3KP8A

The thioredoxin-like domain of a vkor homolog from synechococcus sp.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
94
structure length
94
Chain Sequence
SPLAVGLAAHLRQIGGTMYGAYWCPHCQDQKELFGAAFDQVPYVECSPNGPGTPQAQECTEAGITSYPTWIINGRTYTGVRSLEALAVASGYPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VKORC1/thioredoxin domain protein
publication title Structure of a bacterial homologue of vitamin K epoxide reductase.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Oxidoreductase
total genus 29
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2009-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3kp8A00
1OE7A 3GX0A 1HYUA 3F3QA 4AF2A 3D22A 3DGQA 3GMFA 4KA0A 4V1Ap 4BWSA 2GTUA 3D6IA 4BWQA 1E2YA 4PURA 3LXZA 3DVXA 2FUG2 3DKSA 4WEYA 1MEKA 1S3AA 2RIIA 5IQYA 5G5FA 2A4VA 3EC3A 1PRXA 3GYKA 5DCGA 4XHMA 2VL9A 2B1KA 4K7IA 4ILFA 2GT5A 2G2QA 10GSA 1SL2B 2H30A 2E2MA 3HDCA 2YJ7A 4TR3A 1BYEA 1EP7A 4Z7XA 3GN3A 5F05A 3LYPA 3UBLA 4QL7A 5GZZB 2H01A 3D0ZA 5ECSA 2F3MA 1SYXA 2NPBA 1M7TA 4JR4A 2PVOC 1EP8A 4FH8A 1JZWA 4ZBAA 2DMLA 3US3A 4K2DA 4TXVA 3GKXA 4PNFA 20GSA 1R26A 2CV4A 1K0CA 4LA1A 5A5KA 1MDKA 3GTUB 1O8XA 1SJ6A 3I43A 4YQVA 4JBBA 9GSSA 2YWMA 1TP9A 2XBQA 2PUKC 2LRCA 3H4KA 5HFKA 3EE2A 4TN8A 3ED3A 1X9WB 3E9JB 2REMA 1TRVA 1I5GA 4IGJA 3MWHA 5D9VA 3WYWA 2WULA 2OE1A 5G30A 2D2ZA 3P2AA 1G7OA 5IMDA 3FZ5A 4QL9A 4K7OA 1TK8B 2FGXA 2L5OA 4TXOB 4AJ6A 1GLPA 2X8HA 3VI5A 2R37A 1TW9A 1G7EA 1TI3A 1VF1A 4OFMA 3TRQA 1O81A 4EDZA 3ZLPA 3C1RA 4PX1A 4NHZA 2PU9C 2JZSA 1QGVA 2KOKA 4DSSA 4XS6A 2LJKA 2E7PA 1TU8A 1C72A 4ZB9A 3UVTA 3ZITA 2KP2A 1WMJA 1F3AA 1M2DA 2HYXA 1BJXA 1DBYA 2CA8A 5DAKB 3J7Yb 4MJBA 1SD9A 1B48A 1Z5YE 5AN1A 1A2MA 1W89A 2B1LA 4LMWA 3NZNA 4MF6A 2YV9A 2N5AA 4HQSA 3IAS2 3ERFA 1FO5A 1THOA 3KH7A 4ZBBA 2P0GA 2GSTA 4G19A 4NMUA 3CBUA 5CP1A 3C1SA 1ZYQB 4Q5RA 5DJMA 3MDKA 1YQ1A 1THXA 1SU9A 4MH3A 1FOVA 1SJIA 1GTUA 2VM1A 4WKWA 3A3TA 4L0UA 3BBYA 4ML1A 3ZZXA 4RQRA 2CZ2A 3ZMKA 2ZUPA 4HQZA 2YWNA 2KHPA 4LMVA 5B6MA 4HZ2A 5L71A 3CTFA 1AIUA 3VURA 3N9JA 2AJQB 2C0GA 1ZGNA 5H5SA 3VWVA 4CHSA 5EL8A 2DLXA 3CSHA 4I2TA 2Z9SA 2ON7A 4TR0A 4ML6A 3ZTLA 2MZCA 4G2EA 1R5PA 2HLSA 3C71A 1BG5A 2HE3A 4MK3A 1TK0B 3PGTA 1MDJA 1IYIA 4ISDA 3RBTA 5CO3A 3LQ7A 4TR1A 1GUMA 5G2ZA 2PVQA 2IMFA 2YZUA 2N5BA 4O7HA 5AGYA 2R3XA 2KP1A 3LGCA 4NXIA 4MA9A 1KTEA 2VM2A 1LJRA 3PINA 5ENUA 3KCMA 2RM6A 2MMAA 5GAND 3APOA 5IMCA 4YQMA 2O8VB 1XBSA 1EEMA 2CX3A 2V1MA 3HY2A 5B7CA 3MNGA 4NV2A 5JWRB 3MAKA 1U88A 5DQYA 5IPGA 1UN2A 5DALB 2E2GA 3C7MA 3TUEA 1NHYA 3UVHA 3EINA 4V1Ag 2R4VA 2EIRA 5IIZA 2H70A 3F6DA 1X5CA 3KIJA 1NHOA 4KGIA 3UAPA 2VCZA 2YOIA 4OO5A 2IMKA 3VWXA 1HNCA 2YWOA 2KUCA 6GSXA 2OADA 7GSSA 2EIQA 1PMTA 5ELGA 2XC2A 3TJKA 3TCOA 8GSSA 2HZEB 5H5QA 3DWVA 2B3SA 4JR6A 3RAZA 3FY7A 1UVZA 3FHKA 6GSSA 4ECCA 5G31A 1WE0A 3HA9A 2ES7A 1TRWA 3KH9A 3FYGA 2AV4A 1GH2A 3I6AA 5G1LA 1T4YA 1A8YA 1WRYA 1Z9HA 2BJXA 3R2QA 3F63A 3IE3A 4BPYA 3P90A 5INYA 2MBSA 2IJYA 1Z7RA 2DJ0A 3DVWA 1SKRB 3TRPA 3PR8A 2L6DA 4FYUA 1NW2A 2I9HA 4KSMA 1G0TA 2H1AA 1UC7A 5EY6A 2MMNA 3FR6A 2L4QA 3F8UA 2FNOA 1ILOA 1X5EA 2EIOA 4F82A 2FCHA 5FT3A 2JL4A 1MD3A 4YQUA 2VCXA 3O6TA 1KBNA 3TRXA 2C80A 3NOFA 4FIWA 4GRFA 5COHA 3E0UA 2HT9A 4OFTA 4EUYA 3BCKA 5CRDA 1J9BA 3KP9A 4MF5A 1Q98A 2O7KA 4POKA 3TGZA 3IOSA 4JE1A 2LV3A 4HOJA 1FB6A 2HXKA 4IJIA 1XOAA 3GKMA 3WT1A 3ZL5A 1XOBA 3UEMA 1AUCA 2C3NA 3FW2A 5ECHB 3H79A 5J9BA 2VLVA 4XS4B 2AAWA 4F9ZA 3TJBA 1M9AA 2VCWA 3HXSA 2K18A 3QFAC 1M2BA 1WJKA 3ME8A 2H1BA 3DD3A 3M9KA 2MBTA 4IW9A 3CYNA 3GTUA 4MPGA 4O5RA 4PXOA 2GS3A 1MDIA 5D9TA 2L59A 2VIMA 3IC4A 2DJKA 4I6XA 4GQFA 3KMNA 2WFCA 4GSSA 2CAQA 4GXZA 2RLIA 3L4NA 4TKYA 4X1UA 2CAIA 1TU7A 1SK0A 1OE8A 4WF5A 2K6VA 4YAPA 3QFBC 1SENA 4TXOA 3KZQA 3E3EA 3HD5A 12GSA 5ECOB 2H0IA 2FA4A 4ECIA 1GNWA 5B8AA 1K0DA 2H72A 2DJ3A 18GSA 1F9MA 2AUVA 2PGTA 1WIKA 2AYTA 4OD7A 2CX4A 4HUAA 1YKCA 1DE2A 2R6KA 2V6KA 3GNJA 1ZMAA 2R5GA 3FR3A 14GSA 2DBCA 3LXTA 4J57E 1XCCA 1PKZA 5JCUA 5DAKA 3BJ5A 1GSUA 1T1VA 1XPVA 3GKNA 1Z6MA 1PL1A 1YEPA 4HEA2 4Q5QA 2O85A 1V9WA 1LU4A 3W8SA 1A2JA 4IN0A 3ZYWA 3L78A 3ME7A 3HVVA 3WGEA 2MYGA 2IL3A 3Q6OA 2JZTA 1NSWA 2K8SA 2PN8A 1EWXA 5KN1A 2CT6A 2PPTA 5KN0A 3WD6A 1GSDA 5ECNB 3HCZA 4KSOA 3F9UA 4O32A 5ECMB 5EVOA 3EU3A 4MZBA 3FRCA 1O8WA 1SK1A 4GLTA 3KXOA 16GSA 4NAXA 4PQ1A 1AQVA 4YAVA 5ECQB 1JZOA 3HVXA 3QAWA 2LS5A 4ZL7A 4EXJA 3QMXA 1NM3A 3GFKA 3LWAA 2B7KA 4POBA 2I3YA 1DUGA 2VL3A 1X5DA 1OYJA 4MP4A 2O87A 4NPBA 2G0FA 1XW5A 4L0WA 3LJRA 1QFNA 2P31A 2GQMA 2H0GA 4PUAA 3SWLA 1G6WA 2F8AA 4DVCA 3VLNA 1PGTA 5HFIA 2EC4A 4EVMA 1EZKA 1G6YA 22GSA 1MTCA 1H4OA 2YWIA 5F06A 4DSQA 1KEBA 3CRTA 5DALA 5HR1A 1GWCA 5D9WA 2ON5A 5D8IA 2DJJA 2CVDA 5CNWA 1GL8A 2WCIA 13GSA 4KCEA 1XWBA 3HJPA 2LNSA 4IQ1A 2YV7A 3TJJA 1V40A 2NTOA 5IMAA 2AHEA 4V2NA 4HI7A 3GL5A 2IPAA 2QSIA 2MMOA 2X64A 2HZEA 4HS1A 1YF1A 5IMFA 3UIWA 2DIZA 5ELAA 1S3DA 3QAGA 3LFLA 3J7Yk 2JZRA 1B4QA 2C3QA 3WGXA 3DYRA 4N0VA 2B5EA 1EGOA 1RQMA 2FLSA 2V2GA 3FZ9A 5D73A 4WR4A 1R7HA 3GUSA 4I97A 4MZCA 3U5RE 2LNTA 4TR4A 1XWCA 1GUHA 3H8QA 2MMZA 1SYRA 1JHBA 4DEJA 1GUKA 2TIRA 2YCDA 1OC9B 4WBJA 2C3TA 4GQCA 2X8CA 1WPIA 2H76A 4MDCA 5J3RA 3TJFA 2WS2A 4ECBA 1F6MC 2LKUA 2YP6A 2OKAA 3M9JA 4TVEA 4L5OA 6GSYA 3UMAA 3P7XA 1K0MA 2RM5A 3ZIVA 2HSHA 1OVNA 2IN3A 1CQGA 2LJAA 1SD8A 1SKSB 1GSSA 3APQA 2X99A 5FWGA 3FR9A 4MJEA 1MD4A 3IAM2 3VWUA 4XIHA 5J4UA 1TXXA 1YDKA 1GULA 1T8EB 3UOMA 4XS4A 1FHEA 2H1GA 4K8MA 3L9SA 1BEDA 2GZPA 1Q4JA 2JADA 3SBCA 3PH9A 2GSRA 1FW1A 2LEGA 1SL0B 5CRWA 4KCAA 4E8HA 3CTGA 3EU4A 1HD2A 1ZZYA 4JU5A 3UBKA 4GSNA 4GWRA 3EMPA 4IHUA 5E59A 4EL1A 1W4VA 5ECLB 1OC8A 2HZFA 1K3LA 4TW5A 4WXTA 3CXGA 1PD21 4MZWA 4E8EA 3EMXA 4KB3A 2DC5A 4MLYA 4MH2A 5HQPA 3IA1A 2VL2A 3TKRA 5J41A 4J2FA 2YNXA 2QGVA 2F51A 3G7JA 3Q19A 4AGSA 1DE1A 1TRUA 2C1YA 2GVPA 11GSA 3IPZA 5J5NA 4H86A 2JSZA 1QQ2A 3BD2A 4P3YB 2K8VA 3OR5A 3G7YA 1ZL9A 3KJYA 3H93A 2NBSA 3ZMLA 2OE3A 4LL1B 3N5OA 5HR3A 2LRTA 3ISOA 4MABA 1N8JA 2JSYA 4PGTA 2NVLA 4IJ3A 1U87A 4NWYA 5ABRA 3LEFA 2IWTA 3KD0A 1GTBA 2PBJA 4RI6A 3ZRDA 1U3IA 1WP0A 4GCIA 3H1NA 2V41A 6GSWA 1FB0A 1XIYA 1KNGA 4FO5A 3TOUA 2GSSA 1VF4A 2NDOA 3RPNA 2H0HA 3VPQA 5DVBA 5DJLA 2IIYA 4ZIJA 3TDGA 1GNEA 2FY6A 1XW9A 4N11A 1YF0A 1PX7A 3FZ4A 2H73A 3GIXA 2TRXA 1ERUA 4HZ4A 1USBA 2I4AA 3D5JA 2WGRA 1Y6EA 3EVIA 3FKFA 4MJAA 4KNDA 1GP1A 3HKRA 3TKSA 1WOUA 1X9MB 3RHCA 4TOPA 4I8BA 1TJDA 1RK4A 4EKZA 5A4VA 1CQHA 3I9V2 3BCIA 4ZBDA 2LQOA 3O76A 3RPPA 4XRAA 4K1FA 3F0IA 3TKSE 2OJLA 1N2AA 2ALBA 1GRXA 1YKAA 1R4WA 5JCWA 5IO2A 1GTIA 5HR0A 2C8UA 3VPTA 2HSYA 4FYBA 1GSYA 1A23A 1X0RA 2M72A 3FK8A 4K0GA 5JWOB 3HYPA 3QAVA 4EF0A 1GSFA 1VF2A 4OFNA 5F8BA 3QD9A 5HR2A 3HZ4A 4D73B 2RUEA 1BAYA 5DCHA 2JACA 4I5QA 2H71A 3QR6A 4GSTA 4Q5FA 1PL2A 19GSA 1QXHA 5IM9A 2L57A 3WT2A 1ST9A 1YZXA 1K3YA 3HJMA 1SK2A 2GZZA 3RDWA 2VAFA 3GX8A 2IMEA 1ZYEA 2VLUA 4BVYA 4O92A 5ECPB 4JZQA 1I9DA 4KE3A 4QQ7A 2PMTA 2BTOT 2DSAA 3KGKA 1J0FA 1Y25A 5GSTA 5D9XA 1EOHA 1VRSD 1B8XA 4K9ZA 4LLRA 1EV9A 3TKSC 5LCZA 3IR4A 3QPMA 1VF3A 2GDRA 1TKDB 6GSVA 4WETA 1XWGA 4IKHA 1SJZA 4JRRA 5CREA 4GTUA 4PNGA 17GSA 2GZYA 1UA5A 4EDYA 2FA8A 4MF7A 1T4ZA 5LNKe 2GLRA 4NV5A 2CVBA 2VD1A 1FVKA 2XHFA 4KAEA 4N0ZA 5LD0A 1T00A 2FWEA 2J9HA 3D21A 2E0QA 3APSA 4PQHA 2L4CA 3DMLA 3QCPA 2ZNMA 4ACSA 1AQWA 1OAZA 4N10A 5ECKB 2R2JA 2VCQA 1XWAA 2YN1A 1TI1A 4DSRA 5F07A 2RUFA 1XFLA 2VUPA 4IVFA 5IOXA 2M80A 3TKPA 2VO4A 3GKKA 5B8BA 1U3AA 2X8GA 1K0AA 2QC7A 2XPDA 2GGTA 1M99A 2V6OA 3IK7A 3KTBA 3HHVA 4ECJA 1OC9A 4OCEA 3D4MA 4KDXA 2CZ3A 1QUWA 3IBHA 2XBIA 3IHQA 4GF0A 4K6XA 1T7PB 1J08A 2FWGA 2VD0A 2ZCTA 2TRCP 1SL1B 2L6CA 6GSTA 5HFGA 2B5YA 1A2LA 3QOUA 1PQNA 4BL7A 1O73A 1AW9A 3M8NA 3Q18A 2K9FA 3V1WA 2A2SA 1ZOFA 5CRHA 3ERGA 3TKQA 1A24A 3WGDA 4K7NA 2HRNA 3A2XA 5AIXA 1JZDA 1TRSA 3GH9A 3GRXA 1ERWA 1B9XC 4L5LA 1EV4A 1X9SB 2H6XA 2M46A 1XWKA 3ZVJA 2L5LA 3ZFBA 4KDYA 1EGRA 5ID2A 3K8NA 2WJUA 2H6ZA 2H1DA 2CQ9A 3VFIA 4TRXA 1VGLA 1RW1A 2YANA 2FD3A 3KTLA 2OA7A 2H19A 4IS0A 1O6JA 3HJOA 1QMVA 5F0GA 2B7JA 3EURA 3IRAA 3GSSA 3L9UA 1A0RP 1JZRA 1K3OA 3F3RA 2H6YA 2B5XA 2HFDA 2I1UA 4YH2A 1ERTA 2F8FA 3CSJA 1E6BA 1PKWA 3IXRA 1V98A 5C04A 5JCGA 5B6NA 2IFQB 1ERVA 3GURA 4FYCA 4IP6A 2F9SA 2YPMA 1XVWA 5AISA 5IMZA 4MMMA 1XZOA 3LG6A 4XCSA 2JU5A 1Z3EA 2OACA 1SKWB 4XS1A 3GA4A 4OO4A 1EOGA 3A2VA 3DIEA 1M9BA 4POLA 1Z6NA 2C4JA 3S9FA 4KUNA 5DBQA 1PA3A 4X43A 2VLTA 3RHBA 4MJCA 2OBIA 3M3MA 2P5QA 3VK9A 2N5FA 1PX6A 1ABAA 5G5EA 2LUSA 2LJRA 3P8WA 4G9HA 4J56E 3VI7A 3IDVA 2VCTA 2LRNA 1B9YC 2H74A 4EC0A 3FZAA 2FWHA 2WRTA 1EEJA 2C0EA 5D93A 5IO0A 3ERWA 4OMVA 5ECRB 3HVSA 4RI7A 2GQKA 1JLVA 4ZL9A 1OC3A 2C0DA 2OE0A 5IPHA 4WR5A 2J23A 1WWJA 4G10A 1URMA 1V57A 3L0HA 1ML6A 3ZIJA 4F0CA 1YY7A 5IMVA 2GQLA 3GV1A 3JCML 3KP8A 4LL4B 4JEDA 4X0XA 2PERA 4HDEA 1LBKA 2FHEA 1F2EA 1OKDA 1Z7PA 1V2AA 1JFUA 4CDOA 3CRUA 1DSBA 1IYHA 3DXBA 5ID2B 4ZB6A 3EWLA 1B4PA 3BOAA 3GH6A 2LSTA 5FHIA 1PSQA 3CSIA 5AIVA 2IMIA 5A4WA 5E4WA 3KM6A 5KN3A 4POMA 3F4SA 3CMIA 6GSUA 2PWJA 4OWYA 3ZFLA 1O7UA 2H66A 3NIVA 4HU9A 2DJ1A 4D73A 4HJ2A 3A5WA 3MSZA 3Q74A 4V2MA 2I81A 3TJGA 3GL3A 4PQIA 1FAAA 3IV4A 3KMOA 4MCUA 5G1KA 3W8JA 4L8EA 3VWWA 3TOTA 2B6MA 3GSTA 1ACVA 2AB6A 5CYYA 4DSSB 2WB9A 2H8LA 4ULXA 4OCFA 4F03A 4ZILA 3C73A 2VCVA 3DRNA 5GSSA 5KEJA 5D96A 1F37A 1XW6A 4MPFA 2OBKA 2XPEA 1A8LA 3G7IA 5C00A 4ZB8A 1K0BA 2IMDA 3L9VA 3ZREA 2HI7A 2FWFA 3C8EA 4HU7A 1AXDA 1ON4A 3G9BA 1S3CA 1FG4A 3EYTA 3FEUA 4XTSA 4BA7A 4XRDA 5H5RA 4KH7A 1GTAA 2C0FA 1OKTA 1U6TA 5GAPD 1TTZA 1HNAA 3QDNA 1T3BA 4F0BA 2O89A 5JWQB 4IQAA 1O85A 2YJHA 1QK8A 3HZ8A 1HNBA 4AJ7A 5IOWA 4RQXA 4I2UA 2VL2C 3D4TA 4KDUA 3U6VA 3F4TA 5DQSA 4ZL8A 4AJ8A 3TB2A 1FVJA 1A0FA 3GHAA 1K0NA 4ZXGA 5ECIB 3IK9A 2CVKA 2KLXA 2YZHA 4IBPA 4HJMA 3DEXA 2DMMA 4WBRD 2BMXA 4EO3A 3M0FA 4TR1B 3LYKA 3UARA 4KX4A 5EPFA 3O3TA 3AY8A 4NHWA 1GSQA 4N30A 1AC1A 4IP1A 2GSQA 4IELA 1TK5B 1R5AA 3KEBA 1F3BA 1K0OA 2V32A 2LQQA 2HNLA 1H75A 4CW9A 2LTKA 5KN2A 4Q5NA 1YJ6A 4ID0A 1XVQA 1M2AA 1BX9A 3F4RA 1JLWA 1AQXA 4V2LA 2DIYA 4F2IA 1AAZA 1YEXA 3A2WA 2VOCA 1TDIA 4RUVA 4K0NA 1PN9A 1BQ7A 2DJ2A 3ZVJD 1GSEA 3M1GA 3I69A 3W6GA 4WF4A 4PUFC 3LORA 2QKEA 4EE0A 2H75A 2A2RA 5CAXA 2P5RA 3LSZA 3UL3A 3UJ1A 1ZCPA 1M0UA 5J9CA 5A4UA 1GLQA 3F6FA 1XXUA 1V58A 2WZ9A 5DDLA 1TOFA 1HQOA 2IFQA 2GT6A 2WDUA 2HRFA 4BVXA 4KW6A 5CRGA
chains in the Genus database with same CATH superfamily
1OE7A 3GX0A 1HYUA 3F3QA 4AF2A 3D22A 3DGQA 3GMFA 4KA0A 4V1Ap 4BWSA 2GTUA 3D6IA 4BWQA 1E2YA 4PURA 3LXZA 3DVXA 2FUG2 2R0GA 3DKSA 4WEYA 1MEKA 1S3AA 2RIIA 5IQYA 5G5FA 2A4VA 3EC3A 1PRXA 3GYKA 5DCGA 4XHMA 2VL9A 2B1KA 4K7IA 4ILFA 2GT5A 2G2QA 10GSA 1SL2B 2H30A 2E2MA 3HDCA 2YJ7A 4TR3A 1BYEA 1EP7A 4Z7XA 3GN3A 5F05A 3LYPA 3UBLA 4QL7A 5GZZB 2H01A 3D0ZA 5ECSA 2F3MA 1SYXA 2NPBA 1M7TA 4JR4A 2PVOC 1EP8A 4FH8A 1JZWA 4ZBAA 2DMLA 3US3A 4K2DA 4TXVA 3GKXA 4PNFA 20GSA 1R26A 2CV4A 1K0CA 4LA1A 5A5KA 1MDKA 3GTUB 1O8XA 1SJ6A 3I43A 4YQVA 4JBBA 9GSSA 2YWMA 1TP9A 2XBQA 2PUKC 2LRCA 3H4KA 5HFKA 3EE2A 4TN8A 3ED3A 1X9WB 3E9JB 2REMA 1TRVA 1I5GA 4IGJA 3MWHA 5D9VA 3WYWA 2WULA 2OE1A 5G30A 2D2ZA 3IHGA 3P2AA 1G7OA 5IMDA 3FZ5A 4QL9A 4K7OA 1TK8B 2FGXA 4EIQA 2L5OA 4TXOB 4AJ6A 1GLPA 2X8HA 3VI5A 2R37A 1TW9A 1G7EA 1TI3A 1VF1A 4OFMA 3TRQA 1O81A 4EDZA 3ZLPA 3C1RA 4PX1A 4NHZA 2PU9C 2JZSA 1QGVA 2KOKA 4DSSA 4XS6A 2LJKA 2E7PA 1TU8A 1C72A 4ZB9A 3UVTA 3ZITA 2KP2A 1S3RA 1WMJA 1F3AA 1M2DA 2HYXA 1BJXA 1DBYA 2CA8A 5DAKB 3J7Yb 4MJBA 1SD9A 1B48A 1Z5YE 5AN1A 1A2MA 1W89A 2B1LA 4LMWA 3NZNA 4MF6A 2YV9A 2N5AA 4HQSA 3IAS2 3ERFA 1FO5A 1THOA 3KH7A 4ZBBA 2P0GA 2GSTA 4G19A 4NMUA 3CBUA 5CP1A 3C1SA 1ZYQB 4Q5RA 5DJMA 3MDKA 1YQ1A 1THXA 1SU9A 4MH3A 1FOVA 1SJIA 1GTUA 2VM1A 4WKWA 3A3TA 4L0UA 3BBYA 4ML1A 3ZZXA 4RQRA 2CZ2A 3ZMKA 2ZUPA 4HQZA 2YWNA 2KHPA 4LMVA 5B6MA 4HZ2A 5L71A 3CTFA 1AIUA 3VURA 3N9JA 2AJQB 2C0GA 1ZGNA 5H5SA 3VWVA 4CHSA 5EL8A 2DLXA 3CSHA 4I2TA 2Z9SA 2ON7A 4TR0A 4ML6A 1FOHA 3ZTLA 2MZCA 4G2EA 1R5PA 2HLSA 3C71A 4K5SA 1BG5A 2HE3A 4MK3A 1TK0B 3PGTA 1MDJA 1IYIA 4ISDA 3RBTA 5CO3A 3LQ7A 4TR1A 1GUMA 5G2ZA 2PVQA 2IMFA 2YZUA 2N5BA 4O7HA 5AGYA 2R3XA 2KP1A 3LGCA 4NXIA 4MA9A 1KTEA 2VM2A 2X4AA 1LJRA 3PINA 5ENUA 3KCMA 2RM6A 2MMAA 5GAND 3APOA 5IMCA 4YQMA 2O8VB 1XBSA 1EEMA 2CX3A 2V1MA 3HY2A 5B7CA 3MNGA 4NV2A 5JWRB 3MAKA 1U88A 5DQYA 5IPGA 1UN2A 5DALB 2E2GA 3C7MA 3TUEA 1NHYA 3UVHA 4ICYA 3EINA 4V1Ag 2R4VA 2EIRA 1PFOA 5IIZA 2H70A 3F6DA 1X5CA 5KOXA 3KIJA 1NHOA 4KGIA 3UAPA 2VCZA 2YOIA 4OO5A 2IMKA 3VWXA 1HNCA 2YWOA 2KUCA 6GSXA 2OADA 7GSSA 2EIQA 1PMTA 4O5QA 5ELGA 2XC2A 3TJKA 3TCOA 4YKGA 8GSSA 2HZEB 5H5QA 3DWVA 2B3SA 4JR6A 3RAZA 3FY7A 1UVZA 3FHKA 6GSSA 4ECCA 5G31A 1WE0A 3HA9A 2ES7A 1TRWA 3KH9A 3FYGA 4Z2RA 2AV4A 1ZYNA 2HRKA 1GH2A 3I6AA 5G1LA 1T4YA 1A8YA 1WRYA 1Z9HA 2BJXA 3R2QA 3F63A 3IE3A 4BPYA 3P90A 5INYA 2MBSA 2IJYA 1Z7RA 2DJ0A 3DVWA 1SKRB 3TRPA 3PR8A 2L6DA 4FYUA 1NW2A 2I9HA 4KSMA 1G0TA 2H1AA 1UC7A 5EY6A 2MMNA 3FR6A 2L4QA 3F8UA 2FNOA 1ILOA 1X5EA 2EIOA 4F82A 2FCHA 5FT3A 2JL4A 1MD3A 4YQUA 2VCXA 3O6TA 1KBNA 3TRXA 2C80A 3NOFA 4FIWA 4GRFA 5COHA 3E0UA 2HT9A 4OFTA 4EUYA 3BCKA 5CRDA 1J9BA 3KP9A 4MF5A 1Q98A 2O7KA 4POKA 3TGZA 3IOSA 4JE1A 2LV3A 4HOJA 1FB6A 2HXKA 4IJIA 1XOAA 3GKMA 3WT1A 3ZL5A 1XOBA 3UEMA 1AUCA 2C3NA 2DKHA 3FW2A 4A5PA 5ECHB 3H79A 5J9BA 2VLVA 4XS4B 2AAWA 4F9ZA 3TJBA 1M9AA 2VCWA 3HXSA 2K18A 3QFAC 1M2BA 1WJKA 3ME8A 2H1BA 3DD3A 3M9KA 2MBTA 4IW9A 4EIPA 3CYNA 3GTUA 4MPGA 4O5RA 4PXOA 2GS3A 1MDIA 5D9TA 2L59A 2VIMA 3IC4A 2DJKA 4I6XA 4GQFA 3KMNA 2WFCA 4GSSA 2CAQA 4GXZA 2RLIA 3L4NA 4TKYA 4X1UA 2CAIA 1TU7A 1SK0A 1OE8A 4WF5A 2K6VA 4YAPA 4CY8A 3QFBC 1SENA 4TXOA 3KZQA 3E3EA 3HD5A 12GSA 5ECOB 2H0IA 2FA4A 4ECIA 1GNWA 3FMWA 5B8AA 1K0DA 2H72A 2DJ3A 18GSA 1F9MA 2AUVA 2PGTA 1WIKA 2AYTA 4OD7A 2CX4A 4HUAA 1YKCA 1DE2A 2R6KA 2UZ8A 2V6KA 3GNJA 1ZMAA 2R5GA 3FR3A 3CQFA 14GSA 2DBCA 3LXTA 4J57E 1XCCA 1PKZA 5JCUA 5DAKA 3BJ5A 1GSUA 1T1VA 1XPVA 3GKNA 1Z6MA 1PL1A 1YEPA 4HEA2 4Q5QA 2O85A 1V9WA 1LU4A 3W8SA 4G0LA 1A2JA 4IN0A 3ZYWA 3L78A 3ME7A 3HVVA 3WGEA 2MYGA 2IL3A 3Q6OA 2JZTA 1NSWA 2K8SA 2PN8A 1EWXA 5KN1A 2CT6A 2PPTA 5KN0A 3WD6A 1GSDA 5ECNB 3HCZA 4KSOA 3F9UA 4O32A 5ECMB 4FQUA 5EVOA 3EU3A 4MZBA 3FRCA 1O8WA 1SK1A 4GLTA 3KXOA 16GSA 4NAXA 4PQ1A 1AQVA 4YAVA 5ECQB 1JZOA 3HVXA 3QAWA 2LS5A 4ZL7A 4EXJA 3QMXA 1NM3A 3GFKA 3LWAA 2B7KA 4POBA 2I3YA 1DUGA 2VL3A 1X5DA 1OYJA 3A5IA 4MP4A 2O87A 4NPBA 2G0FA 1XW5A 4L0WA 3LJRA 1QFNA 5BMUA 2P31A 2GQMA 2H0GA 4PUAA 3SWLA 1G6WA 2F8AA 4DVCA 3VLNA 1PGTA 5HFIA 2EC4A 4EVMA 1EZKA 1G6YA 22GSA 4BVYB 1MTCA 1H4OA 2YWIA 5F06A 4DSQA 1KEBA 3CRTA 5DALA 5HR1A 1GWCA 5D9WA 2ON5A 5D8IA 2DJJA 2CVDA 5CNWA 1GL8A 2WCIA 13GSA 4KF9A 4KCEA 1XWBA 3HJPA 2LNSA 4IQ1A 2YV7A 3TJJA 1V40A 2NTOA 5IMAA 2AHEA 4V2NA 4HI7A 3GL5A 2IPAA 2QSIA 2MMOA 2X64A 2HZEA 4HS1A 1YF1A 5IMFA 4Z2UA 3UIWA 2DIZA 5ELAA 1S3DA 3QAGA 3LFLA 3J7Yk 2JZRA 4BIKA 1B4QA 2C3QA 3WGXA 3DYRA 4N0VA 2B5EA 1EGOA 1RQMA 2FLSA 3R3EA 2V2GA 3FZ9A 5D73A 4WR4A 1R7HA 3GUSA 1XG8A 4I97A 4MZCA 3U5RE 2LNTA 4TR4A 4K5RA 1XWCA 1GUHA 3H8QA 4PTSA 2MMZA 1SYRA 1JHBA 1ZYPA 4DEJA 1GUKA 2TIRA 2YCDA 1OC9B 4WBJA 2C3TA 4GQCA 2X8CA 1WPIA 2H76A 4MDCA 5J3RA 3TJFA 2WS2A 4ECBA 1F6MC 2LKUA 2YP6A 2OKAA 3HVNA 3M9JA 4TVEA 4L5OA 6GSYA 3UMAA 3P7XA 1K0MA 2RM5A 3ZIVA 2HSHA 1OVNA 2IN3A 1CQGA 2LJAA 1SD8A 1SKSB 1GSSA 3APQA 2X99A 5FWGA 3FR9A 4MJEA 1MD4A 3IAM2 3VWUA 4BL7B 4XIHA 5J4UA 1TXXA 1YDKA 1GULA 1T8EB 3UOMA 4XS4A 1FHEA 2H1GA 4K8MA 4YKFA 3L9SA 1BEDA 2GZPA 1Q4JA 2JADA 3SBCA 3PH9A 2GSRA 1FW1A 1M3IA 2LEGA 1SL0B 3PPUA 5CRWA 4KCAA 4E8HA 3CTGA 3EU4A 1HD2A 1ZZYA 4JU5A 3UBKA 4GSNA 4GWRA 3EMPA 4IHUA 5E59A 4HSCX 4EL1A 1W4VA 5ECLB 1OC8A 2HZFA 1K3LA 4TW5A 4WXTA 3CXGA 1PD21 4MZWA 4E8EA 3EMXA 4KB3A 2DC5A 4MLYA 4MH2A 5HQPA 3IA1A 2VL2A 4G0IA 3TKRA 5J41A 4J2FA 2YNXA 2QGVA 2F51A 3G7JA 3Q19A 4AGSA 1DE1A 1TRUA 2C1YA 2GVPA 11GSA 3IPZA 5J5NA 4H86A 2JSZA 1QQ2A 3BD2A 4P3YB 2K8VA 3OR5A 3G7YA 1ZL9A 3KJYA 3H93A 2NBSA 3ZMLA 4USSA 2OE3A 4LL1B 3N5OA 5HR3A 2LRTA 3ISOA 4MABA 1N8JA 2JSYA 4PGTA 2NVLA 3MYDA 4IJ3A 1U87A 4NWYA 5ABRA 3LEFA 2IWTA 3KD0A 1GTBA 2PBJA 4RI6A 3ZRDA 1U3IA 1WP0A 4GCIA 3H1NA 2V41A 6GSWA 1FB0A 1M3JA 1KNGA 1XIYA 4FO5A 3TOUA 2GSSA 1VF4A 2NDOA 3RPNA 2H0HA 3VPQA 5DVBA 5DJLA 2IIYA 4ZIJA 3TDGA 1GNEA 2FY6A 1XW9A 4N11A 1YF0A 1PX7A 3FZ4A 2H73A 3GIXA 2TRXA 1ERUA 4HZ4A 1USBA 2I4AA 3D5JA 2WGRA 5BRTA 1Y6EA 3EVIA 3FKFA 4O5UA 4MJAA 4KNDA 1GP1A 3HKRA 3TKSA 1WOUA 1X9MB 2DKIA 3RHCA 4TOPA 4I8BA 1TJDA 1RK4A 4EKZA 5A4VA 1CQHA 3I9V2 3BCIA 4ZBDA 2LQOA 3O76A 3RPPA 4XRAA 4K1FA 3F0IA 3TKSE 2OJLA 1N2AA 2ALBA 1GRXA 1YKAA 1R4WA 5JCWA 5IO2A 1GTIA 5HR0A 2C8UA 3VPTA 2HSYA 4FYBA 1GSYA 2X49A 1A23A 1X0RA 4K2XA 2M72A 3FK8A 4K0GA 5JWOB 3HYPA 3QAVA 4EF0A 1GSFA 1VF2A 4OFNA 5F8BA 3QD9A 5HR2A 3HZ4A 4D73B 2RUEA 1BAYA 5DCHA 2JACA 4I5QA 2H71A 3QR6A 4GSTA 4Q5FA 1PL2A 19GSA 1QXHA 5IM9A 2L57A 3WT2A 1ST9A 1YZXA 1K3YA 3HJMA 1SK2A 2GZZA 3RDWA 2VAFA 3GX8A 2IMEA 1ZYEA 2VLUA 4BVYA 4O92A 5ECPB 4JZQA 1I9DA 4KE3A 4QQ7A 2PMTA 2BTOT 2DSAA 3KGKA 1J0FA 3MIXA 1Y25A 5GSTA 5D9XA 1EOHA 1VRSD 1B8XA 4K9ZA 4LLRA 1EV9A 3TKSC 5LCZA 3IR4A 3QPMA 1VF3A 2GDRA 1TKDB 6GSVA 4WETA 1XWGA 4IKHA 1SJZA 4JRRA 5CREA 4GTUA 4PNGA 17GSA 2GZYA 1UA5A 4EDYA 2FA8A 4MF7A 1T4ZA 5LNKe 2GLRA 4NV5A 2CVBA 2VD1A 1FVKA 2XHFA 4KAEA 4N0ZA 5LD0A 1T00A 2FWEA 2J9HA 3D21A 2E0QA 3APSA 4PQHA 2L4CA 3DMLA 3QCPA 2ZNMA 4ACSA 1AQWA 1OAZA 4N10A 5ECKB 2R2JA 2VCQA 1XWAA 2YN1A 1TI1A 4DSRA 5F07A 2R0CA 2RUFA 1XFLA 2VUPA 4IVFA 5IOXA 2M80A 3TKPA 2VO4A 3GKKA 5B8BA 1U3AA 2X8GA 1K0AA 2QC7A 2XPDA 3LW9A 2GGTA 1M99A 2V6OA 3IK7A 3KTBA 3HHVA 4ECJA 1OC9A 4OCEA 3D4MA 4KDXA 2CZ3A 1QUWA 3IBHA 2XBIA 3IHQA 4GF0A 4K6XA 1T7PB 1J08A 2FWGA 2VD0A 2ZCTA 2TRCP 1SL1B 2L6CA 6GSTA 5HFGA 2B5YA 1A2LA 3QOUA 1PQNA 4BL7A 1O73A 1AW9A 3M8NA 3Q18A 2K9FA 3V1WA 2A2SA 1ZOFA 5CRHA 3ERGA 3TKQA 1A24A 3WGDA 4K7NA 2HRNA 3A2XA 5AIXA 1JZDA 1TRSA 3GH9A 3GRXA 1ERWA 1B9XC 4L5LA 1EV4A 1X9SB 2H6XA 2M46A 1XWKA 3ZVJA 2L5LA 3ZFBA 4KDYA 1EGRA 5ID2A 3K8NA 2WJUA 2H6ZA 2H1DA 2CQ9A 3VFIA 4TRXA 1VGLA 1RW1A 2YANA 2FD3A 3KTLA 2OA7A 2H19A 4IS0A 1O6JA 3HJOA 1QMVA 5F0GA 2B7JA 3EURA 3IRAA 3GSSA 3L9UA 1A0RP 1JZRA 1K3OA 3F3RA 2H6YA 2B5XA 2HFDA 2I1UA 4YH2A 1ERTA 2F8FA 3CSJA 1E6BA 1PKWA 3IXRA 1V98A 5C04A 5JCGA 5B6NA 2IFQB 1ERVA 3GURA 4FYCA 4IP6A 4BVXB 2F9SA 2YPMA 1XVWA 5AISA 5IMZA 4MMMA 1XZOA 3LG6A 4XCSA 2JU5A 1Z3EA 2OACA 1SKWB 4XS1A 3GA4A 4OO4A 1EOGA 3A2VA 3DIEA 1M9BA 4POLA 1Z6NA 2C4JA 3S9FA 4KUNA 5DBQA 1PA3A 4X43A 2VLTA 3RHBA 4MJCA 2OBIA 3M3MA 2P5QA 3VK9A 2N5FA 1PX6A 1ABAA 5G5EA 2LUSA 2LJRA 3P8WA 4G9HA 4J56E 3VI7A 3IDVA 2VCTA 2LRNA 1B9YC 2H74A 4Z2TA 4EC0A 3FZAA 2FWHA 2WRTA 1EEJA 2C0EA 5D93A 5IO0A 3ERWA 4OMVA 5ECRB 3HVSA 4RI7A 2GQKA 1JLVA 4ZL9A 1OC3A 2C0DA 2OE0A 5IPHA 4WR5A 2J23A 1WWJA 4G10A 4X4JA 1URMA 1V57A 3L0HA 1ML6A 3ZIJA 4F0CA 1YY7A 5IMVA 2GQLA 3GV1A 3JCML 3KP8A 4LL4B 4JEDA 4X0XA 2PERA 4HDEA 1LBKA 2FHEA 1F2EA 1OKDA 2QA2A 5KOWA 1Z7PA 1V2AA 1JFUA 4CDOA 3CRUA 1DSBA 1IYHA 3DXBA 5ID2B 4ZB6A 3EWLA 1B4PA 3BOAA 3GH6A 2LSTA 5FHIA 1PSQA 3CSIA 2A2PA 5AIVA 2IMIA 5A4WA 5E4WA 3KM6A 5KN3A 4POMA 2A4HA 3F4SA 3CMIA 6GSUA 2PWJA 4OWYA 3ZFLA 1O7UA 2H66A 3NIVA 4HU9A 2DJ1A 4D73A 4HJ2A 3A5WA 3MSZA 3Q74A 4V2MA 2I81A 3TJGA 3GL3A 2HRAA 4PQIA 1FAAA 3IV4A 3KMOA 4MCUA 5G1KA 3W8JA 3EPTA 4L8EA 3VWWA 3TOTA 2B6MA 3GSTA 1ACVA 2AB6A 5CYYA 4DSSB 2R0PA 2WB9A 2H8LA 4ULXA 4CY6A 4OCFA 4F03A 4ZILA 3C73A 2VCVA 3DRNA 5GSSA 5KEJA 5D96A 2QA1A 1F37A 1XW6A 4MPFA 2OBKA 2XPEA 1A8LA 3G7IA 5C00A 4ZB8A 1K0BA 2IMDA 3L9VA 3ZREA 2HI7A 2FWFA 3C8EA 4HU7A 1AXDA 1ON4A 3G9BA 1S3CA 1FG4A 3EYTA 3FEUA 4XTSA 4BA7A 4XRDA 5H5RA 4KH7A 1GTAA 2C0FA 1OKTA 1U6TA 5GAPD 1TTZA 1HNAA 3QDNA 1T3BA 4F0BA 2O89A 5JWQB 4IQAA 1O85A 2YJHA 1QK8A 3HZ8A 1HNBA 4AJ7A 5IOWA 4RQXA 4I2UA 2VL2C 3D4TA 4KDUA 1PN0A 3U6VA 3F4TA 5DQSA 4ZL8A 4AJ8A 3TB2A 1FVJA 1A0FA 4MNNA 3GHAA 1K0NA 4ZXGA 5ECIB 3IK9A 2CVKA 2KLXA 2YZHA 4IBPA 4HJMA 3DEXA 2DMMA 4WBRD 2BMXA 4EO3A 3M0FA 4TR1B 3LYKA 3UARA 4KX4A 5EPFA 3O3TA 3AY8A 4NHWA 1GSQA 4N30A 1AC1A 4IP1A 2GSQA 4IELA 1TK5B 1R5AA 3KEBA 1F3BA 1K0OA 2V32A 2LQQA 2HNLA 1H75A 4CW9A 2LTKA 5KN2A 4Q5NA 1YJ6A 4ID0A 3IC8A 1XVQA 1M2AA 1BX9A 3F4RA 1JLWA 1AQXA 4V2LA 2DIYA 4F2IA 1AAZA 2HSMA 1YEXA 3A2WA 2VOCA 1TDIA 4RUVA 4K0NA 1PN9A 1BQ7A 2DJ2A 3ZVJD 1GSEA 3M1GA 3I69A 3W6GA 4WF4A 4PUFC 3LORA 2QKEA 4EE0A 2H75A 2A2RA 5CAXA 2P5RA 3LSZA 3UL3A 3UJ1A 1ZCPA 1M0UA 5J9CA 5A4UA 1GLQA 3F6FA 1XXUA 1V58A 2WZ9A 5DDLA 1TOFA 1HQOA 2IFQA 2GT6A 2WDUA 2HRFA 4BVXA 4G0KA 4KW6A 5CRGA
chains in the Genus database with same CATH topology
1OE7A 3GX0A 1HYUA 3F3QA 4AF2A 3D22A 3DGQA 3GMFA 4KA0A 4V1Ap 4BWSA 2GTUA 3D6IA 4BWQA 1E2YA 4PURA 3LXZA 3DVXA 2FUG2 2R0GA 3DKSA 4WEYA 1MEKA 1S3AA 2RIIA 5IQYA 5G5FA 2A4VA 3EC3A 1PRXA 3GYKA 5DCGA 4XHMA 2VL9A 2B1KA 4K7IA 4ILFA 2GT5A 2G2QA 10GSA 1SL2B 2H30A 2E2MA 3HDCA 2YJ7A 4TR3A 1BYEA 1EP7A 4Z7XA 3GN3A 5F05A 3LYPA 3UBLA 4QL7A 5GZZB 2H01A 3D0ZA 5ECSA 2F3MA 1SYXA 2NPBA 1M7TA 4JR4A 2PVOC 1EP8A 4FH8A 1JZWA 4ZBAA 2DMLA 3US3A 4K2DA 4TXVA 3GKXA 4PNFA 20GSA 1R26A 2CV4A 1K0CA 4LA1A 5A5KA 1MDKA 3GTUB 1O8XA 1SJ6A 3I43A 4YQVA 4JBBA 9GSSA 2YWMA 1TP9A 2XBQA 2PUKC 2LRCA 3H4KA 5HFKA 3EE2A 4TN8A 3ED3A 1X9WB 3E9JB 2REMA 1TRVA 1I5GA 4IGJA 3MWHA 5D9VA 3WYWA 2WULA 2OE1A 5G30A 2D2ZA 3IHGA 3P2AA 1G7OA 5IMDA 3FZ5A 4QL9A 4K7OA 1TK8B 2FGXA 4EIQA 2L5OA 4TXOB 4AJ6A 1GLPA 2X8HA 3VI5A 2R37A 1TW9A 1G7EA 1TI3A 1VF1A 4OFMA 3TRQA 1O81A 4EDZA 3ZLPA 3C1RA 4PX1A 4NHZA 2PU9C 2JZSA 1QGVA 2KOKA 4DSSA 4XS6A 2LJKA 2E7PA 1TU8A 1C72A 4ZB9A 3UVTA 3ZITA 2KP2A 1WMJA 1F3AA 1M2DA 2HYXA 1BJXA 1DBYA 2CA8A 5DAKB 3J7Yb 4MJBA 1SD9A 1B48A 1Z5YE 5AN1A 1A2MA 1W89A 2B1LA 4LMWA 3NZNA 4MF6A 2YV9A 2N5AA 4HQSA 3IAS2 3ERFA 1FO5A 1THOA 3KH7A 4ZBBA 2P0GA 2GSTA 4G19A 4NMUA 3CBUA 5CP1A 3C1SA 1ZYQB 4Q5RA 5DJMA 3MDKA 1YQ1A 1THXA 1SU9A 4MH3A 1FOVA 1SJIA 1GTUA 2VM1A 4WKWA 3A3TA 4L0UA 3BBYA 4ML1A 3ZZXA 4RQRA 2CZ2A 3ZMKA 2ZUPA 4HQZA 2YWNA 2KHPA 4LMVA 5B6MA 4HZ2A 5L71A 3CTFA 1AIUA 3VURA 3N9JA 2AJQB 2C0GA 1ZGNA 5H5SA 3VWVA 4CHSA 5EL8A 2DLXA 3CSHA 4I2TA 2Z9SA 2ON7A 4TR0A 4ML6A 1FOHA 3ZTLA 2MZCA 4G2EA 1R5PA 2HLSA 3C71A 4K5SA 1BG5A 2HE3A 4MK3A 1TK0B 3PGTA 1MDJA 1IYIA 4ISDA 3RBTA 5CO3A 3LQ7A 4TR1A 1GUMA 5G2ZA 2PVQA 2IMFA 2YZUA 2N5BA 4O7HA 5AGYA 2R3XA 2KP1A 3LGCA 4NXIA 4MA9A 1KTEA 2VM2A 2X4AA 1LJRA 3PINA 5ENUA 3KCMA 2RM6A 2MMAA 5GAND 3APOA 5IMCA 4YQMA 2O8VB 1XBSA 1EEMA 2CX3A 2V1MA 3HY2A 5B7CA 3MNGA 4NV2A 5JWRB 3MAKA 1U88A 5DQYA 5IPGA 1UN2A 5DALB 2E2GA 3C7MA 3TUEA 1NHYA 3UVHA 4ICYA 3EINA 4V1Ag 2R4VA 2EIRA 5IIZA 2H70A 3F6DA 1X5CA 5KOXA 3KIJA 1NHOA 4KGIA 3UAPA 2VCZA 2YOIA 4OO5A 2IMKA 3VWXA 1HNCA 2YWOA 2KUCA 6GSXA 2OADA 7GSSA 2EIQA 1PMTA 4O5QA 5ELGA 2XC2A 3TJKA 3TCOA 4YKGA 8GSSA 2HZEB 5H5QA 3DWVA 2B3SA 4JR6A 3RAZA 3FY7A 1UVZA 3FHKA 6GSSA 4ECCA 5G31A 1WE0A 3HA9A 2ES7A 1TRWA 3KH9A 3FYGA 4Z2RA 2AV4A 1ZYNA 2HRKA 1GH2A 3I6AA 5G1LA 1T4YA 1A8YA 1WRYA 1Z9HA 2BJXA 3R2QA 3F63A 3IE3A 4BPYA 3P90A 5INYA 2MBSA 2IJYA 1Z7RA 2DJ0A 3DVWA 1SKRB 3TRPA 3PR8A 2L6DA 4FYUA 1NW2A 2I9HA 4KSMA 1G0TA 2H1AA 1UC7A 5EY6A 2MMNA 3FR6A 2L4QA 3F8UA 2FNOA 1ILOA 1X5EA 2EIOA 4F82A 2FCHA 5FT3A 2JL4A 1MD3A 4YQUA 2VCXA 3O6TA 1KBNA 3TRXA 2C80A 3NOFA 4FIWA 4GRFA 5COHA 3E0UA 2HT9A 4OFTA 4EUYA 3BCKA 5CRDA 1J9BA 3KP9A 4MF5A 1Q98A 2O7KA 4POKA 3TGZA 3IOSA 4JE1A 2LV3A 4HOJA 1FB6A 2HXKA 4IJIA 1XOAA 3GKMA 3WT1A 3ZL5A 1XOBA 3UEMA 1AUCA 2C3NA 2DKHA 3FW2A 4A5PA 5ECHB 3H79A 5J9BA 2VLVA 4XS4B 2AAWA 4F9ZA 3TJBA 1M9AA 2VCWA 3HXSA 2K18A 3QFAC 1M2BA 1WJKA 3ME8A 2H1BA 3DD3A 3M9KA 2MBTA 4IW9A 4EIPA 3CYNA 3GTUA 4MPGA 4O5RA 4PXOA 2GS3A 1MDIA 5D9TA 2L59A 2VIMA 3IC4A 2DJKA 4I6XA 4GQFA 3KMNA 2WFCA 4GSSA 2CAQA 4GXZA 2RLIA 3L4NA 4TKYA 4X1UA 2CAIA 1TU7A 1SK0A 1OE8A 4WF5A 2K6VA 4YAPA 4CY8A 3QFBC 1SENA 4TXOA 3KZQA 3E3EA 3HD5A 12GSA 5ECOB 2H0IA 2FA4A 4ECIA 1GNWA 3FMWA 5B8AA 1K0DA 2H72A 2DJ3A 18GSA 1F9MA 2AUVA 2PGTA 1WIKA 2AYTA 4OD7A 2CX4A 4HUAA 1YKCA 1DE2A 2R6KA 2UZ8A 2V6KA 3GNJA 1ZMAA 2R5GA 3FR3A 14GSA 2DBCA 3LXTA 4J57E 1XCCA 1PKZA 5JCUA 5DAKA 3BJ5A 1GSUA 1T1VA 1XPVA 3GKNA 1Z6MA 1PL1A 1YEPA 4HEA2 4Q5QA 2O85A 1V9WA 1LU4A 3W8SA 4G0LA 1A2JA 4IN0A 3ZYWA 3L78A 3ME7A 3HVVA 3WGEA 2MYGA 2IL3A 3Q6OA 2JZTA 1NSWA 2K8SA 2PN8A 1EWXA 5KN1A 2CT6A 2PPTA 5KN0A 3WD6A 1GSDA 5ECNB 3HCZA 4KSOA 3F9UA 4O32A 5ECMB 4FQUA 5EVOA 3EU3A 4MZBA 3FRCA 1O8WA 1SK1A 4GLTA 3KXOA 16GSA 4NAXA 4PQ1A 1AQVA 4YAVA 5ECQB 1JZOA 3HVXA 3QAWA 2LS5A 4ZL7A 4EXJA 3QMXA 1NM3A 3GFKA 3LWAA 2B7KA 4POBA 2I3YA 1DUGA 2VL3A 1X5DA 1OYJA 3A5IA 4MP4A 2O87A 4NPBA 2G0FA 1XW5A 4L0WA 3LJRA 1QFNA 5BMUA 2P31A 2GQMA 2H0GA 4PUAA 3SWLA 1G6WA 2F8AA 4DVCA 3VLNA 1PGTA 5HFIA 2EC4A 4EVMA 1EZKA 1G6YA 22GSA 4BVYB 1MTCA 1H4OA 2YWIA 5F06A 4DSQA 1KEBA 3CRTA 5DALA 5HR1A 1GWCA 5D9WA 2ON5A 5D8IA 2DJJA 2CVDA 5CNWA 1GL8A 2WCIA 13GSA 4KF9A 4KCEA 1XWBA 3HJPA 2LNSA 4IQ1A 2YV7A 3TJJA 1V40A 2NTOA 5IMAA 2AHEA 4V2NA 4HI7A 3GL5A 2IPAA 2QSIA 2MMOA 2X64A 2HZEA 4HS1A 1YF1A 5IMFA 4Z2UA 3UIWA 2DIZA 5ELAA 1S3DA 3QAGA 3LFLA 3J7Yk 2JZRA 1B4QA 2C3QA 3WGXA 3DYRA 4N0VA 2B5EA 1EGOA 1RQMA 2FLSA 3R3EA 2V2GA 3FZ9A 5D73A 4WR4A 1R7HA 3GUSA 4I97A 4MZCA 3U5RE 2LNTA 4TR4A 4K5RA 1XWCA 1GUHA 3H8QA 4PTSA 2MMZA 1SYRA 1JHBA 1ZYPA 4DEJA 1GUKA 2TIRA 2YCDA 1OC9B 4WBJA 2C3TA 4GQCA 2X8CA 1WPIA 2H76A 4MDCA 5J3RA 3TJFA 2WS2A 4ECBA 1F6MC 2LKUA 2YP6A 2OKAA 3M9JA 4TVEA 4L5OA 6GSYA 3UMAA 3P7XA 1K0MA 2RM5A 3ZIVA 2HSHA 1OVNA 2IN3A 1CQGA 2LJAA 1SD8A 1SKSB 1GSSA 3APQA 2X99A 5FWGA 3FR9A 4MJEA 1MD4A 3IAM2 3VWUA 4BL7B 4XIHA 5J4UA 1TXXA 1YDKA 1GULA 1T8EB 3UOMA 4XS4A 1FHEA 2H1GA 4K8MA 4YKFA 3L9SA 1BEDA 2GZPA 1Q4JA 2JADA 3SBCA 3PH9A 2GSRA 1FW1A 2LEGA 1SL0B 3PPUA 5CRWA 4KCAA 4E8HA 3CTGA 3EU4A 1HD2A 1ZZYA 4JU5A 3UBKA 4GSNA 4GWRA 3EMPA 4IHUA 5E59A 4EL1A 1W4VA 5ECLB 1OC8A 2HZFA 1K3LA 4TW5A 4WXTA 3CXGA 1PD21 4MZWA 4E8EA 3EMXA 4KB3A 2DC5A 4MLYA 4MH2A 5HQPA 3IA1A 2VL2A 4G0IA 3TKRA 5J41A 4J2FA 2YNXA 2QGVA 2F51A 3G7JA 3Q19A 4AGSA 1DE1A 1TRUA 2C1YA 2GVPA 11GSA 3IPZA 5J5NA 4H86A 2JSZA 1QQ2A 3BD2A 4P3YB 2K8VA 3OR5A 3G7YA 1ZL9A 3KJYA 3H93A 2NBSA 3ZMLA 4USSA 2OE3A 4LL1B 3N5OA 5HR3A 2LRTA 3ISOA 4MABA 1N8JA 2JSYA 4PGTA 2NVLA 3MYDA 4IJ3A 1U87A 4NWYA 5ABRA 3LEFA 2IWTA 3KD0A 1GTBA 2PBJA 4RI6A 3ZRDA 1U3IA 1WP0A 4GCIA 3H1NA 2V41A 6GSWA 1FB0A 1XIYA 1KNGA 4FO5A 3TOUA 2GSSA 1VF4A 2NDOA 3RPNA 2H0HA 3VPQA 5DVBA 5DJLA 2IIYA 4ZIJA 3TDGA 1GNEA 2FY6A 1XW9A 4N11A 1YF0A 1PX7A 3FZ4A 2H73A 3GIXA 2TRXA 1ERUA 4HZ4A 1USBA 2I4AA 3D5JA 2WGRA 5BRTA 1Y6EA 3EVIA 3FKFA 4O5UA 4MJAA 4KNDA 1GP1A 3HKRA 3TKSA 1WOUA 1X9MB 2DKIA 3RHCA 4TOPA 4I8BA 1TJDA 1RK4A 4EKZA 5A4VA 1CQHA 3I9V2 3BCIA 4ZBDA 2LQOA 3O76A 3RPPA 4XRAA 4K1FA 3F0IA 3TKSE 2OJLA 1N2AA 2ALBA 1GRXA 1YKAA 1R4WA 5JCWA 5IO2A 1GTIA 5HR0A 2C8UA 3VPTA 2HSYA 4FYBA 1GSYA 2X49A 1A23A 1X0RA 4K2XA 2M72A 3FK8A 4K0GA 5JWOB 3HYPA 3QAVA 4EF0A 1GSFA 1VF2A 4OFNA 5F8BA 3QD9A 5HR2A 3HZ4A 4D73B 2RUEA 1BAYA 5DCHA 2JACA 4I5QA 2H71A 3QR6A 4GSTA 4Q5FA 1PL2A 19GSA 1QXHA 5IM9A 2L57A 3WT2A 1ST9A 1YZXA 1K3YA 3HJMA 1SK2A 2GZZA 3RDWA 2VAFA 3GX8A 2IMEA 1ZYEA 2VLUA 4BVYA 4O92A 5ECPB 4JZQA 1I9DA 4KE3A 4QQ7A 2PMTA 2BTOT 2DSAA 3KGKA 1J0FA 3MIXA 1Y25A 5GSTA 5D9XA 1EOHA 1VRSD 1B8XA 4K9ZA 4LLRA 1EV9A 3TKSC 5LCZA 3IR4A 3QPMA 1VF3A 2GDRA 1TKDB 6GSVA 4WETA 1XWGA 4IKHA 1SJZA 4JRRA 5CREA 4GTUA 4PNGA 17GSA 2GZYA 1UA5A 4EDYA 2FA8A 4MF7A 1T4ZA 5LNKe 2GLRA 4NV5A 2CVBA 2VD1A 1FVKA 2XHFA 4KAEA 4N0ZA 5LD0A 1T00A 2FWEA 2J9HA 3D21A 2E0QA 3APSA 4PQHA 2L4CA 3DMLA 3QCPA 2ZNMA 4ACSA 1AQWA 1OAZA 4N10A 5ECKB 2R2JA 2VCQA 1XWAA 2YN1A 1TI1A 4DSRA 5F07A 2R0CA 2RUFA 1XFLA 2VUPA 4IVFA 5IOXA 2M80A 3TKPA 2VO4A 3GKKA 5B8BA 1U3AA 2X8GA 1K0AA 2QC7A 2XPDA 3LW9A 2GGTA 1M99A 2V6OA 3IK7A 3KTBA 3HHVA 4ECJA 1OC9A 4OCEA 3D4MA 4KDXA 2CZ3A 1QUWA 3IBHA 2XBIA 3IHQA 4GF0A 4K6XA 1T7PB 1J08A 2FWGA 2VD0A 2ZCTA 2TRCP 1SL1B 2L6CA 6GSTA 5HFGA 2B5YA 1A2LA 3QOUA 1PQNA 4BL7A 1O73A 1AW9A 3M8NA 3Q18A 2K9FA 3V1WA 2A2SA 1ZOFA 5CRHA 3ERGA 3TKQA 1A24A 3WGDA 4K7NA 2HRNA 3A2XA 5AIXA 1JZDA 1TRSA 3GH9A 3GRXA 1ERWA 1B9XC 4L5LA 1EV4A 1X9SB 2H6XA 2M46A 1XWKA 3ZVJA 2L5LA 3ZFBA 4KDYA 1EGRA 5ID2A 3K8NA 2WJUA 2H6ZA 2H1DA 2CQ9A 3VFIA 4TRXA 1VGLA 1RW1A 2YANA 2FD3A 3KTLA 2OA7A 2H19A 4IS0A 1O6JA 3HJOA 1QMVA 5F0GA 2B7JA 3EURA 3IRAA 3GSSA 3L9UA 1A0RP 1JZRA 1K3OA 3F3RA 2H6YA 2B5XA 2HFDA 2I1UA 4YH2A 1ERTA 2F8FA 3CSJA 1E6BA 1PKWA 3IXRA 1V98A 5C04A 5JCGA 5B6NA 2IFQB 1ERVA 3GURA 4FYCA 4IP6A 4BVXB 2F9SA 2YPMA 1XVWA 5AISA 5IMZA 4MMMA 1XZOA 3LG6A 4XCSA 2JU5A 1Z3EA 2OACA 1SKWB 4XS1A 3GA4A 4OO4A 1EOGA 3A2VA 3DIEA 1M9BA 4POLA 1Z6NA 2C4JA 3S9FA 4KUNA 5DBQA 1PA3A 4X43A 2VLTA 3RHBA 4MJCA 2OBIA 3M3MA 2P5QA 3VK9A 2N5FA 1PX6A 1ABAA 5G5EA 2LUSA 2LJRA 3P8WA 4G9HA 4J56E 3VI7A 3IDVA 2VCTA 2LRNA 1B9YC 2H74A 4Z2TA 4EC0A 3FZAA 2FWHA 2WRTA 1EEJA 2C0EA 5D93A 5IO0A 3ERWA 4OMVA 5ECRB 3HVSA 4RI7A 2GQKA 1JLVA 4ZL9A 1OC3A 2C0DA 2OE0A 5IPHA 4WR5A 2J23A 1WWJA 4G10A 4X4JA 1URMA 1V57A 3L0HA 1ML6A 3ZIJA 4F0CA 1YY7A 5IMVA 2GQLA 3GV1A 3JCML 3KP8A 4LL4B 4JEDA 4X0XA 2PERA 4HDEA 1LBKA 2FHEA 1F2EA 1OKDA 2QA2A 5KOWA 1Z7PA 1V2AA 1JFUA 4CDOA 3CRUA 1DSBA 1IYHA 3DXBA 5ID2B 4ZB6A 3EWLA 1B4PA 3BOAA 3GH6A 2LSTA 5FHIA 1PSQA 3CSIA 2A2PA 5AIVA 2IMIA 5A4WA 5E4WA 3KM6A 5KN3A 4POMA 2A4HA 3F4SA 3CMIA 6GSUA 2PWJA 4OWYA 3ZFLA 1O7UA 2H66A 3NIVA 4HU9A 2DJ1A 4D73A 4HJ2A 3A5WA 3MSZA 3Q74A 4V2MA 2I81A 3TJGA 3GL3A 2HRAA 4PQIA 1FAAA 3IV4A 3KMOA 4MCUA 5G1KA 3W8JA 3EPTA 4L8EA 3VWWA 3TOTA 2B6MA 3GSTA 1ACVA 2AB6A 5CYYA 4DSSB 2R0PA 2WB9A 2H8LA 4ULXA 4CY6A 4OCFA 4F03A 4ZILA 3C73A 2VCVA 3DRNA 5GSSA 5KEJA 5D96A 2QA1A 1F37A 1XW6A 4MPFA 2OBKA 2XPEA 1A8LA 3G7IA 5C00A 4ZB8A 1K0BA 2IMDA 3L9VA 3ZREA 2HI7A 2FWFA 3C8EA 4HU7A 1AXDA 1ON4A 3G9BA 1S3CA 1FG4A 3EYTA 3FEUA 4XTSA 4BA7A 4XRDA 5H5RA 4KH7A 1GTAA 2C0FA 1OKTA 1U6TA 5GAPD 1TTZA 1HNAA 3QDNA 1T3BA 4F0BA 2O89A 5JWQB 4IQAA 1O85A 2YJHA 1QK8A 3HZ8A 1HNBA 4AJ7A 5IOWA 4RQXA 4I2UA 2VL2C 3D4TA 4KDUA 1PN0A 3U6VA 3F4TA 5DQSA 4ZL8A 4AJ8A 3TB2A 1FVJA 1A0FA 4MNNA 3GHAA 1K0NA 4ZXGA 5ECIB 3IK9A 2CVKA 2KLXA 2YZHA 4IBPA 4HJMA 3DEXA 2DMMA 4WBRD 2BMXA 4EO3A 3M0FA 4TR1B 3LYKA 3UARA 4KX4A 5EPFA 3O3TA 3AY8A 4NHWA 1GSQA 4N30A 1AC1A 4IP1A 2GSQA 4IELA 1TK5B 1R5AA 3KEBA 1F3BA 1K0OA 2V32A 2LQQA 2HNLA 1H75A 4CW9A 2LTKA 5KN2A 4Q5NA 1YJ6A 4ID0A 3IC8A 1XVQA 1M2AA 1BX9A 3F4RA 1JLWA 1AQXA 4V2LA 2DIYA 4F2IA 1AAZA 2HSMA 1YEXA 3A2WA 2VOCA 1TDIA 4RUVA 4K0NA 1PN9A 1BQ7A 2DJ2A 3ZVJD 1GSEA 3M1GA 3I69A 3W6GA 4WF4A 4PUFC 3LORA 2QKEA 4EE0A 2H75A 2A2RA 5CAXA 2P5RA 3LSZA 3UL3A 3UJ1A 1ZCPA 1M0UA 5J9CA 5A4UA 1GLQA 3F6FA 1XXUA 1V58A 2WZ9A 5DDLA 1TOFA 1HQOA 2IFQA 2GT6A 2WDUA 2HRFA 4BVXA 4G0KA 4KW6A 5CRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OE7 A;  3GX0 A;  1HYU A;  3F3Q A;  4AF2 A;  3D22 A;  3DGQ A;  3GMF A;  4KA0 A;  4V1A p;  4BWS A;  2GTU A;  3D6I A;  4BWQ A;  1E2Y A;  4PUR A;  3LXZ A;  3DVX A;  2FUG 2;  3DKS A;  4WEY A;  1MEK A;  1S3A A;  2RII A;  5IQY A;  5G5F A;  2A4V A;  3EC3 A;  1PRX A;  3GYK A;  5DCG A;  4XHM A;  2VL9 A;  2B1K A;  4K7I A;  4ILF A;  2GT5 A;  2G2Q A;  10GS A;  1SL2 B;  2H30 A;  2E2M A;  3HDC A;  2YJ7 A;  4TR3 A;  1BYE A;  1EP7 A;  4Z7X A;  3GN3 A;  5F05 A;  3LYP A;  3UBL A;  4QL7 A;  5GZZ B;  2H01 A;  3D0Z A;  5ECS A;  2F3M A;  1SYX A;  2NPB A;  1M7T A;  4JR4 A;  2PVO C;  1EP8 A;  4FH8 A;  1JZW A;  4ZBA A;  2DML A;  3US3 A;  4K2D A;  4TXV A;  3GKX A;  4PNF A;  20GS A;  1R26 A;  2CV4 A;  1K0C A;  4LA1 A;  5A5K A;  1MDK A;  3GTU B;  1O8X A;  1SJ6 A;  3I43 A;  4YQV A;  4JBB A;  9GSS A;  2YWM A;  1TP9 A;  2XBQ A;  2PUK C;  2LRC A;  3H4K A;  5HFK A;  3EE2 A;  4TN8 A;  3ED3 A;  1X9W B;  3E9J B;  2REM A;  1TRV A;  1I5G A;  4IGJ A;  3MWH A;  5D9V A;  3WYW A;  2WUL A;  2OE1 A;  5G30 A;  2D2Z A;  3P2A A;  1G7O A;  5IMD A;  3FZ5 A;  4QL9 A;  4K7O A;  1TK8 B;  2FGX A;  2L5O A;  4TXO B;  4AJ6 A;  1GLP A;  2X8H A;  3VI5 A;  2R37 A;  1TW9 A;  1G7E A;  1TI3 A;  1VF1 A;  4OFM A;  3TRQ A;  1O81 A;  4EDZ A;  3ZLP A;  3C1R A;  4PX1 A;  4NHZ A;  2PU9 C;  2JZS A;  1QGV A;  2KOK A;  4DSS A;  4XS6 A;  2LJK A;  2E7P A;  1TU8 A;  1C72 A;  4ZB9 A;  3UVT A;  3ZIT A;  2KP2 A;  1WMJ A;  1F3A A;  1M2D A;  2HYX A;  1BJX A;  1DBY A;  2CA8 A;  5DAK B;  3J7Y b;  4MJB A;  1SD9 A;  1B48 A;  1Z5Y E;  5AN1 A;  1A2M A;  1W89 A;  2B1L A;  4LMW A;  3NZN A;  4MF6 A;  2YV9 A;  2N5A A;  4HQS A;  3IAS 2;  3ERF A;  1FO5 A;  1THO A;  3KH7 A;  4ZBB A;  2P0G A;  2GST A;  4G19 A;  4NMU A;  3CBU A;  5CP1 A;  3C1S A;  1ZYQ B;  4Q5R A;  5DJM A;  3MDK A;  1YQ1 A;  1THX A;  1SU9 A;  4MH3 A;  1FOV A;  1SJI A;  1GTU A;  2VM1 A;  4WKW A;  3A3T A;  4L0U A;  3BBY A;  4ML1 A;  3ZZX A;  4RQR A;  2CZ2 A;  3ZMK A;  2ZUP A;  4HQZ A;  2YWN A;  2KHP A;  4LMV A;  5B6M A;  4HZ2 A;  5L71 A;  3CTF A;  1AIU A;  3VUR A;  3N9J A;  2AJQ B;  2C0G A;  1ZGN A;  5H5S A;  3VWV A;  4CHS A;  5EL8 A;  2DLX A;  3CSH A;  4I2T A;  2Z9S A;  2ON7 A;  4TR0 A;  4ML6 A;  3ZTL A;  2MZC A;  4G2E A;  1R5P A;  2HLS A;  3C71 A;  1BG5 A;  2HE3 A;  4MK3 A;  1TK0 B;  3PGT A;  1MDJ A;  1IYI A;  4ISD A;  3RBT A;  5CO3 A;  3LQ7 A;  4TR1 A;  1GUM A;  5G2Z A;  2PVQ A;  2IMF A;  2YZU A;  2N5B A;  4O7H A;  5AGY A;  2R3X A;  2KP1 A;  3LGC A;  4NXI A;  4MA9 A;  1KTE A;  2VM2 A;  1LJR A;  3PIN A;  5ENU A;  3KCM A;  2RM6 A;  2MMA A;  5GAN D;  3APO A;  5IMC A;  4YQM A;  2O8V B;  1XBS A;  1EEM A;  2CX3 A;  2V1M A;  3HY2 A;  5B7C A;  3MNG A;  4NV2 A;  5JWR B;  3MAK A;  1U88 A;  5DQY A;  5IPG A;  1UN2 A;  5DAL B;  2E2G A;  3C7M A;  3TUE A;  1NHY A;  3UVH A;  3EIN A;  4V1A g;  2R4V A;  2EIR A;  5IIZ A;  2H70 A;  3F6D A;  1X5C A;  3KIJ A;  1NHO A;  4KGI A;  3UAP A;  2VCZ A;  2YOI A;  4OO5 A;  2IMK A;  3VWX A;  1HNC A;  2YWO A;  2KUC A;  6GSX A;  2OAD A;  7GSS A;  2EIQ A;  1PMT A;  5ELG A;  2XC2 A;  3TJK A;  3TCO A;  8GSS A;  2HZE B;  5H5Q A;  3DWV A;  2B3S A;  4JR6 A;  3RAZ A;  3FY7 A;  1UVZ A;  3FHK A;  6GSS A;  4ECC A;  5G31 A;  1WE0 A;  3HA9 A;  2ES7 A;  1TRW A;  3KH9 A;  3FYG A;  2AV4 A;  1GH2 A;  3I6A A;  5G1L A;  1T4Y A;  1A8Y A;  1WRY A;  1Z9H A;  2BJX A;  3R2Q A;  3F63 A;  3IE3 A;  4BPY A;  3P90 A;  5INY A;  2MBS A;  2IJY A;  1Z7R A;  2DJ0 A;  3DVW A;  1SKR B;  3TRP A;  3PR8 A;  2L6D A;  4FYU A;  1NW2 A;  2I9H A;  4KSM A;  1G0T A;  2H1A A;  1UC7 A;  5EY6 A;  2MMN A;  3FR6 A;  2L4Q A;  3F8U A;  2FNO A;  1ILO A;  1X5E A;  2EIO A;  4F82 A;  2FCH A;  5FT3 A;  2JL4 A;  1MD3 A;  4YQU A;  2VCX A;  3O6T A;  1KBN A;  3TRX A;  2C80 A;  3NOF A;  4FIW A;  4GRF A;  5COH A;  3E0U A;  2HT9 A;  4OFT A;  4EUY A;  3BCK A;  5CRD A;  1J9B A;  3KP9 A;  4MF5 A;  1Q98 A;  2O7K A;  4POK A;  3TGZ A;  3IOS A;  4JE1 A;  2LV3 A;  4HOJ A;  1FB6 A;  2HXK A;  4IJI A;  1XOA A;  3GKM A;  3WT1 A;  3ZL5 A;  1XOB A;  3UEM A;  1AUC A;  2C3N A;  3FW2 A;  5ECH B;  3H79 A;  5J9B A;  2VLV A;  4XS4 B;  2AAW A;  4F9Z A;  3TJB A;  1M9A A;  2VCW A;  3HXS A;  2K18 A;  3QFA C;  1M2B A;  1WJK A;  3ME8 A;  2H1B A;  3DD3 A;  3M9K A;  2MBT A;  4IW9 A;  3CYN A;  3GTU A;  4MPG A;  4O5R A;  4PXO A;  2GS3 A;  1MDI A;  5D9T A;  2L59 A;  2VIM A;  3IC4 A;  2DJK A;  4I6X A;  4GQF A;  3KMN A;  2WFC A;  4GSS A;  2CAQ A;  4GXZ A;  2RLI A;  3L4N A;  4TKY A;  4X1U A;  2CAI A;  1TU7 A;  1SK0 A;  1OE8 A;  4WF5 A;  2K6V A;  4YAP A;  3QFB C;  1SEN A;  4TXO A;  3KZQ A;  3E3E A;  3HD5 A;  12GS A;  5ECO B;  2H0I A;  2FA4 A;  4ECI A;  1GNW A;  5B8A A;  1K0D A;  2H72 A;  2DJ3 A;  18GS A;  1F9M A;  2AUV A;  2PGT A;  1WIK A;  2AYT A;  4OD7 A;  2CX4 A;  4HUA A;  1YKC A;  1DE2 A;  2R6K A;  2V6K A;  3GNJ A;  1ZMA A;  2R5G A;  3FR3 A;  14GS A;  2DBC A;  3LXT A;  4J57 E;  1XCC A;  1PKZ A;  5JCU A;  5DAK A;  3BJ5 A;  1GSU A;  1T1V A;  1XPV A;  3GKN A;  1Z6M A;  1PL1 A;  1YEP A;  4HEA 2;  4Q5Q A;  2O85 A;  1V9W A;  1LU4 A;  3W8S A;  1A2J A;  4IN0 A;  3ZYW A;  3L78 A;  3ME7 A;  3HVV A;  3WGE A;  2MYG A;  2IL3 A;  3Q6O A;  2JZT A;  1NSW A;  2K8S A;  2PN8 A;  1EWX A;  5KN1 A;  2CT6 A;  2PPT A;  5KN0 A;  3WD6 A;  1GSD A;  5ECN B;  3HCZ A;  4KSO A;  3F9U A;  4O32 A;  5ECM B;  5EVO A;  3EU3 A;  4MZB A;  3FRC A;  1O8W A;  1SK1 A;  4GLT A;  3KXO A;  16GS A;  4NAX A;  4PQ1 A;  1AQV A;  4YAV A;  5ECQ B;  1JZO A;  3HVX A;  3QAW A;  2LS5 A;  4ZL7 A;  4EXJ A;  3QMX A;  1NM3 A;  3GFK A;  3LWA A;  2B7K A;  4POB A;  2I3Y A;  1DUG A;  2VL3 A;  1X5D A;  1OYJ A;  4MP4 A;  2O87 A;  4NPB A;  2G0F A;  1XW5 A;  4L0W A;  3LJR A;  1QFN A;  2P31 A;  2GQM A;  2H0G A;  4PUA A;  3SWL A;  1G6W A;  2F8A A;  4DVC A;  3VLN A;  1PGT A;  5HFI A;  2EC4 A;  4EVM A;  1EZK A;  1G6Y A;  22GS A;  1MTC A;  1H4O A;  2YWI A;  5F06 A;  4DSQ A;  1KEB A;  3CRT A;  5DAL A;  5HR1 A;  1GWC A;  5D9W A;  2ON5 A;  5D8I A;  2DJJ A;  2CVD A;  5CNW A;  1GL8 A;  2WCI A;  13GS A;  4KCE A;  1XWB A;  3HJP A;  2LNS A;  4IQ1 A;  2YV7 A;  3TJJ A;  1V40 A;  2NTO A;  5IMA A;  2AHE A;  4V2N A;  4HI7 A;  3GL5 A;  2IPA A;  2QSI A;  2MMO A;  2X64 A;  2HZE A;  4HS1 A;  1YF1 A;  5IMF A;  3UIW A;  2DIZ A;  5ELA A;  1S3D A;  3QAG A;  3LFL A;  3J7Y k;  2JZR A;  1B4Q A;  2C3Q A;  3WGX A;  3DYR A;  4N0V A;  2B5E A;  1EGO A;  1RQM A;  2FLS A;  2V2G A;  3FZ9 A;  5D73 A;  4WR4 A;  1R7H A;  3GUS A;  4I97 A;  4MZC A;  3U5R E;  2LNT A;  4TR4 A;  1XWC A;  1GUH A;  3H8Q A;  2MMZ A;  1SYR A;  1JHB A;  4DEJ A;  1GUK A;  2TIR A;  2YCD A;  1OC9 B;  4WBJ A;  2C3T A;  4GQC A;  2X8C A;  1WPI A;  2H76 A;  4MDC A;  5J3R A;  3TJF A;  2WS2 A;  4ECB A;  1F6M C;  2LKU A;  2YP6 A;  2OKA A;  3M9J A;  4TVE A;  4L5O A;  6GSY A;  3UMA A;  3P7X A;  1K0M A;  2RM5 A;  3ZIV A;  2HSH A;  1OVN A;  2IN3 A;  1CQG A;  2LJA A;  1SD8 A;  1SKS B;  1GSS A;  3APQ A;  2X99 A;  5FWG A;  3FR9 A;  4MJE A;  1MD4 A;  3IAM 2;  3VWU A;  4XIH A;  5J4U A;  1TXX A;  1YDK A;  1GUL A;  1T8E B;  3UOM A;  4XS4 A;  1FHE A;  2H1G A;  4K8M A;  3L9S A;  1BED A;  2GZP A;  1Q4J A;  2JAD A;  3SBC A;  3PH9 A;  2GSR A;  1FW1 A;  2LEG A;  1SL0 B;  5CRW A;  4KCA A;  4E8H A;  3CTG A;  3EU4 A;  1HD2 A;  1ZZY A;  4JU5 A;  3UBK A;  4GSN A;  4GWR A;  3EMP A;  4IHU A;  5E59 A;  4EL1 A;  1W4V A;  5ECL B;  1OC8 A;  2HZF A;  1K3L A;  4TW5 A;  4WXT A;  3CXG A;  1PD2 1;  4MZW A;  4E8E A;  3EMX A;  4KB3 A;  2DC5 A;  4MLY A;  4MH2 A;  5HQP A;  3IA1 A;  2VL2 A;  3TKR A;  5J41 A;  4J2F A;  2YNX A;  2QGV A;  2F51 A;  3G7J A;  3Q19 A;  4AGS A;  1DE1 A;  1TRU A;  2C1Y A;  2GVP A;  11GS A;  3IPZ A;  5J5N A;  4H86 A;  2JSZ A;  1QQ2 A;  3BD2 A;  4P3Y B;  2K8V A;  3OR5 A;  3G7Y A;  1ZL9 A;  3KJY A;  3H93 A;  2NBS A;  3ZML A;  2OE3 A;  4LL1 B;  3N5O A;  5HR3 A;  2LRT A;  3ISO A;  4MAB A;  1N8J A;  2JSY A;  4PGT A;  2NVL A;  4IJ3 A;  1U87 A;  4NWY A;  5ABR A;  3LEF A;  2IWT A;  3KD0 A;  1GTB A;  2PBJ A;  4RI6 A;  3ZRD A;  1U3I A;  1WP0 A;  4GCI A;  3H1N A;  2V41 A;  6GSW A;  1FB0 A;  1XIY A;  1KNG A;  4FO5 A;  3TOU A;  2GSS A;  1VF4 A;  2NDO A;  3RPN A;  2H0H A;  3VPQ A;  5DVB A;  5DJL A;  2IIY A;  4ZIJ A;  3TDG A;  1GNE A;  2FY6 A;  1XW9 A;  4N11 A;  1YF0 A;  1PX7 A;  3FZ4 A;  2H73 A;  3GIX A;  2TRX A;  1ERU A;  4HZ4 A;  1USB A;  2I4A A;  3D5J A;  2WGR A;  1Y6E A;  3EVI A;  3FKF A;  4MJA A;  4KND A;  1GP1 A;  3HKR A;  3TKS A;  1WOU A;  1X9M B;  3RHC A;  4TOP A;  4I8B A;  1TJD A;  1RK4 A;  4EKZ A;  5A4V A;  1CQH A;  3I9V 2;  3BCI A;  4ZBD A;  2LQO A;  3O76 A;  3RPP A;  4XRA A;  4K1F A;  3F0I A;  3TKS E;  2OJL A;  1N2A A;  2ALB A;  1GRX A;  1YKA A;  1R4W A;  5JCW A;  5IO2 A;  1GTI A;  5HR0 A;  2C8U A;  3VPT A;  2HSY A;  4FYB A;  1GSY A;  1A23 A;  1X0R A;  2M72 A;  3FK8 A;  4K0G A;  5JWO B;  3HYP A;  3QAV A;  4EF0 A;  1GSF A;  1VF2 A;  4OFN A;  5F8B A;  3QD9 A;  5HR2 A;  3HZ4 A;  4D73 B;  2RUE A;  1BAY A;  5DCH A;  2JAC A;  4I5Q A;  2H71 A;  3QR6 A;  4GST A;  4Q5F A;  1PL2 A;  19GS A;  1QXH A;  5IM9 A;  2L57 A;  3WT2 A;  1ST9 A;  1YZX A;  1K3Y A;  3HJM A;  1SK2 A;  2GZZ A;  3RDW A;  2VAF A;  3GX8 A;  2IME A;  1ZYE A;  2VLU A;  4BVY A;  4O92 A;  5ECP B;  4JZQ A;  1I9D A;  4KE3 A;  4QQ7 A;  2PMT A;  2BTO T;  2DSA A;  3KGK A;  1J0F A;  1Y25 A;  5GST A;  5D9X A;  1EOH A;  1VRS D;  1B8X A;  4K9Z A;  4LLR A;  1EV9 A;  3TKS C;  5LCZ A;  3IR4 A;  3QPM A;  1VF3 A;  2GDR A;  1TKD B;  6GSV A;  4WET A;  1XWG A;  4IKH A;  1SJZ A;  4JRR A;  5CRE A;  4GTU A;  4PNG A;  17GS A;  2GZY A;  1UA5 A;  4EDY A;  2FA8 A;  4MF7 A;  1T4Z A;  5LNK e;  2GLR A;  4NV5 A;  2CVB A;  2VD1 A;  1FVK A;  2XHF A;  4KAE A;  4N0Z A;  5LD0 A;  1T00 A;  2FWE A;  2J9H A;  3D21 A;  2E0Q A;  3APS A;  4PQH A;  2L4C A;  3DML A;  3QCP A;  2ZNM A;  4ACS A;  1AQW A;  1OAZ A;  4N10 A;  5ECK B;  2R2J A;  2VCQ A;  1XWA A;  2YN1 A;  1TI1 A;  4DSR A;  5F07 A;  2RUF A;  1XFL A;  2VUP A;  4IVF A;  5IOX A;  2M80 A;  3TKP A;  2VO4 A;  3GKK A;  5B8B A;  1U3A A;  2X8G A;  1K0A A;  2QC7 A;  2XPD A;  2GGT A;  1M99 A;  2V6O A;  3IK7 A;  3KTB A;  3HHV A;  4ECJ A;  1OC9 A;  4OCE A;  3D4M A;  4KDX A;  2CZ3 A;  1QUW A;  3IBH A;  2XBI A;  3IHQ A;  4GF0 A;  4K6X A;  1T7P B;  1J08 A;  2FWG A;  2VD0 A;  2ZCT A;  2TRC P;  1SL1 B;  2L6C A;  6GST A;  5HFG A;  2B5Y A;  1A2L A;  3QOU A;  1PQN A;  4BL7 A;  1O73 A;  1AW9 A;  3M8N A;  3Q18 A;  2K9F A;  3V1W A;  2A2S A;  1ZOF A;  5CRH A;  3ERG A;  3TKQ A;  1A24 A;  3WGD A;  4K7N A;  2HRN A;  3A2X A;  5AIX A;  1JZD A;  1TRS A;  3GH9 A;  3GRX A;  1ERW A;  1B9X C;  4L5L A;  1EV4 A;  1X9S B;  2H6X A;  2M46 A;  1XWK A;  3ZVJ A;  2L5L A;  3ZFB A;  4KDY A;  1EGR A;  5ID2 A;  3K8N A;  2WJU A;  2H6Z A;  2H1D A;  2CQ9 A;  3VFI A;  4TRX A;  1VGL A;  1RW1 A;  2YAN A;  2FD3 A;  3KTL A;  2OA7 A;  2H19 A;  4IS0 A;  1O6J A;  3HJO A;  1QMV A;  5F0G A;  2B7J A;  3EUR A;  3IRA A;  3GSS A;  3L9U A;  1A0R P;  1JZR A;  1K3O A;  3F3R A;  2H6Y A;  2B5X A;  2HFD A;  2I1U A;  4YH2 A;  1ERT A;  2F8F A;  3CSJ A;  1E6B A;  1PKW A;  3IXR A;  1V98 A;  5C04 A;  5JCG A;  5B6N A;  2IFQ B;  1ERV A;  3GUR A;  4FYC A;  4IP6 A;  2F9S A;  2YPM A;  1XVW A;  5AIS A;  5IMZ A;  4MMM A;  1XZO A;  3LG6 A;  4XCS A;  2JU5 A;  1Z3E A;  2OAC A;  1SKW B;  4XS1 A;  3GA4 A;  4OO4 A;  1EOG A;  3A2V A;  3DIE A;  1M9B A;  4POL A;  1Z6N A;  2C4J A;  3S9F A;  4KUN A;  5DBQ A;  1PA3 A;  4X43 A;  2VLT A;  3RHB A;  4MJC A;  2OBI A;  3M3M A;  2P5Q A;  3VK9 A;  2N5F A;  1PX6 A;  1ABA A;  5G5E A;  2LUS A;  2LJR A;  3P8W A;  4G9H A;  4J56 E;  3VI7 A;  3IDV A;  2VCT A;  2LRN A;  1B9Y C;  2H74 A;  4EC0 A;  3FZA A;  2FWH A;  2WRT A;  1EEJ A;  2C0E A;  5D93 A;  5IO0 A;  3ERW A;  4OMV A;  5ECR B;  3HVS A;  4RI7 A;  2GQK A;  1JLV A;  4ZL9 A;  1OC3 A;  2C0D A;  2OE0 A;  5IPH A;  4WR5 A;  2J23 A;  1WWJ A;  4G10 A;  1URM A;  1V57 A;  3L0H A;  1ML6 A;  3ZIJ A;  4F0C A;  1YY7 A;  5IMV A;  2GQL A;  3GV1 A;  3JCM L;  3KP8 A;  4LL4 B;  4JED A;  4X0X A;  2PER A;  4HDE A;  1LBK A;  2FHE A;  1F2E A;  1OKD A;  1Z7P A;  1V2A A;  1JFU A;  4CDO A;  3CRU A;  1DSB A;  1IYH A;  3DXB A;  5ID2 B;  4ZB6 A;  3EWL A;  1B4P A;  3BOA A;  3GH6 A;  2LST A;  5FHI A;  1PSQ A;  3CSI A;  5AIV A;  2IMI A;  5A4W A;  5E4W A;  3KM6 A;  5KN3 A;  4POM A;  3F4S A;  3CMI A;  6GSU A;  2PWJ A;  4OWY A;  3ZFL A;  1O7U A;  2H66 A;  3NIV A;  4HU9 A;  2DJ1 A;  4D73 A;  4HJ2 A;  3A5W A;  3MSZ A;  3Q74 A;  4V2M A;  2I81 A;  3TJG A;  3GL3 A;  4PQI A;  1FAA A;  3IV4 A;  3KMO A;  4MCU A;  5G1K A;  3W8J A;  4L8E A;  3VWW A;  3TOT A;  2B6M A;  3GST A;  1ACV A;  2AB6 A;  5CYY A;  4DSS B;  2WB9 A;  2H8L A;  4ULX A;  4OCF A;  4F03 A;  4ZIL A;  3C73 A;  2VCV A;  3DRN A;  5GSS A;  5KEJ A;  5D96 A;  1F37 A;  1XW6 A;  4MPF A;  2OBK A;  2XPE A;  1A8L A;  3G7I A;  5C00 A;  4ZB8 A;  1K0B A;  2IMD A;  3L9V A;  3ZRE A;  2HI7 A;  2FWF A;  3C8E A;  4HU7 A;  1AXD A;  1ON4 A;  3G9B A;  1S3C A;  1FG4 A;  3EYT A;  3FEU A;  4XTS A;  4BA7 A;  4XRD A;  5H5R A;  4KH7 A;  1GTA A;  2C0F A;  1OKT A;  1U6T A;  5GAP D;  1TTZ A;  1HNA A;  3QDN A;  1T3B A;  4F0B A;  2O89 A;  5JWQ B;  4IQA A;  1O85 A;  2YJH A;  1QK8 A;  3HZ8 A;  1HNB A;  4AJ7 A;  5IOW A;  4RQX A;  4I2U A;  2VL2 C;  3D4T A;  4KDU A;  3U6V A;  3F4T A;  5DQS A;  4ZL8 A;  4AJ8 A;  3TB2 A;  1FVJ A;  1A0F A;  3GHA A;  1K0N A;  4ZXG A;  5ECI B;  3IK9 A;  2CVK A;  2KLX A;  2YZH A;  4IBP A;  4HJM A;  3DEX A;  2DMM A;  4WBR D;  2BMX A;  4EO3 A;  3M0F A;  4TR1 B;  3LYK A;  3UAR A;  4KX4 A;  5EPF A;  3O3T A;  3AY8 A;  4NHW A;  1GSQ A;  4N30 A;  1AC1 A;  4IP1 A;  2GSQ A;  4IEL A;  1TK5 B;  1R5A A;  3KEB A;  1F3B A;  1K0O A;  2V32 A;  2LQQ A;  2HNL A;  1H75 A;  4CW9 A;  2LTK A;  5KN2 A;  4Q5N A;  1YJ6 A;  4ID0 A;  1XVQ A;  1M2A A;  1BX9 A;  3F4R A;  1JLW A;  1AQX A;  4V2L A;  2DIY A;  4F2I A;  1AAZ A;  1YEX A;  3A2W A;  2VOC A;  1TDI A;  4RUV A;  4K0N A;  1PN9 A;  1BQ7 A;  2DJ2 A;  3ZVJ D;  1GSE A;  3M1G A;  3I69 A;  3W6G A;  4WF4 A;  4PUF C;  3LOR A;  2QKE A;  4EE0 A;  2H75 A;  2A2R A;  5CAX A;  2P5R A;  3LSZ A;  3UL3 A;  3UJ1 A;  1ZCP A;  1M0U A;  5J9C A;  5A4U A;  1GLQ A;  3F6F A;  1XXU A;  1V58 A;  2WZ9 A;  5DDL A;  1TOF A;  1HQO A;  2IFQ A;  2GT6 A;  2WDU A;  2HRF A;  4BVX A;  4KW6 A;  5CRG A; 
#chains in the Genus database with same CATH topology
 1OE7 A;  3GX0 A;  1HYU A;  3F3Q A;  4AF2 A;  3D22 A;  3DGQ A;  3GMF A;  4KA0 A;  4V1A p;  4BWS A;  2GTU A;  3D6I A;  4BWQ A;  1E2Y A;  4PUR A;  3LXZ A;  3DVX A;  2FUG 2;  2R0G A;  3DKS A;  4WEY A;  1MEK A;  1S3A A;  2RII A;  5IQY A;  5G5F A;  2A4V A;  3EC3 A;  1PRX A;  3GYK A;  5DCG A;  4XHM A;  2VL9 A;  2B1K A;  4K7I A;  4ILF A;  2GT5 A;  2G2Q A;  10GS A;  1SL2 B;  2H30 A;  2E2M A;  3HDC A;  2YJ7 A;  4TR3 A;  1BYE A;  1EP7 A;  4Z7X A;  3GN3 A;  5F05 A;  3LYP A;  3UBL A;  4QL7 A;  5GZZ B;  2H01 A;  3D0Z A;  5ECS A;  2F3M A;  1SYX A;  2NPB A;  1M7T A;  4JR4 A;  2PVO C;  1EP8 A;  4FH8 A;  1JZW A;  4ZBA A;  2DML A;  3US3 A;  4K2D A;  4TXV A;  3GKX A;  4PNF A;  20GS A;  1R26 A;  2CV4 A;  1K0C A;  4LA1 A;  5A5K A;  1MDK A;  3GTU B;  1O8X A;  1SJ6 A;  3I43 A;  4YQV A;  4JBB A;  9GSS A;  2YWM A;  1TP9 A;  2XBQ A;  2PUK C;  2LRC A;  3H4K A;  5HFK A;  3EE2 A;  4TN8 A;  3ED3 A;  1X9W B;  3E9J B;  2REM A;  1TRV A;  1I5G A;  4IGJ A;  3MWH A;  5D9V A;  3WYW A;  2WUL A;  2OE1 A;  5G30 A;  2D2Z A;  3IHG A;  3P2A A;  1G7O A;  5IMD A;  3FZ5 A;  4QL9 A;  4K7O A;  1TK8 B;  2FGX A;  4EIQ A;  2L5O A;  4TXO B;  4AJ6 A;  1GLP A;  2X8H A;  3VI5 A;  2R37 A;  1TW9 A;  1G7E A;  1TI3 A;  1VF1 A;  4OFM A;  3TRQ A;  1O81 A;  4EDZ A;  3ZLP A;  3C1R A;  4PX1 A;  4NHZ A;  2PU9 C;  2JZS A;  1QGV A;  2KOK A;  4DSS A;  4XS6 A;  2LJK A;  2E7P A;  1TU8 A;  1C72 A;  4ZB9 A;  3UVT A;  3ZIT A;  2KP2 A;  1S3R A;  1WMJ A;  1F3A A;  1M2D A;  2HYX A;  1BJX A;  1DBY A;  2CA8 A;  5DAK B;  3J7Y b;  4MJB A;  1SD9 A;  1B48 A;  1Z5Y E;  5AN1 A;  1A2M A;  1W89 A;  2B1L A;  4LMW A;  3NZN A;  4MF6 A;  2YV9 A;  2N5A A;  4HQS A;  3IAS 2;  3ERF A;  1FO5 A;  1THO A;  3KH7 A;  4ZBB A;  2P0G A;  2GST A;  4G19 A;  4NMU A;  3CBU A;  5CP1 A;  3C1S A;  1ZYQ B;  4Q5R A;  5DJM A;  3MDK A;  1YQ1 A;  1THX A;  1SU9 A;  4MH3 A;  1FOV A;  1SJI A;  1GTU A;  2VM1 A;  4WKW A;  3A3T A;  4L0U A;  3BBY A;  4ML1 A;  3ZZX A;  4RQR A;  2CZ2 A;  3ZMK A;  2ZUP A;  4HQZ A;  2YWN A;  2KHP A;  4LMV A;  5B6M A;  4HZ2 A;  5L71 A;  3CTF A;  1AIU A;  3VUR A;  3N9J A;  2AJQ B;  2C0G A;  1ZGN A;  5H5S A;  3VWV A;  4CHS A;  5EL8 A;  2DLX A;  3CSH A;  4I2T A;  2Z9S A;  2ON7 A;  4TR0 A;  4ML6 A;  1FOH A;  3ZTL A;  2MZC A;  4G2E A;  1R5P A;  2HLS A;  3C71 A;  4K5S A;  1BG5 A;  2HE3 A;  4MK3 A;  1TK0 B;  3PGT A;  1MDJ A;  1IYI A;  4ISD A;  3RBT A;  5CO3 A;  3LQ7 A;  4TR1 A;  1GUM A;  5G2Z A;  2PVQ A;  2IMF A;  2YZU A;  2N5B A;  4O7H A;  5AGY A;  2R3X A;  2KP1 A;  3LGC A;  4NXI A;  4MA9 A;  1KTE A;  2VM2 A;  2X4A A;  1LJR A;  3PIN A;  5ENU A;  3KCM A;  2RM6 A;  2MMA A;  5GAN D;  3APO A;  5IMC A;  4YQM A;  2O8V B;  1XBS A;  1EEM A;  2CX3 A;  2V1M A;  3HY2 A;  5B7C A;  3MNG A;  4NV2 A;  5JWR B;  3MAK A;  1U88 A;  5DQY A;  5IPG A;  1UN2 A;  5DAL B;  2E2G A;  3C7M A;  3TUE A;  1NHY A;  3UVH A;  4ICY A;  3EIN A;  4V1A g;  2R4V A;  2EIR A;  1PFO A;  5IIZ A;  2H70 A;  3F6D A;  1X5C A;  5KOX A;  3KIJ A;  1NHO A;  4KGI A;  3UAP A;  2VCZ A;  2YOI A;  4OO5 A;  2IMK A;  3VWX A;  1HNC A;  2YWO A;  2KUC A;  6GSX A;  2OAD A;  7GSS A;  2EIQ A;  1PMT A;  4O5Q A;  5ELG A;  2XC2 A;  3TJK A;  3TCO A;  4YKG A;  8GSS A;  2HZE B;  5H5Q A;  3DWV A;  2B3S A;  4JR6 A;  3RAZ A;  3FY7 A;  1UVZ A;  3FHK A;  6GSS A;  4ECC A;  5G31 A;  1WE0 A;  3HA9 A;  2ES7 A;  1TRW A;  3KH9 A;  3FYG A;  4Z2R A;  2AV4 A;  1ZYN A;  2HRK A;  1GH2 A;  3I6A A;  5G1L A;  1T4Y A;  1A8Y A;  1WRY A;  1Z9H A;  2BJX A;  3R2Q A;  3F63 A;  3IE3 A;  4BPY A;  3P90 A;  5INY A;  2MBS A;  2IJY A;  1Z7R A;  2DJ0 A;  3DVW A;  1SKR B;  3TRP A;  3PR8 A;  2L6D A;  4FYU A;  1NW2 A;  2I9H A;  4KSM A;  1G0T A;  2H1A A;  1UC7 A;  5EY6 A;  2MMN A;  3FR6 A;  2L4Q A;  3F8U A;  2FNO A;  1ILO A;  1X5E A;  2EIO A;  4F82 A;  2FCH A;  5FT3 A;  2JL4 A;  1MD3 A;  4YQU A;  2VCX A;  3O6T A;  1KBN A;  3TRX A;  2C80 A;  3NOF A;  4FIW A;  4GRF A;  5COH A;  3E0U A;  2HT9 A;  4OFT A;  4EUY A;  3BCK A;  5CRD A;  1J9B A;  3KP9 A;  4MF5 A;  1Q98 A;  2O7K A;  4POK A;  3TGZ A;  3IOS A;  4JE1 A;  2LV3 A;  4HOJ A;  1FB6 A;  2HXK A;  4IJI A;  1XOA A;  3GKM A;  3WT1 A;  3ZL5 A;  1XOB A;  3UEM A;  1AUC A;  2C3N A;  2DKH A;  3FW2 A;  4A5P A;  5ECH B;  3H79 A;  5J9B A;  2VLV A;  4XS4 B;  2AAW A;  4F9Z A;  3TJB A;  1M9A A;  2VCW A;  3HXS A;  2K18 A;  3QFA C;  1M2B A;  1WJK A;  3ME8 A;  2H1B A;  3DD3 A;  3M9K A;  2MBT A;  4IW9 A;  4EIP A;  3CYN A;  3GTU A;  4MPG A;  4O5R A;  4PXO A;  2GS3 A;  1MDI A;  5D9T A;  2L59 A;  2VIM A;  3IC4 A;  2DJK A;  4I6X A;  4GQF A;  3KMN A;  2WFC A;  4GSS A;  2CAQ A;  4GXZ A;  2RLI A;  3L4N A;  4TKY A;  4X1U A;  2CAI A;  1TU7 A;  1SK0 A;  1OE8 A;  4WF5 A;  2K6V A;  4YAP A;  4CY8 A;  3QFB C;  1SEN A;  4TXO A;  3KZQ A;  3E3E A;  3HD5 A;  12GS A;  5ECO B;  2H0I A;  2FA4 A;  4ECI A;  1GNW A;  3FMW A;  5B8A A;  1K0D A;  2H72 A;  2DJ3 A;  18GS A;  1F9M A;  2AUV A;  2PGT A;  1WIK A;  2AYT A;  4OD7 A;  2CX4 A;  4HUA A;  1YKC A;  1DE2 A;  2R6K A;  2UZ8 A;  2V6K A;  3GNJ A;  1ZMA A;  2R5G A;  3FR3 A;  3CQF A;  14GS A;  2DBC A;  3LXT A;  4J57 E;  1XCC A;  1PKZ A;  5JCU A;  5DAK A;  3BJ5 A;  1GSU A;  1T1V A;  1XPV A;  3GKN A;  1Z6M A;  1PL1 A;  1YEP A;  4HEA 2;  4Q5Q A;  2O85 A;  1V9W A;  1LU4 A;  3W8S A;  4G0L A;  1A2J A;  4IN0 A;  3ZYW A;  3L78 A;  3ME7 A;  3HVV A;  3WGE A;  2MYG A;  2IL3 A;  3Q6O A;  2JZT A;  1NSW A;  2K8S A;  2PN8 A;  1EWX A;  5KN1 A;  2CT6 A;  2PPT A;  5KN0 A;  3WD6 A;  1GSD A;  5ECN B;  3HCZ A;  4KSO A;  3F9U A;  4O32 A;  5ECM B;  4FQU A;  5EVO A;  3EU3 A;  4MZB A;  3FRC A;  1O8W A;  1SK1 A;  4GLT A;  3KXO A;  16GS A;  4NAX A;  4PQ1 A;  1AQV A;  4YAV A;  5ECQ B;  1JZO A;  3HVX A;  3QAW A;  2LS5 A;  4ZL7 A;  4EXJ A;  3QMX A;  1NM3 A;  3GFK A;  3LWA A;  2B7K A;  4POB A;  2I3Y A;  1DUG A;  2VL3 A;  1X5D A;  1OYJ A;  3A5I A;  4MP4 A;  2O87 A;  4NPB A;  2G0F A;  1XW5 A;  4L0W A;  3LJR A;  1QFN A;  5BMU A;  2P31 A;  2GQM A;  2H0G A;  4PUA A;  3SWL A;  1G6W A;  2F8A A;  4DVC A;  3VLN A;  1PGT A;  5HFI A;  2EC4 A;  4EVM A;  1EZK A;  1G6Y A;  22GS A;  4BVY B;  1MTC A;  1H4O A;  2YWI A;  5F06 A;  4DSQ A;  1KEB A;  3CRT A;  5DAL A;  5HR1 A;  1GWC A;  5D9W A;  2ON5 A;  5D8I A;  2DJJ A;  2CVD A;  5CNW A;  1GL8 A;  2WCI A;  13GS A;  4KF9 A;  4KCE A;  1XWB A;  3HJP A;  2LNS A;  4IQ1 A;  2YV7 A;  3TJJ A;  1V40 A;  2NTO A;  5IMA A;  2AHE A;  4V2N A;  4HI7 A;  3GL5 A;  2IPA A;  2QSI A;  2MMO A;  2X64 A;  2HZE A;  4HS1 A;  1YF1 A;  5IMF A;  4Z2U A;  3UIW A;  2DIZ A;  5ELA A;  1S3D A;  3QAG A;  3LFL A;  3J7Y k;  2JZR A;  4BIK A;  1B4Q A;  2C3Q A;  3WGX A;  3DYR A;  4N0V A;  2B5E A;  1EGO A;  1RQM A;  2FLS A;  3R3E A;  2V2G A;  3FZ9 A;  5D73 A;  4WR4 A;  1R7H A;  3GUS A;  1XG8 A;  4I97 A;  4MZC A;  3U5R E;  2LNT A;  4TR4 A;  4K5R A;  1XWC A;  1GUH A;  3H8Q A;  4PTS A;  2MMZ A;  1SYR A;  1JHB A;  1ZYP A;  4DEJ A;  1GUK A;  2TIR A;  2YCD A;  1OC9 B;  4WBJ A;  2C3T A;  4GQC A;  2X8C A;  1WPI A;  2H76 A;  4MDC A;  5J3R A;  3TJF A;  2WS2 A;  4ECB A;  1F6M C;  2LKU A;  2YP6 A;  2OKA A;  3HVN A;  3M9J A;  4TVE A;  4L5O A;  6GSY A;  3UMA A;  3P7X A;  1K0M A;  2RM5 A;  3ZIV A;  2HSH A;  1OVN A;  2IN3 A;  1CQG A;  2LJA A;  1SD8 A;  1SKS B;  1GSS A;  3APQ A;  2X99 A;  5FWG A;  3FR9 A;  4MJE A;  1MD4 A;  3IAM 2;  3VWU A;  4BL7 B;  4XIH A;  5J4U A;  1TXX A;  1YDK A;  1GUL A;  1T8E B;  3UOM A;  4XS4 A;  1FHE A;  2H1G A;  4K8M A;  4YKF A;  3L9S A;  1BED A;  2GZP A;  1Q4J A;  2JAD A;  3SBC A;  3PH9 A;  2GSR A;  1FW1 A;  1M3I A;  2LEG A;  1SL0 B;  3PPU A;  5CRW A;  4KCA A;  4E8H A;  3CTG A;  3EU4 A;  1HD2 A;  1ZZY A;  4JU5 A;  3UBK A;  4GSN A;  4GWR A;  3EMP A;  4IHU A;  5E59 A;  4HSC X;  4EL1 A;  1W4V A;  5ECL B;  1OC8 A;  2HZF A;  1K3L A;  4TW5 A;  4WXT A;  3CXG A;  1PD2 1;  4MZW A;  4E8E A;  3EMX A;  4KB3 A;  2DC5 A;  4MLY A;  4MH2 A;  5HQP A;  3IA1 A;  2VL2 A;  4G0I A;  3TKR A;  5J41 A;  4J2F A;  2YNX A;  2QGV A;  2F51 A;  3G7J A;  3Q19 A;  4AGS A;  1DE1 A;  1TRU A;  2C1Y A;  2GVP A;  11GS A;  3IPZ A;  5J5N A;  4H86 A;  2JSZ A;  1QQ2 A;  3BD2 A;  4P3Y B;  2K8V A;  3OR5 A;  3G7Y A;  1ZL9 A;  3KJY A;  3H93 A;  2NBS A;  3ZML A;  4USS A;  2OE3 A;  4LL1 B;  3N5O A;  5HR3 A;  2LRT A;  3ISO A;  4MAB A;  1N8J A;  2JSY A;  4PGT A;  2NVL A;  3MYD A;  4IJ3 A;  1U87 A;  4NWY A;  5ABR A;  3LEF A;  2IWT A;  3KD0 A;  1GTB A;  2PBJ A;  4RI6 A;  3ZRD A;  1U3I A;  1WP0 A;  4GCI A;  3H1N A;  2V41 A;  6GSW A;  1FB0 A;  1M3J A;  1KNG A;  1XIY A;  4FO5 A;  3TOU A;  2GSS A;  1VF4 A;  2NDO A;  3RPN A;  2H0H A;  3VPQ A;  5DVB A;  5DJL A;  2IIY A;  4ZIJ A;  3TDG A;  1GNE A;  2FY6 A;  1XW9 A;  4N11 A;  1YF0 A;  1PX7 A;  3FZ4 A;  2H73 A;  3GIX A;  2TRX A;  1ERU A;  4HZ4 A;  1USB A;  2I4A A;  3D5J A;  2WGR A;  5BRT A;  1Y6E A;  3EVI A;  3FKF A;  4O5U A;  4MJA A;  4KND A;  1GP1 A;  3HKR A;  3TKS A;  1WOU A;  1X9M B;  2DKI A;  3RHC A;  4TOP A;  4I8B A;  1TJD A;  1RK4 A;  4EKZ A;  5A4V A;  1CQH A;  3I9V 2;  3BCI A;  4ZBD A;  2LQO A;  3O76 A;  3RPP A;  4XRA A;  4K1F A;  3F0I A;  3TKS E;  2OJL A;  1N2A A;  2ALB A;  1GRX A;  1YKA A;  1R4W A;  5JCW A;  5IO2 A;  1GTI A;  5HR0 A;  2C8U A;  3VPT A;  2HSY A;  4FYB A;  1GSY A;  2X49 A;  1A23 A;  1X0R A;  4K2X A;  2M72 A;  3FK8 A;  4K0G A;  5JWO B;  3HYP A;  3QAV A;  4EF0 A;  1GSF A;  1VF2 A;  4OFN A;  5F8B A;  3QD9 A;  5HR2 A;  3HZ4 A;  4D73 B;  2RUE A;  1BAY A;  5DCH A;  2JAC A;  4I5Q A;  2H71 A;  3QR6 A;  4GST A;  4Q5F A;  1PL2 A;  19GS A;  1QXH A;  5IM9 A;  2L57 A;  3WT2 A;  1ST9 A;  1YZX A;  1K3Y A;  3HJM A;  1SK2 A;  2GZZ A;  3RDW A;  2VAF A;  3GX8 A;  2IME A;  1ZYE A;  2VLU A;  4BVY A;  4O92 A;  5ECP B;  4JZQ A;  1I9D A;  4KE3 A;  4QQ7 A;  2PMT A;  2BTO T;  2DSA A;  3KGK A;  1J0F A;  3MIX A;  1Y25 A;  5GST A;  5D9X A;  1EOH A;  1VRS D;  1B8X A;  4K9Z A;  4LLR A;  1EV9 A;  3TKS C;  5LCZ A;  3IR4 A;  3QPM A;  1VF3 A;  2GDR A;  1TKD B;  6GSV A;  4WET A;  1XWG A;  4IKH A;  1SJZ A;  4JRR A;  5CRE A;  4GTU A;  4PNG A;  17GS A;  2GZY A;  1UA5 A;  4EDY A;  2FA8 A;  4MF7 A;  1T4Z A;  5LNK e;  2GLR A;  4NV5 A;  2CVB A;  2VD1 A;  1FVK A;  2XHF A;  4KAE A;  4N0Z A;  5LD0 A;  1T00 A;  2FWE A;  2J9H A;  3D21 A;  2E0Q A;  3APS A;  4PQH A;  2L4C A;  3DML A;  3QCP A;  2ZNM A;  4ACS A;  1AQW A;  1OAZ A;  4N10 A;  5ECK B;  2R2J A;  2VCQ A;  1XWA A;  2YN1 A;  1TI1 A;  4DSR A;  5F07 A;  2R0C A;  2RUF A;  1XFL A;  2VUP A;  4IVF A;  5IOX A;  2M80 A;  3TKP A;  2VO4 A;  3GKK A;  5B8B A;  1U3A A;  2X8G A;  1K0A A;  2QC7 A;  2XPD A;  3LW9 A;  2GGT A;  1M99 A;  2V6O A;  3IK7 A;  3KTB A;  3HHV A;  4ECJ A;  1OC9 A;  4OCE A;  3D4M A;  4KDX A;  2CZ3 A;  1QUW A;  3IBH A;  2XBI A;  3IHQ A;  4GF0 A;  4K6X A;  1T7P B;  1J08 A;  2FWG A;  2VD0 A;  2ZCT A;  2TRC P;  1SL1 B;  2L6C A;  6GST A;  5HFG A;  2B5Y A;  1A2L A;  3QOU A;  1PQN A;  4BL7 A;  1O73 A;  1AW9 A;  3M8N A;  3Q18 A;  2K9F A;  3V1W A;  2A2S A;  1ZOF A;  5CRH A;  3ERG A;  3TKQ A;  1A24 A;  3WGD A;  4K7N A;  2HRN A;  3A2X A;  5AIX A;  1JZD A;  1TRS A;  3GH9 A;  3GRX A;  1ERW A;  1B9X C;  4L5L A;  1EV4 A;  1X9S B;  2H6X A;  2M46 A;  1XWK A;  3ZVJ A;  2L5L A;  3ZFB A;  4KDY A;  1EGR A;  5ID2 A;  3K8N A;  2WJU A;  2H6Z A;  2H1D A;  2CQ9 A;  3VFI A;  4TRX A;  1VGL A;  1RW1 A;  2YAN A;  2FD3 A;  3KTL A;  2OA7 A;  2H19 A;  4IS0 A;  1O6J A;  3HJO A;  1QMV A;  5F0G A;  2B7J A;  3EUR A;  3IRA A;  3GSS A;  3L9U A;  1A0R P;  1JZR A;  1K3O A;  3F3R A;  2H6Y A;  2B5X A;  2HFD A;  2I1U A;  4YH2 A;  1ERT A;  2F8F A;  3CSJ A;  1E6B A;  1PKW A;  3IXR A;  1V98 A;  5C04 A;  5JCG A;  5B6N A;  2IFQ B;  1ERV A;  3GUR A;  4FYC A;  4IP6 A;  4BVX B;  2F9S A;  2YPM A;  1XVW A;  5AIS A;  5IMZ A;  4MMM A;  1XZO A;  3LG6 A;  4XCS A;  2JU5 A;  1Z3E A;  2OAC A;  1SKW B;  4XS1 A;  3GA4 A;  4OO4 A;  1EOG A;  3A2V A;  3DIE A;  1M9B A;  4POL A;  1Z6N A;  2C4J A;  3S9F A;  4KUN A;  5DBQ A;  1PA3 A;  4X43 A;  2VLT A;  3RHB A;  4MJC A;  2OBI A;  3M3M A;  2P5Q A;  3VK9 A;  2N5F A;  1PX6 A;  1ABA A;  5G5E A;  2LUS A;  2LJR A;  3P8W A;  4G9H A;  4J56 E;  3VI7 A;  3IDV A;  2VCT A;  2LRN A;  1B9Y C;  2H74 A;  4Z2T A;  4EC0 A;  3FZA A;  2FWH A;  2WRT A;  1EEJ A;  2C0E A;  5D93 A;  5IO0 A;  3ERW A;  4OMV A;  5ECR B;  3HVS A;  4RI7 A;  2GQK A;  1JLV A;  4ZL9 A;  1OC3 A;  2C0D A;  2OE0 A;  5IPH A;  4WR5 A;  2J23 A;  1WWJ A;  4G10 A;  4X4J A;  1URM A;  1V57 A;  3L0H A;  1ML6 A;  3ZIJ A;  4F0C A;  1YY7 A;  5IMV A;  2GQL A;  3GV1 A;  3JCM L;  3KP8 A;  4LL4 B;  4JED A;  4X0X A;  2PER A;  4HDE A;  1LBK A;  2FHE A;  1F2E A;  1OKD A;  2QA2 A;  5KOW A;  1Z7P A;  1V2A A;  1JFU A;  4CDO A;  3CRU A;  1DSB A;  1IYH A;  3DXB A;  5ID2 B;  4ZB6 A;  3EWL A;  1B4P A;  3BOA A;  3GH6 A;  2LST A;  5FHI A;  1PSQ A;  3CSI A;  2A2P A;  5AIV A;  2IMI A;  5A4W A;  5E4W A;  3KM6 A;  5KN3 A;  4POM A;  2A4H A;  3F4S A;  3CMI A;  6GSU A;  2PWJ A;  4OWY A;  3ZFL A;  1O7U A;  2H66 A;  3NIV A;  4HU9 A;  2DJ1 A;  4D73 A;  4HJ2 A;  3A5W A;  3MSZ A;  3Q74 A;  4V2M A;  2I81 A;  3TJG A;  3GL3 A;  2HRA A;  4PQI A;  1FAA A;  3IV4 A;  3KMO A;  4MCU A;  5G1K A;  3W8J A;  3EPT A;  4L8E A;  3VWW A;  3TOT A;  2B6M A;  3GST A;  1ACV A;  2AB6 A;  5CYY A;  4DSS B;  2R0P A;  2WB9 A;  2H8L A;  4ULX A;  4CY6 A;  4OCF A;  4F03 A;  4ZIL A;  3C73 A;  2VCV A;  3DRN A;  5GSS A;  5KEJ A;  5D96 A;  2QA1 A;  1F37 A;  1XW6 A;  4MPF A;  2OBK A;  2XPE A;  1A8L A;  3G7I A;  5C00 A;  4ZB8 A;  1K0B A;  2IMD A;  3L9V A;  3ZRE A;  2HI7 A;  2FWF A;  3C8E A;  4HU7 A;  1AXD A;  1ON4 A;  3G9B A;  1S3C A;  1FG4 A;  3EYT A;  3FEU A;  4XTS A;  4BA7 A;  4XRD A;  5H5R A;  4KH7 A;  1GTA A;  2C0F A;  1OKT A;  1U6T A;  5GAP D;  1TTZ A;  1HNA A;  3QDN A;  1T3B A;  4F0B A;  2O89 A;  5JWQ B;  4IQA A;  1O85 A;  2YJH A;  1QK8 A;  3HZ8 A;  1HNB A;  4AJ7 A;  5IOW A;  4RQX A;  4I2U A;  2VL2 C;  3D4T A;  4KDU A;  1PN0 A;  3U6V A;  3F4T A;  5DQS A;  4ZL8 A;  4AJ8 A;  3TB2 A;  1FVJ A;  1A0F A;  4MNN A;  3GHA A;  1K0N A;  4ZXG A;  5ECI B;  3IK9 A;  2CVK A;  2KLX A;  2YZH A;  4IBP A;  4HJM A;  3DEX A;  2DMM A;  4WBR D;  2BMX A;  4EO3 A;  3M0F A;  4TR1 B;  3LYK A;  3UAR A;  4KX4 A;  5EPF A;  3O3T A;  3AY8 A;  4NHW A;  1GSQ A;  4N30 A;  1AC1 A;  4IP1 A;  2GSQ A;  4IEL A;  1TK5 B;  1R5A A;  3KEB A;  1F3B A;  1K0O A;  2V32 A;  2LQQ A;  2HNL A;  1H75 A;  4CW9 A;  2LTK A;  5KN2 A;  4Q5N A;  1YJ6 A;  4ID0 A;  3IC8 A;  1XVQ A;  1M2A A;  1BX9 A;  3F4R A;  1JLW A;  1AQX A;  4V2L A;  2DIY A;  4F2I A;  1AAZ A;  2HSM A;  1YEX A;  3A2W A;  2VOC A;  1TDI A;  4RUV A;  4K0N A;  1PN9 A;  1BQ7 A;  2DJ2 A;  3ZVJ D;  1GSE A;  3M1G A;  3I69 A;  3W6G A;  4WF4 A;  4PUF C;  3LOR A;  2QKE A;  4EE0 A;  2H75 A;  2A2R A;  5CAX A;  2P5R A;  3LSZ A;  3UL3 A;  3UJ1 A;  1ZCP A;  1M0U A;  5J9C A;  5A4U A;  1GLQ A;  3F6F A;  1XXU A;  1V58 A;  2WZ9 A;  5DDL A;  1TOF A;  1HQO A;  2IFQ A;  2GT6 A;  2WDU A;  2HRF A;  4BVX A;  4G0K A;  4KW6 A;  5CRG A; 
#chains in the Genus database with same CATH homology
 1OE7 A;  3GX0 A;  1HYU A;  3F3Q A;  4AF2 A;  3D22 A;  3DGQ A;  3GMF A;  4KA0 A;  4V1A p;  4BWS A;  2GTU A;  3D6I A;  4BWQ A;  1E2Y A;  4PUR A;  3LXZ A;  3DVX A;  2FUG 2;  2R0G A;  3DKS A;  4WEY A;  1MEK A;  1S3A A;  2RII A;  5IQY A;  5G5F A;  2A4V A;  3EC3 A;  1PRX A;  3GYK A;  5DCG A;  4XHM A;  2VL9 A;  2B1K A;  4K7I A;  4ILF A;  2GT5 A;  2G2Q A;  10GS A;  1SL2 B;  2H30 A;  2E2M A;  3HDC A;  2YJ7 A;  4TR3 A;  1BYE A;  1EP7 A;  4Z7X A;  3GN3 A;  5F05 A;  3LYP A;  3UBL A;  4QL7 A;  5GZZ B;  2H01 A;  3D0Z A;  5ECS A;  2F3M A;  1SYX A;  2NPB A;  1M7T A;  4JR4 A;  2PVO C;  1EP8 A;  4FH8 A;  1JZW A;  4ZBA A;  2DML A;  3US3 A;  4K2D A;  4TXV A;  3GKX A;  4PNF A;  20GS A;  1R26 A;  2CV4 A;  1K0C A;  4LA1 A;  5A5K A;  1MDK A;  3GTU B;  1O8X A;  1SJ6 A;  3I43 A;  4YQV A;  4JBB A;  9GSS A;  2YWM A;  1TP9 A;  2XBQ A;  2PUK C;  2LRC A;  3H4K A;  5HFK A;  3EE2 A;  4TN8 A;  3ED3 A;  1X9W B;  3E9J B;  2REM A;  1TRV A;  1I5G A;  4IGJ A;  3MWH A;  5D9V A;  3WYW A;  2WUL A;  2OE1 A;  5G30 A;  2D2Z A;  3IHG A;  3P2A A;  1G7O A;  5IMD A;  3FZ5 A;  4QL9 A;  4K7O A;  1TK8 B;  2FGX A;  4EIQ A;  2L5O A;  4TXO B;  4AJ6 A;  1GLP A;  2X8H A;  3VI5 A;  2R37 A;  1TW9 A;  1G7E A;  1TI3 A;  1VF1 A;  4OFM A;  3TRQ A;  1O81 A;  4EDZ A;  3ZLP A;  3C1R A;  4PX1 A;  4NHZ A;  2PU9 C;  2JZS A;  1QGV A;  2KOK A;  4DSS A;  4XS6 A;  2LJK A;  2E7P A;  1TU8 A;  1C72 A;  4ZB9 A;  3UVT A;  3ZIT A;  2KP2 A;  1WMJ A;  1F3A A;  1M2D A;  2HYX A;  1BJX A;  1DBY A;  2CA8 A;  5DAK B;  3J7Y b;  4MJB A;  1SD9 A;  1B48 A;  1Z5Y E;  5AN1 A;  1A2M A;  1W89 A;  2B1L A;  4LMW A;  3NZN A;  4MF6 A;  2YV9 A;  2N5A A;  4HQS A;  3IAS 2;  3ERF A;  1FO5 A;  1THO A;  3KH7 A;  4ZBB A;  2P0G A;  2GST A;  4G19 A;  4NMU A;  3CBU A;  5CP1 A;  3C1S A;  1ZYQ B;  4Q5R A;  5DJM A;  3MDK A;  1YQ1 A;  1THX A;  1SU9 A;  4MH3 A;  1FOV A;  1SJI A;  1GTU A;  2VM1 A;  4WKW A;  3A3T A;  4L0U A;  3BBY A;  4ML1 A;  3ZZX A;  4RQR A;  2CZ2 A;  3ZMK A;  2ZUP A;  4HQZ A;  2YWN A;  2KHP A;  4LMV A;  5B6M A;  4HZ2 A;  5L71 A;  3CTF A;  1AIU A;  3VUR A;  3N9J A;  2AJQ B;  2C0G A;  1ZGN A;  5H5S A;  3VWV A;  4CHS A;  5EL8 A;  2DLX A;  3CSH A;  4I2T A;  2Z9S A;  2ON7 A;  4TR0 A;  4ML6 A;  1FOH A;  3ZTL A;  2MZC A;  4G2E A;  1R5P A;  2HLS A;  3C71 A;  4K5S A;  1BG5 A;  2HE3 A;  4MK3 A;  1TK0 B;  3PGT A;  1MDJ A;  1IYI A;  4ISD A;  3RBT A;  5CO3 A;  3LQ7 A;  4TR1 A;  1GUM A;  5G2Z A;  2PVQ A;  2IMF A;  2YZU A;  2N5B A;  4O7H A;  5AGY A;  2R3X A;  2KP1 A;  3LGC A;  4NXI A;  4MA9 A;  1KTE A;  2VM2 A;  2X4A A;  1LJR A;  3PIN A;  5ENU A;  3KCM A;  2RM6 A;  2MMA A;  5GAN D;  3APO A;  5IMC A;  4YQM A;  2O8V B;  1XBS A;  1EEM A;  2CX3 A;  2V1M A;  3HY2 A;  5B7C A;  3MNG A;  4NV2 A;  5JWR B;  3MAK A;  1U88 A;  5DQY A;  5IPG A;  1UN2 A;  5DAL B;  2E2G A;  3C7M A;  3TUE A;  1NHY A;  3UVH A;  4ICY A;  3EIN A;  4V1A g;  2R4V A;  2EIR A;  5IIZ A;  2H70 A;  3F6D A;  1X5C A;  5KOX A;  3KIJ A;  1NHO A;  4KGI A;  3UAP A;  2VCZ A;  2YOI A;  4OO5 A;  2IMK A;  3VWX A;  1HNC A;  2YWO A;  2KUC A;  6GSX A;  2OAD A;  7GSS A;  2EIQ A;  1PMT A;  4O5Q A;  5ELG A;  2XC2 A;  3TJK A;  3TCO A;  4YKG A;  8GSS A;  2HZE B;  5H5Q A;  3DWV A;  2B3S A;  4JR6 A;  3RAZ A;  3FY7 A;  1UVZ A;  3FHK A;  6GSS A;  4ECC A;  5G31 A;  1WE0 A;  3HA9 A;  2ES7 A;  1TRW A;  3KH9 A;  3FYG A;  4Z2R A;  2AV4 A;  1ZYN A;  2HRK A;  1GH2 A;  3I6A A;  5G1L A;  1T4Y A;  1A8Y A;  1WRY A;  1Z9H A;  2BJX A;  3R2Q A;  3F63 A;  3IE3 A;  4BPY A;  3P90 A;  5INY A;  2MBS A;  2IJY A;  1Z7R A;  2DJ0 A;  3DVW A;  1SKR B;  3TRP A;  3PR8 A;  2L6D A;  4FYU A;  1NW2 A;  2I9H A;  4KSM A;  1G0T A;  2H1A A;  1UC7 A;  5EY6 A;  2MMN A;  3FR6 A;  2L4Q A;  3F8U A;  2FNO A;  1ILO A;  1X5E A;  2EIO A;  4F82 A;  2FCH A;  5FT3 A;  2JL4 A;  1MD3 A;  4YQU A;  2VCX A;  3O6T A;  1KBN A;  3TRX A;  2C80 A;  3NOF A;  4FIW A;  4GRF A;  5COH A;  3E0U A;  2HT9 A;  4OFT A;  4EUY A;  3BCK A;  5CRD A;  1J9B A;  3KP9 A;  4MF5 A;  1Q98 A;  2O7K A;  4POK A;  3TGZ A;  3IOS A;  4JE1 A;  2LV3 A;  4HOJ A;  1FB6 A;  2HXK A;  4IJI A;  1XOA A;  3GKM A;  3WT1 A;  3ZL5 A;  1XOB A;  3UEM A;  1AUC A;  2C3N A;  2DKH A;  3FW2 A;  4A5P A;  5ECH B;  3H79 A;  5J9B A;  2VLV A;  4XS4 B;  2AAW A;  4F9Z A;  3TJB A;  1M9A A;  2VCW A;  3HXS A;  2K18 A;  3QFA C;  1M2B A;  1WJK A;  3ME8 A;  2H1B A;  3DD3 A;  3M9K A;  2MBT A;  4IW9 A;  4EIP A;  3CYN A;  3GTU A;  4MPG A;  4O5R A;  4PXO A;  2GS3 A;  1MDI A;  5D9T A;  2L59 A;  2VIM A;  3IC4 A;  2DJK A;  4I6X A;  4GQF A;  3KMN A;  2WFC A;  4GSS A;  2CAQ A;  4GXZ A;  2RLI A;  3L4N A;  4TKY A;  4X1U A;  2CAI A;  1TU7 A;  1SK0 A;  1OE8 A;  4WF5 A;  2K6V A;  4YAP A;  4CY8 A;  3QFB C;  1SEN A;  4TXO A;  3KZQ A;  3E3E A;  3HD5 A;  12GS A;  5ECO B;  2H0I A;  2FA4 A;  4ECI A;  1GNW A;  3FMW A;  5B8A A;  1K0D A;  2H72 A;  2DJ3 A;  18GS A;  1F9M A;  2AUV A;  2PGT A;  1WIK A;  2AYT A;  4OD7 A;  2CX4 A;  4HUA A;  1YKC A;  1DE2 A;  2R6K A;  2UZ8 A;  2V6K A;  3GNJ A;  1ZMA A;  2R5G A;  3FR3 A;  14GS A;  2DBC A;  3LXT A;  4J57 E;  1XCC A;  1PKZ A;  5JCU A;  5DAK A;  3BJ5 A;  1GSU A;  1T1V A;  1XPV A;  3GKN A;  1Z6M A;  1PL1 A;  1YEP A;  4HEA 2;  4Q5Q A;  2O85 A;  1V9W A;  1LU4 A;  3W8S A;  4G0L A;  1A2J A;  4IN0 A;  3ZYW A;  3L78 A;  3ME7 A;  3HVV A;  3WGE A;  2MYG A;  2IL3 A;  3Q6O A;  2JZT A;  1NSW A;  2K8S A;  2PN8 A;  1EWX A;  5KN1 A;  2CT6 A;  2PPT A;  5KN0 A;  3WD6 A;  1GSD A;  5ECN B;  3HCZ A;  4KSO A;  3F9U A;  4O32 A;  5ECM B;  4FQU A;  5EVO A;  3EU3 A;  4MZB A;  3FRC A;  1O8W A;  1SK1 A;  4GLT A;  3KXO A;  16GS A;  4NAX A;  4PQ1 A;  1AQV A;  4YAV A;  5ECQ B;  1JZO A;  3HVX A;  3QAW A;  2LS5 A;  4ZL7 A;  4EXJ A;  3QMX A;  1NM3 A;  3GFK A;  3LWA A;  2B7K A;  4POB A;  2I3Y A;  1DUG A;  2VL3 A;  1X5D A;  1OYJ A;  3A5I A;  4MP4 A;  2O87 A;  4NPB A;  2G0F A;  1XW5 A;  4L0W A;  3LJR A;  1QFN A;  5BMU A;  2P31 A;  2GQM A;  2H0G A;  4PUA A;  3SWL A;  1G6W A;  2F8A A;  4DVC A;  3VLN A;  1PGT A;  5HFI A;  2EC4 A;  4EVM A;  1EZK A;  1G6Y A;  22GS A;  4BVY B;  1MTC A;  1H4O A;  2YWI A;  5F06 A;  4DSQ A;  1KEB A;  3CRT A;  5DAL A;  5HR1 A;  1GWC A;  5D9W A;  2ON5 A;  5D8I A;  2DJJ A;  2CVD A;  5CNW A;  1GL8 A;  2WCI A;  13GS A;  4KF9 A;  4KCE A;  1XWB A;  3HJP A;  2LNS A;  4IQ1 A;  2YV7 A;  3TJJ A;  1V40 A;  2NTO A;  5IMA A;  2AHE A;  4V2N A;  4HI7 A;  3GL5 A;  2IPA A;  2QSI A;  2MMO A;  2X64 A;  2HZE A;  4HS1 A;  1YF1 A;  5IMF A;  4Z2U A;  3UIW A;  2DIZ A;  5ELA A;  1S3D A;  3QAG A;  3LFL A;  3J7Y k;  2JZR A;  1B4Q A;  2C3Q A;  3WGX A;  3DYR A;  4N0V A;  2B5E A;  1EGO A;  1RQM A;  2FLS A;  3R3E A;  2V2G A;  3FZ9 A;  5D73 A;  4WR4 A;  1R7H A;  3GUS A;  4I97 A;  4MZC A;  3U5R E;  2LNT A;  4TR4 A;  4K5R A;  1XWC A;  1GUH A;  3H8Q A;  4PTS A;  2MMZ A;  1SYR A;  1JHB A;  1ZYP A;  4DEJ A;  1GUK A;  2TIR A;  2YCD A;  1OC9 B;  4WBJ A;  2C3T A;  4GQC A;  2X8C A;  1WPI A;  2H76 A;  4MDC A;  5J3R A;  3TJF A;  2WS2 A;  4ECB A;  1F6M C;  2LKU A;  2YP6 A;  2OKA A;  3M9J A;  4TVE A;  4L5O A;  6GSY A;  3UMA A;  3P7X A;  1K0M A;  2RM5 A;  3ZIV A;  2HSH A;  1OVN A;  2IN3 A;  1CQG A;  2LJA A;  1SD8 A;  1SKS B;  1GSS A;  3APQ A;  2X99 A;  5FWG A;  3FR9 A;  4MJE A;  1MD4 A;  3IAM 2;  3VWU A;  4BL7 B;  4XIH A;  5J4U A;  1TXX A;  1YDK A;  1GUL A;  1T8E B;  3UOM A;  4XS4 A;  1FHE A;  2H1G A;  4K8M A;  4YKF A;  3L9S A;  1BED A;  2GZP A;  1Q4J A;  2JAD A;  3SBC A;  3PH9 A;  2GSR A;  1FW1 A;  2LEG A;  1SL0 B;  3PPU A;  5CRW A;  4KCA A;  4E8H A;  3CTG A;  3EU4 A;  1HD2 A;  1ZZY A;  4JU5 A;  3UBK A;  4GSN A;  4GWR A;  3EMP A;  4IHU A;  5E59 A;  4EL1 A;  1W4V A;  5ECL B;  1OC8 A;  2HZF A;  1K3L A;  4TW5 A;  4WXT A;  3CXG A;  1PD2 1;  4MZW A;  4E8E A;  3EMX A;  4KB3 A;  2DC5 A;  4MLY A;  4MH2 A;  5HQP A;  3IA1 A;  2VL2 A;  4G0I A;  3TKR A;  5J41 A;  4J2F A;  2YNX A;  2QGV A;  2F51 A;  3G7J A;  3Q19 A;  4AGS A;  1DE1 A;  1TRU A;  2C1Y A;  2GVP A;  11GS A;  3IPZ A;  5J5N A;  4H86 A;  2JSZ A;  1QQ2 A;  3BD2 A;  4P3Y B;  2K8V A;  3OR5 A;  3G7Y A;  1ZL9 A;  3KJY A;  3H93 A;  2NBS A;  3ZML A;  4USS A;  2OE3 A;  4LL1 B;  3N5O A;  5HR3 A;  2LRT A;  3ISO A;  4MAB A;  1N8J A;  2JSY A;  4PGT A;  2NVL A;  3MYD A;  4IJ3 A;  1U87 A;  4NWY A;  5ABR A;  3LEF A;  2IWT A;  3KD0 A;  1GTB A;  2PBJ A;  4RI6 A;  3ZRD A;  1U3I A;  1WP0 A;  4GCI A;  3H1N A;  2V41 A;  6GSW A;  1FB0 A;  1XIY A;  1KNG A;  4FO5 A;  3TOU A;  2GSS A;  1VF4 A;  2NDO A;  3RPN A;  2H0H A;  3VPQ A;  5DVB A;  5DJL A;  2IIY A;  4ZIJ A;  3TDG A;  1GNE A;  2FY6 A;  1XW9 A;  4N11 A;  1YF0 A;  1PX7 A;  3FZ4 A;  2H73 A;  3GIX A;  2TRX A;  1ERU A;  4HZ4 A;  1USB A;  2I4A A;  3D5J A;  2WGR A;  5BRT A;  1Y6E A;  3EVI A;  3FKF A;  4O5U A;  4MJA A;  4KND A;  1GP1 A;  3HKR A;  3TKS A;  1WOU A;  1X9M B;  2DKI A;  3RHC A;  4TOP A;  4I8B A;  1TJD A;  1RK4 A;  4EKZ A;  5A4V A;  1CQH A;  3I9V 2;  3BCI A;  4ZBD A;  2LQO A;  3O76 A;  3RPP A;  4XRA A;  4K1F A;  3F0I A;  3TKS E;  2OJL A;  1N2A A;  2ALB A;  1GRX A;  1YKA A;  1R4W A;  5JCW A;  5IO2 A;  1GTI A;  5HR0 A;  2C8U A;  3VPT A;  2HSY A;  4FYB A;  1GSY A;  2X49 A;  1A23 A;  1X0R A;  4K2X A;  2M72 A;  3FK8 A;  4K0G A;  5JWO B;  3HYP A;  3QAV A;  4EF0 A;  1GSF A;  1VF2 A;  4OFN A;  5F8B A;  3QD9 A;  5HR2 A;  3HZ4 A;  4D73 B;  2RUE A;  1BAY A;  5DCH A;  2JAC A;  4I5Q A;  2H71 A;  3QR6 A;  4GST A;  4Q5F A;  1PL2 A;  19GS A;  1QXH A;  5IM9 A;  2L57 A;  3WT2 A;  1ST9 A;  1YZX A;  1K3Y A;  3HJM A;  1SK2 A;  2GZZ A;  3RDW A;  2VAF A;  3GX8 A;  2IME A;  1ZYE A;  2VLU A;  4BVY A;  4O92 A;  5ECP B;  4JZQ A;  1I9D A;  4KE3 A;  4QQ7 A;  2PMT A;  2BTO T;  2DSA A;  3KGK A;  1J0F A;  3MIX A;  1Y25 A;  5GST A;  5D9X A;  1EOH A;  1VRS D;  1B8X A;  4K9Z A;  4LLR A;  1EV9 A;  3TKS C;  5LCZ A;  3IR4 A;  3QPM A;  1VF3 A;  2GDR A;  1TKD B;  6GSV A;  4WET A;  1XWG A;  4IKH A;  1SJZ A;  4JRR A;  5CRE A;  4GTU A;  4PNG A;  17GS A;  2GZY A;  1UA5 A;  4EDY A;  2FA8 A;  4MF7 A;  1T4Z A;  5LNK e;  2GLR A;  4NV5 A;  2CVB A;  2VD1 A;  1FVK A;  2XHF A;  4KAE A;  4N0Z A;  5LD0 A;  1T00 A;  2FWE A;  2J9H A;  3D21 A;  2E0Q A;  3APS A;  4PQH A;  2L4C A;  3DML A;  3QCP A;  2ZNM A;  4ACS A;  1AQW A;  1OAZ A;  4N10 A;  5ECK B;  2R2J A;  2VCQ A;  1XWA A;  2YN1 A;  1TI1 A;  4DSR A;  5F07 A;  2R0C A;  2RUF A;  1XFL A;  2VUP A;  4IVF A;  5IOX A;  2M80 A;  3TKP A;  2VO4 A;  3GKK A;  5B8B A;  1U3A A;  2X8G A;  1K0A A;  2QC7 A;  2XPD A;  3LW9 A;  2GGT A;  1M99 A;  2V6O A;  3IK7 A;  3KTB A;  3HHV A;  4ECJ A;  1OC9 A;  4OCE A;  3D4M A;  4KDX A;  2CZ3 A;  1QUW A;  3IBH A;  2XBI A;  3IHQ A;  4GF0 A;  4K6X A;  1T7P B;  1J08 A;  2FWG A;  2VD0 A;  2ZCT A;  2TRC P;  1SL1 B;  2L6C A;  6GST A;  5HFG A;  2B5Y A;  1A2L A;  3QOU A;  1PQN A;  4BL7 A;  1O73 A;  1AW9 A;  3M8N A;  3Q18 A;  2K9F A;  3V1W A;  2A2S A;  1ZOF A;  5CRH A;  3ERG A;  3TKQ A;  1A24 A;  3WGD A;  4K7N A;  2HRN A;  3A2X A;  5AIX A;  1JZD A;  1TRS A;  3GH9 A;  3GRX A;  1ERW A;  1B9X C;  4L5L A;  1EV4 A;  1X9S B;  2H6X A;  2M46 A;  1XWK A;  3ZVJ A;  2L5L A;  3ZFB A;  4KDY A;  1EGR A;  5ID2 A;  3K8N A;  2WJU A;  2H6Z A;  2H1D A;  2CQ9 A;  3VFI A;  4TRX A;  1VGL A;  1RW1 A;  2YAN A;  2FD3 A;  3KTL A;  2OA7 A;  2H19 A;  4IS0 A;  1O6J A;  3HJO A;  1QMV A;  5F0G A;  2B7J A;  3EUR A;  3IRA A;  3GSS A;  3L9U A;  1A0R P;  1JZR A;  1K3O A;  3F3R A;  2H6Y A;  2B5X A;  2HFD A;  2I1U A;  4YH2 A;  1ERT A;  2F8F A;  3CSJ A;  1E6B A;  1PKW A;  3IXR A;  1V98 A;  5C04 A;  5JCG A;  5B6N A;  2IFQ B;  1ERV A;  3GUR A;  4FYC A;  4IP6 A;  4BVX B;  2F9S A;  2YPM A;  1XVW A;  5AIS A;  5IMZ A;  4MMM A;  1XZO A;  3LG6 A;  4XCS A;  2JU5 A;  1Z3E A;  2OAC A;  1SKW B;  4XS1 A;  3GA4 A;  4OO4 A;  1EOG A;  3A2V A;  3DIE A;  1M9B A;  4POL A;  1Z6N A;  2C4J A;  3S9F A;  4KUN A;  5DBQ A;  1PA3 A;  4X43 A;  2VLT A;  3RHB A;  4MJC A;  2OBI A;  3M3M A;  2P5Q A;  3VK9 A;  2N5F A;  1PX6 A;  1ABA A;  5G5E A;  2LUS A;  2LJR A;  3P8W A;  4G9H A;  4J56 E;  3VI7 A;  3IDV A;  2VCT A;  2LRN A;  1B9Y C;  2H74 A;  4Z2T A;  4EC0 A;  3FZA A;  2FWH A;  2WRT A;  1EEJ A;  2C0E A;  5D93 A;  5IO0 A;  3ERW A;  4OMV A;  5ECR B;  3HVS A;  4RI7 A;  2GQK A;  1JLV A;  4ZL9 A;  1OC3 A;  2C0D A;  2OE0 A;  5IPH A;  4WR5 A;  2J23 A;  1WWJ A;  4G10 A;  4X4J A;  1URM A;  1V57 A;  3L0H A;  1ML6 A;  3ZIJ A;  4F0C A;  1YY7 A;  5IMV A;  2GQL A;  3GV1 A;  3JCM L;  3KP8 A;  4LL4 B;  4JED A;  4X0X A;  2PER A;  4HDE A;  1LBK A;  2FHE A;  1F2E A;  1OKD A;  2QA2 A;  5KOW A;  1Z7P A;  1V2A A;  1JFU A;  4CDO A;  3CRU A;  1DSB A;  1IYH A;  3DXB A;  5ID2 B;  4ZB6 A;  3EWL A;  1B4P A;  3BOA A;  3GH6 A;  2LST A;  5FHI A;  1PSQ A;  3CSI A;  2A2P A;  5AIV A;  2IMI A;  5A4W A;  5E4W A;  3KM6 A;  5KN3 A;  4POM A;  2A4H A;  3F4S A;  3CMI A;  6GSU A;  2PWJ A;  4OWY A;  3ZFL A;  1O7U A;  2H66 A;  3NIV A;  4HU9 A;  2DJ1 A;  4D73 A;  4HJ2 A;  3A5W A;  3MSZ A;  3Q74 A;  4V2M A;  2I81 A;  3TJG A;  3GL3 A;  2HRA A;  4PQI A;  1FAA A;  3IV4 A;  3KMO A;  4MCU A;  5G1K A;  3W8J A;  3EPT A;  4L8E A;  3VWW A;  3TOT A;  2B6M A;  3GST A;  1ACV A;  2AB6 A;  5CYY A;  4DSS B;  2R0P A;  2WB9 A;  2H8L A;  4ULX A;  4CY6 A;  4OCF A;  4F03 A;  4ZIL A;  3C73 A;  2VCV A;  3DRN A;  5GSS A;  5KEJ A;  5D96 A;  2QA1 A;  1F37 A;  1XW6 A;  4MPF A;  2OBK A;  2XPE A;  1A8L A;  3G7I A;  5C00 A;  4ZB8 A;  1K0B A;  2IMD A;  3L9V A;  3ZRE A;  2HI7 A;  2FWF A;  3C8E A;  4HU7 A;  1AXD A;  1ON4 A;  3G9B A;  1S3C A;  1FG4 A;  3EYT A;  3FEU A;  4XTS A;  4BA7 A;  4XRD A;  5H5R A;  4KH7 A;  1GTA A;  2C0F A;  1OKT A;  1U6T A;  5GAP D;  1TTZ A;  1HNA A;  3QDN A;  1T3B A;  4F0B A;  2O89 A;  5JWQ B;  4IQA A;  1O85 A;  2YJH A;  1QK8 A;  3HZ8 A;  1HNB A;  4AJ7 A;  5IOW A;  4RQX A;  4I2U A;  2VL2 C;  3D4T A;  4KDU A;  1PN0 A;  3U6V A;  3F4T A;  5DQS A;  4ZL8 A;  4AJ8 A;  3TB2 A;  1FVJ A;  1A0F A;  4MNN A;  3GHA A;  1K0N A;  4ZXG A;  5ECI B;  3IK9 A;  2CVK A;  2KLX A;  2YZH A;  4IBP A;  4HJM A;  3DEX A;  2DMM A;  4WBR D;  2BMX A;  4EO3 A;  3M0F A;  4TR1 B;  3LYK A;  3UAR A;  4KX4 A;  5EPF A;  3O3T A;  3AY8 A;  4NHW A;  1GSQ A;  4N30 A;  1AC1 A;  4IP1 A;  2GSQ A;  4IEL A;  1TK5 B;  1R5A A;  3KEB A;  1F3B A;  1K0O A;  2V32 A;  2LQQ A;  2HNL A;  1H75 A;  4CW9 A;  2LTK A;  5KN2 A;  4Q5N A;  1YJ6 A;  4ID0 A;  3IC8 A;  1XVQ A;  1M2A A;  1BX9 A;  3F4R A;  1JLW A;  1AQX A;  4V2L A;  2DIY A;  4F2I A;  1AAZ A;  2HSM A;  1YEX A;  3A2W A;  2VOC A;  1TDI A;  4RUV A;  4K0N A;  1PN9 A;  1BQ7 A;  2DJ2 A;  3ZVJ D;  1GSE A;  3M1G A;  3I69 A;  3W6G A;  4WF4 A;  4PUF C;  3LOR A;  2QKE A;  4EE0 A;  2H75 A;  2A2R A;  5CAX A;  2P5R A;  3LSZ A;  3UL3 A;  3UJ1 A;  1ZCP A;  1M0U A;  5J9C A;  5A4U A;  1GLQ A;  3F6F A;  1XXU A;  1V58 A;  2WZ9 A;  5DDL A;  1TOF A;  1HQO A;  2IFQ A;  2GT6 A;  2WDU A;  2HRF A;  4BVX A;  4G0K A;  4KW6 A;  5CRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...