1XBSA

Crystal structure of human dim2: a dim1-like protein
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
137
structure length
137
Chain Sequence
MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, cell cycle
molecule keywords Dim1-like protein
publication title Biochemical Characterization and Crystal Structure of a Dim1 Family Associated Protein: Dim2
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2004-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02966 DIM1 Mitosis protein DIM1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1xbsA00
2CVBA 2Z9SA 4O7HA 4ISDA 1OC8A 1AAZA 2ON5A 4MLYA 1M9AA 1ML6A 5JWQB 2XPEA 1FW1A 4Z7XA 1XZOA 2H71A 3BD2A 4XHMA 1VF1A 1GL8A 5L71A 4ML6A 3FZ9A 2C0FA 3UJ1A 3WD6A 4F0BA 4V2LA 3NIVA 2YWNA 4YQVA 3CRTA 1PKZA 1SYXA 4ZBAA 1EP7A 1J9BA 2VCZA 5JCGA 1TRSA 2ZUPA 3UEMA 3UIWA 1DSBA 1SL2B 1EOHA 1JZRA 5DBQA 1PN9A 2O87A 1TKDB 1USBA 5HR2A 3KGKA 3TCOA 4WR4A 4WBRD 3QDNA 1DE1A 2EIRA 2LQQA 2C0GA 2R4VA 1NHOA 4TVEA 4GSSA 1AQWA 4GXZA 2O7KA 1PD21 1V9WA 3D21A 4IQAA 4OD7A 3H93A 4CDOA 2QSIA 4POKA 6GSTA 1W4VA 2VL2A 2R5GA 2XPDA 2OACA 2AUVA 6GSXA 5CYYA 1A8LA 2TRXA 3QMXA 2GQMA 2FNOA 3G9BA 3ZIJA 4IN0A 1EP8A 4F2IA 3WGDA 2H01A 4YAPA 4KDUA 3CSJA 1MEKA 4ECBA 1TW9A 3ZL5A 1GTBA 2BMXA 3ZYWA 2NDOA 2V41A 4Q5FA 5G30A 3GA4A 1Y6EA 3LFLA 4X43A 1SD8A 2IJYA 4MABA 4ZL8A 3VWVA 1SK2A 1SK0A 2M46A 1ZZYA 1MDIA 3O6TA 2A2SA 2I81A 4GF0A 4X1UA 2C1YA 4KCEA 4H86A 3L78A 1B4QA 5E59A 1GULA 1ZCPA 1B9YC 1QQ2A 3C71A 4RUVA 3ZFLA 4MZCA 3QPMA 1R4WA 3U5RE 2HI7A 2E2GA 4HU7A 4KB3A 2CAQA 1LU4A 2H19A 4GCIA 1GUKA 5EVOA 3IE3A 4EO3A 5ECRB 1TOFA 4V2MA 2LEGA 2PMTA 4NHZA 3KXOA 3NZNA 4OMVA 2GZPA 2MBTA 1SJIA 3HVXA 2GVPA 1H4OA 1RK4A 1N2AA 2LUSA 4TR0A 2H8LA 3BOAA 1U87A 1YQ1A 1SL0B 2DJ0A 3A2XA 4YQMA 3FRCA 3C1RA 4KE3A 3WT1A 2B1LA 1N8JA 2N5AA 2L4CA 2VCXA 1K3LA 3L4NA 5LCZA 3RBTA 2MMNA 3ERGA 1FAAA 1ZYEA 5ENUA 4CHSA 1MD4A 3DGQA 2VOCA 2I3YA 4ZL7A 3IHQA 1ACVA 2GSSA 1WP0A 3BCKA 4RQXA 3DMLA 3N5OA 2L5OA 2VCVA 4IW9A 4GQCA 1TK0B 1OC9B 2V6OA 2E0QA 4G10A 3FR9A 3H79A 1GSEA 3DVWA 5J3RA 4J57E 1OC3A 3UVTA 1OKDA 2CZ3A 2R6KA 1KEBA 2YZUA 2V2GA 1S3CA 3HHVA 3LJRA 1WMJA 4NPBA 1GSUA 2H74A 2XHFA 2HLSA 1OE8A 4HQZA 4KDYA 4ID0A 2OE1A 3KMOA 2H1GA 1I5GA 3GRXA 3HD5A 2VUPA 1ZGNA 5B8AA 5KN1A 4KDXA 3I9V2 3F9UA 3EYTA 3ERFA 2N5BA 3DYRA 3P90A 2P31A 4WXTA 2R37A 3ERWA 3PINA 2MMAA 1R7HA 3VWXA 2M72A 4F0CA 3L9VA 3TJKA 3H8QA 3M9JA 3DIEA 1M2BA 1SKRB 1R5AA 3GYKA 3ZREA 5G31A 3R2QA 5IMDA 4WEYA 2TIRA 1FHEA 2OE0A 1M2AA 3FK8A 2LRNA 2IMFA 1A2JA 2QGVA 1WPIA 2I1UA 2WJUA 2LRTA 4WF4A 3DKSA 1QFNA 5GAND 2YCDA 1TXXA 4GTUA 1A23A 1V40A 1FVJA 4OO4A 4E8EA 1ZYQB 4AJ7A 2CAIA 3RAZA 2GQLA 1BEDA 3FZ4A 5C04A 2WFCA 5AISA 4ECCA 1ERUA 5CO3A 3ZVJA 3KTLA 2L59A 1BYEA 2PPTA 3GHAA 3RPPA 4MPGA 1Z6NA 4OFMA 3HKRA 4NV5A 1U3IA 2WS2A 4LMVA 3ZITA 2E2MA 5IM9A 1XOAA 16GSA 1H75A 2IMIA 3DD3A 2X8HA 2FGXA 1RW1A 4DEJA 2LNSA 2GSQA 2DMMA 6GSSA 2HZEA 1R26A 2JZRA 3DEXA 1URMA 2VM2A 2MYGA 2OE3A 1JZWA 1S3DA 1T1VA 4DSQA 3IDVA 4O32A 4XTSA 5GZZB 1S3AA 2NBSA 2XBQA 2FUG2 2RUEA 2P5RA 3GH6A 3WYWA 3UMAA 2C3QA 1F3BA 1RQMA 2H73A 3GX0A 4G2EA 3CRUA 5A4WA 3IAM2 4MDCA 2IL3A 4NXIA 4EL1A 4TR3A 4TR1B 1FB0A 2B7KA 3W6GA 4KSOA 3L9UA 1YJ6A 3GL5A 2GDRA 3F4RA 5G5FA 5ECMB 2H1DA 1AIUA 1TJDA 5IPGA 4PQ1A 5J4UA 5F07A 2EIOA 4D73A 3M1GA 1GH2A 2FCHA 2PERA 2J9HA 2GGTA 2TRCP 1PL1A 3CTGA 6GSVA 3IBHA 3UBLA 3AY8A 4V1Ag 4IGJA 2RM6A 3TUEA 3GSTA 5B6MA 4FH8A 5IQYA 2GZZA 2OBKA 4FYCA 1M9BA 2PGTA 4PUFC 1EGOA 3ZTLA 4MH2A 1XVQA 3TB2A 2GSTA 1HQOA 4ILFA 8GSSA 5D96A 5JWRB 2H6YA 2P5QA 4FYBA 1BX9A 2MZCA 1ERTA 2K9FA 2L57A 2H72A 2X99A 4TR4A 4MCUA 1G6WA 3GTUA 2DJ1A 3ZVJD 1GSFA 3C8EA 4N0ZA 1XFLA 2L6DA 2VLTA 3D22A 3GKMA 1TTZA 1O8WA 1GUHA 5ID2A 1AW9A 1ZOFA 3EURA 3IC4A 5J5NA 5G2ZA 2WCIA 3M8NA 1TRUA 1YDKA 2OADA 4XS4B 3J7Yk 3KP9A 1GTUA 2RUFA 3ZZXA 3VURA 4GQFA 1A24A 2HE3A 3I43A 1GSSA 2HYXA 2YV7A 2ON7A 5AGYA 1TRVA 1XCCA 3GIXA 3TOTA 2PVQA 2DC5A 1GTIA 2DJJA 4JBBA 2CZ2A 2WULA 3KEBA 3EWLA 2DIZA 2GTUA 2OA7A 3C73A 4BVXA 5IIZA 2LJKA 1WOUA 4JE1A 4MJCA 4EVMA 2M80A 2LV3A 3VI7A 3D5JA 2LSTA 5ELAA 5F05A 5IMAA 5F8BA 1HNAA 4HZ2A 3IA1A 1YEPA 4BPYA 1XWAA 2MMZA 1I9DA 3IV4A 5AIXA 2ZCTA 3UBKA 2LJAA 1DUGA 5HQPA 2YWMA 2VM1A 5DJLA 1GNWA 3P7XA 3ME7A 1TRWA 5CRHA 2YNXA 1AQXA 4G19A 1XW9A 3E9JB 5GAPD 2L6CA 1Q98A 1O73A 4YH2A 5DAKB 5D9VA 1XPVA 1THXA 3GN3A 2IN3A 5AN1A 1K0MA 4KA0A 2ZNMA 3H4KA 2H1BA 2YPMA 2FWFA 2WZ9A 3O76A 1Z7RA 5EY6A 1SJ6A 1WWJA 3TGZA 4TXVA 2PVOC 2NPBA 1YY7A 3WGXA 1GSDA 5CREA 3C1SA 3QFAC 4FIWA 2FD3A 3DXBA 2E7PA 2B5EA 4EE0A 1JZDA 2HT9A 1TK8B 3TKSC 3UOMA 4NHWA 5J9BA 4LL1B 4K2DA 1GUMA 3JCML 1AC1A 3F4SA 1F37A 4IJIA 4BL7A 2C3TA 4ZB6A 1GSQA 3FZ5A 4TRXA 5DQYA 2H0IA 17GSA 1HNBA 1Z5YE 3VPTA 2VCWA 3CMIA 5HFIA 4PGTA 4WETA 4I8BA 3TJGA 3KP8A 5B6NA 3DRNA 4X0XA 3M0FA 2H0GA 1A8YA 3D6IA 3LWAA 4ZIJA 11GSA 2H75A 3N9JA 4JR4A 1PQNA 1XWGA 5ELGA 1Z9HA 4AJ6A 2J23A 3EMPA 4G9HA 3KCMA 4TW5A 3KTBA 2IPAA 5ECOB 3ISOA 1HD2A 5ECPB 2IFQB 3L9SA 2LRCA 3UL3A 4XCSA 1T3BA 4OO5A 5DCGA 2I9HA 2JU5A 1A2LA 4IBPA 5DCHA 4MF5A 2K8SA 2P0GA 4E8HA 5D9TA 1PMTA 2D2ZA 3QAWA 4XS4A 3D4TA 2AHEA 18GSA 1U88A 3IRAA 2KUCA 5A4VA 1V57A 4IP1A 4L8EA 1O85A 1XW5A 4IELA 1EEJA 1BG5A 2C3NA 4FO5A 1T7PB 5HR3A 2VLVA 3TRPA 2WRTA 5G1LA 3GKKA 4PUAA 2VD1A 1G0TA 1K3OA 5CP1A 2AAWA 3TJJA 5F0GA 3EINA 4MH3A 1YZXA 4HJMA 2GT6A 1M2DA 4NMUA 2G2QA 5HR0A 4DSSB 1XWBA 4Q5RA 3KIJA 1UN2A 4TXOB 4PQHA 1A0RP 1EZKA 3VWUA 1G6YA 1TI3A 5KN3A 3LYPA 4XRAA 4Q5NA 1NHYA 2FY6A 4KSMA 1E6BA 1SKWB 1EEMA 4KNDA 2H6XA 3HZ4A 1ERWA 2FWEA 3BBYA 2B5XA 1TDIA 3D4MA 3TKSA 2X8CA 3HCZA 5J41A 3WT2A 5AIVA 5H5QA 2K8VA 1Z7PA 1X5EA 1XBSA 2JADA 1FG4A 1MDKA 1FB6A 3D0ZA 2H70A 3Q19A 4EXJA 2GZYA 5CRDA 2LQOA 5HFKA 2C0DA 5E4WA 2QKEA 2HRNA 1F9MA 4LA1A 1SENA 4JR6A 1XVWA 2I4AA 1NSWA 2ES7A 2RLIA 1PX7A 1UA5A 1VF3A 4AF2A 2GQKA 3EE2A 2VD0A 2IMKA 3TRQA 3A3TA 2REMA 1KBNA 5IMZA 3FY7A 2LJRA 4EDZA 2HXKA 3HA9A 2F9SA 3WGEA 4GSNA 2N5FA 3LXZA 2VO4A 3Q74A 2IWTA 4HUAA 3TOUA 5CAXA 3KM6A 2OKAA 2VCQA 2H6ZA 22GSA 4N30A 5G1KA 4GWRA 2KOKA 4K8MA 2G0FA 3QD9A 4N11A 1K3YA 1F2EA 5KN0A 1X9MB 5DJMA 1OKTA 5JCWA 3GUSA 3TDGA 1FO5A 1M99A 5LD0A 2H0HA 2NVLA 4PNFA 1G7OA 4KCAA 1U6TA 3FEUA 1O6JA 5HR1A 1F6MC 1T4YA 2B7JA 1PA3A 5DALB 1SL1B 2AB6A 2DJKA 2CA8A 1XXUA 1K0CA 2O89A 2A2RA 1OC9A 2C80A 3M3MA 4MA9A 3IAS2 4IS0A 2IMEA 3HXSA 2C8UA 3Q6OA 3EU4A 3LG6A 1U3AA 3IK7A 2CX3A 1CQHA 1VF2A 3IR4A 1M0UA 1ST9A 3FHKA 1FOVA 1QMVA 3P8WA 2B6MA 2WDUA 2VL9A 3LXTA 2YJ7A 4GLTA 4WKWA 2VL2C 3MNGA 3US3A 3GH9A 4NV2A 3TKRA 1XWKA 3TKPA 1SJZA 2L5LA 2CX4A 4POBA 5F06A 2XC2A 5HFGA 4BWSA 4QL7A 3GKXA 3HZ8A 2AV4A 2JACA 1ILOA 1Z3EA 1GNEA 6GSUA 4YQUA 4HEA2 2HFDA 3DVXA 5INYA 3F6FA 4JU5A 4HS1A 3GKNA 4RQRA 2FHEA 4WR5A 5A5KA 4GRFA 4OCEA 5ECHB 1K0BA 3ZFBA 4HDEA 2JZTA 2QC7A 1CQGA 4XS1A 7GSSA 5LNKe 4PNGA 4DSSA 3LEFA 5ECSA 2F8FA 2CT6A 3BCIA 4TXOA 2C4JA 4HU9A 4EKZA 5CRWA 2K18A 4Q5QA 2PU9C 1JHBA 4MP4A 3CTFA 2MMOA 5IOXA 3V1WA 3I69A 2DLXA 1SD9A 1K0DA 5IMCA 3EVIA 3O3TA 3F4TA 1LBKA 2KHPA 3ZLPA 3KH7A 4ML1A 4IKHA 5D9WA 1R5PA 4V1Ap 4KW6A 4POMA 3LGCA 4KUNA 2FLSA 2F51A 3APSA 4FYUA 1YF1A 3F3QA 2YP6A 4K9ZA 2ALBA 4ZILA 3TRXA 4I5QA 3F3RA 5ABRA 2VL3A 1EOGA 2FA4A 1G7EA 1XW6A 1EV9A 3F0IA 4YAVA 4QQ7A 2HSHA 4PURA 2RIIA 5EL8A 2VIMA 2PUKC 3HYPA 2FWHA 3HJOA 3A2VA 2H1AA 1K0AA 5D8IA 2VCTA 4KX4A 2BTOT 3QAGA 4TN8A 2YOIA 3VI5A 4XRDA 3RHCA 3Q18A 1GRXA 1X0RA 3QOUA 5FHIA 1KNGA 2BJXA 3LORA 2LS5A 4IQ1A 2V1MA 1VGLA 1OYJA 1XOBA 5ECLB 3SBCA 3ZRDA 4JEDA 2YZHA 4KGIA 4QL9A 1GLPA 4J56E 2O8VB 2OJLA 1BQ7A 3LQ7A 1X9WB 19GSA 4AGSA 4MF7A 5DALA 1M7TA 2PN8A 3HDCA 2VAFA 1JFUA 2AJQB 2KP2A 3CSHA 4TKYA 1J08A 4L5LA 5D73A 2O85A 2YWOA 1ZL9A 2DIYA 2R2JA 5B7CA 1A0FA 3DWVA 4EUYA 2JSZA 3W8JA 2L4QA 4K7OA 1OAZA 2IMDA 4WF5A 4TR1A 1T4ZA 6GSWA 3J7Yb 1WE0A 9GSSA 3VK9A 5ECNB 1DBYA 4V2NA 5ECIB 2V6KA 3UAPA 3E0UA 4MZBA 1PGTA 2VLUA 4JZQA 2GT5A 4ACSA 1TU8A 3VWWA 1HNCA 4DVCA 2H30A 14GSA 2B3SA 3IK9A 3FR3A 1F3AA 4I2UA 5A4UA 3GFKA 2R3XA 1GWCA 4EC0A 5DDLA 1KTEA 1YEXA 3G7YA 4NWYA 3PR8A 1PSQA 1O81A 1IYHA 3H1NA 5IO0A 1MD3A 3KH9A 5FWGA 2C0EA 2DMLA 4K6XA 1XIYA 3G7IA 3HJMA 3OR5A 3CYNA 3KD0A 1JLVA 1UC7A 1T8EB 2LTKA 3IOSA 2X64A 1W89A 3I6AA 2JL4A 3HVVA 2HZEB 2H76A 5IMVA 2OBIA 2WB9A 1PX6A 20GSA 4P3YB 3HVSA 3CSIA 3RDWA 10GSA 2CQ9A 4JRRA 4WBJA 3GX8A 5IOWA 1V2AA 5GSTA 1YKCA 4ZB8A 1X5CA 2CVKA 2GLRA 2H66A 3KMNA 3A2WA 4I6XA 4LMWA 2CV4A 4EDYA 2B5YA 3FKFA 4AJ8A 4IP6A 1THOA 2YN1A 5GSSA 4O5RA 4IVFA 3LSZA 1AQVA 4GSTA 1VRSD 2PWJA 4IHUA 5D9XA 4PQIA 1O8XA 1SU9A 13GSA 4BVYA 3SWLA 1UVZA 2HNLA 4ZBBA 1JZOA 3TKQA 4MK3A 5CNWA 3CBUA 3F6DA 4XS6A 1DE2A 5JWOB 1A2MA 4KAEA 3KJYA 3K8NA 2KP1A 1K0NA 1AUCA 4MZWA 3FR6A 1EV4A 2F3MA 4MPFA 4MJBA 3PGTA 1TP9A 1B48A 1E2YA 3LYKA 4OFTA 3FW2A 4OWYA 2HSYA 4D73B 3L0HA 3F63A 3VFIA 4MJEA 4K7IA 4L0UA 2EC4A 2K6VA 3VLNA 4HQSA 3TKSE 2YV9A 3QR6A 1LJRA 5B8BA 4RI7A 1SK1A 3QCPA 4DSRA 1OVNA 3CXGA 4ZXGA 1GLQA 1X9SB 5H5RA 1QK8A 2YWIA 3EMXA 1MDJA 3UVHA 1OE7A 1ON4A 2CVDA 1V98A 4PX1A 3GTUB 5CRGA 4F03A 5IPHA 4RI6A 1YF0A 2XBIA 2YANA 2WGRA 3ZMKA 2DBCA 2DJ2A 1XWCA 4IJ3A 4POLA 2LNTA 5ID2B 3GL3A 3QAVA 2LKUA 3E3EA 3MDKA 5DAKA 1V58A 1GP1A 1PRXA 4XIHA 5JCUA 5EPFA 4F82A 1VF4A 3C7MA 1QUWA 1MTCA 2FWGA 1Z6MA 4I97A 2V32A 1O7UA 3M9KA 5ECKB 1PKWA 1WIKA 4ECIA 3IXRA 1ERVA 4CW9A 2AYTA 4OFNA 3FYGA 5COHA 2HZFA 3BJ5A 3MWHA 1SKSB 3NOFA 5IMFA 1C72A 3GNJA 4ZL9A 3IPZA 1TI1A 2DJ3A 4LL4B 4ZB9A 5KN2A 2B1KA 3APOA 1Q4JA 2DSAA 3GMFA 2PBJA 4ULXA 5G5EA 5J9CA 2KLXA 2GS3A 3G7JA 3ZIVA 4OCFA 5H5SA 4K0GA 1YKAA 4MMMA 4N0VA 12GSA 4O92A 5D93A 1PL2A 4F9ZA 1EGRA 1HYUA 3TJFA 1NM3A 2MBSA 1AXDA 4K7NA 2RM5A 4HI7A 1TU7A 2IIYA 1EWXA 1ABAA 3ED3A 2YJHA 4K0NA 3RHBA 1JLWA 2IFQA 1BJXA 4LLRA 1FVKA 3FZAA 3P2AA 4BA7A 5DVBA 4MJAA 1J0FA 1WJKA 4I2TA 1Y25A 3U6VA 3QFBC 1T00A 4BWQA 3GURA 1B4PA 1GTAA 3EU3A 1QGVA 5ECQB 2HRFA 3F8UA 2JZSA 2FA8A 1K0OA 2NTOA 2GSRA 4K1FA 3GV1A 3EC3A 3TJBA 5IO2A 4NAXA 2EIQA 3A5WA 3ZMLA 3MSZA 3KZQA 3S9FA 3PH9A 1B9XC 1SYRA 4EF0A 3RPNA 3HY2A 4N10A 1WRYA 3ME8A 1ZMAA 6GSYA 5KEJA 2A4VA 3MAKA 1BAYA 4L0WA 4HOJA 4ZBDA 3GSSA 5FT3A 1TK5B 4TOPA 1GSYA 1QXHA 3HJPA 5DQSA 4ECJA 4PXOA 1X5DA 4HZ4A 4J2FA 1IYIA 4KH7A 4L5OA 4MF6A 3UARA 1B8XA 3VPQA 1NW2A 2X8GA 3W8SA 2F8AA 2JSYA 4HJ2A 5C00A 3APQA
chains in the Genus database with same CATH superfamily
2CVBA 2Z9SA 4O7HA 4ISDA 1OC8A 1AAZA 2ON5A 4MLYA 1M9AA 1ML6A 5JWQB 2XPEA 1FW1A 4Z7XA 1XZOA 2H71A 3BD2A 3LW9A 2A2PA 4XHMA 1VF1A 1GL8A 5L71A 4ML6A 3FZ9A 2C0FA 3UJ1A 3WD6A 4F0BA 4V2LA 3NIVA 2YWNA 4YQVA 3CRTA 1PKZA 1SYXA 4ZBAA 1EP7A 1J9BA 2VCZA 5JCGA 1TRSA 2ZUPA 3UEMA 3UIWA 1DSBA 1SL2B 1EOHA 1JZRA 5DBQA 1PN9A 2O87A 1TKDB 1USBA 5HR2A 3KGKA 3TCOA 4WR4A 4WBRD 3QDNA 1DE1A 2EIRA 2LQQA 2C0GA 2R4VA 1NHOA 4TVEA 4GSSA 3MYDA 1AQWA 4GXZA 2R0CA 2O7KA 1PD21 1V9WA 3D21A 4IQAA 4OD7A 3H93A 4CDOA 2QSIA 4POKA 6GSTA 1W4VA 2VL2A 2R5GA 2XPDA 2OACA 2AUVA 6GSXA 5CYYA 1A8LA 4ICYA 2TRXA 1M3IA 3QMXA 2GQMA 2FNOA 3G9BA 3ZIJA 4IN0A 1EP8A 4F2IA 3WGDA 4A5PA 2H01A 4YAPA 4KDUA 3CSJA 1MEKA 4ECBA 1TW9A 3ZL5A 1GTBA 2BMXA 3ZYWA 2NDOA 2V41A 4Q5FA 5G30A 3GA4A 1Y6EA 3LFLA 4X43A 1SD8A 2IJYA 4MABA 4ZL8A 3VWVA 1SK2A 1SK0A 2M46A 1ZZYA 1MDIA 3O6TA 2A2SA 2I81A 4GF0A 4X1UA 2C1YA 4KCEA 4H86A 3L78A 1B4QA 5E59A 1GULA 1ZCPA 1B9YC 1QQ2A 3C71A 4RUVA 3ZFLA 4MZCA 3QPMA 1R4WA 3U5RE 2HI7A 2E2GA 4HU7A 4PTSA 2X49A 4KB3A 2CAQA 1LU4A 2H19A 4GCIA 1GUKA 5EVOA 3IE3A 4EO3A 5ECRB 4K5SA 1TOFA 4V2MA 2LEGA 2PMTA 5BMUA 4NHZA 3KXOA 3NZNA 4OMVA 2GZPA 2MBTA 1SJIA 3HVXA 2GVPA 1H4OA 1RK4A 1N2AA 2LUSA 4TR0A 2H8LA 3BOAA 1U87A 1YQ1A 1SL0B 2DJ0A 3A2XA 4YQMA 3FRCA 3C1RA 4HSCX 4KE3A 3WT1A 2B1LA 1N8JA 2N5AA 2L4CA 2VCXA 1K3LA 3L4NA 5LCZA 3RBTA 2MMNA 3ERGA 1FAAA 1ZYEA 5ENUA 4CHSA 1MD4A 3DGQA 2VOCA 2I3YA 4ZL7A 3IHQA 1ACVA 2GSSA 1WP0A 3BCKA 4RQXA 3DMLA 3N5OA 2L5OA 2VCVA 4IW9A 4GQCA 1TK0B 1OC9B 2V6OA 2E0QA 4G10A 3FR9A 3H79A 1GSEA 3DVWA 2HSMA 5J3RA 4J57E 1OC3A 3UVTA 1OKDA 2CZ3A 2R6KA 1KEBA 2YZUA 2V2GA 1S3CA 3HHVA 3LJRA 1WMJA 4NPBA 1GSUA 2H74A 2XHFA 2HLSA 1OE8A 4HQZA 4KDYA 4ID0A 2OE1A 3KMOA 2H1GA 1I5GA 3GRXA 3HD5A 2VUPA 1ZGNA 5B8AA 5KN1A 4KDXA 3I9V2 3F9UA 3EYTA 3ERFA 2N5BA 3DYRA 3P90A 2P31A 4WXTA 2R37A 3ERWA 3PINA 2MMAA 1R7HA 3VWXA 2M72A 4F0CA 3L9VA 3TJKA 3H8QA 3M9JA 3DIEA 3IC8A 1M2BA 1SKRB 1R5AA 3GYKA 3ZREA 5G31A 3R2QA 5IMDA 4WEYA 2TIRA 1FHEA 2OE0A 1M2AA 3FK8A 2LRNA 2IMFA 1A2JA 2QGVA 1WPIA 2I1UA 2WJUA 2LRTA 4WF4A 3DKSA 1QFNA 5GAND 2YCDA 1TXXA 4GTUA 1A23A 1V40A 1FVJA 4OO4A 4E8EA 1ZYQB 4AJ7A 2CAIA 3RAZA 2GQLA 1BEDA 3FZ4A 5C04A 2WFCA 5AISA 4ECCA 1ERUA 4CY8A 5CO3A 3ZVJA 3KTLA 2L59A 1BYEA 2HRAA 2PPTA 3GHAA 3RPPA 4MPGA 1Z6NA 4OFMA 3HKRA 4NV5A 1U3IA 2WS2A 4LMVA 3ZITA 2E2MA 5IM9A 1XOAA 16GSA 1H75A 2IMIA 3DD3A 2X8HA 2FGXA 1RW1A 4DEJA 2LNSA 2GSQA 2DMMA 6GSSA 2HZEA 1R26A 2JZRA 3DEXA 1URMA 2VM2A 2MYGA 2OE3A 2A4HA 4EIPA 1JZWA 1S3DA 1T1VA 4DSQA 3IDVA 4O32A 4XTSA 5GZZB 1S3AA 2NBSA 2XBQA 2FUG2 2RUEA 2P5RA 1XG8A 3GH6A 3WYWA 3UMAA 4YKGA 2C3QA 1F3BA 1RQMA 2H73A 3GX0A 4G2EA 3CRUA 5A4WA 3IAM2 4MDCA 2IL3A 4NXIA 4EL1A 4TR3A 4TR1B 1FB0A 2B7KA 3W6GA 4KSOA 3L9UA 1YJ6A 3GL5A 2GDRA 3F4RA 5G5FA 5ECMB 2H1DA 1AIUA 1TJDA 5IPGA 4PQ1A 5J4UA 5F07A 2EIOA 4D73A 3M1GA 1GH2A 2FCHA 2PERA 2J9HA 2GGTA 2TRCP 1PL1A 3CTGA 6GSVA 3IBHA 3UBLA 3AY8A 4V1Ag 4IGJA 2RM6A 3TUEA 3GSTA 5B6MA 4FH8A 5IQYA 2GZZA 2OBKA 4FYCA 4EIQA 1M9BA 2PGTA 4PUFC 1EGOA 3ZTLA 4MH2A 1XVQA 3TB2A 2GSTA 1HQOA 4ILFA 4Z2RA 8GSSA 5D96A 5JWRB 2H6YA 4KF9A 2P5QA 4FYBA 1BX9A 2MZCA 1ERTA 2K9FA 2L57A 2H72A 2X99A 4TR4A 4MCUA 1G6WA 3GTUA 2DJ1A 3ZVJD 1GSFA 3C8EA 4N0ZA 1XFLA 2L6DA 2VLTA 3D22A 3GKMA 2QA1A 1TTZA 1O8WA 1GUHA 5ID2A 1AW9A 1ZOFA 3EURA 3IC4A 5J5NA 5G2ZA 1PN0A 5KOWA 2WCIA 3M8NA 1TRUA 1YDKA 2OADA 4XS4B 3J7Yk 3KP9A 1GTUA 2RUFA 3ZZXA 3VURA 4GQFA 1A24A 4BIKA 2HE3A 3I43A 1GSSA 2HYXA 2YV7A 2ON7A 5AGYA 1TRVA 1XCCA 3GIXA 3TOTA 2PVQA 2DC5A 1GTIA 2DJJA 4JBBA 2CZ2A 2WULA 3KEBA 3EWLA 2DIZA 2GTUA 2OA7A 3C73A 4BVXA 5IIZA 2LJKA 1WOUA 4JE1A 4MJCA 4EVMA 2M80A 2LV3A 2HRKA 3VI7A 3D5JA 2LSTA 5ELAA 5F05A 5IMAA 5F8BA 1HNAA 4HZ2A 3IA1A 1YEPA 4BPYA 1XWAA 2MMZA 1I9DA 3IV4A 5AIXA 2ZCTA 3UBKA 2LJAA 1DUGA 5HQPA 2YWMA 2VM1A 5DJLA 1GNWA 3P7XA 3ME7A 1TRWA 5CRHA 2YNXA 1AQXA 4G19A 1XW9A 4O5QA 3E9JB 1FOHA 5GAPD 2L6CA 1Q98A 1O73A 4YH2A 1ZYNA 5DAKB 5D9VA 1XPVA 1THXA 3GN3A 2IN3A 5AN1A 1K0MA 4KA0A 2ZNMA 3H4KA 2H1BA 2YPMA 2FWFA 2WZ9A 3O76A 1Z7RA 5EY6A 1SJ6A 1WWJA 3MIXA 3TGZA 4TXVA 2PVOC 2NPBA 1YY7A 3WGXA 1GSDA 2R0PA 5CREA 3C1SA 3QFAC 4FIWA 2FD3A 3DXBA 2E7PA 2B5EA 4EE0A 1JZDA 2HT9A 1TK8B 3TKSC 3UOMA 4NHWA 5J9BA 4LL1B 4K2DA 1GUMA 3JCML 1AC1A 3F4SA 1F37A 4IJIA 4BL7A 2C3TA 4ZB6A 1GSQA 2DKIA 3FZ5A 4TRXA 5DQYA 2H0IA 17GSA 4G0KA 1HNBA 1Z5YE 3VPTA 2VCWA 3CMIA 5HFIA 4PGTA 4WETA 4I8BA 3TJGA 3KP8A 5B6NA 3DRNA 4X0XA 3M0FA 2H0GA 1A8YA 3D6IA 3LWAA 4ZIJA 11GSA 2H75A 3N9JA 4JR4A 1PQNA 1XWGA 5ELGA 1Z9HA 4AJ6A 2J23A 3EMPA 4G9HA 3KCMA 4TW5A 3KTBA 2IPAA 5ECOB 3ISOA 1HD2A 5ECPB 2IFQB 3L9SA 2LRCA 3UL3A 4XCSA 1T3BA 4OO5A 5DCGA 2I9HA 2JU5A 1A2LA 4IBPA 5DCHA 4MF5A 2K8SA 2P0GA 4E8HA 5D9TA 1PMTA 2D2ZA 3QAWA 4XS4A 3D4TA 2AHEA 18GSA 1U88A 3IRAA 2KUCA 5A4VA 1V57A 4IP1A 4L8EA 4X4JA 1O85A 1XW5A 4IELA 1EEJA 1BG5A 2C3NA 4FO5A 1T7PB 5HR3A 2VLVA 3TRPA 2WRTA 5G1LA 3GKKA 4PUAA 2VD1A 1G0TA 1K3OA 5CP1A 2AAWA 3TJJA 5F0GA 3EINA 4MH3A 1YZXA 4HJMA 2GT6A 1M2DA 4NMUA 2G2QA 5HR0A 4DSSB 1XWBA 4Q5RA 3KIJA 1UN2A 4TXOB 4PQHA 1A0RP 1EZKA 3VWUA 1G6YA 1TI3A 5KN3A 3LYPA 4XRAA 4Q5NA 1NHYA 2FY6A 4KSMA 1E6BA 1SKWB 1EEMA 4KNDA 2H6XA 3HZ4A 1ERWA 2FWEA 3BBYA 2B5XA 1TDIA 3D4MA 3IHGA 3TKSA 2X8CA 3HCZA 5J41A 3WT2A 5AIVA 5H5QA 2K8VA 1Z7PA 1X5EA 1XBSA 2JADA 1FG4A 1MDKA 1FB6A 3D0ZA 2H70A 3Q19A 4EXJA 2GZYA 5CRDA 2LQOA 5HFKA 2C0DA 5E4WA 2QKEA 2HRNA 1F9MA 4LA1A 1SENA 4JR6A 1XVWA 2I4AA 1NSWA 2ES7A 2RLIA 1PX7A 1UA5A 1VF3A 4AF2A 2GQKA 3EE2A 2VD0A 2IMKA 3TRQA 3A3TA 2REMA 1KBNA 5IMZA 3FY7A 2LJRA 4EDZA 2HXKA 3HA9A 3CQFA 2F9SA 4G0IA 3WGEA 4GSNA 2N5FA 3LXZA 2VO4A 3Q74A 2IWTA 4HUAA 3TOUA 5CAXA 3KM6A 2OKAA 2VCQA 2H6ZA 22GSA 4N30A 5G1KA 4GWRA 2KOKA 4K8MA 2G0FA 3QD9A 4N11A 1K3YA 1F2EA 5KN0A 1X9MB 5DJMA 2DKHA 1OKTA 5JCWA 3GUSA 3TDGA 1FO5A 1M99A 5LD0A 2H0HA 4K5RA 2NVLA 4PNFA 1G7OA 4KCAA 1U6TA 3FEUA 1O6JA 5HR1A 1F6MC 5BRTA 1T4YA 2B7JA 1PA3A 5DALB 1SL1B 2AB6A 2DJKA 2CA8A 1XXUA 1K0CA 2O89A 2A2RA 1OC9A 2C80A 3M3MA 4MA9A 3IAS2 4IS0A 2IMEA 3HXSA 2C8UA 3Q6OA 3EU4A 3LG6A 1U3AA 3IK7A 2CX3A 1CQHA 1VF2A 3IR4A 1M0UA 1ST9A 3FHKA 1FOVA 1QMVA 3P8WA 2B6MA 2WDUA 2VL9A 3LXTA 2YJ7A 4GLTA 4WKWA 2VL2C 3MNGA 3US3A 3GH9A 4NV2A 3TKRA 1XWKA 3TKPA 1SJZA 2L5LA 2CX4A 4POBA 5F06A 2XC2A 5HFGA 4BWSA 4QL7A 3GKXA 3HZ8A 2AV4A 2JACA 1ILOA 1Z3EA 1GNEA 6GSUA 3HVNA 1M3JA 4YQUA 4HEA2 2HFDA 3DVXA 5INYA 5KOXA 3F6FA 4JU5A 4HS1A 3GKNA 4RQRA 2FHEA 4WR5A 5A5KA 4GRFA 4OCEA 5ECHB 1K0BA 3ZFBA 4HDEA 2JZTA 2QA2A 2QC7A 1CQGA 4XS1A 7GSSA 5LNKe 4PNGA 4DSSA 3LEFA 5ECSA 2F8FA 2CT6A 3BCIA 4TXOA 2C4JA 4HU9A 4EKZA 5CRWA 2K18A 4MNNA 4Q5QA 2PU9C 4CY6A 1JHBA 4MP4A 3CTFA 2MMOA 5IOXA 3V1WA 3I69A 2DLXA 1SD9A 1K0DA 5IMCA 3EVIA 3O3TA 4YKFA 3F4TA 1LBKA 2KHPA 3ZLPA 3KH7A 4ML1A 4IKHA 5D9WA 4BVYB 1R5PA 4V1Ap 4KW6A 4POMA 3LGCA 4KUNA 2FLSA 2F51A 3APSA 4FYUA 1YF1A 3F3QA 2YP6A 4K9ZA 2ALBA 4ZILA 2X4AA 3TRXA 4I5QA 3F3RA 5ABRA 2VL3A 1EOGA 2FA4A 1G7EA 1XW6A 1EV9A 3F0IA 4YAVA 4QQ7A 2HSHA 4PURA 2RIIA 5EL8A 2VIMA 2PUKC 3HYPA 2FWHA 3HJOA 3A2VA 2H1AA 1K0AA 5D8IA 2VCTA 4KX4A 2BTOT 3QAGA 4TN8A 2YOIA 3VI5A 4XRDA 3RHCA 3Q18A 1GRXA 1X0RA 3QOUA 5FHIA 1KNGA 2BJXA 3LORA 2LS5A 4IQ1A 2V1MA 1VGLA 1OYJA 1XOBA 5ECLB 3SBCA 3ZRDA 4JEDA 2YZHA 4KGIA 4QL9A 1GLPA 4J56E 2O8VB 2OJLA 1BQ7A 3LQ7A 1X9WB 19GSA 4AGSA 4MF7A 5DALA 1M7TA 3FMWA 2PN8A 4FQUA 4G0LA 3HDCA 2VAFA 1JFUA 2AJQB 2KP2A 3CSHA 4TKYA 1J08A 4L5LA 5D73A 1PFOA 2O85A 4Z2TA 2YWOA 1ZL9A 2DIYA 2R2JA 5B7CA 1A0FA 3DWVA 4O5UA 4EUYA 2JSZA 3W8JA 2L4QA 4K7OA 1OAZA 2IMDA 4WF5A 4TR1A 1T4ZA 6GSWA 3J7Yb 1WE0A 9GSSA 3VK9A 5ECNB 1DBYA 4V2NA 5ECIB 2V6KA 3UAPA 3E0UA 4MZBA 1PGTA 2VLUA 4JZQA 2GT5A 4ACSA 1TU8A 3VWWA 1HNCA 4DVCA 2H30A 14GSA 2B3SA 3IK9A 3FR3A 1F3AA 4I2UA 5A4UA 3GFKA 2R3XA 1GWCA 4EC0A 5DDLA 1KTEA 1YEXA 3G7YA 4NWYA 3PR8A 1PSQA 1O81A 1IYHA 3H1NA 2R0GA 5IO0A 1MD3A 3KH9A 5FWGA 2C0EA 2DMLA 4K6XA 1XIYA 3G7IA 3HJMA 3OR5A 3CYNA 3KD0A 1JLVA 1UC7A 1T8EB 2UZ8A 2LTKA 3IOSA 2X64A 1ZYPA 1W89A 3I6AA 2JL4A 3HVVA 2HZEB 2H76A 5IMVA 4USSA 2OBIA 2WB9A 1PX6A 20GSA 4P3YB 3HVSA 3CSIA 3RDWA 10GSA 2CQ9A 4JRRA 4WBJA 3GX8A 5IOWA 1V2AA 5GSTA 1YKCA 4ZB8A 1X5CA 2CVKA 2GLRA 2H66A 3KMNA 3A2WA 4I6XA 4LMWA 2CV4A 4EDYA 2B5YA 3FKFA 4AJ8A 4IP6A 1THOA 2YN1A 5GSSA 4O5RA 4IVFA 3LSZA 1AQVA 4GSTA 1VRSD 2PWJA 4IHUA 5D9XA 4PQIA 1O8XA 1SU9A 13GSA 4BVYA 3SWLA 1UVZA 2HNLA 4ZBBA 4K2XA 1JZOA 3TKQA 1S3RA 4MK3A 5CNWA 3CBUA 3F6DA 4XS6A 1DE2A 5JWOB 1A2MA 4KAEA 3KJYA 3K8NA 2KP1A 1K0NA 1AUCA 4MZWA 3FR6A 4Z2UA 1EV4A 2F3MA 4MPFA 4MJBA 3PGTA 1TP9A 1B48A 1E2YA 3LYKA 4OFTA 3FW2A 4OWYA 2HSYA 4D73B 3L0HA 3A5IA 3F63A 3VFIA 4MJEA 4K7IA 4L0UA 2EC4A 2K6VA 3VLNA 4HQSA 3TKSE 2YV9A 3QR6A 1LJRA 5B8BA 4RI7A 1SK1A 3QCPA 4DSRA 1OVNA 3CXGA 3PPUA 4ZXGA 1GLQA 1X9SB 5H5RA 1QK8A 2YWIA 3EMXA 1MDJA 3UVHA 1OE7A 1ON4A 2CVDA 1V98A 4PX1A 3GTUB 5CRGA 4F03A 5IPHA 4RI6A 1YF0A 2XBIA 2YANA 2WGRA 3ZMKA 2DBCA 2DJ2A 1XWCA 4IJ3A 4POLA 2LNTA 5ID2B 3GL3A 3QAVA 2LKUA 3E3EA 3MDKA 5DAKA 1V58A 1GP1A 1PRXA 4XIHA 5JCUA 5EPFA 3EPTA 4F82A 1VF4A 3C7MA 1QUWA 1MTCA 2FWGA 1Z6MA 4I97A 2V32A 1O7UA 3M9KA 5ECKB 1PKWA 1WIKA 4ECIA 3IXRA 1ERVA 4CW9A 2AYTA 4OFNA 3FYGA 5COHA 2HZFA 3BJ5A 3MWHA 1SKSB 3NOFA 5IMFA 3R3EA 1C72A 3GNJA 4ZL9A 3IPZA 1TI1A 2DJ3A 4LL4B 4ZB9A 5KN2A 2B1KA 3APOA 1Q4JA 2DSAA 4BVXB 3GMFA 2PBJA 4ULXA 5G5EA 5J9CA 2KLXA 2GS3A 3G7JA 3ZIVA 4OCFA 5H5SA 4K0GA 1YKAA 4MMMA 4N0VA 12GSA 4O92A 5D93A 1PL2A 4F9ZA 1EGRA 1HYUA 3TJFA 1NM3A 2MBSA 1AXDA 4K7NA 2RM5A 4HI7A 1TU7A 2IIYA 1EWXA 1ABAA 3ED3A 2YJHA 4K0NA 3RHBA 1JLWA 2IFQA 1BJXA 4LLRA 1FVKA 3FZAA 3P2AA 4BA7A 5DVBA 4MJAA 1J0FA 1WJKA 4I2TA 1Y25A 3U6VA 3QFBC 1T00A 4BWQA 3GURA 1B4PA 1GTAA 3EU3A 1QGVA 5ECQB 2HRFA 3F8UA 2JZSA 2FA8A 1K0OA 2NTOA 2GSRA 4K1FA 3GV1A 3EC3A 3TJBA 5IO2A 4NAXA 2EIQA 3A5WA 3ZMLA 3MSZA 3KZQA 3S9FA 3PH9A 1B9XC 1SYRA 4EF0A 3RPNA 3HY2A 4N10A 1WRYA 3ME8A 1ZMAA 6GSYA 5KEJA 2A4VA 3MAKA 4BL7B 1BAYA 4L0WA 4HOJA 4ZBDA 3GSSA 5FT3A 1TK5B 4TOPA 1GSYA 1QXHA 3HJPA 5DQSA 4ECJA 4PXOA 1X5DA 4HZ4A 4J2FA 1IYIA 4KH7A 4L5OA 4MF6A 3UARA 1B8XA 3VPQA 1NW2A 2X8GA 3W8SA 2F8AA 2JSYA 4HJ2A 5C00A 3APQA
chains in the Genus database with same CATH topology
2CVBA 2Z9SA 4O7HA 4ISDA 1OC8A 1AAZA 2ON5A 4MLYA 1M9AA 1ML6A 5JWQB 2XPEA 1FW1A 4Z7XA 1XZOA 2H71A 3BD2A 3LW9A 2A2PA 4XHMA 1VF1A 1GL8A 5L71A 4ML6A 3FZ9A 2C0FA 3UJ1A 3WD6A 4F0BA 4V2LA 3NIVA 2YWNA 4YQVA 3CRTA 1PKZA 1SYXA 4ZBAA 1EP7A 1J9BA 2VCZA 5JCGA 1TRSA 2ZUPA 3UEMA 3UIWA 1DSBA 1SL2B 1EOHA 1JZRA 5DBQA 1PN9A 2O87A 1TKDB 1USBA 5HR2A 3KGKA 3TCOA 4WR4A 4WBRD 3QDNA 1DE1A 2EIRA 2LQQA 2C0GA 2R4VA 1NHOA 4TVEA 4GSSA 3MYDA 1AQWA 4GXZA 2R0CA 2O7KA 1PD21 1V9WA 3D21A 4IQAA 4OD7A 3H93A 4CDOA 2QSIA 4POKA 6GSTA 1W4VA 2VL2A 2R5GA 2XPDA 2OACA 2AUVA 6GSXA 5CYYA 1A8LA 4ICYA 2TRXA 3QMXA 2GQMA 2FNOA 3G9BA 3ZIJA 4IN0A 1EP8A 4F2IA 3WGDA 4A5PA 2H01A 4YAPA 4KDUA 3CSJA 1MEKA 4ECBA 1TW9A 3ZL5A 1GTBA 2BMXA 3ZYWA 2NDOA 2V41A 4Q5FA 5G30A 3GA4A 1Y6EA 3LFLA 4X43A 1SD8A 2IJYA 4MABA 4ZL8A 3VWVA 1SK2A 1SK0A 2M46A 1ZZYA 1MDIA 3O6TA 2A2SA 2I81A 4GF0A 4X1UA 2C1YA 4KCEA 4H86A 3L78A 1B4QA 5E59A 1GULA 1ZCPA 1B9YC 1QQ2A 3C71A 4RUVA 3ZFLA 4MZCA 3QPMA 1R4WA 3U5RE 2HI7A 2E2GA 4HU7A 4PTSA 2X49A 4KB3A 2CAQA 1LU4A 2H19A 4GCIA 1GUKA 5EVOA 3IE3A 4EO3A 5ECRB 4K5SA 1TOFA 4V2MA 2LEGA 2PMTA 5BMUA 4NHZA 3KXOA 3NZNA 4OMVA 2GZPA 2MBTA 1SJIA 3HVXA 2GVPA 1H4OA 1RK4A 1N2AA 2LUSA 4TR0A 2H8LA 3BOAA 1U87A 1YQ1A 1SL0B 2DJ0A 3A2XA 4YQMA 3FRCA 3C1RA 4KE3A 3WT1A 2B1LA 1N8JA 2N5AA 2L4CA 2VCXA 1K3LA 3L4NA 5LCZA 3RBTA 2MMNA 3ERGA 1FAAA 1ZYEA 5ENUA 4CHSA 1MD4A 3DGQA 2VOCA 2I3YA 4ZL7A 3IHQA 1ACVA 2GSSA 1WP0A 3BCKA 4RQXA 3DMLA 3N5OA 2L5OA 2VCVA 4IW9A 4GQCA 1TK0B 1OC9B 2V6OA 2E0QA 4G10A 3FR9A 3H79A 1GSEA 3DVWA 2HSMA 5J3RA 4J57E 1OC3A 3UVTA 1OKDA 2CZ3A 2R6KA 1KEBA 2YZUA 2V2GA 1S3CA 3HHVA 3LJRA 1WMJA 4NPBA 1GSUA 2H74A 2XHFA 2HLSA 1OE8A 4HQZA 4KDYA 4ID0A 2OE1A 3KMOA 2H1GA 1I5GA 3GRXA 3HD5A 2VUPA 1ZGNA 5B8AA 5KN1A 4KDXA 3I9V2 3F9UA 3EYTA 3ERFA 2N5BA 3DYRA 3P90A 2P31A 4WXTA 2R37A 3ERWA 3PINA 2MMAA 1R7HA 3VWXA 2M72A 4F0CA 3L9VA 3TJKA 3H8QA 3M9JA 3DIEA 3IC8A 1M2BA 1SKRB 1R5AA 3GYKA 3ZREA 5G31A 3R2QA 5IMDA 4WEYA 2TIRA 1FHEA 2OE0A 1M2AA 3FK8A 2LRNA 2IMFA 1A2JA 2QGVA 1WPIA 2I1UA 2WJUA 2LRTA 4WF4A 3DKSA 1QFNA 5GAND 2YCDA 1TXXA 4GTUA 1A23A 1V40A 1FVJA 4OO4A 4E8EA 1ZYQB 4AJ7A 2CAIA 3RAZA 2GQLA 1BEDA 3FZ4A 5C04A 2WFCA 5AISA 4ECCA 1ERUA 4CY8A 5CO3A 3ZVJA 3KTLA 2L59A 1BYEA 2HRAA 2PPTA 3GHAA 3RPPA 4MPGA 1Z6NA 4OFMA 3HKRA 4NV5A 1U3IA 2WS2A 4LMVA 3ZITA 2E2MA 5IM9A 1XOAA 16GSA 1H75A 2IMIA 3DD3A 2X8HA 2FGXA 1RW1A 4DEJA 2LNSA 2GSQA 2DMMA 6GSSA 2HZEA 1R26A 2JZRA 3DEXA 1URMA 2VM2A 2MYGA 2OE3A 2A4HA 4EIPA 1JZWA 1S3DA 1T1VA 4DSQA 3IDVA 4O32A 4XTSA 5GZZB 1S3AA 2NBSA 2XBQA 2FUG2 2RUEA 2P5RA 3GH6A 3WYWA 3UMAA 4YKGA 2C3QA 1F3BA 1RQMA 2H73A 3GX0A 4G2EA 3CRUA 5A4WA 3IAM2 4MDCA 2IL3A 4NXIA 4EL1A 4TR3A 4TR1B 1FB0A 2B7KA 3W6GA 4KSOA 3L9UA 1YJ6A 3GL5A 2GDRA 3F4RA 5G5FA 5ECMB 2H1DA 1AIUA 1TJDA 5IPGA 4PQ1A 5J4UA 5F07A 2EIOA 4D73A 3M1GA 1GH2A 2FCHA 2PERA 2J9HA 2GGTA 2TRCP 1PL1A 3CTGA 6GSVA 3IBHA 3UBLA 3AY8A 4V1Ag 4IGJA 2RM6A 3TUEA 3GSTA 5B6MA 4FH8A 5IQYA 2GZZA 2OBKA 4FYCA 4EIQA 1M9BA 2PGTA 4PUFC 1EGOA 3ZTLA 4MH2A 1XVQA 3TB2A 2GSTA 1HQOA 4ILFA 4Z2RA 8GSSA 5D96A 5JWRB 2H6YA 4KF9A 2P5QA 4FYBA 1BX9A 2MZCA 1ERTA 2K9FA 2L57A 2H72A 2X99A 4TR4A 4MCUA 1G6WA 3GTUA 2DJ1A 3ZVJD 1GSFA 3C8EA 4N0ZA 1XFLA 2L6DA 2VLTA 3D22A 3GKMA 2QA1A 1TTZA 1O8WA 1GUHA 5ID2A 1AW9A 1ZOFA 3EURA 3IC4A 5J5NA 5G2ZA 1PN0A 5KOWA 2WCIA 3M8NA 1TRUA 1YDKA 2OADA 4XS4B 3J7Yk 3KP9A 1GTUA 2RUFA 3ZZXA 3VURA 4GQFA 1A24A 2HE3A 3I43A 1GSSA 2HYXA 2YV7A 2ON7A 5AGYA 1TRVA 1XCCA 3GIXA 3TOTA 2PVQA 2DC5A 1GTIA 2DJJA 4JBBA 2CZ2A 2WULA 3KEBA 3EWLA 2DIZA 2GTUA 2OA7A 3C73A 4BVXA 5IIZA 2LJKA 1WOUA 4JE1A 4MJCA 4EVMA 2M80A 2LV3A 2HRKA 3VI7A 3D5JA 2LSTA 5ELAA 5F05A 5IMAA 5F8BA 1HNAA 4HZ2A 3IA1A 1YEPA 4BPYA 1XWAA 2MMZA 1I9DA 3IV4A 5AIXA 2ZCTA 3UBKA 2LJAA 1DUGA 5HQPA 2YWMA 2VM1A 5DJLA 1GNWA 3P7XA 3ME7A 1TRWA 5CRHA 2YNXA 1AQXA 4G19A 1XW9A 4O5QA 3E9JB 1FOHA 5GAPD 2L6CA 1Q98A 1O73A 4YH2A 1ZYNA 5DAKB 5D9VA 1XPVA 1THXA 3GN3A 2IN3A 5AN1A 1K0MA 4KA0A 2ZNMA 3H4KA 2H1BA 2YPMA 2FWFA 2WZ9A 3O76A 1Z7RA 5EY6A 1SJ6A 1WWJA 3MIXA 3TGZA 4TXVA 2PVOC 2NPBA 1YY7A 3WGXA 1GSDA 2R0PA 5CREA 3C1SA 3QFAC 4FIWA 2FD3A 3DXBA 2E7PA 2B5EA 4EE0A 1JZDA 2HT9A 1TK8B 3TKSC 3UOMA 4NHWA 5J9BA 4LL1B 4K2DA 1GUMA 3JCML 1AC1A 3F4SA 1F37A 4IJIA 4BL7A 2C3TA 4ZB6A 1GSQA 2DKIA 3FZ5A 4TRXA 5DQYA 2H0IA 17GSA 4G0KA 1HNBA 1Z5YE 3VPTA 2VCWA 3CMIA 5HFIA 4PGTA 4WETA 4I8BA 3TJGA 3KP8A 5B6NA 3DRNA 4X0XA 3M0FA 2H0GA 1A8YA 3D6IA 3LWAA 4ZIJA 11GSA 2H75A 3N9JA 4JR4A 1PQNA 1XWGA 5ELGA 1Z9HA 4AJ6A 2J23A 3EMPA 4G9HA 3KCMA 4TW5A 3KTBA 2IPAA 5ECOB 3ISOA 1HD2A 5ECPB 2IFQB 3L9SA 2LRCA 3UL3A 4XCSA 1T3BA 4OO5A 5DCGA 2I9HA 2JU5A 1A2LA 4IBPA 5DCHA 4MF5A 2K8SA 2P0GA 4E8HA 5D9TA 1PMTA 2D2ZA 3QAWA 4XS4A 3D4TA 2AHEA 18GSA 1U88A 3IRAA 2KUCA 5A4VA 1V57A 4IP1A 4L8EA 4X4JA 1O85A 1XW5A 4IELA 1EEJA 1BG5A 2C3NA 4FO5A 1T7PB 5HR3A 2VLVA 3TRPA 2WRTA 5G1LA 3GKKA 4PUAA 2VD1A 1G0TA 1K3OA 5CP1A 2AAWA 3TJJA 5F0GA 3EINA 4MH3A 1YZXA 4HJMA 2GT6A 1M2DA 4NMUA 2G2QA 5HR0A 4DSSB 1XWBA 4Q5RA 3KIJA 1UN2A 4TXOB 4PQHA 1A0RP 1EZKA 3VWUA 1G6YA 1TI3A 5KN3A 3LYPA 4XRAA 4Q5NA 1NHYA 2FY6A 4KSMA 1E6BA 1SKWB 1EEMA 4KNDA 2H6XA 3HZ4A 1ERWA 2FWEA 3BBYA 2B5XA 1TDIA 3D4MA 3IHGA 3TKSA 2X8CA 3HCZA 5J41A 3WT2A 5AIVA 5H5QA 2K8VA 1Z7PA 1X5EA 1XBSA 2JADA 1FG4A 1MDKA 1FB6A 3D0ZA 2H70A 3Q19A 4EXJA 2GZYA 5CRDA 2LQOA 5HFKA 2C0DA 5E4WA 2QKEA 2HRNA 1F9MA 4LA1A 1SENA 4JR6A 1XVWA 2I4AA 1NSWA 2ES7A 2RLIA 1PX7A 1UA5A 1VF3A 4AF2A 2GQKA 3EE2A 2VD0A 2IMKA 3TRQA 3A3TA 2REMA 1KBNA 5IMZA 3FY7A 2LJRA 4EDZA 2HXKA 3HA9A 2F9SA 4G0IA 3WGEA 4GSNA 2N5FA 3LXZA 2VO4A 3Q74A 2IWTA 4HUAA 3TOUA 5CAXA 3KM6A 2OKAA 2VCQA 2H6ZA 22GSA 4N30A 5G1KA 4GWRA 2KOKA 4K8MA 2G0FA 3QD9A 4N11A 1K3YA 1F2EA 5KN0A 1X9MB 5DJMA 2DKHA 1OKTA 5JCWA 3GUSA 3TDGA 1FO5A 1M99A 5LD0A 2H0HA 4K5RA 2NVLA 4PNFA 1G7OA 4KCAA 1U6TA 3FEUA 1O6JA 5HR1A 1F6MC 5BRTA 1T4YA 2B7JA 1PA3A 5DALB 1SL1B 2AB6A 2DJKA 2CA8A 1XXUA 1K0CA 2O89A 2A2RA 1OC9A 2C80A 3M3MA 4MA9A 3IAS2 4IS0A 2IMEA 3HXSA 2C8UA 3Q6OA 3EU4A 3LG6A 1U3AA 3IK7A 2CX3A 1CQHA 1VF2A 3IR4A 1M0UA 1ST9A 3FHKA 1FOVA 1QMVA 3P8WA 2B6MA 2WDUA 2VL9A 3LXTA 2YJ7A 4GLTA 4WKWA 2VL2C 3MNGA 3US3A 3GH9A 4NV2A 3TKRA 1XWKA 3TKPA 1SJZA 2L5LA 2CX4A 4POBA 5F06A 2XC2A 5HFGA 4BWSA 4QL7A 3GKXA 3HZ8A 2AV4A 2JACA 1ILOA 1Z3EA 1GNEA 6GSUA 4YQUA 4HEA2 2HFDA 3DVXA 5INYA 5KOXA 3F6FA 4JU5A 4HS1A 3GKNA 4RQRA 2FHEA 4WR5A 5A5KA 4GRFA 4OCEA 5ECHB 1K0BA 3ZFBA 4HDEA 2JZTA 2QA2A 2QC7A 1CQGA 4XS1A 7GSSA 5LNKe 4PNGA 4DSSA 3LEFA 5ECSA 2F8FA 2CT6A 3BCIA 4TXOA 2C4JA 4HU9A 4EKZA 5CRWA 2K18A 4MNNA 4Q5QA 2PU9C 4CY6A 1JHBA 4MP4A 3CTFA 2MMOA 5IOXA 3V1WA 3I69A 2DLXA 1SD9A 1K0DA 5IMCA 3EVIA 3O3TA 4YKFA 3F4TA 1LBKA 2KHPA 3ZLPA 3KH7A 4ML1A 4IKHA 5D9WA 4BVYB 1R5PA 4V1Ap 4KW6A 4POMA 3LGCA 4KUNA 2FLSA 2F51A 3APSA 4FYUA 1YF1A 3F3QA 2YP6A 4K9ZA 2ALBA 4ZILA 2X4AA 3TRXA 4I5QA 3F3RA 5ABRA 2VL3A 1EOGA 2FA4A 1G7EA 1XW6A 1EV9A 3F0IA 4YAVA 4QQ7A 2HSHA 4PURA 2RIIA 5EL8A 2VIMA 2PUKC 3HYPA 2FWHA 3HJOA 3A2VA 2H1AA 1K0AA 5D8IA 2VCTA 4KX4A 2BTOT 3QAGA 4TN8A 2YOIA 3VI5A 4XRDA 3RHCA 3Q18A 1GRXA 1X0RA 3QOUA 5FHIA 1KNGA 2BJXA 3LORA 2LS5A 4IQ1A 2V1MA 1VGLA 1OYJA 1XOBA 5ECLB 3SBCA 3ZRDA 4JEDA 2YZHA 4KGIA 4QL9A 1GLPA 4J56E 2O8VB 2OJLA 1BQ7A 3LQ7A 1X9WB 19GSA 4AGSA 4MF7A 5DALA 1M7TA 3FMWA 2PN8A 4FQUA 4G0LA 3HDCA 2VAFA 1JFUA 2AJQB 2KP2A 3CSHA 4TKYA 1J08A 4L5LA 5D73A 2O85A 4Z2TA 2YWOA 1ZL9A 2DIYA 2R2JA 5B7CA 1A0FA 3DWVA 4O5UA 4EUYA 2JSZA 3W8JA 2L4QA 4K7OA 1OAZA 2IMDA 4WF5A 4TR1A 1T4ZA 6GSWA 3J7Yb 1WE0A 9GSSA 3VK9A 5ECNB 1DBYA 4V2NA 5ECIB 2V6KA 3UAPA 3E0UA 4MZBA 1PGTA 2VLUA 4JZQA 2GT5A 4ACSA 1TU8A 3VWWA 1HNCA 4DVCA 2H30A 14GSA 2B3SA 3IK9A 3FR3A 1F3AA 4I2UA 5A4UA 3GFKA 2R3XA 1GWCA 4EC0A 5DDLA 1KTEA 1YEXA 3G7YA 4NWYA 3PR8A 1PSQA 1O81A 1IYHA 3H1NA 2R0GA 5IO0A 1MD3A 3KH9A 5FWGA 2C0EA 2DMLA 4K6XA 1XIYA 3G7IA 3HJMA 3OR5A 3CYNA 3KD0A 1JLVA 1UC7A 1T8EB 2UZ8A 2LTKA 3IOSA 2X64A 1ZYPA 1W89A 3I6AA 2JL4A 3HVVA 2HZEB 2H76A 5IMVA 4USSA 2OBIA 2WB9A 1PX6A 20GSA 4P3YB 3HVSA 3CSIA 3RDWA 10GSA 2CQ9A 4JRRA 4WBJA 3GX8A 5IOWA 1V2AA 5GSTA 1YKCA 4ZB8A 1X5CA 2CVKA 2GLRA 2H66A 3KMNA 3A2WA 4I6XA 4LMWA 2CV4A 4EDYA 2B5YA 3FKFA 4AJ8A 4IP6A 1THOA 2YN1A 5GSSA 4O5RA 4IVFA 3LSZA 1AQVA 4GSTA 1VRSD 2PWJA 4IHUA 5D9XA 4PQIA 1O8XA 1SU9A 13GSA 4BVYA 3SWLA 1UVZA 2HNLA 4ZBBA 4K2XA 1JZOA 3TKQA 4MK3A 5CNWA 3CBUA 3F6DA 4XS6A 1DE2A 5JWOB 1A2MA 4KAEA 3KJYA 3K8NA 2KP1A 1K0NA 1AUCA 4MZWA 3FR6A 4Z2UA 1EV4A 2F3MA 4MPFA 4MJBA 3PGTA 1TP9A 1B48A 1E2YA 3LYKA 4OFTA 3FW2A 4OWYA 2HSYA 4D73B 3L0HA 3A5IA 3F63A 3VFIA 4MJEA 4K7IA 4L0UA 2EC4A 2K6VA 3VLNA 4HQSA 3TKSE 2YV9A 3QR6A 1LJRA 5B8BA 4RI7A 1SK1A 3QCPA 4DSRA 1OVNA 3CXGA 3PPUA 4ZXGA 1GLQA 1X9SB 5H5RA 1QK8A 2YWIA 3EMXA 1MDJA 3UVHA 1OE7A 1ON4A 2CVDA 1V98A 4PX1A 3GTUB 5CRGA 4F03A 5IPHA 4RI6A 1YF0A 2XBIA 2YANA 2WGRA 3ZMKA 2DBCA 2DJ2A 1XWCA 4IJ3A 4POLA 2LNTA 5ID2B 3GL3A 3QAVA 2LKUA 3E3EA 3MDKA 5DAKA 1V58A 1GP1A 1PRXA 4XIHA 5JCUA 5EPFA 3EPTA 4F82A 1VF4A 3C7MA 1QUWA 1MTCA 2FWGA 1Z6MA 4I97A 2V32A 1O7UA 3M9KA 5ECKB 1PKWA 1WIKA 4ECIA 3IXRA 1ERVA 4CW9A 2AYTA 4OFNA 3FYGA 5COHA 2HZFA 3BJ5A 3MWHA 1SKSB 3NOFA 5IMFA 3R3EA 1C72A 3GNJA 4ZL9A 3IPZA 1TI1A 2DJ3A 4LL4B 4ZB9A 5KN2A 2B1KA 3APOA 1Q4JA 2DSAA 4BVXB 3GMFA 2PBJA 4ULXA 5G5EA 5J9CA 2KLXA 2GS3A 3G7JA 3ZIVA 4OCFA 5H5SA 4K0GA 1YKAA 4MMMA 4N0VA 12GSA 4O92A 5D93A 1PL2A 4F9ZA 1EGRA 1HYUA 3TJFA 1NM3A 2MBSA 1AXDA 4K7NA 2RM5A 4HI7A 1TU7A 2IIYA 1EWXA 1ABAA 3ED3A 2YJHA 4K0NA 3RHBA 1JLWA 2IFQA 1BJXA 4LLRA 1FVKA 3FZAA 3P2AA 4BA7A 5DVBA 4MJAA 1J0FA 1WJKA 4I2TA 1Y25A 3U6VA 3QFBC 1T00A 4BWQA 3GURA 1B4PA 1GTAA 3EU3A 1QGVA 5ECQB 2HRFA 3F8UA 2JZSA 2FA8A 1K0OA 2NTOA 2GSRA 4K1FA 3GV1A 3EC3A 3TJBA 5IO2A 4NAXA 2EIQA 3A5WA 3ZMLA 3MSZA 3KZQA 3S9FA 3PH9A 1B9XC 1SYRA 4EF0A 3RPNA 3HY2A 4N10A 1WRYA 3ME8A 1ZMAA 6GSYA 5KEJA 2A4VA 3MAKA 4BL7B 1BAYA 4L0WA 4HOJA 4ZBDA 3GSSA 5FT3A 1TK5B 4TOPA 1GSYA 1QXHA 3HJPA 5DQSA 4ECJA 4PXOA 1X5DA 4HZ4A 4J2FA 1IYIA 4KH7A 4L5OA 4MF6A 3UARA 1B8XA 3VPQA 1NW2A 2X8GA 3W8SA 2F8AA 2JSYA 4HJ2A 5C00A 3APQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CVB A;  2Z9S A;  4O7H A;  4ISD A;  1OC8 A;  1AAZ A;  2ON5 A;  4MLY A;  1M9A A;  1ML6 A;  5JWQ B;  2XPE A;  1FW1 A;  4Z7X A;  1XZO A;  2H71 A;  3BD2 A;  4XHM A;  1VF1 A;  1GL8 A;  5L71 A;  4ML6 A;  3FZ9 A;  2C0F A;  3UJ1 A;  3WD6 A;  4F0B A;  4V2L A;  3NIV A;  2YWN A;  4YQV A;  3CRT A;  1PKZ A;  1SYX A;  4ZBA A;  1EP7 A;  1J9B A;  2VCZ A;  5JCG A;  1TRS A;  2ZUP A;  3UEM A;  3UIW A;  1DSB A;  1SL2 B;  1EOH A;  1JZR A;  5DBQ A;  1PN9 A;  2O87 A;  1TKD B;  1USB A;  5HR2 A;  3KGK A;  3TCO A;  4WR4 A;  4WBR D;  3QDN A;  1DE1 A;  2EIR A;  2LQQ A;  2C0G A;  2R4V A;  1NHO A;  4TVE A;  4GSS A;  1AQW A;  4GXZ A;  2O7K A;  1PD2 1;  1V9W A;  3D21 A;  4IQA A;  4OD7 A;  3H93 A;  4CDO A;  2QSI A;  4POK A;  6GST A;  1W4V A;  2VL2 A;  2R5G A;  2XPD A;  2OAC A;  2AUV A;  6GSX A;  5CYY A;  1A8L A;  2TRX A;  3QMX A;  2GQM A;  2FNO A;  3G9B A;  3ZIJ A;  4IN0 A;  1EP8 A;  4F2I A;  3WGD A;  2H01 A;  4YAP A;  4KDU A;  3CSJ A;  1MEK A;  4ECB A;  1TW9 A;  3ZL5 A;  1GTB A;  2BMX A;  3ZYW A;  2NDO A;  2V41 A;  4Q5F A;  5G30 A;  3GA4 A;  1Y6E A;  3LFL A;  4X43 A;  1SD8 A;  2IJY A;  4MAB A;  4ZL8 A;  3VWV A;  1SK2 A;  1SK0 A;  2M46 A;  1ZZY A;  1MDI A;  3O6T A;  2A2S A;  2I81 A;  4GF0 A;  4X1U A;  2C1Y A;  4KCE A;  4H86 A;  3L78 A;  1B4Q A;  5E59 A;  1GUL A;  1ZCP A;  1B9Y C;  1QQ2 A;  3C71 A;  4RUV A;  3ZFL A;  4MZC A;  3QPM A;  1R4W A;  3U5R E;  2HI7 A;  2E2G A;  4HU7 A;  4KB3 A;  2CAQ A;  1LU4 A;  2H19 A;  4GCI A;  1GUK A;  5EVO A;  3IE3 A;  4EO3 A;  5ECR B;  1TOF A;  4V2M A;  2LEG A;  2PMT A;  4NHZ A;  3KXO A;  3NZN A;  4OMV A;  2GZP A;  2MBT A;  1SJI A;  3HVX A;  2GVP A;  1H4O A;  1RK4 A;  1N2A A;  2LUS A;  4TR0 A;  2H8L A;  3BOA A;  1U87 A;  1YQ1 A;  1SL0 B;  2DJ0 A;  3A2X A;  4YQM A;  3FRC A;  3C1R A;  4KE3 A;  3WT1 A;  2B1L A;  1N8J A;  2N5A A;  2L4C A;  2VCX A;  1K3L A;  3L4N A;  5LCZ A;  3RBT A;  2MMN A;  3ERG A;  1FAA A;  1ZYE A;  5ENU A;  4CHS A;  1MD4 A;  3DGQ A;  2VOC A;  2I3Y A;  4ZL7 A;  3IHQ A;  1ACV A;  2GSS A;  1WP0 A;  3BCK A;  4RQX A;  3DML A;  3N5O A;  2L5O A;  2VCV A;  4IW9 A;  4GQC A;  1TK0 B;  1OC9 B;  2V6O A;  2E0Q A;  4G10 A;  3FR9 A;  3H79 A;  1GSE A;  3DVW A;  5J3R A;  4J57 E;  1OC3 A;  3UVT A;  1OKD A;  2CZ3 A;  2R6K A;  1KEB A;  2YZU A;  2V2G A;  1S3C A;  3HHV A;  3LJR A;  1WMJ A;  4NPB A;  1GSU A;  2H74 A;  2XHF A;  2HLS A;  1OE8 A;  4HQZ A;  4KDY A;  4ID0 A;  2OE1 A;  3KMO A;  2H1G A;  1I5G A;  3GRX A;  3HD5 A;  2VUP A;  1ZGN A;  5B8A A;  5KN1 A;  4KDX A;  3I9V 2;  3F9U A;  3EYT A;  3ERF A;  2N5B A;  3DYR A;  3P90 A;  2P31 A;  4WXT A;  2R37 A;  3ERW A;  3PIN A;  2MMA A;  1R7H A;  3VWX A;  2M72 A;  4F0C A;  3L9V A;  3TJK A;  3H8Q A;  3M9J A;  3DIE A;  1M2B A;  1SKR B;  1R5A A;  3GYK A;  3ZRE A;  5G31 A;  3R2Q A;  5IMD A;  4WEY A;  2TIR A;  1FHE A;  2OE0 A;  1M2A A;  3FK8 A;  2LRN A;  2IMF A;  1A2J A;  2QGV A;  1WPI A;  2I1U A;  2WJU A;  2LRT A;  4WF4 A;  3DKS A;  1QFN A;  5GAN D;  2YCD A;  1TXX A;  4GTU A;  1A23 A;  1V40 A;  1FVJ A;  4OO4 A;  4E8E A;  1ZYQ B;  4AJ7 A;  2CAI A;  3RAZ A;  2GQL A;  1BED A;  3FZ4 A;  5C04 A;  2WFC A;  5AIS A;  4ECC A;  1ERU A;  5CO3 A;  3ZVJ A;  3KTL A;  2L59 A;  1BYE A;  2PPT A;  3GHA A;  3RPP A;  4MPG A;  1Z6N A;  4OFM A;  3HKR A;  4NV5 A;  1U3I A;  2WS2 A;  4LMV A;  3ZIT A;  2E2M A;  5IM9 A;  1XOA A;  16GS A;  1H75 A;  2IMI A;  3DD3 A;  2X8H A;  2FGX A;  1RW1 A;  4DEJ A;  2LNS A;  2GSQ A;  2DMM A;  6GSS A;  2HZE A;  1R26 A;  2JZR A;  3DEX A;  1URM A;  2VM2 A;  2MYG A;  2OE3 A;  1JZW A;  1S3D A;  1T1V A;  4DSQ A;  3IDV A;  4O32 A;  4XTS A;  5GZZ B;  1S3A A;  2NBS A;  2XBQ A;  2FUG 2;  2RUE A;  2P5R A;  3GH6 A;  3WYW A;  3UMA A;  2C3Q A;  1F3B A;  1RQM A;  2H73 A;  3GX0 A;  4G2E A;  3CRU A;  5A4W A;  3IAM 2;  4MDC A;  2IL3 A;  4NXI A;  4EL1 A;  4TR3 A;  4TR1 B;  1FB0 A;  2B7K A;  3W6G A;  4KSO A;  3L9U A;  1YJ6 A;  3GL5 A;  2GDR A;  3F4R A;  5G5F A;  5ECM B;  2H1D A;  1AIU A;  1TJD A;  5IPG A;  4PQ1 A;  5J4U A;  5F07 A;  2EIO A;  4D73 A;  3M1G A;  1GH2 A;  2FCH A;  2PER A;  2J9H A;  2GGT A;  2TRC P;  1PL1 A;  3CTG A;  6GSV A;  3IBH A;  3UBL A;  3AY8 A;  4V1A g;  4IGJ A;  2RM6 A;  3TUE A;  3GST A;  5B6M A;  4FH8 A;  5IQY A;  2GZZ A;  2OBK A;  4FYC A;  1M9B A;  2PGT A;  4PUF C;  1EGO A;  3ZTL A;  4MH2 A;  1XVQ A;  3TB2 A;  2GST A;  1HQO A;  4ILF A;  8GSS A;  5D96 A;  5JWR B;  2H6Y A;  2P5Q A;  4FYB A;  1BX9 A;  2MZC A;  1ERT A;  2K9F A;  2L57 A;  2H72 A;  2X99 A;  4TR4 A;  4MCU A;  1G6W A;  3GTU A;  2DJ1 A;  3ZVJ D;  1GSF A;  3C8E A;  4N0Z A;  1XFL A;  2L6D A;  2VLT A;  3D22 A;  3GKM A;  1TTZ A;  1O8W A;  1GUH A;  5ID2 A;  1AW9 A;  1ZOF A;  3EUR A;  3IC4 A;  5J5N A;  5G2Z A;  2WCI A;  3M8N A;  1TRU A;  1YDK A;  2OAD A;  4XS4 B;  3J7Y k;  3KP9 A;  1GTU A;  2RUF A;  3ZZX A;  3VUR A;  4GQF A;  1A24 A;  2HE3 A;  3I43 A;  1GSS A;  2HYX A;  2YV7 A;  2ON7 A;  5AGY A;  1TRV A;  1XCC A;  3GIX A;  3TOT A;  2PVQ A;  2DC5 A;  1GTI A;  2DJJ A;  4JBB A;  2CZ2 A;  2WUL A;  3KEB A;  3EWL A;  2DIZ A;  2GTU A;  2OA7 A;  3C73 A;  4BVX A;  5IIZ A;  2LJK A;  1WOU A;  4JE1 A;  4MJC A;  4EVM A;  2M80 A;  2LV3 A;  3VI7 A;  3D5J A;  2LST A;  5ELA A;  5F05 A;  5IMA A;  5F8B A;  1HNA A;  4HZ2 A;  3IA1 A;  1YEP A;  4BPY A;  1XWA A;  2MMZ A;  1I9D A;  3IV4 A;  5AIX A;  2ZCT A;  3UBK A;  2LJA A;  1DUG A;  5HQP A;  2YWM A;  2VM1 A;  5DJL A;  1GNW A;  3P7X A;  3ME7 A;  1TRW A;  5CRH A;  2YNX A;  1AQX A;  4G19 A;  1XW9 A;  3E9J B;  5GAP D;  2L6C A;  1Q98 A;  1O73 A;  4YH2 A;  5DAK B;  5D9V A;  1XPV A;  1THX A;  3GN3 A;  2IN3 A;  5AN1 A;  1K0M A;  4KA0 A;  2ZNM A;  3H4K A;  2H1B A;  2YPM A;  2FWF A;  2WZ9 A;  3O76 A;  1Z7R A;  5EY6 A;  1SJ6 A;  1WWJ A;  3TGZ A;  4TXV A;  2PVO C;  2NPB A;  1YY7 A;  3WGX A;  1GSD A;  5CRE A;  3C1S A;  3QFA C;  4FIW A;  2FD3 A;  3DXB A;  2E7P A;  2B5E A;  4EE0 A;  1JZD A;  2HT9 A;  1TK8 B;  3TKS C;  3UOM A;  4NHW A;  5J9B A;  4LL1 B;  4K2D A;  1GUM A;  3JCM L;  1AC1 A;  3F4S A;  1F37 A;  4IJI A;  4BL7 A;  2C3T A;  4ZB6 A;  1GSQ A;  3FZ5 A;  4TRX A;  5DQY A;  2H0I A;  17GS A;  1HNB A;  1Z5Y E;  3VPT A;  2VCW A;  3CMI A;  5HFI A;  4PGT A;  4WET A;  4I8B A;  3TJG A;  3KP8 A;  5B6N A;  3DRN A;  4X0X A;  3M0F A;  2H0G A;  1A8Y A;  3D6I A;  3LWA A;  4ZIJ A;  11GS A;  2H75 A;  3N9J A;  4JR4 A;  1PQN A;  1XWG A;  5ELG A;  1Z9H A;  4AJ6 A;  2J23 A;  3EMP A;  4G9H A;  3KCM A;  4TW5 A;  3KTB A;  2IPA A;  5ECO B;  3ISO A;  1HD2 A;  5ECP B;  2IFQ B;  3L9S A;  2LRC A;  3UL3 A;  4XCS A;  1T3B A;  4OO5 A;  5DCG A;  2I9H A;  2JU5 A;  1A2L A;  4IBP A;  5DCH A;  4MF5 A;  2K8S A;  2P0G A;  4E8H A;  5D9T A;  1PMT A;  2D2Z A;  3QAW A;  4XS4 A;  3D4T A;  2AHE A;  18GS A;  1U88 A;  3IRA A;  2KUC A;  5A4V A;  1V57 A;  4IP1 A;  4L8E A;  1O85 A;  1XW5 A;  4IEL A;  1EEJ A;  1BG5 A;  2C3N A;  4FO5 A;  1T7P B;  5HR3 A;  2VLV A;  3TRP A;  2WRT A;  5G1L A;  3GKK A;  4PUA A;  2VD1 A;  1G0T A;  1K3O A;  5CP1 A;  2AAW A;  3TJJ A;  5F0G A;  3EIN A;  4MH3 A;  1YZX A;  4HJM A;  2GT6 A;  1M2D A;  4NMU A;  2G2Q A;  5HR0 A;  4DSS B;  1XWB A;  4Q5R A;  3KIJ A;  1UN2 A;  4TXO B;  4PQH A;  1A0R P;  1EZK A;  3VWU A;  1G6Y A;  1TI3 A;  5KN3 A;  3LYP A;  4XRA A;  4Q5N A;  1NHY A;  2FY6 A;  4KSM A;  1E6B A;  1SKW B;  1EEM A;  4KND A;  2H6X A;  3HZ4 A;  1ERW A;  2FWE A;  3BBY A;  2B5X A;  1TDI A;  3D4M A;  3TKS A;  2X8C A;  3HCZ A;  5J41 A;  3WT2 A;  5AIV A;  5H5Q A;  2K8V A;  1Z7P A;  1X5E A;  1XBS A;  2JAD A;  1FG4 A;  1MDK A;  1FB6 A;  3D0Z A;  2H70 A;  3Q19 A;  4EXJ A;  2GZY A;  5CRD A;  2LQO A;  5HFK A;  2C0D A;  5E4W A;  2QKE A;  2HRN A;  1F9M A;  4LA1 A;  1SEN A;  4JR6 A;  1XVW A;  2I4A A;  1NSW A;  2ES7 A;  2RLI A;  1PX7 A;  1UA5 A;  1VF3 A;  4AF2 A;  2GQK A;  3EE2 A;  2VD0 A;  2IMK A;  3TRQ A;  3A3T A;  2REM A;  1KBN A;  5IMZ A;  3FY7 A;  2LJR A;  4EDZ A;  2HXK A;  3HA9 A;  2F9S A;  3WGE A;  4GSN A;  2N5F A;  3LXZ A;  2VO4 A;  3Q74 A;  2IWT A;  4HUA A;  3TOU A;  5CAX A;  3KM6 A;  2OKA A;  2VCQ A;  2H6Z A;  22GS A;  4N30 A;  5G1K A;  4GWR A;  2KOK A;  4K8M A;  2G0F A;  3QD9 A;  4N11 A;  1K3Y A;  1F2E A;  5KN0 A;  1X9M B;  5DJM A;  1OKT A;  5JCW A;  3GUS A;  3TDG A;  1FO5 A;  1M99 A;  5LD0 A;  2H0H A;  2NVL A;  4PNF A;  1G7O A;  4KCA A;  1U6T A;  3FEU A;  1O6J A;  5HR1 A;  1F6M C;  1T4Y A;  2B7J A;  1PA3 A;  5DAL B;  1SL1 B;  2AB6 A;  2DJK A;  2CA8 A;  1XXU A;  1K0C A;  2O89 A;  2A2R A;  1OC9 A;  2C80 A;  3M3M A;  4MA9 A;  3IAS 2;  4IS0 A;  2IME A;  3HXS A;  2C8U A;  3Q6O A;  3EU4 A;  3LG6 A;  1U3A A;  3IK7 A;  2CX3 A;  1CQH A;  1VF2 A;  3IR4 A;  1M0U A;  1ST9 A;  3FHK A;  1FOV A;  1QMV A;  3P8W A;  2B6M A;  2WDU A;  2VL9 A;  3LXT A;  2YJ7 A;  4GLT A;  4WKW A;  2VL2 C;  3MNG A;  3US3 A;  3GH9 A;  4NV2 A;  3TKR A;  1XWK A;  3TKP A;  1SJZ A;  2L5L A;  2CX4 A;  4POB A;  5F06 A;  2XC2 A;  5HFG A;  4BWS A;  4QL7 A;  3GKX A;  3HZ8 A;  2AV4 A;  2JAC A;  1ILO A;  1Z3E A;  1GNE A;  6GSU A;  4YQU A;  4HEA 2;  2HFD A;  3DVX A;  5INY A;  3F6F A;  4JU5 A;  4HS1 A;  3GKN A;  4RQR A;  2FHE A;  4WR5 A;  5A5K A;  4GRF A;  4OCE A;  5ECH B;  1K0B A;  3ZFB A;  4HDE A;  2JZT A;  2QC7 A;  1CQG A;  4XS1 A;  7GSS A;  5LNK e;  4PNG A;  4DSS A;  3LEF A;  5ECS A;  2F8F A;  2CT6 A;  3BCI A;  4TXO A;  2C4J A;  4HU9 A;  4EKZ A;  5CRW A;  2K18 A;  4Q5Q A;  2PU9 C;  1JHB A;  4MP4 A;  3CTF A;  2MMO A;  5IOX A;  3V1W A;  3I69 A;  2DLX A;  1SD9 A;  1K0D A;  5IMC A;  3EVI A;  3O3T A;  3F4T A;  1LBK A;  2KHP A;  3ZLP A;  3KH7 A;  4ML1 A;  4IKH A;  5D9W A;  1R5P A;  4V1A p;  4KW6 A;  4POM A;  3LGC A;  4KUN A;  2FLS A;  2F51 A;  3APS A;  4FYU A;  1YF1 A;  3F3Q A;  2YP6 A;  4K9Z A;  2ALB A;  4ZIL A;  3TRX A;  4I5Q A;  3F3R A;  5ABR A;  2VL3 A;  1EOG A;  2FA4 A;  1G7E A;  1XW6 A;  1EV9 A;  3F0I A;  4YAV A;  4QQ7 A;  2HSH A;  4PUR A;  2RII A;  5EL8 A;  2VIM A;  2PUK C;  3HYP A;  2FWH A;  3HJO A;  3A2V A;  2H1A A;  1K0A A;  5D8I A;  2VCT A;  4KX4 A;  2BTO T;  3QAG A;  4TN8 A;  2YOI A;  3VI5 A;  4XRD A;  3RHC A;  3Q18 A;  1GRX A;  1X0R A;  3QOU A;  5FHI A;  1KNG A;  2BJX A;  3LOR A;  2LS5 A;  4IQ1 A;  2V1M A;  1VGL A;  1OYJ A;  1XOB A;  5ECL B;  3SBC A;  3ZRD A;  4JED A;  2YZH A;  4KGI A;  4QL9 A;  1GLP A;  4J56 E;  2O8V B;  2OJL A;  1BQ7 A;  3LQ7 A;  1X9W B;  19GS A;  4AGS A;  4MF7 A;  5DAL A;  1M7T A;  2PN8 A;  3HDC A;  2VAF A;  1JFU A;  2AJQ B;  2KP2 A;  3CSH A;  4TKY A;  1J08 A;  4L5L A;  5D73 A;  2O85 A;  2YWO A;  1ZL9 A;  2DIY A;  2R2J A;  5B7C A;  1A0F A;  3DWV A;  4EUY A;  2JSZ A;  3W8J A;  2L4Q A;  4K7O A;  1OAZ A;  2IMD A;  4WF5 A;  4TR1 A;  1T4Z A;  6GSW A;  3J7Y b;  1WE0 A;  9GSS A;  3VK9 A;  5ECN B;  1DBY A;  4V2N A;  5ECI B;  2V6K A;  3UAP A;  3E0U A;  4MZB A;  1PGT A;  2VLU A;  4JZQ A;  2GT5 A;  4ACS A;  1TU8 A;  3VWW A;  1HNC A;  4DVC A;  2H30 A;  14GS A;  2B3S A;  3IK9 A;  3FR3 A;  1F3A A;  4I2U A;  5A4U A;  3GFK A;  2R3X A;  1GWC A;  4EC0 A;  5DDL A;  1KTE A;  1YEX A;  3G7Y A;  4NWY A;  3PR8 A;  1PSQ A;  1O81 A;  1IYH A;  3H1N A;  5IO0 A;  1MD3 A;  3KH9 A;  5FWG A;  2C0E A;  2DML A;  4K6X A;  1XIY A;  3G7I A;  3HJM A;  3OR5 A;  3CYN A;  3KD0 A;  1JLV A;  1UC7 A;  1T8E B;  2LTK A;  3IOS A;  2X64 A;  1W89 A;  3I6A A;  2JL4 A;  3HVV A;  2HZE B;  2H76 A;  5IMV A;  2OBI A;  2WB9 A;  1PX6 A;  20GS A;  4P3Y B;  3HVS A;  3CSI A;  3RDW A;  10GS A;  2CQ9 A;  4JRR A;  4WBJ A;  3GX8 A;  5IOW A;  1V2A A;  5GST A;  1YKC A;  4ZB8 A;  1X5C A;  2CVK A;  2GLR A;  2H66 A;  3KMN A;  3A2W A;  4I6X A;  4LMW A;  2CV4 A;  4EDY A;  2B5Y A;  3FKF A;  4AJ8 A;  4IP6 A;  1THO A;  2YN1 A;  5GSS A;  4O5R A;  4IVF A;  3LSZ A;  1AQV A;  4GST A;  1VRS D;  2PWJ A;  4IHU A;  5D9X A;  4PQI A;  1O8X A;  1SU9 A;  13GS A;  4BVY A;  3SWL A;  1UVZ A;  2HNL A;  4ZBB A;  1JZO A;  3TKQ A;  4MK3 A;  5CNW A;  3CBU A;  3F6D A;  4XS6 A;  1DE2 A;  5JWO B;  1A2M A;  4KAE A;  3KJY A;  3K8N A;  2KP1 A;  1K0N A;  1AUC A;  4MZW A;  3FR6 A;  1EV4 A;  2F3M A;  4MPF A;  4MJB A;  3PGT A;  1TP9 A;  1B48 A;  1E2Y A;  3LYK A;  4OFT A;  3FW2 A;  4OWY A;  2HSY A;  4D73 B;  3L0H A;  3F63 A;  3VFI A;  4MJE A;  4K7I A;  4L0U A;  2EC4 A;  2K6V A;  3VLN A;  4HQS A;  3TKS E;  2YV9 A;  3QR6 A;  1LJR A;  5B8B A;  4RI7 A;  1SK1 A;  3QCP A;  4DSR A;  1OVN A;  3CXG A;  4ZXG A;  1GLQ A;  1X9S B;  5H5R A;  1QK8 A;  2YWI A;  3EMX A;  1MDJ A;  3UVH A;  1OE7 A;  1ON4 A;  2CVD A;  1V98 A;  4PX1 A;  3GTU B;  5CRG A;  4F03 A;  5IPH A;  4RI6 A;  1YF0 A;  2XBI A;  2YAN A;  2WGR A;  3ZMK A;  2DBC A;  2DJ2 A;  1XWC A;  4IJ3 A;  4POL A;  2LNT A;  5ID2 B;  3GL3 A;  3QAV A;  2LKU A;  3E3E A;  3MDK A;  5DAK A;  1V58 A;  1GP1 A;  1PRX A;  4XIH A;  5JCU A;  5EPF A;  4F82 A;  1VF4 A;  3C7M A;  1QUW A;  1MTC A;  2FWG A;  1Z6M A;  4I97 A;  2V32 A;  1O7U A;  3M9K A;  5ECK B;  1PKW A;  1WIK A;  4ECI A;  3IXR A;  1ERV A;  4CW9 A;  2AYT A;  4OFN A;  3FYG A;  5COH A;  2HZF A;  3BJ5 A;  3MWH A;  1SKS B;  3NOF A;  5IMF A;  1C72 A;  3GNJ A;  4ZL9 A;  3IPZ A;  1TI1 A;  2DJ3 A;  4LL4 B;  4ZB9 A;  5KN2 A;  2B1K A;  3APO A;  1Q4J A;  2DSA A;  3GMF A;  2PBJ A;  4ULX A;  5G5E A;  5J9C A;  2KLX A;  2GS3 A;  3G7J A;  3ZIV A;  4OCF A;  5H5S A;  4K0G A;  1YKA A;  4MMM A;  4N0V A;  12GS A;  4O92 A;  5D93 A;  1PL2 A;  4F9Z A;  1EGR A;  1HYU A;  3TJF A;  1NM3 A;  2MBS A;  1AXD A;  4K7N A;  2RM5 A;  4HI7 A;  1TU7 A;  2IIY A;  1EWX A;  1ABA A;  3ED3 A;  2YJH A;  4K0N A;  3RHB A;  1JLW A;  2IFQ A;  1BJX A;  4LLR A;  1FVK A;  3FZA A;  3P2A A;  4BA7 A;  5DVB A;  4MJA A;  1J0F A;  1WJK A;  4I2T A;  1Y25 A;  3U6V A;  3QFB C;  1T00 A;  4BWQ A;  3GUR A;  1B4P A;  1GTA A;  3EU3 A;  1QGV A;  5ECQ B;  2HRF A;  3F8U A;  2JZS A;  2FA8 A;  1K0O A;  2NTO A;  2GSR A;  4K1F A;  3GV1 A;  3EC3 A;  3TJB A;  5IO2 A;  4NAX A;  2EIQ A;  3A5W A;  3ZML A;  3MSZ A;  3KZQ A;  3S9F A;  3PH9 A;  1B9X C;  1SYR A;  4EF0 A;  3RPN A;  3HY2 A;  4N10 A;  1WRY A;  3ME8 A;  1ZMA A;  6GSY A;  5KEJ A;  2A4V A;  3MAK A;  1BAY A;  4L0W A;  4HOJ A;  4ZBD A;  3GSS A;  5FT3 A;  1TK5 B;  4TOP A;  1GSY A;  1QXH A;  3HJP A;  5DQS A;  4ECJ A;  4PXO A;  1X5D A;  4HZ4 A;  4J2F A;  1IYI A;  4KH7 A;  4L5O A;  4MF6 A;  3UAR A;  1B8X A;  3VPQ A;  1NW2 A;  2X8G A;  3W8S A;  2F8A A;  2JSY A;  4HJ2 A;  5C00 A;  3APQ A; 
#chains in the Genus database with same CATH topology
 2CVB A;  2Z9S A;  4O7H A;  4ISD A;  1OC8 A;  1AAZ A;  2ON5 A;  4MLY A;  1M9A A;  1ML6 A;  5JWQ B;  2XPE A;  1FW1 A;  4Z7X A;  1XZO A;  2H71 A;  3BD2 A;  3LW9 A;  2A2P A;  4XHM A;  1VF1 A;  1GL8 A;  5L71 A;  4ML6 A;  3FZ9 A;  2C0F A;  3UJ1 A;  3WD6 A;  4F0B A;  4V2L A;  3NIV A;  2YWN A;  4YQV A;  3CRT A;  1PKZ A;  1SYX A;  4ZBA A;  1EP7 A;  1J9B A;  2VCZ A;  5JCG A;  1TRS A;  2ZUP A;  3UEM A;  3UIW A;  1DSB A;  1SL2 B;  1EOH A;  1JZR A;  5DBQ A;  1PN9 A;  2O87 A;  1TKD B;  1USB A;  5HR2 A;  3KGK A;  3TCO A;  4WR4 A;  4WBR D;  3QDN A;  1DE1 A;  2EIR A;  2LQQ A;  2C0G A;  2R4V A;  1NHO A;  4TVE A;  4GSS A;  3MYD A;  1AQW A;  4GXZ A;  2R0C A;  2O7K A;  1PD2 1;  1V9W A;  3D21 A;  4IQA A;  4OD7 A;  3H93 A;  4CDO A;  2QSI A;  4POK A;  6GST A;  1W4V A;  2VL2 A;  2R5G A;  2XPD A;  2OAC A;  2AUV A;  6GSX A;  5CYY A;  1A8L A;  4ICY A;  2TRX A;  1M3I A;  3QMX A;  2GQM A;  2FNO A;  3G9B A;  3ZIJ A;  4IN0 A;  1EP8 A;  4F2I A;  3WGD A;  4A5P A;  2H01 A;  4YAP A;  4KDU A;  3CSJ A;  1MEK A;  4ECB A;  1TW9 A;  3ZL5 A;  1GTB A;  2BMX A;  3ZYW A;  2NDO A;  2V41 A;  4Q5F A;  5G30 A;  3GA4 A;  1Y6E A;  3LFL A;  4X43 A;  1SD8 A;  2IJY A;  4MAB A;  4ZL8 A;  3VWV A;  1SK2 A;  1SK0 A;  2M46 A;  1ZZY A;  1MDI A;  3O6T A;  2A2S A;  2I81 A;  4GF0 A;  4X1U A;  2C1Y A;  4KCE A;  4H86 A;  3L78 A;  1B4Q A;  5E59 A;  1GUL A;  1ZCP A;  1B9Y C;  1QQ2 A;  3C71 A;  4RUV A;  3ZFL A;  4MZC A;  3QPM A;  1R4W A;  3U5R E;  2HI7 A;  2E2G A;  4HU7 A;  4PTS A;  2X49 A;  4KB3 A;  2CAQ A;  1LU4 A;  2H19 A;  4GCI A;  1GUK A;  5EVO A;  3IE3 A;  4EO3 A;  5ECR B;  4K5S A;  1TOF A;  4V2M A;  2LEG A;  2PMT A;  5BMU A;  4NHZ A;  3KXO A;  3NZN A;  4OMV A;  2GZP A;  2MBT A;  1SJI A;  3HVX A;  2GVP A;  1H4O A;  1RK4 A;  1N2A A;  2LUS A;  4TR0 A;  2H8L A;  3BOA A;  1U87 A;  1YQ1 A;  1SL0 B;  2DJ0 A;  3A2X A;  4YQM A;  3FRC A;  3C1R A;  4HSC X;  4KE3 A;  3WT1 A;  2B1L A;  1N8J A;  2N5A A;  2L4C A;  2VCX A;  1K3L A;  3L4N A;  5LCZ A;  3RBT A;  2MMN A;  3ERG A;  1FAA A;  1ZYE A;  5ENU A;  4CHS A;  1MD4 A;  3DGQ A;  2VOC A;  2I3Y A;  4ZL7 A;  3IHQ A;  1ACV A;  2GSS A;  1WP0 A;  3BCK A;  4RQX A;  3DML A;  3N5O A;  2L5O A;  2VCV A;  4IW9 A;  4GQC A;  1TK0 B;  1OC9 B;  2V6O A;  2E0Q A;  4G10 A;  3FR9 A;  3H79 A;  1GSE A;  3DVW A;  2HSM A;  5J3R A;  4J57 E;  1OC3 A;  3UVT A;  1OKD A;  2CZ3 A;  2R6K A;  1KEB A;  2YZU A;  2V2G A;  1S3C A;  3HHV A;  3LJR A;  1WMJ A;  4NPB A;  1GSU A;  2H74 A;  2XHF A;  2HLS A;  1OE8 A;  4HQZ A;  4KDY A;  4ID0 A;  2OE1 A;  3KMO A;  2H1G A;  1I5G A;  3GRX A;  3HD5 A;  2VUP A;  1ZGN A;  5B8A A;  5KN1 A;  4KDX A;  3I9V 2;  3F9U A;  3EYT A;  3ERF A;  2N5B A;  3DYR A;  3P90 A;  2P31 A;  4WXT A;  2R37 A;  3ERW A;  3PIN A;  2MMA A;  1R7H A;  3VWX A;  2M72 A;  4F0C A;  3L9V A;  3TJK A;  3H8Q A;  3M9J A;  3DIE A;  3IC8 A;  1M2B A;  1SKR B;  1R5A A;  3GYK A;  3ZRE A;  5G31 A;  3R2Q A;  5IMD A;  4WEY A;  2TIR A;  1FHE A;  2OE0 A;  1M2A A;  3FK8 A;  2LRN A;  2IMF A;  1A2J A;  2QGV A;  1WPI A;  2I1U A;  2WJU A;  2LRT A;  4WF4 A;  3DKS A;  1QFN A;  5GAN D;  2YCD A;  1TXX A;  4GTU A;  1A23 A;  1V40 A;  1FVJ A;  4OO4 A;  4E8E A;  1ZYQ B;  4AJ7 A;  2CAI A;  3RAZ A;  2GQL A;  1BED A;  3FZ4 A;  5C04 A;  2WFC A;  5AIS A;  4ECC A;  1ERU A;  4CY8 A;  5CO3 A;  3ZVJ A;  3KTL A;  2L59 A;  1BYE A;  2HRA A;  2PPT A;  3GHA A;  3RPP A;  4MPG A;  1Z6N A;  4OFM A;  3HKR A;  4NV5 A;  1U3I A;  2WS2 A;  4LMV A;  3ZIT A;  2E2M A;  5IM9 A;  1XOA A;  16GS A;  1H75 A;  2IMI A;  3DD3 A;  2X8H A;  2FGX A;  1RW1 A;  4DEJ A;  2LNS A;  2GSQ A;  2DMM A;  6GSS A;  2HZE A;  1R26 A;  2JZR A;  3DEX A;  1URM A;  2VM2 A;  2MYG A;  2OE3 A;  2A4H A;  4EIP A;  1JZW A;  1S3D A;  1T1V A;  4DSQ A;  3IDV A;  4O32 A;  4XTS A;  5GZZ B;  1S3A A;  2NBS A;  2XBQ A;  2FUG 2;  2RUE A;  2P5R A;  1XG8 A;  3GH6 A;  3WYW A;  3UMA A;  4YKG A;  2C3Q A;  1F3B A;  1RQM A;  2H73 A;  3GX0 A;  4G2E A;  3CRU A;  5A4W A;  3IAM 2;  4MDC A;  2IL3 A;  4NXI A;  4EL1 A;  4TR3 A;  4TR1 B;  1FB0 A;  2B7K A;  3W6G A;  4KSO A;  3L9U A;  1YJ6 A;  3GL5 A;  2GDR A;  3F4R A;  5G5F A;  5ECM B;  2H1D A;  1AIU A;  1TJD A;  5IPG A;  4PQ1 A;  5J4U A;  5F07 A;  2EIO A;  4D73 A;  3M1G A;  1GH2 A;  2FCH A;  2PER A;  2J9H A;  2GGT A;  2TRC P;  1PL1 A;  3CTG A;  6GSV A;  3IBH A;  3UBL A;  3AY8 A;  4V1A g;  4IGJ A;  2RM6 A;  3TUE A;  3GST A;  5B6M A;  4FH8 A;  5IQY A;  2GZZ A;  2OBK A;  4FYC A;  4EIQ A;  1M9B A;  2PGT A;  4PUF C;  1EGO A;  3ZTL A;  4MH2 A;  1XVQ A;  3TB2 A;  2GST A;  1HQO A;  4ILF A;  4Z2R A;  8GSS A;  5D96 A;  5JWR B;  2H6Y A;  4KF9 A;  2P5Q A;  4FYB A;  1BX9 A;  2MZC A;  1ERT A;  2K9F A;  2L57 A;  2H72 A;  2X99 A;  4TR4 A;  4MCU A;  1G6W A;  3GTU A;  2DJ1 A;  3ZVJ D;  1GSF A;  3C8E A;  4N0Z A;  1XFL A;  2L6D A;  2VLT A;  3D22 A;  3GKM A;  2QA1 A;  1TTZ A;  1O8W A;  1GUH A;  5ID2 A;  1AW9 A;  1ZOF A;  3EUR A;  3IC4 A;  5J5N A;  5G2Z A;  1PN0 A;  5KOW A;  2WCI A;  3M8N A;  1TRU A;  1YDK A;  2OAD A;  4XS4 B;  3J7Y k;  3KP9 A;  1GTU A;  2RUF A;  3ZZX A;  3VUR A;  4GQF A;  1A24 A;  4BIK A;  2HE3 A;  3I43 A;  1GSS A;  2HYX A;  2YV7 A;  2ON7 A;  5AGY A;  1TRV A;  1XCC A;  3GIX A;  3TOT A;  2PVQ A;  2DC5 A;  1GTI A;  2DJJ A;  4JBB A;  2CZ2 A;  2WUL A;  3KEB A;  3EWL A;  2DIZ A;  2GTU A;  2OA7 A;  3C73 A;  4BVX A;  5IIZ A;  2LJK A;  1WOU A;  4JE1 A;  4MJC A;  4EVM A;  2M80 A;  2LV3 A;  2HRK A;  3VI7 A;  3D5J A;  2LST A;  5ELA A;  5F05 A;  5IMA A;  5F8B A;  1HNA A;  4HZ2 A;  3IA1 A;  1YEP A;  4BPY A;  1XWA A;  2MMZ A;  1I9D A;  3IV4 A;  5AIX A;  2ZCT A;  3UBK A;  2LJA A;  1DUG A;  5HQP A;  2YWM A;  2VM1 A;  5DJL A;  1GNW A;  3P7X A;  3ME7 A;  1TRW A;  5CRH A;  2YNX A;  1AQX A;  4G19 A;  1XW9 A;  4O5Q A;  3E9J B;  1FOH A;  5GAP D;  2L6C A;  1Q98 A;  1O73 A;  4YH2 A;  1ZYN A;  5DAK B;  5D9V A;  1XPV A;  1THX A;  3GN3 A;  2IN3 A;  5AN1 A;  1K0M A;  4KA0 A;  2ZNM A;  3H4K A;  2H1B A;  2YPM A;  2FWF A;  2WZ9 A;  3O76 A;  1Z7R A;  5EY6 A;  1SJ6 A;  1WWJ A;  3MIX A;  3TGZ A;  4TXV A;  2PVO C;  2NPB A;  1YY7 A;  3WGX A;  1GSD A;  2R0P A;  5CRE A;  3C1S A;  3QFA C;  4FIW A;  2FD3 A;  3DXB A;  2E7P A;  2B5E A;  4EE0 A;  1JZD A;  2HT9 A;  1TK8 B;  3TKS C;  3UOM A;  4NHW A;  5J9B A;  4LL1 B;  4K2D A;  1GUM A;  3JCM L;  1AC1 A;  3F4S A;  1F37 A;  4IJI A;  4BL7 A;  2C3T A;  4ZB6 A;  1GSQ A;  2DKI A;  3FZ5 A;  4TRX A;  5DQY A;  2H0I A;  17GS A;  4G0K A;  1HNB A;  1Z5Y E;  3VPT A;  2VCW A;  3CMI A;  5HFI A;  4PGT A;  4WET A;  4I8B A;  3TJG A;  3KP8 A;  5B6N A;  3DRN A;  4X0X A;  3M0F A;  2H0G A;  1A8Y A;  3D6I A;  3LWA A;  4ZIJ A;  11GS A;  2H75 A;  3N9J A;  4JR4 A;  1PQN A;  1XWG A;  5ELG A;  1Z9H A;  4AJ6 A;  2J23 A;  3EMP A;  4G9H A;  3KCM A;  4TW5 A;  3KTB A;  2IPA A;  5ECO B;  3ISO A;  1HD2 A;  5ECP B;  2IFQ B;  3L9S A;  2LRC A;  3UL3 A;  4XCS A;  1T3B A;  4OO5 A;  5DCG A;  2I9H A;  2JU5 A;  1A2L A;  4IBP A;  5DCH A;  4MF5 A;  2K8S A;  2P0G A;  4E8H A;  5D9T A;  1PMT A;  2D2Z A;  3QAW A;  4XS4 A;  3D4T A;  2AHE A;  18GS A;  1U88 A;  3IRA A;  2KUC A;  5A4V A;  1V57 A;  4IP1 A;  4L8E A;  4X4J A;  1O85 A;  1XW5 A;  4IEL A;  1EEJ A;  1BG5 A;  2C3N A;  4FO5 A;  1T7P B;  5HR3 A;  2VLV A;  3TRP A;  2WRT A;  5G1L A;  3GKK A;  4PUA A;  2VD1 A;  1G0T A;  1K3O A;  5CP1 A;  2AAW A;  3TJJ A;  5F0G A;  3EIN A;  4MH3 A;  1YZX A;  4HJM A;  2GT6 A;  1M2D A;  4NMU A;  2G2Q A;  5HR0 A;  4DSS B;  1XWB A;  4Q5R A;  3KIJ A;  1UN2 A;  4TXO B;  4PQH A;  1A0R P;  1EZK A;  3VWU A;  1G6Y A;  1TI3 A;  5KN3 A;  3LYP A;  4XRA A;  4Q5N A;  1NHY A;  2FY6 A;  4KSM A;  1E6B A;  1SKW B;  1EEM A;  4KND A;  2H6X A;  3HZ4 A;  1ERW A;  2FWE A;  3BBY A;  2B5X A;  1TDI A;  3D4M A;  3IHG A;  3TKS A;  2X8C A;  3HCZ A;  5J41 A;  3WT2 A;  5AIV A;  5H5Q A;  2K8V A;  1Z7P A;  1X5E A;  1XBS A;  2JAD A;  1FG4 A;  1MDK A;  1FB6 A;  3D0Z A;  2H70 A;  3Q19 A;  4EXJ A;  2GZY A;  5CRD A;  2LQO A;  5HFK A;  2C0D A;  5E4W A;  2QKE A;  2HRN A;  1F9M A;  4LA1 A;  1SEN A;  4JR6 A;  1XVW A;  2I4A A;  1NSW A;  2ES7 A;  2RLI A;  1PX7 A;  1UA5 A;  1VF3 A;  4AF2 A;  2GQK A;  3EE2 A;  2VD0 A;  2IMK A;  3TRQ A;  3A3T A;  2REM A;  1KBN A;  5IMZ A;  3FY7 A;  2LJR A;  4EDZ A;  2HXK A;  3HA9 A;  3CQF A;  2F9S A;  4G0I A;  3WGE A;  4GSN A;  2N5F A;  3LXZ A;  2VO4 A;  3Q74 A;  2IWT A;  4HUA A;  3TOU A;  5CAX A;  3KM6 A;  2OKA A;  2VCQ A;  2H6Z A;  22GS A;  4N30 A;  5G1K A;  4GWR A;  2KOK A;  4K8M A;  2G0F A;  3QD9 A;  4N11 A;  1K3Y A;  1F2E A;  5KN0 A;  1X9M B;  5DJM A;  2DKH A;  1OKT A;  5JCW A;  3GUS A;  3TDG A;  1FO5 A;  1M99 A;  5LD0 A;  2H0H A;  4K5R A;  2NVL A;  4PNF A;  1G7O A;  4KCA A;  1U6T A;  3FEU A;  1O6J A;  5HR1 A;  1F6M C;  5BRT A;  1T4Y A;  2B7J A;  1PA3 A;  5DAL B;  1SL1 B;  2AB6 A;  2DJK A;  2CA8 A;  1XXU A;  1K0C A;  2O89 A;  2A2R A;  1OC9 A;  2C80 A;  3M3M A;  4MA9 A;  3IAS 2;  4IS0 A;  2IME A;  3HXS A;  2C8U A;  3Q6O A;  3EU4 A;  3LG6 A;  1U3A A;  3IK7 A;  2CX3 A;  1CQH A;  1VF2 A;  3IR4 A;  1M0U A;  1ST9 A;  3FHK A;  1FOV A;  1QMV A;  3P8W A;  2B6M A;  2WDU A;  2VL9 A;  3LXT A;  2YJ7 A;  4GLT A;  4WKW A;  2VL2 C;  3MNG A;  3US3 A;  3GH9 A;  4NV2 A;  3TKR A;  1XWK A;  3TKP A;  1SJZ A;  2L5L A;  2CX4 A;  4POB A;  5F06 A;  2XC2 A;  5HFG A;  4BWS A;  4QL7 A;  3GKX A;  3HZ8 A;  2AV4 A;  2JAC A;  1ILO A;  1Z3E A;  1GNE A;  6GSU A;  3HVN A;  1M3J A;  4YQU A;  4HEA 2;  2HFD A;  3DVX A;  5INY A;  5KOX A;  3F6F A;  4JU5 A;  4HS1 A;  3GKN A;  4RQR A;  2FHE A;  4WR5 A;  5A5K A;  4GRF A;  4OCE A;  5ECH B;  1K0B A;  3ZFB A;  4HDE A;  2JZT A;  2QA2 A;  2QC7 A;  1CQG A;  4XS1 A;  7GSS A;  5LNK e;  4PNG A;  4DSS A;  3LEF A;  5ECS A;  2F8F A;  2CT6 A;  3BCI A;  4TXO A;  2C4J A;  4HU9 A;  4EKZ A;  5CRW A;  2K18 A;  4MNN A;  4Q5Q A;  2PU9 C;  4CY6 A;  1JHB A;  4MP4 A;  3CTF A;  2MMO A;  5IOX A;  3V1W A;  3I69 A;  2DLX A;  1SD9 A;  1K0D A;  5IMC A;  3EVI A;  3O3T A;  4YKF A;  3F4T A;  1LBK A;  2KHP A;  3ZLP A;  3KH7 A;  4ML1 A;  4IKH A;  5D9W A;  4BVY B;  1R5P A;  4V1A p;  4KW6 A;  4POM A;  3LGC A;  4KUN A;  2FLS A;  2F51 A;  3APS A;  4FYU A;  1YF1 A;  3F3Q A;  2YP6 A;  4K9Z A;  2ALB A;  4ZIL A;  2X4A A;  3TRX A;  4I5Q A;  3F3R A;  5ABR A;  2VL3 A;  1EOG A;  2FA4 A;  1G7E A;  1XW6 A;  1EV9 A;  3F0I A;  4YAV A;  4QQ7 A;  2HSH A;  4PUR A;  2RII A;  5EL8 A;  2VIM A;  2PUK C;  3HYP A;  2FWH A;  3HJO A;  3A2V A;  2H1A A;  1K0A A;  5D8I A;  2VCT A;  4KX4 A;  2BTO T;  3QAG A;  4TN8 A;  2YOI A;  3VI5 A;  4XRD A;  3RHC A;  3Q18 A;  1GRX A;  1X0R A;  3QOU A;  5FHI A;  1KNG A;  2BJX A;  3LOR A;  2LS5 A;  4IQ1 A;  2V1M A;  1VGL A;  1OYJ A;  1XOB A;  5ECL B;  3SBC A;  3ZRD A;  4JED A;  2YZH A;  4KGI A;  4QL9 A;  1GLP A;  4J56 E;  2O8V B;  2OJL A;  1BQ7 A;  3LQ7 A;  1X9W B;  19GS A;  4AGS A;  4MF7 A;  5DAL A;  1M7T A;  3FMW A;  2PN8 A;  4FQU A;  4G0L A;  3HDC A;  2VAF A;  1JFU A;  2AJQ B;  2KP2 A;  3CSH A;  4TKY A;  1J08 A;  4L5L A;  5D73 A;  1PFO A;  2O85 A;  4Z2T A;  2YWO A;  1ZL9 A;  2DIY A;  2R2J A;  5B7C A;  1A0F A;  3DWV A;  4O5U A;  4EUY A;  2JSZ A;  3W8J A;  2L4Q A;  4K7O A;  1OAZ A;  2IMD A;  4WF5 A;  4TR1 A;  1T4Z A;  6GSW A;  3J7Y b;  1WE0 A;  9GSS A;  3VK9 A;  5ECN B;  1DBY A;  4V2N A;  5ECI B;  2V6K A;  3UAP A;  3E0U A;  4MZB A;  1PGT A;  2VLU A;  4JZQ A;  2GT5 A;  4ACS A;  1TU8 A;  3VWW A;  1HNC A;  4DVC A;  2H30 A;  14GS A;  2B3S A;  3IK9 A;  3FR3 A;  1F3A A;  4I2U A;  5A4U A;  3GFK A;  2R3X A;  1GWC A;  4EC0 A;  5DDL A;  1KTE A;  1YEX A;  3G7Y A;  4NWY A;  3PR8 A;  1PSQ A;  1O81 A;  1IYH A;  3H1N A;  2R0G A;  5IO0 A;  1MD3 A;  3KH9 A;  5FWG A;  2C0E A;  2DML A;  4K6X A;  1XIY A;  3G7I A;  3HJM A;  3OR5 A;  3CYN A;  3KD0 A;  1JLV A;  1UC7 A;  1T8E B;  2UZ8 A;  2LTK A;  3IOS A;  2X64 A;  1ZYP A;  1W89 A;  3I6A A;  2JL4 A;  3HVV A;  2HZE B;  2H76 A;  5IMV A;  4USS A;  2OBI A;  2WB9 A;  1PX6 A;  20GS A;  4P3Y B;  3HVS A;  3CSI A;  3RDW A;  10GS A;  2CQ9 A;  4JRR A;  4WBJ A;  3GX8 A;  5IOW A;  1V2A A;  5GST A;  1YKC A;  4ZB8 A;  1X5C A;  2CVK A;  2GLR A;  2H66 A;  3KMN A;  3A2W A;  4I6X A;  4LMW A;  2CV4 A;  4EDY A;  2B5Y A;  3FKF A;  4AJ8 A;  4IP6 A;  1THO A;  2YN1 A;  5GSS A;  4O5R A;  4IVF A;  3LSZ A;  1AQV A;  4GST A;  1VRS D;  2PWJ A;  4IHU A;  5D9X A;  4PQI A;  1O8X A;  1SU9 A;  13GS A;  4BVY A;  3SWL A;  1UVZ A;  2HNL A;  4ZBB A;  4K2X A;  1JZO A;  3TKQ A;  1S3R A;  4MK3 A;  5CNW A;  3CBU A;  3F6D A;  4XS6 A;  1DE2 A;  5JWO B;  1A2M A;  4KAE A;  3KJY A;  3K8N A;  2KP1 A;  1K0N A;  1AUC A;  4MZW A;  3FR6 A;  4Z2U A;  1EV4 A;  2F3M A;  4MPF A;  4MJB A;  3PGT A;  1TP9 A;  1B48 A;  1E2Y A;  3LYK A;  4OFT A;  3FW2 A;  4OWY A;  2HSY A;  4D73 B;  3L0H A;  3A5I A;  3F63 A;  3VFI A;  4MJE A;  4K7I A;  4L0U A;  2EC4 A;  2K6V A;  3VLN A;  4HQS A;  3TKS E;  2YV9 A;  3QR6 A;  1LJR A;  5B8B A;  4RI7 A;  1SK1 A;  3QCP A;  4DSR A;  1OVN A;  3CXG A;  3PPU A;  4ZXG A;  1GLQ A;  1X9S B;  5H5R A;  1QK8 A;  2YWI A;  3EMX A;  1MDJ A;  3UVH A;  1OE7 A;  1ON4 A;  2CVD A;  1V98 A;  4PX1 A;  3GTU B;  5CRG A;  4F03 A;  5IPH A;  4RI6 A;  1YF0 A;  2XBI A;  2YAN A;  2WGR A;  3ZMK A;  2DBC A;  2DJ2 A;  1XWC A;  4IJ3 A;  4POL A;  2LNT A;  5ID2 B;  3GL3 A;  3QAV A;  2LKU A;  3E3E A;  3MDK A;  5DAK A;  1V58 A;  1GP1 A;  1PRX A;  4XIH A;  5JCU A;  5EPF A;  3EPT A;  4F82 A;  1VF4 A;  3C7M A;  1QUW A;  1MTC A;  2FWG A;  1Z6M A;  4I97 A;  2V32 A;  1O7U A;  3M9K A;  5ECK B;  1PKW A;  1WIK A;  4ECI A;  3IXR A;  1ERV A;  4CW9 A;  2AYT A;  4OFN A;  3FYG A;  5COH A;  2HZF A;  3BJ5 A;  3MWH A;  1SKS B;  3NOF A;  5IMF A;  3R3E A;  1C72 A;  3GNJ A;  4ZL9 A;  3IPZ A;  1TI1 A;  2DJ3 A;  4LL4 B;  4ZB9 A;  5KN2 A;  2B1K A;  3APO A;  1Q4J A;  2DSA A;  4BVX B;  3GMF A;  2PBJ A;  4ULX A;  5G5E A;  5J9C A;  2KLX A;  2GS3 A;  3G7J A;  3ZIV A;  4OCF A;  5H5S A;  4K0G A;  1YKA A;  4MMM A;  4N0V A;  12GS A;  4O92 A;  5D93 A;  1PL2 A;  4F9Z A;  1EGR A;  1HYU A;  3TJF A;  1NM3 A;  2MBS A;  1AXD A;  4K7N A;  2RM5 A;  4HI7 A;  1TU7 A;  2IIY A;  1EWX A;  1ABA A;  3ED3 A;  2YJH A;  4K0N A;  3RHB A;  1JLW A;  2IFQ A;  1BJX A;  4LLR A;  1FVK A;  3FZA A;  3P2A A;  4BA7 A;  5DVB A;  4MJA A;  1J0F A;  1WJK A;  4I2T A;  1Y25 A;  3U6V A;  3QFB C;  1T00 A;  4BWQ A;  3GUR A;  1B4P A;  1GTA A;  3EU3 A;  1QGV A;  5ECQ B;  2HRF A;  3F8U A;  2JZS A;  2FA8 A;  1K0O A;  2NTO A;  2GSR A;  4K1F A;  3GV1 A;  3EC3 A;  3TJB A;  5IO2 A;  4NAX A;  2EIQ A;  3A5W A;  3ZML A;  3MSZ A;  3KZQ A;  3S9F A;  3PH9 A;  1B9X C;  1SYR A;  4EF0 A;  3RPN A;  3HY2 A;  4N10 A;  1WRY A;  3ME8 A;  1ZMA A;  6GSY A;  5KEJ A;  2A4V A;  3MAK A;  4BL7 B;  1BAY A;  4L0W A;  4HOJ A;  4ZBD A;  3GSS A;  5FT3 A;  1TK5 B;  4TOP A;  1GSY A;  1QXH A;  3HJP A;  5DQS A;  4ECJ A;  4PXO A;  1X5D A;  4HZ4 A;  4J2F A;  1IYI A;  4KH7 A;  4L5O A;  4MF6 A;  3UAR A;  1B8X A;  3VPQ A;  1NW2 A;  2X8G A;  3W8S A;  2F8A A;  2JSY A;  4HJ2 A;  5C00 A;  3APQ A; 
#chains in the Genus database with same CATH homology
 2CVB A;  2Z9S A;  4O7H A;  4ISD A;  1OC8 A;  1AAZ A;  2ON5 A;  4MLY A;  1M9A A;  1ML6 A;  5JWQ B;  2XPE A;  1FW1 A;  4Z7X A;  1XZO A;  2H71 A;  3BD2 A;  3LW9 A;  2A2P A;  4XHM A;  1VF1 A;  1GL8 A;  5L71 A;  4ML6 A;  3FZ9 A;  2C0F A;  3UJ1 A;  3WD6 A;  4F0B A;  4V2L A;  3NIV A;  2YWN A;  4YQV A;  3CRT A;  1PKZ A;  1SYX A;  4ZBA A;  1EP7 A;  1J9B A;  2VCZ A;  5JCG A;  1TRS A;  2ZUP A;  3UEM A;  3UIW A;  1DSB A;  1SL2 B;  1EOH A;  1JZR A;  5DBQ A;  1PN9 A;  2O87 A;  1TKD B;  1USB A;  5HR2 A;  3KGK A;  3TCO A;  4WR4 A;  4WBR D;  3QDN A;  1DE1 A;  2EIR A;  2LQQ A;  2C0G A;  2R4V A;  1NHO A;  4TVE A;  4GSS A;  3MYD A;  1AQW A;  4GXZ A;  2R0C A;  2O7K A;  1PD2 1;  1V9W A;  3D21 A;  4IQA A;  4OD7 A;  3H93 A;  4CDO A;  2QSI A;  4POK A;  6GST A;  1W4V A;  2VL2 A;  2R5G A;  2XPD A;  2OAC A;  2AUV A;  6GSX A;  5CYY A;  1A8L A;  4ICY A;  2TRX A;  3QMX A;  2GQM A;  2FNO A;  3G9B A;  3ZIJ A;  4IN0 A;  1EP8 A;  4F2I A;  3WGD A;  4A5P A;  2H01 A;  4YAP A;  4KDU A;  3CSJ A;  1MEK A;  4ECB A;  1TW9 A;  3ZL5 A;  1GTB A;  2BMX A;  3ZYW A;  2NDO A;  2V41 A;  4Q5F A;  5G30 A;  3GA4 A;  1Y6E A;  3LFL A;  4X43 A;  1SD8 A;  2IJY A;  4MAB A;  4ZL8 A;  3VWV A;  1SK2 A;  1SK0 A;  2M46 A;  1ZZY A;  1MDI A;  3O6T A;  2A2S A;  2I81 A;  4GF0 A;  4X1U A;  2C1Y A;  4KCE A;  4H86 A;  3L78 A;  1B4Q A;  5E59 A;  1GUL A;  1ZCP A;  1B9Y C;  1QQ2 A;  3C71 A;  4RUV A;  3ZFL A;  4MZC A;  3QPM A;  1R4W A;  3U5R E;  2HI7 A;  2E2G A;  4HU7 A;  4PTS A;  2X49 A;  4KB3 A;  2CAQ A;  1LU4 A;  2H19 A;  4GCI A;  1GUK A;  5EVO A;  3IE3 A;  4EO3 A;  5ECR B;  4K5S A;  1TOF A;  4V2M A;  2LEG A;  2PMT A;  5BMU A;  4NHZ A;  3KXO A;  3NZN A;  4OMV A;  2GZP A;  2MBT A;  1SJI A;  3HVX A;  2GVP A;  1H4O A;  1RK4 A;  1N2A A;  2LUS A;  4TR0 A;  2H8L A;  3BOA A;  1U87 A;  1YQ1 A;  1SL0 B;  2DJ0 A;  3A2X A;  4YQM A;  3FRC A;  3C1R A;  4KE3 A;  3WT1 A;  2B1L A;  1N8J A;  2N5A A;  2L4C A;  2VCX A;  1K3L A;  3L4N A;  5LCZ A;  3RBT A;  2MMN A;  3ERG A;  1FAA A;  1ZYE A;  5ENU A;  4CHS A;  1MD4 A;  3DGQ A;  2VOC A;  2I3Y A;  4ZL7 A;  3IHQ A;  1ACV A;  2GSS A;  1WP0 A;  3BCK A;  4RQX A;  3DML A;  3N5O A;  2L5O A;  2VCV A;  4IW9 A;  4GQC A;  1TK0 B;  1OC9 B;  2V6O A;  2E0Q A;  4G10 A;  3FR9 A;  3H79 A;  1GSE A;  3DVW A;  2HSM A;  5J3R A;  4J57 E;  1OC3 A;  3UVT A;  1OKD A;  2CZ3 A;  2R6K A;  1KEB A;  2YZU A;  2V2G A;  1S3C A;  3HHV A;  3LJR A;  1WMJ A;  4NPB A;  1GSU A;  2H74 A;  2XHF A;  2HLS A;  1OE8 A;  4HQZ A;  4KDY A;  4ID0 A;  2OE1 A;  3KMO A;  2H1G A;  1I5G A;  3GRX A;  3HD5 A;  2VUP A;  1ZGN A;  5B8A A;  5KN1 A;  4KDX A;  3I9V 2;  3F9U A;  3EYT A;  3ERF A;  2N5B A;  3DYR A;  3P90 A;  2P31 A;  4WXT A;  2R37 A;  3ERW A;  3PIN A;  2MMA A;  1R7H A;  3VWX A;  2M72 A;  4F0C A;  3L9V A;  3TJK A;  3H8Q A;  3M9J A;  3DIE A;  3IC8 A;  1M2B A;  1SKR B;  1R5A A;  3GYK A;  3ZRE A;  5G31 A;  3R2Q A;  5IMD A;  4WEY A;  2TIR A;  1FHE A;  2OE0 A;  1M2A A;  3FK8 A;  2LRN A;  2IMF A;  1A2J A;  2QGV A;  1WPI A;  2I1U A;  2WJU A;  2LRT A;  4WF4 A;  3DKS A;  1QFN A;  5GAN D;  2YCD A;  1TXX A;  4GTU A;  1A23 A;  1V40 A;  1FVJ A;  4OO4 A;  4E8E A;  1ZYQ B;  4AJ7 A;  2CAI A;  3RAZ A;  2GQL A;  1BED A;  3FZ4 A;  5C04 A;  2WFC A;  5AIS A;  4ECC A;  1ERU A;  4CY8 A;  5CO3 A;  3ZVJ A;  3KTL A;  2L59 A;  1BYE A;  2HRA A;  2PPT A;  3GHA A;  3RPP A;  4MPG A;  1Z6N A;  4OFM A;  3HKR A;  4NV5 A;  1U3I A;  2WS2 A;  4LMV A;  3ZIT A;  2E2M A;  5IM9 A;  1XOA A;  16GS A;  1H75 A;  2IMI A;  3DD3 A;  2X8H A;  2FGX A;  1RW1 A;  4DEJ A;  2LNS A;  2GSQ A;  2DMM A;  6GSS A;  2HZE A;  1R26 A;  2JZR A;  3DEX A;  1URM A;  2VM2 A;  2MYG A;  2OE3 A;  2A4H A;  4EIP A;  1JZW A;  1S3D A;  1T1V A;  4DSQ A;  3IDV A;  4O32 A;  4XTS A;  5GZZ B;  1S3A A;  2NBS A;  2XBQ A;  2FUG 2;  2RUE A;  2P5R A;  3GH6 A;  3WYW A;  3UMA A;  4YKG A;  2C3Q A;  1F3B A;  1RQM A;  2H73 A;  3GX0 A;  4G2E A;  3CRU A;  5A4W A;  3IAM 2;  4MDC A;  2IL3 A;  4NXI A;  4EL1 A;  4TR3 A;  4TR1 B;  1FB0 A;  2B7K A;  3W6G A;  4KSO A;  3L9U A;  1YJ6 A;  3GL5 A;  2GDR A;  3F4R A;  5G5F A;  5ECM B;  2H1D A;  1AIU A;  1TJD A;  5IPG A;  4PQ1 A;  5J4U A;  5F07 A;  2EIO A;  4D73 A;  3M1G A;  1GH2 A;  2FCH A;  2PER A;  2J9H A;  2GGT A;  2TRC P;  1PL1 A;  3CTG A;  6GSV A;  3IBH A;  3UBL A;  3AY8 A;  4V1A g;  4IGJ A;  2RM6 A;  3TUE A;  3GST A;  5B6M A;  4FH8 A;  5IQY A;  2GZZ A;  2OBK A;  4FYC A;  4EIQ A;  1M9B A;  2PGT A;  4PUF C;  1EGO A;  3ZTL A;  4MH2 A;  1XVQ A;  3TB2 A;  2GST A;  1HQO A;  4ILF A;  4Z2R A;  8GSS A;  5D96 A;  5JWR B;  2H6Y A;  4KF9 A;  2P5Q A;  4FYB A;  1BX9 A;  2MZC A;  1ERT A;  2K9F A;  2L57 A;  2H72 A;  2X99 A;  4TR4 A;  4MCU A;  1G6W A;  3GTU A;  2DJ1 A;  3ZVJ D;  1GSF A;  3C8E A;  4N0Z A;  1XFL A;  2L6D A;  2VLT A;  3D22 A;  3GKM A;  2QA1 A;  1TTZ A;  1O8W A;  1GUH A;  5ID2 A;  1AW9 A;  1ZOF A;  3EUR A;  3IC4 A;  5J5N A;  5G2Z A;  1PN0 A;  5KOW A;  2WCI A;  3M8N A;  1TRU A;  1YDK A;  2OAD A;  4XS4 B;  3J7Y k;  3KP9 A;  1GTU A;  2RUF A;  3ZZX A;  3VUR A;  4GQF A;  1A24 A;  2HE3 A;  3I43 A;  1GSS A;  2HYX A;  2YV7 A;  2ON7 A;  5AGY A;  1TRV A;  1XCC A;  3GIX A;  3TOT A;  2PVQ A;  2DC5 A;  1GTI A;  2DJJ A;  4JBB A;  2CZ2 A;  2WUL A;  3KEB A;  3EWL A;  2DIZ A;  2GTU A;  2OA7 A;  3C73 A;  4BVX A;  5IIZ A;  2LJK A;  1WOU A;  4JE1 A;  4MJC A;  4EVM A;  2M80 A;  2LV3 A;  2HRK A;  3VI7 A;  3D5J A;  2LST A;  5ELA A;  5F05 A;  5IMA A;  5F8B A;  1HNA A;  4HZ2 A;  3IA1 A;  1YEP A;  4BPY A;  1XWA A;  2MMZ A;  1I9D A;  3IV4 A;  5AIX A;  2ZCT A;  3UBK A;  2LJA A;  1DUG A;  5HQP A;  2YWM A;  2VM1 A;  5DJL A;  1GNW A;  3P7X A;  3ME7 A;  1TRW A;  5CRH A;  2YNX A;  1AQX A;  4G19 A;  1XW9 A;  4O5Q A;  3E9J B;  1FOH A;  5GAP D;  2L6C A;  1Q98 A;  1O73 A;  4YH2 A;  1ZYN A;  5DAK B;  5D9V A;  1XPV A;  1THX A;  3GN3 A;  2IN3 A;  5AN1 A;  1K0M A;  4KA0 A;  2ZNM A;  3H4K A;  2H1B A;  2YPM A;  2FWF A;  2WZ9 A;  3O76 A;  1Z7R A;  5EY6 A;  1SJ6 A;  1WWJ A;  3MIX A;  3TGZ A;  4TXV A;  2PVO C;  2NPB A;  1YY7 A;  3WGX A;  1GSD A;  2R0P A;  5CRE A;  3C1S A;  3QFA C;  4FIW A;  2FD3 A;  3DXB A;  2E7P A;  2B5E A;  4EE0 A;  1JZD A;  2HT9 A;  1TK8 B;  3TKS C;  3UOM A;  4NHW A;  5J9B A;  4LL1 B;  4K2D A;  1GUM A;  3JCM L;  1AC1 A;  3F4S A;  1F37 A;  4IJI A;  4BL7 A;  2C3T A;  4ZB6 A;  1GSQ A;  2DKI A;  3FZ5 A;  4TRX A;  5DQY A;  2H0I A;  17GS A;  4G0K A;  1HNB A;  1Z5Y E;  3VPT A;  2VCW A;  3CMI A;  5HFI A;  4PGT A;  4WET A;  4I8B A;  3TJG A;  3KP8 A;  5B6N A;  3DRN A;  4X0X A;  3M0F A;  2H0G A;  1A8Y A;  3D6I A;  3LWA A;  4ZIJ A;  11GS A;  2H75 A;  3N9J A;  4JR4 A;  1PQN A;  1XWG A;  5ELG A;  1Z9H A;  4AJ6 A;  2J23 A;  3EMP A;  4G9H A;  3KCM A;  4TW5 A;  3KTB A;  2IPA A;  5ECO B;  3ISO A;  1HD2 A;  5ECP B;  2IFQ B;  3L9S A;  2LRC A;  3UL3 A;  4XCS A;  1T3B A;  4OO5 A;  5DCG A;  2I9H A;  2JU5 A;  1A2L A;  4IBP A;  5DCH A;  4MF5 A;  2K8S A;  2P0G A;  4E8H A;  5D9T A;  1PMT A;  2D2Z A;  3QAW A;  4XS4 A;  3D4T A;  2AHE A;  18GS A;  1U88 A;  3IRA A;  2KUC A;  5A4V A;  1V57 A;  4IP1 A;  4L8E A;  4X4J A;  1O85 A;  1XW5 A;  4IEL A;  1EEJ A;  1BG5 A;  2C3N A;  4FO5 A;  1T7P B;  5HR3 A;  2VLV A;  3TRP A;  2WRT A;  5G1L A;  3GKK A;  4PUA A;  2VD1 A;  1G0T A;  1K3O A;  5CP1 A;  2AAW A;  3TJJ A;  5F0G A;  3EIN A;  4MH3 A;  1YZX A;  4HJM A;  2GT6 A;  1M2D A;  4NMU A;  2G2Q A;  5HR0 A;  4DSS B;  1XWB A;  4Q5R A;  3KIJ A;  1UN2 A;  4TXO B;  4PQH A;  1A0R P;  1EZK A;  3VWU A;  1G6Y A;  1TI3 A;  5KN3 A;  3LYP A;  4XRA A;  4Q5N A;  1NHY A;  2FY6 A;  4KSM A;  1E6B A;  1SKW B;  1EEM A;  4KND A;  2H6X A;  3HZ4 A;  1ERW A;  2FWE A;  3BBY A;  2B5X A;  1TDI A;  3D4M A;  3IHG A;  3TKS A;  2X8C A;  3HCZ A;  5J41 A;  3WT2 A;  5AIV A;  5H5Q A;  2K8V A;  1Z7P A;  1X5E A;  1XBS A;  2JAD A;  1FG4 A;  1MDK A;  1FB6 A;  3D0Z A;  2H70 A;  3Q19 A;  4EXJ A;  2GZY A;  5CRD A;  2LQO A;  5HFK A;  2C0D A;  5E4W A;  2QKE A;  2HRN A;  1F9M A;  4LA1 A;  1SEN A;  4JR6 A;  1XVW A;  2I4A A;  1NSW A;  2ES7 A;  2RLI A;  1PX7 A;  1UA5 A;  1VF3 A;  4AF2 A;  2GQK A;  3EE2 A;  2VD0 A;  2IMK A;  3TRQ A;  3A3T A;  2REM A;  1KBN A;  5IMZ A;  3FY7 A;  2LJR A;  4EDZ A;  2HXK A;  3HA9 A;  2F9S A;  4G0I A;  3WGE A;  4GSN A;  2N5F A;  3LXZ A;  2VO4 A;  3Q74 A;  2IWT A;  4HUA A;  3TOU A;  5CAX A;  3KM6 A;  2OKA A;  2VCQ A;  2H6Z A;  22GS A;  4N30 A;  5G1K A;  4GWR A;  2KOK A;  4K8M A;  2G0F A;  3QD9 A;  4N11 A;  1K3Y A;  1F2E A;  5KN0 A;  1X9M B;  5DJM A;  2DKH A;  1OKT A;  5JCW A;  3GUS A;  3TDG A;  1FO5 A;  1M99 A;  5LD0 A;  2H0H A;  4K5R A;  2NVL A;  4PNF A;  1G7O A;  4KCA A;  1U6T A;  3FEU A;  1O6J A;  5HR1 A;  1F6M C;  5BRT A;  1T4Y A;  2B7J A;  1PA3 A;  5DAL B;  1SL1 B;  2AB6 A;  2DJK A;  2CA8 A;  1XXU A;  1K0C A;  2O89 A;  2A2R A;  1OC9 A;  2C80 A;  3M3M A;  4MA9 A;  3IAS 2;  4IS0 A;  2IME A;  3HXS A;  2C8U A;  3Q6O A;  3EU4 A;  3LG6 A;  1U3A A;  3IK7 A;  2CX3 A;  1CQH A;  1VF2 A;  3IR4 A;  1M0U A;  1ST9 A;  3FHK A;  1FOV A;  1QMV A;  3P8W A;  2B6M A;  2WDU A;  2VL9 A;  3LXT A;  2YJ7 A;  4GLT A;  4WKW A;  2VL2 C;  3MNG A;  3US3 A;  3GH9 A;  4NV2 A;  3TKR A;  1XWK A;  3TKP A;  1SJZ A;  2L5L A;  2CX4 A;  4POB A;  5F06 A;  2XC2 A;  5HFG A;  4BWS A;  4QL7 A;  3GKX A;  3HZ8 A;  2AV4 A;  2JAC A;  1ILO A;  1Z3E A;  1GNE A;  6GSU A;  4YQU A;  4HEA 2;  2HFD A;  3DVX A;  5INY A;  5KOX A;  3F6F A;  4JU5 A;  4HS1 A;  3GKN A;  4RQR A;  2FHE A;  4WR5 A;  5A5K A;  4GRF A;  4OCE A;  5ECH B;  1K0B A;  3ZFB A;  4HDE A;  2JZT A;  2QA2 A;  2QC7 A;  1CQG A;  4XS1 A;  7GSS A;  5LNK e;  4PNG A;  4DSS A;  3LEF A;  5ECS A;  2F8F A;  2CT6 A;  3BCI A;  4TXO A;  2C4J A;  4HU9 A;  4EKZ A;  5CRW A;  2K18 A;  4MNN A;  4Q5Q A;  2PU9 C;  4CY6 A;  1JHB A;  4MP4 A;  3CTF A;  2MMO A;  5IOX A;  3V1W A;  3I69 A;  2DLX A;  1SD9 A;  1K0D A;  5IMC A;  3EVI A;  3O3T A;  4YKF A;  3F4T A;  1LBK A;  2KHP A;  3ZLP A;  3KH7 A;  4ML1 A;  4IKH A;  5D9W A;  4BVY B;  1R5P A;  4V1A p;  4KW6 A;  4POM A;  3LGC A;  4KUN A;  2FLS A;  2F51 A;  3APS A;  4FYU A;  1YF1 A;  3F3Q A;  2YP6 A;  4K9Z A;  2ALB A;  4ZIL A;  2X4A A;  3TRX A;  4I5Q A;  3F3R A;  5ABR A;  2VL3 A;  1EOG A;  2FA4 A;  1G7E A;  1XW6 A;  1EV9 A;  3F0I A;  4YAV A;  4QQ7 A;  2HSH A;  4PUR A;  2RII A;  5EL8 A;  2VIM A;  2PUK C;  3HYP A;  2FWH A;  3HJO A;  3A2V A;  2H1A A;  1K0A A;  5D8I A;  2VCT A;  4KX4 A;  2BTO T;  3QAG A;  4TN8 A;  2YOI A;  3VI5 A;  4XRD A;  3RHC A;  3Q18 A;  1GRX A;  1X0R A;  3QOU A;  5FHI A;  1KNG A;  2BJX A;  3LOR A;  2LS5 A;  4IQ1 A;  2V1M A;  1VGL A;  1OYJ A;  1XOB A;  5ECL B;  3SBC A;  3ZRD A;  4JED A;  2YZH A;  4KGI A;  4QL9 A;  1GLP A;  4J56 E;  2O8V B;  2OJL A;  1BQ7 A;  3LQ7 A;  1X9W B;  19GS A;  4AGS A;  4MF7 A;  5DAL A;  1M7T A;  3FMW A;  2PN8 A;  4FQU A;  4G0L A;  3HDC A;  2VAF A;  1JFU A;  2AJQ B;  2KP2 A;  3CSH A;  4TKY A;  1J08 A;  4L5L A;  5D73 A;  2O85 A;  4Z2T A;  2YWO A;  1ZL9 A;  2DIY A;  2R2J A;  5B7C A;  1A0F A;  3DWV A;  4O5U A;  4EUY A;  2JSZ A;  3W8J A;  2L4Q A;  4K7O A;  1OAZ A;  2IMD A;  4WF5 A;  4TR1 A;  1T4Z A;  6GSW A;  3J7Y b;  1WE0 A;  9GSS A;  3VK9 A;  5ECN B;  1DBY A;  4V2N A;  5ECI B;  2V6K A;  3UAP A;  3E0U A;  4MZB A;  1PGT A;  2VLU A;  4JZQ A;  2GT5 A;  4ACS A;  1TU8 A;  3VWW A;  1HNC A;  4DVC A;  2H30 A;  14GS A;  2B3S A;  3IK9 A;  3FR3 A;  1F3A A;  4I2U A;  5A4U A;  3GFK A;  2R3X A;  1GWC A;  4EC0 A;  5DDL A;  1KTE A;  1YEX A;  3G7Y A;  4NWY A;  3PR8 A;  1PSQ A;  1O81 A;  1IYH A;  3H1N A;  2R0G A;  5IO0 A;  1MD3 A;  3KH9 A;  5FWG A;  2C0E A;  2DML A;  4K6X A;  1XIY A;  3G7I A;  3HJM A;  3OR5 A;  3CYN A;  3KD0 A;  1JLV A;  1UC7 A;  1T8E B;  2UZ8 A;  2LTK A;  3IOS A;  2X64 A;  1ZYP A;  1W89 A;  3I6A A;  2JL4 A;  3HVV A;  2HZE B;  2H76 A;  5IMV A;  4USS A;  2OBI A;  2WB9 A;  1PX6 A;  20GS A;  4P3Y B;  3HVS A;  3CSI A;  3RDW A;  10GS A;  2CQ9 A;  4JRR A;  4WBJ A;  3GX8 A;  5IOW A;  1V2A A;  5GST A;  1YKC A;  4ZB8 A;  1X5C A;  2CVK A;  2GLR A;  2H66 A;  3KMN A;  3A2W A;  4I6X A;  4LMW A;  2CV4 A;  4EDY A;  2B5Y A;  3FKF A;  4AJ8 A;  4IP6 A;  1THO A;  2YN1 A;  5GSS A;  4O5R A;  4IVF A;  3LSZ A;  1AQV A;  4GST A;  1VRS D;  2PWJ A;  4IHU A;  5D9X A;  4PQI A;  1O8X A;  1SU9 A;  13GS A;  4BVY A;  3SWL A;  1UVZ A;  2HNL A;  4ZBB A;  4K2X A;  1JZO A;  3TKQ A;  4MK3 A;  5CNW A;  3CBU A;  3F6D A;  4XS6 A;  1DE2 A;  5JWO B;  1A2M A;  4KAE A;  3KJY A;  3K8N A;  2KP1 A;  1K0N A;  1AUC A;  4MZW A;  3FR6 A;  4Z2U A;  1EV4 A;  2F3M A;  4MPF A;  4MJB A;  3PGT A;  1TP9 A;  1B48 A;  1E2Y A;  3LYK A;  4OFT A;  3FW2 A;  4OWY A;  2HSY A;  4D73 B;  3L0H A;  3A5I A;  3F63 A;  3VFI A;  4MJE A;  4K7I A;  4L0U A;  2EC4 A;  2K6V A;  3VLN A;  4HQS A;  3TKS E;  2YV9 A;  3QR6 A;  1LJR A;  5B8B A;  4RI7 A;  1SK1 A;  3QCP A;  4DSR A;  1OVN A;  3CXG A;  3PPU A;  4ZXG A;  1GLQ A;  1X9S B;  5H5R A;  1QK8 A;  2YWI A;  3EMX A;  1MDJ A;  3UVH A;  1OE7 A;  1ON4 A;  2CVD A;  1V98 A;  4PX1 A;  3GTU B;  5CRG A;  4F03 A;  5IPH A;  4RI6 A;  1YF0 A;  2XBI A;  2YAN A;  2WGR A;  3ZMK A;  2DBC A;  2DJ2 A;  1XWC A;  4IJ3 A;  4POL A;  2LNT A;  5ID2 B;  3GL3 A;  3QAV A;  2LKU A;  3E3E A;  3MDK A;  5DAK A;  1V58 A;  1GP1 A;  1PRX A;  4XIH A;  5JCU A;  5EPF A;  3EPT A;  4F82 A;  1VF4 A;  3C7M A;  1QUW A;  1MTC A;  2FWG A;  1Z6M A;  4I97 A;  2V32 A;  1O7U A;  3M9K A;  5ECK B;  1PKW A;  1WIK A;  4ECI A;  3IXR A;  1ERV A;  4CW9 A;  2AYT A;  4OFN A;  3FYG A;  5COH A;  2HZF A;  3BJ5 A;  3MWH A;  1SKS B;  3NOF A;  5IMF A;  3R3E A;  1C72 A;  3GNJ A;  4ZL9 A;  3IPZ A;  1TI1 A;  2DJ3 A;  4LL4 B;  4ZB9 A;  5KN2 A;  2B1K A;  3APO A;  1Q4J A;  2DSA A;  4BVX B;  3GMF A;  2PBJ A;  4ULX A;  5G5E A;  5J9C A;  2KLX A;  2GS3 A;  3G7J A;  3ZIV A;  4OCF A;  5H5S A;  4K0G A;  1YKA A;  4MMM A;  4N0V A;  12GS A;  4O92 A;  5D93 A;  1PL2 A;  4F9Z A;  1EGR A;  1HYU A;  3TJF A;  1NM3 A;  2MBS A;  1AXD A;  4K7N A;  2RM5 A;  4HI7 A;  1TU7 A;  2IIY A;  1EWX A;  1ABA A;  3ED3 A;  2YJH A;  4K0N A;  3RHB A;  1JLW A;  2IFQ A;  1BJX A;  4LLR A;  1FVK A;  3FZA A;  3P2A A;  4BA7 A;  5DVB A;  4MJA A;  1J0F A;  1WJK A;  4I2T A;  1Y25 A;  3U6V A;  3QFB C;  1T00 A;  4BWQ A;  3GUR A;  1B4P A;  1GTA A;  3EU3 A;  1QGV A;  5ECQ B;  2HRF A;  3F8U A;  2JZS A;  2FA8 A;  1K0O A;  2NTO A;  2GSR A;  4K1F A;  3GV1 A;  3EC3 A;  3TJB A;  5IO2 A;  4NAX A;  2EIQ A;  3A5W A;  3ZML A;  3MSZ A;  3KZQ A;  3S9F A;  3PH9 A;  1B9X C;  1SYR A;  4EF0 A;  3RPN A;  3HY2 A;  4N10 A;  1WRY A;  3ME8 A;  1ZMA A;  6GSY A;  5KEJ A;  2A4V A;  3MAK A;  4BL7 B;  1BAY A;  4L0W A;  4HOJ A;  4ZBD A;  3GSS A;  5FT3 A;  1TK5 B;  4TOP A;  1GSY A;  1QXH A;  3HJP A;  5DQS A;  4ECJ A;  4PXO A;  1X5D A;  4HZ4 A;  4J2F A;  1IYI A;  4KH7 A;  4L5O A;  4MF6 A;  3UAR A;  1B8X A;  3VPQ A;  1NW2 A;  2X8G A;  3W8S A;  2F8A A;  2JSY A;  4HJ2 A;  5C00 A;  3APQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...