3KP8A

The thioredoxin-like domain of a vkor homolog from synechococcus sp.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
94
structure length
94
Chain Sequence
b'SPLAVGLAAHLRQIGGTMYGAYWCPHCQDQKELFGAAFDQVPYVECSPNGPGTPQAQECTEAGITSYPTWIINGRTYTGVRSLEALAVASGYPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VKORC1/thioredoxin domain protein
publication title Structure of a bacterial homologue of vitamin K epoxide reductase.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Oxidoreductase
total genus 29
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2009-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3kp8A00
1AAZA 4Q5NA 4ID0A 1PD21 2VL3A 4ML6A 4OCEA 2K6VA 1ZGNA 5G5EA 1GSQA 1GLPA 1HNBA 3EE2A 4G10A 2V6KA 1ILOA 3IA1A 3KJYA 3CMIA 4CHSA 2LS5A 2H1DA 4L5LA 4NV5A 3GL5A 1FHEA 2C0EA 3VWWA 3VURA 3F63A 3H93A 1WOUA 1ERWA 2H74A 13GSA 3TOUA 4Q5RA 2V32A 1GSDA 1MD4A 4ML1A 2GTUA 2R6KA 2VL2A 2ON5A 3UOMA 2C0GA 2LRCA 6GSSA 3IHQA 1W89A 5IOWA 4KGIA 4PQHA 3GN3A 1ZYQB 3QCPA 3TKSA 5HR0A 3HD5A 5FWGA 5IIZA 4LMWA 1T1VA 1GSSA 2CV4A 4HUAA 2CZ3A 2WZ9A 1M7TA 2H73A 2NTOA 3UIWA 2KP2A 3FEUA 3C1SA 4ZB6A 3J7Yk 4I2UA 2IWTA 3QDNA 1EWXA 4IELA 4MJBA 2BJXA 3PH9A 3ERWA 4EE0A 4GQCA 3C8EA 2YWNA 4TR3A 2M46A 5CNWA 4Q5FA 4X1UA 3D0ZA 2FHEA 1BEDA 1Z6MA 3IE3A 1FAAA 1QK8A 4POLA 2H8LA 5ECIB 3CRTA 3L9SA 5JCWA 1T00A 4X43A 3LSZA 4MF6A 2AJQB 3D5JA 3HJOA 1K0BA 3C1RA 1TI1A 1G6YA 3GTUB 1USBA 1OKDA 4IJIA 3HHVA 2VIMA 4TVEA 4TRXA 1U6TA 2B6MA 1YEXA 2LUSA 2MYGA 5ECSA 3VFIA 3KM6A 2NDOA 4F82A 2C80A 4TN8A 1GTBA 2LNSA 3G7IA 5AN1A 4XCSA 5IO0A 1OVNA 4K0GA 4I97A 4OD7A 3DVXA 3FY7A 4PX1A 2TRCP 2PERA 3KGKA 5IMZA 1UVZA 3TGZA 5F07A 3GTUA 1SJZA 2VO4A 4GSSA 2AB6A 1ZCPA 4WF4A 3GX0A 2GLRA 3EC3A 2VUPA 1LJRA 3O3TA 5A4VA 1LU4A 4AJ8A 1OYJA 3FZ4A 4ECBA 2LJAA 2FD3A 5LD0A 4ISDA 4POKA 2JL4A 1WPIA 2PUKC 3M9KA 4MK3A 3E0UA 1GUHA 2VD1A 3IBHA 3LXTA 2C4JA 2VM2A 4OFNA 4PXOA 2IFQB 3ZIVA 1K3LA 1PL1A 4IP6A 4GCIA 1YZXA 2HSHA 3IV4A 1MD3A 2VLTA 3P90A 1SJIA 1FVKA 2B1LA 3TKRA 4AJ6A 3VI7A 3F3QA 5JCGA 2HRNA 4OFMA 5LCZA 1M0UA 4IS0A 3CSIA 3MDKA 2G2QA 2GDRA 3A2XA 2VL2C 3HY2A 4RQXA 4F9ZA 2ZNMA 1K0NA 1VF1A 4WETA 2L57A 4MMMA 4POMA 1QMVA 2IL3A 2IMKA 4KX4A 2MZCA 2G0FA 3ZVJA 2IFQA 2EIOA 1HYUA 4X0XA 1IYHA 2QC7A 3GKNA 1M2DA 1PSQA 2R3XA 1PL2A 1PX7A 3ZFBA 5G30A 1B9YC 4BPYA 4HU9A 5CREA 2GZPA 1XPVA 2QKEA 4NPBA 1M9AA 1R5PA 3IC4A 3BBYA 2V2GA 1GH2A 2YZHA 2PVOC 2KHPA 4EKZA 1KBNA 2QGVA 2BTOT 2YWOA 2VCVA 17GSA 3APOA 1G0TA 3QMXA 3BCKA 4RI6A 3GIXA 3GSSA 2AUVA 4OO5A 1JZDA 3GMFA 1NW2A 4ZILA 4DVCA 1K3OA 2H0HA 5A4WA 5DJMA 5B8BA 1Y25A 2WCIA 4FO5A 4K9ZA 4RUVA 1EGOA 1XW9A 1X5EA 4IQAA 3GKMA 3VWXA 3UARA 1KEBA 1TRUA 2F51A 4YAVA 2GGTA 4PNGA 2A2SA 1PA3A 1X9WB 1EGRA 1PN9A 2MMOA 3CXGA 2DJ0A 1TXXA 1YKCA 1Z3EA 3KXOA 3BOAA 1O85A 4IKHA 3KIJA 1ERVA 1A23A 5IO2A 1A2LA 2OBKA 4NXIA 1I9DA 1EOHA 1WRYA 2JADA 4DSQA 1H4OA 4N30A 3D4MA 1XCCA 1A0RP 2JZSA 1GNEA 4KSMA 2F9SA 1XVQA 1RQMA 2FCHA 2H70A 3M9JA 4OO4A 2HZFA 2WRTA 1GL8A 3DWVA 5HFIA 3N5OA 3DMLA 2GQLA 1V40A 1TP9A 3CSJA 2C0FA 3TRPA 3FHKA 3TRXA 3E3EA 3UMAA 1A0FA 1K0MA 1S3DA 3F9UA 3ME8A 2CVBA 2B5YA 2H66A 5CRHA 6GSVA 4ECJA 2WJUA 5CAXA 1ML6A 3D21A 3CRUA 2OACA 2LRNA 4NMUA 2VOCA 1PKZA 2RM6A 1THOA 5G31A 1MDJA 3GKKA 3A2WA 4CW9A 2I3YA 1JLVA 3UEMA 4JEDA 4J2FA 3ZLPA 2JU5A 2O89A 2LQOA 1GUMA 2X8GA 4GLTA 2V1MA 1J08A 2GZZA 4HZ4A 5ECQB 3VWUA 3CYNA 1DE2A 1J0FA 3F8UA 5G1LA 4IHUA 1X9MB 5DALB 2H76A 2RUFA 4OMVA 3TKSE 1SYRA 1PMTA 5COHA 4PNFA 3TUEA 2OE0A 3CBUA 2L59A 4NHZA 2H6YA 1MEKA 3ZTLA 1G7EA 3LEFA 1GSFA 3FZ9A 2N5FA 5AGYA 3DIEA 2XC2A 3IAS2 2LTKA 1FB0A 5G5FA 1F2EA 1WIKA 5LNKe 2O7KA 3EVIA 3WT1A 2CAQA 4KUNA 3AY8A 5DALA 2L5OA 3UL3A 2OA7A 4XRAA 5ELAA 2ON7A 1PKWA 1NHOA 4WXTA 3HYPA 3M1GA 4PUFC 1ZOFA 3ZREA 4KE3A 5ECOB 4LL4B 4KCEA 3IDVA 2YJHA 4PQIA 2E2MA 2GVPA 3TRQA 4I5QA 3LORA 2HNLA 3HVXA 2VM1A 3IK7A 1XOAA 1M9BA 4MJAA 3A2VA 1CQHA 4ZB9A 3ZITA 3CTGA 5IMAA 3R2QA 3KTLA 2C3NA 3FKFA 1SL1B 1AQXA 3UAPA 2WGRA 3TJFA 5JWRB 5AISA 2CX4A 2WB9A 3PGTA 4IVFA 2KP1A 4GTUA 4TR4A 2CQ9A 3WGDA 3GX8A 2ZUPA 2I9HA 4IN0A 2IMEA 1B9XC 2FGXA 5EVOA 5B6NA 1T4ZA 1A2JA 3ZMLA 3KCMA 2FA4A 1WE0A 2PGTA 5DCHA 1AC1A 2LKUA 1WJKA 2EC4A 5AIVA 3F3RA 2H71A 1TRVA 3MNGA 4IQ1A 2PWJA 3TKQA 1KTEA 3P7XA 4OFTA 2XHFA 3BD2A 1KNGA 2JSZA 3NZNA 1B4QA 1K0OA 2P0GA 1GTUA 3GA4A 4MDCA 1M2BA 5D9VA 3H4KA 4QL9A 4ZXGA 1XFLA 4ACSA 3Q19A 1QUWA 5GZZB 4EO3A 3L78A 4F2IA 5D96A 3G7YA 1VF3A 2LJKA 3L9UA 2E7PA 2FWFA 5E4WA 4XS1A 2YWMA 1TK5B 2AV4A 2LQQA 1DSBA 4FYCA 2GSQA 6GSUA 2P5RA 3QOUA 2DIZA 2H0GA 2FA8A 1GSUA 2IMFA 2YP6A 4ZL7A 4MJEA 3Q74A 2I1UA 4XS6A 1TW9A 4XHMA 5AIXA 4J57E 5DAKB 2MMAA 1XW5A 1TK8B 3F0IA 4RI7A 2VD0A 1TDIA 4K8MA 1XWCA 1MDKA 4HQZA 6GSXA 3A5WA 4F0BA 2H1AA 1BQ7A 3TCOA 1JFUA 2WS2A 1UN2A 3KD0A 5FHIA 1T3BA 1O8WA 3ZMKA 4EVMA 2ALBA 4O32A 1U3AA 2YNXA 3KTBA 3M8NA 5ECLB 5IMFA 3UVHA 4DEJA 5DAKA 2HI7A 4MH3A 3FW2A 5HR1A 2HFDA 2GQKA 4AJ7A 3GFKA 5B7CA 4PGTA 3O6TA 4ZB8A 4HDEA 2CZ2A 2FWGA 2DJ2A 3GYKA 2HSYA 4I2TA 2R2JA 2VCZA 2N5AA 2YWIA 1BYEA 2VLVA 4V1Ap 3ZIJA 5B8AA 2B5EA 1URMA 2OKAA 4NAXA 1X5DA 4IGJA 5F8BA 3LYKA 1V57A 4NWYA 3MWHA 2M80A 1BAYA 4XTSA 4WR5A 5DBQA 3IXRA 1Q98A 4MA9A 2BMXA 2HT9A 16GSA 1YKAA 2CAIA 5CRWA 4Z7XA 3KMOA 3OR5A 3HJMA 2NVLA 4KCAA 5IM9A 1YDKA 1AXDA 3EMPA 4NHWA 1OC3A 2F8FA 2TRXA 3NOFA 2YJ7A 3DGQA 3TDGA 1SL0B 2LRTA 5HFKA 2C3TA 2C8UA 2O87A 2DJKA 5DJLA 2GSSA 1XOBA 1HNAA 1ERUA 2H01A 9GSSA 2OE3A 3H79A 3ZFLA 1BJXA 2H1GA 4O5RA 3I43A 4J56E 3N9JA 2MMZA 1A2MA 1R26A 3KMNA 4O92A 2IN3A 2PMTA 1T4YA 1XZOA 4XIHA 1N8JA 5CYYA 3VLNA 2FLSA 4BVXA 6GSTA 3I9V2 3M3MA 4WBRD 4JZQA 1GLQA 2TIRA 4FYUA 3I6AA 3HZ4A 3L0HA 5IOXA 1K0AA 4KNDA 2DBCA 4TXVA 4BWQA 3QR6A 1SKWB 4L8EA 4IJ3A 3VWVA 2FUG2 3GRXA 4AGSA 4V2LA 2F8AA 3QFBC 1HQOA 1TJDA 5C04A 3HCZA 1VRSD 3RBTA 3Q6OA 3FR3A 5ENUA 4ZL8A 2LV3A 1OAZA 5ECRB 2I4AA 5KN3A 2O85A 2EIQA 4TR1B 3WD6A 4P3YB 3F4SA 2DLXA 3KH7A 4L0WA 2L6CA 4N0VA 1ZYEA 3FRCA 1OE7A 2GQMA 4TW5A 4G19A 3FZ5A 1Z6NA 5D8IA 3TB2A 2X8HA 1OE8A 3TJGA 3TOTA 2PBJA 3S9FA 1JZRA 2XBQA 2XPDA 3KZQA 4FIWA 2R5GA 2VCWA 2DJ1A 4BA7A 2IMDA 1NHYA 1PGTA 5B6MA 3ZL5A 1FB6A 4TR1A 4GWRA 1GTIA 5KN1A 4YQVA 3C71A 2C1YA 1YY7A 1QXHA 4IP1A 2YN1A 4RQRA 3HJPA 3FR6A 5DQYA 3WT2A 3CSHA 2JZRA 4E8HA 2GSTA 2H72A 3LWAA 5E59A 5G2ZA 3KP8A 2B7JA 2B3SA 2YV9A 1O73A 4G9HA 1IYIA 5KN0A 2DJJA 2OBIA 1YEPA 3IPZA 3EU4A 3EURA 4HOJA 5GSSA 1EEJA 4AF2A 2DIYA 3ZVJD 4GXZA 3QPMA 5H5RA 3D6IA 3BJ5A 4BVYA 2B5XA 4LL1B 2GS3A 1SK0A 2X8CA 3QFAC 1QQ2A 3IR4A 7GSSA 11GSA 1FW1A 1R7HA 3UBKA 4LLRA 5J4UA 2KUCA 1EP8A 3MSZA 5CP1A 3TJBA 1S3AA 3G7JA 1XVWA 2KLXA 3D4TA 5J5NA 5GAND 1SJ6A 1N2AA 3VI5A 10GSA 3DEXA 3G9BA 2H6XA 2AAWA 5ID2B 1F37A 18GSA 2YCDA 1TRWA 2Z9SA 2VLUA 3RPNA 3U6VA 4DSRA 3EYTA 3VPTA 4V2MA 4EC0A 3RHCA 4HZ2A 4PURA 1XIYA 1GSYA 2J23A 3ED3A 1G7OA 3RAZA 3IOSA 3LGCA 1AQWA 5J41A 1SD8A 2GZYA 4JRRA 3GV1A 3FYGA 1W4VA 2GT6A 3QAGA 5ID2A 1GUKA 4K2DA 3HVVA 4F0CA 1SKSB 4PQ1A 1G6WA 2DC5A 5DDLA 3ZRDA 2GT5A 1O7UA 1O8XA 4HU7A 1TTZA 2YZUA 4HI7A 1EEMA 1I5GA 3DKSA 1H75A 5CRDA 2J9HA 2HE3A 3ZYWA 4HJMA 4GSTA 4LMVA 3NIVA 5D9WA 3LJRA 4JR6A 1CQGA 5F05A 5ABRA 2HRFA 3ME7A 3LQ7A 4KW6A 3EINA 4BL7A 1TRSA 3GUSA 2L6DA 1V58A 4WF5A 3DXBA 4JU5A 1VF4A 3F4TA 2MBSA 5GAPD 2LEGA 1U3IA 4MP4A 4ZBBA 4EDYA 2B7KA 1JZOA 2JSYA 1EP7A 2JZTA 5ECNB 2K8VA 3GURA 1SENA 1B48A 1PQNA 1X0RA 4KA0A 3RPPA 3C7MA 1F3BA 1T8EB 1NSWA 4XS4B 5KEJA 3GH9A 2DJ3A 8GSSA 3L4NA 3HZ8A 2RM5A 4F03A 5IMCA 2LNTA 3ERFA 4N0ZA 1UA5A 5L71A 4V1Ag 4KDYA 3GSTA 5H5QA 1SK2A 5DVBA 3F6FA 4K7IA 3K8NA 3TKPA 1XXUA 3W8SA 3FR9A 1ERTA 3E9JB 2H0IA 4MABA 4IBPA 4XS4A 2MBTA 3H8QA 2RLIA 1JLWA 1PRXA 4ILFA 1WWJA 2HZEB 2YOIA 3FK8A 3TJJA 5FT3A 1ZL9A 4YQUA 2CA8A 2VCTA 5IMVA 2R37A 1ACVA 2OADA 3D22A 1OKTA 5J9CA 4E8EA 2H6ZA 1THXA 2K8SA 3Q18A 2REMA 4ZBAA 4OCFA 5H5SA 1SKRB 2YPMA 4EL1A 5EPFA 3APSA 1DBYA 4WR4A 1WMJA 1K3YA 1VF2A 3U5RE 2HLSA 2HZEA 3EU3A 3LYPA 3FZAA 1PX6A 2LJRA 4HS1A 2FY6A 5C00A 3PINA 4YAPA 5DCGA 4ZBDA 3HKRA 1WP0A 2WULA 2DMMA 2DSAA 4KH7A 4DSSB 2MMNA 3IK9A 1QGVA 5JWQB 1TU8A 4EDZA 1Z5YE 4TR0A 1SK1A 4JBBA 2H30A 2RUEA 3P8WA 4KB3A 1GNWA 2OJLA 4LA1A 4N11A 4GF0A 1OC8A 4YQMA 3V1WA 1VGLA 1XW6A 4JR4A 4K6XA 2OE1A 2IIYA 4DSSA 3LXZA 5IPGA 4H86A 4GSNA 5A4UA 1RW1A 1Q4JA 1O6JA 5KN2A 3TJKA 4WKWA 3M0FA 5A5KA 5IQYA 1C72A 3CTFA 1SU9A 2JACA 2HYXA 1YF0A 1X5CA 1ZZYA 5D93A 1AIUA 3DVWA 2FWHA 1F9MA 3GHAA 2LSTA 4ULXA 5D73A 4I6XA 3KP9A 2EIRA 3KEBA 2N5BA 5CRGA 1SYXA 3P2AA 3PR8A 4FYBA 2PPTA 22GSA 3EMXA 1HD2A 3ISOA 1V9WA 12GSA 1ZMAA 2H19A 2D2ZA 3JCML 3IRAA 1M99A 5ECPB 4HQSA 1QFNA 2VCXA 5INYA 4IW9A 3TKSC 1E2YA 2V41A 5G1KA 1YQ1A 2GSRA 4TXOB 4K0NA 3ZZXA 3QD9A 2H1BA 5ECHB 5F06A 5J3RA 2WDUA 3I69A 3WGEA 4K7NA 2XPEA 1TKDB 4OWYA 5HFGA 5HQPA 4POBA 2IJYA 4Q5QA 1BX9A 1AUCA 1S3CA 2C0DA 1ST9A 14GSA 1O81A 2DMLA 2ZCTA 2PU9C 4KSOA 3F6DA 4TXOA 4EUYA 1TI3A 4KAEA 1XBSA 2QSIA 2RIIA 1RK4A 1EV4A 3SBCA 1Y6EA 5DQSA 3EWLA 4V2NA 2VCQA 2A2RA 1EV9A 1MTCA 4MH2A 2AYTA 4QL7A 4MJCA 1DUGA 5F0GA 3WYWA 1A24A 2E2GA 1GP1A 4MCUA 3HXSA 1AW9A 5EY6A 1ON4A 3W8JA 2B1KA 20GSA 1K0CA 2WFCA 4ZL9A 4NV2A 1V2AA 3APQA 1XWKA 4QQ7A 4XRDA 1Z7PA 4L5OA 1DE1A 3UBLA 2PVQA 2L5LA 2XBIA 1U88A 3L9VA 4TKYA 2F3MA 2HXKA 2L4CA 4KDUA 4TOPA 4ZIJA 1Z7RA 3H1NA 3HDCA 4MF7A 2E0QA 5J9BA 1T7PB 4MZCA 2YV7A 5HR2A 3W6GA 3GL3A 4N10A 2CVDA 2FNOA 4MLYA 1TK0B 1GULA 2P31A 3C73A 1SL2B 1JZWA 1B4PA 1FOVA 4BWSA 2IMIA 4FH8A 1GTAA 3US3A 1NM3A 2O8VB 1YJ6A 3A3TA 5ECMB 6GSYA 4G2EA 2A4VA 2IPAA 2VAFA 5ECKB 1ABAA 1E6BA 3GH6A 4JE1A 1TU7A 2K18A 3DYRA 2L4QA 4ECIA 4KDXA 4K1FA 3WGXA 2VL9A 1GWCA 4K7OA 2I81A 4YH2A 3UVTA 3ERGA 5GSTA 4D73B 4ECCA 5JCUA 1X9SB 3LFLA 4L0UA 5D9XA 1JHBA 4GQFA 1F6MC 3HVSA 2K9FA 2KOKA 1R4WA 2AHEA 1R5AA 1Z9HA 2FWEA 3BCIA 3RHBA 3VPQA 2PN8A 2C3QA 1A8LA 3QAWA 4MPGA 3F4RA 4PUAA 1EOGA 1FVJA 1M2AA 2YANA 3MAKA 2H75A 1MDIA 2NBSA 6GSWA 1BG5A 1EZKA 1B8XA 3SWLA 3RDWA 5CO3A 2V6OA 1XWGA 4D73A 1J9BA 3DRNA 4MZBA 1A8YA 2X64A 5JWOB 4WBJA 3LG6A 4MF5A 1FG4A 1U87A 2X99A 4CDOA 4WEYA 2CVKA 1YF1A 2CT6A 3VK9A 3GNJA 4O7HA 1GRXA 4HEA2 4I8BA 1OC9B 2CX3A 1UC7A 5IMDA 1SD9A 3J7Yb 1XWBA 4EF0A 3KH9A 2NPBA 2P5QA 19GSA 4MZWA 2R4VA 1LBKA 1XWAA 3GKXA 3DD3A 2ES7A 1AQVA 5ELGA 1V98A 5D9TA 4MPFA 1K0DA 1TOFA 3HA9A 3IAM2 4GRFA 3UJ1A 4HJ2A 2M72A 5HR3A 3O76A 1GSEA 4EXJA 1FO5A 3QAVA 1F3AA 1OC9A 1HNCA 5IPHA 5EL8A
chains in the Genus database with same CATH superfamily
1AAZA 4Q5NA 4ID0A 1PD21 2VL3A 4ML6A 4OCEA 2K6VA 1ZGNA 5G5EA 1GSQA 2A2PA 1GLPA 1HNBA 3EE2A 4G10A 2V6KA 1ILOA 3IA1A 3KJYA 3CMIA 4CHSA 2LS5A 2H1DA 4L5LA 4NV5A 3GL5A 1FHEA 2C0EA 3VWWA 3VURA 3F63A 3H93A 1WOUA 1ERWA 2H74A 13GSA 3TOUA 4Q5RA 2V32A 2X4AA 1GSDA 1MD4A 4ML1A 2GTUA 2R6KA 2VL2A 2ON5A 3UOMA 2C0GA 2LRCA 6GSSA 3IHQA 1W89A 5IOWA 4KGIA 4PQHA 3GN3A 1ZYQB 3QCPA 3TKSA 5HR0A 3HD5A 5FWGA 5IIZA 4LMWA 1T1VA 1GSSA 2CV4A 4HUAA 2CZ3A 2WZ9A 1M7TA 2H73A 2NTOA 3UIWA 2KP2A 3FEUA 3C1SA 4ZB6A 3J7Yk 4I2UA 2IWTA 3QDNA 1EWXA 4IELA 4MJBA 2BJXA 3PH9A 3ERWA 5BMUA 4EE0A 4GQCA 3C8EA 2YWNA 4TR3A 2M46A 5CNWA 4Q5FA 4X1UA 3D0ZA 2FHEA 4PTSA 2R0GA 1BEDA 1Z6MA 3IE3A 1FAAA 1QK8A 4POLA 2H8LA 5ECIB 3CRTA 3L9SA 5JCWA 1T00A 4X43A 3LSZA 4MF6A 2AJQB 3D5JA 3HJOA 1K0BA 3C1RA 1TI1A 1G6YA 3GTUB 1USBA 1OKDA 4IJIA 3HHVA 2VIMA 4TVEA 4TRXA 1U6TA 2B6MA 1YEXA 2LUSA 2MYGA 5ECSA 3VFIA 3KM6A 2NDOA 4F82A 2C80A 4TN8A 1GTBA 4Z2RA 1PN0A 2LNSA 3G7IA 5AN1A 4XCSA 5IO0A 1OVNA 4K0GA 4I97A 4OD7A 3DVXA 3FY7A 4PX1A 2TRCP 2PERA 3KGKA 5IMZA 1UVZA 3TGZA 5F07A 3GTUA 1SJZA 2VO4A 4GSSA 2AB6A 1ZCPA 4WF4A 3GX0A 2GLRA 3EC3A 2VUPA 1LJRA 3O3TA 5A4VA 1LU4A 4AJ8A 1OYJA 3FZ4A 4ECBA 4MNNA 2LJAA 2FD3A 5LD0A 4ISDA 4POKA 2JL4A 1WPIA 2PUKC 3M9KA 4MK3A 3E0UA 1GUHA 2VD1A 3IBHA 3LXTA 2C4JA 2VM2A 4OFNA 4PXOA 2IFQB 3ZIVA 1K3LA 1PL1A 4IP6A 4GCIA 1YZXA 2HSHA 3IV4A 1MD3A 2VLTA 3P90A 1SJIA 1FVKA 2B1LA 3TKRA 4AJ6A 3VI7A 3F3QA 5JCGA 2HRNA 4OFMA 5LCZA 1M0UA 4IS0A 3CSIA 3MDKA 2G2QA 2GDRA 3A2XA 2VL2C 3HY2A 4RQXA 4F9ZA 2ZNMA 1K0NA 1VF1A 4WETA 3R3EA 2L57A 4MMMA 4POMA 1QMVA 2IL3A 4O5UA 2IMKA 4KX4A 2MZCA 2G0FA 3ZVJA 4CY8A 2IFQA 2EIOA 1HYUA 4X0XA 1IYHA 2QC7A 3GKNA 1M2DA 2QA2A 1PSQA 2R3XA 1PL2A 1PX7A 3ZFBA 5G30A 1B9YC 4BPYA 2HRKA 4HU9A 5CREA 2GZPA 1XPVA 2QKEA 4NPBA 1M9AA 1R5PA 3IC4A 3BBYA 2V2GA 1GH2A 2YZHA 2PVOC 2KHPA 4EKZA 1KBNA 2QGVA 2BTOT 2YWOA 2VCVA 17GSA 3APOA 1G0TA 3QMXA 3BCKA 4RI6A 3GIXA 3GSSA 2AUVA 4OO5A 1JZDA 3GMFA 1NW2A 4ZILA 4DVCA 1PFOA 1K3OA 2H0HA 5A4WA 5DJMA 5B8BA 1Y25A 2WCIA 4FO5A 4K9ZA 4RUVA 1EGOA 1XW9A 1X5EA 4IQAA 3GKMA 3VWXA 3UARA 1KEBA 1TRUA 2F51A 4YAVA 2GGTA 4PNGA 2A2SA 1PA3A 1X9WB 1EGRA 1PN9A 2MMOA 3CXGA 2DJ0A 1TXXA 1YKCA 1Z3EA 3KXOA 3BOAA 1O85A 4IKHA 3KIJA 1ERVA 1A23A 5IO2A 1A2LA 2OBKA 4NXIA 1I9DA 1EOHA 1WRYA 2JADA 4DSQA 1H4OA 4N30A 3D4MA 1XCCA 1A0RP 2JZSA 1GNEA 4O5QA 4KSMA 2F9SA 2DKHA 1XVQA 1RQMA 2FCHA 2H70A 3M9JA 4OO4A 2HZFA 2WRTA 1GL8A 3DWVA 5HFIA 3N5OA 3DMLA 2GQLA 1V40A 1TP9A 3CSJA 2C0FA 3TRPA 3FHKA 3TRXA 3E3EA 3UMAA 1A0FA 1K0MA 1S3DA 3F9UA 3ME8A 2QA1A 2CVBA 2B5YA 2H66A 5CRHA 4CY6A 6GSVA 4ECJA 2WJUA 5CAXA 1ML6A 3D21A 3CRUA 2OACA 2LRNA 4NMUA 2VOCA 3HVNA 1PKZA 2RM6A 1THOA 5G31A 1MDJA 3GKKA 3A2WA 4CW9A 2I3YA 4FQUA 1JLVA 3UEMA 4JEDA 4J2FA 3ZLPA 2JU5A 2O89A 2LQOA 1GUMA 2X8GA 4GLTA 2V1MA 1J08A 2GZZA 4HZ4A 5ECQB 3VWUA 3CYNA 1DE2A 1J0FA 3F8UA 5G1LA 4IHUA 1X9MB 5DALB 2H76A 2RUFA 4OMVA 3TKSE 1SYRA 1PMTA 5COHA 4PNFA 3TUEA 2OE0A 3CQFA 3CBUA 2L59A 4NHZA 2H6YA 1MEKA 3ZTLA 1G7EA 2HRAA 3LEFA 1GSFA 4EIPA 4G0IA 3FZ9A 2N5FA 5AGYA 3DIEA 2XC2A 3IAS2 2LTKA 1FB0A 5G5FA 1F2EA 1WIKA 5LNKe 2O7KA 3EVIA 3WT1A 2CAQA 4KUNA 3AY8A 5DALA 2L5OA 3UL3A 2OA7A 4XRAA 5ELAA 2ON7A 1PKWA 1NHOA 4G0KA 4WXTA 4KF9A 3HYPA 3M1GA 4PUFC 1ZOFA 3ZREA 4KE3A 5ECOB 4LL4B 4KCEA 3IDVA 2YJHA 4PQIA 2E2MA 2GVPA 3TRQA 4I5QA 3LORA 2HNLA 3HVXA 2VM1A 3IK7A 1XOAA 1M9BA 4MJAA 3A2VA 1CQHA 4ZB9A 3ZITA 3CTGA 5IMAA 3R2QA 3KTLA 2C3NA 3FKFA 1SL1B 1AQXA 3UAPA 2WGRA 3TJFA 5JWRB 5AISA 2CX4A 2WB9A 3PGTA 4USSA 4IVFA 2KP1A 4GTUA 4TR4A 2CQ9A 3WGDA 3GX8A 2ZUPA 2I9HA 4IN0A 2IMEA 1B9XC 2FGXA 5EVOA 5B6NA 1T4ZA 1A2JA 3ZMLA 3KCMA 2FA4A 1WE0A 2PGTA 5DCHA 1AC1A 2LKUA 1WJKA 2EC4A 5AIVA 3F3RA 2H71A 1TRVA 3MNGA 4IQ1A 4K5RA 2PWJA 3TKQA 1KTEA 3P7XA 4OFTA 2XHFA 3BD2A 1KNGA 2JSZA 3NZNA 1B4QA 1K0OA 2P0GA 1GTUA 3GA4A 4MDCA 1M2BA 5D9VA 3H4KA 4QL9A 4ZXGA 1XFLA 4ACSA 3Q19A 1QUWA 5GZZB 4EO3A 3L78A 4F2IA 3LW9A 5D96A 3G7YA 1VF3A 2LJKA 3L9UA 2E7PA 2FWFA 5E4WA 4XS1A 2YWMA 1TK5B 5BRTA 4X4JA 2AV4A 2LQQA 1DSBA 4FYCA 2GSQA 6GSUA 2P5RA 3QOUA 2DIZA 2H0GA 2FA8A 1GSUA 2IMFA 2YP6A 4ZL7A 4MJEA 3Q74A 2I1UA 4XS6A 1TW9A 4XHMA 5AIXA 4J57E 5DAKB 2MMAA 1XW5A 1TK8B 3F0IA 4RI7A 2VD0A 1TDIA 4K8MA 1XWCA 1MDKA 4HQZA 6GSXA 3A5WA 4F0BA 2H1AA 1BQ7A 3TCOA 1JFUA 2WS2A 1UN2A 3KD0A 5FHIA 1T3BA 1O8WA 3ZMKA 4EVMA 2ALBA 4O32A 1U3AA 2YNXA 3KTBA 3M8NA 5ECLB 5IMFA 3UVHA 4DEJA 5DAKA 2HI7A 3FW2A 4MH3A 5HR1A 2HFDA 2GQKA 4AJ7A 3GFKA 5B7CA 4PGTA 3O6TA 4ZB8A 4HDEA 2CZ2A 2FWGA 2DJ2A 3GYKA 2HSYA 4I2TA 2R2JA 2VCZA 2N5AA 2YWIA 1BYEA 2VLVA 4V1Ap 3ZIJA 5B8AA 2B5EA 2R0CA 2R0PA 1URMA 2OKAA 4NAXA 1X5DA 4IGJA 5F8BA 3LYKA 1V57A 4NWYA 3MWHA 2M80A 1BAYA 4XTSA 4WR5A 5DBQA 3IXRA 1Q98A 4MA9A 2BMXA 2HT9A 16GSA 1YKAA 2CAIA 5CRWA 4Z7XA 3KMOA 3OR5A 3HJMA 2NVLA 4KCAA 5IM9A 5KOWA 3A5IA 1YDKA 1AXDA 3EMPA 4NHWA 1OC3A 2F8FA 2TRXA 3NOFA 2YJ7A 3DGQA 3TDGA 1SL0B 2LRTA 5HFKA 2C3TA 4BVXB 2C8UA 2O87A 2DJKA 5DJLA 2GSSA 1XOBA 1HNAA 1ERUA 2H01A 9GSSA 2OE3A 3H79A 3ZFLA 1BJXA 2H1GA 4O5RA 3I43A 4J56E 3N9JA 2MMZA 1A2MA 1R26A 3KMNA 4O92A 2IN3A 2PMTA 1T4YA 1XZOA 4XIHA 1N8JA 5CYYA 3VLNA 2FLSA 4BVXA 6GSTA 3I9V2 3M3MA 4WBRD 4JZQA 1GLQA 2TIRA 4FYUA 3I6AA 3HZ4A 3L0HA 5IOXA 1K0AA 4KNDA 2DBCA 4TXVA 4BWQA 3QR6A 1SKWB 4L8EA 4IJ3A 3VWVA 2FUG2 3GRXA 4AGSA 4V2LA 2F8AA 3QFBC 1HQOA 1TJDA 5C04A 3HCZA 1VRSD 3RBTA 3Q6OA 3FR3A 5ENUA 4ZL8A 2LV3A 1OAZA 5ECRB 2I4AA 5KN3A 2O85A 2EIQA 4TR1B 3WD6A 4P3YB 2HSMA 3F4SA 2DLXA 3KH7A 4L0WA 2L6CA 4N0VA 1ZYEA 3FRCA 1OE7A 2GQMA 4TW5A 4G19A 3FZ5A 1Z6NA 5D8IA 3TB2A 2X8HA 1OE8A 3TJGA 3TOTA 2PBJA 3S9FA 1JZRA 2XBQA 2XPDA 3KZQA 4FIWA 2R5GA 2VCWA 2DJ1A 4BA7A 2IMDA 1NHYA 1PGTA 5B6MA 3ZL5A 1FB6A 4TR1A 4GWRA 1GTIA 5KN1A 4YQVA 3C71A 2C1YA 1YY7A 1QXHA 4IP1A 2YN1A 4RQRA 3HJPA 3FR6A 5DQYA 3WT2A 4BVYB 3CSHA 2JZRA 4E8HA 2GSTA 2H72A 3LWAA 5E59A 5G2ZA 3KP8A 2B7JA 2B3SA 2YV9A 1O73A 4G9HA 1IYIA 5KN0A 2DJJA 2OBIA 1YEPA 3IPZA 3EU4A 3EURA 4HOJA 5GSSA 1EEJA 4AF2A 2DIYA 3ZVJD 4GXZA 3QPMA 5H5RA 3FMWA 3D6IA 3BJ5A 4BVYA 2B5XA 4LL1B 2GS3A 1SK0A 2X8CA 3QFAC 4K5SA 1QQ2A 3IR4A 7GSSA 11GSA 1FW1A 1R7HA 3UBKA 4LLRA 5J4UA 2KUCA 1EP8A 3MSZA 5CP1A 3TJBA 1S3AA 3G7JA 1XVWA 2KLXA 3D4TA 5J5NA 5GAND 1SJ6A 1N2AA 3VI5A 10GSA 3DEXA 3G9BA 2H6XA 2AAWA 5ID2B 1F37A 18GSA 2YCDA 1TRWA 2Z9SA 2VLUA 3RPNA 3U6VA 4DSRA 3EYTA 3VPTA 4V2MA 4EC0A 3RHCA 4HZ2A 4PURA 1XIYA 1GSYA 2J23A 3ED3A 1G7OA 3RAZA 3IOSA 3LGCA 1AQWA 5J41A 2X49A 1SD8A 2GZYA 4JRRA 3GV1A 3FYGA 1W4VA 1FOHA 2GT6A 3QAGA 5ID2A 2A4HA 1GUKA 4K2DA 3HVVA 2UZ8A 4F0CA 1SKSB 4PQ1A 1G6WA 4YKGA 4BL7B 2DC5A 5DDLA 3ZRDA 2GT5A 1O7UA 1O8XA 4HU7A 1TTZA 2YZUA 4HI7A 1EEMA 1I5GA 3DKSA 1H75A 5CRDA 2J9HA 2HE3A 3ZYWA 4HJMA 4GSTA 4LMVA 3NIVA 5D9WA 3LJRA 4JR6A 1CQGA 5F05A 5ABRA 2HRFA 3ME7A 3LQ7A 4KW6A 3EINA 4BL7A 1TRSA 3GUSA 2L6DA 1V58A 4WF5A 3DXBA 4JU5A 1VF4A 3F4TA 2MBSA 5GAPD 2LEGA 1U3IA 4MP4A 4ZBBA 4EDYA 3PPUA 2B7KA 1JZOA 2JSYA 1EP7A 2JZTA 5ECNB 2K8VA 3GURA 1SENA 1B48A 1PQNA 1X0RA 4KA0A 3RPPA 3C7MA 1F3BA 1T8EB 1NSWA 4XS4B 5KEJA 3GH9A 2DJ3A 8GSSA 3L4NA 3HZ8A 2RM5A 1M3IA 4F03A 5IMCA 2LNTA 3ERFA 4N0ZA 1UA5A 5L71A 4V1Ag 4KDYA 3GSTA 5H5QA 1SK2A 5DVBA 3F6FA 4K7IA 3K8NA 3TKPA 1XXUA 3W8SA 3FR9A 1ERTA 3E9JB 2H0IA 4MABA 4IBPA 4XS4A 2MBTA 3H8QA 2RLIA 1JLWA 1PRXA 5KOXA 4ILFA 1WWJA 2HZEB 2YOIA 3FK8A 3TJJA 5FT3A 1ZL9A 4YQUA 2CA8A 2VCTA 4EIQA 5IMVA 2R37A 1ACVA 4HSCX 2OADA 3D22A 1OKTA 5J9CA 4E8EA 2H6ZA 1THXA 2K8SA 3Q18A 2REMA 4ZBAA 4OCFA 5H5SA 1SKRB 2YPMA 4EL1A 5EPFA 3APSA 1DBYA 4WR4A 1WMJA 1K3YA 1VF2A 3U5RE 2HLSA 2HZEA 3EU3A 3LYPA 3FZAA 1PX6A 2LJRA 4HS1A 2FY6A 5C00A 3PINA 4YAPA 5DCGA 4ZBDA 3HKRA 1WP0A 2WULA 2DMMA 2DSAA 4KH7A 4DSSB 2MMNA 3IK9A 1QGVA 5JWQB 1TU8A 4EDZA 1Z5YE 4TR0A 1SK1A 4JBBA 2H30A 2RUEA 3P8WA 4KB3A 3EPTA 1GNWA 2OJLA 4LA1A 4N11A 4GF0A 1OC8A 4YQMA 3V1WA 1VGLA 1XW6A 4ICYA 4JR4A 4K6XA 2OE1A 2IIYA 4DSSA 3LXZA 5IPGA 4H86A 4GSNA 5A4UA 1RW1A 1Q4JA 1O6JA 5KN2A 3TJKA 4YKFA 4WKWA 3M0FA 5A5KA 5IQYA 1C72A 3CTFA 1SU9A 2JACA 2HYXA 1X5CA 1YF0A 1ZZYA 5D93A 1AIUA 3DVWA 2FWHA 1F9MA 3GHAA 2LSTA 4ULXA 5D73A 4I6XA 3KP9A 2EIRA 3KEBA 2N5BA 5CRGA 1SYXA 3P2AA 3PR8A 4FYBA 1M3JA 2PPTA 22GSA 3EMXA 1HD2A 3ISOA 1V9WA 2DKIA 12GSA 1ZMAA 2H19A 2D2ZA 3JCML 3IRAA 1M99A 5ECPB 4HQSA 1QFNA 2VCXA 5INYA 4IW9A 3TKSC 1E2YA 2V41A 5G1KA 1YQ1A 4Z2TA 2GSRA 4TXOB 4K0NA 3ZZXA 3QD9A 2H1BA 5ECHB 5F06A 5J3RA 2WDUA 3I69A 1ZYNA 3WGEA 4K7NA 2XPEA 1TKDB 4OWYA 5HFGA 5HQPA 4POBA 2IJYA 4Q5QA 1BX9A 1AUCA 1XG8A 1S3CA 2C0DA 1ST9A 14GSA 1O81A 2DMLA 2ZCTA 2PU9C 4KSOA 3F6DA 4TXOA 4EUYA 1TI3A 4KAEA 1XBSA 2QSIA 2RIIA 1RK4A 1EV4A 3SBCA 1Y6EA 5DQSA 3EWLA 4V2NA 2VCQA 2A2RA 1EV9A 1MTCA 4MH2A 2AYTA 4QL7A 4MJCA 1DUGA 5F0GA 3WYWA 1A24A 2E2GA 1GP1A 4MCUA 3HXSA 1AW9A 5EY6A 1ON4A 3W8JA 2B1KA 1ZYPA 20GSA 1K0CA 2WFCA 4ZL9A 4NV2A 1V2AA 3APQA 1XWKA 4QQ7A 4XRDA 1Z7PA 4L5OA 1DE1A 4K2XA 3UBLA 2PVQA 2L5LA 2XBIA 1U88A 3L9VA 4TKYA 2F3MA 2HXKA 3IHGA 4BIKA 2L4CA 4KDUA 4TOPA 4ZIJA 1Z7RA 3H1NA 3HDCA 4MF7A 2E0QA 5J9BA 1T7PB 4MZCA 2YV7A 5HR2A 3W6GA 3GL3A 4N10A 2CVDA 2FNOA 4MLYA 1TK0B 1GULA 2P31A 3C73A 1SL2B 1JZWA 1B4PA 1FOVA 4BWSA 2IMIA 4FH8A 1GTAA 3US3A 1NM3A 2O8VB 1YJ6A 3A3TA 5ECMB 6GSYA 4G2EA 2A4VA 2IPAA 2VAFA 5ECKB 1ABAA 1E6BA 3GH6A 4JE1A 1TU7A 2K18A 3DYRA 2L4QA 4ECIA 4KDXA 4K1FA 3WGXA 2VL9A 1GWCA 4K7OA 2I81A 3IC8A 4YH2A 3UVTA 3ERGA 5GSTA 4D73B 4ECCA 5JCUA 1X9SB 3LFLA 4L0UA 5D9XA 1JHBA 4GQFA 1F6MC 3HVSA 2K9FA 2KOKA 1R4WA 2AHEA 1R5AA 1Z9HA 2FWEA 3BCIA 3RHBA 3VPQA 2PN8A 2C3QA 1A8LA 3QAWA 4MPGA 3F4RA 4PUAA 1EOGA 1FVJA 1M2AA 2YANA 3MAKA 2H75A 1MDIA 2NBSA 6GSWA 1BG5A 1EZKA 1B8XA 3SWLA 3RDWA 5CO3A 2V6OA 1XWGA 4D73A 1S3RA 4G0LA 1J9BA 3DRNA 4MZBA 1A8YA 2X64A 5JWOB 4WBJA 3LG6A 4MF5A 1FG4A 1U87A 2X99A 4CDOA 4WEYA 2CVKA 1YF1A 2CT6A 3VK9A 3GNJA 4O7HA 4A5PA 1GRXA 4HEA2 4I8BA 3MYDA 4Z2UA 1OC9B 2CX3A 1UC7A 5IMDA 1SD9A 3J7Yb 1XWBA 4EF0A 3KH9A 2NPBA 2P5QA 19GSA 4MZWA 2R4VA 1LBKA 1XWAA 3GKXA 3DD3A 2ES7A 1AQVA 5ELGA 1V98A 5D9TA 4MPFA 1K0DA 1TOFA 3HA9A 3IAM2 4GRFA 3UJ1A 4HJ2A 2M72A 5HR3A 3O76A 1GSEA 4EXJA 1FO5A 3QAVA 1F3AA 1OC9A 3MIXA 1HNCA 5IPHA 5EL8A
chains in the Genus database with same CATH topology
1AAZA 4Q5NA 4ID0A 1PD21 2VL3A 4ML6A 4OCEA 2K6VA 1ZGNA 5G5EA 1GSQA 2A2PA 1GLPA 1HNBA 3EE2A 4G10A 2V6KA 1ILOA 3IA1A 3KJYA 3CMIA 4CHSA 2LS5A 2H1DA 4L5LA 4NV5A 3GL5A 1FHEA 2C0EA 3VWWA 3VURA 3F63A 3H93A 1WOUA 1ERWA 2H74A 13GSA 3TOUA 4Q5RA 2V32A 2X4AA 1GSDA 1MD4A 4ML1A 2GTUA 2R6KA 2VL2A 2ON5A 3UOMA 2C0GA 2LRCA 6GSSA 3IHQA 1W89A 5IOWA 4KGIA 4PQHA 3GN3A 1ZYQB 3QCPA 3TKSA 5HR0A 3HD5A 5FWGA 5IIZA 4LMWA 1T1VA 1GSSA 2CV4A 4HUAA 2CZ3A 2WZ9A 1M7TA 2H73A 2NTOA 3UIWA 2KP2A 3FEUA 3C1SA 4ZB6A 3J7Yk 4I2UA 2IWTA 3QDNA 1EWXA 4IELA 4MJBA 2BJXA 3PH9A 3ERWA 5BMUA 4EE0A 4GQCA 3C8EA 2YWNA 4TR3A 2M46A 5CNWA 4Q5FA 4X1UA 3D0ZA 2FHEA 4PTSA 2R0GA 1BEDA 1Z6MA 3IE3A 1FAAA 1QK8A 4POLA 2H8LA 5ECIB 3CRTA 3L9SA 5JCWA 1T00A 4X43A 3LSZA 4MF6A 2AJQB 3D5JA 3HJOA 1K0BA 3C1RA 1TI1A 1G6YA 3GTUB 1USBA 1OKDA 4IJIA 3HHVA 2VIMA 4TVEA 4TRXA 1U6TA 2B6MA 1YEXA 2LUSA 2MYGA 5ECSA 3VFIA 3KM6A 2NDOA 4F82A 2C80A 4TN8A 1GTBA 4Z2RA 1PN0A 2LNSA 3G7IA 5AN1A 4XCSA 5IO0A 1OVNA 4K0GA 4I97A 4OD7A 3DVXA 3FY7A 4PX1A 2TRCP 2PERA 3KGKA 5IMZA 1UVZA 3TGZA 5F07A 3GTUA 1SJZA 2VO4A 4GSSA 2AB6A 1ZCPA 4WF4A 3GX0A 2GLRA 3EC3A 2VUPA 1LJRA 3O3TA 5A4VA 1LU4A 4AJ8A 1OYJA 3FZ4A 4ECBA 4MNNA 2LJAA 2FD3A 5LD0A 4ISDA 4POKA 2JL4A 1WPIA 2PUKC 3M9KA 4MK3A 3E0UA 1GUHA 2VD1A 3IBHA 3LXTA 2C4JA 2VM2A 4OFNA 4PXOA 2IFQB 3ZIVA 1K3LA 1PL1A 4IP6A 4GCIA 1YZXA 2HSHA 3IV4A 1MD3A 2VLTA 3P90A 1SJIA 1FVKA 2B1LA 3TKRA 4AJ6A 3VI7A 3F3QA 5JCGA 2HRNA 4OFMA 5LCZA 1M0UA 4IS0A 3CSIA 3MDKA 2G2QA 2GDRA 3A2XA 2VL2C 3HY2A 4RQXA 4F9ZA 2ZNMA 1K0NA 1VF1A 4WETA 3R3EA 2L57A 4MMMA 4POMA 1QMVA 2IL3A 4O5UA 2IMKA 4KX4A 2MZCA 2G0FA 3ZVJA 4CY8A 2IFQA 2EIOA 1HYUA 4X0XA 1IYHA 2QC7A 3GKNA 1M2DA 2QA2A 1PSQA 2R3XA 1PL2A 1PX7A 3ZFBA 5G30A 1B9YC 4BPYA 2HRKA 4HU9A 5CREA 2GZPA 1XPVA 2QKEA 4NPBA 1M9AA 1R5PA 3IC4A 3BBYA 2V2GA 1GH2A 2YZHA 2PVOC 2KHPA 4EKZA 1KBNA 2QGVA 2BTOT 2YWOA 2VCVA 17GSA 3APOA 1G0TA 3QMXA 3BCKA 4RI6A 3GIXA 3GSSA 2AUVA 4OO5A 1JZDA 3GMFA 1NW2A 4ZILA 4DVCA 1K3OA 2H0HA 5A4WA 5DJMA 5B8BA 1Y25A 2WCIA 4FO5A 4K9ZA 4RUVA 1EGOA 1XW9A 1X5EA 4IQAA 3GKMA 3VWXA 3UARA 1KEBA 1TRUA 2F51A 4YAVA 2GGTA 4PNGA 2A2SA 1PA3A 1X9WB 1EGRA 1PN9A 2MMOA 3CXGA 2DJ0A 1TXXA 1YKCA 1Z3EA 3KXOA 3BOAA 1O85A 4IKHA 3KIJA 1ERVA 1A23A 5IO2A 1A2LA 2OBKA 4NXIA 1I9DA 1EOHA 1WRYA 2JADA 4DSQA 1H4OA 4N30A 3D4MA 1XCCA 1A0RP 2JZSA 1GNEA 4O5QA 4KSMA 2F9SA 2DKHA 1XVQA 1RQMA 2FCHA 2H70A 3M9JA 4OO4A 2HZFA 2WRTA 1GL8A 3DWVA 5HFIA 3N5OA 3DMLA 2GQLA 1V40A 1TP9A 3CSJA 2C0FA 3TRPA 3FHKA 3TRXA 3E3EA 3UMAA 1A0FA 1K0MA 1S3DA 3F9UA 3ME8A 2QA1A 2CVBA 2B5YA 2H66A 5CRHA 4CY6A 6GSVA 4ECJA 2WJUA 5CAXA 1ML6A 3D21A 3CRUA 2OACA 2LRNA 4NMUA 2VOCA 1PKZA 2RM6A 1THOA 5G31A 1MDJA 3GKKA 3A2WA 4CW9A 2I3YA 4FQUA 1JLVA 3UEMA 4JEDA 4J2FA 3ZLPA 2JU5A 2O89A 2LQOA 1GUMA 2X8GA 4GLTA 2V1MA 1J08A 2GZZA 4HZ4A 5ECQB 3VWUA 3CYNA 1DE2A 1J0FA 3F8UA 5G1LA 4IHUA 1X9MB 5DALB 2H76A 2RUFA 4OMVA 3TKSE 1SYRA 1PMTA 5COHA 4PNFA 3TUEA 2OE0A 3CBUA 2L59A 4NHZA 2H6YA 1MEKA 3ZTLA 1G7EA 2HRAA 3LEFA 1GSFA 4EIPA 4G0IA 3FZ9A 2N5FA 5AGYA 3DIEA 2XC2A 3IAS2 2LTKA 1FB0A 5G5FA 1F2EA 1WIKA 5LNKe 2O7KA 3EVIA 3WT1A 2CAQA 4KUNA 3AY8A 5DALA 2L5OA 3UL3A 2OA7A 4XRAA 5ELAA 2ON7A 1PKWA 1NHOA 4G0KA 4WXTA 4KF9A 3HYPA 3M1GA 4PUFC 1ZOFA 3ZREA 4KE3A 5ECOB 4LL4B 4KCEA 3IDVA 2YJHA 4PQIA 2E2MA 2GVPA 3TRQA 4I5QA 3LORA 2HNLA 3HVXA 2VM1A 3IK7A 1XOAA 1M9BA 4MJAA 3A2VA 1CQHA 4ZB9A 3ZITA 3CTGA 5IMAA 3R2QA 3KTLA 2C3NA 3FKFA 1SL1B 1AQXA 3UAPA 2WGRA 3TJFA 5JWRB 5AISA 2CX4A 2WB9A 3PGTA 4USSA 4IVFA 2KP1A 4GTUA 4TR4A 2CQ9A 3WGDA 3GX8A 2ZUPA 2I9HA 4IN0A 2IMEA 1B9XC 2FGXA 5EVOA 5B6NA 1T4ZA 1A2JA 3ZMLA 3KCMA 2FA4A 1WE0A 2PGTA 5DCHA 1AC1A 2LKUA 1WJKA 2EC4A 5AIVA 3F3RA 2H71A 1TRVA 3MNGA 4IQ1A 4K5RA 2PWJA 3TKQA 1KTEA 3P7XA 4OFTA 2XHFA 3BD2A 1KNGA 2JSZA 3NZNA 1B4QA 1K0OA 2P0GA 1GTUA 3GA4A 4MDCA 1M2BA 5D9VA 3H4KA 4QL9A 4ZXGA 1XFLA 4ACSA 3Q19A 1QUWA 5GZZB 4EO3A 3L78A 4F2IA 3LW9A 5D96A 3G7YA 1VF3A 2LJKA 3L9UA 2E7PA 2FWFA 5E4WA 4XS1A 2YWMA 1TK5B 5BRTA 4X4JA 2AV4A 2LQQA 1DSBA 4FYCA 2GSQA 6GSUA 2P5RA 3QOUA 2DIZA 2H0GA 2FA8A 1GSUA 2IMFA 2YP6A 4ZL7A 4MJEA 3Q74A 2I1UA 4XS6A 1TW9A 4XHMA 5AIXA 4J57E 5DAKB 2MMAA 1XW5A 1TK8B 3F0IA 4RI7A 2VD0A 1TDIA 4K8MA 1XWCA 1MDKA 4HQZA 6GSXA 3A5WA 4F0BA 2H1AA 1BQ7A 3TCOA 1JFUA 2WS2A 1UN2A 3KD0A 5FHIA 1T3BA 1O8WA 3ZMKA 4EVMA 2ALBA 4O32A 1U3AA 2YNXA 3KTBA 3M8NA 5ECLB 5IMFA 3UVHA 4DEJA 5DAKA 2HI7A 4MH3A 3FW2A 5HR1A 2HFDA 2GQKA 4AJ7A 3GFKA 5B7CA 4PGTA 3O6TA 4ZB8A 4HDEA 2CZ2A 2FWGA 2DJ2A 3GYKA 2HSYA 4I2TA 2R2JA 2VCZA 2N5AA 2YWIA 1BYEA 2VLVA 4V1Ap 3ZIJA 5B8AA 2B5EA 2R0CA 2R0PA 1URMA 2OKAA 4NAXA 1X5DA 4IGJA 5F8BA 3LYKA 1V57A 4NWYA 3MWHA 2M80A 1BAYA 4XTSA 4WR5A 5DBQA 3IXRA 1Q98A 4MA9A 2BMXA 2HT9A 16GSA 1YKAA 2CAIA 5CRWA 4Z7XA 3KMOA 3OR5A 3HJMA 2NVLA 4KCAA 5IM9A 5KOWA 3A5IA 1YDKA 1AXDA 3EMPA 4NHWA 1OC3A 2F8FA 2TRXA 3NOFA 2YJ7A 3DGQA 3TDGA 1SL0B 2LRTA 5HFKA 2C3TA 4BVXB 2C8UA 2O87A 2DJKA 5DJLA 2GSSA 1XOBA 1HNAA 1ERUA 2H01A 9GSSA 2OE3A 3H79A 3ZFLA 1BJXA 2H1GA 4O5RA 3I43A 4J56E 3N9JA 2MMZA 1A2MA 1R26A 3KMNA 4O92A 2IN3A 2PMTA 1T4YA 1XZOA 4XIHA 1N8JA 5CYYA 3VLNA 2FLSA 4BVXA 6GSTA 3I9V2 3M3MA 4WBRD 4JZQA 1GLQA 2TIRA 4FYUA 3I6AA 3HZ4A 3L0HA 5IOXA 1K0AA 4KNDA 2DBCA 4TXVA 4BWQA 3QR6A 1SKWB 4L8EA 4IJ3A 3VWVA 2FUG2 3GRXA 4AGSA 4V2LA 2F8AA 3QFBC 1HQOA 1TJDA 5C04A 3HCZA 1VRSD 3RBTA 3Q6OA 3FR3A 5ENUA 4ZL8A 2LV3A 1OAZA 5ECRB 2I4AA 5KN3A 2O85A 2EIQA 4TR1B 3WD6A 4P3YB 2HSMA 3F4SA 2DLXA 3KH7A 4L0WA 2L6CA 4N0VA 1ZYEA 3FRCA 1OE7A 2GQMA 4TW5A 4G19A 3FZ5A 1Z6NA 5D8IA 3TB2A 2X8HA 1OE8A 3TJGA 3TOTA 2PBJA 3S9FA 1JZRA 2XBQA 2XPDA 3KZQA 4FIWA 2R5GA 2VCWA 2DJ1A 4BA7A 2IMDA 1NHYA 1PGTA 5B6MA 3ZL5A 1FB6A 4TR1A 4GWRA 1GTIA 5KN1A 4YQVA 3C71A 2C1YA 1YY7A 1QXHA 4IP1A 2YN1A 4RQRA 3HJPA 3FR6A 5DQYA 3WT2A 4BVYB 3CSHA 2JZRA 4E8HA 2GSTA 2H72A 3LWAA 5E59A 5G2ZA 3KP8A 2B7JA 2B3SA 2YV9A 1O73A 4G9HA 1IYIA 5KN0A 2DJJA 2OBIA 1YEPA 3IPZA 3EU4A 3EURA 4HOJA 5GSSA 1EEJA 4AF2A 2DIYA 3ZVJD 4GXZA 3QPMA 5H5RA 3FMWA 3D6IA 3BJ5A 4BVYA 2B5XA 4LL1B 2GS3A 1SK0A 2X8CA 3QFAC 4K5SA 1QQ2A 3IR4A 7GSSA 11GSA 1FW1A 1R7HA 3UBKA 4LLRA 5J4UA 2KUCA 1EP8A 3MSZA 5CP1A 3TJBA 1S3AA 3G7JA 1XVWA 2KLXA 3D4TA 5J5NA 5GAND 1SJ6A 1N2AA 3VI5A 10GSA 3DEXA 3G9BA 2H6XA 2AAWA 5ID2B 1F37A 18GSA 2YCDA 1TRWA 2Z9SA 2VLUA 3RPNA 3U6VA 4DSRA 3EYTA 3VPTA 4V2MA 4EC0A 3RHCA 4HZ2A 4PURA 1XIYA 1GSYA 2J23A 3ED3A 1G7OA 3RAZA 3IOSA 3LGCA 1AQWA 5J41A 2X49A 1SD8A 2GZYA 4JRRA 3GV1A 3FYGA 1W4VA 1FOHA 2GT6A 3QAGA 5ID2A 2A4HA 1GUKA 4K2DA 3HVVA 2UZ8A 4F0CA 1SKSB 4PQ1A 1G6WA 4YKGA 4BL7B 2DC5A 5DDLA 3ZRDA 2GT5A 1O7UA 1O8XA 4HU7A 1TTZA 2YZUA 4HI7A 1EEMA 1I5GA 3DKSA 1H75A 5CRDA 2J9HA 2HE3A 3ZYWA 4HJMA 4GSTA 4LMVA 3NIVA 5D9WA 3LJRA 4JR6A 1CQGA 5F05A 5ABRA 2HRFA 3ME7A 3LQ7A 4KW6A 3EINA 4BL7A 1TRSA 3GUSA 2L6DA 1V58A 4WF5A 3DXBA 4JU5A 1VF4A 3F4TA 2MBSA 5GAPD 2LEGA 1U3IA 4MP4A 4ZBBA 4EDYA 3PPUA 2B7KA 1JZOA 2JSYA 1EP7A 2JZTA 5ECNB 2K8VA 3GURA 1SENA 1B48A 1PQNA 1X0RA 4KA0A 3RPPA 3C7MA 1F3BA 1T8EB 1NSWA 4XS4B 5KEJA 3GH9A 2DJ3A 8GSSA 3L4NA 3HZ8A 2RM5A 4F03A 5IMCA 2LNTA 3ERFA 4N0ZA 1UA5A 5L71A 4V1Ag 4KDYA 3GSTA 5H5QA 1SK2A 5DVBA 3F6FA 4K7IA 3K8NA 3TKPA 1XXUA 3W8SA 3FR9A 1ERTA 3E9JB 2H0IA 4MABA 4IBPA 4XS4A 2MBTA 3H8QA 2RLIA 1JLWA 1PRXA 5KOXA 4ILFA 1WWJA 2HZEB 2YOIA 3FK8A 3TJJA 5FT3A 1ZL9A 4YQUA 2CA8A 2VCTA 4EIQA 5IMVA 2R37A 1ACVA 2OADA 3D22A 1OKTA 5J9CA 4E8EA 2H6ZA 1THXA 2K8SA 3Q18A 2REMA 4ZBAA 4OCFA 5H5SA 1SKRB 2YPMA 4EL1A 5EPFA 3APSA 1DBYA 4WR4A 1WMJA 1K3YA 1VF2A 3U5RE 2HLSA 2HZEA 3EU3A 3LYPA 3FZAA 1PX6A 2LJRA 4HS1A 2FY6A 5C00A 3PINA 4YAPA 5DCGA 4ZBDA 3HKRA 1WP0A 2WULA 2DMMA 2DSAA 4KH7A 4DSSB 2MMNA 3IK9A 1QGVA 5JWQB 1TU8A 4EDZA 1Z5YE 4TR0A 1SK1A 4JBBA 2H30A 2RUEA 3P8WA 4KB3A 3EPTA 1GNWA 2OJLA 4LA1A 4N11A 4GF0A 1OC8A 4YQMA 3V1WA 1VGLA 1XW6A 4ICYA 4JR4A 4K6XA 2OE1A 2IIYA 4DSSA 3LXZA 5IPGA 4H86A 4GSNA 5A4UA 1RW1A 1Q4JA 1O6JA 5KN2A 3TJKA 4YKFA 4WKWA 3M0FA 5A5KA 5IQYA 1C72A 3CTFA 1SU9A 2JACA 2HYXA 1X5CA 1YF0A 1ZZYA 5D93A 1AIUA 3DVWA 2FWHA 1F9MA 3GHAA 2LSTA 4ULXA 5D73A 4I6XA 3KP9A 2EIRA 3KEBA 2N5BA 5CRGA 1SYXA 3P2AA 3PR8A 4FYBA 2PPTA 22GSA 3EMXA 1HD2A 3ISOA 1V9WA 2DKIA 12GSA 1ZMAA 2H19A 2D2ZA 3JCML 3IRAA 1M99A 5ECPB 4HQSA 1QFNA 2VCXA 5INYA 4IW9A 3TKSC 1E2YA 2V41A 5G1KA 1YQ1A 4Z2TA 2GSRA 4TXOB 4K0NA 3ZZXA 3QD9A 2H1BA 5ECHB 5F06A 5J3RA 2WDUA 3I69A 1ZYNA 3WGEA 4K7NA 2XPEA 1TKDB 4OWYA 5HFGA 5HQPA 4POBA 2IJYA 4Q5QA 1BX9A 1AUCA 1S3CA 2C0DA 1ST9A 14GSA 1O81A 2DMLA 2ZCTA 2PU9C 4KSOA 3F6DA 4TXOA 4EUYA 1TI3A 4KAEA 1XBSA 2QSIA 2RIIA 1RK4A 1EV4A 3SBCA 1Y6EA 5DQSA 3EWLA 4V2NA 2VCQA 2A2RA 1EV9A 1MTCA 4MH2A 2AYTA 4QL7A 4MJCA 1DUGA 5F0GA 3WYWA 1A24A 2E2GA 1GP1A 4MCUA 3HXSA 1AW9A 5EY6A 1ON4A 3W8JA 2B1KA 1ZYPA 20GSA 1K0CA 2WFCA 4ZL9A 4NV2A 1V2AA 3APQA 1XWKA 4QQ7A 4XRDA 1Z7PA 4L5OA 1DE1A 4K2XA 3UBLA 2PVQA 2L5LA 2XBIA 1U88A 3L9VA 4TKYA 2F3MA 2HXKA 3IHGA 2L4CA 4KDUA 4TOPA 4ZIJA 1Z7RA 3H1NA 3HDCA 4MF7A 2E0QA 5J9BA 1T7PB 4MZCA 2YV7A 5HR2A 3W6GA 3GL3A 4N10A 2CVDA 2FNOA 4MLYA 1TK0B 1GULA 2P31A 3C73A 1SL2B 1JZWA 1B4PA 1FOVA 4BWSA 2IMIA 4FH8A 1GTAA 3US3A 1NM3A 2O8VB 1YJ6A 3A3TA 5ECMB 6GSYA 4G2EA 2A4VA 2IPAA 2VAFA 5ECKB 1ABAA 1E6BA 3GH6A 4JE1A 1TU7A 2K18A 3DYRA 2L4QA 4ECIA 4KDXA 4K1FA 3WGXA 2VL9A 1GWCA 4K7OA 2I81A 3IC8A 4YH2A 3UVTA 3ERGA 5GSTA 4D73B 4ECCA 5JCUA 1X9SB 3LFLA 4L0UA 5D9XA 1JHBA 4GQFA 1F6MC 3HVSA 2K9FA 2KOKA 1R4WA 2AHEA 1R5AA 1Z9HA 2FWEA 3BCIA 3RHBA 3VPQA 2PN8A 2C3QA 1A8LA 3QAWA 4MPGA 3F4RA 4PUAA 1EOGA 1FVJA 1M2AA 2YANA 3MAKA 2H75A 1MDIA 2NBSA 6GSWA 1BG5A 1EZKA 1B8XA 3SWLA 3RDWA 5CO3A 2V6OA 1XWGA 4D73A 4G0LA 1J9BA 3DRNA 4MZBA 1A8YA 2X64A 5JWOB 4WBJA 3LG6A 4MF5A 1FG4A 1U87A 2X99A 4CDOA 4WEYA 2CVKA 1YF1A 2CT6A 3VK9A 3GNJA 4O7HA 4A5PA 1GRXA 4HEA2 4I8BA 3MYDA 4Z2UA 1OC9B 2CX3A 1UC7A 5IMDA 1SD9A 3J7Yb 1XWBA 4EF0A 3KH9A 2NPBA 2P5QA 19GSA 4MZWA 2R4VA 1LBKA 1XWAA 3GKXA 3DD3A 2ES7A 1AQVA 5ELGA 1V98A 5D9TA 4MPFA 1K0DA 1TOFA 3HA9A 3IAM2 4GRFA 3UJ1A 4HJ2A 2M72A 5HR3A 3O76A 1GSEA 4EXJA 1FO5A 3QAVA 1F3AA 1OC9A 3MIXA 1HNCA 5IPHA 5EL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AAZ A;  4Q5N A;  4ID0 A;  1PD2 1;  2VL3 A;  4ML6 A;  4OCE A;  2K6V A;  1ZGN A;  5G5E A;  1GSQ A;  1GLP A;  1HNB A;  3EE2 A;  4G10 A;  2V6K A;  1ILO A;  3IA1 A;  3KJY A;  3CMI A;  4CHS A;  2LS5 A;  2H1D A;  4L5L A;  4NV5 A;  3GL5 A;  1FHE A;  2C0E A;  3VWW A;  3VUR A;  3F63 A;  3H93 A;  1WOU A;  1ERW A;  2H74 A;  13GS A;  3TOU A;  4Q5R A;  2V32 A;  1GSD A;  1MD4 A;  4ML1 A;  2GTU A;  2R6K A;  2VL2 A;  2ON5 A;  3UOM A;  2C0G A;  2LRC A;  6GSS A;  3IHQ A;  1W89 A;  5IOW A;  4KGI A;  4PQH A;  3GN3 A;  1ZYQ B;  3QCP A;  3TKS A;  5HR0 A;  3HD5 A;  5FWG A;  5IIZ A;  4LMW A;  1T1V A;  1GSS A;  2CV4 A;  4HUA A;  2CZ3 A;  2WZ9 A;  1M7T A;  2H73 A;  2NTO A;  3UIW A;  2KP2 A;  3FEU A;  3C1S A;  4ZB6 A;  3J7Y k;  4I2U A;  2IWT A;  3QDN A;  1EWX A;  4IEL A;  4MJB A;  2BJX A;  3PH9 A;  3ERW A;  4EE0 A;  4GQC A;  3C8E A;  2YWN A;  4TR3 A;  2M46 A;  5CNW A;  4Q5F A;  4X1U A;  3D0Z A;  2FHE A;  1BED A;  1Z6M A;  3IE3 A;  1FAA A;  1QK8 A;  4POL A;  2H8L A;  5ECI B;  3CRT A;  3L9S A;  5JCW A;  1T00 A;  4X43 A;  3LSZ A;  4MF6 A;  2AJQ B;  3D5J A;  3HJO A;  1K0B A;  3C1R A;  1TI1 A;  1G6Y A;  3GTU B;  1USB A;  1OKD A;  4IJI A;  3HHV A;  2VIM A;  4TVE A;  4TRX A;  1U6T A;  2B6M A;  1YEX A;  2LUS A;  2MYG A;  5ECS A;  3VFI A;  3KM6 A;  2NDO A;  4F82 A;  2C80 A;  4TN8 A;  1GTB A;  2LNS A;  3G7I A;  5AN1 A;  4XCS A;  5IO0 A;  1OVN A;  4K0G A;  4I97 A;  4OD7 A;  3DVX A;  3FY7 A;  4PX1 A;  2TRC P;  2PER A;  3KGK A;  5IMZ A;  1UVZ A;  3TGZ A;  5F07 A;  3GTU A;  1SJZ A;  2VO4 A;  4GSS A;  2AB6 A;  1ZCP A;  4WF4 A;  3GX0 A;  2GLR A;  3EC3 A;  2VUP A;  1LJR A;  3O3T A;  5A4V A;  1LU4 A;  4AJ8 A;  1OYJ A;  3FZ4 A;  4ECB A;  2LJA A;  2FD3 A;  5LD0 A;  4ISD A;  4POK A;  2JL4 A;  1WPI A;  2PUK C;  3M9K A;  4MK3 A;  3E0U A;  1GUH A;  2VD1 A;  3IBH A;  3LXT A;  2C4J A;  2VM2 A;  4OFN A;  4PXO A;  2IFQ B;  3ZIV A;  1K3L A;  1PL1 A;  4IP6 A;  4GCI A;  1YZX A;  2HSH A;  3IV4 A;  1MD3 A;  2VLT A;  3P90 A;  1SJI A;  1FVK A;  2B1L A;  3TKR A;  4AJ6 A;  3VI7 A;  3F3Q A;  5JCG A;  2HRN A;  4OFM A;  5LCZ A;  1M0U A;  4IS0 A;  3CSI A;  3MDK A;  2G2Q A;  2GDR A;  3A2X A;  2VL2 C;  3HY2 A;  4RQX A;  4F9Z A;  2ZNM A;  1K0N A;  1VF1 A;  4WET A;  2L57 A;  4MMM A;  4POM A;  1QMV A;  2IL3 A;  2IMK A;  4KX4 A;  2MZC A;  2G0F A;  3ZVJ A;  2IFQ A;  2EIO A;  1HYU A;  4X0X A;  1IYH A;  2QC7 A;  3GKN A;  1M2D A;  1PSQ A;  2R3X A;  1PL2 A;  1PX7 A;  3ZFB A;  5G30 A;  1B9Y C;  4BPY A;  4HU9 A;  5CRE A;  2GZP A;  1XPV A;  2QKE A;  4NPB A;  1M9A A;  1R5P A;  3IC4 A;  3BBY A;  2V2G A;  1GH2 A;  2YZH A;  2PVO C;  2KHP A;  4EKZ A;  1KBN A;  2QGV A;  2BTO T;  2YWO A;  2VCV A;  17GS A;  3APO A;  1G0T A;  3QMX A;  3BCK A;  4RI6 A;  3GIX A;  3GSS A;  2AUV A;  4OO5 A;  1JZD A;  3GMF A;  1NW2 A;  4ZIL A;  4DVC A;  1K3O A;  2H0H A;  5A4W A;  5DJM A;  5B8B A;  1Y25 A;  2WCI A;  4FO5 A;  4K9Z A;  4RUV A;  1EGO A;  1XW9 A;  1X5E A;  4IQA A;  3GKM A;  3VWX A;  3UAR A;  1KEB A;  1TRU A;  2F51 A;  4YAV A;  2GGT A;  4PNG A;  2A2S A;  1PA3 A;  1X9W B;  1EGR A;  1PN9 A;  2MMO A;  3CXG A;  2DJ0 A;  1TXX A;  1YKC A;  1Z3E A;  3KXO A;  3BOA A;  1O85 A;  4IKH A;  3KIJ A;  1ERV A;  1A23 A;  5IO2 A;  1A2L A;  2OBK A;  4NXI A;  1I9D A;  1EOH A;  1WRY A;  2JAD A;  4DSQ A;  1H4O A;  4N30 A;  3D4M A;  1XCC A;  1A0R P;  2JZS A;  1GNE A;  4KSM A;  2F9S A;  1XVQ A;  1RQM A;  2FCH A;  2H70 A;  3M9J A;  4OO4 A;  2HZF A;  2WRT A;  1GL8 A;  3DWV A;  5HFI A;  3N5O A;  3DML A;  2GQL A;  1V40 A;  1TP9 A;  3CSJ A;  2C0F A;  3TRP A;  3FHK A;  3TRX A;  3E3E A;  3UMA A;  1A0F A;  1K0M A;  1S3D A;  3F9U A;  3ME8 A;  2CVB A;  2B5Y A;  2H66 A;  5CRH A;  6GSV A;  4ECJ A;  2WJU A;  5CAX A;  1ML6 A;  3D21 A;  3CRU A;  2OAC A;  2LRN A;  4NMU A;  2VOC A;  1PKZ A;  2RM6 A;  1THO A;  5G31 A;  1MDJ A;  3GKK A;  3A2W A;  4CW9 A;  2I3Y A;  1JLV A;  3UEM A;  4JED A;  4J2F A;  3ZLP A;  2JU5 A;  2O89 A;  2LQO A;  1GUM A;  2X8G A;  4GLT A;  2V1M A;  1J08 A;  2GZZ A;  4HZ4 A;  5ECQ B;  3VWU A;  3CYN A;  1DE2 A;  1J0F A;  3F8U A;  5G1L A;  4IHU A;  1X9M B;  5DAL B;  2H76 A;  2RUF A;  4OMV A;  3TKS E;  1SYR A;  1PMT A;  5COH A;  4PNF A;  3TUE A;  2OE0 A;  3CBU A;  2L59 A;  4NHZ A;  2H6Y A;  1MEK A;  3ZTL A;  1G7E A;  3LEF A;  1GSF A;  3FZ9 A;  2N5F A;  5AGY A;  3DIE A;  2XC2 A;  3IAS 2;  2LTK A;  1FB0 A;  5G5F A;  1F2E A;  1WIK A;  5LNK e;  2O7K A;  3EVI A;  3WT1 A;  2CAQ A;  4KUN A;  3AY8 A;  5DAL A;  2L5O A;  3UL3 A;  2OA7 A;  4XRA A;  5ELA A;  2ON7 A;  1PKW A;  1NHO A;  4WXT A;  3HYP A;  3M1G A;  4PUF C;  1ZOF A;  3ZRE A;  4KE3 A;  5ECO B;  4LL4 B;  4KCE A;  3IDV A;  2YJH A;  4PQI A;  2E2M A;  2GVP A;  3TRQ A;  4I5Q A;  3LOR A;  2HNL A;  3HVX A;  2VM1 A;  3IK7 A;  1XOA A;  1M9B A;  4MJA A;  3A2V A;  1CQH A;  4ZB9 A;  3ZIT A;  3CTG A;  5IMA A;  3R2Q A;  3KTL A;  2C3N A;  3FKF A;  1SL1 B;  1AQX A;  3UAP A;  2WGR A;  3TJF A;  5JWR B;  5AIS A;  2CX4 A;  2WB9 A;  3PGT A;  4IVF A;  2KP1 A;  4GTU A;  4TR4 A;  2CQ9 A;  3WGD A;  3GX8 A;  2ZUP A;  2I9H A;  4IN0 A;  2IME A;  1B9X C;  2FGX A;  5EVO A;  5B6N A;  1T4Z A;  1A2J A;  3ZML A;  3KCM A;  2FA4 A;  1WE0 A;  2PGT A;  5DCH A;  1AC1 A;  2LKU A;  1WJK A;  2EC4 A;  5AIV A;  3F3R A;  2H71 A;  1TRV A;  3MNG A;  4IQ1 A;  2PWJ A;  3TKQ A;  1KTE A;  3P7X A;  4OFT A;  2XHF A;  3BD2 A;  1KNG A;  2JSZ A;  3NZN A;  1B4Q A;  1K0O A;  2P0G A;  1GTU A;  3GA4 A;  4MDC A;  1M2B A;  5D9V A;  3H4K A;  4QL9 A;  4ZXG A;  1XFL A;  4ACS A;  3Q19 A;  1QUW A;  5GZZ B;  4EO3 A;  3L78 A;  4F2I A;  5D96 A;  3G7Y A;  1VF3 A;  2LJK A;  3L9U A;  2E7P A;  2FWF A;  5E4W A;  4XS1 A;  2YWM A;  1TK5 B;  2AV4 A;  2LQQ A;  1DSB A;  4FYC A;  2GSQ A;  6GSU A;  2P5R A;  3QOU A;  2DIZ A;  2H0G A;  2FA8 A;  1GSU A;  2IMF A;  2YP6 A;  4ZL7 A;  4MJE A;  3Q74 A;  2I1U A;  4XS6 A;  1TW9 A;  4XHM A;  5AIX A;  4J57 E;  5DAK B;  2MMA A;  1XW5 A;  1TK8 B;  3F0I A;  4RI7 A;  2VD0 A;  1TDI A;  4K8M A;  1XWC A;  1MDK A;  4HQZ A;  6GSX A;  3A5W A;  4F0B A;  2H1A A;  1BQ7 A;  3TCO A;  1JFU A;  2WS2 A;  1UN2 A;  3KD0 A;  5FHI A;  1T3B A;  1O8W A;  3ZMK A;  4EVM A;  2ALB A;  4O32 A;  1U3A A;  2YNX A;  3KTB A;  3M8N A;  5ECL B;  5IMF A;  3UVH A;  4DEJ A;  5DAK A;  2HI7 A;  4MH3 A;  3FW2 A;  5HR1 A;  2HFD A;  2GQK A;  4AJ7 A;  3GFK A;  5B7C A;  4PGT A;  3O6T A;  4ZB8 A;  4HDE A;  2CZ2 A;  2FWG A;  2DJ2 A;  3GYK A;  2HSY A;  4I2T A;  2R2J A;  2VCZ A;  2N5A A;  2YWI A;  1BYE A;  2VLV A;  4V1A p;  3ZIJ A;  5B8A A;  2B5E A;  1URM A;  2OKA A;  4NAX A;  1X5D A;  4IGJ A;  5F8B A;  3LYK A;  1V57 A;  4NWY A;  3MWH A;  2M80 A;  1BAY A;  4XTS A;  4WR5 A;  5DBQ A;  3IXR A;  1Q98 A;  4MA9 A;  2BMX A;  2HT9 A;  16GS A;  1YKA A;  2CAI A;  5CRW A;  4Z7X A;  3KMO A;  3OR5 A;  3HJM A;  2NVL A;  4KCA A;  5IM9 A;  1YDK A;  1AXD A;  3EMP A;  4NHW A;  1OC3 A;  2F8F A;  2TRX A;  3NOF A;  2YJ7 A;  3DGQ A;  3TDG A;  1SL0 B;  2LRT A;  5HFK A;  2C3T A;  2C8U A;  2O87 A;  2DJK A;  5DJL A;  2GSS A;  1XOB A;  1HNA A;  1ERU A;  2H01 A;  9GSS A;  2OE3 A;  3H79 A;  3ZFL A;  1BJX A;  2H1G A;  4O5R A;  3I43 A;  4J56 E;  3N9J A;  2MMZ A;  1A2M A;  1R26 A;  3KMN A;  4O92 A;  2IN3 A;  2PMT A;  1T4Y A;  1XZO A;  4XIH A;  1N8J A;  5CYY A;  3VLN A;  2FLS A;  4BVX A;  6GST A;  3I9V 2;  3M3M A;  4WBR D;  4JZQ A;  1GLQ A;  2TIR A;  4FYU A;  3I6A A;  3HZ4 A;  3L0H A;  5IOX A;  1K0A A;  4KND A;  2DBC A;  4TXV A;  4BWQ A;  3QR6 A;  1SKW B;  4L8E A;  4IJ3 A;  3VWV A;  2FUG 2;  3GRX A;  4AGS A;  4V2L A;  2F8A A;  3QFB C;  1HQO A;  1TJD A;  5C04 A;  3HCZ A;  1VRS D;  3RBT A;  3Q6O A;  3FR3 A;  5ENU A;  4ZL8 A;  2LV3 A;  1OAZ A;  5ECR B;  2I4A A;  5KN3 A;  2O85 A;  2EIQ A;  4TR1 B;  3WD6 A;  4P3Y B;  3F4S A;  2DLX A;  3KH7 A;  4L0W A;  2L6C A;  4N0V A;  1ZYE A;  3FRC A;  1OE7 A;  2GQM A;  4TW5 A;  4G19 A;  3FZ5 A;  1Z6N A;  5D8I A;  3TB2 A;  2X8H A;  1OE8 A;  3TJG A;  3TOT A;  2PBJ A;  3S9F A;  1JZR A;  2XBQ A;  2XPD A;  3KZQ A;  4FIW A;  2R5G A;  2VCW A;  2DJ1 A;  4BA7 A;  2IMD A;  1NHY A;  1PGT A;  5B6M A;  3ZL5 A;  1FB6 A;  4TR1 A;  4GWR A;  1GTI A;  5KN1 A;  4YQV A;  3C71 A;  2C1Y A;  1YY7 A;  1QXH A;  4IP1 A;  2YN1 A;  4RQR A;  3HJP A;  3FR6 A;  5DQY A;  3WT2 A;  3CSH A;  2JZR A;  4E8H A;  2GST A;  2H72 A;  3LWA A;  5E59 A;  5G2Z A;  3KP8 A;  2B7J A;  2B3S A;  2YV9 A;  1O73 A;  4G9H A;  1IYI A;  5KN0 A;  2DJJ A;  2OBI A;  1YEP A;  3IPZ A;  3EU4 A;  3EUR A;  4HOJ A;  5GSS A;  1EEJ A;  4AF2 A;  2DIY A;  3ZVJ D;  4GXZ A;  3QPM A;  5H5R A;  3D6I A;  3BJ5 A;  4BVY A;  2B5X A;  4LL1 B;  2GS3 A;  1SK0 A;  2X8C A;  3QFA C;  1QQ2 A;  3IR4 A;  7GSS A;  11GS A;  1FW1 A;  1R7H A;  3UBK A;  4LLR A;  5J4U A;  2KUC A;  1EP8 A;  3MSZ A;  5CP1 A;  3TJB A;  1S3A A;  3G7J A;  1XVW A;  2KLX A;  3D4T A;  5J5N A;  5GAN D;  1SJ6 A;  1N2A A;  3VI5 A;  10GS A;  3DEX A;  3G9B A;  2H6X A;  2AAW A;  5ID2 B;  1F37 A;  18GS A;  2YCD A;  1TRW A;  2Z9S A;  2VLU A;  3RPN A;  3U6V A;  4DSR A;  3EYT A;  3VPT A;  4V2M A;  4EC0 A;  3RHC A;  4HZ2 A;  4PUR A;  1XIY A;  1GSY A;  2J23 A;  3ED3 A;  1G7O A;  3RAZ A;  3IOS A;  3LGC A;  1AQW A;  5J41 A;  1SD8 A;  2GZY A;  4JRR A;  3GV1 A;  3FYG A;  1W4V A;  2GT6 A;  3QAG A;  5ID2 A;  1GUK A;  4K2D A;  3HVV A;  4F0C A;  1SKS B;  4PQ1 A;  1G6W A;  2DC5 A;  5DDL A;  3ZRD A;  2GT5 A;  1O7U A;  1O8X A;  4HU7 A;  1TTZ A;  2YZU A;  4HI7 A;  1EEM A;  1I5G A;  3DKS A;  1H75 A;  5CRD A;  2J9H A;  2HE3 A;  3ZYW A;  4HJM A;  4GST A;  4LMV A;  3NIV A;  5D9W A;  3LJR A;  4JR6 A;  1CQG A;  5F05 A;  5ABR A;  2HRF A;  3ME7 A;  3LQ7 A;  4KW6 A;  3EIN A;  4BL7 A;  1TRS A;  3GUS A;  2L6D A;  1V58 A;  4WF5 A;  3DXB A;  4JU5 A;  1VF4 A;  3F4T A;  2MBS A;  5GAP D;  2LEG A;  1U3I A;  4MP4 A;  4ZBB A;  4EDY A;  2B7K A;  1JZO A;  2JSY A;  1EP7 A;  2JZT A;  5ECN B;  2K8V A;  3GUR A;  1SEN A;  1B48 A;  1PQN A;  1X0R A;  4KA0 A;  3RPP A;  3C7M A;  1F3B A;  1T8E B;  1NSW A;  4XS4 B;  5KEJ A;  3GH9 A;  2DJ3 A;  8GSS A;  3L4N A;  3HZ8 A;  2RM5 A;  4F03 A;  5IMC A;  2LNT A;  3ERF A;  4N0Z A;  1UA5 A;  5L71 A;  4V1A g;  4KDY A;  3GST A;  5H5Q A;  1SK2 A;  5DVB A;  3F6F A;  4K7I A;  3K8N A;  3TKP A;  1XXU A;  3W8S A;  3FR9 A;  1ERT A;  3E9J B;  2H0I A;  4MAB A;  4IBP A;  4XS4 A;  2MBT A;  3H8Q A;  2RLI A;  1JLW A;  1PRX A;  4ILF A;  1WWJ A;  2HZE B;  2YOI A;  3FK8 A;  3TJJ A;  5FT3 A;  1ZL9 A;  4YQU A;  2CA8 A;  2VCT A;  5IMV A;  2R37 A;  1ACV A;  2OAD A;  3D22 A;  1OKT A;  5J9C A;  4E8E A;  2H6Z A;  1THX A;  2K8S A;  3Q18 A;  2REM A;  4ZBA A;  4OCF A;  5H5S A;  1SKR B;  2YPM A;  4EL1 A;  5EPF A;  3APS A;  1DBY A;  4WR4 A;  1WMJ A;  1K3Y A;  1VF2 A;  3U5R E;  2HLS A;  2HZE A;  3EU3 A;  3LYP A;  3FZA A;  1PX6 A;  2LJR A;  4HS1 A;  2FY6 A;  5C00 A;  3PIN A;  4YAP A;  5DCG A;  4ZBD A;  3HKR A;  1WP0 A;  2WUL A;  2DMM A;  2DSA A;  4KH7 A;  4DSS B;  2MMN A;  3IK9 A;  1QGV A;  5JWQ B;  1TU8 A;  4EDZ A;  1Z5Y E;  4TR0 A;  1SK1 A;  4JBB A;  2H30 A;  2RUE A;  3P8W A;  4KB3 A;  1GNW A;  2OJL A;  4LA1 A;  4N11 A;  4GF0 A;  1OC8 A;  4YQM A;  3V1W A;  1VGL A;  1XW6 A;  4JR4 A;  4K6X A;  2OE1 A;  2IIY A;  4DSS A;  3LXZ A;  5IPG A;  4H86 A;  4GSN A;  5A4U A;  1RW1 A;  1Q4J A;  1O6J A;  5KN2 A;  3TJK A;  4WKW A;  3M0F A;  5A5K A;  5IQY A;  1C72 A;  3CTF A;  1SU9 A;  2JAC A;  2HYX A;  1YF0 A;  1X5C A;  1ZZY A;  5D93 A;  1AIU A;  3DVW A;  2FWH A;  1F9M A;  3GHA A;  2LST A;  4ULX A;  5D73 A;  4I6X A;  3KP9 A;  2EIR A;  3KEB A;  2N5B A;  5CRG A;  1SYX A;  3P2A A;  3PR8 A;  4FYB A;  2PPT A;  22GS A;  3EMX A;  1HD2 A;  3ISO A;  1V9W A;  12GS A;  1ZMA A;  2H19 A;  2D2Z A;  3JCM L;  3IRA A;  1M99 A;  5ECP B;  4HQS A;  1QFN A;  2VCX A;  5INY A;  4IW9 A;  3TKS C;  1E2Y A;  2V41 A;  5G1K A;  1YQ1 A;  2GSR A;  4TXO B;  4K0N A;  3ZZX A;  3QD9 A;  2H1B A;  5ECH B;  5F06 A;  5J3R A;  2WDU A;  3I69 A;  3WGE A;  4K7N A;  2XPE A;  1TKD B;  4OWY A;  5HFG A;  5HQP A;  4POB A;  2IJY A;  4Q5Q A;  1BX9 A;  1AUC A;  1S3C A;  2C0D A;  1ST9 A;  14GS A;  1O81 A;  2DML A;  2ZCT A;  2PU9 C;  4KSO A;  3F6D A;  4TXO A;  4EUY A;  1TI3 A;  4KAE A;  1XBS A;  2QSI A;  2RII A;  1RK4 A;  1EV4 A;  3SBC A;  1Y6E A;  5DQS A;  3EWL A;  4V2N A;  2VCQ A;  2A2R A;  1EV9 A;  1MTC A;  4MH2 A;  2AYT A;  4QL7 A;  4MJC A;  1DUG A;  5F0G A;  3WYW A;  1A24 A;  2E2G A;  1GP1 A;  4MCU A;  3HXS A;  1AW9 A;  5EY6 A;  1ON4 A;  3W8J A;  2B1K A;  20GS A;  1K0C A;  2WFC A;  4ZL9 A;  4NV2 A;  1V2A A;  3APQ A;  1XWK A;  4QQ7 A;  4XRD A;  1Z7P A;  4L5O A;  1DE1 A;  3UBL A;  2PVQ A;  2L5L A;  2XBI A;  1U88 A;  3L9V A;  4TKY A;  2F3M A;  2HXK A;  2L4C A;  4KDU A;  4TOP A;  4ZIJ A;  1Z7R A;  3H1N A;  3HDC A;  4MF7 A;  2E0Q A;  5J9B A;  1T7P B;  4MZC A;  2YV7 A;  5HR2 A;  3W6G A;  3GL3 A;  4N10 A;  2CVD A;  2FNO A;  4MLY A;  1TK0 B;  1GUL A;  2P31 A;  3C73 A;  1SL2 B;  1JZW A;  1B4P A;  1FOV A;  4BWS A;  2IMI A;  4FH8 A;  1GTA A;  3US3 A;  1NM3 A;  2O8V B;  1YJ6 A;  3A3T A;  5ECM B;  6GSY A;  4G2E A;  2A4V A;  2IPA A;  2VAF A;  5ECK B;  1ABA A;  1E6B A;  3GH6 A;  4JE1 A;  1TU7 A;  2K18 A;  3DYR A;  2L4Q A;  4ECI A;  4KDX A;  4K1F A;  3WGX A;  2VL9 A;  1GWC A;  4K7O A;  2I81 A;  4YH2 A;  3UVT A;  3ERG A;  5GST A;  4D73 B;  4ECC A;  5JCU A;  1X9S B;  3LFL A;  4L0U A;  5D9X A;  1JHB A;  4GQF A;  1F6M C;  3HVS A;  2K9F A;  2KOK A;  1R4W A;  2AHE A;  1R5A A;  1Z9H A;  2FWE A;  3BCI A;  3RHB A;  3VPQ A;  2PN8 A;  2C3Q A;  1A8L A;  3QAW A;  4MPG A;  3F4R A;  4PUA A;  1EOG A;  1FVJ A;  1M2A A;  2YAN A;  3MAK A;  2H75 A;  1MDI A;  2NBS A;  6GSW A;  1BG5 A;  1EZK A;  1B8X A;  3SWL A;  3RDW A;  5CO3 A;  2V6O A;  1XWG A;  4D73 A;  1J9B A;  3DRN A;  4MZB A;  1A8Y A;  2X64 A;  5JWO B;  4WBJ A;  3LG6 A;  4MF5 A;  1FG4 A;  1U87 A;  2X99 A;  4CDO A;  4WEY A;  2CVK A;  1YF1 A;  2CT6 A;  3VK9 A;  3GNJ A;  4O7H A;  1GRX A;  4HEA 2;  4I8B A;  1OC9 B;  2CX3 A;  1UC7 A;  5IMD A;  1SD9 A;  3J7Y b;  1XWB A;  4EF0 A;  3KH9 A;  2NPB A;  2P5Q A;  19GS A;  4MZW A;  2R4V A;  1LBK A;  1XWA A;  3GKX A;  3DD3 A;  2ES7 A;  1AQV A;  5ELG A;  1V98 A;  5D9T A;  4MPF A;  1K0D A;  1TOF A;  3HA9 A;  3IAM 2;  4GRF A;  3UJ1 A;  4HJ2 A;  2M72 A;  5HR3 A;  3O76 A;  1GSE A;  4EXJ A;  1FO5 A;  3QAV A;  1F3A A;  1OC9 A;  1HNC A;  5IPH A;  5EL8 A; 
#chains in the Genus database with same CATH topology
 1AAZ A;  4Q5N A;  4ID0 A;  1PD2 1;  2VL3 A;  4ML6 A;  4OCE A;  2K6V A;  1ZGN A;  5G5E A;  1GSQ A;  2A2P A;  1GLP A;  1HNB A;  3EE2 A;  4G10 A;  2V6K A;  1ILO A;  3IA1 A;  3KJY A;  3CMI A;  4CHS A;  2LS5 A;  2H1D A;  4L5L A;  4NV5 A;  3GL5 A;  1FHE A;  2C0E A;  3VWW A;  3VUR A;  3F63 A;  3H93 A;  1WOU A;  1ERW A;  2H74 A;  13GS A;  3TOU A;  4Q5R A;  2V32 A;  2X4A A;  1GSD A;  1MD4 A;  4ML1 A;  2GTU A;  2R6K A;  2VL2 A;  2ON5 A;  3UOM A;  2C0G A;  2LRC A;  6GSS A;  3IHQ A;  1W89 A;  5IOW A;  4KGI A;  4PQH A;  3GN3 A;  1ZYQ B;  3QCP A;  3TKS A;  5HR0 A;  3HD5 A;  5FWG A;  5IIZ A;  4LMW A;  1T1V A;  1GSS A;  2CV4 A;  4HUA A;  2CZ3 A;  2WZ9 A;  1M7T A;  2H73 A;  2NTO A;  3UIW A;  2KP2 A;  3FEU A;  3C1S A;  4ZB6 A;  3J7Y k;  4I2U A;  2IWT A;  3QDN A;  1EWX A;  4IEL A;  4MJB A;  2BJX A;  3PH9 A;  3ERW A;  5BMU A;  4EE0 A;  4GQC A;  3C8E A;  2YWN A;  4TR3 A;  2M46 A;  5CNW A;  4Q5F A;  4X1U A;  3D0Z A;  2FHE A;  4PTS A;  2R0G A;  1BED A;  1Z6M A;  3IE3 A;  1FAA A;  1QK8 A;  4POL A;  2H8L A;  5ECI B;  3CRT A;  3L9S A;  5JCW A;  1T00 A;  4X43 A;  3LSZ A;  4MF6 A;  2AJQ B;  3D5J A;  3HJO A;  1K0B A;  3C1R A;  1TI1 A;  1G6Y A;  3GTU B;  1USB A;  1OKD A;  4IJI A;  3HHV A;  2VIM A;  4TVE A;  4TRX A;  1U6T A;  2B6M A;  1YEX A;  2LUS A;  2MYG A;  5ECS A;  3VFI A;  3KM6 A;  2NDO A;  4F82 A;  2C80 A;  4TN8 A;  1GTB A;  4Z2R A;  1PN0 A;  2LNS A;  3G7I A;  5AN1 A;  4XCS A;  5IO0 A;  1OVN A;  4K0G A;  4I97 A;  4OD7 A;  3DVX A;  3FY7 A;  4PX1 A;  2TRC P;  2PER A;  3KGK A;  5IMZ A;  1UVZ A;  3TGZ A;  5F07 A;  3GTU A;  1SJZ A;  2VO4 A;  4GSS A;  2AB6 A;  1ZCP A;  4WF4 A;  3GX0 A;  2GLR A;  3EC3 A;  2VUP A;  1LJR A;  3O3T A;  5A4V A;  1LU4 A;  4AJ8 A;  1OYJ A;  3FZ4 A;  4ECB A;  4MNN A;  2LJA A;  2FD3 A;  5LD0 A;  4ISD A;  4POK A;  2JL4 A;  1WPI A;  2PUK C;  3M9K A;  4MK3 A;  3E0U A;  1GUH A;  2VD1 A;  3IBH A;  3LXT A;  2C4J A;  2VM2 A;  4OFN A;  4PXO A;  2IFQ B;  3ZIV A;  1K3L A;  1PL1 A;  4IP6 A;  4GCI A;  1YZX A;  2HSH A;  3IV4 A;  1MD3 A;  2VLT A;  3P90 A;  1SJI A;  1FVK A;  2B1L A;  3TKR A;  4AJ6 A;  3VI7 A;  3F3Q A;  5JCG A;  2HRN A;  4OFM A;  5LCZ A;  1M0U A;  4IS0 A;  3CSI A;  3MDK A;  2G2Q A;  2GDR A;  3A2X A;  2VL2 C;  3HY2 A;  4RQX A;  4F9Z A;  2ZNM A;  1K0N A;  1VF1 A;  4WET A;  3R3E A;  2L57 A;  4MMM A;  4POM A;  1QMV A;  2IL3 A;  4O5U A;  2IMK A;  4KX4 A;  2MZC A;  2G0F A;  3ZVJ A;  4CY8 A;  2IFQ A;  2EIO A;  1HYU A;  4X0X A;  1IYH A;  2QC7 A;  3GKN A;  1M2D A;  2QA2 A;  1PSQ A;  2R3X A;  1PL2 A;  1PX7 A;  3ZFB A;  5G30 A;  1B9Y C;  4BPY A;  2HRK A;  4HU9 A;  5CRE A;  2GZP A;  1XPV A;  2QKE A;  4NPB A;  1M9A A;  1R5P A;  3IC4 A;  3BBY A;  2V2G A;  1GH2 A;  2YZH A;  2PVO C;  2KHP A;  4EKZ A;  1KBN A;  2QGV A;  2BTO T;  2YWO A;  2VCV A;  17GS A;  3APO A;  1G0T A;  3QMX A;  3BCK A;  4RI6 A;  3GIX A;  3GSS A;  2AUV A;  4OO5 A;  1JZD A;  3GMF A;  1NW2 A;  4ZIL A;  4DVC A;  1PFO A;  1K3O A;  2H0H A;  5A4W A;  5DJM A;  5B8B A;  1Y25 A;  2WCI A;  4FO5 A;  4K9Z A;  4RUV A;  1EGO A;  1XW9 A;  1X5E A;  4IQA A;  3GKM A;  3VWX A;  3UAR A;  1KEB A;  1TRU A;  2F51 A;  4YAV A;  2GGT A;  4PNG A;  2A2S A;  1PA3 A;  1X9W B;  1EGR A;  1PN9 A;  2MMO A;  3CXG A;  2DJ0 A;  1TXX A;  1YKC A;  1Z3E A;  3KXO A;  3BOA A;  1O85 A;  4IKH A;  3KIJ A;  1ERV A;  1A23 A;  5IO2 A;  1A2L A;  2OBK A;  4NXI A;  1I9D A;  1EOH A;  1WRY A;  2JAD A;  4DSQ A;  1H4O A;  4N30 A;  3D4M A;  1XCC A;  1A0R P;  2JZS A;  1GNE A;  4O5Q A;  4KSM A;  2F9S A;  2DKH A;  1XVQ A;  1RQM A;  2FCH A;  2H70 A;  3M9J A;  4OO4 A;  2HZF A;  2WRT A;  1GL8 A;  3DWV A;  5HFI A;  3N5O A;  3DML A;  2GQL A;  1V40 A;  1TP9 A;  3CSJ A;  2C0F A;  3TRP A;  3FHK A;  3TRX A;  3E3E A;  3UMA A;  1A0F A;  1K0M A;  1S3D A;  3F9U A;  3ME8 A;  2QA1 A;  2CVB A;  2B5Y A;  2H66 A;  5CRH A;  4CY6 A;  6GSV A;  4ECJ A;  2WJU A;  5CAX A;  1ML6 A;  3D21 A;  3CRU A;  2OAC A;  2LRN A;  4NMU A;  2VOC A;  3HVN A;  1PKZ A;  2RM6 A;  1THO A;  5G31 A;  1MDJ A;  3GKK A;  3A2W A;  4CW9 A;  2I3Y A;  4FQU A;  1JLV A;  3UEM A;  4JED A;  4J2F A;  3ZLP A;  2JU5 A;  2O89 A;  2LQO A;  1GUM A;  2X8G A;  4GLT A;  2V1M A;  1J08 A;  2GZZ A;  4HZ4 A;  5ECQ B;  3VWU A;  3CYN A;  1DE2 A;  1J0F A;  3F8U A;  5G1L A;  4IHU A;  1X9M B;  5DAL B;  2H76 A;  2RUF A;  4OMV A;  3TKS E;  1SYR A;  1PMT A;  5COH A;  4PNF A;  3TUE A;  2OE0 A;  3CQF A;  3CBU A;  2L59 A;  4NHZ A;  2H6Y A;  1MEK A;  3ZTL A;  1G7E A;  2HRA A;  3LEF A;  1GSF A;  4EIP A;  4G0I A;  3FZ9 A;  2N5F A;  5AGY A;  3DIE A;  2XC2 A;  3IAS 2;  2LTK A;  1FB0 A;  5G5F A;  1F2E A;  1WIK A;  5LNK e;  2O7K A;  3EVI A;  3WT1 A;  2CAQ A;  4KUN A;  3AY8 A;  5DAL A;  2L5O A;  3UL3 A;  2OA7 A;  4XRA A;  5ELA A;  2ON7 A;  1PKW A;  1NHO A;  4G0K A;  4WXT A;  4KF9 A;  3HYP A;  3M1G A;  4PUF C;  1ZOF A;  3ZRE A;  4KE3 A;  5ECO B;  4LL4 B;  4KCE A;  3IDV A;  2YJH A;  4PQI A;  2E2M A;  2GVP A;  3TRQ A;  4I5Q A;  3LOR A;  2HNL A;  3HVX A;  2VM1 A;  3IK7 A;  1XOA A;  1M9B A;  4MJA A;  3A2V A;  1CQH A;  4ZB9 A;  3ZIT A;  3CTG A;  5IMA A;  3R2Q A;  3KTL A;  2C3N A;  3FKF A;  1SL1 B;  1AQX A;  3UAP A;  2WGR A;  3TJF A;  5JWR B;  5AIS A;  2CX4 A;  2WB9 A;  3PGT A;  4USS A;  4IVF A;  2KP1 A;  4GTU A;  4TR4 A;  2CQ9 A;  3WGD A;  3GX8 A;  2ZUP A;  2I9H A;  4IN0 A;  2IME A;  1B9X C;  2FGX A;  5EVO A;  5B6N A;  1T4Z A;  1A2J A;  3ZML A;  3KCM A;  2FA4 A;  1WE0 A;  2PGT A;  5DCH A;  1AC1 A;  2LKU A;  1WJK A;  2EC4 A;  5AIV A;  3F3R A;  2H71 A;  1TRV A;  3MNG A;  4IQ1 A;  4K5R A;  2PWJ A;  3TKQ A;  1KTE A;  3P7X A;  4OFT A;  2XHF A;  3BD2 A;  1KNG A;  2JSZ A;  3NZN A;  1B4Q A;  1K0O A;  2P0G A;  1GTU A;  3GA4 A;  4MDC A;  1M2B A;  5D9V A;  3H4K A;  4QL9 A;  4ZXG A;  1XFL A;  4ACS A;  3Q19 A;  1QUW A;  5GZZ B;  4EO3 A;  3L78 A;  4F2I A;  3LW9 A;  5D96 A;  3G7Y A;  1VF3 A;  2LJK A;  3L9U A;  2E7P A;  2FWF A;  5E4W A;  4XS1 A;  2YWM A;  1TK5 B;  5BRT A;  4X4J A;  2AV4 A;  2LQQ A;  1DSB A;  4FYC A;  2GSQ A;  6GSU A;  2P5R A;  3QOU A;  2DIZ A;  2H0G A;  2FA8 A;  1GSU A;  2IMF A;  2YP6 A;  4ZL7 A;  4MJE A;  3Q74 A;  2I1U A;  4XS6 A;  1TW9 A;  4XHM A;  5AIX A;  4J57 E;  5DAK B;  2MMA A;  1XW5 A;  1TK8 B;  3F0I A;  4RI7 A;  2VD0 A;  1TDI A;  4K8M A;  1XWC A;  1MDK A;  4HQZ A;  6GSX A;  3A5W A;  4F0B A;  2H1A A;  1BQ7 A;  3TCO A;  1JFU A;  2WS2 A;  1UN2 A;  3KD0 A;  5FHI A;  1T3B A;  1O8W A;  3ZMK A;  4EVM A;  2ALB A;  4O32 A;  1U3A A;  2YNX A;  3KTB A;  3M8N A;  5ECL B;  5IMF A;  3UVH A;  4DEJ A;  5DAK A;  2HI7 A;  3FW2 A;  4MH3 A;  5HR1 A;  2HFD A;  2GQK A;  4AJ7 A;  3GFK A;  5B7C A;  4PGT A;  3O6T A;  4ZB8 A;  4HDE A;  2CZ2 A;  2FWG A;  2DJ2 A;  3GYK A;  2HSY A;  4I2T A;  2R2J A;  2VCZ A;  2N5A A;  2YWI A;  1BYE A;  2VLV A;  4V1A p;  3ZIJ A;  5B8A A;  2B5E A;  2R0C A;  2R0P A;  1URM A;  2OKA A;  4NAX A;  1X5D A;  4IGJ A;  5F8B A;  3LYK A;  1V57 A;  4NWY A;  3MWH A;  2M80 A;  1BAY A;  4XTS A;  4WR5 A;  5DBQ A;  3IXR A;  1Q98 A;  4MA9 A;  2BMX A;  2HT9 A;  16GS A;  1YKA A;  2CAI A;  5CRW A;  4Z7X A;  3KMO A;  3OR5 A;  3HJM A;  2NVL A;  4KCA A;  5IM9 A;  5KOW A;  3A5I A;  1YDK A;  1AXD A;  3EMP A;  4NHW A;  1OC3 A;  2F8F A;  2TRX A;  3NOF A;  2YJ7 A;  3DGQ A;  3TDG A;  1SL0 B;  2LRT A;  5HFK A;  2C3T A;  4BVX B;  2C8U A;  2O87 A;  2DJK A;  5DJL A;  2GSS A;  1XOB A;  1HNA A;  1ERU A;  2H01 A;  9GSS A;  2OE3 A;  3H79 A;  3ZFL A;  1BJX A;  2H1G A;  4O5R A;  3I43 A;  4J56 E;  3N9J A;  2MMZ A;  1A2M A;  1R26 A;  3KMN A;  4O92 A;  2IN3 A;  2PMT A;  1T4Y A;  1XZO A;  4XIH A;  1N8J A;  5CYY A;  3VLN A;  2FLS A;  4BVX A;  6GST A;  3I9V 2;  3M3M A;  4WBR D;  4JZQ A;  1GLQ A;  2TIR A;  4FYU A;  3I6A A;  3HZ4 A;  3L0H A;  5IOX A;  1K0A A;  4KND A;  2DBC A;  4TXV A;  4BWQ A;  3QR6 A;  1SKW B;  4L8E A;  4IJ3 A;  3VWV A;  2FUG 2;  3GRX A;  4AGS A;  4V2L A;  2F8A A;  3QFB C;  1HQO A;  1TJD A;  5C04 A;  3HCZ A;  1VRS D;  3RBT A;  3Q6O A;  3FR3 A;  5ENU A;  4ZL8 A;  2LV3 A;  1OAZ A;  5ECR B;  2I4A A;  5KN3 A;  2O85 A;  2EIQ A;  4TR1 B;  3WD6 A;  4P3Y B;  2HSM A;  3F4S A;  2DLX A;  3KH7 A;  4L0W A;  2L6C A;  4N0V A;  1ZYE A;  3FRC A;  1OE7 A;  2GQM A;  4TW5 A;  4G19 A;  3FZ5 A;  1Z6N A;  5D8I A;  3TB2 A;  2X8H A;  1OE8 A;  3TJG A;  3TOT A;  2PBJ A;  3S9F A;  1JZR A;  2XBQ A;  2XPD A;  3KZQ A;  4FIW A;  2R5G A;  2VCW A;  2DJ1 A;  4BA7 A;  2IMD A;  1NHY A;  1PGT A;  5B6M A;  3ZL5 A;  1FB6 A;  4TR1 A;  4GWR A;  1GTI A;  5KN1 A;  4YQV A;  3C71 A;  2C1Y A;  1YY7 A;  1QXH A;  4IP1 A;  2YN1 A;  4RQR A;  3HJP A;  3FR6 A;  5DQY A;  3WT2 A;  4BVY B;  3CSH A;  2JZR A;  4E8H A;  2GST A;  2H72 A;  3LWA A;  5E59 A;  5G2Z A;  3KP8 A;  2B7J A;  2B3S A;  2YV9 A;  1O73 A;  4G9H A;  1IYI A;  5KN0 A;  2DJJ A;  2OBI A;  1YEP A;  3IPZ A;  3EU4 A;  3EUR A;  4HOJ A;  5GSS A;  1EEJ A;  4AF2 A;  2DIY A;  3ZVJ D;  4GXZ A;  3QPM A;  5H5R A;  3FMW A;  3D6I A;  3BJ5 A;  4BVY A;  2B5X A;  4LL1 B;  2GS3 A;  1SK0 A;  2X8C A;  3QFA C;  4K5S A;  1QQ2 A;  3IR4 A;  7GSS A;  11GS A;  1FW1 A;  1R7H A;  3UBK A;  4LLR A;  5J4U A;  2KUC A;  1EP8 A;  3MSZ A;  5CP1 A;  3TJB A;  1S3A A;  3G7J A;  1XVW A;  2KLX A;  3D4T A;  5J5N A;  5GAN D;  1SJ6 A;  1N2A A;  3VI5 A;  10GS A;  3DEX A;  3G9B A;  2H6X A;  2AAW A;  5ID2 B;  1F37 A;  18GS A;  2YCD A;  1TRW A;  2Z9S A;  2VLU A;  3RPN A;  3U6V A;  4DSR A;  3EYT A;  3VPT A;  4V2M A;  4EC0 A;  3RHC A;  4HZ2 A;  4PUR A;  1XIY A;  1GSY A;  2J23 A;  3ED3 A;  1G7O A;  3RAZ A;  3IOS A;  3LGC A;  1AQW A;  5J41 A;  2X49 A;  1SD8 A;  2GZY A;  4JRR A;  3GV1 A;  3FYG A;  1W4V A;  1FOH A;  2GT6 A;  3QAG A;  5ID2 A;  2A4H A;  1GUK A;  4K2D A;  3HVV A;  2UZ8 A;  4F0C A;  1SKS B;  4PQ1 A;  1G6W A;  4YKG A;  4BL7 B;  2DC5 A;  5DDL A;  3ZRD A;  2GT5 A;  1O7U A;  1O8X A;  4HU7 A;  1TTZ A;  2YZU A;  4HI7 A;  1EEM A;  1I5G A;  3DKS A;  1H75 A;  5CRD A;  2J9H A;  2HE3 A;  3ZYW A;  4HJM A;  4GST A;  4LMV A;  3NIV A;  5D9W A;  3LJR A;  4JR6 A;  1CQG A;  5F05 A;  5ABR A;  2HRF A;  3ME7 A;  3LQ7 A;  4KW6 A;  3EIN A;  4BL7 A;  1TRS A;  3GUS A;  2L6D A;  1V58 A;  4WF5 A;  3DXB A;  4JU5 A;  1VF4 A;  3F4T A;  2MBS A;  5GAP D;  2LEG A;  1U3I A;  4MP4 A;  4ZBB A;  4EDY A;  3PPU A;  2B7K A;  1JZO A;  2JSY A;  1EP7 A;  2JZT A;  5ECN B;  2K8V A;  3GUR A;  1SEN A;  1B48 A;  1PQN A;  1X0R A;  4KA0 A;  3RPP A;  3C7M A;  1F3B A;  1T8E B;  1NSW A;  4XS4 B;  5KEJ A;  3GH9 A;  2DJ3 A;  8GSS A;  3L4N A;  3HZ8 A;  2RM5 A;  1M3I A;  4F03 A;  5IMC A;  2LNT A;  3ERF A;  4N0Z A;  1UA5 A;  5L71 A;  4V1A g;  4KDY A;  3GST A;  5H5Q A;  1SK2 A;  5DVB A;  3F6F A;  4K7I A;  3K8N A;  3TKP A;  1XXU A;  3W8S A;  3FR9 A;  1ERT A;  3E9J B;  2H0I A;  4MAB A;  4IBP A;  4XS4 A;  2MBT A;  3H8Q A;  2RLI A;  1JLW A;  1PRX A;  5KOX A;  4ILF A;  1WWJ A;  2HZE B;  2YOI A;  3FK8 A;  3TJJ A;  5FT3 A;  1ZL9 A;  4YQU A;  2CA8 A;  2VCT A;  4EIQ A;  5IMV A;  2R37 A;  1ACV A;  4HSC X;  2OAD A;  3D22 A;  1OKT A;  5J9C A;  4E8E A;  2H6Z A;  1THX A;  2K8S A;  3Q18 A;  2REM A;  4ZBA A;  4OCF A;  5H5S A;  1SKR B;  2YPM A;  4EL1 A;  5EPF A;  3APS A;  1DBY A;  4WR4 A;  1WMJ A;  1K3Y A;  1VF2 A;  3U5R E;  2HLS A;  2HZE A;  3EU3 A;  3LYP A;  3FZA A;  1PX6 A;  2LJR A;  4HS1 A;  2FY6 A;  5C00 A;  3PIN A;  4YAP A;  5DCG A;  4ZBD A;  3HKR A;  1WP0 A;  2WUL A;  2DMM A;  2DSA A;  4KH7 A;  4DSS B;  2MMN A;  3IK9 A;  1QGV A;  5JWQ B;  1TU8 A;  4EDZ A;  1Z5Y E;  4TR0 A;  1SK1 A;  4JBB A;  2H30 A;  2RUE A;  3P8W A;  4KB3 A;  3EPT A;  1GNW A;  2OJL A;  4LA1 A;  4N11 A;  4GF0 A;  1OC8 A;  4YQM A;  3V1W A;  1VGL A;  1XW6 A;  4ICY A;  4JR4 A;  4K6X A;  2OE1 A;  2IIY A;  4DSS A;  3LXZ A;  5IPG A;  4H86 A;  4GSN A;  5A4U A;  1RW1 A;  1Q4J A;  1O6J A;  5KN2 A;  3TJK A;  4YKF A;  4WKW A;  3M0F A;  5A5K A;  5IQY A;  1C72 A;  3CTF A;  1SU9 A;  2JAC A;  2HYX A;  1X5C A;  1YF0 A;  1ZZY A;  5D93 A;  1AIU A;  3DVW A;  2FWH A;  1F9M A;  3GHA A;  2LST A;  4ULX A;  5D73 A;  4I6X A;  3KP9 A;  2EIR A;  3KEB A;  2N5B A;  5CRG A;  1SYX A;  3P2A A;  3PR8 A;  4FYB A;  1M3J A;  2PPT A;  22GS A;  3EMX A;  1HD2 A;  3ISO A;  1V9W A;  2DKI A;  12GS A;  1ZMA A;  2H19 A;  2D2Z A;  3JCM L;  3IRA A;  1M99 A;  5ECP B;  4HQS A;  1QFN A;  2VCX A;  5INY A;  4IW9 A;  3TKS C;  1E2Y A;  2V41 A;  5G1K A;  1YQ1 A;  4Z2T A;  2GSR A;  4TXO B;  4K0N A;  3ZZX A;  3QD9 A;  2H1B A;  5ECH B;  5F06 A;  5J3R A;  2WDU A;  3I69 A;  1ZYN A;  3WGE A;  4K7N A;  2XPE A;  1TKD B;  4OWY A;  5HFG A;  5HQP A;  4POB A;  2IJY A;  4Q5Q A;  1BX9 A;  1AUC A;  1XG8 A;  1S3C A;  2C0D A;  1ST9 A;  14GS A;  1O81 A;  2DML A;  2ZCT A;  2PU9 C;  4KSO A;  3F6D A;  4TXO A;  4EUY A;  1TI3 A;  4KAE A;  1XBS A;  2QSI A;  2RII A;  1RK4 A;  1EV4 A;  3SBC A;  1Y6E A;  5DQS A;  3EWL A;  4V2N A;  2VCQ A;  2A2R A;  1EV9 A;  1MTC A;  4MH2 A;  2AYT A;  4QL7 A;  4MJC A;  1DUG A;  5F0G A;  3WYW A;  1A24 A;  2E2G A;  1GP1 A;  4MCU A;  3HXS A;  1AW9 A;  5EY6 A;  1ON4 A;  3W8J A;  2B1K A;  1ZYP A;  20GS A;  1K0C A;  2WFC A;  4ZL9 A;  4NV2 A;  1V2A A;  3APQ A;  1XWK A;  4QQ7 A;  4XRD A;  1Z7P A;  4L5O A;  1DE1 A;  4K2X A;  3UBL A;  2PVQ A;  2L5L A;  2XBI A;  1U88 A;  3L9V A;  4TKY A;  2F3M A;  2HXK A;  3IHG A;  4BIK A;  2L4C A;  4KDU A;  4TOP A;  4ZIJ A;  1Z7R A;  3H1N A;  3HDC A;  4MF7 A;  2E0Q A;  5J9B A;  1T7P B;  4MZC A;  2YV7 A;  5HR2 A;  3W6G A;  3GL3 A;  4N10 A;  2CVD A;  2FNO A;  4MLY A;  1TK0 B;  1GUL A;  2P31 A;  3C73 A;  1SL2 B;  1JZW A;  1B4P A;  1FOV A;  4BWS A;  2IMI A;  4FH8 A;  1GTA A;  3US3 A;  1NM3 A;  2O8V B;  1YJ6 A;  3A3T A;  5ECM B;  6GSY A;  4G2E A;  2A4V A;  2IPA A;  2VAF A;  5ECK B;  1ABA A;  1E6B A;  3GH6 A;  4JE1 A;  1TU7 A;  2K18 A;  3DYR A;  2L4Q A;  4ECI A;  4KDX A;  4K1F A;  3WGX A;  2VL9 A;  1GWC A;  4K7O A;  2I81 A;  3IC8 A;  4YH2 A;  3UVT A;  3ERG A;  5GST A;  4D73 B;  4ECC A;  5JCU A;  1X9S B;  3LFL A;  4L0U A;  5D9X A;  1JHB A;  4GQF A;  1F6M C;  3HVS A;  2K9F A;  2KOK A;  1R4W A;  2AHE A;  1R5A A;  1Z9H A;  2FWE A;  3BCI A;  3RHB A;  3VPQ A;  2PN8 A;  2C3Q A;  1A8L A;  3QAW A;  4MPG A;  3F4R A;  4PUA A;  1EOG A;  1FVJ A;  1M2A A;  2YAN A;  3MAK A;  2H75 A;  1MDI A;  2NBS A;  6GSW A;  1BG5 A;  1EZK A;  1B8X A;  3SWL A;  3RDW A;  5CO3 A;  2V6O A;  1XWG A;  4D73 A;  1S3R A;  4G0L A;  1J9B A;  3DRN A;  4MZB A;  1A8Y A;  2X64 A;  5JWO B;  4WBJ A;  3LG6 A;  4MF5 A;  1FG4 A;  1U87 A;  2X99 A;  4CDO A;  4WEY A;  2CVK A;  1YF1 A;  2CT6 A;  3VK9 A;  3GNJ A;  4O7H A;  4A5P A;  1GRX A;  4HEA 2;  4I8B A;  3MYD A;  4Z2U A;  1OC9 B;  2CX3 A;  1UC7 A;  5IMD A;  1SD9 A;  3J7Y b;  1XWB A;  4EF0 A;  3KH9 A;  2NPB A;  2P5Q A;  19GS A;  4MZW A;  2R4V A;  1LBK A;  1XWA A;  3GKX A;  3DD3 A;  2ES7 A;  1AQV A;  5ELG A;  1V98 A;  5D9T A;  4MPF A;  1K0D A;  1TOF A;  3HA9 A;  3IAM 2;  4GRF A;  3UJ1 A;  4HJ2 A;  2M72 A;  5HR3 A;  3O76 A;  1GSE A;  4EXJ A;  1FO5 A;  3QAV A;  1F3A A;  1OC9 A;  3MIX A;  1HNC A;  5IPH A;  5EL8 A; 
#chains in the Genus database with same CATH homology
 1AAZ A;  4Q5N A;  4ID0 A;  1PD2 1;  2VL3 A;  4ML6 A;  4OCE A;  2K6V A;  1ZGN A;  5G5E A;  1GSQ A;  2A2P A;  1GLP A;  1HNB A;  3EE2 A;  4G10 A;  2V6K A;  1ILO A;  3IA1 A;  3KJY A;  3CMI A;  4CHS A;  2LS5 A;  2H1D A;  4L5L A;  4NV5 A;  3GL5 A;  1FHE A;  2C0E A;  3VWW A;  3VUR A;  3F63 A;  3H93 A;  1WOU A;  1ERW A;  2H74 A;  13GS A;  3TOU A;  4Q5R A;  2V32 A;  2X4A A;  1GSD A;  1MD4 A;  4ML1 A;  2GTU A;  2R6K A;  2VL2 A;  2ON5 A;  3UOM A;  2C0G A;  2LRC A;  6GSS A;  3IHQ A;  1W89 A;  5IOW A;  4KGI A;  4PQH A;  3GN3 A;  1ZYQ B;  3QCP A;  3TKS A;  5HR0 A;  3HD5 A;  5FWG A;  5IIZ A;  4LMW A;  1T1V A;  1GSS A;  2CV4 A;  4HUA A;  2CZ3 A;  2WZ9 A;  1M7T A;  2H73 A;  2NTO A;  3UIW A;  2KP2 A;  3FEU A;  3C1S A;  4ZB6 A;  3J7Y k;  4I2U A;  2IWT A;  3QDN A;  1EWX A;  4IEL A;  4MJB A;  2BJX A;  3PH9 A;  3ERW A;  5BMU A;  4EE0 A;  4GQC A;  3C8E A;  2YWN A;  4TR3 A;  2M46 A;  5CNW A;  4Q5F A;  4X1U A;  3D0Z A;  2FHE A;  4PTS A;  2R0G A;  1BED A;  1Z6M A;  3IE3 A;  1FAA A;  1QK8 A;  4POL A;  2H8L A;  5ECI B;  3CRT A;  3L9S A;  5JCW A;  1T00 A;  4X43 A;  3LSZ A;  4MF6 A;  2AJQ B;  3D5J A;  3HJO A;  1K0B A;  3C1R A;  1TI1 A;  1G6Y A;  3GTU B;  1USB A;  1OKD A;  4IJI A;  3HHV A;  2VIM A;  4TVE A;  4TRX A;  1U6T A;  2B6M A;  1YEX A;  2LUS A;  2MYG A;  5ECS A;  3VFI A;  3KM6 A;  2NDO A;  4F82 A;  2C80 A;  4TN8 A;  1GTB A;  4Z2R A;  1PN0 A;  2LNS A;  3G7I A;  5AN1 A;  4XCS A;  5IO0 A;  1OVN A;  4K0G A;  4I97 A;  4OD7 A;  3DVX A;  3FY7 A;  4PX1 A;  2TRC P;  2PER A;  3KGK A;  5IMZ A;  1UVZ A;  3TGZ A;  5F07 A;  3GTU A;  1SJZ A;  2VO4 A;  4GSS A;  2AB6 A;  1ZCP A;  4WF4 A;  3GX0 A;  2GLR A;  3EC3 A;  2VUP A;  1LJR A;  3O3T A;  5A4V A;  1LU4 A;  4AJ8 A;  1OYJ A;  3FZ4 A;  4ECB A;  4MNN A;  2LJA A;  2FD3 A;  5LD0 A;  4ISD A;  4POK A;  2JL4 A;  1WPI A;  2PUK C;  3M9K A;  4MK3 A;  3E0U A;  1GUH A;  2VD1 A;  3IBH A;  3LXT A;  2C4J A;  2VM2 A;  4OFN A;  4PXO A;  2IFQ B;  3ZIV A;  1K3L A;  1PL1 A;  4IP6 A;  4GCI A;  1YZX A;  2HSH A;  3IV4 A;  1MD3 A;  2VLT A;  3P90 A;  1SJI A;  1FVK A;  2B1L A;  3TKR A;  4AJ6 A;  3VI7 A;  3F3Q A;  5JCG A;  2HRN A;  4OFM A;  5LCZ A;  1M0U A;  4IS0 A;  3CSI A;  3MDK A;  2G2Q A;  2GDR A;  3A2X A;  2VL2 C;  3HY2 A;  4RQX A;  4F9Z A;  2ZNM A;  1K0N A;  1VF1 A;  4WET A;  3R3E A;  2L57 A;  4MMM A;  4POM A;  1QMV A;  2IL3 A;  4O5U A;  2IMK A;  4KX4 A;  2MZC A;  2G0F A;  3ZVJ A;  4CY8 A;  2IFQ A;  2EIO A;  1HYU A;  4X0X A;  1IYH A;  2QC7 A;  3GKN A;  1M2D A;  2QA2 A;  1PSQ A;  2R3X A;  1PL2 A;  1PX7 A;  3ZFB A;  5G30 A;  1B9Y C;  4BPY A;  2HRK A;  4HU9 A;  5CRE A;  2GZP A;  1XPV A;  2QKE A;  4NPB A;  1M9A A;  1R5P A;  3IC4 A;  3BBY A;  2V2G A;  1GH2 A;  2YZH A;  2PVO C;  2KHP A;  4EKZ A;  1KBN A;  2QGV A;  2BTO T;  2YWO A;  2VCV A;  17GS A;  3APO A;  1G0T A;  3QMX A;  3BCK A;  4RI6 A;  3GIX A;  3GSS A;  2AUV A;  4OO5 A;  1JZD A;  3GMF A;  1NW2 A;  4ZIL A;  4DVC A;  1K3O A;  2H0H A;  5A4W A;  5DJM A;  5B8B A;  1Y25 A;  2WCI A;  4FO5 A;  4K9Z A;  4RUV A;  1EGO A;  1XW9 A;  1X5E A;  4IQA A;  3GKM A;  3VWX A;  3UAR A;  1KEB A;  1TRU A;  2F51 A;  4YAV A;  2GGT A;  4PNG A;  2A2S A;  1PA3 A;  1X9W B;  1EGR A;  1PN9 A;  2MMO A;  3CXG A;  2DJ0 A;  1TXX A;  1YKC A;  1Z3E A;  3KXO A;  3BOA A;  1O85 A;  4IKH A;  3KIJ A;  1ERV A;  1A23 A;  5IO2 A;  1A2L A;  2OBK A;  4NXI A;  1I9D A;  1EOH A;  1WRY A;  2JAD A;  4DSQ A;  1H4O A;  4N30 A;  3D4M A;  1XCC A;  1A0R P;  2JZS A;  1GNE A;  4O5Q A;  4KSM A;  2F9S A;  2DKH A;  1XVQ A;  1RQM A;  2FCH A;  2H70 A;  3M9J A;  4OO4 A;  2HZF A;  2WRT A;  1GL8 A;  3DWV A;  5HFI A;  3N5O A;  3DML A;  2GQL A;  1V40 A;  1TP9 A;  3CSJ A;  2C0F A;  3TRP A;  3FHK A;  3TRX A;  3E3E A;  3UMA A;  1A0F A;  1K0M A;  1S3D A;  3F9U A;  3ME8 A;  2QA1 A;  2CVB A;  2B5Y A;  2H66 A;  5CRH A;  4CY6 A;  6GSV A;  4ECJ A;  2WJU A;  5CAX A;  1ML6 A;  3D21 A;  3CRU A;  2OAC A;  2LRN A;  4NMU A;  2VOC A;  1PKZ A;  2RM6 A;  1THO A;  5G31 A;  1MDJ A;  3GKK A;  3A2W A;  4CW9 A;  2I3Y A;  4FQU A;  1JLV A;  3UEM A;  4JED A;  4J2F A;  3ZLP A;  2JU5 A;  2O89 A;  2LQO A;  1GUM A;  2X8G A;  4GLT A;  2V1M A;  1J08 A;  2GZZ A;  4HZ4 A;  5ECQ B;  3VWU A;  3CYN A;  1DE2 A;  1J0F A;  3F8U A;  5G1L A;  4IHU A;  1X9M B;  5DAL B;  2H76 A;  2RUF A;  4OMV A;  3TKS E;  1SYR A;  1PMT A;  5COH A;  4PNF A;  3TUE A;  2OE0 A;  3CBU A;  2L59 A;  4NHZ A;  2H6Y A;  1MEK A;  3ZTL A;  1G7E A;  2HRA A;  3LEF A;  1GSF A;  4EIP A;  4G0I A;  3FZ9 A;  2N5F A;  5AGY A;  3DIE A;  2XC2 A;  3IAS 2;  2LTK A;  1FB0 A;  5G5F A;  1F2E A;  1WIK A;  5LNK e;  2O7K A;  3EVI A;  3WT1 A;  2CAQ A;  4KUN A;  3AY8 A;  5DAL A;  2L5O A;  3UL3 A;  2OA7 A;  4XRA A;  5ELA A;  2ON7 A;  1PKW A;  1NHO A;  4G0K A;  4WXT A;  4KF9 A;  3HYP A;  3M1G A;  4PUF C;  1ZOF A;  3ZRE A;  4KE3 A;  5ECO B;  4LL4 B;  4KCE A;  3IDV A;  2YJH A;  4PQI A;  2E2M A;  2GVP A;  3TRQ A;  4I5Q A;  3LOR A;  2HNL A;  3HVX A;  2VM1 A;  3IK7 A;  1XOA A;  1M9B A;  4MJA A;  3A2V A;  1CQH A;  4ZB9 A;  3ZIT A;  3CTG A;  5IMA A;  3R2Q A;  3KTL A;  2C3N A;  3FKF A;  1SL1 B;  1AQX A;  3UAP A;  2WGR A;  3TJF A;  5JWR B;  5AIS A;  2CX4 A;  2WB9 A;  3PGT A;  4USS A;  4IVF A;  2KP1 A;  4GTU A;  4TR4 A;  2CQ9 A;  3WGD A;  3GX8 A;  2ZUP A;  2I9H A;  4IN0 A;  2IME A;  1B9X C;  2FGX A;  5EVO A;  5B6N A;  1T4Z A;  1A2J A;  3ZML A;  3KCM A;  2FA4 A;  1WE0 A;  2PGT A;  5DCH A;  1AC1 A;  2LKU A;  1WJK A;  2EC4 A;  5AIV A;  3F3R A;  2H71 A;  1TRV A;  3MNG A;  4IQ1 A;  4K5R A;  2PWJ A;  3TKQ A;  1KTE A;  3P7X A;  4OFT A;  2XHF A;  3BD2 A;  1KNG A;  2JSZ A;  3NZN A;  1B4Q A;  1K0O A;  2P0G A;  1GTU A;  3GA4 A;  4MDC A;  1M2B A;  5D9V A;  3H4K A;  4QL9 A;  4ZXG A;  1XFL A;  4ACS A;  3Q19 A;  1QUW A;  5GZZ B;  4EO3 A;  3L78 A;  4F2I A;  3LW9 A;  5D96 A;  3G7Y A;  1VF3 A;  2LJK A;  3L9U A;  2E7P A;  2FWF A;  5E4W A;  4XS1 A;  2YWM A;  1TK5 B;  5BRT A;  4X4J A;  2AV4 A;  2LQQ A;  1DSB A;  4FYC A;  2GSQ A;  6GSU A;  2P5R A;  3QOU A;  2DIZ A;  2H0G A;  2FA8 A;  1GSU A;  2IMF A;  2YP6 A;  4ZL7 A;  4MJE A;  3Q74 A;  2I1U A;  4XS6 A;  1TW9 A;  4XHM A;  5AIX A;  4J57 E;  5DAK B;  2MMA A;  1XW5 A;  1TK8 B;  3F0I A;  4RI7 A;  2VD0 A;  1TDI A;  4K8M A;  1XWC A;  1MDK A;  4HQZ A;  6GSX A;  3A5W A;  4F0B A;  2H1A A;  1BQ7 A;  3TCO A;  1JFU A;  2WS2 A;  1UN2 A;  3KD0 A;  5FHI A;  1T3B A;  1O8W A;  3ZMK A;  4EVM A;  2ALB A;  4O32 A;  1U3A A;  2YNX A;  3KTB A;  3M8N A;  5ECL B;  5IMF A;  3UVH A;  4DEJ A;  5DAK A;  2HI7 A;  4MH3 A;  3FW2 A;  5HR1 A;  2HFD A;  2GQK A;  4AJ7 A;  3GFK A;  5B7C A;  4PGT A;  3O6T A;  4ZB8 A;  4HDE A;  2CZ2 A;  2FWG A;  2DJ2 A;  3GYK A;  2HSY A;  4I2T A;  2R2J A;  2VCZ A;  2N5A A;  2YWI A;  1BYE A;  2VLV A;  4V1A p;  3ZIJ A;  5B8A A;  2B5E A;  2R0C A;  2R0P A;  1URM A;  2OKA A;  4NAX A;  1X5D A;  4IGJ A;  5F8B A;  3LYK A;  1V57 A;  4NWY A;  3MWH A;  2M80 A;  1BAY A;  4XTS A;  4WR5 A;  5DBQ A;  3IXR A;  1Q98 A;  4MA9 A;  2BMX A;  2HT9 A;  16GS A;  1YKA A;  2CAI A;  5CRW A;  4Z7X A;  3KMO A;  3OR5 A;  3HJM A;  2NVL A;  4KCA A;  5IM9 A;  5KOW A;  3A5I A;  1YDK A;  1AXD A;  3EMP A;  4NHW A;  1OC3 A;  2F8F A;  2TRX A;  3NOF A;  2YJ7 A;  3DGQ A;  3TDG A;  1SL0 B;  2LRT A;  5HFK A;  2C3T A;  4BVX B;  2C8U A;  2O87 A;  2DJK A;  5DJL A;  2GSS A;  1XOB A;  1HNA A;  1ERU A;  2H01 A;  9GSS A;  2OE3 A;  3H79 A;  3ZFL A;  1BJX A;  2H1G A;  4O5R A;  3I43 A;  4J56 E;  3N9J A;  2MMZ A;  1A2M A;  1R26 A;  3KMN A;  4O92 A;  2IN3 A;  2PMT A;  1T4Y A;  1XZO A;  4XIH A;  1N8J A;  5CYY A;  3VLN A;  2FLS A;  4BVX A;  6GST A;  3I9V 2;  3M3M A;  4WBR D;  4JZQ A;  1GLQ A;  2TIR A;  4FYU A;  3I6A A;  3HZ4 A;  3L0H A;  5IOX A;  1K0A A;  4KND A;  2DBC A;  4TXV A;  4BWQ A;  3QR6 A;  1SKW B;  4L8E A;  4IJ3 A;  3VWV A;  2FUG 2;  3GRX A;  4AGS A;  4V2L A;  2F8A A;  3QFB C;  1HQO A;  1TJD A;  5C04 A;  3HCZ A;  1VRS D;  3RBT A;  3Q6O A;  3FR3 A;  5ENU A;  4ZL8 A;  2LV3 A;  1OAZ A;  5ECR B;  2I4A A;  5KN3 A;  2O85 A;  2EIQ A;  4TR1 B;  3WD6 A;  4P3Y B;  2HSM A;  3F4S A;  2DLX A;  3KH7 A;  4L0W A;  2L6C A;  4N0V A;  1ZYE A;  3FRC A;  1OE7 A;  2GQM A;  4TW5 A;  4G19 A;  3FZ5 A;  1Z6N A;  5D8I A;  3TB2 A;  2X8H A;  1OE8 A;  3TJG A;  3TOT A;  2PBJ A;  3S9F A;  1JZR A;  2XBQ A;  2XPD A;  3KZQ A;  4FIW A;  2R5G A;  2VCW A;  2DJ1 A;  4BA7 A;  2IMD A;  1NHY A;  1PGT A;  5B6M A;  3ZL5 A;  1FB6 A;  4TR1 A;  4GWR A;  1GTI A;  5KN1 A;  4YQV A;  3C71 A;  2C1Y A;  1YY7 A;  1QXH A;  4IP1 A;  2YN1 A;  4RQR A;  3HJP A;  3FR6 A;  5DQY A;  3WT2 A;  4BVY B;  3CSH A;  2JZR A;  4E8H A;  2GST A;  2H72 A;  3LWA A;  5E59 A;  5G2Z A;  3KP8 A;  2B7J A;  2B3S A;  2YV9 A;  1O73 A;  4G9H A;  1IYI A;  5KN0 A;  2DJJ A;  2OBI A;  1YEP A;  3IPZ A;  3EU4 A;  3EUR A;  4HOJ A;  5GSS A;  1EEJ A;  4AF2 A;  2DIY A;  3ZVJ D;  4GXZ A;  3QPM A;  5H5R A;  3FMW A;  3D6I A;  3BJ5 A;  4BVY A;  2B5X A;  4LL1 B;  2GS3 A;  1SK0 A;  2X8C A;  3QFA C;  4K5S A;  1QQ2 A;  3IR4 A;  7GSS A;  11GS A;  1FW1 A;  1R7H A;  3UBK A;  4LLR A;  5J4U A;  2KUC A;  1EP8 A;  3MSZ A;  5CP1 A;  3TJB A;  1S3A A;  3G7J A;  1XVW A;  2KLX A;  3D4T A;  5J5N A;  5GAN D;  1SJ6 A;  1N2A A;  3VI5 A;  10GS A;  3DEX A;  3G9B A;  2H6X A;  2AAW A;  5ID2 B;  1F37 A;  18GS A;  2YCD A;  1TRW A;  2Z9S A;  2VLU A;  3RPN A;  3U6V A;  4DSR A;  3EYT A;  3VPT A;  4V2M A;  4EC0 A;  3RHC A;  4HZ2 A;  4PUR A;  1XIY A;  1GSY A;  2J23 A;  3ED3 A;  1G7O A;  3RAZ A;  3IOS A;  3LGC A;  1AQW A;  5J41 A;  2X49 A;  1SD8 A;  2GZY A;  4JRR A;  3GV1 A;  3FYG A;  1W4V A;  1FOH A;  2GT6 A;  3QAG A;  5ID2 A;  2A4H A;  1GUK A;  4K2D A;  3HVV A;  2UZ8 A;  4F0C A;  1SKS B;  4PQ1 A;  1G6W A;  4YKG A;  4BL7 B;  2DC5 A;  5DDL A;  3ZRD A;  2GT5 A;  1O7U A;  1O8X A;  4HU7 A;  1TTZ A;  2YZU A;  4HI7 A;  1EEM A;  1I5G A;  3DKS A;  1H75 A;  5CRD A;  2J9H A;  2HE3 A;  3ZYW A;  4HJM A;  4GST A;  4LMV A;  3NIV A;  5D9W A;  3LJR A;  4JR6 A;  1CQG A;  5F05 A;  5ABR A;  2HRF A;  3ME7 A;  3LQ7 A;  4KW6 A;  3EIN A;  4BL7 A;  1TRS A;  3GUS A;  2L6D A;  1V58 A;  4WF5 A;  3DXB A;  4JU5 A;  1VF4 A;  3F4T A;  2MBS A;  5GAP D;  2LEG A;  1U3I A;  4MP4 A;  4ZBB A;  4EDY A;  3PPU A;  2B7K A;  1JZO A;  2JSY A;  1EP7 A;  2JZT A;  5ECN B;  2K8V A;  3GUR A;  1SEN A;  1B48 A;  1PQN A;  1X0R A;  4KA0 A;  3RPP A;  3C7M A;  1F3B A;  1T8E B;  1NSW A;  4XS4 B;  5KEJ A;  3GH9 A;  2DJ3 A;  8GSS A;  3L4N A;  3HZ8 A;  2RM5 A;  4F03 A;  5IMC A;  2LNT A;  3ERF A;  4N0Z A;  1UA5 A;  5L71 A;  4V1A g;  4KDY A;  3GST A;  5H5Q A;  1SK2 A;  5DVB A;  3F6F A;  4K7I A;  3K8N A;  3TKP A;  1XXU A;  3W8S A;  3FR9 A;  1ERT A;  3E9J B;  2H0I A;  4MAB A;  4IBP A;  4XS4 A;  2MBT A;  3H8Q A;  2RLI A;  1JLW A;  1PRX A;  5KOX A;  4ILF A;  1WWJ A;  2HZE B;  2YOI A;  3FK8 A;  3TJJ A;  5FT3 A;  1ZL9 A;  4YQU A;  2CA8 A;  2VCT A;  4EIQ A;  5IMV A;  2R37 A;  1ACV A;  2OAD A;  3D22 A;  1OKT A;  5J9C A;  4E8E A;  2H6Z A;  1THX A;  2K8S A;  3Q18 A;  2REM A;  4ZBA A;  4OCF A;  5H5S A;  1SKR B;  2YPM A;  4EL1 A;  5EPF A;  3APS A;  1DBY A;  4WR4 A;  1WMJ A;  1K3Y A;  1VF2 A;  3U5R E;  2HLS A;  2HZE A;  3EU3 A;  3LYP A;  3FZA A;  1PX6 A;  2LJR A;  4HS1 A;  2FY6 A;  5C00 A;  3PIN A;  4YAP A;  5DCG A;  4ZBD A;  3HKR A;  1WP0 A;  2WUL A;  2DMM A;  2DSA A;  4KH7 A;  4DSS B;  2MMN A;  3IK9 A;  1QGV A;  5JWQ B;  1TU8 A;  4EDZ A;  1Z5Y E;  4TR0 A;  1SK1 A;  4JBB A;  2H30 A;  2RUE A;  3P8W A;  4KB3 A;  3EPT A;  1GNW A;  2OJL A;  4LA1 A;  4N11 A;  4GF0 A;  1OC8 A;  4YQM A;  3V1W A;  1VGL A;  1XW6 A;  4ICY A;  4JR4 A;  4K6X A;  2OE1 A;  2IIY A;  4DSS A;  3LXZ A;  5IPG A;  4H86 A;  4GSN A;  5A4U A;  1RW1 A;  1Q4J A;  1O6J A;  5KN2 A;  3TJK A;  4YKF A;  4WKW A;  3M0F A;  5A5K A;  5IQY A;  1C72 A;  3CTF A;  1SU9 A;  2JAC A;  2HYX A;  1X5C A;  1YF0 A;  1ZZY A;  5D93 A;  1AIU A;  3DVW A;  2FWH A;  1F9M A;  3GHA A;  2LST A;  4ULX A;  5D73 A;  4I6X A;  3KP9 A;  2EIR A;  3KEB A;  2N5B A;  5CRG A;  1SYX A;  3P2A A;  3PR8 A;  4FYB A;  2PPT A;  22GS A;  3EMX A;  1HD2 A;  3ISO A;  1V9W A;  2DKI A;  12GS A;  1ZMA A;  2H19 A;  2D2Z A;  3JCM L;  3IRA A;  1M99 A;  5ECP B;  4HQS A;  1QFN A;  2VCX A;  5INY A;  4IW9 A;  3TKS C;  1E2Y A;  2V41 A;  5G1K A;  1YQ1 A;  4Z2T A;  2GSR A;  4TXO B;  4K0N A;  3ZZX A;  3QD9 A;  2H1B A;  5ECH B;  5F06 A;  5J3R A;  2WDU A;  3I69 A;  1ZYN A;  3WGE A;  4K7N A;  2XPE A;  1TKD B;  4OWY A;  5HFG A;  5HQP A;  4POB A;  2IJY A;  4Q5Q A;  1BX9 A;  1AUC A;  1S3C A;  2C0D A;  1ST9 A;  14GS A;  1O81 A;  2DML A;  2ZCT A;  2PU9 C;  4KSO A;  3F6D A;  4TXO A;  4EUY A;  1TI3 A;  4KAE A;  1XBS A;  2QSI A;  2RII A;  1RK4 A;  1EV4 A;  3SBC A;  1Y6E A;  5DQS A;  3EWL A;  4V2N A;  2VCQ A;  2A2R A;  1EV9 A;  1MTC A;  4MH2 A;  2AYT A;  4QL7 A;  4MJC A;  1DUG A;  5F0G A;  3WYW A;  1A24 A;  2E2G A;  1GP1 A;  4MCU A;  3HXS A;  1AW9 A;  5EY6 A;  1ON4 A;  3W8J A;  2B1K A;  1ZYP A;  20GS A;  1K0C A;  2WFC A;  4ZL9 A;  4NV2 A;  1V2A A;  3APQ A;  1XWK A;  4QQ7 A;  4XRD A;  1Z7P A;  4L5O A;  1DE1 A;  4K2X A;  3UBL A;  2PVQ A;  2L5L A;  2XBI A;  1U88 A;  3L9V A;  4TKY A;  2F3M A;  2HXK A;  3IHG A;  2L4C A;  4KDU A;  4TOP A;  4ZIJ A;  1Z7R A;  3H1N A;  3HDC A;  4MF7 A;  2E0Q A;  5J9B A;  1T7P B;  4MZC A;  2YV7 A;  5HR2 A;  3W6G A;  3GL3 A;  4N10 A;  2CVD A;  2FNO A;  4MLY A;  1TK0 B;  1GUL A;  2P31 A;  3C73 A;  1SL2 B;  1JZW A;  1B4P A;  1FOV A;  4BWS A;  2IMI A;  4FH8 A;  1GTA A;  3US3 A;  1NM3 A;  2O8V B;  1YJ6 A;  3A3T A;  5ECM B;  6GSY A;  4G2E A;  2A4V A;  2IPA A;  2VAF A;  5ECK B;  1ABA A;  1E6B A;  3GH6 A;  4JE1 A;  1TU7 A;  2K18 A;  3DYR A;  2L4Q A;  4ECI A;  4KDX A;  4K1F A;  3WGX A;  2VL9 A;  1GWC A;  4K7O A;  2I81 A;  3IC8 A;  4YH2 A;  3UVT A;  3ERG A;  5GST A;  4D73 B;  4ECC A;  5JCU A;  1X9S B;  3LFL A;  4L0U A;  5D9X A;  1JHB A;  4GQF A;  1F6M C;  3HVS A;  2K9F A;  2KOK A;  1R4W A;  2AHE A;  1R5A A;  1Z9H A;  2FWE A;  3BCI A;  3RHB A;  3VPQ A;  2PN8 A;  2C3Q A;  1A8L A;  3QAW A;  4MPG A;  3F4R A;  4PUA A;  1EOG A;  1FVJ A;  1M2A A;  2YAN A;  3MAK A;  2H75 A;  1MDI A;  2NBS A;  6GSW A;  1BG5 A;  1EZK A;  1B8X A;  3SWL A;  3RDW A;  5CO3 A;  2V6O A;  1XWG A;  4D73 A;  4G0L A;  1J9B A;  3DRN A;  4MZB A;  1A8Y A;  2X64 A;  5JWO B;  4WBJ A;  3LG6 A;  4MF5 A;  1FG4 A;  1U87 A;  2X99 A;  4CDO A;  4WEY A;  2CVK A;  1YF1 A;  2CT6 A;  3VK9 A;  3GNJ A;  4O7H A;  4A5P A;  1GRX A;  4HEA 2;  4I8B A;  3MYD A;  4Z2U A;  1OC9 B;  2CX3 A;  1UC7 A;  5IMD A;  1SD9 A;  3J7Y b;  1XWB A;  4EF0 A;  3KH9 A;  2NPB A;  2P5Q A;  19GS A;  4MZW A;  2R4V A;  1LBK A;  1XWA A;  3GKX A;  3DD3 A;  2ES7 A;  1AQV A;  5ELG A;  1V98 A;  5D9T A;  4MPF A;  1K0D A;  1TOF A;  3HA9 A;  3IAM 2;  4GRF A;  3UJ1 A;  4HJ2 A;  2M72 A;  5HR3 A;  3O76 A;  1GSE A;  4EXJ A;  1FO5 A;  3QAV A;  1F3A A;  1OC9 A;  3MIX A;  1HNC A;  5IPH A;  5EL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...