1ZYQB

T7 dna polymerase in complex with 8og and incoming ddatp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/electron transport/dna
molecule keywords 5'-D(*CP*GP*AP*AP*AP*AP*CP*GP*AP*CP*GP*GP*CP*CP*AP*GP*TP*GP*
publication title A lysine residue in the fingers subdomain of t7 DNA polymerase modulates the miscoding potential of 8-oxo-7,8-dihydroguanosine.
pubmed doi rcsb
source organism Enterobacteria phage t7
total genus 25
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2005-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1zyqB00
1URMA 4HS1A 4KX4A 5ECPB 4PX1A 3KH9A 5G1KA 1FO5A 2GZYA 4KH7A 1XWBA 2C8UA 1U88A 3C1RA 3KMNA 1ERUA 4NPBA 1N8JA 4CHSA 5ENUA 3A5WA 4Z7XA 4KUNA 4MZCA 3GTUA 1FHEA 1OE8A 1F9MA 2LRNA 2VCTA 3TRPA 1S3CA 4GCIA 2ES7A 3BOAA 1X9MB 2H30A 3O3TA 3ISOA 3FHKA 1A8LA 1EGOA 3GL5A 5DALB 3IPZA 1GL8A 1DUGA 3ERGA 11GSA 3S9FA 2O7KA 4HI7A 1OAZA 4J57E 5GAPD 2FGXA 3ERWA 4MF6A 3E0UA 1PQNA 5A4UA 3ZL5A 2PWJA 1V40A 19GSA 1GUMA 4MZBA 2V1MA 4PQIA 4TW5A 1K0DA 1B9YC 2X64A 4KSOA 1U3AA 1M2DA 2WZ9A 3FZ4A 4F2IA 1GTIA 5IMDA 2H76A 4G19A 2F8FA 2KLXA 3ME7A 4ID0A 16GSA 3W6GA 1U87A 3G7JA 1SL2B 4V1Ap 5CNWA 1YKAA 2FA8A 2DJ0A 2L57A 2MMAA 1ZYEA 2I3YA 3F9UA 4ZL8A 3FZAA 4K7NA 1VF4A 1GSSA 1ACVA 2C0EA 1B4QA 2GSSA 3UIWA 3GX8A 3ZLPA 2RUFA 4IP6A 4EDYA 3CYNA 5DAKB 2Z9SA 4L0WA 5J5NA 4J56E 5B8BA 3KM6A 6GSXA 3GH9A 1K3YA 3ZMLA 2IMEA 3EU3A 1K0OA 4LMVA 2YWMA 1F37A 5HR3A 4GSNA 1OC8A 3WD6A 1SYXA 1DE2A 3KP8A 1GWCA 1U3IA 2OACA 4XCSA 1WP0A 2G0FA 2VIMA 3PINA 4F0CA 1TU8A 2H66A 4IGJA 3UVTA 4MABA 4JR6A 1GNEA 3GSTA 1K0AA 4IKHA 4Q5FA 3HJPA 3TOTA 1FW1A 3IR4A 4BVXA 5IPHA 4OFTA 2YJHA 4IELA 2V41A 3DEXA 8GSSA 3GA4A 1OC9A 1ZCPA 4X43A 4JU5A 4G2EA 1EV4A 1A2MA 2GQKA 5IM9A 1HNCA 1W4VA 1Z3EA 3UEMA 2LEGA 2KOKA 4QQ7A 3TKRA 3VK9A 1NHYA 3EU4A 4IQ1A 4E8EA 3ZFBA 1KEBA 4IW9A 1DBYA 2IMDA 2H19A 3LWAA 3IRAA 5EVOA 2BMXA 5F06A 1MDJA 1WWJA 7GSSA 1T8EB 4MA9A 4FO5A 2HSHA 1OKTA 3K8NA 2TIRA 4KCEA 2CAQA 3DWVA 2R6KA 4KW6A 4EDZA 1TK5B 4EXJA 2RUEA 5CRWA 1MDKA 2X8HA 1THOA 1T7PB 3HCZA 1K0BA 5DQSA 3LJRA 2C3QA 1M0UA 2JL4A 3GKMA 5HR0A 3UVHA 3EMPA 1V9WA 1QQ2A 2H6XA 1AW9A 2R37A 1KTEA 1Q98A 2HRNA 1J9BA 5ECHB 2H71A 1SYRA 5IO0A 2OE1A 4X0XA 2GTUA 3W8SA 4F9ZA 5CRDA 5D93A 2PMTA 4LA1A 1TRVA 4TR1A 3M0FA 2L4CA 1F3AA 1BJXA 4PXOA 2V6OA 4ECJA 4NV5A 4V2NA 3IV4A 1M2BA 1LJRA 4ACSA 3H93A 2FUG2 5IQYA 5IO2A 3G7YA 2VL2A 4OWYA 3QFAC 4P3YB 4ZILA 2A2RA 3MWHA 1M2AA 3VI5A 4I6XA 2F3MA 1EV9A 2HLSA 1ST9A 3GMFA 2MMZA 3FZ5A 5ECKB 2JZSA 3F6DA 1PSQA 5B8AA 5AIXA 2MZCA 4HJ2A 4TKYA 2VD1A 1AIUA 2B7KA 3IOSA 1H4OA 4PNFA 3FR9A 2YZUA 3HVVA 4KNDA 3P90A 1AAZA 2R2JA 1PD21 5DAKA 2DJKA 3I6AA 4O92A 1TP9A 1QXHA 1SK2A 3FKFA 4BA7A 1QFNA 2GQLA 2HSYA 4V2LA 2K8VA 3ZIJA 5JWOB 2VOCA 4O5RA 1OYJA 1AQWA 2J9HA 1RK4A 3D22A 2L6DA 5D8IA 2G2QA 2WB9A 4RQXA 2C3TA 2CV4A 4OMVA 3RHBA 4L5OA 2AJQB 4RQRA 2L5LA 2LKUA 4Q5QA 3HJOA 4X1UA 3QAWA 4WEYA 5H5RA 4HJMA 1GSYA 3V1WA 2YV9A 2VL2C 2DJ1A 2WJUA 3F4SA 3O76A 3IA1A 3Q6OA 1NHOA 3CSJA 2PERA 2MMNA 3SBCA 1Z6MA 4MDCA 5ECNB 1YF1A 3FR3A 4KE3A 2FWFA 2MBSA 2B7JA 3WT2A 2H75A 4ZBDA 2OADA 3HA9A 4OFNA 3F3QA 4NXIA 1V58A 3ZTLA 1XWCA 1KBNA 3L4NA 2H0IA 2C0DA 2YN1A 4NHWA 1O73A 2YPMA 3GFKA 4IBPA 2IL3A 2FWHA 4XRAA 5ECSA 5ELAA 2JSZA 4YQUA 2R4VA 5KN1A 2HE3A 2QSIA 5ID2B 4KGIA 3IC4A 3TJGA 5G5FA 4AJ6A 4K1FA 2XPDA 2TRXA 5DCHA 1PA3A 1XIYA 3F8UA 5COHA 3TKSA 3D5JA 22GSA 1RQMA 2GQMA 3CTFA 3DXBA 4EC0A 1V98A 5G1LA 2HFDA 1X9SB 3HHVA 3H8QA 3RPNA 4BL7A 4KDUA 1G7OA 4N30A 1GLQA 2GZZA 2J23A 14GSA 1JFUA 2IWTA 2YWNA 4JBBA 3PGTA 4ML1A 2VCWA 3DGQA 3D4TA 1XWAA 1HNAA 2C0FA 1K0MA 5ECMB 1SK0A 1HNBA 2DIZA 4O32A 3KTLA 1SU9A 4KDYA 3TJJA 1OC3A 1DE1A 4OO5A 2YWOA 3L9SA 1JZOA 2ON5A 2P31A 4IS0A 2VM2A 3ZREA 2H01A 4DVCA 4F82A 4XTSA 5INYA 4YAVA 2GVPA 1Y6EA 2JADA 1O81A 1XWGA 2H73A 1QUWA 2MMOA 2PBJA 3NOFA 1TW9A 3APOA 1XVQA 3GUSA 3TKSC 4TXOB 4CDOA 1VF3A 3M1GA 5C00A 1O7UA 3ZVJD 1GTUA 3CSIA 2P5RA 2DLXA 2H1AA 1LU4A 2VO4A 3TKSE 3TJFA 1M7TA 2QKEA 5G2ZA 1EP8A 3KXOA 5HR1A 4TR1B 3VI7A 2FCHA 1GSDA 3HKRA 4K0GA 4K6XA 4D73B 1AXDA 1SJZA 1XXUA 1YF0A 1TRUA 3C1SA 1ERVA 1SD8A 2EIQA 2CA8A 3EWLA 2LV3A 2H74A 2P5QA 3VPQA 4ZBBA 3L0HA 4N11A 3VPTA 4ZXGA 4ISDA 2E0QA 4XS6A 5ECQB 4WR5A 1UVZA 2CQ9A 4DSRA 3HD5A 2WULA 1I5GA 3LORA 2VM1A 1K0CA 20GSA 1TXXA 3RPPA 2L59A 4MMMA 2H6ZA 1X9WB 4BWQA 2GSRA 5ECOB 3QAVA 2VL3A 4AJ7A 2NBSA 4K8MA 2LQQA 2O87A 2OE0A 2FD3A 2VCQA 3IBHA 3VLNA 1F2EA 1XW5A 1TTZA 4MF7A 4I2UA 5G30A 5J9CA 3LXTA 2H0GA 2XHFA 4OCEA 3NZNA 5CAXA 2V6KA 2HZEB 5KN2A 3UBKA 2K6VA 3MDKA 2F9SA 3GL3A 1G6YA 4TR0A 4HU7A 3IXRA 1EP7A 4FH8A 2LSTA 3H79A 1CQGA 5ID2A 3M8NA 2DJ3A 1SENA 2FHEA 2L5OA 2YCDA 1ZZYA 5IMFA 3TKQA 1YY7A 3U6VA 4I97A 2H0HA 3LGCA 5GZZB 4WR4A 3LXZA 2IMIA 1QGVA 1OKDA 4NAXA 1VF1A 4ZL9A 2CZ3A 4IJ3A 3BJ5A 2ZCTA 1HYUA 4WBJA 2CX3A 4G10A 3F63A 1SKWB 2HT9A 3TJKA 6GSWA 3I69A 1UN2A 2P0GA 6GSUA 4QL7A 5ABRA 2MBTA 4ILFA 2C1YA 2NDOA 5IMCA 4TR3A 1O6JA 1UC7A 2B5XA 3DD3A 3DMLA 1ML6A 4IHUA 1ZGNA 2CVKA 4L8EA 3HVSA 4O7HA 2F51A 3IAM2 4WF5A 1AQVA 5J3RA 5IMZA 1X5CA 5IIZA 2JZRA 1LBKA 5G5EA 3HVXA 5CRHA 3Q18A 1FB6A 4PGTA 3ZYWA 3GYKA 2GDRA 4JZQA 5FHIA 1TOFA 1XCCA 1TJDA 1E6BA 1YEPA 4K9ZA 4ECBA 1A2JA 2O8VB 4IVFA 4PUAA 3DRNA 4TXOA 5JCGA 2H1DA 3W8JA 1BX9A 1UA5A 1R4WA 3P8WA 1EZKA 5F8BA 4L0UA 3GN3A 5HFGA 4HQSA 3O6TA 4BWSA 5IPGA 2LJAA 1GSFA 3ZFLA 1XW6A 1WMJA 4HEA2 1PRXA 1V2AA 4I2TA 2DJ2A 5D9TA 1WJKA 1SL0B 2FY6A 2REMA 3BBYA 1XWKA 2C0GA 1O85A 3E3EA 3QOUA 1JZRA 3VWXA 2H72A 4F0BA 4Q5NA 4D73A 1R26A 5B6MA 3QCPA 2VLUA 3EVIA 2I9HA 3R2QA 5CRGA 3ZVJA 4MZWA 4EO3A 5A4VA 4OCFA 3L9VA 3UOMA 3KD0A 1W89A 3F4RA 4EL1A 3CRUA 4LLRA 1G6WA 1MD3A 2PPTA 3MSZA 3CRTA 4I5QA 2GZPA 2GT6A 4FYCA 1T4ZA 5JCUA 3A2XA 5F05A 5JCWA 3HY2A 2C3NA 4EE0A 1GSUA 2PN8A 1MD4A 3IK9A 2MYGA 3LEFA 3D6IA 4JEDA 1ZMAA 3PH9A 1MEKA 2C80A 1C72A 2QGVA 1R5PA 3CXGA 4JE1A 1R5AA 3H1NA 1TK8B 3CTGA 4XHMA 2HI7A 2ZUPA 1GNWA 4TXVA 1SJ6A 1GLPA 3TDGA 4OO4A 4RI7A 5D9XA 1JZWA 1ZYQB 4J2FA 2GT5A 2HZEA 1GSEA 3EYTA 2OBIA 3F4TA 2LRCA 3DYRA 1ABAA 5H5SA 4Q5RA 2IPAA 2YOIA 3FK8A 2LQOA 1EOHA 2OA7A 2X8CA 4JR4A 3TOUA 3FR6A 4MP4A 3APQA 4ML6A 3KEBA 4FYBA 2GLRA 3F3RA 2WGRA 13GSA 2PGTA 3IHQA 3UMAA 3EMXA 1ERWA 1GH2A 1T3BA 3ZITA 2H70A 4HU9A 1Z7PA 3UARA 4IQAA 1F3BA 5LD0A 5IOXA 2JZTA 4WBRD 2VAFA 4GTUA 2YZHA 1X0RA 3QDNA 2BJXA 1MTCA 1FAAA 3GURA 1SL1B 2M80A 4EKZA 2B5EA 2CZ2A 2JU5A 3KH7A 3HYPA 1T00A 3IDVA 4V1Ag 4IP1A 2O85A 2V2GA 6GSTA 2I81A 2PUKC 1BEDA 1A0RP 1H75A 2GSQA 4ZIJA 5DCGA 1F6MC 2M72A 1TK0B 5KN0A 2CX4A 2VD0A 1PX7A 2HRFA 4NWYA 2CT6A 3BCKA 4GRFA 1Z7RA 1NW2A 3GSSA 5FWGA 2YWIA 3CSHA 1EGRA 3LFLA 3QAGA 4WETA 6GSSA 1TI3A 2YV7A 3GHAA 5CREA 3LYPA 1OVNA 1M9BA 3Q74A 2IMKA 1B9XC 5DBQA 1GRXA 2DIYA 3N5OA 4ZB9A 2FLSA 4PNGA 1GP1A 4LL4B 1JLWA 1XPVA 2KP2A 2YJ7A 1GUKA 1B48A 4QL9A 4XIHA 1S3AA 1J0FA 3VFIA 5H5QA 3A2VA 3PR8A 3FY7A 4H86A 3ZMKA 1JHBA 3DVWA 2B1LA 2TRCP 2RM6A 2KP1A 2IJYA 4IJIA 1SKSB 2E7PA 2HNLA 1Q4JA 5FT3A 3WYWA 3TKPA 3TUEA 2VLTA 2E2GA 1PL1A 2GGTA 3C73A 3QMXA 3TGZA 5B6NA 1GSQA 2NVLA 2EC4A 2EIOA 2I1UA 1Z6NA 1ZOFA 4ZB6A 3P7XA 5HQPA 4PQ1A 3U5RE 1IYIA 3GKXA 5A4WA 1WRYA 1GUHA 1DSBA 9GSSA 4DSSA 2LTKA 4HDEA 1TI1A 1S3DA 3GNJA 2VCZA 6GSYA 3D0ZA 4E8HA 3C7MA 5IMAA 1PN9A 1Z9HA 3GKKA 2AAWA 4XRDA 4MPGA 2D2ZA 1BYEA 2VUPA 3WGEA 4ECCA 3MAKA 4OFMA 1YQ1A 3EINA 3KJYA 5ECRB 2B6MA 4RUVA 1QK8A 3LYKA 2K9FA 4MK3A 6GSVA 4TN8A 3GH6A 4KDXA 5D9VA 1X5EA 1XBSA 2RIIA 2GS3A 2O89A 1AC1A 1TRWA 2F8AA 2AB6A 2LNTA 2QC7A 3TB2A 1SJIA 4MJBA 1A2LA 2DMMA 4RI6A 2AV4A 5E4WA 1PL2A 3M9KA 10GSA 5AN1A 1WPIA 2BTOT 4GQCA 3RBTA 3Q19A 1FVJA 3TRQA 5AISA 1I9DA 1X5DA 4AGSA 2RLIA 4AJ8A 4G9HA 4HOJA 5D73A 1K3OA 5CO3A 3J7Yk 1A8YA 1BQ7A 5B7CA 3UBLA 3WGXA 4KCAA 4TVEA 4OD7A 2HYXA 5LNKe 2N5BA 2HXKA 5G31A 2RM5A 3FYGA 2A2SA 3D4MA 4YH2A 3ZRDA 3D21A 2OE3A 12GSA 2A4VA 3EC3A 3NIVA 1XVWA 1U6TA 1K0NA 2VCXA 2VLVA 5GAND 5EY6A 4POKA 4I8BA 1EEJA 4TOPA 3A3TA 1WIKA 3TJBA 1XZOA 2OJLA 4MJCA 1SK1A 3UL3A 5D96A 5L71A 3DVXA 4L5LA 1A0FA 3CMIA 2IFQA 4YAPA 5D9WA 3US3A 3HZ8A 2FWGA 2JACA 1GTAA 4FYUA 5DVBA 1HD2A 1EOGA 2VL9A 5ECLB 2B5YA 2ZNMA 1T4YA 3A2WA 2WS2A 3IK7A 3TCOA 2IMFA 2IN3A 2PU9C 5GSTA 3AY8A 1NSWA 2AHEA 2HZFA 4AF2A 3GKNA 4KA0A 4K7IA 3BCIA 3H4KA 1BG5A 3GX0A 1O8WA 3E9JB 3QFBC 3LSZA 4KSMA 3DIEA 4POBA 1G0TA 2N5AA 2B3SA 4BPYA 4K2DA 4F03A 3G9BA 3VWVA 2L6CA 1TKDB 1QMVA 3APSA 3TRXA 3QPMA 2EIRA 1ON4A 1BAYA 2ALBA 3FW2A 3WT1A 3RDWA 4N10A 1B8XA 3P2AA 4XS4B 3SWLA 3BD2A 2AUVA 2XC2A 2R5GA 3HDCA 3EURA 3G7IA 4PUFC 1K3LA 5F07A 1EEMA 1JZDA 1WE0A 1KNGA 4MJEA 3KCMA 5DQYA 5A5KA 3L9UA 4MH2A 2H8LA 2M46A 3WGDA 2B1KA 2XBQA 2NTOA 4MF5A 18GSA 4YQMA 1TDIA 5AGYA 1TRSA 2GSTA 4TR4A 2LS5A 3HXSA 3ME8A 2I4AA 2WFCA 1VGLA 1MDIA 1VF2A 2YNXA 3VWWA 5KEJA 1PKZA 4KB3A 1FVKA 4YQVA 1NM3A 5J9BA 2X99A 1N2AA 4MH3A 4GSTA 5DDLA 1XOAA 3OR5A 1HQOA 3J7Yb 2KUCA 3MNGA 4PURA 4BVYA 4EUYA 4GLTA 3M3MA 2LUSA 5HR2A 3VURA 4K7OA 4CW9A 4DSQA 1XFLA 1O8XA 4EVMA 1RW1A 3F0IA 5DJLA 1THXA 5DALA 5EPFA 1V57A 2OKAA 1XOBA 2IIYA 4MCUA 3ED3A 1T1VA 4GF0A 3N9JA 4GSSA 4V2MA 2CVBA 3KZQA 2LRTA 4WF4A 1CQHA 4DSSB 1ILOA 2H1GA 4HQZA 2LJRA 2WRTA 4NV2A 1JLVA 4POLA 2FWEA 1Z5YE 2DBCA 3EE2A 5IMVA 3I43A 4NMUA 1OE7A 1M99A 2K18A 1GTBA 3IE3A 3GTUB 4XS1A 3I9V2 5C04A 2ON7A 1M9AA 4WKWA 1G7EA 1IYHA 1R7HA 3M9JA 3C71A 1J08A 2PVOC 2XBIA 4MJAA 1ZL9A 2V32A 5ECIB 4EF0A 1YEXA 1TU7A 1SD9A 1WOUA 1FB0A 2H6YA 2OBKA 5EL8A 5IOWA 1YDKA 4NHZA 2VCVA 4LL1B 3ZZXA 3FEUA 4WXTA 2R3XA 4HZ2A 5JWQB 2LNSA 4KAEA 1PKWA 5DJMA 4GXZA 3UAPA 5CYYA 2PVQA 2H1BA 4HZ4A 1VRSD 4N0ZA 3CBUA 4MLYA 3RHCA 4GWRA 3IAS2 4LMWA 3FZ9A 5E59A 4ZL7A 3KGKA 1USBA 1GULA 3F6FA 4XS4A 1AQXA 2NPBA 2IFQB 4FIWA 3HJMA 2XPEA 3GIXA 3UJ1A 2DSAA 2L4QA 1SKRB 5J4UA 5GSSA 3QD9A 2LJKA 2KHPA 5HFKA 2YP6A 1YKCA 3HZ4A 4IN0A 3C8EA 1B4PA 2FA4A 4N0VA 3VWUA 1FOVA 2K8SA 3ERFA 5KN3A 3KIJA 3QR6A 2AYTA 4POMA 1PGTA 2C4JA 2X8GA 1ERTA 4PQHA 4ZB8A 4ECIA 1YJ6A 5HFIA 5J41A 1PMTA 3L78A 4TRXA 5JWRB 1OC9B 3KMOA 17GSA 2FNOA 2E2MA 3KP9A 3RAZA 5ELGA 5CP1A 2YANA 2WCIA 2DC5A 1PX6A 3FRCA 4MPFA 1E2YA 2CAIA 5LCZA 4ULXA 1A24A 3KTBA 1XW9A 5F0GA 2CVDA 4DEJA 3JCML 4K0NA 1Y25A 1EWXA 2JSYA 3ZIVA 2WDUA 3GRXA 5AIVA 1AUCA 1YZXA 2DMLA 3GV1A 3LQ7A 2DJJA 2N5FA 4JRRA 1FG4A 1A23A 4HUAA 3LG6A 4ZBAA 4GQFA 3DKSA
chains in the Genus database with same CATH superfamily
1URMA 4HS1A 4KX4A 5ECPB 4PX1A 3KH9A 5G1KA 1FO5A 2GZYA 4KH7A 1XWBA 2C8UA 1U88A 3C1RA 3KMNA 1ERUA 4NPBA 1N8JA 4CHSA 5ENUA 3A5WA 3MIXA 4Z7XA 4KUNA 4MZCA 3GTUA 1FHEA 4BVYB 1OE8A 1F9MA 2LRNA 2VCTA 3TRPA 1S3CA 4GCIA 2ES7A 3BOAA 1X9MB 2H30A 3O3TA 3ISOA 3FHKA 1A8LA 1EGOA 3GL5A 5DALB 3IPZA 1GL8A 1DUGA 3ERGA 11GSA 3S9FA 2O7KA 4HI7A 1OAZA 4J57E 5GAPD 2FGXA 3ERWA 4MF6A 3E0UA 1PQNA 5A4UA 3ZL5A 2PWJA 1V40A 4CY6A 19GSA 1GUMA 4MZBA 2V1MA 4PQIA 4TW5A 1K0DA 1B9YC 4FQUA 2X64A 4KSOA 1U3AA 1M2DA 2WZ9A 3FZ4A 4F2IA 1GTIA 5IMDA 2H76A 4G19A 2F8FA 2KLXA 3ME7A 4ID0A 16GSA 3W6GA 1U87A 3G7JA 1SL2B 4V1Ap 4CY8A 5CNWA 1YKAA 2FA8A 2DJ0A 2L57A 2MMAA 2R0CA 1ZYEA 2I3YA 3F9UA 4ZL8A 3FZAA 4K7NA 5BMUA 1VF4A 1GSSA 1ACVA 2C0EA 1B4QA 2GSSA 3UIWA 3GX8A 3ZLPA 2RUFA 4IP6A 4EDYA 3CYNA 5DAKB 4KF9A 2Z9SA 4L0WA 5J5NA 4J56E 5B8BA 3KM6A 6GSXA 3GH9A 1K3YA 3ZMLA 2IMEA 3EU3A 1K0OA 4LMVA 2YWMA 1F37A 5HR3A 4GSNA 1OC8A 3WD6A 1SYXA 1DE2A 3KP8A 1GWCA 1U3IA 2OACA 4XCSA 1ZYPA 1WP0A 2G0FA 2VIMA 3PINA 4F0CA 1TU8A 2H66A 4IGJA 3UVTA 4MABA 4JR6A 1GNEA 3GSTA 1K0AA 4IKHA 4Q5FA 3HJPA 3TOTA 1FW1A 3IR4A 4BVXA 5IPHA 3MYDA 4OFTA 2YJHA 4IELA 2V41A 3DEXA 8GSSA 3GA4A 1OC9A 1ZCPA 4X43A 4JU5A 4G2EA 1EV4A 1A2MA 2GQKA 5IM9A 1HNCA 1W4VA 1Z3EA 4USSA 3UEMA 2LEGA 2KOKA 4QQ7A 2QA1A 3TKRA 3VK9A 1NHYA 3EU4A 4IQ1A 4E8EA 3ZFBA 1KEBA 4IW9A 1DBYA 2IMDA 2H19A 3R3EA 3LWAA 3IRAA 5EVOA 2BMXA 5F06A 1MDJA 1WWJA 7GSSA 1T8EB 4MA9A 4FO5A 2HSHA 1OKTA 3K8NA 2TIRA 4KCEA 2CAQA 3DWVA 2R6KA 4KW6A 4EDZA 1TK5B 4EXJA 2RUEA 5CRWA 1MDKA 2X8HA 1THOA 1T7PB 1FOHA 3HCZA 1K0BA 5DQSA 3LJRA 2C3QA 1M0UA 2JL4A 4BL7B 3GKMA 5HR0A 3UVHA 3EMPA 1V9WA 1QQ2A 2H6XA 1AW9A 2R37A 1KTEA 1Q98A 2HRNA 1J9BA 5ECHB 2H71A 1SYRA 5IO0A 2OE1A 4X0XA 4EIPA 2GTUA 3W8SA 4F9ZA 5CRDA 5D93A 2PMTA 4LA1A 1TRVA 4TR1A 3M0FA 2L4CA 1F3AA 1BJXA 4PXOA 2HSMA 2V6OA 4ECJA 4NV5A 4V2NA 3IV4A 4YKGA 1M2BA 1LJRA 4ACSA 3H93A 4G0KA 2FUG2 5IQYA 5IO2A 3G7YA 2VL2A 4OWYA 3QFAC 4P3YB 4ZILA 1PN0A 2A2RA 3MWHA 1M2AA 3VI5A 4I6XA 2F3MA 1EV9A 2HLSA 1ST9A 3GMFA 2MMZA 3FZ5A 5KOWA 5ECKB 2JZSA 3F6DA 1PSQA 5B8AA 5AIXA 2MZCA 4HJ2A 4TKYA 2VD1A 1AIUA 2B7KA 3IOSA 1H4OA 4PNFA 3FR9A 2YZUA 3HVVA 4KNDA 3P90A 3CQFA 1AAZA 2R2JA 1PD21 5DAKA 2DJKA 3I6AA 4O92A 1TP9A 1QXHA 1SK2A 3FKFA 4BA7A 1QFNA 2GQLA 2HSYA 4V2LA 2K8VA 3ZIJA 5JWOB 2VOCA 4O5RA 1OYJA 1AQWA 2J9HA 1RK4A 3D22A 2L6DA 5D8IA 2G2QA 2WB9A 4RQXA 2C3TA 2CV4A 4OMVA 3RHBA 4L5OA 2AJQB 4RQRA 2L5LA 2LKUA 4Q5QA 3HJOA 4X1UA 3QAWA 4WEYA 5H5RA 4HJMA 1GSYA 3V1WA 2YV9A 2VL2C 2DJ1A 2WJUA 3F4SA 3O76A 3IA1A 3Q6OA 1NHOA 3CSJA 5KOXA 2PERA 2MMNA 3SBCA 1M3JA 1Z6MA 4MDCA 5ECNB 1YF1A 3FR3A 4KE3A 2FWFA 2MBSA 2B7JA 3WT2A 2H75A 4X4JA 4ZBDA 2OADA 3HA9A 4OFNA 3F3QA 4NXIA 1V58A 3ZTLA 1XWCA 1KBNA 3L4NA 2H0IA 2C0DA 2YN1A 4NHWA 1O73A 2YPMA 3GFKA 4IBPA 2IL3A 1S3RA 2FWHA 4XRAA 5ECSA 5ELAA 2JSZA 4YQUA 2R4VA 5KN1A 2HE3A 2QSIA 5ID2B 4KGIA 3IC4A 3TJGA 5G5FA 4AJ6A 4K1FA 2XPDA 2TRXA 5DCHA 1PA3A 1XIYA 3F8UA 5COHA 3TKSA 3D5JA 22GSA 1RQMA 2GQMA 3CTFA 3DXBA 4EC0A 1V98A 5G1LA 2HFDA 1X9SB 3HHVA 3H8QA 3RPNA 4BL7A 4KDUA 1G7OA 4N30A 1GLQA 2GZZA 2J23A 14GSA 1JFUA 2IWTA 2YWNA 4JBBA 3PGTA 4ML1A 2VCWA 3DGQA 3D4TA 1XWAA 1HNAA 2C0FA 1K0MA 5ECMB 1SK0A 1HNBA 2DIZA 4O32A 3KTLA 1SU9A 4KDYA 3TJJA 1OC3A 1DE1A 4OO5A 2YWOA 3L9SA 1JZOA 2ON5A 2P31A 4IS0A 2VM2A 3ZREA 2H01A 4DVCA 4F82A 4XTSA 5INYA 4YAVA 2GVPA 1Y6EA 2JADA 2UZ8A 1O81A 1XWGA 2H73A 1QUWA 2MMOA 2PBJA 3NOFA 1TW9A 3APOA 1XVQA 3GUSA 3TKSC 4TXOB 4CDOA 1VF3A 3M1GA 5C00A 1O7UA 3ZVJD 1GTUA 3CSIA 2P5RA 2DLXA 2H1AA 1LU4A 2VO4A 3TKSE 3TJFA 1M7TA 2QKEA 5G2ZA 1EP8A 3KXOA 5HR1A 4TR1B 3VI7A 2FCHA 1GSDA 3HKRA 4K0GA 4K6XA 4D73B 1AXDA 1SJZA 1XXUA 1YF0A 4PTSA 1TRUA 3C1SA 1ERVA 1SD8A 2EIQA 2CA8A 3EWLA 2LV3A 2H74A 2P5QA 1PFOA 3VPQA 4ZBBA 3L0HA 4N11A 3VPTA 4ZXGA 4ISDA 2E0QA 4XS6A 5ECQB 4WR5A 1UVZA 2CQ9A 4DSRA 3HD5A 2WULA 1I5GA 3LORA 2VM1A 1K0CA 20GSA 1TXXA 3FMWA 3RPPA 2L59A 4MMMA 2H6ZA 1X9WB 4BWQA 2GSRA 5ECOB 3QAVA 2VL3A 4AJ7A 2NBSA 4K8MA 2LQQA 2DKIA 2O87A 2FD3A 2OE0A 2VCQA 3IBHA 4K2XA 3VLNA 1F2EA 1XW5A 1TTZA 4MF7A 4I2UA 5G30A 5J9CA 3LXTA 2H0GA 2XHFA 4OCEA 3NZNA 5CAXA 2V6KA 2HZEB 5KN2A 3UBKA 2K6VA 3MDKA 2F9SA 3GL3A 1G6YA 2X49A 4TR0A 4HU7A 3IXRA 1EP7A 4FH8A 2LSTA 3H79A 1CQGA 5ID2A 3M8NA 2DJ3A 1SENA 2FHEA 2L5OA 2YCDA 1ZZYA 5IMFA 3TKQA 1YY7A 3U6VA 3A5IA 4I97A 2H0HA 3LGCA 5GZZB 4WR4A 3LXZA 2IMIA 1QGVA 1OKDA 4NAXA 1VF1A 4ZL9A 2CZ3A 4IJ3A 3BJ5A 2ZCTA 1HYUA 4WBJA 2CX3A 4G10A 3F63A 1SKWB 2HT9A 3TJKA 6GSWA 3I69A 1UN2A 2P0GA 6GSUA 4QL7A 5ABRA 2MBTA 4ILFA 2C1YA 2NDOA 5IMCA 4TR3A 1O6JA 1UC7A 2B5XA 3DD3A 3DMLA 1ML6A 4IHUA 1ZGNA 2CVKA 4L8EA 3HVSA 4O7HA 2F51A 4O5QA 3IAM2 4WF5A 1AQVA 5J3RA 5IMZA 1X5CA 5IIZA 2JZRA 1LBKA 5G5EA 3HVXA 5CRHA 3Q18A 1FB6A 4PGTA 3ZYWA 3GYKA 2GDRA 4JZQA 5FHIA 1TOFA 1XCCA 1TJDA 1E6BA 1YEPA 4K9ZA 4ECBA 3EPTA 1A2JA 2O8VB 4IVFA 4PUAA 3DRNA 4TXOA 5JCGA 2H1DA 3W8JA 1BX9A 1UA5A 1R4WA 3P8WA 1EZKA 5F8BA 4L0UA 3GN3A 5HFGA 4HQSA 3O6TA 4BWSA 5IPGA 2LJAA 1GSFA 3ZFLA 1XW6A 1WMJA 4HEA2 1PRXA 1V2AA 4I2TA 2DJ2A 5D9TA 1WJKA 1SL0B 2FY6A 2REMA 3BBYA 1XWKA 2C0GA 1O85A 3E3EA 3QOUA 1JZRA 3VWXA 2H72A 4F0BA 4Q5NA 4D73A 1R26A 5B6MA 3QCPA 2VLUA 3EVIA 2I9HA 3R2QA 5CRGA 3ZVJA 4MZWA 4EO3A 5A4VA 4OCFA 3L9VA 3UOMA 3KD0A 1W89A 3F4RA 5BRTA 4EL1A 3CRUA 4LLRA 1G6WA 1MD3A 2PPTA 3MSZA 3CRTA 1M3IA 4I5QA 2GZPA 2GT6A 4FYCA 1T4ZA 5JCUA 3A2XA 5F05A 5JCWA 3HY2A 2C3NA 4EE0A 1GSUA 2PN8A 1MD4A 3IK9A 2MYGA 3LEFA 3D6IA 4JEDA 1ZMAA 3PH9A 1MEKA 2C80A 1C72A 2QGVA 4K5RA 1R5PA 3CXGA 4JE1A 1R5AA 3H1NA 1TK8B 3CTGA 4XHMA 2HI7A 2ZUPA 1GNWA 4TXVA 1SJ6A 1GLPA 3TDGA 4OO4A 4RI7A 5D9XA 1JZWA 1ZYQB 4J2FA 2GT5A 2HZEA 1GSEA 3EYTA 2OBIA 3F4TA 2LRCA 3DYRA 1ABAA 5H5SA 4Q5RA 2IPAA 2YOIA 3FK8A 2LQOA 1EOHA 2OA7A 2X8CA 4JR4A 3TOUA 3FR6A 4MP4A 3APQA 4ML6A 3KEBA 4FYBA 2GLRA 3F3RA 2WGRA 13GSA 2PGTA 3IHQA 3UMAA 3EMXA 1ERWA 1GH2A 1T3BA 3ZITA 2H70A 4HU9A 1Z7PA 3UARA 4IQAA 1F3BA 5LD0A 5IOXA 2JZTA 4WBRD 2VAFA 4GTUA 2YZHA 1X0RA 3QDNA 2BJXA 1MTCA 2QA2A 1FAAA 3GURA 1SL1B 2M80A 4EKZA 2B5EA 2CZ2A 2JU5A 3KH7A 3HYPA 1T00A 3IDVA 4V1Ag 4IP1A 2O85A 2V2GA 6GSTA 2I81A 2PUKC 1BEDA 1A0RP 1H75A 2GSQA 4ZIJA 5DCGA 1F6MC 2M72A 1TK0B 5KN0A 2CX4A 2VD0A 1PX7A 2HRFA 4NWYA 2CT6A 3BCKA 4GRFA 1Z7RA 1NW2A 3GSSA 5FWGA 2YWIA 3CSHA 1EGRA 3LFLA 3QAGA 4WETA 6GSSA 1TI3A 2YV7A 3GHAA 5CREA 3LYPA 1OVNA 1M9BA 3Q74A 2IMKA 1B9XC 5DBQA 1GRXA 2DIYA 3N5OA 4ZB9A 2FLSA 4PNGA 1GP1A 4LL4B 1ZYNA 1JLWA 1XPVA 2KP2A 2YJ7A 1GUKA 1B48A 4QL9A 4XIHA 1S3AA 1J0FA 3VFIA 5H5QA 3A2VA 3PR8A 3FY7A 4H86A 3ZMKA 1JHBA 3DVWA 2R0GA 2B1LA 2TRCP 2RM6A 2KP1A 2IJYA 4IJIA 1SKSB 2E7PA 2HNLA 1Q4JA 5FT3A 3WYWA 3TKPA 3TUEA 2VLTA 2E2GA 1PL1A 2GGTA 4G0IA 3C73A 3QMXA 3TGZA 5B6NA 1GSQA 3HVNA 2NVLA 2EC4A 2EIOA 2I1UA 1Z6NA 1ZOFA 4ZB6A 3P7XA 5HQPA 4PQ1A 3U5RE 1IYIA 3GKXA 5A4WA 1WRYA 1GUHA 1DSBA 9GSSA 4DSSA 2HRAA 2LTKA 4HDEA 1TI1A 1S3DA 3GNJA 2VCZA 6GSYA 3D0ZA 4E8HA 3C7MA 5IMAA 1PN9A 1Z9HA 3GKKA 2R0PA 2AAWA 4XRDA 4MPGA 2D2ZA 1BYEA 2VUPA 3WGEA 4ECCA 3MAKA 4OFMA 1YQ1A 3EINA 3KJYA 5ECRB 2B6MA 4RUVA 1QK8A 3LYKA 2K9FA 4MK3A 6GSVA 4TN8A 3GH6A 4KDXA 5D9VA 1X5EA 1XBSA 2RIIA 2GS3A 2O89A 1AC1A 1TRWA 2F8AA 2AB6A 2LNTA 2QC7A 3TB2A 1SJIA 4MJBA 1A2LA 2DMMA 4RI6A 2AV4A 5E4WA 1PL2A 3M9KA 10GSA 5AN1A 1WPIA 2BTOT 4GQCA 3RBTA 3Q19A 1FVJA 3TRQA 5AISA 4YKFA 1I9DA 1X5DA 4AGSA 2RLIA 4AJ8A 4G9HA 4HOJA 5D73A 1K3OA 5CO3A 3J7Yk 1A8YA 1BQ7A 5B7CA 3UBLA 3WGXA 4KCAA 2X4AA 4TVEA 4OD7A 2HYXA 5LNKe 2N5BA 2HXKA 5G31A 2RM5A 3FYGA 2A2SA 3D4MA 4YH2A 3ZRDA 3D21A 2OE3A 12GSA 2A4VA 3EC3A 3NIVA 1XVWA 1U6TA 1K0NA 2VCXA 2VLVA 5GAND 5EY6A 4POKA 4I8BA 1EEJA 4TOPA 3LW9A 3A3TA 1WIKA 3TJBA 1XZOA 2OJLA 4MJCA 1SK1A 3UL3A 5D96A 5L71A 3DVXA 4L5LA 1A0FA 3CMIA 2IFQA 4YAPA 5D9WA 3US3A 3HZ8A 2FWGA 2JACA 1GTAA 4FYUA 5DVBA 1HD2A 1EOGA 2VL9A 5ECLB 2B5YA 2ZNMA 1T4YA 3A2WA 2WS2A 3IK7A 3TCOA 2IMFA 2IN3A 2PU9C 5GSTA 3AY8A 1NSWA 2AHEA 2HZFA 4AF2A 3GKNA 4KA0A 4K7IA 3BCIA 3H4KA 1BG5A 3GX0A 1O8WA 4EIQA 2HRKA 3E9JB 3QFBC 3LSZA 4KSMA 3DIEA 4POBA 1G0TA 2N5AA 2B3SA 4K5SA 4BPYA 4K2DA 4F03A 3G9BA 4BIKA 4A5PA 3VWVA 2L6CA 1TKDB 1QMVA 3APSA 3TRXA 3QPMA 2EIRA 1ON4A 1BAYA 2ALBA 3FW2A 2A2PA 3WT1A 3RDWA 4N10A 1B8XA 3P2AA 4XS4B 3SWLA 3BD2A 2AUVA 2XC2A 2R5GA 3HDCA 3EURA 3G7IA 4PUFC 1K3LA 5F07A 1EEMA 1JZDA 1WE0A 1KNGA 4MJEA 3KCMA 5DQYA 5A5KA 3L9UA 4MH2A 2H8LA 2M46A 3WGDA 2B1KA 2XBQA 2NTOA 4MF5A 18GSA 2DKHA 4YQMA 1TDIA 5AGYA 1TRSA 2GSTA 4TR4A 2LS5A 3HXSA 3ME8A 2I4AA 4Z2UA 2WFCA 1VGLA 1MDIA 1VF2A 2YNXA 3VWWA 5KEJA 1PKZA 4KB3A 1FVKA 4YQVA 1NM3A 5J9BA 2X99A 1N2AA 4MH3A 4GSTA 5DDLA 1XOAA 3OR5A 1HQOA 3J7Yb 2KUCA 3MNGA 4PURA 4BVYA 4EUYA 4GLTA 3M3MA 2LUSA 5HR2A 3VURA 4K7OA 4CW9A 4DSQA 1XFLA 1O8XA 4EVMA 1RW1A 3F0IA 5DJLA 4MNNA 1THXA 5DALA 5EPFA 1V57A 2OKAA 1XOBA 2IIYA 4MCUA 3ED3A 1T1VA 4GF0A 2A4HA 3N9JA 4GSSA 4V2MA 2CVBA 3KZQA 2LRTA 4WF4A 1CQHA 4DSSB 1ILOA 1XG8A 2H1GA 4HQZA 4O5UA 2LJRA 2WRTA 4NV2A 1JLVA 4POLA 2FWEA 1Z5YE 2DBCA 3EE2A 5IMVA 3I43A 4NMUA 1OE7A 1M99A 2K18A 1GTBA 3IE3A 3GTUB 4XS1A 3I9V2 5C04A 2ON7A 1M9AA 4WKWA 1G7EA 1IYHA 3PPUA 1R7HA 3M9JA 3C71A 1J08A 2PVOC 2XBIA 4MJAA 1ZL9A 2V32A 5ECIB 4EF0A 1YEXA 1TU7A 1SD9A 1WOUA 1FB0A 2H6YA 2OBKA 5EL8A 5IOWA 1YDKA 4NHZA 2VCVA 4LL1B 3ZZXA 3FEUA 4WXTA 2R3XA 4HZ2A 5JWQB 2LNSA 4KAEA 1PKWA 5DJMA 4GXZA 3UAPA 5CYYA 2PVQA 3IC8A 4Z2TA 2H1BA 4HZ4A 1VRSD 4N0ZA 3CBUA 4MLYA 3RHCA 4GWRA 4ICYA 3IAS2 4LMWA 3FZ9A 5E59A 4ZL7A 3KGKA 1USBA 1GULA 3F6FA 4XS4A 1AQXA 2NPBA 2IFQB 4FIWA 3HJMA 2XPEA 3GIXA 3UJ1A 2DSAA 2L4QA 1SKRB 5J4UA 5GSSA 3QD9A 2LJKA 2KHPA 5HFKA 2YP6A 1YKCA 3HZ4A 4IN0A 3C8EA 1B4PA 2FA4A 4N0VA 3VWUA 1FOVA 2K8SA 3ERFA 5KN3A 3KIJA 3QR6A 2AYTA 4POMA 1PGTA 3IHGA 2C4JA 2X8GA 1ERTA 4PQHA 4ZB8A 4ECIA 1YJ6A 4BVXB 5HFIA 5J41A 1PMTA 3L78A 4TRXA 5JWRB 1OC9B 3KMOA 17GSA 2FNOA 2E2MA 3KP9A 3RAZA 5ELGA 5CP1A 2YANA 2WCIA 2DC5A 1PX6A 3FRCA 4MPFA 1E2YA 2CAIA 5LCZA 4ULXA 1A24A 3KTBA 1XW9A 5F0GA 2CVDA 4DEJA 3JCML 4K0NA 1Y25A 1EWXA 2JSYA 4Z2RA 3ZIVA 2WDUA 3GRXA 5AIVA 1AUCA 1YZXA 2DMLA 3GV1A 3LQ7A 2DJJA 2N5FA 4HSCX 4G0LA 4JRRA 1FG4A 1A23A 4HUAA 3LG6A 4ZBAA 4GQFA 3DKSA
chains in the Genus database with same CATH topology
1URMA 4HS1A 4KX4A 5ECPB 4PX1A 3KH9A 5G1KA 1FO5A 2GZYA 4KH7A 1XWBA 2C8UA 1U88A 3C1RA 3KMNA 1ERUA 4NPBA 1N8JA 4CHSA 5ENUA 3A5WA 3MIXA 4Z7XA 4KUNA 4MZCA 3GTUA 1FHEA 4BVYB 1OE8A 1F9MA 2LRNA 2VCTA 3TRPA 1S3CA 4GCIA 2ES7A 3BOAA 1X9MB 2H30A 3O3TA 3ISOA 3FHKA 1A8LA 1EGOA 3GL5A 5DALB 3IPZA 1GL8A 1DUGA 3ERGA 11GSA 3S9FA 2O7KA 4HI7A 1OAZA 4J57E 5GAPD 2FGXA 3ERWA 4MF6A 3E0UA 1PQNA 5A4UA 3ZL5A 2PWJA 1V40A 4CY6A 19GSA 1GUMA 4MZBA 2V1MA 4PQIA 4TW5A 1K0DA 1B9YC 4FQUA 2X64A 4KSOA 1U3AA 1M2DA 2WZ9A 3FZ4A 4F2IA 1GTIA 5IMDA 2H76A 4G19A 2F8FA 2KLXA 3ME7A 4ID0A 16GSA 3W6GA 1U87A 3G7JA 1SL2B 4V1Ap 4CY8A 5CNWA 1YKAA 2FA8A 2DJ0A 2L57A 2MMAA 2R0CA 1ZYEA 2I3YA 3F9UA 4ZL8A 3FZAA 4K7NA 5BMUA 1VF4A 1GSSA 1ACVA 2C0EA 1B4QA 2GSSA 3UIWA 3GX8A 3ZLPA 2RUFA 4IP6A 4EDYA 3CYNA 5DAKB 4KF9A 2Z9SA 4L0WA 5J5NA 4J56E 5B8BA 3KM6A 6GSXA 3GH9A 1K3YA 3ZMLA 2IMEA 3EU3A 1K0OA 4LMVA 2YWMA 1F37A 5HR3A 4GSNA 1OC8A 3WD6A 1SYXA 1DE2A 3KP8A 1GWCA 1U3IA 2OACA 4XCSA 1ZYPA 1WP0A 2G0FA 2VIMA 3PINA 4F0CA 1TU8A 2H66A 4IGJA 3UVTA 4MABA 4JR6A 1GNEA 3GSTA 1K0AA 4IKHA 4Q5FA 3HJPA 3TOTA 1FW1A 3IR4A 4BVXA 5IPHA 3MYDA 4OFTA 2YJHA 4IELA 2V41A 3DEXA 8GSSA 3GA4A 1OC9A 1ZCPA 4X43A 4JU5A 4G2EA 1EV4A 1A2MA 2GQKA 5IM9A 1HNCA 1W4VA 1Z3EA 4USSA 3UEMA 2LEGA 2KOKA 4QQ7A 2QA1A 3TKRA 3VK9A 1NHYA 3EU4A 4IQ1A 4E8EA 3ZFBA 1KEBA 4IW9A 1DBYA 2IMDA 2H19A 3R3EA 3LWAA 3IRAA 5EVOA 2BMXA 5F06A 1MDJA 1WWJA 7GSSA 1T8EB 4MA9A 4FO5A 2HSHA 1OKTA 3K8NA 2TIRA 4KCEA 2CAQA 3DWVA 2R6KA 4KW6A 4EDZA 1TK5B 4EXJA 2RUEA 5CRWA 1MDKA 2X8HA 1THOA 1T7PB 1FOHA 3HCZA 1K0BA 5DQSA 3LJRA 2C3QA 1M0UA 2JL4A 4BL7B 3GKMA 5HR0A 3UVHA 3EMPA 1V9WA 1QQ2A 2H6XA 1AW9A 2R37A 1KTEA 1Q98A 2HRNA 1J9BA 5ECHB 2H71A 1SYRA 5IO0A 2OE1A 4X0XA 4EIPA 2GTUA 3W8SA 4F9ZA 5CRDA 5D93A 2PMTA 4LA1A 1TRVA 4TR1A 3M0FA 2L4CA 1F3AA 1BJXA 4PXOA 2HSMA 2V6OA 4ECJA 4NV5A 4V2NA 3IV4A 4YKGA 1M2BA 1LJRA 4ACSA 3H93A 4G0KA 2FUG2 5IQYA 5IO2A 3G7YA 2VL2A 4OWYA 3QFAC 4P3YB 4ZILA 1PN0A 2A2RA 3MWHA 1M2AA 3VI5A 4I6XA 2F3MA 1EV9A 2HLSA 1ST9A 3GMFA 2MMZA 3FZ5A 5KOWA 5ECKB 2JZSA 3F6DA 1PSQA 5B8AA 5AIXA 2MZCA 4HJ2A 4TKYA 2VD1A 1AIUA 2B7KA 3IOSA 1H4OA 4PNFA 3FR9A 2YZUA 3HVVA 4KNDA 3P90A 1AAZA 2R2JA 1PD21 5DAKA 2DJKA 3I6AA 4O92A 1TP9A 1QXHA 1SK2A 3FKFA 4BA7A 1QFNA 2GQLA 2HSYA 4V2LA 2K8VA 3ZIJA 5JWOB 2VOCA 4O5RA 1OYJA 1AQWA 2J9HA 1RK4A 3D22A 2L6DA 5D8IA 2G2QA 2WB9A 4RQXA 2C3TA 2CV4A 4OMVA 3RHBA 4L5OA 2AJQB 4RQRA 2L5LA 2LKUA 4Q5QA 3HJOA 4X1UA 3QAWA 4WEYA 5H5RA 4HJMA 1GSYA 3V1WA 2YV9A 2VL2C 2DJ1A 2WJUA 3F4SA 3O76A 3IA1A 3Q6OA 1NHOA 3CSJA 5KOXA 2PERA 2MMNA 3SBCA 1Z6MA 4MDCA 5ECNB 1YF1A 3FR3A 4KE3A 2FWFA 2MBSA 2B7JA 3WT2A 2H75A 4X4JA 4ZBDA 2OADA 3HA9A 4OFNA 3F3QA 4NXIA 1V58A 3ZTLA 1XWCA 1KBNA 3L4NA 2H0IA 2C0DA 2YN1A 4NHWA 1O73A 2YPMA 3GFKA 4IBPA 2IL3A 2FWHA 4XRAA 5ECSA 5ELAA 2JSZA 4YQUA 2R4VA 5KN1A 2HE3A 2QSIA 5ID2B 4KGIA 3IC4A 3TJGA 5G5FA 4AJ6A 4K1FA 2XPDA 2TRXA 5DCHA 1PA3A 1XIYA 3F8UA 5COHA 3TKSA 3D5JA 22GSA 1RQMA 2GQMA 3CTFA 3DXBA 4EC0A 1V98A 5G1LA 2HFDA 1X9SB 3HHVA 3H8QA 3RPNA 4BL7A 4KDUA 1G7OA 4N30A 1GLQA 2GZZA 2J23A 14GSA 1JFUA 2IWTA 2YWNA 4JBBA 3PGTA 4ML1A 2VCWA 3DGQA 3D4TA 1XWAA 1HNAA 2C0FA 1K0MA 5ECMB 1SK0A 1HNBA 2DIZA 4O32A 3KTLA 1SU9A 4KDYA 3TJJA 1OC3A 1DE1A 4OO5A 2YWOA 3L9SA 1JZOA 2ON5A 2P31A 4IS0A 2VM2A 3ZREA 2H01A 4DVCA 4F82A 4XTSA 5INYA 4YAVA 2GVPA 1Y6EA 2JADA 2UZ8A 1O81A 1XWGA 2H73A 1QUWA 2MMOA 2PBJA 3NOFA 1TW9A 3APOA 1XVQA 3GUSA 3TKSC 4TXOB 4CDOA 1VF3A 3M1GA 5C00A 1O7UA 3ZVJD 1GTUA 3CSIA 2P5RA 2DLXA 2H1AA 1LU4A 2VO4A 3TKSE 3TJFA 1M7TA 2QKEA 5G2ZA 1EP8A 3KXOA 5HR1A 4TR1B 3VI7A 2FCHA 1GSDA 3HKRA 4K0GA 4K6XA 4D73B 1AXDA 1SJZA 1XXUA 1YF0A 4PTSA 1TRUA 3C1SA 1ERVA 1SD8A 2EIQA 2CA8A 3EWLA 2LV3A 2H74A 2P5QA 3VPQA 4ZBBA 3L0HA 4N11A 3VPTA 4ZXGA 4ISDA 2E0QA 4XS6A 5ECQB 4WR5A 1UVZA 2CQ9A 4DSRA 3HD5A 2WULA 1I5GA 3LORA 2VM1A 1K0CA 20GSA 1TXXA 3FMWA 3RPPA 2L59A 4MMMA 2H6ZA 1X9WB 4BWQA 2GSRA 5ECOB 3QAVA 2VL3A 4AJ7A 2NBSA 4K8MA 2LQQA 2DKIA 2O87A 2FD3A 2OE0A 2VCQA 3IBHA 4K2XA 3VLNA 1F2EA 1XW5A 1TTZA 4MF7A 4I2UA 5G30A 5J9CA 3LXTA 2H0GA 2XHFA 4OCEA 3NZNA 5CAXA 2V6KA 2HZEB 5KN2A 3UBKA 2K6VA 3MDKA 2F9SA 3GL3A 1G6YA 2X49A 4TR0A 4HU7A 3IXRA 1EP7A 4FH8A 2LSTA 3H79A 1CQGA 5ID2A 3M8NA 2DJ3A 1SENA 2FHEA 2L5OA 2YCDA 1ZZYA 5IMFA 3TKQA 1YY7A 3U6VA 3A5IA 4I97A 2H0HA 3LGCA 5GZZB 4WR4A 3LXZA 2IMIA 1QGVA 1OKDA 4NAXA 1VF1A 4ZL9A 2CZ3A 4IJ3A 3BJ5A 2ZCTA 1HYUA 4WBJA 2CX3A 4G10A 3F63A 1SKWB 2HT9A 3TJKA 6GSWA 3I69A 1UN2A 2P0GA 6GSUA 4QL7A 5ABRA 2MBTA 4ILFA 2C1YA 2NDOA 5IMCA 4TR3A 1O6JA 1UC7A 2B5XA 3DD3A 3DMLA 1ML6A 4IHUA 1ZGNA 2CVKA 4L8EA 3HVSA 4O7HA 2F51A 4O5QA 3IAM2 4WF5A 1AQVA 5J3RA 5IMZA 1X5CA 5IIZA 2JZRA 1LBKA 5G5EA 3HVXA 5CRHA 3Q18A 1FB6A 4PGTA 3ZYWA 3GYKA 2GDRA 4JZQA 5FHIA 1TOFA 1XCCA 1TJDA 1E6BA 1YEPA 4K9ZA 4ECBA 3EPTA 1A2JA 2O8VB 4IVFA 4PUAA 3DRNA 4TXOA 5JCGA 2H1DA 3W8JA 1BX9A 1UA5A 1R4WA 3P8WA 1EZKA 5F8BA 4L0UA 3GN3A 5HFGA 4HQSA 3O6TA 4BWSA 5IPGA 2LJAA 1GSFA 3ZFLA 1XW6A 1WMJA 4HEA2 1PRXA 1V2AA 4I2TA 2DJ2A 5D9TA 1WJKA 1SL0B 2FY6A 2REMA 3BBYA 1XWKA 2C0GA 1O85A 3E3EA 3QOUA 1JZRA 3VWXA 2H72A 4F0BA 4Q5NA 4D73A 1R26A 5B6MA 3QCPA 2VLUA 3EVIA 2I9HA 3R2QA 5CRGA 3ZVJA 4MZWA 4EO3A 5A4VA 4OCFA 3L9VA 3UOMA 3KD0A 1W89A 3F4RA 5BRTA 4EL1A 3CRUA 4LLRA 1G6WA 1MD3A 2PPTA 3MSZA 3CRTA 4I5QA 2GZPA 2GT6A 4FYCA 1T4ZA 5JCUA 3A2XA 5F05A 5JCWA 3HY2A 2C3NA 4EE0A 1GSUA 2PN8A 1MD4A 3IK9A 2MYGA 3LEFA 3D6IA 4JEDA 1ZMAA 3PH9A 1MEKA 2C80A 1C72A 2QGVA 4K5RA 1R5PA 3CXGA 4JE1A 1R5AA 3H1NA 1TK8B 3CTGA 4XHMA 2HI7A 2ZUPA 1GNWA 4TXVA 1SJ6A 1GLPA 3TDGA 4OO4A 4RI7A 5D9XA 1JZWA 1ZYQB 4J2FA 2GT5A 2HZEA 1GSEA 3EYTA 2OBIA 3F4TA 2LRCA 3DYRA 1ABAA 5H5SA 4Q5RA 2IPAA 2YOIA 3FK8A 2LQOA 1EOHA 2OA7A 2X8CA 4JR4A 3TOUA 3FR6A 4MP4A 3APQA 4ML6A 3KEBA 4FYBA 2GLRA 3F3RA 2WGRA 13GSA 2PGTA 3IHQA 3UMAA 3EMXA 1ERWA 1GH2A 1T3BA 3ZITA 2H70A 4HU9A 1Z7PA 3UARA 4IQAA 1F3BA 5LD0A 5IOXA 2JZTA 4WBRD 2VAFA 4GTUA 2YZHA 1X0RA 3QDNA 2BJXA 1MTCA 2QA2A 1FAAA 3GURA 1SL1B 2M80A 4EKZA 2B5EA 2CZ2A 2JU5A 3KH7A 3HYPA 1T00A 3IDVA 4V1Ag 4IP1A 2O85A 2V2GA 6GSTA 2I81A 2PUKC 1BEDA 1A0RP 1H75A 2GSQA 4ZIJA 5DCGA 1F6MC 2M72A 1TK0B 5KN0A 2CX4A 2VD0A 1PX7A 2HRFA 4NWYA 2CT6A 3BCKA 4GRFA 1Z7RA 1NW2A 3GSSA 5FWGA 2YWIA 3CSHA 1EGRA 3LFLA 3QAGA 4WETA 6GSSA 1TI3A 2YV7A 3GHAA 5CREA 3LYPA 1OVNA 1M9BA 3Q74A 2IMKA 1B9XC 5DBQA 1GRXA 2DIYA 3N5OA 4ZB9A 2FLSA 4PNGA 1GP1A 4LL4B 1ZYNA 1JLWA 1XPVA 2KP2A 2YJ7A 1GUKA 1B48A 4QL9A 4XIHA 1S3AA 1J0FA 3VFIA 5H5QA 3A2VA 3PR8A 3FY7A 4H86A 3ZMKA 1JHBA 3DVWA 2R0GA 2B1LA 2TRCP 2RM6A 2KP1A 2IJYA 4IJIA 1SKSB 2E7PA 2HNLA 1Q4JA 5FT3A 3WYWA 3TKPA 3TUEA 2VLTA 2E2GA 1PL1A 2GGTA 4G0IA 3C73A 3QMXA 3TGZA 5B6NA 1GSQA 2NVLA 2EC4A 2EIOA 2I1UA 1Z6NA 1ZOFA 4ZB6A 3P7XA 5HQPA 4PQ1A 3U5RE 1IYIA 3GKXA 5A4WA 1WRYA 1GUHA 1DSBA 9GSSA 4DSSA 2HRAA 2LTKA 4HDEA 1TI1A 1S3DA 3GNJA 2VCZA 6GSYA 3D0ZA 4E8HA 3C7MA 5IMAA 1PN9A 1Z9HA 3GKKA 2R0PA 2AAWA 4XRDA 4MPGA 2D2ZA 1BYEA 2VUPA 3WGEA 4ECCA 3MAKA 4OFMA 1YQ1A 3EINA 3KJYA 5ECRB 2B6MA 4RUVA 1QK8A 3LYKA 2K9FA 4MK3A 6GSVA 4TN8A 3GH6A 4KDXA 5D9VA 1X5EA 1XBSA 2RIIA 2GS3A 2O89A 1AC1A 1TRWA 2F8AA 2AB6A 2LNTA 2QC7A 3TB2A 1SJIA 4MJBA 1A2LA 2DMMA 4RI6A 2AV4A 5E4WA 1PL2A 3M9KA 10GSA 5AN1A 1WPIA 2BTOT 4GQCA 3RBTA 3Q19A 1FVJA 3TRQA 5AISA 4YKFA 1I9DA 1X5DA 4AGSA 2RLIA 4AJ8A 4G9HA 4HOJA 5D73A 1K3OA 5CO3A 3J7Yk 1A8YA 1BQ7A 5B7CA 3UBLA 3WGXA 4KCAA 2X4AA 4TVEA 4OD7A 2HYXA 5LNKe 2N5BA 2HXKA 5G31A 2RM5A 3FYGA 2A2SA 3D4MA 4YH2A 3ZRDA 3D21A 2OE3A 12GSA 2A4VA 3EC3A 3NIVA 1XVWA 1U6TA 1K0NA 2VCXA 2VLVA 5GAND 5EY6A 4POKA 4I8BA 1EEJA 4TOPA 3LW9A 3A3TA 1WIKA 3TJBA 1XZOA 2OJLA 4MJCA 1SK1A 3UL3A 5D96A 5L71A 3DVXA 4L5LA 1A0FA 3CMIA 2IFQA 4YAPA 5D9WA 3US3A 3HZ8A 2FWGA 2JACA 1GTAA 4FYUA 5DVBA 1HD2A 1EOGA 2VL9A 5ECLB 2B5YA 2ZNMA 1T4YA 3A2WA 2WS2A 3IK7A 3TCOA 2IMFA 2IN3A 2PU9C 5GSTA 3AY8A 1NSWA 2AHEA 2HZFA 4AF2A 3GKNA 4KA0A 4K7IA 3BCIA 3H4KA 1BG5A 3GX0A 1O8WA 4EIQA 2HRKA 3E9JB 3QFBC 3LSZA 4KSMA 3DIEA 4POBA 1G0TA 2N5AA 2B3SA 4K5SA 4BPYA 4K2DA 4F03A 3G9BA 4A5PA 3VWVA 2L6CA 1TKDB 1QMVA 3APSA 3TRXA 3QPMA 2EIRA 1ON4A 1BAYA 2ALBA 3FW2A 2A2PA 3WT1A 3RDWA 4N10A 1B8XA 3P2AA 4XS4B 3SWLA 3BD2A 2AUVA 2XC2A 2R5GA 3HDCA 3EURA 3G7IA 4PUFC 1K3LA 5F07A 1EEMA 1JZDA 1WE0A 1KNGA 4MJEA 3KCMA 5DQYA 5A5KA 3L9UA 4MH2A 2H8LA 2M46A 3WGDA 2B1KA 2XBQA 2NTOA 4MF5A 18GSA 4YQMA 2DKHA 1TDIA 5AGYA 1TRSA 2GSTA 4TR4A 2LS5A 3HXSA 3ME8A 2I4AA 4Z2UA 2WFCA 1VGLA 1MDIA 1VF2A 2YNXA 3VWWA 5KEJA 1PKZA 4KB3A 1FVKA 4YQVA 1NM3A 5J9BA 2X99A 1N2AA 4MH3A 4GSTA 5DDLA 1XOAA 3OR5A 1HQOA 3J7Yb 2KUCA 3MNGA 4PURA 4BVYA 4EUYA 4GLTA 3M3MA 2LUSA 5HR2A 3VURA 4K7OA 4CW9A 4DSQA 1XFLA 1O8XA 4EVMA 1RW1A 3F0IA 5DJLA 4MNNA 1THXA 5DALA 5EPFA 1V57A 2OKAA 1XOBA 2IIYA 4MCUA 3ED3A 1T1VA 4GF0A 2A4HA 3N9JA 4GSSA 4V2MA 2CVBA 3KZQA 2LRTA 4WF4A 1CQHA 4DSSB 1ILOA 2H1GA 4HQZA 4O5UA 2LJRA 2WRTA 4NV2A 1JLVA 4POLA 2FWEA 1Z5YE 2DBCA 3EE2A 5IMVA 3I43A 4NMUA 1OE7A 1M99A 2K18A 1GTBA 3IE3A 3GTUB 4XS1A 3I9V2 5C04A 2ON7A 1M9AA 4WKWA 1G7EA 1IYHA 3PPUA 1R7HA 3M9JA 3C71A 1J08A 2PVOC 2XBIA 4MJAA 1ZL9A 2V32A 5ECIB 4EF0A 1YEXA 1TU7A 1SD9A 1WOUA 1FB0A 2H6YA 2OBKA 5EL8A 5IOWA 1YDKA 4NHZA 2VCVA 4LL1B 3ZZXA 3FEUA 4WXTA 2R3XA 4HZ2A 5JWQB 2LNSA 4KAEA 1PKWA 5DJMA 4GXZA 3UAPA 5CYYA 2PVQA 3IC8A 4Z2TA 2H1BA 4HZ4A 1VRSD 4N0ZA 3CBUA 4MLYA 3RHCA 4GWRA 4ICYA 3IAS2 4LMWA 3FZ9A 5E59A 4ZL7A 3KGKA 1USBA 1GULA 3F6FA 4XS4A 1AQXA 2NPBA 2IFQB 4FIWA 3HJMA 2XPEA 3GIXA 3UJ1A 2DSAA 2L4QA 1SKRB 5J4UA 5GSSA 3QD9A 2LJKA 2KHPA 5HFKA 2YP6A 1YKCA 3HZ4A 4IN0A 3C8EA 1B4PA 2FA4A 4N0VA 3VWUA 1FOVA 2K8SA 3ERFA 5KN3A 3KIJA 3QR6A 2AYTA 4POMA 1PGTA 3IHGA 2C4JA 2X8GA 1ERTA 4PQHA 4ZB8A 4ECIA 1YJ6A 4BVXB 5HFIA 5J41A 1PMTA 3L78A 4TRXA 5JWRB 1OC9B 3KMOA 17GSA 2FNOA 2E2MA 3KP9A 3RAZA 5ELGA 5CP1A 2YANA 2WCIA 2DC5A 1PX6A 3FRCA 4MPFA 1E2YA 2CAIA 5LCZA 4ULXA 1A24A 3KTBA 1XW9A 5F0GA 2CVDA 4DEJA 3JCML 4K0NA 1Y25A 1EWXA 2JSYA 4Z2RA 3ZIVA 2WDUA 3GRXA 5AIVA 1AUCA 1YZXA 2DMLA 3GV1A 3LQ7A 2DJJA 2N5FA 4G0LA 4JRRA 1FG4A 1A23A 4HUAA 3LG6A 4ZBAA 4GQFA 3DKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1URM A;  4HS1 A;  4KX4 A;  5ECP B;  4PX1 A;  3KH9 A;  5G1K A;  1FO5 A;  2GZY A;  4KH7 A;  1XWB A;  2C8U A;  1U88 A;  3C1R A;  3KMN A;  1ERU A;  4NPB A;  1N8J A;  4CHS A;  5ENU A;  3A5W A;  4Z7X A;  4KUN A;  4MZC A;  3GTU A;  1FHE A;  1OE8 A;  1F9M A;  2LRN A;  2VCT A;  3TRP A;  1S3C A;  4GCI A;  2ES7 A;  3BOA A;  1X9M B;  2H30 A;  3O3T A;  3ISO A;  3FHK A;  1A8L A;  1EGO A;  3GL5 A;  5DAL B;  3IPZ A;  1GL8 A;  1DUG A;  3ERG A;  11GS A;  3S9F A;  2O7K A;  4HI7 A;  1OAZ A;  4J57 E;  5GAP D;  2FGX A;  3ERW A;  4MF6 A;  3E0U A;  1PQN A;  5A4U A;  3ZL5 A;  2PWJ A;  1V40 A;  19GS A;  1GUM A;  4MZB A;  2V1M A;  4PQI A;  4TW5 A;  1K0D A;  1B9Y C;  2X64 A;  4KSO A;  1U3A A;  1M2D A;  2WZ9 A;  3FZ4 A;  4F2I A;  1GTI A;  5IMD A;  2H76 A;  4G19 A;  2F8F A;  2KLX A;  3ME7 A;  4ID0 A;  16GS A;  3W6G A;  1U87 A;  3G7J A;  1SL2 B;  4V1A p;  5CNW A;  1YKA A;  2FA8 A;  2DJ0 A;  2L57 A;  2MMA A;  1ZYE A;  2I3Y A;  3F9U A;  4ZL8 A;  3FZA A;  4K7N A;  1VF4 A;  1GSS A;  1ACV A;  2C0E A;  1B4Q A;  2GSS A;  3UIW A;  3GX8 A;  3ZLP A;  2RUF A;  4IP6 A;  4EDY A;  3CYN A;  5DAK B;  2Z9S A;  4L0W A;  5J5N A;  4J56 E;  5B8B A;  3KM6 A;  6GSX A;  3GH9 A;  1K3Y A;  3ZML A;  2IME A;  3EU3 A;  1K0O A;  4LMV A;  2YWM A;  1F37 A;  5HR3 A;  4GSN A;  1OC8 A;  3WD6 A;  1SYX A;  1DE2 A;  3KP8 A;  1GWC A;  1U3I A;  2OAC A;  4XCS A;  1WP0 A;  2G0F A;  2VIM A;  3PIN A;  4F0C A;  1TU8 A;  2H66 A;  4IGJ A;  3UVT A;  4MAB A;  4JR6 A;  1GNE A;  3GST A;  1K0A A;  4IKH A;  4Q5F A;  3HJP A;  3TOT A;  1FW1 A;  3IR4 A;  4BVX A;  5IPH A;  4OFT A;  2YJH A;  4IEL A;  2V41 A;  3DEX A;  8GSS A;  3GA4 A;  1OC9 A;  1ZCP A;  4X43 A;  4JU5 A;  4G2E A;  1EV4 A;  1A2M A;  2GQK A;  5IM9 A;  1HNC A;  1W4V A;  1Z3E A;  3UEM A;  2LEG A;  2KOK A;  4QQ7 A;  3TKR A;  3VK9 A;  1NHY A;  3EU4 A;  4IQ1 A;  4E8E A;  3ZFB A;  1KEB A;  4IW9 A;  1DBY A;  2IMD A;  2H19 A;  3LWA A;  3IRA A;  5EVO A;  2BMX A;  5F06 A;  1MDJ A;  1WWJ A;  7GSS A;  1T8E B;  4MA9 A;  4FO5 A;  2HSH A;  1OKT A;  3K8N A;  2TIR A;  4KCE A;  2CAQ A;  3DWV A;  2R6K A;  4KW6 A;  4EDZ A;  1TK5 B;  4EXJ A;  2RUE A;  5CRW A;  1MDK A;  2X8H A;  1THO A;  1T7P B;  3HCZ A;  1K0B A;  5DQS A;  3LJR A;  2C3Q A;  1M0U A;  2JL4 A;  3GKM A;  5HR0 A;  3UVH A;  3EMP A;  1V9W A;  1QQ2 A;  2H6X A;  1AW9 A;  2R37 A;  1KTE A;  1Q98 A;  2HRN A;  1J9B A;  5ECH B;  2H71 A;  1SYR A;  5IO0 A;  2OE1 A;  4X0X A;  2GTU A;  3W8S A;  4F9Z A;  5CRD A;  5D93 A;  2PMT A;  4LA1 A;  1TRV A;  4TR1 A;  3M0F A;  2L4C A;  1F3A A;  1BJX A;  4PXO A;  2V6O A;  4ECJ A;  4NV5 A;  4V2N A;  3IV4 A;  1M2B A;  1LJR A;  4ACS A;  3H93 A;  2FUG 2;  5IQY A;  5IO2 A;  3G7Y A;  2VL2 A;  4OWY A;  3QFA C;  4P3Y B;  4ZIL A;  2A2R A;  3MWH A;  1M2A A;  3VI5 A;  4I6X A;  2F3M A;  1EV9 A;  2HLS A;  1ST9 A;  3GMF A;  2MMZ A;  3FZ5 A;  5ECK B;  2JZS A;  3F6D A;  1PSQ A;  5B8A A;  5AIX A;  2MZC A;  4HJ2 A;  4TKY A;  2VD1 A;  1AIU A;  2B7K A;  3IOS A;  1H4O A;  4PNF A;  3FR9 A;  2YZU A;  3HVV A;  4KND A;  3P90 A;  1AAZ A;  2R2J A;  1PD2 1;  5DAK A;  2DJK A;  3I6A A;  4O92 A;  1TP9 A;  1QXH A;  1SK2 A;  3FKF A;  4BA7 A;  1QFN A;  2GQL A;  2HSY A;  4V2L A;  2K8V A;  3ZIJ A;  5JWO B;  2VOC A;  4O5R A;  1OYJ A;  1AQW A;  2J9H A;  1RK4 A;  3D22 A;  2L6D A;  5D8I A;  2G2Q A;  2WB9 A;  4RQX A;  2C3T A;  2CV4 A;  4OMV A;  3RHB A;  4L5O A;  2AJQ B;  4RQR A;  2L5L A;  2LKU A;  4Q5Q A;  3HJO A;  4X1U A;  3QAW A;  4WEY A;  5H5R A;  4HJM A;  1GSY A;  3V1W A;  2YV9 A;  2VL2 C;  2DJ1 A;  2WJU A;  3F4S A;  3O76 A;  3IA1 A;  3Q6O A;  1NHO A;  3CSJ A;  2PER A;  2MMN A;  3SBC A;  1Z6M A;  4MDC A;  5ECN B;  1YF1 A;  3FR3 A;  4KE3 A;  2FWF A;  2MBS A;  2B7J A;  3WT2 A;  2H75 A;  4ZBD A;  2OAD A;  3HA9 A;  4OFN A;  3F3Q A;  4NXI A;  1V58 A;  3ZTL A;  1XWC A;  1KBN A;  3L4N A;  2H0I A;  2C0D A;  2YN1 A;  4NHW A;  1O73 A;  2YPM A;  3GFK A;  4IBP A;  2IL3 A;  2FWH A;  4XRA A;  5ECS A;  5ELA A;  2JSZ A;  4YQU A;  2R4V A;  5KN1 A;  2HE3 A;  2QSI A;  5ID2 B;  4KGI A;  3IC4 A;  3TJG A;  5G5F A;  4AJ6 A;  4K1F A;  2XPD A;  2TRX A;  5DCH A;  1PA3 A;  1XIY A;  3F8U A;  5COH A;  3TKS A;  3D5J A;  22GS A;  1RQM A;  2GQM A;  3CTF A;  3DXB A;  4EC0 A;  1V98 A;  5G1L A;  2HFD A;  1X9S B;  3HHV A;  3H8Q A;  3RPN A;  4BL7 A;  4KDU A;  1G7O A;  4N30 A;  1GLQ A;  2GZZ A;  2J23 A;  14GS A;  1JFU A;  2IWT A;  2YWN A;  4JBB A;  3PGT A;  4ML1 A;  2VCW A;  3DGQ A;  3D4T A;  1XWA A;  1HNA A;  2C0F A;  1K0M A;  5ECM B;  1SK0 A;  1HNB A;  2DIZ A;  4O32 A;  3KTL A;  1SU9 A;  4KDY A;  3TJJ A;  1OC3 A;  1DE1 A;  4OO5 A;  2YWO A;  3L9S A;  1JZO A;  2ON5 A;  2P31 A;  4IS0 A;  2VM2 A;  3ZRE A;  2H01 A;  4DVC A;  4F82 A;  4XTS A;  5INY A;  4YAV A;  2GVP A;  1Y6E A;  2JAD A;  1O81 A;  1XWG A;  2H73 A;  1QUW A;  2MMO A;  2PBJ A;  3NOF A;  1TW9 A;  3APO A;  1XVQ A;  3GUS A;  3TKS C;  4TXO B;  4CDO A;  1VF3 A;  3M1G A;  5C00 A;  1O7U A;  3ZVJ D;  1GTU A;  3CSI A;  2P5R A;  2DLX A;  2H1A A;  1LU4 A;  2VO4 A;  3TKS E;  3TJF A;  1M7T A;  2QKE A;  5G2Z A;  1EP8 A;  3KXO A;  5HR1 A;  4TR1 B;  3VI7 A;  2FCH A;  1GSD A;  3HKR A;  4K0G A;  4K6X A;  4D73 B;  1AXD A;  1SJZ A;  1XXU A;  1YF0 A;  1TRU A;  3C1S A;  1ERV A;  1SD8 A;  2EIQ A;  2CA8 A;  3EWL A;  2LV3 A;  2H74 A;  2P5Q A;  3VPQ A;  4ZBB A;  3L0H A;  4N11 A;  3VPT A;  4ZXG A;  4ISD A;  2E0Q A;  4XS6 A;  5ECQ B;  4WR5 A;  1UVZ A;  2CQ9 A;  4DSR A;  3HD5 A;  2WUL A;  1I5G A;  3LOR A;  2VM1 A;  1K0C A;  20GS A;  1TXX A;  3RPP A;  2L59 A;  4MMM A;  2H6Z A;  1X9W B;  4BWQ A;  2GSR A;  5ECO B;  3QAV A;  2VL3 A;  4AJ7 A;  2NBS A;  4K8M A;  2LQQ A;  2O87 A;  2OE0 A;  2FD3 A;  2VCQ A;  3IBH A;  3VLN A;  1F2E A;  1XW5 A;  1TTZ A;  4MF7 A;  4I2U A;  5G30 A;  5J9C A;  3LXT A;  2H0G A;  2XHF A;  4OCE A;  3NZN A;  5CAX A;  2V6K A;  2HZE B;  5KN2 A;  3UBK A;  2K6V A;  3MDK A;  2F9S A;  3GL3 A;  1G6Y A;  4TR0 A;  4HU7 A;  3IXR A;  1EP7 A;  4FH8 A;  2LST A;  3H79 A;  1CQG A;  5ID2 A;  3M8N A;  2DJ3 A;  1SEN A;  2FHE A;  2L5O A;  2YCD A;  1ZZY A;  5IMF A;  3TKQ A;  1YY7 A;  3U6V A;  4I97 A;  2H0H A;  3LGC A;  5GZZ B;  4WR4 A;  3LXZ A;  2IMI A;  1QGV A;  1OKD A;  4NAX A;  1VF1 A;  4ZL9 A;  2CZ3 A;  4IJ3 A;  3BJ5 A;  2ZCT A;  1HYU A;  4WBJ A;  2CX3 A;  4G10 A;  3F63 A;  1SKW B;  2HT9 A;  3TJK A;  6GSW A;  3I69 A;  1UN2 A;  2P0G A;  6GSU A;  4QL7 A;  5ABR A;  2MBT A;  4ILF A;  2C1Y A;  2NDO A;  5IMC A;  4TR3 A;  1O6J A;  1UC7 A;  2B5X A;  3DD3 A;  3DML A;  1ML6 A;  4IHU A;  1ZGN A;  2CVK A;  4L8E A;  3HVS A;  4O7H A;  2F51 A;  3IAM 2;  4WF5 A;  1AQV A;  5J3R A;  5IMZ A;  1X5C A;  5IIZ A;  2JZR A;  1LBK A;  5G5E A;  3HVX A;  5CRH A;  3Q18 A;  1FB6 A;  4PGT A;  3ZYW A;  3GYK A;  2GDR A;  4JZQ A;  5FHI A;  1TOF A;  1XCC A;  1TJD A;  1E6B A;  1YEP A;  4K9Z A;  4ECB A;  1A2J A;  2O8V B;  4IVF A;  4PUA A;  3DRN A;  4TXO A;  5JCG A;  2H1D A;  3W8J A;  1BX9 A;  1UA5 A;  1R4W A;  3P8W A;  1EZK A;  5F8B A;  4L0U A;  3GN3 A;  5HFG A;  4HQS A;  3O6T A;  4BWS A;  5IPG A;  2LJA A;  1GSF A;  3ZFL A;  1XW6 A;  1WMJ A;  4HEA 2;  1PRX A;  1V2A A;  4I2T A;  2DJ2 A;  5D9T A;  1WJK A;  1SL0 B;  2FY6 A;  2REM A;  3BBY A;  1XWK A;  2C0G A;  1O85 A;  3E3E A;  3QOU A;  1JZR A;  3VWX A;  2H72 A;  4F0B A;  4Q5N A;  4D73 A;  1R26 A;  5B6M A;  3QCP A;  2VLU A;  3EVI A;  2I9H A;  3R2Q A;  5CRG A;  3ZVJ A;  4MZW A;  4EO3 A;  5A4V A;  4OCF A;  3L9V A;  3UOM A;  3KD0 A;  1W89 A;  3F4R A;  4EL1 A;  3CRU A;  4LLR A;  1G6W A;  1MD3 A;  2PPT A;  3MSZ A;  3CRT A;  4I5Q A;  2GZP A;  2GT6 A;  4FYC A;  1T4Z A;  5JCU A;  3A2X A;  5F05 A;  5JCW A;  3HY2 A;  2C3N A;  4EE0 A;  1GSU A;  2PN8 A;  1MD4 A;  3IK9 A;  2MYG A;  3LEF A;  3D6I A;  4JED A;  1ZMA A;  3PH9 A;  1MEK A;  2C80 A;  1C72 A;  2QGV A;  1R5P A;  3CXG A;  4JE1 A;  1R5A A;  3H1N A;  1TK8 B;  3CTG A;  4XHM A;  2HI7 A;  2ZUP A;  1GNW A;  4TXV A;  1SJ6 A;  1GLP A;  3TDG A;  4OO4 A;  4RI7 A;  5D9X A;  1JZW A;  1ZYQ B;  4J2F A;  2GT5 A;  2HZE A;  1GSE A;  3EYT A;  2OBI A;  3F4T A;  2LRC A;  3DYR A;  1ABA A;  5H5S A;  4Q5R A;  2IPA A;  2YOI A;  3FK8 A;  2LQO A;  1EOH A;  2OA7 A;  2X8C A;  4JR4 A;  3TOU A;  3FR6 A;  4MP4 A;  3APQ A;  4ML6 A;  3KEB A;  4FYB A;  2GLR A;  3F3R A;  2WGR A;  13GS A;  2PGT A;  3IHQ A;  3UMA A;  3EMX A;  1ERW A;  1GH2 A;  1T3B A;  3ZIT A;  2H70 A;  4HU9 A;  1Z7P A;  3UAR A;  4IQA A;  1F3B A;  5LD0 A;  5IOX A;  2JZT A;  4WBR D;  2VAF A;  4GTU A;  2YZH A;  1X0R A;  3QDN A;  2BJX A;  1MTC A;  1FAA A;  3GUR A;  1SL1 B;  2M80 A;  4EKZ A;  2B5E A;  2CZ2 A;  2JU5 A;  3KH7 A;  3HYP A;  1T00 A;  3IDV A;  4V1A g;  4IP1 A;  2O85 A;  2V2G A;  6GST A;  2I81 A;  2PUK C;  1BED A;  1A0R P;  1H75 A;  2GSQ A;  4ZIJ A;  5DCG A;  1F6M C;  2M72 A;  1TK0 B;  5KN0 A;  2CX4 A;  2VD0 A;  1PX7 A;  2HRF A;  4NWY A;  2CT6 A;  3BCK A;  4GRF A;  1Z7R A;  1NW2 A;  3GSS A;  5FWG A;  2YWI A;  3CSH A;  1EGR A;  3LFL A;  3QAG A;  4WET A;  6GSS A;  1TI3 A;  2YV7 A;  3GHA A;  5CRE A;  3LYP A;  1OVN A;  1M9B A;  3Q74 A;  2IMK A;  1B9X C;  5DBQ A;  1GRX A;  2DIY A;  3N5O A;  4ZB9 A;  2FLS A;  4PNG A;  1GP1 A;  4LL4 B;  1JLW A;  1XPV A;  2KP2 A;  2YJ7 A;  1GUK A;  1B48 A;  4QL9 A;  4XIH A;  1S3A A;  1J0F A;  3VFI A;  5H5Q A;  3A2V A;  3PR8 A;  3FY7 A;  4H86 A;  3ZMK A;  1JHB A;  3DVW A;  2B1L A;  2TRC P;  2RM6 A;  2KP1 A;  2IJY A;  4IJI A;  1SKS B;  2E7P A;  2HNL A;  1Q4J A;  5FT3 A;  3WYW A;  3TKP A;  3TUE A;  2VLT A;  2E2G A;  1PL1 A;  2GGT A;  3C73 A;  3QMX A;  3TGZ A;  5B6N A;  1GSQ A;  2NVL A;  2EC4 A;  2EIO A;  2I1U A;  1Z6N A;  1ZOF A;  4ZB6 A;  3P7X A;  5HQP A;  4PQ1 A;  3U5R E;  1IYI A;  3GKX A;  5A4W A;  1WRY A;  1GUH A;  1DSB A;  9GSS A;  4DSS A;  2LTK A;  4HDE A;  1TI1 A;  1S3D A;  3GNJ A;  2VCZ A;  6GSY A;  3D0Z A;  4E8H A;  3C7M A;  5IMA A;  1PN9 A;  1Z9H A;  3GKK A;  2AAW A;  4XRD A;  4MPG A;  2D2Z A;  1BYE A;  2VUP A;  3WGE A;  4ECC A;  3MAK A;  4OFM A;  1YQ1 A;  3EIN A;  3KJY A;  5ECR B;  2B6M A;  4RUV A;  1QK8 A;  3LYK A;  2K9F A;  4MK3 A;  6GSV A;  4TN8 A;  3GH6 A;  4KDX A;  5D9V A;  1X5E A;  1XBS A;  2RII A;  2GS3 A;  2O89 A;  1AC1 A;  1TRW A;  2F8A A;  2AB6 A;  2LNT A;  2QC7 A;  3TB2 A;  1SJI A;  4MJB A;  1A2L A;  2DMM A;  4RI6 A;  2AV4 A;  5E4W A;  1PL2 A;  3M9K A;  10GS A;  5AN1 A;  1WPI A;  2BTO T;  4GQC A;  3RBT A;  3Q19 A;  1FVJ A;  3TRQ A;  5AIS A;  1I9D A;  1X5D A;  4AGS A;  2RLI A;  4AJ8 A;  4G9H A;  4HOJ A;  5D73 A;  1K3O A;  5CO3 A;  3J7Y k;  1A8Y A;  1BQ7 A;  5B7C A;  3UBL A;  3WGX A;  4KCA A;  4TVE A;  4OD7 A;  2HYX A;  5LNK e;  2N5B A;  2HXK A;  5G31 A;  2RM5 A;  3FYG A;  2A2S A;  3D4M A;  4YH2 A;  3ZRD A;  3D21 A;  2OE3 A;  12GS A;  2A4V A;  3EC3 A;  3NIV A;  1XVW A;  1U6T A;  1K0N A;  2VCX A;  2VLV A;  5GAN D;  5EY6 A;  4POK A;  4I8B A;  1EEJ A;  4TOP A;  3A3T A;  1WIK A;  3TJB A;  1XZO A;  2OJL A;  4MJC A;  1SK1 A;  3UL3 A;  5D96 A;  5L71 A;  3DVX A;  4L5L A;  1A0F A;  3CMI A;  2IFQ A;  4YAP A;  5D9W A;  3US3 A;  3HZ8 A;  2FWG A;  2JAC A;  1GTA A;  4FYU A;  5DVB A;  1HD2 A;  1EOG A;  2VL9 A;  5ECL B;  2B5Y A;  2ZNM A;  1T4Y A;  3A2W A;  2WS2 A;  3IK7 A;  3TCO A;  2IMF A;  2IN3 A;  2PU9 C;  5GST A;  3AY8 A;  1NSW A;  2AHE A;  2HZF A;  4AF2 A;  3GKN A;  4KA0 A;  4K7I A;  3BCI A;  3H4K A;  1BG5 A;  3GX0 A;  1O8W A;  3E9J B;  3QFB C;  3LSZ A;  4KSM A;  3DIE A;  4POB A;  1G0T A;  2N5A A;  2B3S A;  4BPY A;  4K2D A;  4F03 A;  3G9B A;  3VWV A;  2L6C A;  1TKD B;  1QMV A;  3APS A;  3TRX A;  3QPM A;  2EIR A;  1ON4 A;  1BAY A;  2ALB A;  3FW2 A;  3WT1 A;  3RDW A;  4N10 A;  1B8X A;  3P2A A;  4XS4 B;  3SWL A;  3BD2 A;  2AUV A;  2XC2 A;  2R5G A;  3HDC A;  3EUR A;  3G7I A;  4PUF C;  1K3L A;  5F07 A;  1EEM A;  1JZD A;  1WE0 A;  1KNG A;  4MJE A;  3KCM A;  5DQY A;  5A5K A;  3L9U A;  4MH2 A;  2H8L A;  2M46 A;  3WGD A;  2B1K A;  2XBQ A;  2NTO A;  4MF5 A;  18GS A;  4YQM A;  1TDI A;  5AGY A;  1TRS A;  2GST A;  4TR4 A;  2LS5 A;  3HXS A;  3ME8 A;  2I4A A;  2WFC A;  1VGL A;  1MDI A;  1VF2 A;  2YNX A;  3VWW A;  5KEJ A;  1PKZ A;  4KB3 A;  1FVK A;  4YQV A;  1NM3 A;  5J9B A;  2X99 A;  1N2A A;  4MH3 A;  4GST A;  5DDL A;  1XOA A;  3OR5 A;  1HQO A;  3J7Y b;  2KUC A;  3MNG A;  4PUR A;  4BVY A;  4EUY A;  4GLT A;  3M3M A;  2LUS A;  5HR2 A;  3VUR A;  4K7O A;  4CW9 A;  4DSQ A;  1XFL A;  1O8X A;  4EVM A;  1RW1 A;  3F0I A;  5DJL A;  1THX A;  5DAL A;  5EPF A;  1V57 A;  2OKA A;  1XOB A;  2IIY A;  4MCU A;  3ED3 A;  1T1V A;  4GF0 A;  3N9J A;  4GSS A;  4V2M A;  2CVB A;  3KZQ A;  2LRT A;  4WF4 A;  1CQH A;  4DSS B;  1ILO A;  2H1G A;  4HQZ A;  2LJR A;  2WRT A;  4NV2 A;  1JLV A;  4POL A;  2FWE A;  1Z5Y E;  2DBC A;  3EE2 A;  5IMV A;  3I43 A;  4NMU A;  1OE7 A;  1M99 A;  2K18 A;  1GTB A;  3IE3 A;  3GTU B;  4XS1 A;  3I9V 2;  5C04 A;  2ON7 A;  1M9A A;  4WKW A;  1G7E A;  1IYH A;  1R7H A;  3M9J A;  3C71 A;  1J08 A;  2PVO C;  2XBI A;  4MJA A;  1ZL9 A;  2V32 A;  5ECI B;  4EF0 A;  1YEX A;  1TU7 A;  1SD9 A;  1WOU A;  1FB0 A;  2H6Y A;  2OBK A;  5EL8 A;  5IOW A;  1YDK A;  4NHZ A;  2VCV A;  4LL1 B;  3ZZX A;  3FEU A;  4WXT A;  2R3X A;  4HZ2 A;  5JWQ B;  2LNS A;  4KAE A;  1PKW A;  5DJM A;  4GXZ A;  3UAP A;  5CYY A;  2PVQ A;  2H1B A;  4HZ4 A;  1VRS D;  4N0Z A;  3CBU A;  4MLY A;  3RHC A;  4GWR A;  3IAS 2;  4LMW A;  3FZ9 A;  5E59 A;  4ZL7 A;  3KGK A;  1USB A;  1GUL A;  3F6F A;  4XS4 A;  1AQX A;  2NPB A;  2IFQ B;  4FIW A;  3HJM A;  2XPE A;  3GIX A;  3UJ1 A;  2DSA A;  2L4Q A;  1SKR B;  5J4U A;  5GSS A;  3QD9 A;  2LJK A;  2KHP A;  5HFK A;  2YP6 A;  1YKC A;  3HZ4 A;  4IN0 A;  3C8E A;  1B4P A;  2FA4 A;  4N0V A;  3VWU A;  1FOV A;  2K8S A;  3ERF A;  5KN3 A;  3KIJ A;  3QR6 A;  2AYT A;  4POM A;  1PGT A;  2C4J A;  2X8G A;  1ERT A;  4PQH A;  4ZB8 A;  4ECI A;  1YJ6 A;  5HFI A;  5J41 A;  1PMT A;  3L78 A;  4TRX A;  5JWR B;  1OC9 B;  3KMO A;  17GS A;  2FNO A;  2E2M A;  3KP9 A;  3RAZ A;  5ELG A;  5CP1 A;  2YAN A;  2WCI A;  2DC5 A;  1PX6 A;  3FRC A;  4MPF A;  1E2Y A;  2CAI A;  5LCZ A;  4ULX A;  1A24 A;  3KTB A;  1XW9 A;  5F0G A;  2CVD A;  4DEJ A;  3JCM L;  4K0N A;  1Y25 A;  1EWX A;  2JSY A;  3ZIV A;  2WDU A;  3GRX A;  5AIV A;  1AUC A;  1YZX A;  2DML A;  3GV1 A;  3LQ7 A;  2DJJ A;  2N5F A;  4JRR A;  1FG4 A;  1A23 A;  4HUA A;  3LG6 A;  4ZBA A;  4GQF A;  3DKS A; 
#chains in the Genus database with same CATH topology
 1URM A;  4HS1 A;  4KX4 A;  5ECP B;  4PX1 A;  3KH9 A;  5G1K A;  1FO5 A;  2GZY A;  4KH7 A;  1XWB A;  2C8U A;  1U88 A;  3C1R A;  3KMN A;  1ERU A;  4NPB A;  1N8J A;  4CHS A;  5ENU A;  3A5W A;  3MIX A;  4Z7X A;  4KUN A;  4MZC A;  3GTU A;  1FHE A;  4BVY B;  1OE8 A;  1F9M A;  2LRN A;  2VCT A;  3TRP A;  1S3C A;  4GCI A;  2ES7 A;  3BOA A;  1X9M B;  2H30 A;  3O3T A;  3ISO A;  3FHK A;  1A8L A;  1EGO A;  3GL5 A;  5DAL B;  3IPZ A;  1GL8 A;  1DUG A;  3ERG A;  11GS A;  3S9F A;  2O7K A;  4HI7 A;  1OAZ A;  4J57 E;  5GAP D;  2FGX A;  3ERW A;  4MF6 A;  3E0U A;  1PQN A;  5A4U A;  3ZL5 A;  2PWJ A;  1V40 A;  4CY6 A;  19GS A;  1GUM A;  4MZB A;  2V1M A;  4PQI A;  4TW5 A;  1K0D A;  1B9Y C;  4FQU A;  2X64 A;  4KSO A;  1U3A A;  1M2D A;  2WZ9 A;  3FZ4 A;  4F2I A;  1GTI A;  5IMD A;  2H76 A;  4G19 A;  2F8F A;  2KLX A;  3ME7 A;  4ID0 A;  16GS A;  3W6G A;  1U87 A;  3G7J A;  1SL2 B;  4V1A p;  4CY8 A;  5CNW A;  1YKA A;  2FA8 A;  2DJ0 A;  2L57 A;  2MMA A;  2R0C A;  1ZYE A;  2I3Y A;  3F9U A;  4ZL8 A;  3FZA A;  4K7N A;  5BMU A;  1VF4 A;  1GSS A;  1ACV A;  2C0E A;  1B4Q A;  2GSS A;  3UIW A;  3GX8 A;  3ZLP A;  2RUF A;  4IP6 A;  4EDY A;  3CYN A;  5DAK B;  4KF9 A;  2Z9S A;  4L0W A;  5J5N A;  4J56 E;  5B8B A;  3KM6 A;  6GSX A;  3GH9 A;  1K3Y A;  3ZML A;  2IME A;  3EU3 A;  1K0O A;  4LMV A;  2YWM A;  1F37 A;  5HR3 A;  4GSN A;  1OC8 A;  3WD6 A;  1SYX A;  1DE2 A;  3KP8 A;  1GWC A;  1U3I A;  2OAC A;  4XCS A;  1ZYP A;  1WP0 A;  2G0F A;  2VIM A;  3PIN A;  4F0C A;  1TU8 A;  2H66 A;  4IGJ A;  3UVT A;  4MAB A;  4JR6 A;  1GNE A;  3GST A;  1K0A A;  4IKH A;  4Q5F A;  3HJP A;  3TOT A;  1FW1 A;  3IR4 A;  4BVX A;  5IPH A;  3MYD A;  4OFT A;  2YJH A;  4IEL A;  2V41 A;  3DEX A;  8GSS A;  3GA4 A;  1OC9 A;  1ZCP A;  4X43 A;  4JU5 A;  4G2E A;  1EV4 A;  1A2M A;  2GQK A;  5IM9 A;  1HNC A;  1W4V A;  1Z3E A;  4USS A;  3UEM A;  2LEG A;  2KOK A;  4QQ7 A;  2QA1 A;  3TKR A;  3VK9 A;  1NHY A;  3EU4 A;  4IQ1 A;  4E8E A;  3ZFB A;  1KEB A;  4IW9 A;  1DBY A;  2IMD A;  2H19 A;  3R3E A;  3LWA A;  3IRA A;  5EVO A;  2BMX A;  5F06 A;  1MDJ A;  1WWJ A;  7GSS A;  1T8E B;  4MA9 A;  4FO5 A;  2HSH A;  1OKT A;  3K8N A;  2TIR A;  4KCE A;  2CAQ A;  3DWV A;  2R6K A;  4KW6 A;  4EDZ A;  1TK5 B;  4EXJ A;  2RUE A;  5CRW A;  1MDK A;  2X8H A;  1THO A;  1T7P B;  1FOH A;  3HCZ A;  1K0B A;  5DQS A;  3LJR A;  2C3Q A;  1M0U A;  2JL4 A;  4BL7 B;  3GKM A;  5HR0 A;  3UVH A;  3EMP A;  1V9W A;  1QQ2 A;  2H6X A;  1AW9 A;  2R37 A;  1KTE A;  1Q98 A;  2HRN A;  1J9B A;  5ECH B;  2H71 A;  1SYR A;  5IO0 A;  2OE1 A;  4X0X A;  4EIP A;  2GTU A;  3W8S A;  4F9Z A;  5CRD A;  5D93 A;  2PMT A;  4LA1 A;  1TRV A;  4TR1 A;  3M0F A;  2L4C A;  1F3A A;  1BJX A;  4PXO A;  2HSM A;  2V6O A;  4ECJ A;  4NV5 A;  4V2N A;  3IV4 A;  4YKG A;  1M2B A;  1LJR A;  4ACS A;  3H93 A;  4G0K A;  2FUG 2;  5IQY A;  5IO2 A;  3G7Y A;  2VL2 A;  4OWY A;  3QFA C;  4P3Y B;  4ZIL A;  1PN0 A;  2A2R A;  3MWH A;  1M2A A;  3VI5 A;  4I6X A;  2F3M A;  1EV9 A;  2HLS A;  1ST9 A;  3GMF A;  2MMZ A;  3FZ5 A;  5KOW A;  5ECK B;  2JZS A;  3F6D A;  1PSQ A;  5B8A A;  5AIX A;  2MZC A;  4HJ2 A;  4TKY A;  2VD1 A;  1AIU A;  2B7K A;  3IOS A;  1H4O A;  4PNF A;  3FR9 A;  2YZU A;  3HVV A;  4KND A;  3P90 A;  3CQF A;  1AAZ A;  2R2J A;  1PD2 1;  5DAK A;  2DJK A;  3I6A A;  4O92 A;  1TP9 A;  1QXH A;  1SK2 A;  3FKF A;  4BA7 A;  1QFN A;  2GQL A;  2HSY A;  4V2L A;  2K8V A;  3ZIJ A;  5JWO B;  2VOC A;  4O5R A;  1OYJ A;  1AQW A;  2J9H A;  1RK4 A;  3D22 A;  2L6D A;  5D8I A;  2G2Q A;  2WB9 A;  4RQX A;  2C3T A;  2CV4 A;  4OMV A;  3RHB A;  4L5O A;  2AJQ B;  4RQR A;  2L5L A;  2LKU A;  4Q5Q A;  3HJO A;  4X1U A;  3QAW A;  4WEY A;  5H5R A;  4HJM A;  1GSY A;  3V1W A;  2YV9 A;  2VL2 C;  2DJ1 A;  2WJU A;  3F4S A;  3O76 A;  3IA1 A;  3Q6O A;  1NHO A;  3CSJ A;  5KOX A;  2PER A;  2MMN A;  3SBC A;  1M3J A;  1Z6M A;  4MDC A;  5ECN B;  1YF1 A;  3FR3 A;  4KE3 A;  2FWF A;  2MBS A;  2B7J A;  3WT2 A;  2H75 A;  4X4J A;  4ZBD A;  2OAD A;  3HA9 A;  4OFN A;  3F3Q A;  4NXI A;  1V58 A;  3ZTL A;  1XWC A;  1KBN A;  3L4N A;  2H0I A;  2C0D A;  2YN1 A;  4NHW A;  1O73 A;  2YPM A;  3GFK A;  4IBP A;  2IL3 A;  1S3R A;  2FWH A;  4XRA A;  5ECS A;  5ELA A;  2JSZ A;  4YQU A;  2R4V A;  5KN1 A;  2HE3 A;  2QSI A;  5ID2 B;  4KGI A;  3IC4 A;  3TJG A;  5G5F A;  4AJ6 A;  4K1F A;  2XPD A;  2TRX A;  5DCH A;  1PA3 A;  1XIY A;  3F8U A;  5COH A;  3TKS A;  3D5J A;  22GS A;  1RQM A;  2GQM A;  3CTF A;  3DXB A;  4EC0 A;  1V98 A;  5G1L A;  2HFD A;  1X9S B;  3HHV A;  3H8Q A;  3RPN A;  4BL7 A;  4KDU A;  1G7O A;  4N30 A;  1GLQ A;  2GZZ A;  2J23 A;  14GS A;  1JFU A;  2IWT A;  2YWN A;  4JBB A;  3PGT A;  4ML1 A;  2VCW A;  3DGQ A;  3D4T A;  1XWA A;  1HNA A;  2C0F A;  1K0M A;  5ECM B;  1SK0 A;  1HNB A;  2DIZ A;  4O32 A;  3KTL A;  1SU9 A;  4KDY A;  3TJJ A;  1OC3 A;  1DE1 A;  4OO5 A;  2YWO A;  3L9S A;  1JZO A;  2ON5 A;  2P31 A;  4IS0 A;  2VM2 A;  3ZRE A;  2H01 A;  4DVC A;  4F82 A;  4XTS A;  5INY A;  4YAV A;  2GVP A;  1Y6E A;  2JAD A;  2UZ8 A;  1O81 A;  1XWG A;  2H73 A;  1QUW A;  2MMO A;  2PBJ A;  3NOF A;  1TW9 A;  3APO A;  1XVQ A;  3GUS A;  3TKS C;  4TXO B;  4CDO A;  1VF3 A;  3M1G A;  5C00 A;  1O7U A;  3ZVJ D;  1GTU A;  3CSI A;  2P5R A;  2DLX A;  2H1A A;  1LU4 A;  2VO4 A;  3TKS E;  3TJF A;  1M7T A;  2QKE A;  5G2Z A;  1EP8 A;  3KXO A;  5HR1 A;  4TR1 B;  3VI7 A;  2FCH A;  1GSD A;  3HKR A;  4K0G A;  4K6X A;  4D73 B;  1AXD A;  1SJZ A;  1XXU A;  1YF0 A;  4PTS A;  1TRU A;  3C1S A;  1ERV A;  1SD8 A;  2EIQ A;  2CA8 A;  3EWL A;  2LV3 A;  2H74 A;  2P5Q A;  1PFO A;  3VPQ A;  4ZBB A;  3L0H A;  4N11 A;  3VPT A;  4ZXG A;  4ISD A;  2E0Q A;  4XS6 A;  5ECQ B;  4WR5 A;  1UVZ A;  2CQ9 A;  4DSR A;  3HD5 A;  2WUL A;  1I5G A;  3LOR A;  2VM1 A;  1K0C A;  20GS A;  1TXX A;  3FMW A;  3RPP A;  2L59 A;  4MMM A;  2H6Z A;  1X9W B;  4BWQ A;  2GSR A;  5ECO B;  3QAV A;  2VL3 A;  4AJ7 A;  2NBS A;  4K8M A;  2LQQ A;  2DKI A;  2O87 A;  2FD3 A;  2OE0 A;  2VCQ A;  3IBH A;  4K2X A;  3VLN A;  1F2E A;  1XW5 A;  1TTZ A;  4MF7 A;  4I2U A;  5G30 A;  5J9C A;  3LXT A;  2H0G A;  2XHF A;  4OCE A;  3NZN A;  5CAX A;  2V6K A;  2HZE B;  5KN2 A;  3UBK A;  2K6V A;  3MDK A;  2F9S A;  3GL3 A;  1G6Y A;  2X49 A;  4TR0 A;  4HU7 A;  3IXR A;  1EP7 A;  4FH8 A;  2LST A;  3H79 A;  1CQG A;  5ID2 A;  3M8N A;  2DJ3 A;  1SEN A;  2FHE A;  2L5O A;  2YCD A;  1ZZY A;  5IMF A;  3TKQ A;  1YY7 A;  3U6V A;  3A5I A;  4I97 A;  2H0H A;  3LGC A;  5GZZ B;  4WR4 A;  3LXZ A;  2IMI A;  1QGV A;  1OKD A;  4NAX A;  1VF1 A;  4ZL9 A;  2CZ3 A;  4IJ3 A;  3BJ5 A;  2ZCT A;  1HYU A;  4WBJ A;  2CX3 A;  4G10 A;  3F63 A;  1SKW B;  2HT9 A;  3TJK A;  6GSW A;  3I69 A;  1UN2 A;  2P0G A;  6GSU A;  4QL7 A;  5ABR A;  2MBT A;  4ILF A;  2C1Y A;  2NDO A;  5IMC A;  4TR3 A;  1O6J A;  1UC7 A;  2B5X A;  3DD3 A;  3DML A;  1ML6 A;  4IHU A;  1ZGN A;  2CVK A;  4L8E A;  3HVS A;  4O7H A;  2F51 A;  4O5Q A;  3IAM 2;  4WF5 A;  1AQV A;  5J3R A;  5IMZ A;  1X5C A;  5IIZ A;  2JZR A;  1LBK A;  5G5E A;  3HVX A;  5CRH A;  3Q18 A;  1FB6 A;  4PGT A;  3ZYW A;  3GYK A;  2GDR A;  4JZQ A;  5FHI A;  1TOF A;  1XCC A;  1TJD A;  1E6B A;  1YEP A;  4K9Z A;  4ECB A;  3EPT A;  1A2J A;  2O8V B;  4IVF A;  4PUA A;  3DRN A;  4TXO A;  5JCG A;  2H1D A;  3W8J A;  1BX9 A;  1UA5 A;  1R4W A;  3P8W A;  1EZK A;  5F8B A;  4L0U A;  3GN3 A;  5HFG A;  4HQS A;  3O6T A;  4BWS A;  5IPG A;  2LJA A;  1GSF A;  3ZFL A;  1XW6 A;  1WMJ A;  4HEA 2;  1PRX A;  1V2A A;  4I2T A;  2DJ2 A;  5D9T A;  1WJK A;  1SL0 B;  2FY6 A;  2REM A;  3BBY A;  1XWK A;  2C0G A;  1O85 A;  3E3E A;  3QOU A;  1JZR A;  3VWX A;  2H72 A;  4F0B A;  4Q5N A;  4D73 A;  1R26 A;  5B6M A;  3QCP A;  2VLU A;  3EVI A;  2I9H A;  3R2Q A;  5CRG A;  3ZVJ A;  4MZW A;  4EO3 A;  5A4V A;  4OCF A;  3L9V A;  3UOM A;  3KD0 A;  1W89 A;  3F4R A;  5BRT A;  4EL1 A;  3CRU A;  4LLR A;  1G6W A;  1MD3 A;  2PPT A;  3MSZ A;  3CRT A;  1M3I A;  4I5Q A;  2GZP A;  2GT6 A;  4FYC A;  1T4Z A;  5JCU A;  3A2X A;  5F05 A;  5JCW A;  3HY2 A;  2C3N A;  4EE0 A;  1GSU A;  2PN8 A;  1MD4 A;  3IK9 A;  2MYG A;  3LEF A;  3D6I A;  4JED A;  1ZMA A;  3PH9 A;  1MEK A;  2C80 A;  1C72 A;  2QGV A;  4K5R A;  1R5P A;  3CXG A;  4JE1 A;  1R5A A;  3H1N A;  1TK8 B;  3CTG A;  4XHM A;  2HI7 A;  2ZUP A;  1GNW A;  4TXV A;  1SJ6 A;  1GLP A;  3TDG A;  4OO4 A;  4RI7 A;  5D9X A;  1JZW A;  1ZYQ B;  4J2F A;  2GT5 A;  2HZE A;  1GSE A;  3EYT A;  2OBI A;  3F4T A;  2LRC A;  3DYR A;  1ABA A;  5H5S A;  4Q5R A;  2IPA A;  2YOI A;  3FK8 A;  2LQO A;  1EOH A;  2OA7 A;  2X8C A;  4JR4 A;  3TOU A;  3FR6 A;  4MP4 A;  3APQ A;  4ML6 A;  3KEB A;  4FYB A;  2GLR A;  3F3R A;  2WGR A;  13GS A;  2PGT A;  3IHQ A;  3UMA A;  3EMX A;  1ERW A;  1GH2 A;  1T3B A;  3ZIT A;  2H70 A;  4HU9 A;  1Z7P A;  3UAR A;  4IQA A;  1F3B A;  5LD0 A;  5IOX A;  2JZT A;  4WBR D;  2VAF A;  4GTU A;  2YZH A;  1X0R A;  3QDN A;  2BJX A;  1MTC A;  2QA2 A;  1FAA A;  3GUR A;  1SL1 B;  2M80 A;  4EKZ A;  2B5E A;  2CZ2 A;  2JU5 A;  3KH7 A;  3HYP A;  1T00 A;  3IDV A;  4V1A g;  4IP1 A;  2O85 A;  2V2G A;  6GST A;  2I81 A;  2PUK C;  1BED A;  1A0R P;  1H75 A;  2GSQ A;  4ZIJ A;  5DCG A;  1F6M C;  2M72 A;  1TK0 B;  5KN0 A;  2CX4 A;  2VD0 A;  1PX7 A;  2HRF A;  4NWY A;  2CT6 A;  3BCK A;  4GRF A;  1Z7R A;  1NW2 A;  3GSS A;  5FWG A;  2YWI A;  3CSH A;  1EGR A;  3LFL A;  3QAG A;  4WET A;  6GSS A;  1TI3 A;  2YV7 A;  3GHA A;  5CRE A;  3LYP A;  1OVN A;  1M9B A;  3Q74 A;  2IMK A;  1B9X C;  5DBQ A;  1GRX A;  2DIY A;  3N5O A;  4ZB9 A;  2FLS A;  4PNG A;  1GP1 A;  4LL4 B;  1ZYN A;  1JLW A;  1XPV A;  2KP2 A;  2YJ7 A;  1GUK A;  1B48 A;  4QL9 A;  4XIH A;  1S3A A;  1J0F A;  3VFI A;  5H5Q A;  3A2V A;  3PR8 A;  3FY7 A;  4H86 A;  3ZMK A;  1JHB A;  3DVW A;  2R0G A;  2B1L A;  2TRC P;  2RM6 A;  2KP1 A;  2IJY A;  4IJI A;  1SKS B;  2E7P A;  2HNL A;  1Q4J A;  5FT3 A;  3WYW A;  3TKP A;  3TUE A;  2VLT A;  2E2G A;  1PL1 A;  2GGT A;  4G0I A;  3C73 A;  3QMX A;  3TGZ A;  5B6N A;  1GSQ A;  3HVN A;  2NVL A;  2EC4 A;  2EIO A;  2I1U A;  1Z6N A;  1ZOF A;  4ZB6 A;  3P7X A;  5HQP A;  4PQ1 A;  3U5R E;  1IYI A;  3GKX A;  5A4W A;  1WRY A;  1GUH A;  1DSB A;  9GSS A;  4DSS A;  2HRA A;  2LTK A;  4HDE A;  1TI1 A;  1S3D A;  3GNJ A;  2VCZ A;  6GSY A;  3D0Z A;  4E8H A;  3C7M A;  5IMA A;  1PN9 A;  1Z9H A;  3GKK A;  2R0P A;  2AAW A;  4XRD A;  4MPG A;  2D2Z A;  1BYE A;  2VUP A;  3WGE A;  4ECC A;  3MAK A;  4OFM A;  1YQ1 A;  3EIN A;  3KJY A;  5ECR B;  2B6M A;  4RUV A;  1QK8 A;  3LYK A;  2K9F A;  4MK3 A;  6GSV A;  4TN8 A;  3GH6 A;  4KDX A;  5D9V A;  1X5E A;  1XBS A;  2RII A;  2GS3 A;  2O89 A;  1AC1 A;  1TRW A;  2F8A A;  2AB6 A;  2LNT A;  2QC7 A;  3TB2 A;  1SJI A;  4MJB A;  1A2L A;  2DMM A;  4RI6 A;  2AV4 A;  5E4W A;  1PL2 A;  3M9K A;  10GS A;  5AN1 A;  1WPI A;  2BTO T;  4GQC A;  3RBT A;  3Q19 A;  1FVJ A;  3TRQ A;  5AIS A;  4YKF A;  1I9D A;  1X5D A;  4AGS A;  2RLI A;  4AJ8 A;  4G9H A;  4HOJ A;  5D73 A;  1K3O A;  5CO3 A;  3J7Y k;  1A8Y A;  1BQ7 A;  5B7C A;  3UBL A;  3WGX A;  4KCA A;  2X4A A;  4TVE A;  4OD7 A;  2HYX A;  5LNK e;  2N5B A;  2HXK A;  5G31 A;  2RM5 A;  3FYG A;  2A2S A;  3D4M A;  4YH2 A;  3ZRD A;  3D21 A;  2OE3 A;  12GS A;  2A4V A;  3EC3 A;  3NIV A;  1XVW A;  1U6T A;  1K0N A;  2VCX A;  2VLV A;  5GAN D;  5EY6 A;  4POK A;  4I8B A;  1EEJ A;  4TOP A;  3LW9 A;  3A3T A;  1WIK A;  3TJB A;  1XZO A;  2OJL A;  4MJC A;  1SK1 A;  3UL3 A;  5D96 A;  5L71 A;  3DVX A;  4L5L A;  1A0F A;  3CMI A;  2IFQ A;  4YAP A;  5D9W A;  3US3 A;  3HZ8 A;  2FWG A;  2JAC A;  1GTA A;  4FYU A;  5DVB A;  1HD2 A;  1EOG A;  2VL9 A;  5ECL B;  2B5Y A;  2ZNM A;  1T4Y A;  3A2W A;  2WS2 A;  3IK7 A;  3TCO A;  2IMF A;  2IN3 A;  2PU9 C;  5GST A;  3AY8 A;  1NSW A;  2AHE A;  2HZF A;  4AF2 A;  3GKN A;  4KA0 A;  4K7I A;  3BCI A;  3H4K A;  1BG5 A;  3GX0 A;  1O8W A;  4EIQ A;  2HRK A;  3E9J B;  3QFB C;  3LSZ A;  4KSM A;  3DIE A;  4POB A;  1G0T A;  2N5A A;  2B3S A;  4K5S A;  4BPY A;  4K2D A;  4F03 A;  3G9B A;  4BIK A;  4A5P A;  3VWV A;  2L6C A;  1TKD B;  1QMV A;  3APS A;  3TRX A;  3QPM A;  2EIR A;  1ON4 A;  1BAY A;  2ALB A;  3FW2 A;  2A2P A;  3WT1 A;  3RDW A;  4N10 A;  1B8X A;  3P2A A;  4XS4 B;  3SWL A;  3BD2 A;  2AUV A;  2XC2 A;  2R5G A;  3HDC A;  3EUR A;  3G7I A;  4PUF C;  1K3L A;  5F07 A;  1EEM A;  1JZD A;  1WE0 A;  1KNG A;  4MJE A;  3KCM A;  5DQY A;  5A5K A;  3L9U A;  4MH2 A;  2H8L A;  2M46 A;  3WGD A;  2B1K A;  2XBQ A;  2NTO A;  4MF5 A;  18GS A;  2DKH A;  4YQM A;  1TDI A;  5AGY A;  1TRS A;  2GST A;  4TR4 A;  2LS5 A;  3HXS A;  3ME8 A;  2I4A A;  4Z2U A;  2WFC A;  1VGL A;  1MDI A;  1VF2 A;  2YNX A;  3VWW A;  5KEJ A;  1PKZ A;  4KB3 A;  1FVK A;  4YQV A;  1NM3 A;  5J9B A;  2X99 A;  1N2A A;  4MH3 A;  4GST A;  5DDL A;  1XOA A;  3OR5 A;  1HQO A;  3J7Y b;  2KUC A;  3MNG A;  4PUR A;  4BVY A;  4EUY A;  4GLT A;  3M3M A;  2LUS A;  5HR2 A;  3VUR A;  4K7O A;  4CW9 A;  4DSQ A;  1XFL A;  1O8X A;  4EVM A;  1RW1 A;  3F0I A;  5DJL A;  4MNN A;  1THX A;  5DAL A;  5EPF A;  1V57 A;  2OKA A;  1XOB A;  2IIY A;  4MCU A;  3ED3 A;  1T1V A;  4GF0 A;  2A4H A;  3N9J A;  4GSS A;  4V2M A;  2CVB A;  3KZQ A;  2LRT A;  4WF4 A;  1CQH A;  4DSS B;  1ILO A;  1XG8 A;  2H1G A;  4HQZ A;  4O5U A;  2LJR A;  2WRT A;  4NV2 A;  1JLV A;  4POL A;  2FWE A;  1Z5Y E;  2DBC A;  3EE2 A;  5IMV A;  3I43 A;  4NMU A;  1OE7 A;  1M99 A;  2K18 A;  1GTB A;  3IE3 A;  3GTU B;  4XS1 A;  3I9V 2;  5C04 A;  2ON7 A;  1M9A A;  4WKW A;  1G7E A;  1IYH A;  3PPU A;  1R7H A;  3M9J A;  3C71 A;  1J08 A;  2PVO C;  2XBI A;  4MJA A;  1ZL9 A;  2V32 A;  5ECI B;  4EF0 A;  1YEX A;  1TU7 A;  1SD9 A;  1WOU A;  1FB0 A;  2H6Y A;  2OBK A;  5EL8 A;  5IOW A;  1YDK A;  4NHZ A;  2VCV A;  4LL1 B;  3ZZX A;  3FEU A;  4WXT A;  2R3X A;  4HZ2 A;  5JWQ B;  2LNS A;  4KAE A;  1PKW A;  5DJM A;  4GXZ A;  3UAP A;  5CYY A;  2PVQ A;  3IC8 A;  4Z2T A;  2H1B A;  4HZ4 A;  1VRS D;  4N0Z A;  3CBU A;  4MLY A;  3RHC A;  4GWR A;  4ICY A;  3IAS 2;  4LMW A;  3FZ9 A;  5E59 A;  4ZL7 A;  3KGK A;  1USB A;  1GUL A;  3F6F A;  4XS4 A;  1AQX A;  2NPB A;  2IFQ B;  4FIW A;  3HJM A;  2XPE A;  3GIX A;  3UJ1 A;  2DSA A;  2L4Q A;  1SKR B;  5J4U A;  5GSS A;  3QD9 A;  2LJK A;  2KHP A;  5HFK A;  2YP6 A;  1YKC A;  3HZ4 A;  4IN0 A;  3C8E A;  1B4P A;  2FA4 A;  4N0V A;  3VWU A;  1FOV A;  2K8S A;  3ERF A;  5KN3 A;  3KIJ A;  3QR6 A;  2AYT A;  4POM A;  1PGT A;  3IHG A;  2C4J A;  2X8G A;  1ERT A;  4PQH A;  4ZB8 A;  4ECI A;  1YJ6 A;  4BVX B;  5HFI A;  5J41 A;  1PMT A;  3L78 A;  4TRX A;  5JWR B;  1OC9 B;  3KMO A;  17GS A;  2FNO A;  2E2M A;  3KP9 A;  3RAZ A;  5ELG A;  5CP1 A;  2YAN A;  2WCI A;  2DC5 A;  1PX6 A;  3FRC A;  4MPF A;  1E2Y A;  2CAI A;  5LCZ A;  4ULX A;  1A24 A;  3KTB A;  1XW9 A;  5F0G A;  2CVD A;  4DEJ A;  3JCM L;  4K0N A;  1Y25 A;  1EWX A;  2JSY A;  4Z2R A;  3ZIV A;  2WDU A;  3GRX A;  5AIV A;  1AUC A;  1YZX A;  2DML A;  3GV1 A;  3LQ7 A;  2DJJ A;  2N5F A;  4HSC X;  4G0L A;  4JRR A;  1FG4 A;  1A23 A;  4HUA A;  3LG6 A;  4ZBA A;  4GQF A;  3DKS A; 
#chains in the Genus database with same CATH homology
 1URM A;  4HS1 A;  4KX4 A;  5ECP B;  4PX1 A;  3KH9 A;  5G1K A;  1FO5 A;  2GZY A;  4KH7 A;  1XWB A;  2C8U A;  1U88 A;  3C1R A;  3KMN A;  1ERU A;  4NPB A;  1N8J A;  4CHS A;  5ENU A;  3A5W A;  3MIX A;  4Z7X A;  4KUN A;  4MZC A;  3GTU A;  1FHE A;  4BVY B;  1OE8 A;  1F9M A;  2LRN A;  2VCT A;  3TRP A;  1S3C A;  4GCI A;  2ES7 A;  3BOA A;  1X9M B;  2H30 A;  3O3T A;  3ISO A;  3FHK A;  1A8L A;  1EGO A;  3GL5 A;  5DAL B;  3IPZ A;  1GL8 A;  1DUG A;  3ERG A;  11GS A;  3S9F A;  2O7K A;  4HI7 A;  1OAZ A;  4J57 E;  5GAP D;  2FGX A;  3ERW A;  4MF6 A;  3E0U A;  1PQN A;  5A4U A;  3ZL5 A;  2PWJ A;  1V40 A;  4CY6 A;  19GS A;  1GUM A;  4MZB A;  2V1M A;  4PQI A;  4TW5 A;  1K0D A;  1B9Y C;  4FQU A;  2X64 A;  4KSO A;  1U3A A;  1M2D A;  2WZ9 A;  3FZ4 A;  4F2I A;  1GTI A;  5IMD A;  2H76 A;  4G19 A;  2F8F A;  2KLX A;  3ME7 A;  4ID0 A;  16GS A;  3W6G A;  1U87 A;  3G7J A;  1SL2 B;  4V1A p;  4CY8 A;  5CNW A;  1YKA A;  2FA8 A;  2DJ0 A;  2L57 A;  2MMA A;  2R0C A;  1ZYE A;  2I3Y A;  3F9U A;  4ZL8 A;  3FZA A;  4K7N A;  5BMU A;  1VF4 A;  1GSS A;  1ACV A;  2C0E A;  1B4Q A;  2GSS A;  3UIW A;  3GX8 A;  3ZLP A;  2RUF A;  4IP6 A;  4EDY A;  3CYN A;  5DAK B;  4KF9 A;  2Z9S A;  4L0W A;  5J5N A;  4J56 E;  5B8B A;  3KM6 A;  6GSX A;  3GH9 A;  1K3Y A;  3ZML A;  2IME A;  3EU3 A;  1K0O A;  4LMV A;  2YWM A;  1F37 A;  5HR3 A;  4GSN A;  1OC8 A;  3WD6 A;  1SYX A;  1DE2 A;  3KP8 A;  1GWC A;  1U3I A;  2OAC A;  4XCS A;  1ZYP A;  1WP0 A;  2G0F A;  2VIM A;  3PIN A;  4F0C A;  1TU8 A;  2H66 A;  4IGJ A;  3UVT A;  4MAB A;  4JR6 A;  1GNE A;  3GST A;  1K0A A;  4IKH A;  4Q5F A;  3HJP A;  3TOT A;  1FW1 A;  3IR4 A;  4BVX A;  5IPH A;  3MYD A;  4OFT A;  2YJH A;  4IEL A;  2V41 A;  3DEX A;  8GSS A;  3GA4 A;  1OC9 A;  1ZCP A;  4X43 A;  4JU5 A;  4G2E A;  1EV4 A;  1A2M A;  2GQK A;  5IM9 A;  1HNC A;  1W4V A;  1Z3E A;  4USS A;  3UEM A;  2LEG A;  2KOK A;  4QQ7 A;  2QA1 A;  3TKR A;  3VK9 A;  1NHY A;  3EU4 A;  4IQ1 A;  4E8E A;  3ZFB A;  1KEB A;  4IW9 A;  1DBY A;  2IMD A;  2H19 A;  3R3E A;  3LWA A;  3IRA A;  5EVO A;  2BMX A;  5F06 A;  1MDJ A;  1WWJ A;  7GSS A;  1T8E B;  4MA9 A;  4FO5 A;  2HSH A;  1OKT A;  3K8N A;  2TIR A;  4KCE A;  2CAQ A;  3DWV A;  2R6K A;  4KW6 A;  4EDZ A;  1TK5 B;  4EXJ A;  2RUE A;  5CRW A;  1MDK A;  2X8H A;  1THO A;  1T7P B;  1FOH A;  3HCZ A;  1K0B A;  5DQS A;  3LJR A;  2C3Q A;  1M0U A;  2JL4 A;  4BL7 B;  3GKM A;  5HR0 A;  3UVH A;  3EMP A;  1V9W A;  1QQ2 A;  2H6X A;  1AW9 A;  2R37 A;  1KTE A;  1Q98 A;  2HRN A;  1J9B A;  5ECH B;  2H71 A;  1SYR A;  5IO0 A;  2OE1 A;  4X0X A;  4EIP A;  2GTU A;  3W8S A;  4F9Z A;  5CRD A;  5D93 A;  2PMT A;  4LA1 A;  1TRV A;  4TR1 A;  3M0F A;  2L4C A;  1F3A A;  1BJX A;  4PXO A;  2HSM A;  2V6O A;  4ECJ A;  4NV5 A;  4V2N A;  3IV4 A;  4YKG A;  1M2B A;  1LJR A;  4ACS A;  3H93 A;  4G0K A;  2FUG 2;  5IQY A;  5IO2 A;  3G7Y A;  2VL2 A;  4OWY A;  3QFA C;  4P3Y B;  4ZIL A;  1PN0 A;  2A2R A;  3MWH A;  1M2A A;  3VI5 A;  4I6X A;  2F3M A;  1EV9 A;  2HLS A;  1ST9 A;  3GMF A;  2MMZ A;  3FZ5 A;  5KOW A;  5ECK B;  2JZS A;  3F6D A;  1PSQ A;  5B8A A;  5AIX A;  2MZC A;  4HJ2 A;  4TKY A;  2VD1 A;  1AIU A;  2B7K A;  3IOS A;  1H4O A;  4PNF A;  3FR9 A;  2YZU A;  3HVV A;  4KND A;  3P90 A;  1AAZ A;  2R2J A;  1PD2 1;  5DAK A;  2DJK A;  3I6A A;  4O92 A;  1TP9 A;  1QXH A;  1SK2 A;  3FKF A;  4BA7 A;  1QFN A;  2GQL A;  2HSY A;  4V2L A;  2K8V A;  3ZIJ A;  5JWO B;  2VOC A;  4O5R A;  1OYJ A;  1AQW A;  2J9H A;  1RK4 A;  3D22 A;  2L6D A;  5D8I A;  2G2Q A;  2WB9 A;  4RQX A;  2C3T A;  2CV4 A;  4OMV A;  3RHB A;  4L5O A;  2AJQ B;  4RQR A;  2L5L A;  2LKU A;  4Q5Q A;  3HJO A;  4X1U A;  3QAW A;  4WEY A;  5H5R A;  4HJM A;  1GSY A;  3V1W A;  2YV9 A;  2VL2 C;  2DJ1 A;  2WJU A;  3F4S A;  3O76 A;  3IA1 A;  3Q6O A;  1NHO A;  3CSJ A;  5KOX A;  2PER A;  2MMN A;  3SBC A;  1Z6M A;  4MDC A;  5ECN B;  1YF1 A;  3FR3 A;  4KE3 A;  2FWF A;  2MBS A;  2B7J A;  3WT2 A;  2H75 A;  4X4J A;  4ZBD A;  2OAD A;  3HA9 A;  4OFN A;  3F3Q A;  4NXI A;  1V58 A;  3ZTL A;  1XWC A;  1KBN A;  3L4N A;  2H0I A;  2C0D A;  2YN1 A;  4NHW A;  1O73 A;  2YPM A;  3GFK A;  4IBP A;  2IL3 A;  2FWH A;  4XRA A;  5ECS A;  5ELA A;  2JSZ A;  4YQU A;  2R4V A;  5KN1 A;  2HE3 A;  2QSI A;  5ID2 B;  4KGI A;  3IC4 A;  3TJG A;  5G5F A;  4AJ6 A;  4K1F A;  2XPD A;  2TRX A;  5DCH A;  1PA3 A;  1XIY A;  3F8U A;  5COH A;  3TKS A;  3D5J A;  22GS A;  1RQM A;  2GQM A;  3CTF A;  3DXB A;  4EC0 A;  1V98 A;  5G1L A;  2HFD A;  1X9S B;  3HHV A;  3H8Q A;  3RPN A;  4BL7 A;  4KDU A;  1G7O A;  4N30 A;  1GLQ A;  2GZZ A;  2J23 A;  14GS A;  1JFU A;  2IWT A;  2YWN A;  4JBB A;  3PGT A;  4ML1 A;  2VCW A;  3DGQ A;  3D4T A;  1XWA A;  1HNA A;  2C0F A;  1K0M A;  5ECM B;  1SK0 A;  1HNB A;  2DIZ A;  4O32 A;  3KTL A;  1SU9 A;  4KDY A;  3TJJ A;  1OC3 A;  1DE1 A;  4OO5 A;  2YWO A;  3L9S A;  1JZO A;  2ON5 A;  2P31 A;  4IS0 A;  2VM2 A;  3ZRE A;  2H01 A;  4DVC A;  4F82 A;  4XTS A;  5INY A;  4YAV A;  2GVP A;  1Y6E A;  2JAD A;  2UZ8 A;  1O81 A;  1XWG A;  2H73 A;  1QUW A;  2MMO A;  2PBJ A;  3NOF A;  1TW9 A;  3APO A;  1XVQ A;  3GUS A;  3TKS C;  4TXO B;  4CDO A;  1VF3 A;  3M1G A;  5C00 A;  1O7U A;  3ZVJ D;  1GTU A;  3CSI A;  2P5R A;  2DLX A;  2H1A A;  1LU4 A;  2VO4 A;  3TKS E;  3TJF A;  1M7T A;  2QKE A;  5G2Z A;  1EP8 A;  3KXO A;  5HR1 A;  4TR1 B;  3VI7 A;  2FCH A;  1GSD A;  3HKR A;  4K0G A;  4K6X A;  4D73 B;  1AXD A;  1SJZ A;  1XXU A;  1YF0 A;  4PTS A;  1TRU A;  3C1S A;  1ERV A;  1SD8 A;  2EIQ A;  2CA8 A;  3EWL A;  2LV3 A;  2H74 A;  2P5Q A;  3VPQ A;  4ZBB A;  3L0H A;  4N11 A;  3VPT A;  4ZXG A;  4ISD A;  2E0Q A;  4XS6 A;  5ECQ B;  4WR5 A;  1UVZ A;  2CQ9 A;  4DSR A;  3HD5 A;  2WUL A;  1I5G A;  3LOR A;  2VM1 A;  1K0C A;  20GS A;  1TXX A;  3FMW A;  3RPP A;  2L59 A;  4MMM A;  2H6Z A;  1X9W B;  4BWQ A;  2GSR A;  5ECO B;  3QAV A;  2VL3 A;  4AJ7 A;  2NBS A;  4K8M A;  2LQQ A;  2DKI A;  2O87 A;  2FD3 A;  2OE0 A;  2VCQ A;  3IBH A;  4K2X A;  3VLN A;  1F2E A;  1XW5 A;  1TTZ A;  4MF7 A;  4I2U A;  5G30 A;  5J9C A;  3LXT A;  2H0G A;  2XHF A;  4OCE A;  3NZN A;  5CAX A;  2V6K A;  2HZE B;  5KN2 A;  3UBK A;  2K6V A;  3MDK A;  2F9S A;  3GL3 A;  1G6Y A;  2X49 A;  4TR0 A;  4HU7 A;  3IXR A;  1EP7 A;  4FH8 A;  2LST A;  3H79 A;  1CQG A;  5ID2 A;  3M8N A;  2DJ3 A;  1SEN A;  2FHE A;  2L5O A;  2YCD A;  1ZZY A;  5IMF A;  3TKQ A;  1YY7 A;  3U6V A;  3A5I A;  4I97 A;  2H0H A;  3LGC A;  5GZZ B;  4WR4 A;  3LXZ A;  2IMI A;  1QGV A;  1OKD A;  4NAX A;  1VF1 A;  4ZL9 A;  2CZ3 A;  4IJ3 A;  3BJ5 A;  2ZCT A;  1HYU A;  4WBJ A;  2CX3 A;  4G10 A;  3F63 A;  1SKW B;  2HT9 A;  3TJK A;  6GSW A;  3I69 A;  1UN2 A;  2P0G A;  6GSU A;  4QL7 A;  5ABR A;  2MBT A;  4ILF A;  2C1Y A;  2NDO A;  5IMC A;  4TR3 A;  1O6J A;  1UC7 A;  2B5X A;  3DD3 A;  3DML A;  1ML6 A;  4IHU A;  1ZGN A;  2CVK A;  4L8E A;  3HVS A;  4O7H A;  2F51 A;  4O5Q A;  3IAM 2;  4WF5 A;  1AQV A;  5J3R A;  5IMZ A;  1X5C A;  5IIZ A;  2JZR A;  1LBK A;  5G5E A;  3HVX A;  5CRH A;  3Q18 A;  1FB6 A;  4PGT A;  3ZYW A;  3GYK A;  2GDR A;  4JZQ A;  5FHI A;  1TOF A;  1XCC A;  1TJD A;  1E6B A;  1YEP A;  4K9Z A;  4ECB A;  3EPT A;  1A2J A;  2O8V B;  4IVF A;  4PUA A;  3DRN A;  4TXO A;  5JCG A;  2H1D A;  3W8J A;  1BX9 A;  1UA5 A;  1R4W A;  3P8W A;  1EZK A;  5F8B A;  4L0U A;  3GN3 A;  5HFG A;  4HQS A;  3O6T A;  4BWS A;  5IPG A;  2LJA A;  1GSF A;  3ZFL A;  1XW6 A;  1WMJ A;  4HEA 2;  1PRX A;  1V2A A;  4I2T A;  2DJ2 A;  5D9T A;  1WJK A;  1SL0 B;  2FY6 A;  2REM A;  3BBY A;  1XWK A;  2C0G A;  1O85 A;  3E3E A;  3QOU A;  1JZR A;  3VWX A;  2H72 A;  4F0B A;  4Q5N A;  4D73 A;  1R26 A;  5B6M A;  3QCP A;  2VLU A;  3EVI A;  2I9H A;  3R2Q A;  5CRG A;  3ZVJ A;  4MZW A;  4EO3 A;  5A4V A;  4OCF A;  3L9V A;  3UOM A;  3KD0 A;  1W89 A;  3F4R A;  5BRT A;  4EL1 A;  3CRU A;  4LLR A;  1G6W A;  1MD3 A;  2PPT A;  3MSZ A;  3CRT A;  4I5Q A;  2GZP A;  2GT6 A;  4FYC A;  1T4Z A;  5JCU A;  3A2X A;  5F05 A;  5JCW A;  3HY2 A;  2C3N A;  4EE0 A;  1GSU A;  2PN8 A;  1MD4 A;  3IK9 A;  2MYG A;  3LEF A;  3D6I A;  4JED A;  1ZMA A;  3PH9 A;  1MEK A;  2C80 A;  1C72 A;  2QGV A;  4K5R A;  1R5P A;  3CXG A;  4JE1 A;  1R5A A;  3H1N A;  1TK8 B;  3CTG A;  4XHM A;  2HI7 A;  2ZUP A;  1GNW A;  4TXV A;  1SJ6 A;  1GLP A;  3TDG A;  4OO4 A;  4RI7 A;  5D9X A;  1JZW A;  1ZYQ B;  4J2F A;  2GT5 A;  2HZE A;  1GSE A;  3EYT A;  2OBI A;  3F4T A;  2LRC A;  3DYR A;  1ABA A;  5H5S A;  4Q5R A;  2IPA A;  2YOI A;  3FK8 A;  2LQO A;  1EOH A;  2OA7 A;  2X8C A;  4JR4 A;  3TOU A;  3FR6 A;  4MP4 A;  3APQ A;  4ML6 A;  3KEB A;  4FYB A;  2GLR A;  3F3R A;  2WGR A;  13GS A;  2PGT A;  3IHQ A;  3UMA A;  3EMX A;  1ERW A;  1GH2 A;  1T3B A;  3ZIT A;  2H70 A;  4HU9 A;  1Z7P A;  3UAR A;  4IQA A;  1F3B A;  5LD0 A;  5IOX A;  2JZT A;  4WBR D;  2VAF A;  4GTU A;  2YZH A;  1X0R A;  3QDN A;  2BJX A;  1MTC A;  2QA2 A;  1FAA A;  3GUR A;  1SL1 B;  2M80 A;  4EKZ A;  2B5E A;  2CZ2 A;  2JU5 A;  3KH7 A;  3HYP A;  1T00 A;  3IDV A;  4V1A g;  4IP1 A;  2O85 A;  2V2G A;  6GST A;  2I81 A;  2PUK C;  1BED A;  1A0R P;  1H75 A;  2GSQ A;  4ZIJ A;  5DCG A;  1F6M C;  2M72 A;  1TK0 B;  5KN0 A;  2CX4 A;  2VD0 A;  1PX7 A;  2HRF A;  4NWY A;  2CT6 A;  3BCK A;  4GRF A;  1Z7R A;  1NW2 A;  3GSS A;  5FWG A;  2YWI A;  3CSH A;  1EGR A;  3LFL A;  3QAG A;  4WET A;  6GSS A;  1TI3 A;  2YV7 A;  3GHA A;  5CRE A;  3LYP A;  1OVN A;  1M9B A;  3Q74 A;  2IMK A;  1B9X C;  5DBQ A;  1GRX A;  2DIY A;  3N5O A;  4ZB9 A;  2FLS A;  4PNG A;  1GP1 A;  4LL4 B;  1ZYN A;  1JLW A;  1XPV A;  2KP2 A;  2YJ7 A;  1GUK A;  1B48 A;  4QL9 A;  4XIH A;  1S3A A;  1J0F A;  3VFI A;  5H5Q A;  3A2V A;  3PR8 A;  3FY7 A;  4H86 A;  3ZMK A;  1JHB A;  3DVW A;  2R0G A;  2B1L A;  2TRC P;  2RM6 A;  2KP1 A;  2IJY A;  4IJI A;  1SKS B;  2E7P A;  2HNL A;  1Q4J A;  5FT3 A;  3WYW A;  3TKP A;  3TUE A;  2VLT A;  2E2G A;  1PL1 A;  2GGT A;  4G0I A;  3C73 A;  3QMX A;  3TGZ A;  5B6N A;  1GSQ A;  2NVL A;  2EC4 A;  2EIO A;  2I1U A;  1Z6N A;  1ZOF A;  4ZB6 A;  3P7X A;  5HQP A;  4PQ1 A;  3U5R E;  1IYI A;  3GKX A;  5A4W A;  1WRY A;  1GUH A;  1DSB A;  9GSS A;  4DSS A;  2HRA A;  2LTK A;  4HDE A;  1TI1 A;  1S3D A;  3GNJ A;  2VCZ A;  6GSY A;  3D0Z A;  4E8H A;  3C7M A;  5IMA A;  1PN9 A;  1Z9H A;  3GKK A;  2R0P A;  2AAW A;  4XRD A;  4MPG A;  2D2Z A;  1BYE A;  2VUP A;  3WGE A;  4ECC A;  3MAK A;  4OFM A;  1YQ1 A;  3EIN A;  3KJY A;  5ECR B;  2B6M A;  4RUV A;  1QK8 A;  3LYK A;  2K9F A;  4MK3 A;  6GSV A;  4TN8 A;  3GH6 A;  4KDX A;  5D9V A;  1X5E A;  1XBS A;  2RII A;  2GS3 A;  2O89 A;  1AC1 A;  1TRW A;  2F8A A;  2AB6 A;  2LNT A;  2QC7 A;  3TB2 A;  1SJI A;  4MJB A;  1A2L A;  2DMM A;  4RI6 A;  2AV4 A;  5E4W A;  1PL2 A;  3M9K A;  10GS A;  5AN1 A;  1WPI A;  2BTO T;  4GQC A;  3RBT A;  3Q19 A;  1FVJ A;  3TRQ A;  5AIS A;  4YKF A;  1I9D A;  1X5D A;  4AGS A;  2RLI A;  4AJ8 A;  4G9H A;  4HOJ A;  5D73 A;  1K3O A;  5CO3 A;  3J7Y k;  1A8Y A;  1BQ7 A;  5B7C A;  3UBL A;  3WGX A;  4KCA A;  2X4A A;  4TVE A;  4OD7 A;  2HYX A;  5LNK e;  2N5B A;  2HXK A;  5G31 A;  2RM5 A;  3FYG A;  2A2S A;  3D4M A;  4YH2 A;  3ZRD A;  3D21 A;  2OE3 A;  12GS A;  2A4V A;  3EC3 A;  3NIV A;  1XVW A;  1U6T A;  1K0N A;  2VCX A;  2VLV A;  5GAN D;  5EY6 A;  4POK A;  4I8B A;  1EEJ A;  4TOP A;  3LW9 A;  3A3T A;  1WIK A;  3TJB A;  1XZO A;  2OJL A;  4MJC A;  1SK1 A;  3UL3 A;  5D96 A;  5L71 A;  3DVX A;  4L5L A;  1A0F A;  3CMI A;  2IFQ A;  4YAP A;  5D9W A;  3US3 A;  3HZ8 A;  2FWG A;  2JAC A;  1GTA A;  4FYU A;  5DVB A;  1HD2 A;  1EOG A;  2VL9 A;  5ECL B;  2B5Y A;  2ZNM A;  1T4Y A;  3A2W A;  2WS2 A;  3IK7 A;  3TCO A;  2IMF A;  2IN3 A;  2PU9 C;  5GST A;  3AY8 A;  1NSW A;  2AHE A;  2HZF A;  4AF2 A;  3GKN A;  4KA0 A;  4K7I A;  3BCI A;  3H4K A;  1BG5 A;  3GX0 A;  1O8W A;  4EIQ A;  2HRK A;  3E9J B;  3QFB C;  3LSZ A;  4KSM A;  3DIE A;  4POB A;  1G0T A;  2N5A A;  2B3S A;  4K5S A;  4BPY A;  4K2D A;  4F03 A;  3G9B A;  4A5P A;  3VWV A;  2L6C A;  1TKD B;  1QMV A;  3APS A;  3TRX A;  3QPM A;  2EIR A;  1ON4 A;  1BAY A;  2ALB A;  3FW2 A;  2A2P A;  3WT1 A;  3RDW A;  4N10 A;  1B8X A;  3P2A A;  4XS4 B;  3SWL A;  3BD2 A;  2AUV A;  2XC2 A;  2R5G A;  3HDC A;  3EUR A;  3G7I A;  4PUF C;  1K3L A;  5F07 A;  1EEM A;  1JZD A;  1WE0 A;  1KNG A;  4MJE A;  3KCM A;  5DQY A;  5A5K A;  3L9U A;  4MH2 A;  2H8L A;  2M46 A;  3WGD A;  2B1K A;  2XBQ A;  2NTO A;  4MF5 A;  18GS A;  4YQM A;  2DKH A;  1TDI A;  5AGY A;  1TRS A;  2GST A;  4TR4 A;  2LS5 A;  3HXS A;  3ME8 A;  2I4A A;  4Z2U A;  2WFC A;  1VGL A;  1MDI A;  1VF2 A;  2YNX A;  3VWW A;  5KEJ A;  1PKZ A;  4KB3 A;  1FVK A;  4YQV A;  1NM3 A;  5J9B A;  2X99 A;  1N2A A;  4MH3 A;  4GST A;  5DDL A;  1XOA A;  3OR5 A;  1HQO A;  3J7Y b;  2KUC A;  3MNG A;  4PUR A;  4BVY A;  4EUY A;  4GLT A;  3M3M A;  2LUS A;  5HR2 A;  3VUR A;  4K7O A;  4CW9 A;  4DSQ A;  1XFL A;  1O8X A;  4EVM A;  1RW1 A;  3F0I A;  5DJL A;  4MNN A;  1THX A;  5DAL A;  5EPF A;  1V57 A;  2OKA A;  1XOB A;  2IIY A;  4MCU A;  3ED3 A;  1T1V A;  4GF0 A;  2A4H A;  3N9J A;  4GSS A;  4V2M A;  2CVB A;  3KZQ A;  2LRT A;  4WF4 A;  1CQH A;  4DSS B;  1ILO A;  2H1G A;  4HQZ A;  4O5U A;  2LJR A;  2WRT A;  4NV2 A;  1JLV A;  4POL A;  2FWE A;  1Z5Y E;  2DBC A;  3EE2 A;  5IMV A;  3I43 A;  4NMU A;  1OE7 A;  1M99 A;  2K18 A;  1GTB A;  3IE3 A;  3GTU B;  4XS1 A;  3I9V 2;  5C04 A;  2ON7 A;  1M9A A;  4WKW A;  1G7E A;  1IYH A;  3PPU A;  1R7H A;  3M9J A;  3C71 A;  1J08 A;  2PVO C;  2XBI A;  4MJA A;  1ZL9 A;  2V32 A;  5ECI B;  4EF0 A;  1YEX A;  1TU7 A;  1SD9 A;  1WOU A;  1FB0 A;  2H6Y A;  2OBK A;  5EL8 A;  5IOW A;  1YDK A;  4NHZ A;  2VCV A;  4LL1 B;  3ZZX A;  3FEU A;  4WXT A;  2R3X A;  4HZ2 A;  5JWQ B;  2LNS A;  4KAE A;  1PKW A;  5DJM A;  4GXZ A;  3UAP A;  5CYY A;  2PVQ A;  3IC8 A;  4Z2T A;  2H1B A;  4HZ4 A;  1VRS D;  4N0Z A;  3CBU A;  4MLY A;  3RHC A;  4GWR A;  4ICY A;  3IAS 2;  4LMW A;  3FZ9 A;  5E59 A;  4ZL7 A;  3KGK A;  1USB A;  1GUL A;  3F6F A;  4XS4 A;  1AQX A;  2NPB A;  2IFQ B;  4FIW A;  3HJM A;  2XPE A;  3GIX A;  3UJ1 A;  2DSA A;  2L4Q A;  1SKR B;  5J4U A;  5GSS A;  3QD9 A;  2LJK A;  2KHP A;  5HFK A;  2YP6 A;  1YKC A;  3HZ4 A;  4IN0 A;  3C8E A;  1B4P A;  2FA4 A;  4N0V A;  3VWU A;  1FOV A;  2K8S A;  3ERF A;  5KN3 A;  3KIJ A;  3QR6 A;  2AYT A;  4POM A;  1PGT A;  3IHG A;  2C4J A;  2X8G A;  1ERT A;  4PQH A;  4ZB8 A;  4ECI A;  1YJ6 A;  4BVX B;  5HFI A;  5J41 A;  1PMT A;  3L78 A;  4TRX A;  5JWR B;  1OC9 B;  3KMO A;  17GS A;  2FNO A;  2E2M A;  3KP9 A;  3RAZ A;  5ELG A;  5CP1 A;  2YAN A;  2WCI A;  2DC5 A;  1PX6 A;  3FRC A;  4MPF A;  1E2Y A;  2CAI A;  5LCZ A;  4ULX A;  1A24 A;  3KTB A;  1XW9 A;  5F0G A;  2CVD A;  4DEJ A;  3JCM L;  4K0N A;  1Y25 A;  1EWX A;  2JSY A;  4Z2R A;  3ZIV A;  2WDU A;  3GRX A;  5AIV A;  1AUC A;  1YZX A;  2DML A;  3GV1 A;  3LQ7 A;  2DJJ A;  2N5F A;  4G0L A;  4JRR A;  1FG4 A;  1A23 A;  4HUA A;  3LG6 A;  4ZBA A;  4GQF A;  3DKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...