3UVTA

Crystal structure of the third catalytic domain of erp46
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
106
Chain Sequence
b'STVLALTENNFDDTIAEGITFIKFYAPWCGHCKTLAPTWEELSKKEFPGAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSLHRFVLSQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Thioredoxin domain-containing protein 5
publication title Structure of the third catalytic domain of the protein disulfide isomerase ERp46.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 33
structure length 106
sequence length 107
chains with identical sequence B, C, D, E
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3uvtA00
3F3RA 3ZVJD 3APOA 5DCGA 3HY2A 1A24A 2B7KA 5A4UA 2L5OA 4GTUA 3TKRA 3KZQA 1VF2A 4GSSA 2M80A 1PKWA 2Z9SA 4CW9A 1Z6MA 4IS0A 3F63A 3QDNA 4WF5A 1A0FA 4LMWA 2P0GA 3GUSA 1TRSA 3LYPA 1XBSA 2E2MA 1GSSA 1XVQA 4QL7A 3PR8A 4RI7A 3P7XA 3QAVA 2VUPA 3FYGA 3IK7A 6GSVA 3IHQA 4X43A 3FZAA 3TUEA 4KCAA 3ZIJA 5JCGA 3IA1A 1UVZA 4V1Ap 1VF1A 1O73A 2LS5A 3TRQA 2XPEA 2ALBA 2LJRA 1AQWA 2A2RA 2WFCA 1T3BA 1XWAA 1H4OA 4I2UA 4RI6A 3QFBC 5D96A 3F6DA 4OWYA 4L0UA 1BJXA 16GSA 4K7OA 4LA1A 4DVCA 2JACA 4J57E 4GLTA 1RK4A 5F07A 4TR3A 1HNCA 2HT9A 1BX9A 4FO5A 2REMA 3GKNA 4YQUA 3CSJA 1GSEA 1OVNA 4POBA 4OMVA 2H71A 3GMFA 4G2EA 3J7Yk 5CREA 1XW6A 1X0RA 3PGTA 3VK9A 3DEXA 3HDCA 3Q6OA 1F9MA 1T00A 2QGVA 2ZCTA 1WPIA 2YZUA 1FHEA 2YOIA 1WE0A 2GQKA 2DJ1A 1NM3A 1T4ZA 3IR4A 3GKKA 2FCHA 1XIYA 5IIZA 2DSAA 1AC1A 3MNGA 2VAFA 5IO0A 3D4TA 5DQYA 3ZLPA 1V2AA 3CSHA 4KCEA 3LQ7A 5G2ZA 3C1SA 2GVPA 2AUVA 3KXOA 2C0EA 2PWJA 5AISA 1XW9A 3VLNA 3IC4A 4O32A 5DAKA 3TJKA 3O76A 2MYGA 4XS4A 5F0GA 4I5QA 4Q5NA 3BJ5A 2GZPA 4JBBA 2BJXA 5IMAA 3FK8A 3FHKA 3HCZA 1OAZA 1SJ6A 3LYKA 4HZ4A 4HDEA 2FUG2 1SYRA 3ERGA 5B6NA 4HQSA 2CZ3A 2OKAA 5HR2A 2H0IA 1ZGNA 2LUSA 4X0XA 1GTIA 3TRXA 3HXSA 3WT2A 1K3YA 3EYTA 2GT6A 3E3EA 1GTAA 4ZB9A 2XPDA 1SKRB 2QSIA 3ZL5A 5HR1A 4WF4A 1NHYA 1S3AA 1F6MC 3RDWA 1B4QA 4JEDA 5G31A 3HZ4A 3RAZA 4MH2A 2K8SA 3IDVA 4WR4A 1OE8A 3RPPA 4MJCA 2A4VA 3H4KA 2PN8A 3UVHA 3KM6A 5JWRB 5HFGA 3L9SA 1J0FA 2X8GA 4L5LA 2FWEA 2KLXA 4F9ZA 3H8QA 3FY7A 1OE7A 5ID2A 4BWQA 1YKAA 5GSTA 4KAEA 1EOHA 2LV3A 1VF4A 5J3RA 2WJUA 5JCUA 4Z7XA 3DVWA 2DJ3A 5G5FA 1EGRA 1V58A 4XIHA 4EKZA 4PUAA 3I43A 2OA7A 3VURA 4KH7A 2C3NA 4MJBA 2RIIA 3TJGA 4PUFC 4TKYA 1IYHA 2ON5A 3UEMA 5KN0A 2C80A 4HJ2A 1KNGA 4YH2A 2CT6A 2CAQA 5LNKe 3IAS2 1GLPA 3CSIA 3RHCA 1X9SB 2F3MA 1THOA 2L6CA 5G1LA 4IJ3A 1V57A 3LXZA 3HYPA 5JWOB 2VM2A 4K8MA 4Q5FA 4J2FA 3PH9A 1OC3A 5ENUA 1NW2A 3EWLA 4HOJA 2HI7A 2FHEA 3BD2A 4X1UA 4MLYA 4O92A 2JZRA 3ZMLA 3TJFA 3HVXA 3KH9A 3IXRA 2K18A 2J23A 3IRAA 2V6KA 3FR9A 3AY8A 2LKUA 3QD9A 3C1RA 4BPYA 1PN9A 3EMPA 2LEGA 2H0HA 5ECMB 5FHIA 4MF5A 1MTCA 2M72A 3KEBA 4EO3A 1AIUA 3NIVA 4ECIA 4MF7A 1OKDA 1A23A 2O87A 3TB2A 4KW6A 5ABRA 1TW9A 2HZFA 1OC9B 1OYJA 1FVKA 1XZOA 2MMAA 1Z5YE 1M9BA 4MZWA 5IM9A 4DSRA 2A2SA 4NPBA 2MBSA 1FG4A 4MH3A 4F0CA 2IL3A 3F4SA 1W4VA 4HQZA 1FVJA 6GSXA 1SL1B 3DRNA 3CRUA 4IQ1A 2HLSA 2VCVA 1GRXA 4IKHA 5IQYA 2LNSA 1GSQA 1Z9HA 3FR3A 2TIRA 2X64A 5J5NA 5DQSA 4EL1A 4N30A 4L0WA 3UL3A 2WCIA 5ECIB 4WBRD 4AJ7A 3GYKA 5COHA 2DMMA 3H79A 3LXTA 2XBQA 5AIVA 1AW9A 4H86A 4D73A 2JU5A 4GWRA 1EP8A 2JZTA 4XRAA 1U3AA 1M0UA 4K9ZA 2DIYA 4KE3A 2AYTA 1Z6NA 1THXA 1VF3A 5IMZA 1GSDA 5CRGA 5CNWA 3M8NA 3GN3A 1PRXA 2OADA 2QC7A 1K0OA 2HNLA 1G6YA 2IJYA 3GRXA 1ON4A 2F51A 4XHMA 1HYUA 3HA9A 4WR5A 3QCPA 2YWOA 2CX3A 4MF6A 1MDKA 19GSA 5HQPA 2OBKA 2H0GA 2KHPA 1Z7RA 2YANA 3C71A 2IN3A 3L78A 2DC5A 2PBJA 3TOTA 2R37A 2YZHA 1BYEA 5IOWA 4F0BA 4MZCA 3KH7A 2IIYA 1B4PA 2JSYA 5G30A 4HS1A 2JL4A 2F8FA 1K0NA 3NZNA 1SD9A 4FIWA 4GF0A 4MP4A 5ECQB 1XWBA 2FLSA 4LL4B 3VWXA 4HZ2A 2VL2C 1TK8B 5GAND 2FA8A 4KNDA 4TXOB 4K6XA 3CYNA 3GTUB 1FAAA 1YDKA 5F8BA 2YCDA 2X8HA 2YWMA 4QQ7A 2LTKA 1EP7A 3EE2A 1ACVA 2VCWA 4HUAA 4N0VA 3BOAA 3HKRA 3N9JA 4ML1A 2R6KA 3WGEA 4WXTA 1TP9A 1FW1A 3LEFA 4N11A 1JZRA 1GH2A 1A2JA 1O7UA 3P8WA 4ID0A 2NVLA 1HNBA 2NPBA 2N5FA 5C00A 3GA4A 5D9VA 1IYIA 2GZZA 3EINA 3SWLA 4IELA 2I3YA 3LJRA 3L9UA 4IBPA 1PKZA 5D9WA 1PQNA 4IN0A 4IHUA 4XTSA 2C3QA 3A2WA 1EZKA 4ACSA 4PURA 12GSA 4K7IA 4POMA 1O8XA 2O8VB 1EV9A 1SL0B 3D5JA 3M0FA 2CV4A 4MMMA 4AGSA 2R4VA 1BAYA 1X5DA 3D21A 4XS6A 3VI7A 1FO5A 2HXKA 3TJJA 4FYCA 2HSYA 2OE0A 5IOXA 4GQCA 2FD3A 2NBSA 3KD0A 2E7PA 2DLXA 4BVYA 2VLUA 5ECHB 1B9XC 3GH9A 1DBYA 3GV1A 4CHSA 4NAXA 4IW9A 1GNWA 2F8AA 3KJYA 1URMA 3KMNA 1GNEA 4KA0A 2I81A 1E6BA 2YV9A 5D8IA 5ECSA 4OCFA 1Q98A 2B5EA 4XS1A 4ZL7A 4MCUA 5IMCA 2EC4A 1AUCA 4BL7A 1R4WA 1FOVA 1WJKA 3M3MA 5G1KA 5AN1A 2KOKA 3APSA 4EDYA 1OKTA 4NMUA 2G2QA 2ZUPA 2WZ9A 2X8CA 2N5AA 1SJZA 2P5RA 2LNTA 2YJ7A 3GX8A 5FT3A 2VL2A 3UBLA 2JZSA 1U3IA 1HD2A 2H1GA 2PMTA 2C0FA 5B8BA 1I5GA 4EDZA 3U6VA 4K0GA 3M9JA 2I4AA 2LRTA 2TRXA 2H1BA 5G5EA 1UA5A 4TXVA 4JR4A 4ZL8A 4ZL9A 1X5EA 1XWCA 2CVDA 4I6XA 4BVXA 2WB9A 3H93A 5KN2A 2IFQB 2GTUA 4EC0A 1GULA 4IQAA 1MD3A 18GSA 4JU5A 3A3TA 3NOFA 3GIXA 3IPZA 5JWQB 2GT5A 1Z3EA 2YV7A 4FYBA 1GUMA 3CXGA 3G7YA 1YEXA 1AQVA 1K0MA 5ELGA 1TK5B 2JADA 3UOMA 2GSSA 3F4RA 5DALB 4ZBDA 3TGZA 3H1NA 4FYUA 2P5QA 3HVVA 5KEJA 3W6GA 2K9FA 4PNGA 4WEYA 2MMZA 1GL8A 4V1Ag 3APQA 4ML6A 1F2EA 1FB0A 4E8EA 3G7JA 4DSQA 1XOAA 1PL1A 2YP6A 2VLTA 3D4MA 3WGXA 22GSA 5F05A 2WRTA 2VCZA 3QFAC 3F0IA 4YQVA 2AJQB 2IMEA 2YPMA 2J9HA 4TR1B 4KUNA 2O85A 4TRXA 3HZ8A 5CAXA 1SKWB 3LWAA 4KB3A 2H6ZA 1RQMA 4ZILA 2IMIA 1JZWA 2L5LA 5A5KA 4AJ8A 2RM6A 2VO4A 5AIXA 3ZITA 3EU3A 3KGKA 3FW2A 3N5OA 2FY6A 4K1FA 4QL9A 2PU9C 1XWGA 2V41A 3I6AA 5GAPD 3US3A 1HNAA 1TTZA 2OBIA 4NWYA 2HFDA 3EMXA 4NV5A 4POLA 2DJ0A 3KCMA 1GSUA 1ERUA 3O6TA 1M99A 2H6XA 5B7CA 2HZEB 3IK9A 4KDUA 5J9BA 1K3OA 3UJ1A 1SD8A 5CYYA 4YAPA 1Z7PA 6GSTA 1KTEA 3QR6A 3ERWA 1K0DA 1QMVA 4OO5A 1GLQA 5DBQA 2FWGA 4YQMA 1ZMAA 3ZFBA 2OACA 1NSWA 2C3TA 5J41A 1SENA 1YJ6A 4DSSA 1G0TA 1N2AA 5ECKB 1KEBA 1XPVA 1SYXA 5D93A 2X99A 1X9WB 3ZFLA 14GSA 2GQMA 3DGQA 6GSWA 6GSUA 4F03A 2VD0A 5IMFA 2V32A 1WOUA 1PSQA 4ULXA 1TU7A 1U87A 1YQ1A 4TOPA 2YNXA 2B3SA 4AF2A 2B5XA 5DDLA 3CRTA 1GTUA 1GSFA 1QUWA 1QFNA 3C8EA 10GSA 3A5WA 3UAPA 1A0RP 1TDIA 4NHWA 5B6MA 2H1AA 1O6JA 3M1GA 3QAGA 2RM5A 3O3TA 1YKCA 4GXZA 1JZDA 5HR3A 1Y6EA 1ABAA 3RBTA 1LJRA 2BMXA 2VD1A 3GURA 1OC9A 2XBIA 3KP8A 3ZZXA 1Y25A 1R5PA 1JLWA 4TN8A 2EIOA 5H5RA 1AXDA 4PX1A 1EEJA 5GSSA 5DJLA 2D2ZA 3LORA 3ZIVA 2QKEA 3BBYA 5GZZB 5ECLB 2CAIA 3L0HA 1U6TA 3IAM2 5CRDA 3VPQA 3E9JB 3VWWA 2WULA 5EY6A 4JRRA 3HJMA 2GGTA 1TXXA 4I8BA 4XCSA 3FR6A 2AAWA 2H1DA 1XVWA 1TI1A 1VGLA 5CP1A 4KX4A 3FKFA 5E4WA 3KIJA 2CA8A 5FWGA 1WMJA 5H5QA 3CBUA 2C8UA 1AAZA 3D22A 3ZRDA 4BWSA 4OO4A 2HRNA 2PERA 4JR6A 3U5RE 3I9V2 3IV4A 2AHEA 1MDJA 3IBHA 2PUKC 2LJAA 1T1VA 4HU7A 3G9BA 3MDKA 2GSQA 2B1KA 3LGCA 5EPFA 4ECBA 2IWTA 6GSSA 3W8JA 5ECOB 3M9KA 3QAWA 20GSA 2HYXA 1ZL9A 4O5RA 2WGRA 3ZREA 4ISDA 3G7IA 4KSMA 4GQFA 2OE1A 1ZYQB 2ES7A 3DYRA 4BA7A 5H5SA 13GSA 1DE1A 4MPFA 3DKSA 3JCML 2H70A 2EIRA 2I1UA 1ZCPA 5ELAA 4TXOA 4P3YB 2VCTA 3GTUA 2V2GA 3L9VA 1TRUA 1DSBA 4I97A 4G9HA 4KGIA 4PQ1A 3RPNA 4MABA 3TKSE 1ZOFA 4ECCA 1TRWA 1V9WA 4LMVA 2B5YA 3IE3A 3DWVA 2JSZA 3W8SA 3GKMA 2H73A 2IPAA 1A8YA 8GSSA 1ML6A 2HSHA 1U88A 3D6IA 1M2BA 3L4NA 3C73A 4GSTA 4MK3A 5ECPB 4F2IA 1SK1A 4HI7A 4DEJA 4EE0A 2O89A 3LSZA 3EVIA 1M9AA 3UIWA 2VL3A 4ZB6A 1LBKA 5F06A 2IMFA 11GSA 2NTOA 1PGTA 4IJIA 4OFTA 3Q18A 2FA4A 3A2VA 3EC3A 3R2QA 5DVBA 4OCEA 3VFIA 3HJOA 3FZ4A 1JFUA 5D73A 1QXHA 2CQ9A 2M46A 3CMIA 4V2MA 1SK0A 7GSSA 17GSA 2OE3A 1T7PB 4NV2A 1UN2A 1PX7A 1W89A 4N10A 1EGOA 2RUEA 3F9UA 1PL2A 2VOCA 4ZBBA 4AJ6A 3VI5A 1M7TA 1JLVA 1EV4A 2VLVA 3IOSA 1EOGA 1K0AA 3FZ5A 1I9DA 3WGDA 3QOUA 2GS3A 1XCCA 3DMLA 3GSTA 4G19A 4HJMA 4NXIA 2AV4A 5D9TA 4IVFA 3C7MA 1WRYA 3EU4A 5L71A 1BG5A 1TOFA 2CZ2A 1G7EA 3GHAA 3KTBA 4KDXA 5EL8A 4RQRA 4IP6A 2H76A 2YWIA 4V2LA 2FWFA 2PGTA 2LQQA 2TRCP 3Q74A 1ZYEA 4MA9A 2MZCA 3DXBA 1M2DA 1UC7A 2DIZA 4MJEA 1AQXA 2G0FA 2GZYA 3GFKA 5DCHA 2MMNA 1ST9A 5J9CA 5HFKA 2L6DA 3GSSA 2FGXA 4RQXA 2H66A 4L5OA 2VIMA 3V1WA 3E0UA 1PMTA 4KSOA 3TJBA 2C0DA 1CQGA 1EWXA 2P31A 1Q4JA 1GWCA 4K7NA 3GKXA 1K0BA 1QQ2A 2IFQA 2YJHA 2WS2A 1BEDA 3ED3A 1YZXA 4ZB8A 5DAKB 2LRNA 4Q5QA 1ERTA 3ZYWA 4XS4B 5ECNB 2B6MA 3TKQA 2F9SA 3DD3A 4WKWA 5EVOA 4OFNA 4YAVA 4ECJA 4EUYA 6GSYA 1T8EB 1SJIA 5DJMA 5HFIA 3ZTLA 3MAKA 5DALA 1TKDB 4JE1A 3HJPA 4EF0A 4PGTA 3VWVA 3I69A 2MMOA 2ZNMA 3ERFA 2FWHA 4ILFA 2DBCA 2B7JA 2O7KA 3VPTA 1FB6A 4E8HA 2KUCA 2VM1A 2V1MA 3MSZA 4PNFA 1GUHA 2VCQA 2XC2A 3FZ9A 1G7OA 3F8UA 9GSSA 4EVMA 2FNOA 3A2XA 4TR1A 2NDOA 5E59A 1YY7A 5JCWA 2LSTA 1XFLA 5A4WA 3ZVJA 1WWJA 2C0GA 1MEKA 1H75A 3TKSC 4OFMA 3UVTA 4GSNA 4ZIJA 1V98A 3SBCA 4I2TA 4TR0A 4L8EA 1TK0B 3KTLA 5ID2B 3VWUA 4J56E 2H01A 2PVQA 2IMDA 1F37A 1SK2A 4V2NA 5HR0A 2CVKA 4GCIA 3TOUA 1S3CA 4N0ZA 4O7HA 5LCZA 3MWHA 4WETA 4OD7A 1JHBA 1XXUA 3HD5A 3UMAA 5IMDA 5CRHA 1K3LA 1GSYA 2HZEA 5KN3A 1C72A 4WBJA 1NHOA 1RW1A 1YF1A 2H8LA 1MDIA 3P2AA 3HHVA 3OR5A 1M2AA 1SL2B 1XWKA 2H6YA 4LL1B 1R26A 3WD6A 3GX0A 2H75A 3TCOA 5IPHA 4JZQA 5IO2A 3TKPA 1B48A 2HE3A 1A2LA 4LLRA 1YEPA 2VCXA 4POKA 2H30A 1K0CA 3J7Yb 1G6WA 1V40A 2WDUA 1MD4A 4NHZA 2B1LA 1GUKA 3WYWA 4HEA2 2I9HA 2DJJA 3F4TA 4DSSB 3S9FA 3QMXA 2L57A 3HVSA 1WP0A 1O85A 3DVXA 2GLRA 4K2DA 5AGYA 4KDYA 3ISOA 4XRDA 2YN1A 1OC8A 3GL5A 1ZZYA 3F6FA 4ZXGA 1A2MA 3BCKA 1HQOA 3KP9A 1TRVA 3GL3A 2BTOT 3GNJA 1ERVA 3P90A 3BCIA 4Q5RA 5IMVA 2GQLA 3Q19A 2ON7A 1X9MB 4MPGA 2L4CA 2R3XA 1VRSD 1ERWA 3LFLA 2HRFA 3F3QA 3ME7A 1S3DA 4HU9A 3CTGA 1EEMA 3FRCA 2OJLA 3FEUA 2AB6A 2GDRA 4G10A 1R5AA 1PD21 1XOBA 4TW5A 2H72A 1CQHA 1TI3A 1PA3A 1SU9A 4CDOA 1A8LA 3UARA 2E0QA 2H74A 3ME8A 1J08A 5B8AA 1USBA 3TKSA 4EXJA 2V6OA 5CRWA 5KN1A 2DJKA 4PQIA 1X5CA 2H19A 4MDCA 5CO3A 1B8XA 2CX4A 1F3AA 3EURA 4K0NA 3D0ZA 2C4JA 1YF0A 2L4QA 4PQHA 2KP1A 2MBTA 2LJKA 1R7HA 2PVOC 2KP2A 1QGVA 2IMKA 2K8VA 5ECRB 1DUGA 1E2YA 4MJAA 4TR4A 4FH8A 1QK8A 2LRCA 4IGJA 5LD0A 5INYA 3LG6A 4ZBAA 2DJ2A 3K8NA 4D73B 2C1YA 3RHBA 1WIKA 4RUVA 1O8WA 3WT1A 1LU4A 2EIQA 2YWNA 1XW5A 3DIEA 3TRPA 2LQOA 2E2GA 1DE2A 2CVBA 1GTBA 1B9YC 1JZOA 2K6VA 5A4VA 1O81A 1T4YA 2L59A 4F82A 3GH6A 2RLIA 5D9XA 3ZMKA 2DMLA 1GP1A 3PINA 2N5BA 1F3BA 2XHFA 4MZBA 2VL9A 1N8JA 3TDGA 5IPGA 1J9BA 1TJDA 1BQ7A 5C04A 3KMOA 4GRFA 2RUFA 5J4UA 4PXOA 1PX6A 3UBKA 2R2JA 3CTFA 4TVEA 2GSTA 2R5GA 2GSRA 1KBNA 2PPTA 1TU8A 1SKSB 4IP1A 1ILOA 3QPMA
chains in the Genus database with same CATH superfamily
3F3RA 3ZVJD 3APOA 5DCGA 3HY2A 1A24A 2B7KA 4K5SA 5A4UA 2L5OA 4GTUA 3TKRA 3KZQA 1VF2A 4GSSA 2M80A 1PKWA 2Z9SA 4CW9A 1Z6MA 4IS0A 1XG8A 4EIQA 3F63A 3QDNA 4WF5A 1A0FA 4LMWA 2P0GA 3GUSA 1TRSA 3LYPA 1XBSA 2E2MA 1GSSA 1XVQA 4QL7A 3PR8A 4RI7A 3P7XA 3QAVA 2VUPA 3FYGA 3IK7A 6GSVA 3IHQA 4X43A 3FZAA 3TUEA 3IHGA 4KCAA 3ZIJA 5JCGA 3IA1A 1UVZA 4V1Ap 1VF1A 1O73A 2LS5A 3TRQA 2XPEA 2ALBA 2LJRA 1AQWA 2A2RA 2WFCA 1T3BA 1XWAA 1H4OA 4I2UA 4RI6A 3QFBC 5D96A 3F6DA 4OWYA 4L0UA 1BJXA 16GSA 4K7OA 2A4HA 4LA1A 4DVCA 2JACA 4J57E 4GLTA 1RK4A 5F07A 4TR3A 1HNCA 2HT9A 1BX9A 4FO5A 2REMA 4BVYB 3GKNA 4YQUA 3CSJA 1GSEA 1OVNA 4POBA 4OMVA 2H71A 3GMFA 4G2EA 3J7Yk 5CREA 1XW6A 1X0RA 3PGTA 3VK9A 3DEXA 3HDCA 3Q6OA 1F9MA 1T00A 2X4AA 2QGVA 2ZCTA 1WPIA 2YZUA 1FHEA 2YOIA 1WE0A 2GQKA 2DJ1A 1NM3A 1T4ZA 3IR4A 3GKKA 2FCHA 1XIYA 5IIZA 2DSAA 1AC1A 3MNGA 2VAFA 5IO0A 3D4TA 5DQYA 3ZLPA 1V2AA 3CSHA 4KCEA 3LQ7A 5G2ZA 3C1SA 2GVPA 2AUVA 3KXOA 2C0EA 2PWJA 5AISA 1XW9A 3VLNA 3IC4A 4O32A 5DAKA 3TJKA 3O76A 2MYGA 4XS4A 5F0GA 4I5QA 4Q5NA 3BJ5A 2GZPA 4JBBA 4FQUA 2BJXA 5IMAA 3FK8A 3FHKA 3HCZA 1OAZA 1SJ6A 3LYKA 4BVXB 4HZ4A 4HDEA 2FUG2 1SYRA 3ERGA 4Z2UA 5B6NA 4HQSA 2CZ3A 2OKAA 5HR2A 2H0IA 1ZGNA 2LUSA 4X0XA 1GTIA 3TRXA 3HXSA 3WT2A 1K3YA 3EYTA 2GT6A 3E3EA 1GTAA 4ZB9A 2XPDA 1SKRB 2QSIA 3ZL5A 5HR1A 4WF4A 1NHYA 1S3AA 1F6MC 3RDWA 1B4QA 4JEDA 5G31A 3HZ4A 3RAZA 4MH2A 2K8SA 3IDVA 4WR4A 1OE8A 3RPPA 4MJCA 2A4VA 3H4KA 2PN8A 3UVHA 3KM6A 5JWRB 5HFGA 3L9SA 1J0FA 4USSA 2X8GA 4L5LA 2FWEA 2KLXA 4F9ZA 3H8QA 3FY7A 1OE7A 5ID2A 4BWQA 1YKAA 5GSTA 4KAEA 1EOHA 2LV3A 1VF4A 5J3RA 2WJUA 5JCUA 4Z7XA 3DVWA 2DJ3A 5G5FA 1EGRA 1V58A 4XIHA 4EKZA 4PUAA 3I43A 2OA7A 3VURA 4KH7A 2C3NA 4MJBA 2RIIA 3TJGA 4PUFC 4TKYA 1IYHA 2ON5A 3UEMA 5KN0A 2C80A 4HJ2A 1KNGA 4YH2A 2CT6A 2CAQA 4G0LA 5LNKe 3IAS2 4EIPA 1GLPA 3CSIA 3RHCA 1X9SB 2F3MA 1THOA 2L6CA 5G1LA 4IJ3A 1V57A 3LXZA 3HYPA 5JWOB 2VM2A 4K8MA 4Q5FA 4J2FA 3PH9A 1OC3A 1ZYPA 5ENUA 1NW2A 3EWLA 4HOJA 2QA2A 2HI7A 2FHEA 3BD2A 4X1UA 4MLYA 4O92A 2JZRA 3ZMLA 4BIKA 3TJFA 3HVXA 3KH9A 3IXRA 2K18A 2J23A 3IRAA 2V6KA 3FR9A 3AY8A 2LKUA 3QD9A 3C1RA 4BPYA 1PN9A 3EMPA 2LEGA 2H0HA 5ECMB 5FHIA 4MF5A 1MTCA 2A2PA 2M72A 3KEBA 4EO3A 1AIUA 3NIVA 4ECIA 4MF7A 1OKDA 4CY8A 1A23A 2O87A 3TB2A 4KW6A 5ABRA 1TW9A 2HZFA 1OC9B 1OYJA 1FVKA 1XZOA 2MMAA 1Z5YE 1M9BA 4MZWA 5IM9A 4DSRA 2A2SA 4NPBA 2MBSA 1FG4A 4MH3A 4F0CA 2IL3A 3F4SA 1W4VA 3MYDA 4HQZA 1FVJA 6GSXA 1SL1B 3DRNA 3CRUA 4IQ1A 2HLSA 2VCVA 1GRXA 4IKHA 5IQYA 2LNSA 1GSQA 1Z9HA 3FR3A 2TIRA 2X64A 5J5NA 5DQSA 4EL1A 4N30A 4L0WA 3UL3A 2WCIA 5ECIB 4WBRD 4AJ7A 3GYKA 5COHA 2DMMA 3H79A 3LXTA 2XBQA 5AIVA 3LW9A 1AW9A 4H86A 4D73A 2JU5A 4GWRA 1EP8A 2JZTA 4XRAA 1U3AA 1M0UA 4K9ZA 2DIYA 4KE3A 2AYTA 1Z6NA 1THXA 1VF3A 5IMZA 1GSDA 4ICYA 5CRGA 5CNWA 3M8NA 3GN3A 1PRXA 2OADA 2QC7A 5BMUA 1K0OA 2HNLA 1G6YA 2IJYA 3GRXA 1ON4A 2F51A 4XHMA 1HYUA 3HA9A 4WR5A 3QCPA 2YWOA 2CX3A 4MF6A 1MDKA 19GSA 5HQPA 2OBKA 2H0GA 2KHPA 1Z7RA 2YANA 3C71A 2IN3A 3L78A 2DC5A 2PBJA 3TOTA 2R37A 2YZHA 4YKGA 1BYEA 5IOWA 4F0BA 4MZCA 3KH7A 2IIYA 1B4PA 2JSYA 5G30A 4HS1A 2JL4A 2F8FA 1K0NA 3NZNA 1SD9A 4FIWA 4GF0A 4MP4A 5ECQB 1XWBA 2FLSA 4LL4B 3VWXA 4HZ2A 2VL2C 1M3JA 1TK8B 5GAND 2FA8A 4KNDA 4TXOB 4K6XA 3CYNA 3GTUB 1FAAA 1YDKA 4MNNA 5F8BA 2YCDA 2X8HA 2YWMA 4QQ7A 2LTKA 1EP7A 3EE2A 1ACVA 2VCWA 4HUAA 4N0VA 3BOAA 3HKRA 3N9JA 4ML1A 2R6KA 4A5PA 3WGEA 4WXTA 1TP9A 1FW1A 3LEFA 4N11A 1JZRA 1GH2A 1A2JA 1O7UA 3P8WA 4ID0A 2NVLA 1HNBA 2NPBA 2N5FA 5C00A 3GA4A 5D9VA 1IYIA 2GZZA 3EINA 3SWLA 4IELA 2I3YA 3LJRA 3L9UA 4IBPA 1S3RA 1PKZA 5D9WA 1PQNA 4IN0A 4IHUA 4XTSA 2C3QA 3A2WA 1EZKA 4ACSA 4PURA 12GSA 4K7IA 4POMA 1O8XA 2O8VB 3R3EA 1EV9A 1SL0B 3D5JA 3M0FA 2CV4A 4MMMA 4AGSA 2R4VA 1BAYA 1X5DA 3D21A 4XS6A 3VI7A 1FO5A 2HXKA 3TJJA 4FYCA 2HSYA 2OE0A 5IOXA 4GQCA 2FD3A 2NBSA 3KD0A 2E7PA 2DLXA 4BVYA 2VLUA 5ECHB 1B9XC 3GH9A 1DBYA 3GV1A 4CHSA 4NAXA 4IW9A 2R0CA 1GNWA 2F8AA 3KJYA 1URMA 3KMNA 1GNEA 4KA0A 2I81A 1E6BA 2YV9A 5D8IA 5ECSA 4OCFA 1Q98A 2B5EA 4XS1A 4ZL7A 3PPUA 4MCUA 5IMCA 2EC4A 1AUCA 4BL7A 1R4WA 1FOVA 1WJKA 3M3MA 5G1KA 5AN1A 2KOKA 3APSA 4EDYA 1OKTA 4NMUA 2G2QA 2ZUPA 2WZ9A 2X8CA 2N5AA 1SJZA 2P5RA 2LNTA 2YJ7A 3GX8A 5FT3A 2VL2A 3UBLA 2JZSA 1U3IA 1HD2A 2H1GA 4O5UA 4YKFA 2PMTA 2C0FA 5B8BA 1I5GA 4EDZA 3U6VA 4K0GA 3M9JA 2I4AA 2LRTA 2TRXA 2H1BA 5G5EA 1UA5A 4TXVA 4JR4A 4X4JA 4ZL8A 4ZL9A 1X5EA 1XWCA 2CVDA 4I6XA 4BVXA 2WB9A 3H93A 5KN2A 2IFQB 2GTUA 4EC0A 1GULA 4IQAA 1MD3A 18GSA 4JU5A 3A3TA 3NOFA 3GIXA 3IPZA 5JWQB 2GT5A 1Z3EA 2YV7A 4FYBA 1GUMA 3CXGA 3G7YA 1YEXA 1AQVA 1K0MA 5ELGA 1TK5B 2JADA 3UOMA 2GSSA 3F4RA 5DALB 4ZBDA 3TGZA 3H1NA 4FYUA 2P5QA 3HVVA 5KEJA 3W6GA 2K9FA 4PNGA 4WEYA 2MMZA 1GL8A 4V1Ag 3APQA 4ML6A 1F2EA 1FB0A 4E8EA 3G7JA 4DSQA 1XOAA 1PL1A 2YP6A 2HSMA 2VLTA 3D4MA 3WGXA 22GSA 2WRTA 5F05A 2VCZA 3QFAC 3F0IA 4YQVA 2AJQB 2IMEA 2YPMA 2J9HA 4TR1B 4KUNA 2O85A 4TRXA 3HZ8A 5CAXA 1SKWB 3LWAA 4KB3A 2H6ZA 1RQMA 4ZILA 2IMIA 1JZWA 2L5LA 5A5KA 4AJ8A 2RM6A 2VO4A 5AIXA 3ZITA 3EU3A 3KGKA 3FW2A 3N5OA 2FY6A 4K1FA 4QL9A 2PU9C 1XWGA 2V41A 3I6AA 5GAPD 3US3A 1HNAA 3CQFA 1TTZA 2OBIA 4NWYA 2HFDA 3EMXA 4NV5A 4POLA 2DJ0A 3KCMA 1GSUA 1ERUA 3O6TA 1M99A 2H6XA 5B7CA 2HZEB 3IK9A 4KDUA 5J9BA 1K3OA 3UJ1A 1SD8A 5CYYA 4YAPA 1Z7PA 6GSTA 1KTEA 3QR6A 3ERWA 1K0DA 1QMVA 4OO5A 1GLQA 5DBQA 2FWGA 4YQMA 4CY6A 1ZMAA 3ZFBA 2OACA 1NSWA 2C3TA 5J41A 1SENA 1YJ6A 4DSSA 1G0TA 1N2AA 5ECKB 1KEBA 1XPVA 1SYXA 5D93A 2X99A 1X9WB 3ZFLA 4K5RA 14GSA 2GQMA 3DGQA 6GSWA 6GSUA 4F03A 2VD0A 5IMFA 2V32A 1WOUA 1PSQA 4ULXA 1TU7A 1U87A 1YQ1A 4TOPA 2YNXA 4Z2RA 2B3SA 4AF2A 2B5XA 5DDLA 3CRTA 1GTUA 1GSFA 1QUWA 1QFNA 3C8EA 10GSA 3A5WA 3UAPA 1A0RP 1TDIA 4NHWA 5B6MA 2H1AA 1O6JA 3M1GA 3QAGA 2RM5A 3O3TA 1YKCA 4GXZA 1JZDA 5HR3A 1Y6EA 1ABAA 3RBTA 1LJRA 2BMXA 2VD1A 3GURA 1OC9A 2XBIA 3KP8A 3ZZXA 1Y25A 1R5PA 1JLWA 4TN8A 2EIOA 5H5RA 1AXDA 1PN0A 4PX1A 1EEJA 5GSSA 5DJLA 2D2ZA 3LORA 3ZIVA 2QKEA 3BBYA 5GZZB 5ECLB 2CAIA 3L0HA 4G0KA 1U6TA 3IAM2 5CRDA 3VPQA 3E9JB 3VWWA 2WULA 5EY6A 4JRRA 3HJMA 2GGTA 1TXXA 4I8BA 4XCSA 3FR6A 2AAWA 2H1DA 1XVWA 1TI1A 1VGLA 5CP1A 4KX4A 3FKFA 5E4WA 3KIJA 2CA8A 5FWGA 2QA1A 1WMJA 5H5QA 3CBUA 2C8UA 1AAZA 3D22A 3ZRDA 4BWSA 4OO4A 2HRNA 2PERA 2R0GA 4JR6A 3U5RE 3I9V2 3IV4A 2AHEA 1MDJA 3IBHA 2PUKC 2LJAA 1T1VA 4HU7A 3G9BA 3MDKA 2GSQA 2B1KA 3LGCA 5EPFA 4ECBA 2IWTA 6GSSA 3W8JA 5ECOB 3M9KA 3QAWA 4KF9A 20GSA 2HYXA 1ZL9A 4O5RA 2WGRA 3ZREA 4ISDA 3G7IA 4KSMA 4GQFA 2OE1A 1ZYQB 2ES7A 3DYRA 4BA7A 5H5SA 13GSA 1DE1A 4MPFA 3DKSA 3JCML 2H70A 2EIRA 2I1UA 5KOWA 1ZCPA 5ELAA 4TXOA 4P3YB 2VCTA 3GTUA 2V2GA 3L9VA 1TRUA 1DSBA 4I97A 4G9HA 4KGIA 4PQ1A 3RPNA 4MABA 3TKSE 1ZOFA 4ECCA 1TRWA 1V9WA 4LMVA 2B5YA 3IE3A 3DWVA 2JSZA 3W8SA 3GKMA 2H73A 2IPAA 1A8YA 8GSSA 1ML6A 2HSHA 1U88A 3D6IA 1M2BA 3L4NA 1PFOA 3C73A 4GSTA 4MK3A 5ECPB 4F2IA 1SK1A 4HI7A 4DEJA 4EE0A 2O89A 3LSZA 3EVIA 1M9AA 3UIWA 2VL3A 4ZB6A 1LBKA 5F06A 2IMFA 11GSA 2NTOA 1PGTA 4IJIA 4OFTA 3Q18A 2FA4A 3A2VA 3EC3A 3R2QA 5DVBA 4OCEA 3VFIA 3HJOA 3FZ4A 1JFUA 5D73A 1QXHA 2CQ9A 2M46A 3CMIA 4V2MA 1SK0A 7GSSA 17GSA 2OE3A 1T7PB 4NV2A 1UN2A 1PX7A 1W89A 4N10A 3HVNA 1EGOA 2RUEA 3F9UA 1PL2A 2VOCA 4ZBBA 4AJ6A 3VI5A 1M7TA 2DKHA 1JLVA 1EV4A 2VLVA 3IOSA 1EOGA 1K0AA 3FZ5A 1I9DA 3WGDA 3QOUA 2GS3A 1XCCA 3DMLA 3GSTA 4G19A 4HJMA 4NXIA 2AV4A 4IVFA 3C7MA 1WRYA 3EU4A 5D9TA 5L71A 1BG5A 1TOFA 2CZ2A 1G7EA 2UZ8A 3GHAA 3KTBA 4KDXA 5EL8A 4RQRA 4IP6A 2H76A 2YWIA 4V2LA 2FWFA 2PGTA 2LQQA 2TRCP 3Q74A 1ZYEA 3IC8A 4MA9A 2MZCA 3DXBA 1M2DA 1UC7A 2DIZA 4MJEA 1AQXA 2G0FA 2GZYA 3GFKA 5DCHA 2MMNA 1ST9A 5J9CA 5HFKA 2L6DA 3GSSA 2FGXA 4RQXA 4BL7B 2H66A 4L5OA 2VIMA 3V1WA 3E0UA 1PMTA 4KSOA 3TJBA 2C0DA 1CQGA 1EWXA 2P31A 1Q4JA 1GWCA 4K7NA 3GKXA 1K0BA 1QQ2A 2IFQA 2YJHA 2WS2A 1BEDA 3ED3A 1YZXA 4ZB8A 5DAKB 2LRNA 4Q5QA 1ERTA 3ZYWA 4XS4B 5ECNB 2B6MA 3TKQA 2F9SA 3DD3A 4WKWA 5EVOA 4OFNA 4YAVA 4ECJA 4EUYA 6GSYA 1T8EB 2HRAA 1SJIA 5DJMA 5HFIA 3ZTLA 3MAKA 5DALA 4Z2TA 1TKDB 4JE1A 3HJPA 4EF0A 4PGTA 3VWVA 3I69A 2MMOA 2ZNMA 3ERFA 2FWHA 4ILFA 2DBCA 2B7JA 2O7KA 3VPTA 1FB6A 4E8HA 2KUCA 2VM1A 2V1MA 3MSZA 4PNFA 1GUHA 2VCQA 5BRTA 2XC2A 3FZ9A 1G7OA 3F8UA 9GSSA 4EVMA 2FNOA 3A2XA 4TR1A 2NDOA 5E59A 1YY7A 5JCWA 2LSTA 1XFLA 5A4WA 3ZVJA 1WWJA 2C0GA 1MEKA 1H75A 3TKSC 4OFMA 3UVTA 4GSNA 4ZIJA 1V98A 3SBCA 4I2TA 4TR0A 4L8EA 2X49A 1TK0B 3KTLA 5ID2B 3VWUA 4J56E 2H01A 2PVQA 2IMDA 1F37A 1SK2A 4V2NA 5HR0A 2CVKA 4GCIA 3TOUA 1S3CA 4N0ZA 4O7HA 5LCZA 3MWHA 4WETA 4OD7A 1JHBA 1XXUA 3HD5A 3UMAA 5IMDA 5CRHA 1K3LA 1GSYA 2HZEA 5KN3A 1C72A 4WBJA 1NHOA 1RW1A 1YF1A 2H8LA 1MDIA 3P2AA 1M3IA 3HHVA 3OR5A 1M2AA 1SL2B 1XWKA 2H6YA 4LL1B 1R26A 3WD6A 3GX0A 2H75A 3TCOA 5IPHA 4JZQA 5IO2A 3TKPA 3MIXA 1B48A 2HE3A 1A2LA 4LLRA 1YEPA 2VCXA 4POKA 2H30A 1K0CA 3J7Yb 1G6WA 1V40A 2WDUA 1MD4A 4NHZA 2B1LA 1GUKA 3WYWA 4HEA2 3FMWA 2I9HA 2DJJA 3F4TA 4DSSB 3S9FA 4K2XA 3QMXA 2L57A 3HVSA 1WP0A 1O85A 3DVXA 2GLRA 4K2DA 5AGYA 4KDYA 3ISOA 4XRDA 2YN1A 1OC8A 3GL5A 1ZZYA 3F6FA 4ZXGA 1A2MA 3BCKA 1HQOA 3KP9A 1TRVA 3GL3A 2BTOT 3GNJA 1ERVA 3P90A 4PTSA 3BCIA 4Q5RA 5IMVA 2GQLA 3Q19A 2ON7A 1X9MB 4MPGA 2L4CA 1ZYNA 2R3XA 1VRSD 1ERWA 3LFLA 2HRFA 3F3QA 3ME7A 3A5IA 1S3DA 4HU9A 3CTGA 1EEMA 3FRCA 2OJLA 3FEUA 2AB6A 2GDRA 4G10A 1R5AA 1PD21 1XOBA 4TW5A 2H72A 1CQHA 1TI3A 1PA3A 3EPTA 1SU9A 4CDOA 1A8LA 3UARA 2E0QA 2H74A 3ME8A 2HRKA 1J08A 5B8AA 1USBA 3TKSA 4EXJA 2V6OA 5CRWA 4O5QA 5KN1A 2DJKA 4PQIA 1X5CA 2H19A 4MDCA 5CO3A 1B8XA 2CX4A 1F3AA 3EURA 4K0NA 3D0ZA 2C4JA 1YF0A 2L4QA 4PQHA 2KP1A 2MBTA 2LJKA 1R7HA 2PVOC 2KP2A 1QGVA 2IMKA 2K8VA 5ECRB 1DUGA 1E2YA 4HSCX 4MJAA 4TR4A 4FH8A 2DKIA 1QK8A 2LRCA 4IGJA 5LD0A 5INYA 3LG6A 4ZBAA 2DJ2A 3K8NA 4D73B 2C1YA 3RHBA 1WIKA 4RUVA 1O8WA 3WT1A 1LU4A 2EIQA 2YWNA 1XW5A 3DIEA 3TRPA 2LQOA 5KOXA 2E2GA 1DE2A 2CVBA 1GTBA 1B9YC 1JZOA 2K6VA 5A4VA 1O81A 1T4YA 2L59A 4F82A 3GH6A 2RLIA 5D9XA 3ZMKA 2DMLA 1GP1A 3PINA 2N5BA 1F3BA 2XHFA 4MZBA 2VL9A 1N8JA 1FOHA 3TDGA 5IPGA 1J9BA 1TJDA 1BQ7A 5C04A 3KMOA 4GRFA 2RUFA 4G0IA 5J4UA 4PXOA 1PX6A 3UBKA 2R2JA 3CTFA 4TVEA 2GSTA 2R5GA 2GSRA 1KBNA 2PPTA 1TU8A 1SKSB 4IP1A 1ILOA 2R0PA 3QPMA
chains in the Genus database with same CATH topology
3F3RA 3ZVJD 3APOA 5DCGA 3HY2A 1A24A 2B7KA 4K5SA 5A4UA 2L5OA 4GTUA 3TKRA 3KZQA 1VF2A 4GSSA 2M80A 1PKWA 2Z9SA 4CW9A 1Z6MA 4IS0A 4EIQA 3F63A 3QDNA 4WF5A 1A0FA 4LMWA 2P0GA 3GUSA 1TRSA 3LYPA 1XBSA 2E2MA 1GSSA 1XVQA 4QL7A 3PR8A 4RI7A 3P7XA 3QAVA 2VUPA 3FYGA 3IK7A 6GSVA 3IHQA 4X43A 3FZAA 3TUEA 3IHGA 4KCAA 3ZIJA 5JCGA 3IA1A 1UVZA 4V1Ap 1VF1A 1O73A 2LS5A 3TRQA 2XPEA 2ALBA 2LJRA 1AQWA 2A2RA 2WFCA 1T3BA 1XWAA 1H4OA 4I2UA 4RI6A 3QFBC 5D96A 3F6DA 4OWYA 4L0UA 1BJXA 16GSA 4K7OA 2A4HA 4LA1A 4DVCA 2JACA 4J57E 4GLTA 1RK4A 5F07A 4TR3A 1HNCA 2HT9A 1BX9A 4FO5A 2REMA 4BVYB 3GKNA 4YQUA 3CSJA 1GSEA 1OVNA 4POBA 4OMVA 2H71A 3GMFA 4G2EA 3J7Yk 5CREA 1XW6A 1X0RA 3PGTA 3VK9A 3DEXA 3HDCA 3Q6OA 1F9MA 1T00A 2X4AA 2QGVA 2ZCTA 1WPIA 2YZUA 1FHEA 2YOIA 1WE0A 2GQKA 2DJ1A 1NM3A 1T4ZA 3IR4A 3GKKA 2FCHA 1XIYA 5IIZA 2DSAA 1AC1A 3MNGA 2VAFA 5IO0A 3D4TA 5DQYA 3ZLPA 1V2AA 3CSHA 4KCEA 3LQ7A 5G2ZA 3C1SA 2GVPA 2AUVA 3KXOA 2C0EA 2PWJA 5AISA 1XW9A 3VLNA 3IC4A 4O32A 5DAKA 3TJKA 3O76A 2MYGA 4XS4A 5F0GA 4I5QA 4Q5NA 3BJ5A 2GZPA 4JBBA 4FQUA 2BJXA 5IMAA 3FK8A 3FHKA 3HCZA 1OAZA 1SJ6A 3LYKA 4BVXB 4HZ4A 4HDEA 2FUG2 1SYRA 3ERGA 4Z2UA 5B6NA 4HQSA 2CZ3A 2OKAA 5HR2A 2H0IA 1ZGNA 2LUSA 4X0XA 1GTIA 3TRXA 3HXSA 3WT2A 1K3YA 3EYTA 2GT6A 3E3EA 1GTAA 4ZB9A 2XPDA 1SKRB 2QSIA 3ZL5A 5HR1A 4WF4A 1NHYA 1S3AA 1F6MC 3RDWA 1B4QA 4JEDA 5G31A 3HZ4A 3RAZA 4MH2A 2K8SA 3IDVA 4WR4A 1OE8A 3RPPA 4MJCA 2A4VA 3H4KA 2PN8A 3UVHA 3KM6A 5JWRB 5HFGA 3L9SA 1J0FA 4USSA 2X8GA 4L5LA 2FWEA 2KLXA 4F9ZA 3H8QA 3FY7A 1OE7A 5ID2A 4BWQA 1YKAA 5GSTA 4KAEA 1EOHA 2LV3A 1VF4A 5J3RA 2WJUA 5JCUA 4Z7XA 3DVWA 2DJ3A 5G5FA 1EGRA 1V58A 4XIHA 4EKZA 4PUAA 3I43A 2OA7A 3VURA 4KH7A 2C3NA 4MJBA 2RIIA 3TJGA 4PUFC 4TKYA 1IYHA 2ON5A 3UEMA 5KN0A 2C80A 4HJ2A 1KNGA 4YH2A 2CT6A 2CAQA 4G0LA 5LNKe 3IAS2 4EIPA 1GLPA 3CSIA 3RHCA 1X9SB 2F3MA 1THOA 2L6CA 5G1LA 4IJ3A 1V57A 3LXZA 3HYPA 5JWOB 2VM2A 4K8MA 4Q5FA 4J2FA 3PH9A 1OC3A 1ZYPA 5ENUA 1NW2A 3EWLA 4HOJA 2QA2A 2HI7A 2FHEA 3BD2A 4X1UA 4MLYA 4O92A 2JZRA 3ZMLA 3TJFA 3HVXA 3KH9A 3IXRA 2K18A 2J23A 3IRAA 2V6KA 3FR9A 3AY8A 2LKUA 3QD9A 3C1RA 4BPYA 1PN9A 3EMPA 2LEGA 2H0HA 5ECMB 5FHIA 4MF5A 1MTCA 2A2PA 2M72A 3KEBA 4EO3A 1AIUA 3NIVA 4ECIA 4MF7A 1OKDA 4CY8A 1A23A 2O87A 3TB2A 4KW6A 5ABRA 1TW9A 2HZFA 1OC9B 1OYJA 1FVKA 1XZOA 2MMAA 1Z5YE 1M9BA 4MZWA 5IM9A 4DSRA 2A2SA 4NPBA 2MBSA 1FG4A 4MH3A 4F0CA 2IL3A 3F4SA 1W4VA 3MYDA 4HQZA 1FVJA 6GSXA 1SL1B 3DRNA 3CRUA 4IQ1A 2HLSA 2VCVA 1GRXA 4IKHA 5IQYA 2LNSA 1GSQA 1Z9HA 3FR3A 2TIRA 2X64A 5J5NA 5DQSA 4EL1A 4N30A 4L0WA 3UL3A 2WCIA 5ECIB 4WBRD 4AJ7A 3GYKA 5COHA 2DMMA 3H79A 3LXTA 2XBQA 5AIVA 3LW9A 1AW9A 4H86A 4D73A 2JU5A 4GWRA 1EP8A 2JZTA 4XRAA 1U3AA 1M0UA 4K9ZA 2DIYA 4KE3A 2AYTA 1Z6NA 1THXA 1VF3A 5IMZA 1GSDA 4ICYA 5CRGA 5CNWA 3M8NA 3GN3A 1PRXA 2OADA 2QC7A 5BMUA 1K0OA 2HNLA 1G6YA 2IJYA 3GRXA 1ON4A 2F51A 4XHMA 1HYUA 3HA9A 4WR5A 3QCPA 2YWOA 2CX3A 4MF6A 1MDKA 19GSA 5HQPA 2OBKA 2H0GA 2KHPA 1Z7RA 2YANA 3C71A 2IN3A 3L78A 2DC5A 2PBJA 3TOTA 2R37A 2YZHA 4YKGA 1BYEA 5IOWA 4F0BA 4MZCA 3KH7A 2IIYA 1B4PA 2JSYA 5G30A 4HS1A 2JL4A 2F8FA 1K0NA 3NZNA 1SD9A 4FIWA 4GF0A 4MP4A 5ECQB 1XWBA 2FLSA 4LL4B 3VWXA 4HZ2A 2VL2C 1TK8B 5GAND 2FA8A 4KNDA 4TXOB 4K6XA 3CYNA 3GTUB 1FAAA 1YDKA 4MNNA 5F8BA 2YCDA 2X8HA 2YWMA 4QQ7A 2LTKA 1EP7A 3EE2A 1ACVA 2VCWA 4HUAA 4N0VA 3BOAA 3HKRA 3N9JA 4ML1A 2R6KA 4A5PA 3WGEA 4WXTA 1TP9A 1FW1A 3LEFA 4N11A 1JZRA 1GH2A 1A2JA 1O7UA 3P8WA 4ID0A 2NVLA 1HNBA 2NPBA 2N5FA 5C00A 3GA4A 5D9VA 1IYIA 2GZZA 3EINA 3SWLA 4IELA 2I3YA 3LJRA 3L9UA 4IBPA 1PKZA 5D9WA 1PQNA 4IN0A 4IHUA 4XTSA 2C3QA 3A2WA 1EZKA 4ACSA 4PURA 12GSA 4K7IA 4POMA 1O8XA 2O8VB 3R3EA 1EV9A 1SL0B 3D5JA 3M0FA 2CV4A 4MMMA 4AGSA 2R4VA 1BAYA 1X5DA 3D21A 4XS6A 3VI7A 1FO5A 2HXKA 3TJJA 4FYCA 2HSYA 2OE0A 5IOXA 4GQCA 2FD3A 2NBSA 3KD0A 2E7PA 2DLXA 4BVYA 2VLUA 5ECHB 1B9XC 3GH9A 1DBYA 3GV1A 4CHSA 4NAXA 4IW9A 2R0CA 1GNWA 2F8AA 3KJYA 1URMA 3KMNA 1GNEA 4KA0A 2I81A 1E6BA 2YV9A 5D8IA 5ECSA 4OCFA 1Q98A 2B5EA 4XS1A 4ZL7A 3PPUA 4MCUA 5IMCA 2EC4A 1AUCA 4BL7A 1R4WA 1FOVA 1WJKA 3M3MA 5G1KA 5AN1A 2KOKA 3APSA 4EDYA 1OKTA 4NMUA 2G2QA 2ZUPA 2WZ9A 2X8CA 2N5AA 1SJZA 2P5RA 2LNTA 2YJ7A 3GX8A 5FT3A 2VL2A 3UBLA 2JZSA 1U3IA 1HD2A 2H1GA 4O5UA 4YKFA 2PMTA 2C0FA 5B8BA 1I5GA 4EDZA 3U6VA 4K0GA 3M9JA 2I4AA 2LRTA 2TRXA 2H1BA 5G5EA 1UA5A 4TXVA 4JR4A 4X4JA 4ZL8A 4ZL9A 1X5EA 1XWCA 2CVDA 4I6XA 4BVXA 2WB9A 3H93A 5KN2A 2IFQB 2GTUA 4EC0A 1GULA 4IQAA 1MD3A 18GSA 4JU5A 3A3TA 3NOFA 3GIXA 3IPZA 5JWQB 2GT5A 1Z3EA 2YV7A 4FYBA 1GUMA 3CXGA 3G7YA 1YEXA 1AQVA 1K0MA 5ELGA 1TK5B 2JADA 3UOMA 2GSSA 3F4RA 5DALB 4ZBDA 3TGZA 3H1NA 4FYUA 2P5QA 3HVVA 5KEJA 3W6GA 2K9FA 4PNGA 4WEYA 2MMZA 1GL8A 4V1Ag 3APQA 4ML6A 1F2EA 1FB0A 4E8EA 3G7JA 4DSQA 1XOAA 1PL1A 2YP6A 2HSMA 2VLTA 3D4MA 3WGXA 22GSA 2WRTA 5F05A 2VCZA 3QFAC 3F0IA 4YQVA 2AJQB 2IMEA 2YPMA 2J9HA 4TR1B 4KUNA 2O85A 4TRXA 3HZ8A 5CAXA 1SKWB 3LWAA 4KB3A 2H6ZA 1RQMA 4ZILA 2IMIA 1JZWA 2L5LA 5A5KA 4AJ8A 2RM6A 2VO4A 5AIXA 3ZITA 3EU3A 3KGKA 3FW2A 3N5OA 2FY6A 4K1FA 4QL9A 2PU9C 1XWGA 2V41A 3I6AA 5GAPD 3US3A 1HNAA 1TTZA 2OBIA 4NWYA 2HFDA 3EMXA 4NV5A 4POLA 2DJ0A 3KCMA 1GSUA 1ERUA 3O6TA 1M99A 2H6XA 5B7CA 2HZEB 3IK9A 4KDUA 5J9BA 1K3OA 3UJ1A 1SD8A 5CYYA 4YAPA 1Z7PA 6GSTA 1KTEA 3QR6A 3ERWA 1K0DA 1QMVA 4OO5A 1GLQA 5DBQA 2FWGA 4YQMA 4CY6A 1ZMAA 3ZFBA 2OACA 1NSWA 2C3TA 5J41A 1SENA 1YJ6A 4DSSA 1G0TA 1N2AA 5ECKB 1KEBA 1XPVA 1SYXA 5D93A 2X99A 1X9WB 3ZFLA 4K5RA 14GSA 2GQMA 3DGQA 6GSWA 6GSUA 4F03A 2VD0A 5IMFA 2V32A 1WOUA 1PSQA 4ULXA 1TU7A 1U87A 1YQ1A 4TOPA 2YNXA 4Z2RA 2B3SA 4AF2A 2B5XA 5DDLA 3CRTA 1GTUA 1GSFA 1QUWA 1QFNA 3C8EA 10GSA 3A5WA 3UAPA 1A0RP 1TDIA 4NHWA 5B6MA 2H1AA 1O6JA 3M1GA 3QAGA 2RM5A 3O3TA 1YKCA 4GXZA 1JZDA 5HR3A 1Y6EA 1ABAA 3RBTA 1LJRA 2BMXA 2VD1A 3GURA 1OC9A 2XBIA 3KP8A 3ZZXA 1Y25A 1R5PA 1JLWA 4TN8A 2EIOA 5H5RA 1AXDA 1PN0A 4PX1A 1EEJA 5GSSA 5DJLA 2D2ZA 3LORA 3ZIVA 2QKEA 3BBYA 5GZZB 5ECLB 2CAIA 3L0HA 4G0KA 1U6TA 3IAM2 5CRDA 3VPQA 3E9JB 3VWWA 2WULA 5EY6A 4JRRA 3HJMA 2GGTA 1TXXA 4I8BA 4XCSA 3FR6A 2AAWA 2H1DA 1XVWA 1TI1A 1VGLA 5CP1A 4KX4A 3FKFA 5E4WA 3KIJA 2CA8A 5FWGA 2QA1A 1WMJA 5H5QA 3CBUA 2C8UA 1AAZA 3D22A 3ZRDA 4BWSA 4OO4A 2HRNA 2PERA 2R0GA 4JR6A 3U5RE 3I9V2 3IV4A 2AHEA 1MDJA 3IBHA 2PUKC 2LJAA 1T1VA 4HU7A 3G9BA 3MDKA 2GSQA 2B1KA 3LGCA 5EPFA 4ECBA 2IWTA 6GSSA 3W8JA 5ECOB 3M9KA 3QAWA 4KF9A 20GSA 2HYXA 1ZL9A 4O5RA 2WGRA 3ZREA 4ISDA 3G7IA 4KSMA 4GQFA 2OE1A 1ZYQB 2ES7A 3DYRA 4BA7A 5H5SA 13GSA 1DE1A 4MPFA 3DKSA 3JCML 2H70A 2EIRA 2I1UA 5KOWA 1ZCPA 5ELAA 4TXOA 4P3YB 2VCTA 3GTUA 2V2GA 3L9VA 1TRUA 1DSBA 4I97A 4G9HA 4KGIA 4PQ1A 3RPNA 4MABA 3TKSE 1ZOFA 4ECCA 1TRWA 1V9WA 4LMVA 2B5YA 3IE3A 3DWVA 2JSZA 3W8SA 3GKMA 2H73A 2IPAA 1A8YA 8GSSA 1ML6A 2HSHA 1U88A 3D6IA 1M2BA 3L4NA 3C73A 4GSTA 4MK3A 5ECPB 4F2IA 1SK1A 4HI7A 4DEJA 4EE0A 2O89A 3LSZA 3EVIA 1M9AA 3UIWA 2VL3A 4ZB6A 1LBKA 5F06A 2IMFA 11GSA 2NTOA 1PGTA 4IJIA 4OFTA 3Q18A 2FA4A 3A2VA 3EC3A 3R2QA 5DVBA 4OCEA 3VFIA 3HJOA 3FZ4A 1JFUA 5D73A 1QXHA 2CQ9A 2M46A 3CMIA 4V2MA 1SK0A 7GSSA 17GSA 2OE3A 1T7PB 4NV2A 1UN2A 1PX7A 1W89A 4N10A 1EGOA 2RUEA 3F9UA 1PL2A 2VOCA 4ZBBA 4AJ6A 3VI5A 1M7TA 2DKHA 1JLVA 1EV4A 2VLVA 3IOSA 1EOGA 1K0AA 3FZ5A 1I9DA 3WGDA 3QOUA 2GS3A 1XCCA 3DMLA 3GSTA 4G19A 4HJMA 4NXIA 2AV4A 4IVFA 3C7MA 1WRYA 3EU4A 5D9TA 5L71A 1BG5A 1TOFA 2CZ2A 1G7EA 2UZ8A 3GHAA 3KTBA 4KDXA 5EL8A 4RQRA 4IP6A 2H76A 2YWIA 4V2LA 2FWFA 2PGTA 2LQQA 2TRCP 3Q74A 1ZYEA 3IC8A 4MA9A 2MZCA 3DXBA 1M2DA 1UC7A 2DIZA 4MJEA 1AQXA 2G0FA 2GZYA 3GFKA 5DCHA 2MMNA 1ST9A 5J9CA 5HFKA 2L6DA 3GSSA 2FGXA 4RQXA 4BL7B 2H66A 4L5OA 2VIMA 3V1WA 3E0UA 1PMTA 4KSOA 3TJBA 2C0DA 1CQGA 1EWXA 2P31A 1Q4JA 1GWCA 4K7NA 3GKXA 1K0BA 1QQ2A 2IFQA 2YJHA 2WS2A 1BEDA 3ED3A 1YZXA 4ZB8A 5DAKB 2LRNA 4Q5QA 1ERTA 3ZYWA 4XS4B 5ECNB 2B6MA 3TKQA 2F9SA 3DD3A 4WKWA 5EVOA 4OFNA 4YAVA 4ECJA 4EUYA 6GSYA 1T8EB 2HRAA 1SJIA 5DJMA 5HFIA 3ZTLA 3MAKA 5DALA 4Z2TA 1TKDB 4JE1A 3HJPA 4EF0A 4PGTA 3VWVA 3I69A 2MMOA 2ZNMA 3ERFA 2FWHA 4ILFA 2DBCA 2B7JA 2O7KA 3VPTA 1FB6A 4E8HA 2KUCA 2VM1A 2V1MA 3MSZA 4PNFA 1GUHA 2VCQA 5BRTA 2XC2A 3FZ9A 1G7OA 3F8UA 9GSSA 4EVMA 2FNOA 3A2XA 4TR1A 2NDOA 5E59A 1YY7A 5JCWA 2LSTA 1XFLA 5A4WA 3ZVJA 1WWJA 2C0GA 1MEKA 1H75A 3TKSC 4OFMA 3UVTA 4GSNA 4ZIJA 1V98A 3SBCA 4I2TA 4TR0A 4L8EA 2X49A 1TK0B 3KTLA 5ID2B 3VWUA 4J56E 2H01A 2PVQA 2IMDA 1F37A 1SK2A 4V2NA 5HR0A 2CVKA 4GCIA 3TOUA 1S3CA 4N0ZA 4O7HA 5LCZA 3MWHA 4WETA 4OD7A 1JHBA 1XXUA 3HD5A 3UMAA 5IMDA 5CRHA 1K3LA 1GSYA 2HZEA 5KN3A 1C72A 4WBJA 1NHOA 1RW1A 1YF1A 2H8LA 1MDIA 3P2AA 3HHVA 3OR5A 1M2AA 1SL2B 1XWKA 2H6YA 4LL1B 1R26A 3WD6A 3GX0A 2H75A 3TCOA 5IPHA 4JZQA 5IO2A 3TKPA 3MIXA 1B48A 2HE3A 1A2LA 4LLRA 1YEPA 2VCXA 4POKA 2H30A 1K0CA 3J7Yb 1G6WA 1V40A 2WDUA 1MD4A 4NHZA 2B1LA 1GUKA 3WYWA 4HEA2 3FMWA 2I9HA 2DJJA 3F4TA 4DSSB 3S9FA 4K2XA 3QMXA 2L57A 3HVSA 1WP0A 1O85A 3DVXA 2GLRA 4K2DA 5AGYA 4KDYA 3ISOA 4XRDA 2YN1A 1OC8A 3GL5A 1ZZYA 3F6FA 4ZXGA 1A2MA 3BCKA 1HQOA 3KP9A 1TRVA 3GL3A 2BTOT 3GNJA 1ERVA 3P90A 4PTSA 3BCIA 4Q5RA 5IMVA 2GQLA 3Q19A 2ON7A 1X9MB 4MPGA 2L4CA 1ZYNA 2R3XA 1VRSD 1ERWA 3LFLA 2HRFA 3F3QA 3ME7A 3A5IA 1S3DA 4HU9A 3CTGA 1EEMA 3FRCA 2OJLA 3FEUA 2AB6A 2GDRA 4G10A 1R5AA 1PD21 1XOBA 4TW5A 2H72A 1CQHA 1TI3A 1PA3A 3EPTA 1SU9A 4CDOA 1A8LA 3UARA 2E0QA 2H74A 3ME8A 2HRKA 1J08A 5B8AA 1USBA 3TKSA 4EXJA 2V6OA 5CRWA 4O5QA 5KN1A 2DJKA 4PQIA 1X5CA 2H19A 4MDCA 5CO3A 1B8XA 2CX4A 1F3AA 3EURA 4K0NA 3D0ZA 2C4JA 1YF0A 2L4QA 4PQHA 2KP1A 2MBTA 2LJKA 1R7HA 2PVOC 2KP2A 1QGVA 2IMKA 2K8VA 5ECRB 1DUGA 1E2YA 4MJAA 4TR4A 4FH8A 2DKIA 1QK8A 2LRCA 4IGJA 5LD0A 5INYA 3LG6A 4ZBAA 2DJ2A 3K8NA 4D73B 2C1YA 3RHBA 1WIKA 4RUVA 1O8WA 3WT1A 1LU4A 2EIQA 2YWNA 1XW5A 3DIEA 3TRPA 2LQOA 5KOXA 2E2GA 1DE2A 2CVBA 1GTBA 1B9YC 1JZOA 2K6VA 5A4VA 1O81A 1T4YA 2L59A 4F82A 3GH6A 2RLIA 5D9XA 3ZMKA 2DMLA 1GP1A 3PINA 2N5BA 1F3BA 2XHFA 4MZBA 2VL9A 1N8JA 1FOHA 3TDGA 5IPGA 1J9BA 1TJDA 1BQ7A 5C04A 3KMOA 4GRFA 2RUFA 4G0IA 5J4UA 4PXOA 1PX6A 3UBKA 2R2JA 3CTFA 4TVEA 2GSTA 2R5GA 2GSRA 1KBNA 2PPTA 1TU8A 1SKSB 4IP1A 1ILOA 2R0PA 3QPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F3R A;  3ZVJ D;  3APO A;  5DCG A;  3HY2 A;  1A24 A;  2B7K A;  5A4U A;  2L5O A;  4GTU A;  3TKR A;  3KZQ A;  1VF2 A;  4GSS A;  2M80 A;  1PKW A;  2Z9S A;  4CW9 A;  1Z6M A;  4IS0 A;  3F63 A;  3QDN A;  4WF5 A;  1A0F A;  4LMW A;  2P0G A;  3GUS A;  1TRS A;  3LYP A;  1XBS A;  2E2M A;  1GSS A;  1XVQ A;  4QL7 A;  3PR8 A;  4RI7 A;  3P7X A;  3QAV A;  2VUP A;  3FYG A;  3IK7 A;  6GSV A;  3IHQ A;  4X43 A;  3FZA A;  3TUE A;  4KCA A;  3ZIJ A;  5JCG A;  3IA1 A;  1UVZ A;  4V1A p;  1VF1 A;  1O73 A;  2LS5 A;  3TRQ A;  2XPE A;  2ALB A;  2LJR A;  1AQW A;  2A2R A;  2WFC A;  1T3B A;  1XWA A;  1H4O A;  4I2U A;  4RI6 A;  3QFB C;  5D96 A;  3F6D A;  4OWY A;  4L0U A;  1BJX A;  16GS A;  4K7O A;  4LA1 A;  4DVC A;  2JAC A;  4J57 E;  4GLT A;  1RK4 A;  5F07 A;  4TR3 A;  1HNC A;  2HT9 A;  1BX9 A;  4FO5 A;  2REM A;  3GKN A;  4YQU A;  3CSJ A;  1GSE A;  1OVN A;  4POB A;  4OMV A;  2H71 A;  3GMF A;  4G2E A;  3J7Y k;  5CRE A;  1XW6 A;  1X0R A;  3PGT A;  3VK9 A;  3DEX A;  3HDC A;  3Q6O A;  1F9M A;  1T00 A;  2QGV A;  2ZCT A;  1WPI A;  2YZU A;  1FHE A;  2YOI A;  1WE0 A;  2GQK A;  2DJ1 A;  1NM3 A;  1T4Z A;  3IR4 A;  3GKK A;  2FCH A;  1XIY A;  5IIZ A;  2DSA A;  1AC1 A;  3MNG A;  2VAF A;  5IO0 A;  3D4T A;  5DQY A;  3ZLP A;  1V2A A;  3CSH A;  4KCE A;  3LQ7 A;  5G2Z A;  3C1S A;  2GVP A;  2AUV A;  3KXO A;  2C0E A;  2PWJ A;  5AIS A;  1XW9 A;  3VLN A;  3IC4 A;  4O32 A;  5DAK A;  3TJK A;  3O76 A;  2MYG A;  4XS4 A;  5F0G A;  4I5Q A;  4Q5N A;  3BJ5 A;  2GZP A;  4JBB A;  2BJX A;  5IMA A;  3FK8 A;  3FHK A;  3HCZ A;  1OAZ A;  1SJ6 A;  3LYK A;  4HZ4 A;  4HDE A;  2FUG 2;  1SYR A;  3ERG A;  5B6N A;  4HQS A;  2CZ3 A;  2OKA A;  5HR2 A;  2H0I A;  1ZGN A;  2LUS A;  4X0X A;  1GTI A;  3TRX A;  3HXS A;  3WT2 A;  1K3Y A;  3EYT A;  2GT6 A;  3E3E A;  1GTA A;  4ZB9 A;  2XPD A;  1SKR B;  2QSI A;  3ZL5 A;  5HR1 A;  4WF4 A;  1NHY A;  1S3A A;  1F6M C;  3RDW A;  1B4Q A;  4JED A;  5G31 A;  3HZ4 A;  3RAZ A;  4MH2 A;  2K8S A;  3IDV A;  4WR4 A;  1OE8 A;  3RPP A;  4MJC A;  2A4V A;  3H4K A;  2PN8 A;  3UVH A;  3KM6 A;  5JWR B;  5HFG A;  3L9S A;  1J0F A;  2X8G A;  4L5L A;  2FWE A;  2KLX A;  4F9Z A;  3H8Q A;  3FY7 A;  1OE7 A;  5ID2 A;  4BWQ A;  1YKA A;  5GST A;  4KAE A;  1EOH A;  2LV3 A;  1VF4 A;  5J3R A;  2WJU A;  5JCU A;  4Z7X A;  3DVW A;  2DJ3 A;  5G5F A;  1EGR A;  1V58 A;  4XIH A;  4EKZ A;  4PUA A;  3I43 A;  2OA7 A;  3VUR A;  4KH7 A;  2C3N A;  4MJB A;  2RII A;  3TJG A;  4PUF C;  4TKY A;  1IYH A;  2ON5 A;  3UEM A;  5KN0 A;  2C80 A;  4HJ2 A;  1KNG A;  4YH2 A;  2CT6 A;  2CAQ A;  5LNK e;  3IAS 2;  1GLP A;  3CSI A;  3RHC A;  1X9S B;  2F3M A;  1THO A;  2L6C A;  5G1L A;  4IJ3 A;  1V57 A;  3LXZ A;  3HYP A;  5JWO B;  2VM2 A;  4K8M A;  4Q5F A;  4J2F A;  3PH9 A;  1OC3 A;  5ENU A;  1NW2 A;  3EWL A;  4HOJ A;  2HI7 A;  2FHE A;  3BD2 A;  4X1U A;  4MLY A;  4O92 A;  2JZR A;  3ZML A;  3TJF A;  3HVX A;  3KH9 A;  3IXR A;  2K18 A;  2J23 A;  3IRA A;  2V6K A;  3FR9 A;  3AY8 A;  2LKU A;  3QD9 A;  3C1R A;  4BPY A;  1PN9 A;  3EMP A;  2LEG A;  2H0H A;  5ECM B;  5FHI A;  4MF5 A;  1MTC A;  2M72 A;  3KEB A;  4EO3 A;  1AIU A;  3NIV A;  4ECI A;  4MF7 A;  1OKD A;  1A23 A;  2O87 A;  3TB2 A;  4KW6 A;  5ABR A;  1TW9 A;  2HZF A;  1OC9 B;  1OYJ A;  1FVK A;  1XZO A;  2MMA A;  1Z5Y E;  1M9B A;  4MZW A;  5IM9 A;  4DSR A;  2A2S A;  4NPB A;  2MBS A;  1FG4 A;  4MH3 A;  4F0C A;  2IL3 A;  3F4S A;  1W4V A;  4HQZ A;  1FVJ A;  6GSX A;  1SL1 B;  3DRN A;  3CRU A;  4IQ1 A;  2HLS A;  2VCV A;  1GRX A;  4IKH A;  5IQY A;  2LNS A;  1GSQ A;  1Z9H A;  3FR3 A;  2TIR A;  2X64 A;  5J5N A;  5DQS A;  4EL1 A;  4N30 A;  4L0W A;  3UL3 A;  2WCI A;  5ECI B;  4WBR D;  4AJ7 A;  3GYK A;  5COH A;  2DMM A;  3H79 A;  3LXT A;  2XBQ A;  5AIV A;  1AW9 A;  4H86 A;  4D73 A;  2JU5 A;  4GWR A;  1EP8 A;  2JZT A;  4XRA A;  1U3A A;  1M0U A;  4K9Z A;  2DIY A;  4KE3 A;  2AYT A;  1Z6N A;  1THX A;  1VF3 A;  5IMZ A;  1GSD A;  5CRG A;  5CNW A;  3M8N A;  3GN3 A;  1PRX A;  2OAD A;  2QC7 A;  1K0O A;  2HNL A;  1G6Y A;  2IJY A;  3GRX A;  1ON4 A;  2F51 A;  4XHM A;  1HYU A;  3HA9 A;  4WR5 A;  3QCP A;  2YWO A;  2CX3 A;  4MF6 A;  1MDK A;  19GS A;  5HQP A;  2OBK A;  2H0G A;  2KHP A;  1Z7R A;  2YAN A;  3C71 A;  2IN3 A;  3L78 A;  2DC5 A;  2PBJ A;  3TOT A;  2R37 A;  2YZH A;  1BYE A;  5IOW A;  4F0B A;  4MZC A;  3KH7 A;  2IIY A;  1B4P A;  2JSY A;  5G30 A;  4HS1 A;  2JL4 A;  2F8F A;  1K0N A;  3NZN A;  1SD9 A;  4FIW A;  4GF0 A;  4MP4 A;  5ECQ B;  1XWB A;  2FLS A;  4LL4 B;  3VWX A;  4HZ2 A;  2VL2 C;  1TK8 B;  5GAN D;  2FA8 A;  4KND A;  4TXO B;  4K6X A;  3CYN A;  3GTU B;  1FAA A;  1YDK A;  5F8B A;  2YCD A;  2X8H A;  2YWM A;  4QQ7 A;  2LTK A;  1EP7 A;  3EE2 A;  1ACV A;  2VCW A;  4HUA A;  4N0V A;  3BOA A;  3HKR A;  3N9J A;  4ML1 A;  2R6K A;  3WGE A;  4WXT A;  1TP9 A;  1FW1 A;  3LEF A;  4N11 A;  1JZR A;  1GH2 A;  1A2J A;  1O7U A;  3P8W A;  4ID0 A;  2NVL A;  1HNB A;  2NPB A;  2N5F A;  5C00 A;  3GA4 A;  5D9V A;  1IYI A;  2GZZ A;  3EIN A;  3SWL A;  4IEL A;  2I3Y A;  3LJR A;  3L9U A;  4IBP A;  1PKZ A;  5D9W A;  1PQN A;  4IN0 A;  4IHU A;  4XTS A;  2C3Q A;  3A2W A;  1EZK A;  4ACS A;  4PUR A;  12GS A;  4K7I A;  4POM A;  1O8X A;  2O8V B;  1EV9 A;  1SL0 B;  3D5J A;  3M0F A;  2CV4 A;  4MMM A;  4AGS A;  2R4V A;  1BAY A;  1X5D A;  3D21 A;  4XS6 A;  3VI7 A;  1FO5 A;  2HXK A;  3TJJ A;  4FYC A;  2HSY A;  2OE0 A;  5IOX A;  4GQC A;  2FD3 A;  2NBS A;  3KD0 A;  2E7P A;  2DLX A;  4BVY A;  2VLU A;  5ECH B;  1B9X C;  3GH9 A;  1DBY A;  3GV1 A;  4CHS A;  4NAX A;  4IW9 A;  1GNW A;  2F8A A;  3KJY A;  1URM A;  3KMN A;  1GNE A;  4KA0 A;  2I81 A;  1E6B A;  2YV9 A;  5D8I A;  5ECS A;  4OCF A;  1Q98 A;  2B5E A;  4XS1 A;  4ZL7 A;  4MCU A;  5IMC A;  2EC4 A;  1AUC A;  4BL7 A;  1R4W A;  1FOV A;  1WJK A;  3M3M A;  5G1K A;  5AN1 A;  2KOK A;  3APS A;  4EDY A;  1OKT A;  4NMU A;  2G2Q A;  2ZUP A;  2WZ9 A;  2X8C A;  2N5A A;  1SJZ A;  2P5R A;  2LNT A;  2YJ7 A;  3GX8 A;  5FT3 A;  2VL2 A;  3UBL A;  2JZS A;  1U3I A;  1HD2 A;  2H1G A;  2PMT A;  2C0F A;  5B8B A;  1I5G A;  4EDZ A;  3U6V A;  4K0G A;  3M9J A;  2I4A A;  2LRT A;  2TRX A;  2H1B A;  5G5E A;  1UA5 A;  4TXV A;  4JR4 A;  4ZL8 A;  4ZL9 A;  1X5E A;  1XWC A;  2CVD A;  4I6X A;  4BVX A;  2WB9 A;  3H93 A;  5KN2 A;  2IFQ B;  2GTU A;  4EC0 A;  1GUL A;  4IQA A;  1MD3 A;  18GS A;  4JU5 A;  3A3T A;  3NOF A;  3GIX A;  3IPZ A;  5JWQ B;  2GT5 A;  1Z3E A;  2YV7 A;  4FYB A;  1GUM A;  3CXG A;  3G7Y A;  1YEX A;  1AQV A;  1K0M A;  5ELG A;  1TK5 B;  2JAD A;  3UOM A;  2GSS A;  3F4R A;  5DAL B;  4ZBD A;  3TGZ A;  3H1N A;  4FYU A;  2P5Q A;  3HVV A;  5KEJ A;  3W6G A;  2K9F A;  4PNG A;  4WEY A;  2MMZ A;  1GL8 A;  4V1A g;  3APQ A;  4ML6 A;  1F2E A;  1FB0 A;  4E8E A;  3G7J A;  4DSQ A;  1XOA A;  1PL1 A;  2YP6 A;  2VLT A;  3D4M A;  3WGX A;  22GS A;  5F05 A;  2WRT A;  2VCZ A;  3QFA C;  3F0I A;  4YQV A;  2AJQ B;  2IME A;  2YPM A;  2J9H A;  4TR1 B;  4KUN A;  2O85 A;  4TRX A;  3HZ8 A;  5CAX A;  1SKW B;  3LWA A;  4KB3 A;  2H6Z A;  1RQM A;  4ZIL A;  2IMI A;  1JZW A;  2L5L A;  5A5K A;  4AJ8 A;  2RM6 A;  2VO4 A;  5AIX A;  3ZIT A;  3EU3 A;  3KGK A;  3FW2 A;  3N5O A;  2FY6 A;  4K1F A;  4QL9 A;  2PU9 C;  1XWG A;  2V41 A;  3I6A A;  5GAP D;  3US3 A;  1HNA A;  1TTZ A;  2OBI A;  4NWY A;  2HFD A;  3EMX A;  4NV5 A;  4POL A;  2DJ0 A;  3KCM A;  1GSU A;  1ERU A;  3O6T A;  1M99 A;  2H6X A;  5B7C A;  2HZE B;  3IK9 A;  4KDU A;  5J9B A;  1K3O A;  3UJ1 A;  1SD8 A;  5CYY A;  4YAP A;  1Z7P A;  6GST A;  1KTE A;  3QR6 A;  3ERW A;  1K0D A;  1QMV A;  4OO5 A;  1GLQ A;  5DBQ A;  2FWG A;  4YQM A;  1ZMA A;  3ZFB A;  2OAC A;  1NSW A;  2C3T A;  5J41 A;  1SEN A;  1YJ6 A;  4DSS A;  1G0T A;  1N2A A;  5ECK B;  1KEB A;  1XPV A;  1SYX A;  5D93 A;  2X99 A;  1X9W B;  3ZFL A;  14GS A;  2GQM A;  3DGQ A;  6GSW A;  6GSU A;  4F03 A;  2VD0 A;  5IMF A;  2V32 A;  1WOU A;  1PSQ A;  4ULX A;  1TU7 A;  1U87 A;  1YQ1 A;  4TOP A;  2YNX A;  2B3S A;  4AF2 A;  2B5X A;  5DDL A;  3CRT A;  1GTU A;  1GSF A;  1QUW A;  1QFN A;  3C8E A;  10GS A;  3A5W A;  3UAP A;  1A0R P;  1TDI A;  4NHW A;  5B6M A;  2H1A A;  1O6J A;  3M1G A;  3QAG A;  2RM5 A;  3O3T A;  1YKC A;  4GXZ A;  1JZD A;  5HR3 A;  1Y6E A;  1ABA A;  3RBT A;  1LJR A;  2BMX A;  2VD1 A;  3GUR A;  1OC9 A;  2XBI A;  3KP8 A;  3ZZX A;  1Y25 A;  1R5P A;  1JLW A;  4TN8 A;  2EIO A;  5H5R A;  1AXD A;  4PX1 A;  1EEJ A;  5GSS A;  5DJL A;  2D2Z A;  3LOR A;  3ZIV A;  2QKE A;  3BBY A;  5GZZ B;  5ECL B;  2CAI A;  3L0H A;  1U6T A;  3IAM 2;  5CRD A;  3VPQ A;  3E9J B;  3VWW A;  2WUL A;  5EY6 A;  4JRR A;  3HJM A;  2GGT A;  1TXX A;  4I8B A;  4XCS A;  3FR6 A;  2AAW A;  2H1D A;  1XVW A;  1TI1 A;  1VGL A;  5CP1 A;  4KX4 A;  3FKF A;  5E4W A;  3KIJ A;  2CA8 A;  5FWG A;  1WMJ A;  5H5Q A;  3CBU A;  2C8U A;  1AAZ A;  3D22 A;  3ZRD A;  4BWS A;  4OO4 A;  2HRN A;  2PER A;  4JR6 A;  3U5R E;  3I9V 2;  3IV4 A;  2AHE A;  1MDJ A;  3IBH A;  2PUK C;  2LJA A;  1T1V A;  4HU7 A;  3G9B A;  3MDK A;  2GSQ A;  2B1K A;  3LGC A;  5EPF A;  4ECB A;  2IWT A;  6GSS A;  3W8J A;  5ECO B;  3M9K A;  3QAW A;  20GS A;  2HYX A;  1ZL9 A;  4O5R A;  2WGR A;  3ZRE A;  4ISD A;  3G7I A;  4KSM A;  4GQF A;  2OE1 A;  1ZYQ B;  2ES7 A;  3DYR A;  4BA7 A;  5H5S A;  13GS A;  1DE1 A;  4MPF A;  3DKS A;  3JCM L;  2H70 A;  2EIR A;  2I1U A;  1ZCP A;  5ELA A;  4TXO A;  4P3Y B;  2VCT A;  3GTU A;  2V2G A;  3L9V A;  1TRU A;  1DSB A;  4I97 A;  4G9H A;  4KGI A;  4PQ1 A;  3RPN A;  4MAB A;  3TKS E;  1ZOF A;  4ECC A;  1TRW A;  1V9W A;  4LMV A;  2B5Y A;  3IE3 A;  3DWV A;  2JSZ A;  3W8S A;  3GKM A;  2H73 A;  2IPA A;  1A8Y A;  8GSS A;  1ML6 A;  2HSH A;  1U88 A;  3D6I A;  1M2B A;  3L4N A;  3C73 A;  4GST A;  4MK3 A;  5ECP B;  4F2I A;  1SK1 A;  4HI7 A;  4DEJ A;  4EE0 A;  2O89 A;  3LSZ A;  3EVI A;  1M9A A;  3UIW A;  2VL3 A;  4ZB6 A;  1LBK A;  5F06 A;  2IMF A;  11GS A;  2NTO A;  1PGT A;  4IJI A;  4OFT A;  3Q18 A;  2FA4 A;  3A2V A;  3EC3 A;  3R2Q A;  5DVB A;  4OCE A;  3VFI A;  3HJO A;  3FZ4 A;  1JFU A;  5D73 A;  1QXH A;  2CQ9 A;  2M46 A;  3CMI A;  4V2M A;  1SK0 A;  7GSS A;  17GS A;  2OE3 A;  1T7P B;  4NV2 A;  1UN2 A;  1PX7 A;  1W89 A;  4N10 A;  1EGO A;  2RUE A;  3F9U A;  1PL2 A;  2VOC A;  4ZBB A;  4AJ6 A;  3VI5 A;  1M7T A;  1JLV A;  1EV4 A;  2VLV A;  3IOS A;  1EOG A;  1K0A A;  3FZ5 A;  1I9D A;  3WGD A;  3QOU A;  2GS3 A;  1XCC A;  3DML A;  3GST A;  4G19 A;  4HJM A;  4NXI A;  2AV4 A;  5D9T A;  4IVF A;  3C7M A;  1WRY A;  3EU4 A;  5L71 A;  1BG5 A;  1TOF A;  2CZ2 A;  1G7E A;  3GHA A;  3KTB A;  4KDX A;  5EL8 A;  4RQR A;  4IP6 A;  2H76 A;  2YWI A;  4V2L A;  2FWF A;  2PGT A;  2LQQ A;  2TRC P;  3Q74 A;  1ZYE A;  4MA9 A;  2MZC A;  3DXB A;  1M2D A;  1UC7 A;  2DIZ A;  4MJE A;  1AQX A;  2G0F A;  2GZY A;  3GFK A;  5DCH A;  2MMN A;  1ST9 A;  5J9C A;  5HFK A;  2L6D A;  3GSS A;  2FGX A;  4RQX A;  2H66 A;  4L5O A;  2VIM A;  3V1W A;  3E0U A;  1PMT A;  4KSO A;  3TJB A;  2C0D A;  1CQG A;  1EWX A;  2P31 A;  1Q4J A;  1GWC A;  4K7N A;  3GKX A;  1K0B A;  1QQ2 A;  2IFQ A;  2YJH A;  2WS2 A;  1BED A;  3ED3 A;  1YZX A;  4ZB8 A;  5DAK B;  2LRN A;  4Q5Q A;  1ERT A;  3ZYW A;  4XS4 B;  5ECN B;  2B6M A;  3TKQ A;  2F9S A;  3DD3 A;  4WKW A;  5EVO A;  4OFN A;  4YAV A;  4ECJ A;  4EUY A;  6GSY A;  1T8E B;  1SJI A;  5DJM A;  5HFI A;  3ZTL A;  3MAK A;  5DAL A;  1TKD B;  4JE1 A;  3HJP A;  4EF0 A;  4PGT A;  3VWV A;  3I69 A;  2MMO A;  2ZNM A;  3ERF A;  2FWH A;  4ILF A;  2DBC A;  2B7J A;  2O7K A;  3VPT A;  1FB6 A;  4E8H A;  2KUC A;  2VM1 A;  2V1M A;  3MSZ A;  4PNF A;  1GUH A;  2VCQ A;  2XC2 A;  3FZ9 A;  1G7O A;  3F8U A;  9GSS A;  4EVM A;  2FNO A;  3A2X A;  4TR1 A;  2NDO A;  5E59 A;  1YY7 A;  5JCW A;  2LST A;  1XFL A;  5A4W A;  3ZVJ A;  1WWJ A;  2C0G A;  1MEK A;  1H75 A;  3TKS C;  4OFM A;  3UVT A;  4GSN A;  4ZIJ A;  1V98 A;  3SBC A;  4I2T A;  4TR0 A;  4L8E A;  1TK0 B;  3KTL A;  5ID2 B;  3VWU A;  4J56 E;  2H01 A;  2PVQ A;  2IMD A;  1F37 A;  1SK2 A;  4V2N A;  5HR0 A;  2CVK A;  4GCI A;  3TOU A;  1S3C A;  4N0Z A;  4O7H A;  5LCZ A;  3MWH A;  4WET A;  4OD7 A;  1JHB A;  1XXU A;  3HD5 A;  3UMA A;  5IMD A;  5CRH A;  1K3L A;  1GSY A;  2HZE A;  5KN3 A;  1C72 A;  4WBJ A;  1NHO A;  1RW1 A;  1YF1 A;  2H8L A;  1MDI A;  3P2A A;  3HHV A;  3OR5 A;  1M2A A;  1SL2 B;  1XWK A;  2H6Y A;  4LL1 B;  1R26 A;  3WD6 A;  3GX0 A;  2H75 A;  3TCO A;  5IPH A;  4JZQ A;  5IO2 A;  3TKP A;  1B48 A;  2HE3 A;  1A2L A;  4LLR A;  1YEP A;  2VCX A;  4POK A;  2H30 A;  1K0C A;  3J7Y b;  1G6W A;  1V40 A;  2WDU A;  1MD4 A;  4NHZ A;  2B1L A;  1GUK A;  3WYW A;  4HEA 2;  2I9H A;  2DJJ A;  3F4T A;  4DSS B;  3S9F A;  3QMX A;  2L57 A;  3HVS A;  1WP0 A;  1O85 A;  3DVX A;  2GLR A;  4K2D A;  5AGY A;  4KDY A;  3ISO A;  4XRD A;  2YN1 A;  1OC8 A;  3GL5 A;  1ZZY A;  3F6F A;  4ZXG A;  1A2M A;  3BCK A;  1HQO A;  3KP9 A;  1TRV A;  3GL3 A;  2BTO T;  3GNJ A;  1ERV A;  3P90 A;  3BCI A;  4Q5R A;  5IMV A;  2GQL A;  3Q19 A;  2ON7 A;  1X9M B;  4MPG A;  2L4C A;  2R3X A;  1VRS D;  1ERW A;  3LFL A;  2HRF A;  3F3Q A;  3ME7 A;  1S3D A;  4HU9 A;  3CTG A;  1EEM A;  3FRC A;  2OJL A;  3FEU A;  2AB6 A;  2GDR A;  4G10 A;  1R5A A;  1PD2 1;  1XOB A;  4TW5 A;  2H72 A;  1CQH A;  1TI3 A;  1PA3 A;  1SU9 A;  4CDO A;  1A8L A;  3UAR A;  2E0Q A;  2H74 A;  3ME8 A;  1J08 A;  5B8A A;  1USB A;  3TKS A;  4EXJ A;  2V6O A;  5CRW A;  5KN1 A;  2DJK A;  4PQI A;  1X5C A;  2H19 A;  4MDC A;  5CO3 A;  1B8X A;  2CX4 A;  1F3A A;  3EUR A;  4K0N A;  3D0Z A;  2C4J A;  1YF0 A;  2L4Q A;  4PQH A;  2KP1 A;  2MBT A;  2LJK A;  1R7H A;  2PVO C;  2KP2 A;  1QGV A;  2IMK A;  2K8V A;  5ECR B;  1DUG A;  1E2Y A;  4MJA A;  4TR4 A;  4FH8 A;  1QK8 A;  2LRC A;  4IGJ A;  5LD0 A;  5INY A;  3LG6 A;  4ZBA A;  2DJ2 A;  3K8N A;  4D73 B;  2C1Y A;  3RHB A;  1WIK A;  4RUV A;  1O8W A;  3WT1 A;  1LU4 A;  2EIQ A;  2YWN A;  1XW5 A;  3DIE A;  3TRP A;  2LQO A;  2E2G A;  1DE2 A;  2CVB A;  1GTB A;  1B9Y C;  1JZO A;  2K6V A;  5A4V A;  1O81 A;  1T4Y A;  2L59 A;  4F82 A;  3GH6 A;  2RLI A;  5D9X A;  3ZMK A;  2DML A;  1GP1 A;  3PIN A;  2N5B A;  1F3B A;  2XHF A;  4MZB A;  2VL9 A;  1N8J A;  3TDG A;  5IPG A;  1J9B A;  1TJD A;  1BQ7 A;  5C04 A;  3KMO A;  4GRF A;  2RUF A;  5J4U A;  4PXO A;  1PX6 A;  3UBK A;  2R2J A;  3CTF A;  4TVE A;  2GST A;  2R5G A;  2GSR A;  1KBN A;  2PPT A;  1TU8 A;  1SKS B;  4IP1 A;  1ILO A;  3QPM A; 
#chains in the Genus database with same CATH topology
 3F3R A;  3ZVJ D;  3APO A;  5DCG A;  3HY2 A;  1A24 A;  2B7K A;  4K5S A;  5A4U A;  2L5O A;  4GTU A;  3TKR A;  3KZQ A;  1VF2 A;  4GSS A;  2M80 A;  1PKW A;  2Z9S A;  4CW9 A;  1Z6M A;  4IS0 A;  1XG8 A;  4EIQ A;  3F63 A;  3QDN A;  4WF5 A;  1A0F A;  4LMW A;  2P0G A;  3GUS A;  1TRS A;  3LYP A;  1XBS A;  2E2M A;  1GSS A;  1XVQ A;  4QL7 A;  3PR8 A;  4RI7 A;  3P7X A;  3QAV A;  2VUP A;  3FYG A;  3IK7 A;  6GSV A;  3IHQ A;  4X43 A;  3FZA A;  3TUE A;  3IHG A;  4KCA A;  3ZIJ A;  5JCG A;  3IA1 A;  1UVZ A;  4V1A p;  1VF1 A;  1O73 A;  2LS5 A;  3TRQ A;  2XPE A;  2ALB A;  2LJR A;  1AQW A;  2A2R A;  2WFC A;  1T3B A;  1XWA A;  1H4O A;  4I2U A;  4RI6 A;  3QFB C;  5D96 A;  3F6D A;  4OWY A;  4L0U A;  1BJX A;  16GS A;  4K7O A;  2A4H A;  4LA1 A;  4DVC A;  2JAC A;  4J57 E;  4GLT A;  1RK4 A;  5F07 A;  4TR3 A;  1HNC A;  2HT9 A;  1BX9 A;  4FO5 A;  2REM A;  4BVY B;  3GKN A;  4YQU A;  3CSJ A;  1GSE A;  1OVN A;  4POB A;  4OMV A;  2H71 A;  3GMF A;  4G2E A;  3J7Y k;  5CRE A;  1XW6 A;  1X0R A;  3PGT A;  3VK9 A;  3DEX A;  3HDC A;  3Q6O A;  1F9M A;  1T00 A;  2X4A A;  2QGV A;  2ZCT A;  1WPI A;  2YZU A;  1FHE A;  2YOI A;  1WE0 A;  2GQK A;  2DJ1 A;  1NM3 A;  1T4Z A;  3IR4 A;  3GKK A;  2FCH A;  1XIY A;  5IIZ A;  2DSA A;  1AC1 A;  3MNG A;  2VAF A;  5IO0 A;  3D4T A;  5DQY A;  3ZLP A;  1V2A A;  3CSH A;  4KCE A;  3LQ7 A;  5G2Z A;  3C1S A;  2GVP A;  2AUV A;  3KXO A;  2C0E A;  2PWJ A;  5AIS A;  1XW9 A;  3VLN A;  3IC4 A;  4O32 A;  5DAK A;  3TJK A;  3O76 A;  2MYG A;  4XS4 A;  5F0G A;  4I5Q A;  4Q5N A;  3BJ5 A;  2GZP A;  4JBB A;  4FQU A;  2BJX A;  5IMA A;  3FK8 A;  3FHK A;  3HCZ A;  1OAZ A;  1SJ6 A;  3LYK A;  4BVX B;  4HZ4 A;  4HDE A;  2FUG 2;  1SYR A;  3ERG A;  4Z2U A;  5B6N A;  4HQS A;  2CZ3 A;  2OKA A;  5HR2 A;  2H0I A;  1ZGN A;  2LUS A;  4X0X A;  1GTI A;  3TRX A;  3HXS A;  3WT2 A;  1K3Y A;  3EYT A;  2GT6 A;  3E3E A;  1GTA A;  4ZB9 A;  2XPD A;  1SKR B;  2QSI A;  3ZL5 A;  5HR1 A;  4WF4 A;  1NHY A;  1S3A A;  1F6M C;  3RDW A;  1B4Q A;  4JED A;  5G31 A;  3HZ4 A;  3RAZ A;  4MH2 A;  2K8S A;  3IDV A;  4WR4 A;  1OE8 A;  3RPP A;  4MJC A;  2A4V A;  3H4K A;  2PN8 A;  3UVH A;  3KM6 A;  5JWR B;  5HFG A;  3L9S A;  1J0F A;  4USS A;  2X8G A;  4L5L A;  2FWE A;  2KLX A;  4F9Z A;  3H8Q A;  3FY7 A;  1OE7 A;  5ID2 A;  4BWQ A;  1YKA A;  5GST A;  4KAE A;  1EOH A;  2LV3 A;  1VF4 A;  5J3R A;  2WJU A;  5JCU A;  4Z7X A;  3DVW A;  2DJ3 A;  5G5F A;  1EGR A;  1V58 A;  4XIH A;  4EKZ A;  4PUA A;  3I43 A;  2OA7 A;  3VUR A;  4KH7 A;  2C3N A;  4MJB A;  2RII A;  3TJG A;  4PUF C;  4TKY A;  1IYH A;  2ON5 A;  3UEM A;  5KN0 A;  2C80 A;  4HJ2 A;  1KNG A;  4YH2 A;  2CT6 A;  2CAQ A;  4G0L A;  5LNK e;  3IAS 2;  4EIP A;  1GLP A;  3CSI A;  3RHC A;  1X9S B;  2F3M A;  1THO A;  2L6C A;  5G1L A;  4IJ3 A;  1V57 A;  3LXZ A;  3HYP A;  5JWO B;  2VM2 A;  4K8M A;  4Q5F A;  4J2F A;  3PH9 A;  1OC3 A;  1ZYP A;  5ENU A;  1NW2 A;  3EWL A;  4HOJ A;  2QA2 A;  2HI7 A;  2FHE A;  3BD2 A;  4X1U A;  4MLY A;  4O92 A;  2JZR A;  3ZML A;  4BIK A;  3TJF A;  3HVX A;  3KH9 A;  3IXR A;  2K18 A;  2J23 A;  3IRA A;  2V6K A;  3FR9 A;  3AY8 A;  2LKU A;  3QD9 A;  3C1R A;  4BPY A;  1PN9 A;  3EMP A;  2LEG A;  2H0H A;  5ECM B;  5FHI A;  4MF5 A;  1MTC A;  2A2P A;  2M72 A;  3KEB A;  4EO3 A;  1AIU A;  3NIV A;  4ECI A;  4MF7 A;  1OKD A;  4CY8 A;  1A23 A;  2O87 A;  3TB2 A;  4KW6 A;  5ABR A;  1TW9 A;  2HZF A;  1OC9 B;  1OYJ A;  1FVK A;  1XZO A;  2MMA A;  1Z5Y E;  1M9B A;  4MZW A;  5IM9 A;  4DSR A;  2A2S A;  4NPB A;  2MBS A;  1FG4 A;  4MH3 A;  4F0C A;  2IL3 A;  3F4S A;  1W4V A;  3MYD A;  4HQZ A;  1FVJ A;  6GSX A;  1SL1 B;  3DRN A;  3CRU A;  4IQ1 A;  2HLS A;  2VCV A;  1GRX A;  4IKH A;  5IQY A;  2LNS A;  1GSQ A;  1Z9H A;  3FR3 A;  2TIR A;  2X64 A;  5J5N A;  5DQS A;  4EL1 A;  4N30 A;  4L0W A;  3UL3 A;  2WCI A;  5ECI B;  4WBR D;  4AJ7 A;  3GYK A;  5COH A;  2DMM A;  3H79 A;  3LXT A;  2XBQ A;  5AIV A;  3LW9 A;  1AW9 A;  4H86 A;  4D73 A;  2JU5 A;  4GWR A;  1EP8 A;  2JZT A;  4XRA A;  1U3A A;  1M0U A;  4K9Z A;  2DIY A;  4KE3 A;  2AYT A;  1Z6N A;  1THX A;  1VF3 A;  5IMZ A;  1GSD A;  4ICY A;  5CRG A;  5CNW A;  3M8N A;  3GN3 A;  1PRX A;  2OAD A;  2QC7 A;  5BMU A;  1K0O A;  2HNL A;  1G6Y A;  2IJY A;  3GRX A;  1ON4 A;  2F51 A;  4XHM A;  1HYU A;  3HA9 A;  4WR5 A;  3QCP A;  2YWO A;  2CX3 A;  4MF6 A;  1MDK A;  19GS A;  5HQP A;  2OBK A;  2H0G A;  2KHP A;  1Z7R A;  2YAN A;  3C71 A;  2IN3 A;  3L78 A;  2DC5 A;  2PBJ A;  3TOT A;  2R37 A;  2YZH A;  4YKG A;  1BYE A;  5IOW A;  4F0B A;  4MZC A;  3KH7 A;  2IIY A;  1B4P A;  2JSY A;  5G30 A;  4HS1 A;  2JL4 A;  2F8F A;  1K0N A;  3NZN A;  1SD9 A;  4FIW A;  4GF0 A;  4MP4 A;  5ECQ B;  1XWB A;  2FLS A;  4LL4 B;  3VWX A;  4HZ2 A;  2VL2 C;  1M3J A;  1TK8 B;  5GAN D;  2FA8 A;  4KND A;  4TXO B;  4K6X A;  3CYN A;  3GTU B;  1FAA A;  1YDK A;  4MNN A;  5F8B A;  2YCD A;  2X8H A;  2YWM A;  4QQ7 A;  2LTK A;  1EP7 A;  3EE2 A;  1ACV A;  2VCW A;  4HUA A;  4N0V A;  3BOA A;  3HKR A;  3N9J A;  4ML1 A;  2R6K A;  4A5P A;  3WGE A;  4WXT A;  1TP9 A;  1FW1 A;  3LEF A;  4N11 A;  1JZR A;  1GH2 A;  1A2J A;  1O7U A;  3P8W A;  4ID0 A;  2NVL A;  1HNB A;  2NPB A;  2N5F A;  5C00 A;  3GA4 A;  5D9V A;  1IYI A;  2GZZ A;  3EIN A;  3SWL A;  4IEL A;  2I3Y A;  3LJR A;  3L9U A;  4IBP A;  1S3R A;  1PKZ A;  5D9W A;  1PQN A;  4IN0 A;  4IHU A;  4XTS A;  2C3Q A;  3A2W A;  1EZK A;  4ACS A;  4PUR A;  12GS A;  4K7I A;  4POM A;  1O8X A;  2O8V B;  3R3E A;  1EV9 A;  1SL0 B;  3D5J A;  3M0F A;  2CV4 A;  4MMM A;  4AGS A;  2R4V A;  1BAY A;  1X5D A;  3D21 A;  4XS6 A;  3VI7 A;  1FO5 A;  2HXK A;  3TJJ A;  4FYC A;  2HSY A;  2OE0 A;  5IOX A;  4GQC A;  2FD3 A;  2NBS A;  3KD0 A;  2E7P A;  2DLX A;  4BVY A;  2VLU A;  5ECH B;  1B9X C;  3GH9 A;  1DBY A;  3GV1 A;  4CHS A;  4NAX A;  4IW9 A;  2R0C A;  1GNW A;  2F8A A;  3KJY A;  1URM A;  3KMN A;  1GNE A;  4KA0 A;  2I81 A;  1E6B A;  2YV9 A;  5D8I A;  5ECS A;  4OCF A;  1Q98 A;  2B5E A;  4XS1 A;  4ZL7 A;  3PPU A;  4MCU A;  5IMC A;  2EC4 A;  1AUC A;  4BL7 A;  1R4W A;  1FOV A;  1WJK A;  3M3M A;  5G1K A;  5AN1 A;  2KOK A;  3APS A;  4EDY A;  1OKT A;  4NMU A;  2G2Q A;  2ZUP A;  2WZ9 A;  2X8C A;  2N5A A;  1SJZ A;  2P5R A;  2LNT A;  2YJ7 A;  3GX8 A;  5FT3 A;  2VL2 A;  3UBL A;  2JZS A;  1U3I A;  1HD2 A;  2H1G A;  4O5U A;  4YKF A;  2PMT A;  2C0F A;  5B8B A;  1I5G A;  4EDZ A;  3U6V A;  4K0G A;  3M9J A;  2I4A A;  2LRT A;  2TRX A;  2H1B A;  5G5E A;  1UA5 A;  4TXV A;  4JR4 A;  4X4J A;  4ZL8 A;  4ZL9 A;  1X5E A;  1XWC A;  2CVD A;  4I6X A;  4BVX A;  2WB9 A;  3H93 A;  5KN2 A;  2IFQ B;  2GTU A;  4EC0 A;  1GUL A;  4IQA A;  1MD3 A;  18GS A;  4JU5 A;  3A3T A;  3NOF A;  3GIX A;  3IPZ A;  5JWQ B;  2GT5 A;  1Z3E A;  2YV7 A;  4FYB A;  1GUM A;  3CXG A;  3G7Y A;  1YEX A;  1AQV A;  1K0M A;  5ELG A;  1TK5 B;  2JAD A;  3UOM A;  2GSS A;  3F4R A;  5DAL B;  4ZBD A;  3TGZ A;  3H1N A;  4FYU A;  2P5Q A;  3HVV A;  5KEJ A;  3W6G A;  2K9F A;  4PNG A;  4WEY A;  2MMZ A;  1GL8 A;  4V1A g;  3APQ A;  4ML6 A;  1F2E A;  1FB0 A;  4E8E A;  3G7J A;  4DSQ A;  1XOA A;  1PL1 A;  2YP6 A;  2HSM A;  2VLT A;  3D4M A;  3WGX A;  22GS A;  2WRT A;  5F05 A;  2VCZ A;  3QFA C;  3F0I A;  4YQV A;  2AJQ B;  2IME A;  2YPM A;  2J9H A;  4TR1 B;  4KUN A;  2O85 A;  4TRX A;  3HZ8 A;  5CAX A;  1SKW B;  3LWA A;  4KB3 A;  2H6Z A;  1RQM A;  4ZIL A;  2IMI A;  1JZW A;  2L5L A;  5A5K A;  4AJ8 A;  2RM6 A;  2VO4 A;  5AIX A;  3ZIT A;  3EU3 A;  3KGK A;  3FW2 A;  3N5O A;  2FY6 A;  4K1F A;  4QL9 A;  2PU9 C;  1XWG A;  2V41 A;  3I6A A;  5GAP D;  3US3 A;  1HNA A;  3CQF A;  1TTZ A;  2OBI A;  4NWY A;  2HFD A;  3EMX A;  4NV5 A;  4POL A;  2DJ0 A;  3KCM A;  1GSU A;  1ERU A;  3O6T A;  1M99 A;  2H6X A;  5B7C A;  2HZE B;  3IK9 A;  4KDU A;  5J9B A;  1K3O A;  3UJ1 A;  1SD8 A;  5CYY A;  4YAP A;  1Z7P A;  6GST A;  1KTE A;  3QR6 A;  3ERW A;  1K0D A;  1QMV A;  4OO5 A;  1GLQ A;  5DBQ A;  2FWG A;  4YQM A;  4CY6 A;  1ZMA A;  3ZFB A;  2OAC A;  1NSW A;  2C3T A;  5J41 A;  1SEN A;  1YJ6 A;  4DSS A;  1G0T A;  1N2A A;  5ECK B;  1KEB A;  1XPV A;  1SYX A;  5D93 A;  2X99 A;  1X9W B;  3ZFL A;  4K5R A;  14GS A;  2GQM A;  3DGQ A;  6GSW A;  6GSU A;  4F03 A;  2VD0 A;  5IMF A;  2V32 A;  1WOU A;  1PSQ A;  4ULX A;  1TU7 A;  1U87 A;  1YQ1 A;  4TOP A;  2YNX A;  4Z2R A;  2B3S A;  4AF2 A;  2B5X A;  5DDL A;  3CRT A;  1GTU A;  1GSF A;  1QUW A;  1QFN A;  3C8E A;  10GS A;  3A5W A;  3UAP A;  1A0R P;  1TDI A;  4NHW A;  5B6M A;  2H1A A;  1O6J A;  3M1G A;  3QAG A;  2RM5 A;  3O3T A;  1YKC A;  4GXZ A;  1JZD A;  5HR3 A;  1Y6E A;  1ABA A;  3RBT A;  1LJR A;  2BMX A;  2VD1 A;  3GUR A;  1OC9 A;  2XBI A;  3KP8 A;  3ZZX A;  1Y25 A;  1R5P A;  1JLW A;  4TN8 A;  2EIO A;  5H5R A;  1AXD A;  1PN0 A;  4PX1 A;  1EEJ A;  5GSS A;  5DJL A;  2D2Z A;  3LOR A;  3ZIV A;  2QKE A;  3BBY A;  5GZZ B;  5ECL B;  2CAI A;  3L0H A;  4G0K A;  1U6T A;  3IAM 2;  5CRD A;  3VPQ A;  3E9J B;  3VWW A;  2WUL A;  5EY6 A;  4JRR A;  3HJM A;  2GGT A;  1TXX A;  4I8B A;  4XCS A;  3FR6 A;  2AAW A;  2H1D A;  1XVW A;  1TI1 A;  1VGL A;  5CP1 A;  4KX4 A;  3FKF A;  5E4W A;  3KIJ A;  2CA8 A;  5FWG A;  2QA1 A;  1WMJ A;  5H5Q A;  3CBU A;  2C8U A;  1AAZ A;  3D22 A;  3ZRD A;  4BWS A;  4OO4 A;  2HRN A;  2PER A;  2R0G A;  4JR6 A;  3U5R E;  3I9V 2;  3IV4 A;  2AHE A;  1MDJ A;  3IBH A;  2PUK C;  2LJA A;  1T1V A;  4HU7 A;  3G9B A;  3MDK A;  2GSQ A;  2B1K A;  3LGC A;  5EPF A;  4ECB A;  2IWT A;  6GSS A;  3W8J A;  5ECO B;  3M9K A;  3QAW A;  4KF9 A;  20GS A;  2HYX A;  1ZL9 A;  4O5R A;  2WGR A;  3ZRE A;  4ISD A;  3G7I A;  4KSM A;  4GQF A;  2OE1 A;  1ZYQ B;  2ES7 A;  3DYR A;  4BA7 A;  5H5S A;  13GS A;  1DE1 A;  4MPF A;  3DKS A;  3JCM L;  2H70 A;  2EIR A;  2I1U A;  5KOW A;  1ZCP A;  5ELA A;  4TXO A;  4P3Y B;  2VCT A;  3GTU A;  2V2G A;  3L9V A;  1TRU A;  1DSB A;  4I97 A;  4G9H A;  4KGI A;  4PQ1 A;  3RPN A;  4MAB A;  3TKS E;  1ZOF A;  4ECC A;  1TRW A;  1V9W A;  4LMV A;  2B5Y A;  3IE3 A;  3DWV A;  2JSZ A;  3W8S A;  3GKM A;  2H73 A;  2IPA A;  1A8Y A;  8GSS A;  1ML6 A;  2HSH A;  1U88 A;  3D6I A;  1M2B A;  3L4N A;  1PFO A;  3C73 A;  4GST A;  4MK3 A;  5ECP B;  4F2I A;  1SK1 A;  4HI7 A;  4DEJ A;  4EE0 A;  2O89 A;  3LSZ A;  3EVI A;  1M9A A;  3UIW A;  2VL3 A;  4ZB6 A;  1LBK A;  5F06 A;  2IMF A;  11GS A;  2NTO A;  1PGT A;  4IJI A;  4OFT A;  3Q18 A;  2FA4 A;  3A2V A;  3EC3 A;  3R2Q A;  5DVB A;  4OCE A;  3VFI A;  3HJO A;  3FZ4 A;  1JFU A;  5D73 A;  1QXH A;  2CQ9 A;  2M46 A;  3CMI A;  4V2M A;  1SK0 A;  7GSS A;  17GS A;  2OE3 A;  1T7P B;  4NV2 A;  1UN2 A;  1PX7 A;  1W89 A;  4N10 A;  3HVN A;  1EGO A;  2RUE A;  3F9U A;  1PL2 A;  2VOC A;  4ZBB A;  4AJ6 A;  3VI5 A;  1M7T A;  2DKH A;  1JLV A;  1EV4 A;  2VLV A;  3IOS A;  1EOG A;  1K0A A;  3FZ5 A;  1I9D A;  3WGD A;  3QOU A;  2GS3 A;  1XCC A;  3DML A;  3GST A;  4G19 A;  4HJM A;  4NXI A;  2AV4 A;  4IVF A;  3C7M A;  1WRY A;  3EU4 A;  5D9T A;  5L71 A;  1BG5 A;  1TOF A;  2CZ2 A;  1G7E A;  2UZ8 A;  3GHA A;  3KTB A;  4KDX A;  5EL8 A;  4RQR A;  4IP6 A;  2H76 A;  2YWI A;  4V2L A;  2FWF A;  2PGT A;  2LQQ A;  2TRC P;  3Q74 A;  1ZYE A;  3IC8 A;  4MA9 A;  2MZC A;  3DXB A;  1M2D A;  1UC7 A;  2DIZ A;  4MJE A;  1AQX A;  2G0F A;  2GZY A;  3GFK A;  5DCH A;  2MMN A;  1ST9 A;  5J9C A;  5HFK A;  2L6D A;  3GSS A;  2FGX A;  4RQX A;  4BL7 B;  2H66 A;  4L5O A;  2VIM A;  3V1W A;  3E0U A;  1PMT A;  4KSO A;  3TJB A;  2C0D A;  1CQG A;  1EWX A;  2P31 A;  1Q4J A;  1GWC A;  4K7N A;  3GKX A;  1K0B A;  1QQ2 A;  2IFQ A;  2YJH A;  2WS2 A;  1BED A;  3ED3 A;  1YZX A;  4ZB8 A;  5DAK B;  2LRN A;  4Q5Q A;  1ERT A;  3ZYW A;  4XS4 B;  5ECN B;  2B6M A;  3TKQ A;  2F9S A;  3DD3 A;  4WKW A;  5EVO A;  4OFN A;  4YAV A;  4ECJ A;  4EUY A;  6GSY A;  1T8E B;  2HRA A;  1SJI A;  5DJM A;  5HFI A;  3ZTL A;  3MAK A;  5DAL A;  4Z2T A;  1TKD B;  4JE1 A;  3HJP A;  4EF0 A;  4PGT A;  3VWV A;  3I69 A;  2MMO A;  2ZNM A;  3ERF A;  2FWH A;  4ILF A;  2DBC A;  2B7J A;  2O7K A;  3VPT A;  1FB6 A;  4E8H A;  2KUC A;  2VM1 A;  2V1M A;  3MSZ A;  4PNF A;  1GUH A;  2VCQ A;  5BRT A;  2XC2 A;  3FZ9 A;  1G7O A;  3F8U A;  9GSS A;  4EVM A;  2FNO A;  3A2X A;  4TR1 A;  2NDO A;  5E59 A;  1YY7 A;  5JCW A;  2LST A;  1XFL A;  5A4W A;  3ZVJ A;  1WWJ A;  2C0G A;  1MEK A;  1H75 A;  3TKS C;  4OFM A;  3UVT A;  4GSN A;  4ZIJ A;  1V98 A;  3SBC A;  4I2T A;  4TR0 A;  4L8E A;  2X49 A;  1TK0 B;  3KTL A;  5ID2 B;  3VWU A;  4J56 E;  2H01 A;  2PVQ A;  2IMD A;  1F37 A;  1SK2 A;  4V2N A;  5HR0 A;  2CVK A;  4GCI A;  3TOU A;  1S3C A;  4N0Z A;  4O7H A;  5LCZ A;  3MWH A;  4WET A;  4OD7 A;  1JHB A;  1XXU A;  3HD5 A;  3UMA A;  5IMD A;  5CRH A;  1K3L A;  1GSY A;  2HZE A;  5KN3 A;  1C72 A;  4WBJ A;  1NHO A;  1RW1 A;  1YF1 A;  2H8L A;  1MDI A;  3P2A A;  1M3I A;  3HHV A;  3OR5 A;  1M2A A;  1SL2 B;  1XWK A;  2H6Y A;  4LL1 B;  1R26 A;  3WD6 A;  3GX0 A;  2H75 A;  3TCO A;  5IPH A;  4JZQ A;  5IO2 A;  3TKP A;  3MIX A;  1B48 A;  2HE3 A;  1A2L A;  4LLR A;  1YEP A;  2VCX A;  4POK A;  2H30 A;  1K0C A;  3J7Y b;  1G6W A;  1V40 A;  2WDU A;  1MD4 A;  4NHZ A;  2B1L A;  1GUK A;  3WYW A;  4HEA 2;  3FMW A;  2I9H A;  2DJJ A;  3F4T A;  4DSS B;  3S9F A;  4K2X A;  3QMX A;  2L57 A;  3HVS A;  1WP0 A;  1O85 A;  3DVX A;  2GLR A;  4K2D A;  5AGY A;  4KDY A;  3ISO A;  4XRD A;  2YN1 A;  1OC8 A;  3GL5 A;  1ZZY A;  3F6F A;  4ZXG A;  1A2M A;  3BCK A;  1HQO A;  3KP9 A;  1TRV A;  3GL3 A;  2BTO T;  3GNJ A;  1ERV A;  3P90 A;  4PTS A;  3BCI A;  4Q5R A;  5IMV A;  2GQL A;  3Q19 A;  2ON7 A;  1X9M B;  4MPG A;  2L4C A;  1ZYN A;  2R3X A;  1VRS D;  1ERW A;  3LFL A;  2HRF A;  3F3Q A;  3ME7 A;  3A5I A;  1S3D A;  4HU9 A;  3CTG A;  1EEM A;  3FRC A;  2OJL A;  3FEU A;  2AB6 A;  2GDR A;  4G10 A;  1R5A A;  1PD2 1;  1XOB A;  4TW5 A;  2H72 A;  1CQH A;  1TI3 A;  1PA3 A;  3EPT A;  1SU9 A;  4CDO A;  1A8L A;  3UAR A;  2E0Q A;  2H74 A;  3ME8 A;  2HRK A;  1J08 A;  5B8A A;  1USB A;  3TKS A;  4EXJ A;  2V6O A;  5CRW A;  4O5Q A;  5KN1 A;  2DJK A;  4PQI A;  1X5C A;  2H19 A;  4MDC A;  5CO3 A;  1B8X A;  2CX4 A;  1F3A A;  3EUR A;  4K0N A;  3D0Z A;  2C4J A;  1YF0 A;  2L4Q A;  4PQH A;  2KP1 A;  2MBT A;  2LJK A;  1R7H A;  2PVO C;  2KP2 A;  1QGV A;  2IMK A;  2K8V A;  5ECR B;  1DUG A;  1E2Y A;  4HSC X;  4MJA A;  4TR4 A;  4FH8 A;  2DKI A;  1QK8 A;  2LRC A;  4IGJ A;  5LD0 A;  5INY A;  3LG6 A;  4ZBA A;  2DJ2 A;  3K8N A;  4D73 B;  2C1Y A;  3RHB A;  1WIK A;  4RUV A;  1O8W A;  3WT1 A;  1LU4 A;  2EIQ A;  2YWN A;  1XW5 A;  3DIE A;  3TRP A;  2LQO A;  5KOX A;  2E2G A;  1DE2 A;  2CVB A;  1GTB A;  1B9Y C;  1JZO A;  2K6V A;  5A4V A;  1O81 A;  1T4Y A;  2L59 A;  4F82 A;  3GH6 A;  2RLI A;  5D9X A;  3ZMK A;  2DML A;  1GP1 A;  3PIN A;  2N5B A;  1F3B A;  2XHF A;  4MZB A;  2VL9 A;  1N8J A;  1FOH A;  3TDG A;  5IPG A;  1J9B A;  1TJD A;  1BQ7 A;  5C04 A;  3KMO A;  4GRF A;  2RUF A;  4G0I A;  5J4U A;  4PXO A;  1PX6 A;  3UBK A;  2R2J A;  3CTF A;  4TVE A;  2GST A;  2R5G A;  2GSR A;  1KBN A;  2PPT A;  1TU8 A;  1SKS B;  4IP1 A;  1ILO A;  2R0P A;  3QPM A; 
#chains in the Genus database with same CATH homology
 3F3R A;  3ZVJ D;  3APO A;  5DCG A;  3HY2 A;  1A24 A;  2B7K A;  4K5S A;  5A4U A;  2L5O A;  4GTU A;  3TKR A;  3KZQ A;  1VF2 A;  4GSS A;  2M80 A;  1PKW A;  2Z9S A;  4CW9 A;  1Z6M A;  4IS0 A;  4EIQ A;  3F63 A;  3QDN A;  4WF5 A;  1A0F A;  4LMW A;  2P0G A;  3GUS A;  1TRS A;  3LYP A;  1XBS A;  2E2M A;  1GSS A;  1XVQ A;  4QL7 A;  3PR8 A;  4RI7 A;  3P7X A;  3QAV A;  2VUP A;  3FYG A;  3IK7 A;  6GSV A;  3IHQ A;  4X43 A;  3FZA A;  3TUE A;  3IHG A;  4KCA A;  3ZIJ A;  5JCG A;  3IA1 A;  1UVZ A;  4V1A p;  1VF1 A;  1O73 A;  2LS5 A;  3TRQ A;  2XPE A;  2ALB A;  2LJR A;  1AQW A;  2A2R A;  2WFC A;  1T3B A;  1XWA A;  1H4O A;  4I2U A;  4RI6 A;  3QFB C;  5D96 A;  3F6D A;  4OWY A;  4L0U A;  1BJX A;  16GS A;  4K7O A;  2A4H A;  4LA1 A;  4DVC A;  2JAC A;  4J57 E;  4GLT A;  1RK4 A;  5F07 A;  4TR3 A;  1HNC A;  2HT9 A;  1BX9 A;  4FO5 A;  2REM A;  4BVY B;  3GKN A;  4YQU A;  3CSJ A;  1GSE A;  1OVN A;  4POB A;  4OMV A;  2H71 A;  3GMF A;  4G2E A;  3J7Y k;  5CRE A;  1XW6 A;  1X0R A;  3PGT A;  3VK9 A;  3DEX A;  3HDC A;  3Q6O A;  1F9M A;  1T00 A;  2X4A A;  2QGV A;  2ZCT A;  1WPI A;  2YZU A;  1FHE A;  2YOI A;  1WE0 A;  2GQK A;  2DJ1 A;  1NM3 A;  1T4Z A;  3IR4 A;  3GKK A;  2FCH A;  1XIY A;  5IIZ A;  2DSA A;  1AC1 A;  3MNG A;  2VAF A;  5IO0 A;  3D4T A;  5DQY A;  3ZLP A;  1V2A A;  3CSH A;  4KCE A;  3LQ7 A;  5G2Z A;  3C1S A;  2GVP A;  2AUV A;  3KXO A;  2C0E A;  2PWJ A;  5AIS A;  1XW9 A;  3VLN A;  3IC4 A;  4O32 A;  5DAK A;  3TJK A;  3O76 A;  2MYG A;  4XS4 A;  5F0G A;  4I5Q A;  4Q5N A;  3BJ5 A;  2GZP A;  4JBB A;  4FQU A;  2BJX A;  5IMA A;  3FK8 A;  3FHK A;  3HCZ A;  1OAZ A;  1SJ6 A;  3LYK A;  4BVX B;  4HZ4 A;  4HDE A;  2FUG 2;  1SYR A;  3ERG A;  4Z2U A;  5B6N A;  4HQS A;  2CZ3 A;  2OKA A;  5HR2 A;  2H0I A;  1ZGN A;  2LUS A;  4X0X A;  1GTI A;  3TRX A;  3HXS A;  3WT2 A;  1K3Y A;  3EYT A;  2GT6 A;  3E3E A;  1GTA A;  4ZB9 A;  2XPD A;  1SKR B;  2QSI A;  3ZL5 A;  5HR1 A;  4WF4 A;  1NHY A;  1S3A A;  1F6M C;  3RDW A;  1B4Q A;  4JED A;  5G31 A;  3HZ4 A;  3RAZ A;  4MH2 A;  2K8S A;  3IDV A;  4WR4 A;  1OE8 A;  3RPP A;  4MJC A;  2A4V A;  3H4K A;  2PN8 A;  3UVH A;  3KM6 A;  5JWR B;  5HFG A;  3L9S A;  1J0F A;  4USS A;  2X8G A;  4L5L A;  2FWE A;  2KLX A;  4F9Z A;  3H8Q A;  3FY7 A;  1OE7 A;  5ID2 A;  4BWQ A;  1YKA A;  5GST A;  4KAE A;  1EOH A;  2LV3 A;  1VF4 A;  5J3R A;  2WJU A;  5JCU A;  4Z7X A;  3DVW A;  2DJ3 A;  5G5F A;  1EGR A;  1V58 A;  4XIH A;  4EKZ A;  4PUA A;  3I43 A;  2OA7 A;  3VUR A;  4KH7 A;  2C3N A;  4MJB A;  2RII A;  3TJG A;  4PUF C;  4TKY A;  1IYH A;  2ON5 A;  3UEM A;  5KN0 A;  2C80 A;  4HJ2 A;  1KNG A;  4YH2 A;  2CT6 A;  2CAQ A;  4G0L A;  5LNK e;  3IAS 2;  4EIP A;  1GLP A;  3CSI A;  3RHC A;  1X9S B;  2F3M A;  1THO A;  2L6C A;  5G1L A;  4IJ3 A;  1V57 A;  3LXZ A;  3HYP A;  5JWO B;  2VM2 A;  4K8M A;  4Q5F A;  4J2F A;  3PH9 A;  1OC3 A;  1ZYP A;  5ENU A;  1NW2 A;  3EWL A;  4HOJ A;  2QA2 A;  2HI7 A;  2FHE A;  3BD2 A;  4X1U A;  4MLY A;  4O92 A;  2JZR A;  3ZML A;  3TJF A;  3HVX A;  3KH9 A;  3IXR A;  2K18 A;  2J23 A;  3IRA A;  2V6K A;  3FR9 A;  3AY8 A;  2LKU A;  3QD9 A;  3C1R A;  4BPY A;  1PN9 A;  3EMP A;  2LEG A;  2H0H A;  5ECM B;  5FHI A;  4MF5 A;  1MTC A;  2A2P A;  2M72 A;  3KEB A;  4EO3 A;  1AIU A;  3NIV A;  4ECI A;  4MF7 A;  1OKD A;  4CY8 A;  1A23 A;  2O87 A;  3TB2 A;  4KW6 A;  5ABR A;  1TW9 A;  2HZF A;  1OC9 B;  1OYJ A;  1FVK A;  1XZO A;  2MMA A;  1Z5Y E;  1M9B A;  4MZW A;  5IM9 A;  4DSR A;  2A2S A;  4NPB A;  2MBS A;  1FG4 A;  4MH3 A;  4F0C A;  2IL3 A;  3F4S A;  1W4V A;  3MYD A;  4HQZ A;  1FVJ A;  6GSX A;  1SL1 B;  3DRN A;  3CRU A;  4IQ1 A;  2HLS A;  2VCV A;  1GRX A;  4IKH A;  5IQY A;  2LNS A;  1GSQ A;  1Z9H A;  3FR3 A;  2TIR A;  2X64 A;  5J5N A;  5DQS A;  4EL1 A;  4N30 A;  4L0W A;  3UL3 A;  2WCI A;  5ECI B;  4WBR D;  4AJ7 A;  3GYK A;  5COH A;  2DMM A;  3H79 A;  3LXT A;  2XBQ A;  5AIV A;  3LW9 A;  1AW9 A;  4H86 A;  4D73 A;  2JU5 A;  4GWR A;  1EP8 A;  2JZT A;  4XRA A;  1U3A A;  1M0U A;  4K9Z A;  2DIY A;  4KE3 A;  2AYT A;  1Z6N A;  1THX A;  1VF3 A;  5IMZ A;  1GSD A;  4ICY A;  5CRG A;  5CNW A;  3M8N A;  3GN3 A;  1PRX A;  2OAD A;  2QC7 A;  5BMU A;  1K0O A;  2HNL A;  1G6Y A;  2IJY A;  3GRX A;  1ON4 A;  2F51 A;  4XHM A;  1HYU A;  3HA9 A;  4WR5 A;  3QCP A;  2YWO A;  2CX3 A;  4MF6 A;  1MDK A;  19GS A;  5HQP A;  2OBK A;  2H0G A;  2KHP A;  1Z7R A;  2YAN A;  3C71 A;  2IN3 A;  3L78 A;  2DC5 A;  2PBJ A;  3TOT A;  2R37 A;  2YZH A;  4YKG A;  1BYE A;  5IOW A;  4F0B A;  4MZC A;  3KH7 A;  2IIY A;  1B4P A;  2JSY A;  5G30 A;  4HS1 A;  2JL4 A;  2F8F A;  1K0N A;  3NZN A;  1SD9 A;  4FIW A;  4GF0 A;  4MP4 A;  5ECQ B;  1XWB A;  2FLS A;  4LL4 B;  3VWX A;  4HZ2 A;  2VL2 C;  1TK8 B;  5GAN D;  2FA8 A;  4KND A;  4TXO B;  4K6X A;  3CYN A;  3GTU B;  1FAA A;  1YDK A;  4MNN A;  5F8B A;  2YCD A;  2X8H A;  2YWM A;  4QQ7 A;  2LTK A;  1EP7 A;  3EE2 A;  1ACV A;  2VCW A;  4HUA A;  4N0V A;  3BOA A;  3HKR A;  3N9J A;  4ML1 A;  2R6K A;  4A5P A;  3WGE A;  4WXT A;  1TP9 A;  1FW1 A;  3LEF A;  4N11 A;  1JZR A;  1GH2 A;  1A2J A;  1O7U A;  3P8W A;  4ID0 A;  2NVL A;  1HNB A;  2NPB A;  2N5F A;  5C00 A;  3GA4 A;  5D9V A;  1IYI A;  2GZZ A;  3EIN A;  3SWL A;  4IEL A;  2I3Y A;  3LJR A;  3L9U A;  4IBP A;  1PKZ A;  5D9W A;  1PQN A;  4IN0 A;  4IHU A;  4XTS A;  2C3Q A;  3A2W A;  1EZK A;  4ACS A;  4PUR A;  12GS A;  4K7I A;  4POM A;  1O8X A;  2O8V B;  3R3E A;  1EV9 A;  1SL0 B;  3D5J A;  3M0F A;  2CV4 A;  4MMM A;  4AGS A;  2R4V A;  1BAY A;  1X5D A;  3D21 A;  4XS6 A;  3VI7 A;  1FO5 A;  2HXK A;  3TJJ A;  4FYC A;  2HSY A;  2OE0 A;  5IOX A;  4GQC A;  2FD3 A;  2NBS A;  3KD0 A;  2E7P A;  2DLX A;  4BVY A;  2VLU A;  5ECH B;  1B9X C;  3GH9 A;  1DBY A;  3GV1 A;  4CHS A;  4NAX A;  4IW9 A;  2R0C A;  1GNW A;  2F8A A;  3KJY A;  1URM A;  3KMN A;  1GNE A;  4KA0 A;  2I81 A;  1E6B A;  2YV9 A;  5D8I A;  5ECS A;  4OCF A;  1Q98 A;  2B5E A;  4XS1 A;  4ZL7 A;  3PPU A;  4MCU A;  5IMC A;  2EC4 A;  1AUC A;  4BL7 A;  1R4W A;  1FOV A;  1WJK A;  3M3M A;  5G1K A;  5AN1 A;  2KOK A;  3APS A;  4EDY A;  1OKT A;  4NMU A;  2G2Q A;  2ZUP A;  2WZ9 A;  2X8C A;  2N5A A;  1SJZ A;  2P5R A;  2LNT A;  2YJ7 A;  3GX8 A;  5FT3 A;  2VL2 A;  3UBL A;  2JZS A;  1U3I A;  1HD2 A;  2H1G A;  4O5U A;  4YKF A;  2PMT A;  2C0F A;  5B8B A;  1I5G A;  4EDZ A;  3U6V A;  4K0G A;  3M9J A;  2I4A A;  2LRT A;  2TRX A;  2H1B A;  5G5E A;  1UA5 A;  4TXV A;  4JR4 A;  4X4J A;  4ZL8 A;  4ZL9 A;  1X5E A;  1XWC A;  2CVD A;  4I6X A;  4BVX A;  2WB9 A;  3H93 A;  5KN2 A;  2IFQ B;  2GTU A;  4EC0 A;  1GUL A;  4IQA A;  1MD3 A;  18GS A;  4JU5 A;  3A3T A;  3NOF A;  3GIX A;  3IPZ A;  5JWQ B;  2GT5 A;  1Z3E A;  2YV7 A;  4FYB A;  1GUM A;  3CXG A;  3G7Y A;  1YEX A;  1AQV A;  1K0M A;  5ELG A;  1TK5 B;  2JAD A;  3UOM A;  2GSS A;  3F4R A;  5DAL B;  4ZBD A;  3TGZ A;  3H1N A;  4FYU A;  2P5Q A;  3HVV A;  5KEJ A;  3W6G A;  2K9F A;  4PNG A;  4WEY A;  2MMZ A;  1GL8 A;  4V1A g;  3APQ A;  4ML6 A;  1F2E A;  1FB0 A;  4E8E A;  3G7J A;  4DSQ A;  1XOA A;  1PL1 A;  2YP6 A;  2HSM A;  2VLT A;  3D4M A;  3WGX A;  22GS A;  2WRT A;  5F05 A;  2VCZ A;  3QFA C;  3F0I A;  4YQV A;  2AJQ B;  2IME A;  2YPM A;  2J9H A;  4TR1 B;  4KUN A;  2O85 A;  4TRX A;  3HZ8 A;  5CAX A;  1SKW B;  3LWA A;  4KB3 A;  2H6Z A;  1RQM A;  4ZIL A;  2IMI A;  1JZW A;  2L5L A;  5A5K A;  4AJ8 A;  2RM6 A;  2VO4 A;  5AIX A;  3ZIT A;  3EU3 A;  3KGK A;  3FW2 A;  3N5O A;  2FY6 A;  4K1F A;  4QL9 A;  2PU9 C;  1XWG A;  2V41 A;  3I6A A;  5GAP D;  3US3 A;  1HNA A;  1TTZ A;  2OBI A;  4NWY A;  2HFD A;  3EMX A;  4NV5 A;  4POL A;  2DJ0 A;  3KCM A;  1GSU A;  1ERU A;  3O6T A;  1M99 A;  2H6X A;  5B7C A;  2HZE B;  3IK9 A;  4KDU A;  5J9B A;  1K3O A;  3UJ1 A;  1SD8 A;  5CYY A;  4YAP A;  1Z7P A;  6GST A;  1KTE A;  3QR6 A;  3ERW A;  1K0D A;  1QMV A;  4OO5 A;  1GLQ A;  5DBQ A;  2FWG A;  4YQM A;  4CY6 A;  1ZMA A;  3ZFB A;  2OAC A;  1NSW A;  2C3T A;  5J41 A;  1SEN A;  1YJ6 A;  4DSS A;  1G0T A;  1N2A A;  5ECK B;  1KEB A;  1XPV A;  1SYX A;  5D93 A;  2X99 A;  1X9W B;  3ZFL A;  4K5R A;  14GS A;  2GQM A;  3DGQ A;  6GSW A;  6GSU A;  4F03 A;  2VD0 A;  5IMF A;  2V32 A;  1WOU A;  1PSQ A;  4ULX A;  1TU7 A;  1U87 A;  1YQ1 A;  4TOP A;  2YNX A;  4Z2R A;  2B3S A;  4AF2 A;  2B5X A;  5DDL A;  3CRT A;  1GTU A;  1GSF A;  1QUW A;  1QFN A;  3C8E A;  10GS A;  3A5W A;  3UAP A;  1A0R P;  1TDI A;  4NHW A;  5B6M A;  2H1A A;  1O6J A;  3M1G A;  3QAG A;  2RM5 A;  3O3T A;  1YKC A;  4GXZ A;  1JZD A;  5HR3 A;  1Y6E A;  1ABA A;  3RBT A;  1LJR A;  2BMX A;  2VD1 A;  3GUR A;  1OC9 A;  2XBI A;  3KP8 A;  3ZZX A;  1Y25 A;  1R5P A;  1JLW A;  4TN8 A;  2EIO A;  5H5R A;  1AXD A;  1PN0 A;  4PX1 A;  1EEJ A;  5GSS A;  5DJL A;  2D2Z A;  3LOR A;  3ZIV A;  2QKE A;  3BBY A;  5GZZ B;  5ECL B;  2CAI A;  3L0H A;  4G0K A;  1U6T A;  3IAM 2;  5CRD A;  3VPQ A;  3E9J B;  3VWW A;  2WUL A;  5EY6 A;  4JRR A;  3HJM A;  2GGT A;  1TXX A;  4I8B A;  4XCS A;  3FR6 A;  2AAW A;  2H1D A;  1XVW A;  1TI1 A;  1VGL A;  5CP1 A;  4KX4 A;  3FKF A;  5E4W A;  3KIJ A;  2CA8 A;  5FWG A;  2QA1 A;  1WMJ A;  5H5Q A;  3CBU A;  2C8U A;  1AAZ A;  3D22 A;  3ZRD A;  4BWS A;  4OO4 A;  2HRN A;  2PER A;  2R0G A;  4JR6 A;  3U5R E;  3I9V 2;  3IV4 A;  2AHE A;  1MDJ A;  3IBH A;  2PUK C;  2LJA A;  1T1V A;  4HU7 A;  3G9B A;  3MDK A;  2GSQ A;  2B1K A;  3LGC A;  5EPF A;  4ECB A;  2IWT A;  6GSS A;  3W8J A;  5ECO B;  3M9K A;  3QAW A;  4KF9 A;  20GS A;  2HYX A;  1ZL9 A;  4O5R A;  2WGR A;  3ZRE A;  4ISD A;  3G7I A;  4KSM A;  4GQF A;  2OE1 A;  1ZYQ B;  2ES7 A;  3DYR A;  4BA7 A;  5H5S A;  13GS A;  1DE1 A;  4MPF A;  3DKS A;  3JCM L;  2H70 A;  2EIR A;  2I1U A;  5KOW A;  1ZCP A;  5ELA A;  4TXO A;  4P3Y B;  2VCT A;  3GTU A;  2V2G A;  3L9V A;  1TRU A;  1DSB A;  4I97 A;  4G9H A;  4KGI A;  4PQ1 A;  3RPN A;  4MAB A;  3TKS E;  1ZOF A;  4ECC A;  1TRW A;  1V9W A;  4LMV A;  2B5Y A;  3IE3 A;  3DWV A;  2JSZ A;  3W8S A;  3GKM A;  2H73 A;  2IPA A;  1A8Y A;  8GSS A;  1ML6 A;  2HSH A;  1U88 A;  3D6I A;  1M2B A;  3L4N A;  3C73 A;  4GST A;  4MK3 A;  5ECP B;  4F2I A;  1SK1 A;  4HI7 A;  4DEJ A;  4EE0 A;  2O89 A;  3LSZ A;  3EVI A;  1M9A A;  3UIW A;  2VL3 A;  4ZB6 A;  1LBK A;  5F06 A;  2IMF A;  11GS A;  2NTO A;  1PGT A;  4IJI A;  4OFT A;  3Q18 A;  2FA4 A;  3A2V A;  3EC3 A;  3R2Q A;  5DVB A;  4OCE A;  3VFI A;  3HJO A;  3FZ4 A;  1JFU A;  5D73 A;  1QXH A;  2CQ9 A;  2M46 A;  3CMI A;  4V2M A;  1SK0 A;  7GSS A;  17GS A;  2OE3 A;  1T7P B;  4NV2 A;  1UN2 A;  1PX7 A;  1W89 A;  4N10 A;  1EGO A;  2RUE A;  3F9U A;  1PL2 A;  2VOC A;  4ZBB A;  4AJ6 A;  3VI5 A;  1M7T A;  2DKH A;  1JLV A;  1EV4 A;  2VLV A;  3IOS A;  1EOG A;  1K0A A;  3FZ5 A;  1I9D A;  3WGD A;  3QOU A;  2GS3 A;  1XCC A;  3DML A;  3GST A;  4G19 A;  4HJM A;  4NXI A;  2AV4 A;  4IVF A;  3C7M A;  1WRY A;  3EU4 A;  5D9T A;  5L71 A;  1BG5 A;  1TOF A;  2CZ2 A;  1G7E A;  2UZ8 A;  3GHA A;  3KTB A;  4KDX A;  5EL8 A;  4RQR A;  4IP6 A;  2H76 A;  2YWI A;  4V2L A;  2FWF A;  2PGT A;  2LQQ A;  2TRC P;  3Q74 A;  1ZYE A;  3IC8 A;  4MA9 A;  2MZC A;  3DXB A;  1M2D A;  1UC7 A;  2DIZ A;  4MJE A;  1AQX A;  2G0F A;  2GZY A;  3GFK A;  5DCH A;  2MMN A;  1ST9 A;  5J9C A;  5HFK A;  2L6D A;  3GSS A;  2FGX A;  4RQX A;  4BL7 B;  2H66 A;  4L5O A;  2VIM A;  3V1W A;  3E0U A;  1PMT A;  4KSO A;  3TJB A;  2C0D A;  1CQG A;  1EWX A;  2P31 A;  1Q4J A;  1GWC A;  4K7N A;  3GKX A;  1K0B A;  1QQ2 A;  2IFQ A;  2YJH A;  2WS2 A;  1BED A;  3ED3 A;  1YZX A;  4ZB8 A;  5DAK B;  2LRN A;  4Q5Q A;  1ERT A;  3ZYW A;  4XS4 B;  5ECN B;  2B6M A;  3TKQ A;  2F9S A;  3DD3 A;  4WKW A;  5EVO A;  4OFN A;  4YAV A;  4ECJ A;  4EUY A;  6GSY A;  1T8E B;  2HRA A;  1SJI A;  5DJM A;  5HFI A;  3ZTL A;  3MAK A;  5DAL A;  4Z2T A;  1TKD B;  4JE1 A;  3HJP A;  4EF0 A;  4PGT A;  3VWV A;  3I69 A;  2MMO A;  2ZNM A;  3ERF A;  2FWH A;  4ILF A;  2DBC A;  2B7J A;  2O7K A;  3VPT A;  1FB6 A;  4E8H A;  2KUC A;  2VM1 A;  2V1M A;  3MSZ A;  4PNF A;  1GUH A;  2VCQ A;  5BRT A;  2XC2 A;  3FZ9 A;  1G7O A;  3F8U A;  9GSS A;  4EVM A;  2FNO A;  3A2X A;  4TR1 A;  2NDO A;  5E59 A;  1YY7 A;  5JCW A;  2LST A;  1XFL A;  5A4W A;  3ZVJ A;  1WWJ A;  2C0G A;  1MEK A;  1H75 A;  3TKS C;  4OFM A;  3UVT A;  4GSN A;  4ZIJ A;  1V98 A;  3SBC A;  4I2T A;  4TR0 A;  4L8E A;  2X49 A;  1TK0 B;  3KTL A;  5ID2 B;  3VWU A;  4J56 E;  2H01 A;  2PVQ A;  2IMD A;  1F37 A;  1SK2 A;  4V2N A;  5HR0 A;  2CVK A;  4GCI A;  3TOU A;  1S3C A;  4N0Z A;  4O7H A;  5LCZ A;  3MWH A;  4WET A;  4OD7 A;  1JHB A;  1XXU A;  3HD5 A;  3UMA A;  5IMD A;  5CRH A;  1K3L A;  1GSY A;  2HZE A;  5KN3 A;  1C72 A;  4WBJ A;  1NHO A;  1RW1 A;  1YF1 A;  2H8L A;  1MDI A;  3P2A A;  3HHV A;  3OR5 A;  1M2A A;  1SL2 B;  1XWK A;  2H6Y A;  4LL1 B;  1R26 A;  3WD6 A;  3GX0 A;  2H75 A;  3TCO A;  5IPH A;  4JZQ A;  5IO2 A;  3TKP A;  3MIX A;  1B48 A;  2HE3 A;  1A2L A;  4LLR A;  1YEP A;  2VCX A;  4POK A;  2H30 A;  1K0C A;  3J7Y b;  1G6W A;  1V40 A;  2WDU A;  1MD4 A;  4NHZ A;  2B1L A;  1GUK A;  3WYW A;  4HEA 2;  3FMW A;  2I9H A;  2DJJ A;  3F4T A;  4DSS B;  3S9F A;  4K2X A;  3QMX A;  2L57 A;  3HVS A;  1WP0 A;  1O85 A;  3DVX A;  2GLR A;  4K2D A;  5AGY A;  4KDY A;  3ISO A;  4XRD A;  2YN1 A;  1OC8 A;  3GL5 A;  1ZZY A;  3F6F A;  4ZXG A;  1A2M A;  3BCK A;  1HQO A;  3KP9 A;  1TRV A;  3GL3 A;  2BTO T;  3GNJ A;  1ERV A;  3P90 A;  4PTS A;  3BCI A;  4Q5R A;  5IMV A;  2GQL A;  3Q19 A;  2ON7 A;  1X9M B;  4MPG A;  2L4C A;  1ZYN A;  2R3X A;  1VRS D;  1ERW A;  3LFL A;  2HRF A;  3F3Q A;  3ME7 A;  3A5I A;  1S3D A;  4HU9 A;  3CTG A;  1EEM A;  3FRC A;  2OJL A;  3FEU A;  2AB6 A;  2GDR A;  4G10 A;  1R5A A;  1PD2 1;  1XOB A;  4TW5 A;  2H72 A;  1CQH A;  1TI3 A;  1PA3 A;  3EPT A;  1SU9 A;  4CDO A;  1A8L A;  3UAR A;  2E0Q A;  2H74 A;  3ME8 A;  2HRK A;  1J08 A;  5B8A A;  1USB A;  3TKS A;  4EXJ A;  2V6O A;  5CRW A;  4O5Q A;  5KN1 A;  2DJK A;  4PQI A;  1X5C A;  2H19 A;  4MDC A;  5CO3 A;  1B8X A;  2CX4 A;  1F3A A;  3EUR A;  4K0N A;  3D0Z A;  2C4J A;  1YF0 A;  2L4Q A;  4PQH A;  2KP1 A;  2MBT A;  2LJK A;  1R7H A;  2PVO C;  2KP2 A;  1QGV A;  2IMK A;  2K8V A;  5ECR B;  1DUG A;  1E2Y A;  4MJA A;  4TR4 A;  4FH8 A;  2DKI A;  1QK8 A;  2LRC A;  4IGJ A;  5LD0 A;  5INY A;  3LG6 A;  4ZBA A;  2DJ2 A;  3K8N A;  4D73 B;  2C1Y A;  3RHB A;  1WIK A;  4RUV A;  1O8W A;  3WT1 A;  1LU4 A;  2EIQ A;  2YWN A;  1XW5 A;  3DIE A;  3TRP A;  2LQO A;  5KOX A;  2E2G A;  1DE2 A;  2CVB A;  1GTB A;  1B9Y C;  1JZO A;  2K6V A;  5A4V A;  1O81 A;  1T4Y A;  2L59 A;  4F82 A;  3GH6 A;  2RLI A;  5D9X A;  3ZMK A;  2DML A;  1GP1 A;  3PIN A;  2N5B A;  1F3B A;  2XHF A;  4MZB A;  2VL9 A;  1N8J A;  1FOH A;  3TDG A;  5IPG A;  1J9B A;  1TJD A;  1BQ7 A;  5C04 A;  3KMO A;  4GRF A;  2RUF A;  4G0I A;  5J4U A;  4PXO A;  1PX6 A;  3UBK A;  2R2J A;  3CTF A;  4TVE A;  2GST A;  2R5G A;  2GSR A;  1KBN A;  2PPT A;  1TU8 A;  1SKS B;  4IP1 A;  1ILO A;  2R0P A;  3QPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...