B A;  3CTF A;  5IOW A;  3FHK A;  2HNL A;  3IXR A;  4P3Y B;  3M9K A;  2L6D A;  1GSF A;  5F06 A;  3UVT A;  3E3E A;  3JCM L;  2ES7 A;  4G9H A;  4IKH A;  3A3T A;  1X5D A;  4O5Q A;  1DUG A;  4F0B A;  4XS1 A;  4MH3 A;  1XXU A;  4XS4 A;  2K18 A;  4IJ3 A;  3D5J A;  1PD2 1;  2EIR A;  2LEG A;  2H1B A;  4YAP A;  4V2M A;  4DVC A;  3M1G A;  1GNW A;  2C8U A;  2C1Y A;  3QAW A;  2E7P A;  2FWF A;  3WGX A;  4MP4 A;  2J9H A;  2MBT A;  3CSJ A;  1USB A;  3VPT A;  4TW5 A;  1XIY A;  1YF1 A;  1XW6 A;  4K7I A;  1TK5 B;  4LMW A;  5COH A;  4EDZ A;  4MAB A;  2H0I A;  1S3A A;  2AB6 A;  1V98 A;  4V1A g;  3ME8 A;  4ECJ A;  2GSS A;  1ML6 A;  1TRU A;  2VCV A;  3G7J A;  1K0B A;  3C7M A;  4KGI A;  1S3C A;  5GST A;  3H4K A;  1GTU A;  5IQY A;  4ISD A;  1T8E B;  1MDK A;  1PKZ A;  3FZ4 A;  5CP1 A;  2XHF A;  4I2U A;  4KX4 A;  4ILF A;  1TRS A;  2DC5 A;  1T4Z A;  1M2B A;  2UZ8 A;  2YN1 A;  3DIE A;  2X8C A;  4J56 E;  3TRQ A;  3FYG A;  1FB0 A;  1SYX A;  2PN8 A;  5B8A A;  2A2R A;  4OWY A;  1VGL A;  5DAK B;  3IC8 A;  2PER A;  1XPV A;  4POM A;  2H8L A;  4V2L A;  1IYH A;  4NWY A;  20GS A;  22GS A;  2JL4 A;  2L5L A;  2CZ2 A;  2C3N A;  1SYR A;  3EIN A;  2B1K A;  2NVL A;  2H0G A;  4FIW A;  5INY A;  2RLI A;  3D22 A;  4K2X A;  1VF4 A;  1UVZ A;  2CV4 A;  1MEK A;  3TB2 A;  2LRC A;  3VUR A;  3FKF A;  2B5Y A;  5EVO A;  3GL3 A;  5AGY A;  1Q98 A;  4ICY A;  5KEJ A;  3BOA A;  1FW1 A;  2V1M A;  5GZZ B;  1S3D A;  4GRF A;  2DJ2 A;  1Z6M A;  2C3T A;  2N5A A;  5J4U A;  4KDX A;  2G2Q A;  4K5R A;  1TK8 B;  2RII A;  5A4W A;  6GSS A;  4RQX A;  3ED3 A;  5D9X A;  2X99 A;  3GKK A;  1WRY A;  1PN0 A;  4MNN A;  4BVY B;  3ZFB A;  1JFU A;  2O85 A;  4MH2 A;  4A5P A;  2H30 A;  2C0F A;  1XFL A;  1Z5Y E;  1WIK A;  1W4V A;  3IAM 2;  3DEX A;  3KTL A;  4BL7 B;  3ZIV A;  4JBB A;  3MYD A;  1SK2 A;  4ZIL A;  2H71 A;  1ZOF A;  4OFN A;  3MNG A;  1GUL A;  3D6I A;  2F9S A;  4MPF A;  5FT3 A;  5A4V A;  1B9Y C;  3QFA C;  3MIX A;  1X9M B;  3VWW A;  3M0F A;  3TJG A;  1MDI A;  1SJZ A;  5DQS A;  1A23 A;  4PX1 A;  1ZGN A;  1Z7R A;  2JAD A;  3F6D A;  3GKX A;  1F2E A;  4POB A;  5DAK A;  4HJM A;  4HDE A;  2OA7 A;  2VM1 A;  3IA1 A;  4TR3 A;  3RHC A;  1BG5 A;  3HJO A;  4GSS A;  2PPT A;  5IMV A;  4I97 A;  4ZB8 A;  4DSQ A;  1GUM A;  4I2T A;  1URM A;  2NPB A;  2X64 A;  3KCM A;  1TU7 A;  2A2S A;  1EV4 A;  1M99 A;  3C71 A;  3IHG A;  2BJX A;  2K8S A;  1GP1 A;  3I69 A;  4WXT A;  3D4T A;  1TRV A;  2WB9 A;  3QPM A;  2H72 A;  3DYR A;  2GZY A;  1X0R A;  2R2J A;  4MA9 A;  1A2L A;  4PNF A;  2R5G A;  4OO5 A;  4DSR A;  2PU9 C;  4ZL8 A;  5IOX A;  2PMT A;  1TI1 A;  4Q5R A;  1C72 A;  1OKD A;  2E0Q A;  1WE0 A;  1XWG A;  1R26 A;  1G6Y A;  5GSS A;  3GN3 A;  1R5P A;  1SKW B;  2NBS A;  4KSM A;  4GST A;  2CAQ A;  3ME7 A;  1PL2 A;  4ZL7 A;  4NV2 A;  5ECH B;  3VLN A;  4BVY A;  1AXD A;  4ML1 A;  2I9H A;  2YWN A;  1THO A;  3D4M A;  5IIZ A;  1DSB A;  4OO4 A;  4ML6 A;  5IMC A;  5F07 A;  4BL7 A;  4L0W A;  4OCF A;  4O7H A;  4ID0 A;  1BYE A;  2GQK A;  4J2F A;  5IO0 A;  4KH7 A;  1ZZY A;  3ZZX A;  1SL1 B;  1THX A;  3UAR A;  3GTU A;  5HR1 A;  5JCU A;  4QQ7 A;  1SK1 A;  4ZBD A;  3GRX A;  3TKS E;  4LLR A;  1E2Y A;  4RI7 A;  1K3L A;  1R7H A;  4ZB9 A;  3EMP A;  1KBN A;  2LJA A;  1SEN A;  3ISO A;  4G0K A;  4EKZ A;  1XWK A;  2IMK A;  1UA5 A;  1WP0 A;  1AQX A;  2WUL A;  1B9X C;  2H6X A;  5C04 A;  4YQU A;  2DIZ A;  5B6M A;  4F0C A;  2KP2 A;  3EYT A;  2OBI A;  5IM9 A;  1IYI A;  1GTI A;  2DJJ A;  1EP7 A;  2RUF A;  2YWI A;  1ACV A;  2X4A A;  1VF3 A;  2KP1 A;  4NAX A;  8GSS A;  4IN0 A;  1AAZ A;  2MMA A;  4F82 A;  1SJI A;  3VWV A;  4NPB A;  2A2P A;  3H79 A;  4MPG A;  3J7Y b;  2JSY A;  4BA7 A;  2WS2 A;  4JZQ A;  1SL2 B;  1ERW A;  2GS3 A;  5G5E A;  4IS0 A;  2FCH A;  1R5A A;  2VCX A;  4K6X A;  1AQW A;  2GQL A;  1ST9 A;  1AC1 A;  2ON5 A;  1AW9 A;  5CYY A;  3TJB A;  3I6A A;  3RAZ A;  1GSQ A;  1PMT A;  2YZH A;  3O3T A;  3OR5 A;  5ELG A;  2L4C A;  3P8W A;  3AY8 A;  5J9C A;  1JZO A;  4QL9 A;  3I43 A;  3HJM A;  2FUG 2;  4XS6 A;  4NXI A;  3IPZ A;  2WGR A;  4GWR A;  6GSV A;  4IGJ A;  5JWQ B;  4EO3 A;  2H74 A;  2MYG A;  3EC3 A;  1O73 A;  1ZYN A;  3GH9 A;  1PGT A;  1PSQ A;  3TRX A;  4TR4 A;  3IR4 A;  3PGT A;  5D96 A;  2CX3 A;  2CA8 A;  3DGQ A;  4FYB A;  2WDU A;  1A8L A;  4EC0 A;  1F9M A;  4EUY A;  4HJ2 A;  1KNG A;  1O8W A;  4MJE A;  3FR6 A;  3LXT A;  4GQC A;  2IMI A;  1BJX A;  2X49 A;  1JLV A;  4FYU A;  3TOT A;  17GS A;  4ECI A;  4LA1 A;  1X5E A;  3M8N A;  1WJK A;  5G1K A;  4ZL9 A;  1O7U A;  5AIS A;  1YJ6 A;  1G7E A;  5CRH A;  3VI7 A;  4TN8 A;  12GS A;  2HSM A;  1G6W A;  1GTA A;  4PNG A;  4XIH A;  4MZB A;  4FYC A;  10GS A;  1TRW A;  3GV1 A;  5G2Z A;  4F9Z A;  4EVM A;  5ECQ B;  1GSS A;  4ZBB A;  2PVQ A;  5ECS A;  3LW9 A;  5ID2 B;  9GSS A;  4FH8 A;  1QK8 A;  4FQU A;  5IO2 A;  3EPT A;  2YCD A;  4DEJ A;  2X8H A;  2LTK A;  4JRR A;  4MF7 A;  2DJ0 A;  3IK7 A;  1XWA A;  1TKD B;  4IP1 A;  3UEM A;  2VCZ A;  2K8V A;  1SK0 A;  3DVW A;  5HR3 A;  4Q5Q A;  2BMX A;  2NTO A;  1XBS A;  1OE8 A;  2LNS A;  3F0I A;  2OE3 A;  2FWG A;  3EU4 A;  3D21 A;  5FWG A;  5ECK B;  3MWH A;  2R37 A;  2GTU A;  4IW9 A;  4TR1 A;  2WFC A;  3GIX A;  3GH6 A;  1GLP A;  1FVJ A;  3UVH A;  4MZC A;  3P7X A;  4ECC A;  2FA4 A;  1SU9 A;  2H6Y A;  1BX9 A;  2C0D A;  3H8Q A;  3FK8 A;  5G31 A;  3LXZ A;  1T3B A;  3F8U A;  13GS A;  4MZW A;  5B8B A;  2H66 A;  2R0C A;  3GKM A;  1M2D A;  6GSX A;  3HVV A;  4XRD A;  3A5W A;  3KM6 A;  1NSW A;  5LNK e;  1EWX A;  4XCS A;  4WEY A;  1Z3E A;  4HOJ A;  3MDK A;  1X9S B;  5DJM A;  2I4A A;  4HU7 A;  2GST A;  3GMF A;  2JZT A;  4X0X A;  5AIV A;  1NM3 A;  4N10 A;  2RM6 A;  5D9V A;  3TGZ A;  18GS A;  2VCT A;  2AV4 A;  3F3Q A;  1ZL9 A;  1AUC A;  5FHI A;  1TI3 A;  3C8E A;  1ON4 A;  1K0D A;  2IME A;  2LS5 A;  4HQZ A;  5EY6 A;  5KN0 A;  1SL0 B;  3LSZ A;  1GWC A;  3GUR A;  6GSW A;  1Z6N A;  2M80 A;  2REM A;  3PIN A;  2HSH A;  4O92 A;  2HZE B;  2V41 A;  1VRS D;  2YNX A;  3IC4 A;  3M3M A;  1JLW A;  1V58 A;  2C3Q A;  5H5R A;  5BMU A;  1SD8 A;  3LQ7 A;  5F8B A;  5ID2 A;  2ALB A;  3FZA A;  2L4Q A;  2GZP A;  2HXK A;  19GS A;  3GKN A;  3R3E A;  4OFT A;  3WT1 A;  3W6G A;  1QUW A;  5ECL B;  1ZYP A;  16GS A;  1EEJ A;  5ECN B;  4WKW A;  5A5K A;  1TK0 B;  1F37 A;  4OCE A;  14GS A;  2GT6 A;  2LKU A;  3O6T A;  2LJR A;  2QSI A;  1RQM A;  4ZB6 A;  3VWX A;  3LWA A;  4MDC A;  5AIX A;  1K0O A;  2O89 A;  4RI6 A;  4N11 A;  3KGK A;  3UL3 A;  1ZMA A;  2H19 A;  4MK3 A;  1KTE A;  1GNE A;  4KW6 A;  1QFN A;  4HI7 A;  3F6F A;  4GXZ A;  11GS A;  4HUA A;  3A2V A;  4L5O A;  4Q5F A;  2YP6 A;  5EPF A;  1F3A A;  2F8A A;  1ZCP A;  2XC2 A;  1W89 A;  5B7C A;  1A24 A;  4TXV A;  2C80 A;  2L6C A;  1GSD A;  1GSE A;  4K5S A;  2CAI A;  2JZR A;  4K0N A;  4IHU A;  3A5I A;  4PUR A;  5CRG A;  4MF5 A;  3WGD A;  4BVX B;  1QMV A;  5KN1 A;  2PWJ A;  2A4V A;  3HD5 A;  2L5O A;  3G9B A;  2AAW A;  5G1L A;  2B5E A;  3FY7 A;  2R3X A;  4PGT A;  5J5N A;  4WR4 A;  2X8G A;  3TUE A;  1X5C A;  2R6K A;  3HVX A;  1GUK A;  2VD0 A;  5D9W A;  4OMV A;  1EZK A;  4RQR A;  2MMZ A;  1M0U A;  1Y25 A;  3FR9 A;  5HR2 A;  1YKC A;  3RBT A;  2VUP A;  4F2I A;  3ZIT A;  5CRW A;  4AJ7 A;  1PX7 A;  2V6K A;  2JU5 A;  3US3 A;  2ON7 A;  3RDW A;  3SBC A;  2HZE A;  1PQN A;  3C1R A;  2CVD A;  1XVQ A;  2YPM A;  3UJ1 A;  1QGV A;  5JCG A;  1XVW A;  2H1G A;  4WF5 A;  3GYK A;  3HXS A;  4V2N A;  2I81 A;  4MCU A;  3KJY A;  3ERG A;  1OAZ A;  4D73 B;  1T7P B;  2LRN A;  2KUC A;  4HZ2 A;  2H01 A;  4K9Z A;  4G0L A;  5IMZ A;  3ZLP A;  2H0H A;  2VD1 A;  3ZTL A;  2MZC A;  1CQG A;  2JSZ A;  3KP9 A;  1HNB A;  2DML A;  2RM5 A;  2ZCT A;  5ECM B;  2EC4 A;  1ERV A;  5H5Q A;  1OYJ A;  1A2J A;  4V1A p;  3KMO A;  3F9U A;  1YDK A;  3ERF A;  3TJK A;  4CY8 A;  3C1S A;  3WGE A;  2VLV A;  5ENU A;  3MSZ A;  4G19 A;  2E2G A;  4USS A;  2Z9S A;  1O85 A;  1DE1 A;  3BD2 A;  4WET A;  2YJ7 A;  1X9W B;  3CTG A;  3TJF A;  1M7T A;  2FNO A;  3HJP A;  2DJ3 A;  1GUH A;  1O6J A;  1WOU A;  3TCO A;  2XBQ A;  5L71 A;  2CZ3 A;  3P90 A;  1K3O A;  4BVX A;  1SKR B;  4K7O A;  3LYP A;  2RUE A;  1V2A A;  2FD3 A;  2VO4 A;  3VK9 A;  1QXH A;  2HI7 A;  1JZR A;  2HRF A;  2KLX A;  3F4R A;  1PA3 A;  1T00 A;  3KIJ A;  2K9F A;  3UBL A;  3HHV A;  2OAC A;  4LL1 B;  1A2M A;  3QMX A;  1YF0 A;  3HDC A;  3Q6O A;  3PPU A;  1EOH A;  5IMA A;  1EEM A;  3CMI A;  2O7K A;  4GCI A;  3IK9 A;  4IJI A;  3GA4 A;  4MMM A;  5DAL B;  1PL1 A;  2BTO T;  5LCZ A;  1WPI A;  2YWO A;  2GGT A;  3GX0 A;  5ELA A;  1MD3 A;  2PGT A;  4POK A;  2YV9 A;  5IMD A;  2DKH A;  1JZD A;  1MD4 A;  4POL A;  4EXJ A;  2F8F A;  5J3R A;  2LQO A;  2H76 A;  3TRP A;  4YQM A;  4N30 A;  1ABA A;  3IHQ A;  4BWS A;  4MF6 A;  5ECR B;  4GQF A;  1RK4 A;  2YAN A;  5C00 A;  2N5B A;  4IEL A;  1J08 A;  4D73 A;  1NHY A;  3L9U A;  4EIP A;  2ZUP A;  2WCI A;  1Q4J A;  2TIR A;  4G10 A;  1YEX A;  5CAX A;  1JZW A;  2FWH A;  2VLU A;  3QD9 A;  1T1V A;  2I1U A;  5D73 A;  4KCE A;  2B1L A;  4ULX A;  4K8M A;  3QR6 A;  4XS4 B;  2H1D A;  3Q74 A;  1VF1 A;  1G0T A;  1UC7 A;  2QA1 A;  3V1W A;  4GF0 A;  4LL4 B;  1AIU A;  1V57 A;  3IAS 2;  4CW9 A;  5HR0 A;  4TKY A;  1ERU A;  5JCW A;  3O76 A;  1O8X A;  2YV7 A;  1U6T A;  2C0G A;  2V32 A;  4JR6 A;  4YAV A;  3BCK A;  5DQY A;  4Q5N A;  2GSQ A;  3ZFL A;  2A4H A;  3Q19 A;  3NZN A;  5G30 A;  4WF4 A;  2HE3 A;  4KA0 A;  4ZXG A;  2YZU A;  3M9J A;  5B6N A;  2GZZ A;  3FW2 A;  4GSN A;  3CSI A;  2YJH A;  2O87 A;  3QCP A;  2HLS A;  4Z2T A;  3H93 A;  1ZYE A;  4JU5 A;  4ACS A;  3FRC A;  4G0I A;  4JED A;  3R2Q A;  5DDL A;  4O5U A;  4EIQ A;  4IVF A;  1PRX A;  5CRD A;  4RUV A;  3FEU A;  3ERW A;  2QKE A;  1FAA A;  3DML A;  3APS A;  1EP8 A;  2VM2 A;  2GQM A;  1GLQ A;  3DVX A;  2YWM A;  1GH2 A;  3K8N A;  3GHA A;  3KH7 A;  5IMF A;  5JWO B;  3ZYW A;  4KF9 A;  5IPG A;  4MJA A;  1O81 A;  5CNW A;  2MBS A;  3SWL A;  2YOI A;  1K0N A;  4PXO A;  3WD6 A;  3PH9 A;  2C4J A;  4Z7X A;  1K0C A;  1YY7 A;  4X43 A;  1TDI A;  3GSS A;  1OE7 A;  3EU3 A;  3L4N A;  3ZIJ A;  4EE0 A;  2VLT A;  4I6X A;  5CRE A;  5F05 A;  5GAN D;  4IQA A;  1U3I A;  2FLS A;  3ZVJ A;  1AQV A;  2DJ1 A;  3LOR A;  2CT6 A;  4PQI A;  1YQ1 A;  3VWU A;  5KOX A;  1SJ6 A;  1UN2 A;  2IPA A;  2C0E A;  2IJY A;  1FG4 A;  5LD0 A;  4EDY A;  3EE2 A;  1HD2 A;  3G7Y A;  3G7I A;  1U3A A;  2CVB A;  2P0G A;  4WBR D;  2KOK A;  3DWV A;  4I5Q A;  2OAD A;  1K0A A;  2FY6 A;  2TRC P;  2CX4 A;  1TTZ A;  2E2M A;  4KDY A;  3FMW A;  4KSO A;  5GAP D;  2G0F A;  2H73 A;  1LU4 A;  2B6M A;  3LEF A;  5DJL A;  3TOU A;  2H70 A;  1SKS B;  1TOF A;  2O8V B;  4HS1 A;  2WJU A;  4GTU A;  2IMD A;  1H75 A;  3TJJ A;  3KTB A;  1G7O A;  1XWB A;  2JZS A;  3KZQ A;  3IRA A;  3L78 A;  1WMJ A;  1DBY A;  2N5F A;  3KP8 A;  3ZRE A;  1GSU A;  1N2A A;  3KD0 A;  1GSY A;  4KE3 A;  2LRT A;  6GSU A;  2DBC A;  3IDV A;  1K3Y A;  3LGC A;  2EIQ A;  2HZF A;  4NHZ A;  1B4Q A;  2K6V A;  3UBK A;  5KN3 A;  1XCC A;  4X4J A;  5KN2 A;  3WT2 A;  3QFB C;  4AGS A;  3LYK A;  3CRT A;  2XBI A;  4O5R A;  1H4O A;  2IFQ B;  2V6O A;  4G2E A;  2AYT A;  4K1F A;  3GST A;  3L9V A;  2AUV A;  2DJK A;  1TP9 A;  4NV5 A;  2H1A A;  4YKG A;  3I9V 2;  1Y6E A;  2CQ9 A;  4HU9 A;  2FHE A;  4KAE A;  3UIW A;  4I8B A;  2ZNM A;  3F3R A;  2FGX A;  3QAG A;  2HFD A;  5H5S A;  6GST A;  1YEP A;  3A2X A;  4PQH A;  1HNC A;  3KMN A;  2VCW A;  3IE3 A;  4AF2 A;  2IIY A;  1B8X A;  2IN3 A;  2QGV A;  2JAC A;  3TKP A;  3DD3 A;  4IP6 A;  2HRA A;  4E8E A;  4X1U A;  3DKS A;  5ECI B;  2J23 A;  2EIO A;  1XZO A;  2PBJ A;  2H75 A;  1XOA A;  3F4S A;  4K0G A;  4AJ6 A;  3TDG A;  2PVO C;  1B48 A;  1TXX A;  5ABR A;  2VIM A;  1FO5 A;  3HA9 A;  1I9D A;  2HSY A;  3E0U A;  3S9F A;  4OD7 A;  3GFK A;  3HVS A;  5D8I A;  2OJL A;  1EOG A;  5D93 A;  1N8J A;  4IQ1 A;  2MMO A;  3CBU A;  4Z2U A;  1B4P A;  3DRN A;  4F03 A;  3HYP A;  3QAV A;  3CYN A;  4MLY A;  4QL7 A;  1YZX A;  2F51 A;  2R0P A;  4PTS A;  4MJB A;  2DKI A;  1KEB A;  4DSS B;  3NIV A;  1TW9 A;  2TRX A;  3GTU B;  3ZL5 A;  3FZ9 A;  3HY2 A;  5HFI A;  5DBQ A;  3LJR A;  1EGR A;  1MTC A;  4EF0 A;  3TKQ A;  4TR0 A;  2XPE A;  3WYW A;  3EWL A;  3VI5 A;  3L0H A;  5BRT A;  1FVK A;  3CRU A;  2IFQ A;  1QQ2 A;  1LJR A;  5F0G A;  2F3M A;  5DVB A;  3UOM A;  1XW9 A;  1J0F A;  3CXG A;  2P5R A;  3CSH A;  5J9B A;  3QDN A;  1VF2 A;  4CDO A;  2L59 A;  3FR3 A;  1BED A;  5AN1 A;  4PUA A;  3KEB A;  4GLT A;  5EL8 A;  3J7Y k;  4ECB A;  3F63 A;  3ZRD A;  2VAF A;  4K2D A;  4OFM A;  2R0G A;  3IV4 A;  2OKA A;  3L9S A;  2L57 A;  2IWT A;  2M72 A;  2LV3 A;  1M9B A;  4BPY A;  2VOC A;  4YQV A;  4TVE A;  1K0M A;  2B3S A;  1A8Y A;  3W8S A;  3RPP A;  3LFL A;  1PKW A;  2IL3 A;  3HCZ A;  1F3B A;  3HZ8 A;  1A0R P;  5HQP A;  2B7J A;  1V9W A;  4HQS A;  3FZ5 A;  2GLR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...