3UVTA

Crystal structure of the third catalytic domain of erp46
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
106
Chain Sequence
STVLALTENNFDDTIAEGITFIKFYAPWCGHCKTLAPTWEELSKKEFPGAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSLHRFVLSQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase
molecule keywords Thioredoxin domain-containing protein 5
publication title Structure of the third catalytic domain of the protein disulfide isomerase ERp46.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 106
sequence length 107
chains with identical sequence B, C, D, E
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3uvtA00
5ECPB 4E8EA 1FB0A 4GSSA 3I43A 2MYGA 3KTBA 3GRXA 1TTZA 3J7Yk 1JZDA 1U6TA 3P8WA 4EDYA 1TKDB 3ZLPA 1ZOFA 2Z9SA 4K1FA 1XWKA 2HRFA 4G2EA 2WGRA 3M1GA 4IVFA 3C8EA 2CZ3A 4KNDA 1YJ6A 4LLRA 3KEBA 2FLSA 3F63A 1GH2A 2LSTA 4BVXA 1G6YA 1VF1A 2B1KA 3ERGA 5IMAA 6GSWA 1C72A 1LBKA 1YF1A 1TU8A 2JL4A 3DVWA 1Z6MA 4YH2A 3HD5A 11GSA 3TRXA 3VWWA 1QUWA 1GLQA 2YV7A 4HI7A 2VD0A 5G31A 4TVEA 4I6XA 1OKTA 4N10A 1H4OA 4G10A 4YQUA 2YNXA 1B8XA 1B9XC 2CV4A 1YQ1A 2XBIA 5G1LA 2ZUPA 1QXHA 2V41A 2O87A 4L0UA 3UIWA 3ZMKA 1T4ZA 5COHA 1B48A 2PVOC 3FZ4A 5IMCA 4Q5RA 1PL2A 3QDNA 5HR2A 4L5LA 1FG4A 2WRTA 4KE3A 3HA9A 3ZITA 4L0WA 2A2RA 5G1KA 2L59A 2C1YA 1O8XA 3VPQA 3ZIVA 1T8EB 3HVXA 2KOKA 3GMFA 1K0OA 3WT2A 5IQYA 5E4WA 1ZL9A 5IPHA 1GSYA 3QR6A 3ZZXA 1Z5YE 4YQMA 1EOGA 2DSAA 2FWHA 3CRTA 2M80A 1B9YC 3FK8A 4TXOB 3O6TA 4WKWA 2LJAA 4JRRA 4PUAA 4WXTA 1TK5B 2IFQA 4TN8A 4ULXA 3HKRA 4HJ2A 4IBPA 3IDVA 3MWHA 2L4QA 2HI7A 3LORA 2HRNA 4MH2A 4WF5A 2YJ7A 3RDWA 1JZWA 4POLA 5B7CA 1OC9B 1EV4A 5H5SA 1T1VA 4K7OA 2H66A 3UBLA 4GSNA 1V58A 2OADA 5LNKe 4HEA2 1THOA 1PN9A 1Z9HA 2B1LA 3GSSA 4HOJA 1SD8A 4K7IA 4PX1A 2OBKA 3HZ4A 1IYIA 1EGOA 4IGJA 5IMDA 3HDCA 2N5BA 3P2AA 2MZCA 3LG6A 3GH9A 3D0ZA 1TI1A 3HXSA 4N0ZA 4NHWA 1ZGNA 7GSSA 2EC4A 3PINA 1KTEA 1VGLA 2FA8A 3TB2A 4ZBBA 2AB6A 1YDKA 4XCSA 4KSOA 4MA9A 2C0EA 2QC7A 3TRPA 3GX0A 2H1DA 3F9UA 1K0DA 2VCXA 5HFKA 4BPYA 3PR8A 3TJGA 3D4MA 3TJJA 4POKA 2MMAA 4JR4A 2IWTA 1LU4A 2AUVA 3DMLA 2PWJA 1BAYA 3A2XA 2LRCA 4MPFA 4XHMA 3QAWA 3ERWA 3NZNA 4KB3A 4V2NA 4LL4B 2VM1A 1JZOA 3CTFA 1U88A 3M0FA 1GSSA 1K3YA 2C80A 3R2QA 1SK0A 2DJKA 5JCGA 1XW5A 1EEJA 1X0RA 1SL1B 3KGKA 1J0FA 3CTGA 2MMOA 3GHAA 4KGIA 4X1UA 2QKEA 2GSTA 3GKNA 5ECRB 2PN8A 4MZCA 3CSJA 3EE2A 2MBSA 4HUAA 3F4RA 4RQRA 2FCHA 5HQPA 2YPMA 4CHSA 1A0FA 3ZREA 2P5QA 3LJRA 3HJMA 1M7TA 1XIYA 1X9WB 3EYTA 5ECIB 2GSSA 3IE3A 4K2DA 2NVLA 4O7HA 1MDJA 2NBSA 5ID2A 13GSA 1ON4A 4N30A 4I8BA 1XWGA 4AF2A 3FKFA 4FYBA 5IIZA 2O8VB 3LYKA 5CRHA 1E6BA 4Z7XA 4YQVA 1XW9A 1PKWA 3SBCA 2AHEA 4WBRD 5IO2A 3ZFBA 2IN3A 5CRDA 2H74A 2K6VA 2BJXA 3GKXA 4HJMA 2JSYA 1GSEA 1Z7PA 1ML6A 2CVKA 3WYWA 2GZYA 1PX6A 4GLTA 4MJEA 5EPFA 4K0GA 4IHUA 4HZ4A 3K8NA 4BL7A 4POMA 3IA1A 1CQGA 1F2EA 2HSYA 2YWIA 5CO3A 3CMIA 3P7XA 3A3TA 3ZYWA 3Q19A 1SENA 4WR5A 3ZVJD 4E8HA 5HFGA 1EWXA 2OBIA 3DRNA 2LNTA 2XHFA 3EMXA 2H76A 1K0NA 5J3RA 3F8UA 4MDCA 3ZIJA 1HNCA 1Y25A 4NV5A 1OE8A 3DXBA 3RHBA 1SL0B 3F6DA 4EE0A 5ECOB 3KZQA 1AQXA 1S3DA 4WETA 1ERVA 1MEKA 1V98A 4OFTA 2VCWA 3UJ1A 2B3SA 2B6MA 4ECIA 2C3QA 5ECQB 3WD6A 4XS6A 2B7KA 3W6GA 1BYEA 2R2JA 5A5KA 4MABA 1XOBA 1YY7A 2TRCP 1RQMA 3GUSA 2F9SA 5FHIA 5ECMB 4TR1B 2F8FA 1TXXA 5INYA 1M9AA 1VF3A 3HJOA 4BWQA 5KN1A 20GSA 2B5YA 2FD3A 4MF7A 3E9JB 5H5RA 4IJ3A 4TR0A 3HJPA 4KUNA 3L4NA 4IELA 1T4YA 1XPVA 1WWJA 2H71A 4K0NA 5CYYA 3D4TA 3TUEA 5ABRA 3US3A 1T3BA 2H6ZA 2R4VA 1ZYEA 1M2BA 5FWGA 3APQA 2DJ2A 3UMAA 6GSXA 3IAS2 3GH6A 1ZZYA 4KCEA 4KCAA 5GSSA 2X99A 3EU3A 2B5EA 4IS0A 1SYXA 3KM6A 3VFIA 1WIKA 2H72A 4OCEA 4GRFA 1BQ7A 2FWGA 2HXKA 2R5GA 3U6VA 3E0UA 4CDOA 3GFKA 3KCMA 3QPMA 3DYRA 5JWRB 4PUFC 3I69A 2HE3A 5D8IA 4EL1A 4FIWA 3BCIA 1GUKA 5LCZA 4Q5QA 5HFIA 1A23A 3N5OA 1EP7A 4KX4A 2B7JA 2FGXA 2L4CA 5ECKB 2HSHA 14GSA 4GSTA 1GSDA 1X9MB 1OYJA 2VUPA 5ECSA 1O73A 4YAVA 4FO5A 2H1GA 5J4UA 2M46A 1HNBA 4PQIA 4DSSA 1E2YA 5F0GA 4D73A 3MDKA 4EO3A 4ECJA 2HZEA 4K7NA 1FW1A 2VLTA 1GWCA 3FY7A 4IW9A 4MJAA 1ACVA 1PA3A 1OKDA 2CAQA 6GSTA 4V1Ag 4TR3A 4KH7A 2H73A 3L9SA 10GSA 3TCOA 2K8VA 3KP9A 2WZ9A 5ECHB 4AJ6A 3DVXA 3GTUB 5DJMA 4ACSA 1TRWA 4PNGA 2ALBA 2KUCA 4FYUA 2RM5A 2LQQA 1EEMA 1BG5A 1SU9A 2X8GA 2C3NA 1HQOA 1NHOA 5CREA 5CAXA 1O8WA 1A2LA 2IMDA 4RI7A 1JLWA 1G7EA 3GX8A 1U3IA 1GTBA 3TKSC 1F9MA 4KDXA 4NAXA 3GNJA 1YEXA 5H5QA 2LRNA 1YKCA 2E2MA 6GSSA 4GXZA 1G6WA 3RAZA 4K6XA 3E3EA 2LJRA 3LFLA 1SKWB 3ERFA 1XFLA 4Q5NA 2DC5A 1AQWA 3FZ9A 3VWXA 5FT3A 2VOCA 6GSYA 3TDGA 2J23A 3DIEA 2LEGA 1RK4A 3FR6A 5JCUA 2PPTA 2JADA 2GGTA 2VL2C 1A0RP 3EVIA 22GSA 4NMUA 2REMA 4EVMA 3VI5A 3ED3A 2YOIA 4LMWA 1PX7A 1FOVA 3CSIA 4PXOA 2LRTA 2GTUA 1AC1A 1MDKA 2YANA 2BMXA 4H86A 1PKZA 1A8YA 4MZWA 3P90A 1FHEA 4HU7A 3QCPA 1O7UA 1UVZA 3BCKA 1SD9A 2O89A 4TXOA 1S3AA 5IOWA 1GUHA 2OE3A 1GTIA 5D9WA 3TGZA 2HZFA 1SJZA 1K3LA 1SKSB 2P0GA 1LJRA 1SL2B 1J9BA 5G2ZA 2OE1A 2MBTA 4BWSA 4CW9A 4L8EA 3MSZA 1K0CA 3CYNA 4DSQA 1YKAA 4IP1A 4TRXA 2RLIA 3RBTA 4MMMA 3APOA 1EZKA 1F6MC 2C4JA 1QK8A 4ID0A 5DAKB 1OC9A 5DALB 2JZRA 3CRUA 4PQHA 4V2LA 2PBJA 3HYPA 1XVWA 1URMA 3UVHA 4XS1A 1QQ2A 1HYUA 5HR3A 18GSA 3C1RA 3IHQA 2C0FA 1GULA 4TR4A 1A2JA 3LXTA 3PH9A 2R37A 2WULA 1FVJA 1N8JA 1JZRA 2XBQA 2XPDA 5CRWA 3PGTA 5EL8A 3C7MA 5KN3A 3TOTA 3A2VA 4OO5A 1OVNA 4O32A 1FB6A 5GSTA 2X8CA 2GLRA 2LJKA 4J57E 4G19A 2WS2A 1YZXA 4F9ZA 2OJLA 2C0GA 2BTOT 4GCIA 2KHPA 3FR3A 2HLSA 1VF4A 2N5FA 2LV3A 3APSA 3RPNA 3G7JA 4WBJA 3IK7A 2FA4A 1WPIA 5CNWA 3KTLA 3HCZA 4Q5FA 2L5LA 3TKSA 3L9UA 3HY2A 1V57A 3QOUA 2NDOA 2H0HA 5A4WA 17GSA 2B5XA 4MK3A 3TKQA 1U87A 3HVVA 3IV4A 1JFUA 1FAAA 2G0FA 1TP9A 2VM2A 2LKUA 5F8BA 4XRAA 1TJDA 1THXA 2V1MA 2A4VA 2VLUA 3JCML 3GL5A 2HYXA 1S3CA 2C3TA 5ID2B 3UBKA 3EU4A 1GNWA 3WGDA 1H75A 2DJ0A 2VL2A 4ECCA 4F0BA 3KXOA 4F0CA 2GQLA 3DEXA 1ERTA 1ERWA 4MF5A 2F8AA 2R3XA 1F3AA 2LS5A 3H93A 1SK1A 2PUKC 3HVSA 4MH3A 1AW9A 4ML6A 4OO4A 4ZL7A 4AGSA 2YWNA 5DQYA 1GSQA 3FW2A 3Q74A 2VL3A 1XWBA 1MTCA 2EIRA 2PERA 5IMZA 2ZNMA 1AXDA 2JACA 3L78A 3KH9A 4ZBAA 3UL3A 1QFNA 2KP1A 5AN1A 5G5EA 1BX9A 2RUFA 4ILFA 4FYCA 1F3BA 1BJXA 1O85A 3GV1A 2IJYA 5DCHA 1X5DA 2GQMA 4FH8A 3KIJA 1WMJA 1MD4A 3IPZA 4HU9A 1R5PA 1O81A 3GSTA 5AISA 3QAVA 3IAM2 3UEMA 4GWRA 4AJ7A 1T7PB 16GSA 5F07A 5C00A 3VURA 4PNFA 4RI6A 1V2AA 5JCWA 2H6YA 1J08A 1SJ6A 1ZMAA 3H1NA 1UC7A 3NOFA 4ZILA 1DSBA 4X0XA 3TJBA 4ECBA 2H8LA 1K0MA 5AGYA 2NPBA 1DE1A 1Z7RA 2JZTA 5G30A 3BJ5A 1XZOA 2YP6A 4EUYA 2I9HA 1NSWA 2E0QA 4TR1A 2CVBA 5D9VA 1TOFA 2VAFA 1BEDA 2N5AA 2H1BA 2CX3A 4IJIA 5KEJA 9GSSA 1OC8A 3F3QA 1Q98A 5ENUA 2MMZA 5B6NA 3KD0A 1V40A 1I9DA 3FZ5A 1K0AA 2IMFA 3GA4A 2IMEA 2FHEA 3AY8A 1TRUA 3ME7A 5GAND 3TKPA 3VWVA 4P3YB 2H1AA 1ILOA 3MAKA 2L57A 1VF2A 4HZ2A 4LA1A 2DIZA 1XOAA 1ERUA 3QFBC 4I5QA 1NHYA 8GSSA 3NIVA 2OA7A 5IM9A 3FEUA 3GIXA 3EC3A 3LQ7A 4V2MA 3OR5A 2CX4A 4EXJA 2AV4A 1EOHA 1PRXA 5ELGA 4JBBA 4MPGA 4OD7A 1TU7A 4BA7A 2IMKA 3UAPA 4XRDA 1T00A 3F3RA 5A4UA 1TI3A 4TKYA 2FWEA 1ZYQB 1TK8B 4XS4A 5B8BA 3QMXA 5ELAA 2FWFA 3EURA 3D22A 2YZHA 4OMVA 3EINA 3WGXA 3VWUA 3TOUA 3IK9A 5F06A 4KAEA 2V6KA 4K9ZA 4OFNA 4F2IA 1MD3A 2YV9A 2KLXA 2M72A 5HR0A 3GKKA 1G0TA 3GL3A 3VPTA 4KW6A 1W89A 2H70A 1GLPA 2GT5A 3IC4A 2I3YA 4HQZA 3L9VA 3H79A 2K9FA 1X5CA 3MNGA 4KSMA 3D5JA 4OWYA 3WT1A 2CQ9A 3GTUA 2RIIA 4O92A 1GL8A 2GZPA 6GSVA 1K3OA 3IR4A 3HZ8A 2IL3A 2RM6A 1CQHA 2G2QA 2RUEA 5D96A 2I81A 4PQ1A 1JLVA 2QSIA 2WCIA 2H01A 2IIYA 3CBUA 1A8LA 5AIVA 3VLNA 4I97A 1GTUA 1AAZA 3S9FA 2ON7A 2AAWA 2H75A 4F82A 5JWQB 1X5EA 2AYTA 1Z3EA 1TDIA 3N9JA 3M9KA 3A5WA 1TW9A 3TRQA 2PVQA 1W4VA 3ME8A 3W8SA 3F4TA 1Z6NA 1DBYA 1XBSA 1M0UA 1FO5A 2E2GA 1AIUA 1AQVA 1OAZA 2EIQA 2VCQA 1SK2A 2CT6A 4MZBA 2VCVA 3VK9A 5J9CA 4HS1A 3QFAC 1HD2A 2OE0A 1XWCA 3C1SA 3IRAA 4KA0A 1GTAA 1O6JA 2YZUA 2X64A 3DGQA 3RPPA 1ABAA 3LEFA 5DCGA 3DKSA 2AJQB 2H0GA 5AIXA 19GSA 1I5GA 1GNEA 4JU5A 4RUVA 2L6CA 12GSA 4NPBA 3CSHA 3GYKA 4ZB8A 2IFQB 2VIMA 5E59A 2FY6A 3F4SA 3I9V2 5D9XA 1JHBA 2CAIA 5C04A 3J7Yb 2X8HA 1WJKA 3GN3A 3G7IA 2DBCA 2YWOA 1SKRB 1GRXA 4JEDA 4IN0A 3UARA 3GURA 3Q18A 5DJLA 3IBHA 1DE2A 2IPAA 4EKZA 1R4WA 2L6DA 1M2DA 4NWYA 2H19A 3BD2A 5HR1A 3UOMA 4TXVA 3FRCA 3WGEA 5EVOA 4ZL8A 5DALA 3CXGA 5DAKA 1U3AA 1RW1A 5LD0A 1G7OA 3VI7A 2CVDA 4QL7A 1UN2A 3TKRA 1XW6A 1OC3A 2A2SA 1M99A 1B4PA 2LUSA 3FR9A 1XXUA 2VCTA 2WDUA 4ISDA 4LMVA 2E7PA 5D9TA 1M2AA 2CA8A 1R7HA 3ISOA 1B4QA 2DJ3A 3DD3A 4PURA 4JZQA 3LSZA 2KP2A 2I1UA 2DJJA 4MLYA 5DQSA 1USBA 2YWMA 4I2TA 5CP1A 3EWLA 3C73A 1TK0B 2VD1A 5J9BA 1V9WA 2XPEA 2VL9A 3I6AA 1EP8A 2F3MA 1PGTA 5D93A 5J5NA 3ZFLA 4MJBA 5DBQA 1WP0A 3QD9A 4WR4A 1XVQA 1GSUA 2GZZA 2V2GA 3LWAA 4GQFA 1A2MA 3RHCA 2DMLA 5B8AA 4BVYA 1QMVA 3GKMA 2VLVA 1PD21 5GZZB 3QAGA 5D73A 3LXZA 5G5FA 2WFCA 3FHKA 3W8JA 4MJCA 2ZCTA 5A4VA 1PQNA 4KDUA 2DIYA 2C0DA 3M3MA 4IKHA 5JWOB 2H6XA 3O76A 2F51A 4DSRA 5IPGA 1TRSA 3ZL5A 1WE0A 1GUMA 4MF6A 2LNSA 1TRVA 3G7YA 1X9SB 2GSQA 1KBNA 4DEJA 2H0IA 4K8MA 2WJUA 3KP8A 4JE1A 2YN1A 5IO0A 2YJHA 5DVBA 3FYGA 1FVKA 2P31A 2V6OA 1ZCPA 1MDIA 1WRYA 3U5RE 1EGRA 1Y6EA 3ZRDA 3TJFA 2GQKA 2LTKA 1PSQA 5IMVA 4MP4A 1KEBA 4GQCA 4EC0A 1R5AA 3IXRA 3BOAA 2YCDA 2JSZA 3ZVJA 4IP6A 2JZSA 5J41A 2WB9A 3KMNA 3F0IA 2OACA 2K18A 4PGTA 4XTSA 5EY6A 1NM3A 2GS3A 2H30A 2EIOA 2NTOA 2I4AA 3O3TA 1SYRA 1A24A 5ECNB 4MCUA 4XIHA 1F37A 1YF0A 2DJ1A 4L5OA 3UVTA 4AJ8A 2FNOA 5GAPD 2P5RA 1VRSD 2J9HA 4DVCA 1YEPA 4QQ7A 2GVPA 4GF0A 3DWVA 4QL9A 2ES7A 1EV9A 4NXIA 1HNAA 1AUCA 1SJIA 2C8UA 4HDEA 3KMOA 2GDRA 4EDZA 3G9BA 4ZXGA 4OFMA 4O5RA 3KJYA 5F05A 1GSFA 4F03A 3SWLA 2QGVA 2TIRA 4LL1B 4N0VA 5KN2A 1Q4JA 4WF4A 3HHVA 4ZBDA 1PL1A 1QGVA 1UA5A 2HNLA 3D6IA 2CZ2A 4X43A 1DUGA 2GSRA 3M8NA 4V1Ap 2PMTA 4ZL9A 2MMNA 2R6KA 3TJKA 4HQSA 4G9HA 3KH7A 4POBA 3H4KA 4NV2A 2PU9C 2FUG2 4J2FA 4ZB6A 1XWAA 4TOPA 1ST9A 3M9JA 4ZIJA 3C71A 2L5OA 4ML1A 1PMTA 1M9BA 2HT9A 2PGTA 3IOSA 3LYPA 4N11A 3A2WA 3LGCA 1XCCA 2VCZA 4TW5A 2DLXA 1KNGA 4J56E 3V1WA 4IQAA 3ZMLA 2VO4A 2LQOA 1IYHA 4RQXA 3BBYA 4ZB9A 2V32A 3Q6OA 2D2ZA 2DMMA 4JR6A 2O85A 4I2UA 4EF0A 4WEYA 2ON5A 3EMPA 1GP1A 2IMIA 5B6MA 5IOXA 1OE7A 5CRGA 5ECLB 4OCFA 1NW2A 4KDYA 4XS4B 3TKSE 2K8SA 3H8QA 5DDLA 5IMFA 2JU5A 3L0HA 4GTUA 1K0BA 3F6FA 4IQ1A 2TRXA 4NHZA 4DSSB 2OKAA 4D73B 1N2AA 2HZEB 3FZAA 6GSUA 3D21A 2O7KA 2HFDA 3ZTLA 2XC2A 2GT6A 5KN0A 4YAPA 1R26A 1WOUA 5L71A
chains in the Genus database with same CATH superfamily
5ECPB 4E8EA 1FB0A 4GSSA 3I43A 2MYGA 3KTBA 3GRXA 1TTZA 3J7Yk 1JZDA 1U6TA 3P8WA 4EDYA 1TKDB 3ZLPA 1ZOFA 2Z9SA 4K1FA 1XWKA 2HRFA 4G2EA 2WGRA 3M1GA 4IVFA 3C8EA 2CZ3A 4KNDA 1YJ6A 4LLRA 3KEBA 2FLSA 3F63A 1GH2A 2LSTA 4BVXA 1G6YA 1VF1A 2B1KA 3ERGA 5IMAA 6GSWA 1C72A 1LBKA 1YF1A 1TU8A 2JL4A 3DVWA 1Z6MA 4YH2A 3HD5A 11GSA 3TRXA 3VWWA 1QUWA 1GLQA 2YV7A 4HI7A 2VD0A 5G31A 4TVEA 4I6XA 1OKTA 4N10A 1H4OA 4G10A 4YQUA 2YNXA 1B8XA 1B9XC 2CV4A 1YQ1A 2XBIA 5G1LA 2ZUPA 1QXHA 2V41A 2O87A 4L0UA 3UIWA 3ZMKA 1T4ZA 5COHA 1B48A 2PVOC 3FZ4A 5IMCA 4Q5RA 1PL2A 3QDNA 5HR2A 4L5LA 1FG4A 2WRTA 4KE3A 3HA9A 3ZITA 4L0WA 2A2RA 5G1KA 2L59A 2C1YA 1O8XA 3VPQA 3ZIVA 1T8EB 3HVXA 2KOKA 3GMFA 1K0OA 3WT2A 5IQYA 5E4WA 1ZL9A 5IPHA 1GSYA 3QR6A 3ZZXA 4Z2TA 1Z5YE 4YQMA 1EOGA 2DSAA 2FWHA 3CRTA 2M80A 1B9YC 3FK8A 4TXOB 3O6TA 4WKWA 2LJAA 4JRRA 4PUAA 4WXTA 1TK5B 2IFQA 4TN8A 4ULXA 3HKRA 4HJ2A 4IBPA 3IDVA 3MWHA 2L4QA 1S3RA 2HI7A 3LORA 2HRNA 4MH2A 4WF5A 2YJ7A 3RDWA 1JZWA 4POLA 5B7CA 1OC9B 1EV4A 5H5SA 1T1VA 3A5IA 4K7OA 2H66A 3UBLA 4GSNA 1V58A 2OADA 5LNKe 4HEA2 1THOA 1PN9A 1Z9HA 2B1LA 3GSSA 4HOJA 1SD8A 4K7IA 1XG8A 4PX1A 2OBKA 3HZ4A 1IYIA 1EGOA 4IGJA 5IMDA 3HDCA 2N5BA 3P2AA 2MZCA 3LG6A 3GH9A 3D0ZA 1TI1A 3HXSA 4N0ZA 4NHWA 1ZGNA 7GSSA 2EC4A 3PINA 1KTEA 1VGLA 2FA8A 3TB2A 4ZBBA 2AB6A 1YDKA 4XCSA 4KSOA 4MA9A 2C0EA 2QC7A 3TRPA 3GX0A 2H1DA 3F9UA 1K0DA 2VCXA 5HFKA 4BPYA 1FOHA 3PR8A 3TJGA 3D4MA 3TJJA 4POKA 2MMAA 4JR4A 2IWTA 1LU4A 2AUVA 3DMLA 2PWJA 1BAYA 3A2XA 4HSCX 4Z2RA 2LRCA 4MPFA 4XHMA 3QAWA 3ERWA 3NZNA 4KB3A 4V2NA 4LL4B 2VM1A 1JZOA 3CTFA 3IC8A 1U88A 3M0FA 1GSSA 1K3YA 2C80A 3R2QA 1SK0A 2DJKA 5JCGA 1XW5A 1EEJA 1X0RA 3LW9A 1SL1B 3KGKA 1J0FA 3CTGA 2MMOA 3GHAA 4KGIA 4X1UA 2QKEA 2GSTA 3GKNA 5ECRB 2PN8A 4MZCA 3CSJA 3EE2A 2MBSA 4HUAA 3F4RA 2QA2A 4RQRA 2FCHA 5HQPA 2YPMA 4CHSA 1A0FA 3ZREA 2P5QA 3LJRA 3HJMA 1M7TA 1XIYA 1X9WB 3EYTA 5ECIB 2GSSA 3IE3A 4K2DA 2NVLA 4O7HA 1MDJA 2NBSA 5ID2A 13GSA 1ON4A 4N30A 4I8BA 1XWGA 4AF2A 3FKFA 4FYBA 5IIZA 2O8VB 3LYKA 5CRHA 1E6BA 4Z7XA 4YQVA 1XW9A 1PKWA 3SBCA 2AHEA 4WBRD 5IO2A 3ZFBA 2IN3A 5CRDA 2H74A 3IHGA 2K6VA 2BJXA 3GKXA 4HJMA 2JSYA 1GSEA 1Z7PA 1ML6A 2CVKA 3WYWA 2GZYA 1PX6A 4GLTA 4MJEA 5EPFA 4K0GA 4IHUA 4HZ4A 4CY6A 3K8NA 4BL7A 4POMA 3IA1A 1CQGA 1F2EA 2HSYA 2YWIA 5CO3A 3CMIA 3P7XA 3A3TA 3ZYWA 3Q19A 1SENA 4WR5A 3ZVJD 4E8HA 5HFGA 1EWXA 2OBIA 3DRNA 2LNTA 2XHFA 3EMXA 2H76A 4A5PA 1K0NA 5J3RA 3F8UA 4MDCA 3ZIJA 1HNCA 1Y25A 4NV5A 1OE8A 3DXBA 3RHBA 1SL0B 3F6DA 4EE0A 5ECOB 3KZQA 1AQXA 1S3DA 4WETA 1ERVA 1MEKA 1V98A 4OFTA 2VCWA 3UJ1A 2B3SA 2B6MA 4ECIA 2C3QA 5ECQB 2X4AA 3WD6A 4XS6A 2B7KA 3W6GA 1BYEA 2R2JA 5A5KA 4MABA 1XOBA 1YY7A 2TRCP 1RQMA 3GUSA 2F9SA 5FHIA 5ECMB 4TR1B 2F8FA 1TXXA 5INYA 1M9AA 1VF3A 3HJOA 4BWQA 5KN1A 20GSA 2B5YA 2FD3A 4MF7A 3E9JB 5H5RA 4IJ3A 4TR0A 3HJPA 4KUNA 3L4NA 4IELA 1T4YA 1XPVA 1WWJA 2H71A 4K0NA 5CYYA 3D4TA 3TUEA 5ABRA 3US3A 1T3BA 2H6ZA 2R4VA 1ZYEA 1M2BA 5FWGA 3APQA 2DJ2A 3UMAA 6GSXA 3IAS2 3GH6A 1ZZYA 4KCEA 4KCAA 5GSSA 2X99A 3EU3A 2B5EA 4IS0A 1SYXA 3KM6A 3VFIA 1WIKA 2H72A 4OCEA 4GRFA 1BQ7A 2FWGA 2HXKA 2R5GA 3U6VA 3E0UA 4CDOA 3GFKA 3KCMA 3QPMA 3DYRA 5JWRB 4PUFC 3I69A 2HE3A 5D8IA 4EL1A 4FIWA 3BCIA 1GUKA 5LCZA 4Q5QA 5HFIA 1A23A 3N5OA 1EP7A 4KX4A 2B7JA 2FGXA 2L4CA 5ECKB 2HSHA 14GSA 4GSTA 1GSDA 1X9MB 1OYJA 2VUPA 5ECSA 1O73A 4YAVA 4FO5A 2H1GA 5J4UA 2M46A 1HNBA 4PQIA 2R0GA 4DSSA 1E2YA 5F0GA 4D73A 3MDKA 4EO3A 4ECJA 2HZEA 4K7NA 1FW1A 2VLTA 1GWCA 3FY7A 4IW9A 4MJAA 1ACVA 1PA3A 1OKDA 2CAQA 6GSTA 4V1Ag 4TR3A 4KH7A 2H73A 3L9SA 10GSA 3TCOA 2K8VA 3KP9A 2WZ9A 5ECHB 4AJ6A 3DVXA 4G0KA 3GTUB 5DJMA 4ACSA 1TRWA 4PNGA 2ALBA 2KUCA 4FYUA 2RM5A 2LQQA 1EEMA 1BG5A 1SU9A 2X8GA 2C3NA 1HQOA 1NHOA 1PFOA 5CREA 5CAXA 1O8WA 1A2LA 2IMDA 4RI7A 1JLWA 1G7EA 3GX8A 1U3IA 1GTBA 3TKSC 1F9MA 4KDXA 4NAXA 3GNJA 1YEXA 5H5QA 2LRNA 1YKCA 2QA1A 2E2MA 6GSSA 4GXZA 4K2XA 1G6WA 3RAZA 4K6XA 3E3EA 2LJRA 3LFLA 1SKWB 3ERFA 1XFLA 4Q5NA 2DC5A 1AQWA 3FZ9A 3VWXA 5FT3A 2VOCA 6GSYA 3TDGA 2J23A 3DIEA 2LEGA 1RK4A 3FR6A 5JCUA 2PPTA 2JADA 2GGTA 2VL2C 1A0RP 3EVIA 22GSA 4NMUA 2REMA 4EVMA 3VI5A 3ED3A 2YOIA 4LMWA 1PX7A 1FOVA 3CSIA 4PXOA 2LRTA 2GTUA 1AC1A 1MDKA 2YANA 4KF9A 2BMXA 4H86A 1PKZA 1A8YA 4MZWA 3P90A 1FHEA 4HU7A 3QCPA 1O7UA 1UVZA 3BCKA 1SD9A 2O89A 4TXOA 1S3AA 5IOWA 1GUHA 2OE3A 1GTIA 5D9WA 3TGZA 2HZFA 1SJZA 1K3LA 1SKSB 4K5SA 2P0GA 1LJRA 1SL2B 2R0PA 1J9BA 5G2ZA 2OE1A 2MBTA 4BWSA 4CW9A 4L8EA 3MSZA 1K0CA 3CYNA 4FQUA 4DSQA 1YKAA 4IP1A 4TRXA 2RLIA 3RBTA 4MMMA 3APOA 1EZKA 1F6MC 2C4JA 1QK8A 4ID0A 5DAKB 1OC9A 5DALB 2JZRA 3CRUA 4PQHA 4V2LA 2PBJA 3HYPA 1XVWA 1URMA 3UVHA 4XS1A 1QQ2A 1HYUA 5HR3A 18GSA 3C1RA 3IHQA 2C0FA 1GULA 4TR4A 1A2JA 3LXTA 3PH9A 2R37A 2WULA 1FVJA 1N8JA 1JZRA 2XBQA 2XPDA 5CRWA 3PGTA 5EL8A 3C7MA 5KN3A 3TOTA 3A2VA 4OO5A 1OVNA 4O32A 1FB6A 5GSTA 2X8CA 2GLRA 2LJKA 4J57E 4G19A 2WS2A 1YZXA 4BIKA 4F9ZA 2OJLA 2C0GA 2BTOT 4GCIA 2KHPA 3FR3A 4CY8A 2HLSA 1VF4A 2N5FA 2LV3A 3APSA 3RPNA 3G7JA 4WBJA 3IK7A 2FA4A 1WPIA 5CNWA 3KTLA 3HCZA 4Q5FA 2L5LA 4BVYB 3TKSA 3L9UA 3HY2A 1V57A 3QOUA 2NDOA 2H0HA 5A4WA 17GSA 2B5XA 4MK3A 3TKQA 1U87A 3HVVA 3IV4A 1JFUA 4EIPA 2R0CA 1FAAA 2G0FA 1TP9A 2VM2A 2LKUA 5F8BA 4XRAA 1TJDA 1THXA 2V1MA 2A4VA 2VLUA 3JCML 3GL5A 2HYXA 1S3CA 2C3TA 5ID2B 3UBKA 4G0IA 2UZ8A 3EU4A 1GNWA 3WGDA 1H75A 4X4JA 2DJ0A 2VL2A 4ECCA 4F0BA 3KXOA 4F0CA 2GQLA 3DEXA 1ERTA 1ERWA 4MF5A 2F8AA 2R3XA 1F3AA 2HSMA 2LS5A 3H93A 1SK1A 2PUKC 3HVSA 4MH3A 4O5UA 1AW9A 4ML6A 4OO4A 4ZL7A 4AGSA 2YWNA 5DQYA 1GSQA 2HRAA 3FW2A 3Q74A 2VL3A 1XWBA 1MTCA 2EIRA 2PERA 5IMZA 2ZNMA 1AXDA 4K5RA 2JACA 3L78A 3KH9A 1PN0A 4ZBAA 3UL3A 1QFNA 2KP1A 5AN1A 5G5EA 1BX9A 2RUFA 4ILFA 4FYCA 1F3BA 1BJXA 1O85A 3GV1A 2IJYA 5DCHA 1X5DA 2GQMA 4FH8A 3KIJA 1WMJA 1MD4A 3IPZA 4HU9A 3PPUA 1R5PA 1O81A 3GSTA 5AISA 3QAVA 3IAM2 3UEMA 4GWRA 4AJ7A 1T7PB 16GSA 5F07A 5C00A 3VURA 4PNFA 4RI6A 1V2AA 5JCWA 2H6YA 1J08A 1SJ6A 1ZMAA 3H1NA 1UC7A 3NOFA 4ZILA 1DSBA 4X0XA 3TJBA 4ECBA 2H8LA 1K0MA 4O5QA 5AGYA 2NPBA 1DE1A 1Z7RA 2JZTA 5G30A 3BJ5A 1XZOA 2YP6A 4EUYA 2I9HA 1NSWA 2E0QA 4TR1A 2CVBA 4YKFA 5D9VA 1TOFA 2VAFA 1BEDA 2N5AA 2H1BA 2CX3A 4IJIA 5KEJA 9GSSA 1OC8A 3F3QA 1Q98A 5ENUA 2MMZA 5B6NA 3KD0A 1V40A 1I9DA 3FZ5A 1K0AA 2IMFA 3GA4A 2IMEA 2FHEA 3AY8A 1TRUA 3ME7A 5GAND 3TKPA 3VWVA 4P3YB 2H1AA 1ILOA 3MAKA 2L57A 1VF2A 4HZ2A 4LA1A 2DIZA 1XOAA 4Z2UA 1ERUA 3QFBC 4I5QA 1NHYA 8GSSA 3NIVA 2OA7A 5IM9A 3FEUA 3GIXA 3EC3A 3LQ7A 4V2MA 3OR5A 2CX4A 4EXJA 2AV4A 1EOHA 1PRXA 5ELGA 4JBBA 4MPGA 4OD7A 1TU7A 4BA7A 2IMKA 4PTSA 3UAPA 4XRDA 1T00A 3F3RA 3R3EA 5A4UA 1TI3A 4TKYA 2FWEA 1ZYQB 1TK8B 4XS4A 5B8BA 3QMXA 5ELAA 2FWFA 3EURA 3D22A 4MNNA 2YZHA 4OMVA 3EINA 3WGXA 3VWUA 3TOUA 3IK9A 5F06A 4KAEA 2V6KA 4K9ZA 4OFNA 4F2IA 1MD3A 2YV9A 4EIQA 2KLXA 2M72A 5HR0A 3GKKA 1G0TA 3GL3A 3VPTA 3MYDA 4KW6A 1W89A 2H70A 1GLPA 2GT5A 3IC4A 2I3YA 4HQZA 3L9VA 3H79A 4BVXB 1M3JA 2K9FA 1X5CA 3MNGA 4KSMA 3D5JA 4OWYA 3WT1A 2CQ9A 3GTUA 2RIIA 4O92A 1GL8A 2GZPA 6GSVA 1K3OA 3IR4A 3HZ8A 3HVNA 2IL3A 2RM6A 1CQHA 2G2QA 2RUEA 5D96A 2I81A 4PQ1A 1JLVA 2QSIA 2WCIA 2H01A 2IIYA 3CBUA 1A8LA 5AIVA 3VLNA 4I97A 1GTUA 1AAZA 3S9FA 2ON7A 2AAWA 2H75A 4F82A 5JWQB 1X5EA 2AYTA 1Z3EA 1TDIA 3N9JA 3M9KA 3A5WA 1TW9A 3TRQA 2PVQA 1W4VA 3ME8A 3W8SA 4G0LA 3F4TA 1Z6NA 2HRKA 1DBYA 1XBSA 1M0UA 1FO5A 2E2GA 1AIUA 1AQVA 2X49A 1OAZA 2EIQA 2VCQA 1SK2A 2CT6A 4MZBA 2VCVA 3VK9A 5J9CA 4HS1A 3QFAC 1HD2A 2OE0A 1XWCA 3C1SA 3IRAA 4KA0A 1GTAA 1O6JA 5KOWA 2YZUA 2X64A 3DGQA 3RPPA 1ABAA 3LEFA 5DCGA 3DKSA 2AJQB 2H0GA 5AIXA 19GSA 1I5GA 1GNEA 4JU5A 4RUVA 2L6CA 12GSA 4YKGA 4NPBA 3CSHA 3GYKA 4ZB8A 2IFQB 2VIMA 5E59A 2FY6A 3F4SA 3I9V2 5D9XA 1JHBA 2CAIA 5C04A 3J7Yb 2X8HA 1WJKA 3GN3A 3G7IA 2DBCA 2YWOA 1SKRB 1GRXA 4JEDA 4IN0A 3UARA 3GURA 3Q18A 5DJLA 3IBHA 1DE2A 2IPAA 1ZYNA 4EKZA 1R4WA 2L6DA 1M2DA 4NWYA 2H19A 3BD2A 5HR1A 3UOMA 4TXVA 3FRCA 3WGEA 4USSA 5EVOA 4ZL8A 5DALA 3CXGA 5DAKA 1U3AA 1RW1A 5LD0A 1G7OA 3VI7A 2CVDA 4QL7A 1UN2A 3TKRA 1XW6A 1OC3A 2A2SA 1M99A 1B4PA 2LUSA 3FR9A 1XXUA 2VCTA 2WDUA 4ISDA 4LMVA 2E7PA 5D9TA 1M2AA 2CA8A 1R7HA 3ISOA 1B4QA 2DJ3A 3DD3A 4PURA 4JZQA 3LSZA 2KP2A 2I1UA 2DJJA 4MLYA 5DQSA 5KOXA 1USBA 2YWMA 4I2TA 5CP1A 3EWLA 3C73A 1TK0B 2VD1A 5J9BA 1V9WA 2XPEA 2VL9A 3I6AA 1EP8A 2F3MA 1PGTA 5D93A 5J5NA 3ZFLA 4MJBA 5DBQA 1WP0A 3QD9A 4WR4A 5BRTA 1XVQA 5BMUA 1GSUA 2GZZA 2V2GA 3LWAA 4GQFA 1A2MA 3RHCA 2DMLA 5B8AA 4BVYA 1QMVA 3GKMA 3EPTA 2VLVA 1PD21 5GZZB 3QAGA 5D73A 3LXZA 5G5FA 2WFCA 3FHKA 3W8JA 4MJCA 2ZCTA 5A4VA 1PQNA 4KDUA 2DIYA 2C0DA 3M3MA 4IKHA 5JWOB 2H6XA 3O76A 1ZYPA 2F51A 4DSRA 5IPGA 1TRSA 3ZL5A 1WE0A 1GUMA 4MF6A 2LNSA 1TRVA 3G7YA 1X9SB 2GSQA 1KBNA 4DEJA 2H0IA 4K8MA 2WJUA 3KP8A 4JE1A 2YN1A 5IO0A 2YJHA 5DVBA 3FYGA 1FVKA 4ICYA 2P31A 2V6OA 2DKIA 1ZCPA 1MDIA 1WRYA 3U5RE 1EGRA 1Y6EA 4BL7B 3ZRDA 3TJFA 2GQKA 2LTKA 1PSQA 5IMVA 4MP4A 1KEBA 4GQCA 4EC0A 1R5AA 3IXRA 3BOAA 2YCDA 2JSZA 3ZVJA 4IP6A 2JZSA 3CQFA 2WB9A 5J41A 3KMNA 3F0IA 2OACA 2DKHA 2K18A 4PGTA 4XTSA 5EY6A 1NM3A 2A2PA 2GS3A 2H30A 2EIOA 2NTOA 2I4AA 3O3TA 1SYRA 1A24A 5ECNB 4MCUA 4XIHA 1F37A 1YF0A 2DJ1A 4L5OA 3UVTA 4AJ8A 2FNOA 5GAPD 2P5RA 1VRSD 2J9HA 3MIXA 1M3IA 4DVCA 1YEPA 4QQ7A 2GVPA 4GF0A 3DWVA 4QL9A 2ES7A 1EV9A 4NXIA 1HNAA 1AUCA 1SJIA 2C8UA 4HDEA 3KMOA 2GDRA 4EDZA 3G9BA 4ZXGA 4OFMA 4O5RA 3KJYA 5F05A 1GSFA 4F03A 3SWLA 2QGVA 2TIRA 4LL1B 4N0VA 5KN2A 1Q4JA 4WF4A 3HHVA 4ZBDA 1PL1A 1QGVA 1UA5A 2HNLA 3D6IA 2CZ2A 4X43A 1DUGA 2GSRA 3M8NA 4V1Ap 2PMTA 4ZL9A 2MMNA 2R6KA 3TJKA 4HQSA 4G9HA 3KH7A 4POBA 3H4KA 4NV2A 2PU9C 2FUG2 4J2FA 4ZB6A 1XWAA 4TOPA 1ST9A 3M9JA 4ZIJA 3C71A 2L5OA 4ML1A 1PMTA 1M9BA 2A4HA 2HT9A 2PGTA 3IOSA 3LYPA 4N11A 3A2WA 3LGCA 1XCCA 2VCZA 4TW5A 2DLXA 3FMWA 1KNGA 4J56E 3V1WA 4IQAA 3ZMLA 2VO4A 2LQOA 1IYHA 4RQXA 3BBYA 4ZB9A 2V32A 3Q6OA 2D2ZA 2DMMA 4JR6A 2O85A 4I2UA 4EF0A 4WEYA 2ON5A 3EMPA 1GP1A 2IMIA 5B6MA 5IOXA 1OE7A 5CRGA 5ECLB 4OCFA 1NW2A 4KDYA 4XS4B 3TKSE 2K8SA 3H8QA 5DDLA 5IMFA 2JU5A 3L0HA 4GTUA 1K0BA 3F6FA 4IQ1A 2TRXA 4NHZA 4DSSB 2OKAA 4D73B 1N2AA 2HZEB 3FZAA 6GSUA 3D21A 2O7KA 2HFDA 3ZTLA 2XC2A 2GT6A 5KN0A 4YAPA 1R26A 1WOUA 5L71A
chains in the Genus database with same CATH topology
5ECPB 4E8EA 1FB0A 4GSSA 3I43A 2MYGA 3KTBA 3GRXA 1TTZA 3J7Yk 1JZDA 1U6TA 3P8WA 4EDYA 1TKDB 3ZLPA 1ZOFA 2Z9SA 4K1FA 1XWKA 2HRFA 4G2EA 2WGRA 3M1GA 4IVFA 3C8EA 2CZ3A 4KNDA 1YJ6A 4LLRA 3KEBA 2FLSA 3F63A 1GH2A 2LSTA 4BVXA 1G6YA 1VF1A 2B1KA 3ERGA 5IMAA 6GSWA 1C72A 1LBKA 1YF1A 1TU8A 2JL4A 3DVWA 1Z6MA 4YH2A 3HD5A 11GSA 3TRXA 3VWWA 1QUWA 1GLQA 2YV7A 4HI7A 2VD0A 5G31A 4TVEA 4I6XA 1OKTA 4N10A 1H4OA 4G10A 4YQUA 2YNXA 1B8XA 1B9XC 2CV4A 1YQ1A 2XBIA 5G1LA 2ZUPA 1QXHA 2V41A 2O87A 4L0UA 3UIWA 3ZMKA 1T4ZA 5COHA 1B48A 2PVOC 3FZ4A 5IMCA 4Q5RA 1PL2A 3QDNA 5HR2A 4L5LA 1FG4A 2WRTA 4KE3A 3HA9A 3ZITA 4L0WA 2A2RA 5G1KA 2L59A 2C1YA 1O8XA 3VPQA 3ZIVA 1T8EB 3HVXA 2KOKA 3GMFA 1K0OA 3WT2A 5IQYA 5E4WA 1ZL9A 5IPHA 1GSYA 3QR6A 3ZZXA 4Z2TA 1Z5YE 4YQMA 1EOGA 2DSAA 2FWHA 3CRTA 2M80A 1B9YC 3FK8A 4TXOB 3O6TA 4WKWA 2LJAA 4JRRA 4PUAA 4WXTA 1TK5B 2IFQA 4TN8A 4ULXA 3HKRA 4HJ2A 4IBPA 3IDVA 3MWHA 2L4QA 2HI7A 3LORA 2HRNA 4MH2A 4WF5A 2YJ7A 3RDWA 1JZWA 4POLA 5B7CA 1OC9B 1EV4A 5H5SA 1T1VA 3A5IA 4K7OA 2H66A 3UBLA 4GSNA 1V58A 2OADA 5LNKe 4HEA2 1THOA 1PN9A 1Z9HA 2B1LA 3GSSA 4HOJA 1SD8A 4K7IA 4PX1A 2OBKA 3HZ4A 1IYIA 1EGOA 4IGJA 5IMDA 3HDCA 2N5BA 3P2AA 2MZCA 3LG6A 3GH9A 3D0ZA 1TI1A 3HXSA 4N0ZA 4NHWA 1ZGNA 7GSSA 2EC4A 3PINA 1KTEA 1VGLA 2FA8A 3TB2A 4ZBBA 2AB6A 1YDKA 4XCSA 4KSOA 4MA9A 2C0EA 2QC7A 3TRPA 3GX0A 2H1DA 3F9UA 1K0DA 2VCXA 5HFKA 4BPYA 1FOHA 3PR8A 3TJGA 3D4MA 3TJJA 4POKA 2MMAA 4JR4A 2IWTA 1LU4A 2AUVA 3DMLA 2PWJA 1BAYA 3A2XA 4Z2RA 2LRCA 4MPFA 4XHMA 3QAWA 3ERWA 3NZNA 4KB3A 4V2NA 4LL4B 2VM1A 1JZOA 3CTFA 3IC8A 1U88A 3M0FA 1GSSA 1K3YA 2C80A 3R2QA 1SK0A 2DJKA 5JCGA 1XW5A 1EEJA 1X0RA 3LW9A 1SL1B 3KGKA 1J0FA 3CTGA 2MMOA 3GHAA 4KGIA 4X1UA 2QKEA 2GSTA 3GKNA 5ECRB 2PN8A 4MZCA 3CSJA 3EE2A 2MBSA 4HUAA 3F4RA 2QA2A 4RQRA 2FCHA 5HQPA 2YPMA 4CHSA 1A0FA 3ZREA 2P5QA 3LJRA 3HJMA 1M7TA 1XIYA 1X9WB 3EYTA 5ECIB 2GSSA 3IE3A 4K2DA 2NVLA 4O7HA 1MDJA 2NBSA 5ID2A 13GSA 1ON4A 4N30A 4I8BA 1XWGA 4AF2A 3FKFA 4FYBA 5IIZA 2O8VB 3LYKA 5CRHA 1E6BA 4Z7XA 4YQVA 1XW9A 1PKWA 3SBCA 2AHEA 4WBRD 5IO2A 3ZFBA 2IN3A 5CRDA 2H74A 3IHGA 2K6VA 2BJXA 3GKXA 4HJMA 2JSYA 1GSEA 1Z7PA 1ML6A 2CVKA 3WYWA 2GZYA 1PX6A 4GLTA 4MJEA 5EPFA 4K0GA 4IHUA 4HZ4A 4CY6A 3K8NA 4BL7A 4POMA 3IA1A 1CQGA 1F2EA 2HSYA 2YWIA 5CO3A 3CMIA 3P7XA 3A3TA 3ZYWA 3Q19A 1SENA 4WR5A 3ZVJD 4E8HA 5HFGA 1EWXA 2OBIA 3DRNA 2LNTA 2XHFA 3EMXA 2H76A 4A5PA 1K0NA 5J3RA 3F8UA 4MDCA 3ZIJA 1HNCA 1Y25A 4NV5A 1OE8A 3DXBA 3RHBA 1SL0B 3F6DA 4EE0A 5ECOB 3KZQA 1AQXA 1S3DA 4WETA 1ERVA 1MEKA 1V98A 4OFTA 2VCWA 3UJ1A 2B3SA 2B6MA 4ECIA 2C3QA 5ECQB 2X4AA 3WD6A 4XS6A 2B7KA 3W6GA 1BYEA 2R2JA 5A5KA 4MABA 1XOBA 1YY7A 2TRCP 1RQMA 3GUSA 2F9SA 5FHIA 5ECMB 4TR1B 2F8FA 1TXXA 5INYA 1M9AA 1VF3A 3HJOA 4BWQA 5KN1A 20GSA 2B5YA 2FD3A 4MF7A 3E9JB 5H5RA 4IJ3A 4TR0A 3HJPA 4KUNA 3L4NA 4IELA 1T4YA 1XPVA 1WWJA 2H71A 4K0NA 5CYYA 3D4TA 3TUEA 5ABRA 3US3A 1T3BA 2H6ZA 2R4VA 1ZYEA 1M2BA 5FWGA 3APQA 2DJ2A 3UMAA 6GSXA 3IAS2 3GH6A 1ZZYA 4KCEA 4KCAA 5GSSA 2X99A 3EU3A 2B5EA 4IS0A 1SYXA 3KM6A 3VFIA 1WIKA 2H72A 4OCEA 4GRFA 1BQ7A 2FWGA 2HXKA 2R5GA 3U6VA 3E0UA 4CDOA 3GFKA 3KCMA 3QPMA 3DYRA 5JWRB 4PUFC 3I69A 2HE3A 5D8IA 4EL1A 4FIWA 3BCIA 1GUKA 5LCZA 4Q5QA 5HFIA 1A23A 3N5OA 1EP7A 4KX4A 2B7JA 2FGXA 2L4CA 5ECKB 2HSHA 14GSA 4GSTA 1GSDA 1X9MB 1OYJA 2VUPA 5ECSA 1O73A 4YAVA 4FO5A 2H1GA 5J4UA 2M46A 1HNBA 4PQIA 2R0GA 4DSSA 1E2YA 5F0GA 4D73A 3MDKA 4EO3A 4ECJA 2HZEA 4K7NA 1FW1A 2VLTA 1GWCA 3FY7A 4IW9A 4MJAA 1ACVA 1PA3A 1OKDA 2CAQA 6GSTA 4V1Ag 4TR3A 4KH7A 2H73A 3L9SA 10GSA 3TCOA 2K8VA 3KP9A 2WZ9A 5ECHB 4AJ6A 3DVXA 4G0KA 3GTUB 5DJMA 4ACSA 1TRWA 4PNGA 2ALBA 2KUCA 4FYUA 2RM5A 2LQQA 1EEMA 1BG5A 1SU9A 2X8GA 2C3NA 1HQOA 1NHOA 5CREA 5CAXA 1O8WA 1A2LA 2IMDA 4RI7A 1JLWA 1G7EA 3GX8A 1U3IA 1GTBA 3TKSC 1F9MA 4KDXA 4NAXA 3GNJA 1YEXA 5H5QA 2LRNA 1YKCA 2QA1A 2E2MA 6GSSA 4GXZA 4K2XA 1G6WA 3RAZA 4K6XA 3E3EA 2LJRA 3LFLA 1SKWB 3ERFA 1XFLA 4Q5NA 2DC5A 1AQWA 3FZ9A 3VWXA 5FT3A 2VOCA 6GSYA 3TDGA 2J23A 3DIEA 2LEGA 1RK4A 3FR6A 5JCUA 2PPTA 2JADA 2GGTA 2VL2C 1A0RP 3EVIA 22GSA 4NMUA 2REMA 4EVMA 3VI5A 3ED3A 2YOIA 4LMWA 1PX7A 1FOVA 3CSIA 4PXOA 2LRTA 2GTUA 1AC1A 1MDKA 2YANA 4KF9A 2BMXA 4H86A 1PKZA 1A8YA 4MZWA 3P90A 1FHEA 4HU7A 3QCPA 1O7UA 1UVZA 3BCKA 1SD9A 2O89A 4TXOA 1S3AA 5IOWA 1GUHA 2OE3A 1GTIA 5D9WA 3TGZA 2HZFA 1SJZA 1K3LA 1SKSB 4K5SA 2P0GA 1LJRA 1SL2B 2R0PA 1J9BA 5G2ZA 2OE1A 2MBTA 4BWSA 4CW9A 4L8EA 3MSZA 1K0CA 3CYNA 4FQUA 4DSQA 1YKAA 4IP1A 4TRXA 2RLIA 3RBTA 4MMMA 3APOA 1EZKA 1F6MC 2C4JA 1QK8A 4ID0A 5DAKB 1OC9A 5DALB 2JZRA 3CRUA 4PQHA 4V2LA 2PBJA 3HYPA 1XVWA 1URMA 3UVHA 4XS1A 1QQ2A 1HYUA 5HR3A 18GSA 3C1RA 3IHQA 2C0FA 1GULA 4TR4A 1A2JA 3LXTA 3PH9A 2R37A 2WULA 1FVJA 1N8JA 1JZRA 2XBQA 2XPDA 5CRWA 3PGTA 5EL8A 3C7MA 5KN3A 3TOTA 3A2VA 4OO5A 1OVNA 4O32A 1FB6A 5GSTA 2X8CA 2GLRA 2LJKA 4J57E 4G19A 2WS2A 1YZXA 4F9ZA 2OJLA 2C0GA 2BTOT 4GCIA 2KHPA 3FR3A 4CY8A 2HLSA 1VF4A 2N5FA 2LV3A 3APSA 3RPNA 3G7JA 4WBJA 3IK7A 2FA4A 1WPIA 5CNWA 3KTLA 3HCZA 4Q5FA 2L5LA 4BVYB 3TKSA 3L9UA 3HY2A 1V57A 3QOUA 2NDOA 2H0HA 5A4WA 17GSA 2B5XA 4MK3A 3TKQA 1U87A 3HVVA 3IV4A 1JFUA 4EIPA 2R0CA 1FAAA 2G0FA 1TP9A 2VM2A 2LKUA 5F8BA 4XRAA 1TJDA 1THXA 2V1MA 2A4VA 2VLUA 3JCML 3GL5A 2HYXA 1S3CA 2C3TA 5ID2B 3UBKA 4G0IA 2UZ8A 3EU4A 1GNWA 3WGDA 1H75A 4X4JA 2DJ0A 2VL2A 4ECCA 4F0BA 3KXOA 4F0CA 2GQLA 3DEXA 1ERTA 1ERWA 4MF5A 2F8AA 2R3XA 1F3AA 2HSMA 2LS5A 3H93A 1SK1A 2PUKC 3HVSA 4MH3A 4O5UA 1AW9A 4ML6A 4OO4A 4ZL7A 4AGSA 2YWNA 5DQYA 1GSQA 2HRAA 3FW2A 3Q74A 2VL3A 1XWBA 1MTCA 2EIRA 2PERA 5IMZA 2ZNMA 1AXDA 4K5RA 2JACA 3L78A 3KH9A 1PN0A 4ZBAA 3UL3A 1QFNA 2KP1A 5AN1A 5G5EA 1BX9A 2RUFA 4ILFA 4FYCA 1F3BA 1BJXA 1O85A 3GV1A 2IJYA 5DCHA 1X5DA 2GQMA 4FH8A 3KIJA 1WMJA 1MD4A 3IPZA 4HU9A 3PPUA 1R5PA 1O81A 3GSTA 5AISA 3QAVA 3IAM2 3UEMA 4GWRA 4AJ7A 1T7PB 16GSA 5F07A 5C00A 3VURA 4PNFA 4RI6A 1V2AA 5JCWA 2H6YA 1J08A 1SJ6A 1ZMAA 3H1NA 1UC7A 3NOFA 4ZILA 1DSBA 4X0XA 3TJBA 4ECBA 2H8LA 1K0MA 4O5QA 5AGYA 2NPBA 1DE1A 1Z7RA 2JZTA 5G30A 3BJ5A 1XZOA 2YP6A 4EUYA 2I9HA 1NSWA 2E0QA 4TR1A 2CVBA 4YKFA 5D9VA 1TOFA 2VAFA 1BEDA 2N5AA 2H1BA 2CX3A 4IJIA 5KEJA 9GSSA 1OC8A 3F3QA 1Q98A 5ENUA 2MMZA 5B6NA 3KD0A 1V40A 1I9DA 3FZ5A 1K0AA 2IMFA 3GA4A 2IMEA 2FHEA 3AY8A 1TRUA 3ME7A 5GAND 3TKPA 3VWVA 4P3YB 2H1AA 1ILOA 3MAKA 2L57A 1VF2A 4HZ2A 4LA1A 2DIZA 1XOAA 4Z2UA 1ERUA 3QFBC 4I5QA 1NHYA 8GSSA 3NIVA 2OA7A 5IM9A 3FEUA 3GIXA 3EC3A 3LQ7A 4V2MA 3OR5A 2CX4A 4EXJA 2AV4A 1EOHA 1PRXA 5ELGA 4JBBA 4MPGA 4OD7A 1TU7A 4BA7A 2IMKA 4PTSA 3UAPA 4XRDA 1T00A 3F3RA 3R3EA 5A4UA 1TI3A 4TKYA 2FWEA 1ZYQB 1TK8B 4XS4A 5B8BA 3QMXA 5ELAA 2FWFA 3EURA 3D22A 4MNNA 2YZHA 4OMVA 3EINA 3WGXA 3VWUA 3TOUA 3IK9A 5F06A 4KAEA 2V6KA 4K9ZA 4OFNA 4F2IA 1MD3A 2YV9A 4EIQA 2KLXA 2M72A 5HR0A 3GKKA 1G0TA 3GL3A 3VPTA 3MYDA 4KW6A 1W89A 2H70A 1GLPA 2GT5A 3IC4A 2I3YA 4HQZA 3L9VA 3H79A 4BVXB 2K9FA 1X5CA 3MNGA 4KSMA 3D5JA 4OWYA 3WT1A 2CQ9A 3GTUA 2RIIA 4O92A 1GL8A 2GZPA 6GSVA 1K3OA 3IR4A 3HZ8A 2IL3A 2RM6A 1CQHA 2G2QA 2RUEA 5D96A 2I81A 4PQ1A 1JLVA 2QSIA 2WCIA 2H01A 2IIYA 3CBUA 1A8LA 5AIVA 3VLNA 4I97A 1GTUA 1AAZA 3S9FA 2ON7A 2AAWA 2H75A 4F82A 5JWQB 1X5EA 2AYTA 1Z3EA 1TDIA 3N9JA 3M9KA 3A5WA 1TW9A 3TRQA 2PVQA 1W4VA 3ME8A 3W8SA 4G0LA 3F4TA 1Z6NA 2HRKA 1DBYA 1XBSA 1M0UA 1FO5A 2E2GA 1AIUA 1AQVA 2X49A 1OAZA 2EIQA 2VCQA 1SK2A 2CT6A 4MZBA 2VCVA 3VK9A 5J9CA 4HS1A 3QFAC 1HD2A 2OE0A 1XWCA 3C1SA 3IRAA 4KA0A 1GTAA 1O6JA 5KOWA 2YZUA 2X64A 3DGQA 3RPPA 1ABAA 3LEFA 5DCGA 3DKSA 2AJQB 2H0GA 5AIXA 19GSA 1I5GA 1GNEA 4JU5A 4RUVA 2L6CA 12GSA 4YKGA 4NPBA 3CSHA 3GYKA 4ZB8A 2IFQB 2VIMA 5E59A 2FY6A 3F4SA 3I9V2 5D9XA 1JHBA 2CAIA 5C04A 3J7Yb 2X8HA 1WJKA 3GN3A 3G7IA 2DBCA 2YWOA 1SKRB 1GRXA 4JEDA 4IN0A 3UARA 3GURA 3Q18A 5DJLA 3IBHA 1DE2A 2IPAA 1ZYNA 4EKZA 1R4WA 2L6DA 1M2DA 4NWYA 2H19A 3BD2A 5HR1A 3UOMA 4TXVA 3FRCA 3WGEA 4USSA 5EVOA 4ZL8A 5DALA 3CXGA 5DAKA 1U3AA 1RW1A 5LD0A 1G7OA 3VI7A 2CVDA 4QL7A 1UN2A 3TKRA 1XW6A 1OC3A 2A2SA 1M99A 1B4PA 2LUSA 3FR9A 1XXUA 2VCTA 2WDUA 4ISDA 4LMVA 2E7PA 5D9TA 1M2AA 2CA8A 1R7HA 3ISOA 1B4QA 2DJ3A 3DD3A 4PURA 4JZQA 3LSZA 2KP2A 2I1UA 2DJJA 4MLYA 5DQSA 5KOXA 1USBA 2YWMA 4I2TA 5CP1A 3EWLA 3C73A 1TK0B 2VD1A 5J9BA 1V9WA 2XPEA 2VL9A 3I6AA 1EP8A 2F3MA 1PGTA 5D93A 5J5NA 3ZFLA 4MJBA 5DBQA 1WP0A 3QD9A 4WR4A 5BRTA 1XVQA 5BMUA 1GSUA 2GZZA 2V2GA 3LWAA 4GQFA 1A2MA 3RHCA 2DMLA 5B8AA 4BVYA 1QMVA 3GKMA 3EPTA 2VLVA 1PD21 5GZZB 3QAGA 5D73A 3LXZA 5G5FA 2WFCA 3FHKA 3W8JA 4MJCA 2ZCTA 5A4VA 1PQNA 4KDUA 2DIYA 2C0DA 3M3MA 4IKHA 5JWOB 2H6XA 3O76A 1ZYPA 2F51A 4DSRA 5IPGA 1TRSA 3ZL5A 1WE0A 1GUMA 4MF6A 2LNSA 1TRVA 3G7YA 1X9SB 2GSQA 1KBNA 4DEJA 2H0IA 4K8MA 2WJUA 3KP8A 4JE1A 2YN1A 5IO0A 2YJHA 5DVBA 3FYGA 1FVKA 4ICYA 2P31A 2V6OA 2DKIA 1ZCPA 1MDIA 1WRYA 3U5RE 1EGRA 1Y6EA 4BL7B 3ZRDA 3TJFA 2GQKA 2LTKA 1PSQA 5IMVA 4MP4A 1KEBA 4GQCA 4EC0A 1R5AA 3IXRA 3BOAA 2YCDA 2JSZA 3ZVJA 4IP6A 2JZSA 5J41A 2WB9A 3KMNA 3F0IA 2OACA 2DKHA 2K18A 4PGTA 4XTSA 5EY6A 1NM3A 2A2PA 2GS3A 2H30A 2EIOA 2NTOA 2I4AA 3O3TA 1SYRA 1A24A 5ECNB 4MCUA 4XIHA 1F37A 1YF0A 2DJ1A 4L5OA 3UVTA 4AJ8A 2FNOA 5GAPD 2P5RA 1VRSD 2J9HA 3MIXA 4DVCA 1YEPA 4QQ7A 2GVPA 4GF0A 3DWVA 4QL9A 2ES7A 1EV9A 4NXIA 1HNAA 1AUCA 1SJIA 2C8UA 4HDEA 3KMOA 2GDRA 4EDZA 3G9BA 4ZXGA 4OFMA 4O5RA 3KJYA 5F05A 1GSFA 4F03A 3SWLA 2QGVA 2TIRA 4LL1B 4N0VA 5KN2A 1Q4JA 4WF4A 3HHVA 4ZBDA 1PL1A 1QGVA 1UA5A 2HNLA 3D6IA 2CZ2A 4X43A 1DUGA 2GSRA 3M8NA 4V1Ap 2PMTA 4ZL9A 2MMNA 2R6KA 3TJKA 4HQSA 4G9HA 3KH7A 4POBA 3H4KA 4NV2A 2PU9C 2FUG2 4J2FA 4ZB6A 1XWAA 4TOPA 1ST9A 3M9JA 4ZIJA 3C71A 2L5OA 4ML1A 1PMTA 1M9BA 2A4HA 2HT9A 2PGTA 3IOSA 3LYPA 4N11A 3A2WA 3LGCA 1XCCA 2VCZA 4TW5A 2DLXA 3FMWA 1KNGA 4J56E 3V1WA 4IQAA 3ZMLA 2VO4A 2LQOA 1IYHA 4RQXA 3BBYA 4ZB9A 2V32A 3Q6OA 2D2ZA 2DMMA 4JR6A 2O85A 4I2UA 4EF0A 4WEYA 2ON5A 3EMPA 1GP1A 2IMIA 5B6MA 5IOXA 1OE7A 5CRGA 5ECLB 4OCFA 1NW2A 4KDYA 4XS4B 3TKSE 2K8SA 3H8QA 5DDLA 5IMFA 2JU5A 3L0HA 4GTUA 1K0BA 3F6FA 4IQ1A 2TRXA 4NHZA 4DSSB 2OKAA 4D73B 1N2AA 2HZEB 3FZAA 6GSUA 3D21A 2O7KA 2HFDA 3ZTLA 2XC2A 2GT6A 5KN0A 4YAPA 1R26A 1WOUA 5L71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ECP B;  4E8E A;  1FB0 A;  4GSS A;  3I43 A;  2MYG A;  3KTB A;  3GRX A;  1TTZ A;  3J7Y k;  1JZD A;  1U6T A;  3P8W A;  4EDY A;  1TKD B;  3ZLP A;  1ZOF A;  2Z9S A;  4K1F A;  1XWK A;  2HRF A;  4G2E A;  2WGR A;  3M1G A;  4IVF A;  3C8E A;  2CZ3 A;  4KND A;  1YJ6 A;  4LLR A;  3KEB A;  2FLS A;  3F63 A;  1GH2 A;  2LST A;  4BVX A;  1G6Y A;  1VF1 A;  2B1K A;  3ERG A;  5IMA A;  6GSW A;  1C72 A;  1LBK A;  1YF1 A;  1TU8 A;  2JL4 A;  3DVW A;  1Z6M A;  4YH2 A;  3HD5 A;  11GS A;  3TRX A;  3VWW A;  1QUW A;  1GLQ A;  2YV7 A;  4HI7 A;  2VD0 A;  5G31 A;  4TVE A;  4I6X A;  1OKT A;  4N10 A;  1H4O A;  4G10 A;  4YQU A;  2YNX A;  1B8X A;  1B9X C;  2CV4 A;  1YQ1 A;  2XBI A;  5G1L A;  2ZUP A;  1QXH A;  2V41 A;  2O87 A;  4L0U A;  3UIW A;  3ZMK A;  1T4Z A;  5COH A;  1B48 A;  2PVO C;  3FZ4 A;  5IMC A;  4Q5R A;  1PL2 A;  3QDN A;  5HR2 A;  4L5L A;  1FG4 A;  2WRT A;  4KE3 A;  3HA9 A;  3ZIT A;  4L0W A;  2A2R A;  5G1K A;  2L59 A;  2C1Y A;  1O8X A;  3VPQ A;  3ZIV A;  1T8E B;  3HVX A;  2KOK A;  3GMF A;  1K0O A;  3WT2 A;  5IQY A;  5E4W A;  1ZL9 A;  5IPH A;  1GSY A;  3QR6 A;  3ZZX A;  1Z5Y E;  4YQM A;  1EOG A;  2DSA A;  2FWH A;  3CRT A;  2M80 A;  1B9Y C;  3FK8 A;  4TXO B;  3O6T A;  4WKW A;  2LJA A;  4JRR A;  4PUA A;  4WXT A;  1TK5 B;  2IFQ A;  4TN8 A;  4ULX A;  3HKR A;  4HJ2 A;  4IBP A;  3IDV A;  3MWH A;  2L4Q A;  2HI7 A;  3LOR A;  2HRN A;  4MH2 A;  4WF5 A;  2YJ7 A;  3RDW A;  1JZW A;  4POL A;  5B7C A;  1OC9 B;  1EV4 A;  5H5S A;  1T1V A;  4K7O A;  2H66 A;  3UBL A;  4GSN A;  1V58 A;  2OAD A;  5LNK e;  4HEA 2;  1THO A;  1PN9 A;  1Z9H A;  2B1L A;  3GSS A;  4HOJ A;  1SD8 A;  4K7I A;  4PX1 A;  2OBK A;  3HZ4 A;  1IYI A;  1EGO A;  4IGJ A;  5IMD A;  3HDC A;  2N5B A;  3P2A A;  2MZC A;  3LG6 A;  3GH9 A;  3D0Z A;  1TI1 A;  3HXS A;  4N0Z A;  4NHW A;  1ZGN A;  7GSS A;  2EC4 A;  3PIN A;  1KTE A;  1VGL A;  2FA8 A;  3TB2 A;  4ZBB A;  2AB6 A;  1YDK A;  4XCS A;  4KSO A;  4MA9 A;  2C0E A;  2QC7 A;  3TRP A;  3GX0 A;  2H1D A;  3F9U A;  1K0D A;  2VCX A;  5HFK A;  4BPY A;  3PR8 A;  3TJG A;  3D4M A;  3TJJ A;  4POK A;  2MMA A;  4JR4 A;  2IWT A;  1LU4 A;  2AUV A;  3DML A;  2PWJ A;  1BAY A;  3A2X A;  2LRC A;  4MPF A;  4XHM A;  3QAW A;  3ERW A;  3NZN A;  4KB3 A;  4V2N A;  4LL4 B;  2VM1 A;  1JZO A;  3CTF A;  1U88 A;  3M0F A;  1GSS A;  1K3Y A;  2C80 A;  3R2Q A;  1SK0 A;  2DJK A;  5JCG A;  1XW5 A;  1EEJ A;  1X0R A;  1SL1 B;  3KGK A;  1J0F A;  3CTG A;  2MMO A;  3GHA A;  4KGI A;  4X1U A;  2QKE A;  2GST A;  3GKN A;  5ECR B;  2PN8 A;  4MZC A;  3CSJ A;  3EE2 A;  2MBS A;  4HUA A;  3F4R A;  4RQR A;  2FCH A;  5HQP A;  2YPM A;  4CHS A;  1A0F A;  3ZRE A;  2P5Q A;  3LJR A;  3HJM A;  1M7T A;  1XIY A;  1X9W B;  3EYT A;  5ECI B;  2GSS A;  3IE3 A;  4K2D A;  2NVL A;  4O7H A;  1MDJ A;  2NBS A;  5ID2 A;  13GS A;  1ON4 A;  4N30 A;  4I8B A;  1XWG A;  4AF2 A;  3FKF A;  4FYB A;  5IIZ A;  2O8V B;  3LYK A;  5CRH A;  1E6B A;  4Z7X A;  4YQV A;  1XW9 A;  1PKW A;  3SBC A;  2AHE A;  4WBR D;  5IO2 A;  3ZFB A;  2IN3 A;  5CRD A;  2H74 A;  2K6V A;  2BJX A;  3GKX A;  4HJM A;  2JSY A;  1GSE A;  1Z7P A;  1ML6 A;  2CVK A;  3WYW A;  2GZY A;  1PX6 A;  4GLT A;  4MJE A;  5EPF A;  4K0G A;  4IHU A;  4HZ4 A;  3K8N A;  4BL7 A;  4POM A;  3IA1 A;  1CQG A;  1F2E A;  2HSY A;  2YWI A;  5CO3 A;  3CMI A;  3P7X A;  3A3T A;  3ZYW A;  3Q19 A;  1SEN A;  4WR5 A;  3ZVJ D;  4E8H A;  5HFG A;  1EWX A;  2OBI A;  3DRN A;  2LNT A;  2XHF A;  3EMX A;  2H76 A;  1K0N A;  5J3R A;  3F8U A;  4MDC A;  3ZIJ A;  1HNC A;  1Y25 A;  4NV5 A;  1OE8 A;  3DXB A;  3RHB A;  1SL0 B;  3F6D A;  4EE0 A;  5ECO B;  3KZQ A;  1AQX A;  1S3D A;  4WET A;  1ERV A;  1MEK A;  1V98 A;  4OFT A;  2VCW A;  3UJ1 A;  2B3S A;  2B6M A;  4ECI A;  2C3Q A;  5ECQ B;  3WD6 A;  4XS6 A;  2B7K A;  3W6G A;  1BYE A;  2R2J A;  5A5K A;  4MAB A;  1XOB A;  1YY7 A;  2TRC P;  1RQM A;  3GUS A;  2F9S A;  5FHI A;  5ECM B;  4TR1 B;  2F8F A;  1TXX A;  5INY A;  1M9A A;  1VF3 A;  3HJO A;  4BWQ A;  5KN1 A;  20GS A;  2B5Y A;  2FD3 A;  4MF7 A;  3E9J B;  5H5R A;  4IJ3 A;  4TR0 A;  3HJP A;  4KUN A;  3L4N A;  4IEL A;  1T4Y A;  1XPV A;  1WWJ A;  2H71 A;  4K0N A;  5CYY A;  3D4T A;  3TUE A;  5ABR A;  3US3 A;  1T3B A;  2H6Z A;  2R4V A;  1ZYE A;  1M2B A;  5FWG A;  3APQ A;  2DJ2 A;  3UMA A;  6GSX A;  3IAS 2;  3GH6 A;  1ZZY A;  4KCE A;  4KCA A;  5GSS A;  2X99 A;  3EU3 A;  2B5E A;  4IS0 A;  1SYX A;  3KM6 A;  3VFI A;  1WIK A;  2H72 A;  4OCE A;  4GRF A;  1BQ7 A;  2FWG A;  2HXK A;  2R5G A;  3U6V A;  3E0U A;  4CDO A;  3GFK A;  3KCM A;  3QPM A;  3DYR A;  5JWR B;  4PUF C;  3I69 A;  2HE3 A;  5D8I A;  4EL1 A;  4FIW A;  3BCI A;  1GUK A;  5LCZ A;  4Q5Q A;  5HFI A;  1A23 A;  3N5O A;  1EP7 A;  4KX4 A;  2B7J A;  2FGX A;  2L4C A;  5ECK B;  2HSH A;  14GS A;  4GST A;  1GSD A;  1X9M B;  1OYJ A;  2VUP A;  5ECS A;  1O73 A;  4YAV A;  4FO5 A;  2H1G A;  5J4U A;  2M46 A;  1HNB A;  4PQI A;  4DSS A;  1E2Y A;  5F0G A;  4D73 A;  3MDK A;  4EO3 A;  4ECJ A;  2HZE A;  4K7N A;  1FW1 A;  2VLT A;  1GWC A;  3FY7 A;  4IW9 A;  4MJA A;  1ACV A;  1PA3 A;  1OKD A;  2CAQ A;  6GST A;  4V1A g;  4TR3 A;  4KH7 A;  2H73 A;  3L9S A;  10GS A;  3TCO A;  2K8V A;  3KP9 A;  2WZ9 A;  5ECH B;  4AJ6 A;  3DVX A;  3GTU B;  5DJM A;  4ACS A;  1TRW A;  4PNG A;  2ALB A;  2KUC A;  4FYU A;  2RM5 A;  2LQQ A;  1EEM A;  1BG5 A;  1SU9 A;  2X8G A;  2C3N A;  1HQO A;  1NHO A;  5CRE A;  5CAX A;  1O8W A;  1A2L A;  2IMD A;  4RI7 A;  1JLW A;  1G7E A;  3GX8 A;  1U3I A;  1GTB A;  3TKS C;  1F9M A;  4KDX A;  4NAX A;  3GNJ A;  1YEX A;  5H5Q A;  2LRN A;  1YKC A;  2E2M A;  6GSS A;  4GXZ A;  1G6W A;  3RAZ A;  4K6X A;  3E3E A;  2LJR A;  3LFL A;  1SKW B;  3ERF A;  1XFL A;  4Q5N A;  2DC5 A;  1AQW A;  3FZ9 A;  3VWX A;  5FT3 A;  2VOC A;  6GSY A;  3TDG A;  2J23 A;  3DIE A;  2LEG A;  1RK4 A;  3FR6 A;  5JCU A;  2PPT A;  2JAD A;  2GGT A;  2VL2 C;  1A0R P;  3EVI A;  22GS A;  4NMU A;  2REM A;  4EVM A;  3VI5 A;  3ED3 A;  2YOI A;  4LMW A;  1PX7 A;  1FOV A;  3CSI A;  4PXO A;  2LRT A;  2GTU A;  1AC1 A;  1MDK A;  2YAN A;  2BMX A;  4H86 A;  1PKZ A;  1A8Y A;  4MZW A;  3P90 A;  1FHE A;  4HU7 A;  3QCP A;  1O7U A;  1UVZ A;  3BCK A;  1SD9 A;  2O89 A;  4TXO A;  1S3A A;  5IOW A;  1GUH A;  2OE3 A;  1GTI A;  5D9W A;  3TGZ A;  2HZF A;  1SJZ A;  1K3L A;  1SKS B;  2P0G A;  1LJR A;  1SL2 B;  1J9B A;  5G2Z A;  2OE1 A;  2MBT A;  4BWS A;  4CW9 A;  4L8E A;  3MSZ A;  1K0C A;  3CYN A;  4DSQ A;  1YKA A;  4IP1 A;  4TRX A;  2RLI A;  3RBT A;  4MMM A;  3APO A;  1EZK A;  1F6M C;  2C4J A;  1QK8 A;  4ID0 A;  5DAK B;  1OC9 A;  5DAL B;  2JZR A;  3CRU A;  4PQH A;  4V2L A;  2PBJ A;  3HYP A;  1XVW A;  1URM A;  3UVH A;  4XS1 A;  1QQ2 A;  1HYU A;  5HR3 A;  18GS A;  3C1R A;  3IHQ A;  2C0F A;  1GUL A;  4TR4 A;  1A2J A;  3LXT A;  3PH9 A;  2R37 A;  2WUL A;  1FVJ A;  1N8J A;  1JZR A;  2XBQ A;  2XPD A;  5CRW A;  3PGT A;  5EL8 A;  3C7M A;  5KN3 A;  3TOT A;  3A2V A;  4OO5 A;  1OVN A;  4O32 A;  1FB6 A;  5GST A;  2X8C A;  2GLR A;  2LJK A;  4J57 E;  4G19 A;  2WS2 A;  1YZX A;  4F9Z A;  2OJL A;  2C0G A;  2BTO T;  4GCI A;  2KHP A;  3FR3 A;  2HLS A;  1VF4 A;  2N5F A;  2LV3 A;  3APS A;  3RPN A;  3G7J A;  4WBJ A;  3IK7 A;  2FA4 A;  1WPI A;  5CNW A;  3KTL A;  3HCZ A;  4Q5F A;  2L5L A;  3TKS A;  3L9U A;  3HY2 A;  1V57 A;  3QOU A;  2NDO A;  2H0H A;  5A4W A;  17GS A;  2B5X A;  4MK3 A;  3TKQ A;  1U87 A;  3HVV A;  3IV4 A;  1JFU A;  1FAA A;  2G0F A;  1TP9 A;  2VM2 A;  2LKU A;  5F8B A;  4XRA A;  1TJD A;  1THX A;  2V1M A;  2A4V A;  2VLU A;  3JCM L;  3GL5 A;  2HYX A;  1S3C A;  2C3T A;  5ID2 B;  3UBK A;  3EU4 A;  1GNW A;  3WGD A;  1H75 A;  2DJ0 A;  2VL2 A;  4ECC A;  4F0B A;  3KXO A;  4F0C A;  2GQL A;  3DEX A;  1ERT A;  1ERW A;  4MF5 A;  2F8A A;  2R3X A;  1F3A A;  2LS5 A;  3H93 A;  1SK1 A;  2PUK C;  3HVS A;  4MH3 A;  1AW9 A;  4ML6 A;  4OO4 A;  4ZL7 A;  4AGS A;  2YWN A;  5DQY A;  1GSQ A;  3FW2 A;  3Q74 A;  2VL3 A;  1XWB A;  1MTC A;  2EIR A;  2PER A;  5IMZ A;  2ZNM A;  1AXD A;  2JAC A;  3L78 A;  3KH9 A;  4ZBA A;  3UL3 A;  1QFN A;  2KP1 A;  5AN1 A;  5G5E A;  1BX9 A;  2RUF A;  4ILF A;  4FYC A;  1F3B A;  1BJX A;  1O85 A;  3GV1 A;  2IJY A;  5DCH A;  1X5D A;  2GQM A;  4FH8 A;  3KIJ A;  1WMJ A;  1MD4 A;  3IPZ A;  4HU9 A;  1R5P A;  1O81 A;  3GST A;  5AIS A;  3QAV A;  3IAM 2;  3UEM A;  4GWR A;  4AJ7 A;  1T7P B;  16GS A;  5F07 A;  5C00 A;  3VUR A;  4PNF A;  4RI6 A;  1V2A A;  5JCW A;  2H6Y A;  1J08 A;  1SJ6 A;  1ZMA A;  3H1N A;  1UC7 A;  3NOF A;  4ZIL A;  1DSB A;  4X0X A;  3TJB A;  4ECB A;  2H8L A;  1K0M A;  5AGY A;  2NPB A;  1DE1 A;  1Z7R A;  2JZT A;  5G30 A;  3BJ5 A;  1XZO A;  2YP6 A;  4EUY A;  2I9H A;  1NSW A;  2E0Q A;  4TR1 A;  2CVB A;  5D9V A;  1TOF A;  2VAF A;  1BED A;  2N5A A;  2H1B A;  2CX3 A;  4IJI A;  5KEJ A;  9GSS A;  1OC8 A;  3F3Q A;  1Q98 A;  5ENU A;  2MMZ A;  5B6N A;  3KD0 A;  1V40 A;  1I9D A;  3FZ5 A;  1K0A A;  2IMF A;  3GA4 A;  2IME A;  2FHE A;  3AY8 A;  1TRU A;  3ME7 A;  5GAN D;  3TKP A;  3VWV A;  4P3Y B;  2H1A A;  1ILO A;  3MAK A;  2L57 A;  1VF2 A;  4HZ2 A;  4LA1 A;  2DIZ A;  1XOA A;  1ERU A;  3QFB C;  4I5Q A;  1NHY A;  8GSS A;  3NIV A;  2OA7 A;  5IM9 A;  3FEU A;  3GIX A;  3EC3 A;  3LQ7 A;  4V2M A;  3OR5 A;  2CX4 A;  4EXJ A;  2AV4 A;  1EOH A;  1PRX A;  5ELG A;  4JBB A;  4MPG A;  4OD7 A;  1TU7 A;  4BA7 A;  2IMK A;  3UAP A;  4XRD A;  1T00 A;  3F3R A;  5A4U A;  1TI3 A;  4TKY A;  2FWE A;  1ZYQ B;  1TK8 B;  4XS4 A;  5B8B A;  3QMX A;  5ELA A;  2FWF A;  3EUR A;  3D22 A;  2YZH A;  4OMV A;  3EIN A;  3WGX A;  3VWU A;  3TOU A;  3IK9 A;  5F06 A;  4KAE A;  2V6K A;  4K9Z A;  4OFN A;  4F2I A;  1MD3 A;  2YV9 A;  2KLX A;  2M72 A;  5HR0 A;  3GKK A;  1G0T A;  3GL3 A;  3VPT A;  4KW6 A;  1W89 A;  2H70 A;  1GLP A;  2GT5 A;  3IC4 A;  2I3Y A;  4HQZ A;  3L9V A;  3H79 A;  2K9F A;  1X5C A;  3MNG A;  4KSM A;  3D5J A;  4OWY A;  3WT1 A;  2CQ9 A;  3GTU A;  2RII A;  4O92 A;  1GL8 A;  2GZP A;  6GSV A;  1K3O A;  3IR4 A;  3HZ8 A;  2IL3 A;  2RM6 A;  1CQH A;  2G2Q A;  2RUE A;  5D96 A;  2I81 A;  4PQ1 A;  1JLV A;  2QSI A;  2WCI A;  2H01 A;  2IIY A;  3CBU A;  1A8L A;  5AIV A;  3VLN A;  4I97 A;  1GTU A;  1AAZ A;  3S9F A;  2ON7 A;  2AAW A;  2H75 A;  4F82 A;  5JWQ B;  1X5E A;  2AYT A;  1Z3E A;  1TDI A;  3N9J A;  3M9K A;  3A5W A;  1TW9 A;  3TRQ A;  2PVQ A;  1W4V A;  3ME8 A;  3W8S A;  3F4T A;  1Z6N A;  1DBY A;  1XBS A;  1M0U A;  1FO5 A;  2E2G A;  1AIU A;  1AQV A;  1OAZ A;  2EIQ A;  2VCQ A;  1SK2 A;  2CT6 A;  4MZB A;  2VCV A;  3VK9 A;  5J9C A;  4HS1 A;  3QFA C;  1HD2 A;  2OE0 A;  1XWC A;  3C1S A;  3IRA A;  4KA0 A;  1GTA A;  1O6J A;  2YZU A;  2X64 A;  3DGQ A;  3RPP A;  1ABA A;  3LEF A;  5DCG A;  3DKS A;  2AJQ B;  2H0G A;  5AIX A;  19GS A;  1I5G A;  1GNE A;  4JU5 A;  4RUV A;  2L6C A;  12GS A;  4NPB A;  3CSH A;  3GYK A;  4ZB8 A;  2IFQ B;  2VIM A;  5E59 A;  2FY6 A;  3F4S A;  3I9V 2;  5D9X A;  1JHB A;  2CAI A;  5C04 A;  3J7Y b;  2X8H A;  1WJK A;  3GN3 A;  3G7I A;  2DBC A;  2YWO A;  1SKR B;  1GRX A;  4JED A;  4IN0 A;  3UAR A;  3GUR A;  3Q18 A;  5DJL A;  3IBH A;  1DE2 A;  2IPA A;  4EKZ A;  1R4W A;  2L6D A;  1M2D A;  4NWY A;  2H19 A;  3BD2 A;  5HR1 A;  3UOM A;  4TXV A;  3FRC A;  3WGE A;  5EVO A;  4ZL8 A;  5DAL A;  3CXG A;  5DAK A;  1U3A A;  1RW1 A;  5LD0 A;  1G7O A;  3VI7 A;  2CVD A;  4QL7 A;  1UN2 A;  3TKR A;  1XW6 A;  1OC3 A;  2A2S A;  1M99 A;  1B4P A;  2LUS A;  3FR9 A;  1XXU A;  2VCT A;  2WDU A;  4ISD A;  4LMV A;  2E7P A;  5D9T A;  1M2A A;  2CA8 A;  1R7H A;  3ISO A;  1B4Q A;  2DJ3 A;  3DD3 A;  4PUR A;  4JZQ A;  3LSZ A;  2KP2 A;  2I1U A;  2DJJ A;  4MLY A;  5DQS A;  1USB A;  2YWM A;  4I2T A;  5CP1 A;  3EWL A;  3C73 A;  1TK0 B;  2VD1 A;  5J9B A;  1V9W A;  2XPE A;  2VL9 A;  3I6A A;  1EP8 A;  2F3M A;  1PGT A;  5D93 A;  5J5N A;  3ZFL A;  4MJB A;  5DBQ A;  1WP0 A;  3QD9 A;  4WR4 A;  1XVQ A;  1GSU A;  2GZZ A;  2V2G A;  3LWA A;  4GQF A;  1A2M A;  3RHC A;  2DML A;  5B8A A;  4BVY A;  1QMV A;  3GKM A;  2VLV A;  1PD2 1;  5GZZ B;  3QAG A;  5D73 A;  3LXZ A;  5G5F A;  2WFC A;  3FHK A;  3W8J A;  4MJC A;  2ZCT A;  5A4V A;  1PQN A;  4KDU A;  2DIY A;  2C0D A;  3M3M A;  4IKH A;  5JWO B;  2H6X A;  3O76 A;  2F51 A;  4DSR A;  5IPG A;  1TRS A;  3ZL5 A;  1WE0 A;  1GUM A;  4MF6 A;  2LNS A;  1TRV A;  3G7Y A;  1X9S B;  2GSQ A;  1KBN A;  4DEJ A;  2H0I A;  4K8M A;  2WJU A;  3KP8 A;  4JE1 A;  2YN1 A;  5IO0 A;  2YJH A;  5DVB A;  3FYG A;  1FVK A;  2P31 A;  2V6O A;  1ZCP A;  1MDI A;  1WRY A;  3U5R E;  1EGR A;  1Y6E A;  3ZRD A;  3TJF A;  2GQK A;  2LTK A;  1PSQ A;  5IMV A;  4MP4 A;  1KEB A;  4GQC A;  4EC0 A;  1R5A A;  3IXR A;  3BOA A;  2YCD A;  2JSZ A;  3ZVJ A;  4IP6 A;  2JZS A;  5J41 A;  2WB9 A;  3KMN A;  3F0I A;  2OAC A;  2K18 A;  4PGT A;  4XTS A;  5EY6 A;  1NM3 A;  2GS3 A;  2H30 A;  2EIO A;  2NTO A;  2I4A A;  3O3T A;  1SYR A;  1A24 A;  5ECN B;  4MCU A;  4XIH A;  1F37 A;  1YF0 A;  2DJ1 A;  4L5O A;  3UVT A;  4AJ8 A;  2FNO A;  5GAP D;  2P5R A;  1VRS D;  2J9H A;  4DVC A;  1YEP A;  4QQ7 A;  2GVP A;  4GF0 A;  3DWV A;  4QL9 A;  2ES7 A;  1EV9 A;  4NXI A;  1HNA A;  1AUC A;  1SJI A;  2C8U A;  4HDE A;  3KMO A;  2GDR A;  4EDZ A;  3G9B A;  4ZXG A;  4OFM A;  4O5R A;  3KJY A;  5F05 A;  1GSF A;  4F03 A;  3SWL A;  2QGV A;  2TIR A;  4LL1 B;  4N0V A;  5KN2 A;  1Q4J A;  4WF4 A;  3HHV A;  4ZBD A;  1PL1 A;  1QGV A;  1UA5 A;  2HNL A;  3D6I A;  2CZ2 A;  4X43 A;  1DUG A;  2GSR A;  3M8N A;  4V1A p;  2PMT A;  4ZL9 A;  2MMN A;  2R6K A;  3TJK A;  4HQS A;  4G9H A;  3KH7 A;  4POB A;  3H4K A;  4NV2 A;  2PU9 C;  2FUG 2;  4J2F A;  4ZB6 A;  1XWA A;  4TOP A;  1ST9 A;  3M9J A;  4ZIJ A;  3C71 A;  2L5O A;  4ML1 A;  1PMT A;  1M9B A;  2HT9 A;  2PGT A;  3IOS A;  3LYP A;  4N11 A;  3A2W A;  3LGC A;  1XCC A;  2VCZ A;  4TW5 A;  2DLX A;  1KNG A;  4J56 E;  3V1W A;  4IQA A;  3ZML A;  2VO4 A;  2LQO A;  1IYH A;  4RQX A;  3BBY A;  4ZB9 A;  2V32 A;  3Q6O A;  2D2Z A;  2DMM A;  4JR6 A;  2O85 A;  4I2U A;  4EF0 A;  4WEY A;  2ON5 A;  3EMP A;  1GP1 A;  2IMI A;  5B6M A;  5IOX A;  1OE7 A;  5CRG A;  5ECL B;  4OCF A;  1NW2 A;  4KDY A;  4XS4 B;  3TKS E;  2K8S A;  3H8Q A;  5DDL A;  5IMF A;  2JU5 A;  3L0H A;  4GTU A;  1K0B A;  3F6F A;  4IQ1 A;  2TRX A;  4NHZ A;  4DSS B;  2OKA A;  4D73 B;  1N2A A;  2HZE B;  3FZA A;  6GSU A;  3D21 A;  2O7K A;  2HFD A;  3ZTL A;  2XC2 A;  2GT6 A;  5KN0 A;  4YAP A;  1R26 A;  1WOU A;  5L71 A; 
#chains in the Genus database with same CATH topology
 5ECP B;  4E8E A;  1FB0 A;  4GSS A;  3I43 A;  2MYG A;  3KTB A;  3GRX A;  1TTZ A;  3J7Y k;  1JZD A;  1U6T A;  3P8W A;  4EDY A;  1TKD B;  3ZLP A;  1ZOF A;  2Z9S A;  4K1F A;  1XWK A;  2HRF A;  4G2E A;  2WGR A;  3M1G A;  4IVF A;  3C8E A;  2CZ3 A;  4KND A;  1YJ6 A;  4LLR A;  3KEB A;  2FLS A;  3F63 A;  1GH2 A;  2LST A;  4BVX A;  1G6Y A;  1VF1 A;  2B1K A;  3ERG A;  5IMA A;  6GSW A;  1C72 A;  1LBK A;  1YF1 A;  1TU8 A;  2JL4 A;  3DVW A;  1Z6M A;  4YH2 A;  3HD5 A;  11GS A;  3TRX A;  3VWW A;  1QUW A;  1GLQ A;  2YV7 A;  4HI7 A;  2VD0 A;  5G31 A;  4TVE A;  4I6X A;  1OKT A;  4N10 A;  1H4O A;  4G10 A;  4YQU A;  2YNX A;  1B8X A;  1B9X C;  2CV4 A;  1YQ1 A;  2XBI A;  5G1L A;  2ZUP A;  1QXH A;  2V41 A;  2O87 A;  4L0U A;  3UIW A;  3ZMK A;  1T4Z A;  5COH A;  1B48 A;  2PVO C;  3FZ4 A;  5IMC A;  4Q5R A;  1PL2 A;  3QDN A;  5HR2 A;  4L5L A;  1FG4 A;  2WRT A;  4KE3 A;  3HA9 A;  3ZIT A;  4L0W A;  2A2R A;  5G1K A;  2L59 A;  2C1Y A;  1O8X A;  3VPQ A;  3ZIV A;  1T8E B;  3HVX A;  2KOK A;  3GMF A;  1K0O A;  3WT2 A;  5IQY A;  5E4W A;  1ZL9 A;  5IPH A;  1GSY A;  3QR6 A;  3ZZX A;  4Z2T A;  1Z5Y E;  4YQM A;  1EOG A;  2DSA A;  2FWH A;  3CRT A;  2M80 A;  1B9Y C;  3FK8 A;  4TXO B;  3O6T A;  4WKW A;  2LJA A;  4JRR A;  4PUA A;  4WXT A;  1TK5 B;  2IFQ A;  4TN8 A;  4ULX A;  3HKR A;  4HJ2 A;  4IBP A;  3IDV A;  3MWH A;  2L4Q A;  1S3R A;  2HI7 A;  3LOR A;  2HRN A;  4MH2 A;  4WF5 A;  2YJ7 A;  3RDW A;  1JZW A;  4POL A;  5B7C A;  1OC9 B;  1EV4 A;  5H5S A;  1T1V A;  3A5I A;  4K7O A;  2H66 A;  3UBL A;  4GSN A;  1V58 A;  2OAD A;  5LNK e;  4HEA 2;  1THO A;  1PN9 A;  1Z9H A;  2B1L A;  3GSS A;  4HOJ A;  1SD8 A;  4K7I A;  1XG8 A;  4PX1 A;  2OBK A;  3HZ4 A;  1IYI A;  1EGO A;  4IGJ A;  5IMD A;  3HDC A;  2N5B A;  3P2A A;  2MZC A;  3LG6 A;  3GH9 A;  3D0Z A;  1TI1 A;  3HXS A;  4N0Z A;  4NHW A;  1ZGN A;  7GSS A;  2EC4 A;  3PIN A;  1KTE A;  1VGL A;  2FA8 A;  3TB2 A;  4ZBB A;  2AB6 A;  1YDK A;  4XCS A;  4KSO A;  4MA9 A;  2C0E A;  2QC7 A;  3TRP A;  3GX0 A;  2H1D A;  3F9U A;  1K0D A;  2VCX A;  5HFK A;  4BPY A;  1FOH A;  3PR8 A;  3TJG A;  3D4M A;  3TJJ A;  4POK A;  2MMA A;  4JR4 A;  2IWT A;  1LU4 A;  2AUV A;  3DML A;  2PWJ A;  1BAY A;  3A2X A;  4HSC X;  4Z2R A;  2LRC A;  4MPF A;  4XHM A;  3QAW A;  3ERW A;  3NZN A;  4KB3 A;  4V2N A;  4LL4 B;  2VM1 A;  1JZO A;  3CTF A;  3IC8 A;  1U88 A;  3M0F A;  1GSS A;  1K3Y A;  2C80 A;  3R2Q A;  1SK0 A;  2DJK A;  5JCG A;  1XW5 A;  1EEJ A;  1X0R A;  3LW9 A;  1SL1 B;  3KGK A;  1J0F A;  3CTG A;  2MMO A;  3GHA A;  4KGI A;  4X1U A;  2QKE A;  2GST A;  3GKN A;  5ECR B;  2PN8 A;  4MZC A;  3CSJ A;  3EE2 A;  2MBS A;  4HUA A;  3F4R A;  2QA2 A;  4RQR A;  2FCH A;  5HQP A;  2YPM A;  4CHS A;  1A0F A;  3ZRE A;  2P5Q A;  3LJR A;  3HJM A;  1M7T A;  1XIY A;  1X9W B;  3EYT A;  5ECI B;  2GSS A;  3IE3 A;  4K2D A;  2NVL A;  4O7H A;  1MDJ A;  2NBS A;  5ID2 A;  13GS A;  1ON4 A;  4N30 A;  4I8B A;  1XWG A;  4AF2 A;  3FKF A;  4FYB A;  5IIZ A;  2O8V B;  3LYK A;  5CRH A;  1E6B A;  4Z7X A;  4YQV A;  1XW9 A;  1PKW A;  3SBC A;  2AHE A;  4WBR D;  5IO2 A;  3ZFB A;  2IN3 A;  5CRD A;  2H74 A;  3IHG A;  2K6V A;  2BJX A;  3GKX A;  4HJM A;  2JSY A;  1GSE A;  1Z7P A;  1ML6 A;  2CVK A;  3WYW A;  2GZY A;  1PX6 A;  4GLT A;  4MJE A;  5EPF A;  4K0G A;  4IHU A;  4HZ4 A;  4CY6 A;  3K8N A;  4BL7 A;  4POM A;  3IA1 A;  1CQG A;  1F2E A;  2HSY A;  2YWI A;  5CO3 A;  3CMI A;  3P7X A;  3A3T A;  3ZYW A;  3Q19 A;  1SEN A;  4WR5 A;  3ZVJ D;  4E8H A;  5HFG A;  1EWX A;  2OBI A;  3DRN A;  2LNT A;  2XHF A;  3EMX A;  2H76 A;  4A5P A;  1K0N A;  5J3R A;  3F8U A;  4MDC A;  3ZIJ A;  1HNC A;  1Y25 A;  4NV5 A;  1OE8 A;  3DXB A;  3RHB A;  1SL0 B;  3F6D A;  4EE0 A;  5ECO B;  3KZQ A;  1AQX A;  1S3D A;  4WET A;  1ERV A;  1MEK A;  1V98 A;  4OFT A;  2VCW A;  3UJ1 A;  2B3S A;  2B6M A;  4ECI A;  2C3Q A;  5ECQ B;  2X4A A;  3WD6 A;  4XS6 A;  2B7K A;  3W6G A;  1BYE A;  2R2J A;  5A5K A;  4MAB A;  1XOB A;  1YY7 A;  2TRC P;  1RQM A;  3GUS A;  2F9S A;  5FHI A;  5ECM B;  4TR1 B;  2F8F A;  1TXX A;  5INY A;  1M9A A;  1VF3 A;  3HJO A;  4BWQ A;  5KN1 A;  20GS A;  2B5Y A;  2FD3 A;  4MF7 A;  3E9J B;  5H5R A;  4IJ3 A;  4TR0 A;  3HJP A;  4KUN A;  3L4N A;  4IEL A;  1T4Y A;  1XPV A;  1WWJ A;  2H71 A;  4K0N A;  5CYY A;  3D4T A;  3TUE A;  5ABR A;  3US3 A;  1T3B A;  2H6Z A;  2R4V A;  1ZYE A;  1M2B A;  5FWG A;  3APQ A;  2DJ2 A;  3UMA A;  6GSX A;  3IAS 2;  3GH6 A;  1ZZY A;  4KCE A;  4KCA A;  5GSS A;  2X99 A;  3EU3 A;  2B5E A;  4IS0 A;  1SYX A;  3KM6 A;  3VFI A;  1WIK A;  2H72 A;  4OCE A;  4GRF A;  1BQ7 A;  2FWG A;  2HXK A;  2R5G A;  3U6V A;  3E0U A;  4CDO A;  3GFK A;  3KCM A;  3QPM A;  3DYR A;  5JWR B;  4PUF C;  3I69 A;  2HE3 A;  5D8I A;  4EL1 A;  4FIW A;  3BCI A;  1GUK A;  5LCZ A;  4Q5Q A;  5HFI A;  1A23 A;  3N5O A;  1EP7 A;  4KX4 A;  2B7J A;  2FGX A;  2L4C A;  5ECK B;  2HSH A;  14GS A;  4GST A;  1GSD A;  1X9M B;  1OYJ A;  2VUP A;  5ECS A;  1O73 A;  4YAV A;  4FO5 A;  2H1G A;  5J4U A;  2M46 A;  1HNB A;  4PQI A;  2R0G A;  4DSS A;  1E2Y A;  5F0G A;  4D73 A;  3MDK A;  4EO3 A;  4ECJ A;  2HZE A;  4K7N A;  1FW1 A;  2VLT A;  1GWC A;  3FY7 A;  4IW9 A;  4MJA A;  1ACV A;  1PA3 A;  1OKD A;  2CAQ A;  6GST A;  4V1A g;  4TR3 A;  4KH7 A;  2H73 A;  3L9S A;  10GS A;  3TCO A;  2K8V A;  3KP9 A;  2WZ9 A;  5ECH B;  4AJ6 A;  3DVX A;  4G0K A;  3GTU B;  5DJM A;  4ACS A;  1TRW A;  4PNG A;  2ALB A;  2KUC A;  4FYU A;  2RM5 A;  2LQQ A;  1EEM A;  1BG5 A;  1SU9 A;  2X8G A;  2C3N A;  1HQO A;  1NHO A;  1PFO A;  5CRE A;  5CAX A;  1O8W A;  1A2L A;  2IMD A;  4RI7 A;  1JLW A;  1G7E A;  3GX8 A;  1U3I A;  1GTB A;  3TKS C;  1F9M A;  4KDX A;  4NAX A;  3GNJ A;  1YEX A;  5H5Q A;  2LRN A;  1YKC A;  2QA1 A;  2E2M A;  6GSS A;  4GXZ A;  4K2X A;  1G6W A;  3RAZ A;  4K6X A;  3E3E A;  2LJR A;  3LFL A;  1SKW B;  3ERF A;  1XFL A;  4Q5N A;  2DC5 A;  1AQW A;  3FZ9 A;  3VWX A;  5FT3 A;  2VOC A;  6GSY A;  3TDG A;  2J23 A;  3DIE A;  2LEG A;  1RK4 A;  3FR6 A;  5JCU A;  2PPT A;  2JAD A;  2GGT A;  2VL2 C;  1A0R P;  3EVI A;  22GS A;  4NMU A;  2REM A;  4EVM A;  3VI5 A;  3ED3 A;  2YOI A;  4LMW A;  1PX7 A;  1FOV A;  3CSI A;  4PXO A;  2LRT A;  2GTU A;  1AC1 A;  1MDK A;  2YAN A;  4KF9 A;  2BMX A;  4H86 A;  1PKZ A;  1A8Y A;  4MZW A;  3P90 A;  1FHE A;  4HU7 A;  3QCP A;  1O7U A;  1UVZ A;  3BCK A;  1SD9 A;  2O89 A;  4TXO A;  1S3A A;  5IOW A;  1GUH A;  2OE3 A;  1GTI A;  5D9W A;  3TGZ A;  2HZF A;  1SJZ A;  1K3L A;  1SKS B;  4K5S A;  2P0G A;  1LJR A;  1SL2 B;  2R0P A;  1J9B A;  5G2Z A;  2OE1 A;  2MBT A;  4BWS A;  4CW9 A;  4L8E A;  3MSZ A;  1K0C A;  3CYN A;  4FQU A;  4DSQ A;  1YKA A;  4IP1 A;  4TRX A;  2RLI A;  3RBT A;  4MMM A;  3APO A;  1EZK A;  1F6M C;  2C4J A;  1QK8 A;  4ID0 A;  5DAK B;  1OC9 A;  5DAL B;  2JZR A;  3CRU A;  4PQH A;  4V2L A;  2PBJ A;  3HYP A;  1XVW A;  1URM A;  3UVH A;  4XS1 A;  1QQ2 A;  1HYU A;  5HR3 A;  18GS A;  3C1R A;  3IHQ A;  2C0F A;  1GUL A;  4TR4 A;  1A2J A;  3LXT A;  3PH9 A;  2R37 A;  2WUL A;  1FVJ A;  1N8J A;  1JZR A;  2XBQ A;  2XPD A;  5CRW A;  3PGT A;  5EL8 A;  3C7M A;  5KN3 A;  3TOT A;  3A2V A;  4OO5 A;  1OVN A;  4O32 A;  1FB6 A;  5GST A;  2X8C A;  2GLR A;  2LJK A;  4J57 E;  4G19 A;  2WS2 A;  1YZX A;  4BIK A;  4F9Z A;  2OJL A;  2C0G A;  2BTO T;  4GCI A;  2KHP A;  3FR3 A;  4CY8 A;  2HLS A;  1VF4 A;  2N5F A;  2LV3 A;  3APS A;  3RPN A;  3G7J A;  4WBJ A;  3IK7 A;  2FA4 A;  1WPI A;  5CNW A;  3KTL A;  3HCZ A;  4Q5F A;  2L5L A;  4BVY B;  3TKS A;  3L9U A;  3HY2 A;  1V57 A;  3QOU A;  2NDO A;  2H0H A;  5A4W A;  17GS A;  2B5X A;  4MK3 A;  3TKQ A;  1U87 A;  3HVV A;  3IV4 A;  1JFU A;  4EIP A;  2R0C A;  1FAA A;  2G0F A;  1TP9 A;  2VM2 A;  2LKU A;  5F8B A;  4XRA A;  1TJD A;  1THX A;  2V1M A;  2A4V A;  2VLU A;  3JCM L;  3GL5 A;  2HYX A;  1S3C A;  2C3T A;  5ID2 B;  3UBK A;  4G0I A;  2UZ8 A;  3EU4 A;  1GNW A;  3WGD A;  1H75 A;  4X4J A;  2DJ0 A;  2VL2 A;  4ECC A;  4F0B A;  3KXO A;  4F0C A;  2GQL A;  3DEX A;  1ERT A;  1ERW A;  4MF5 A;  2F8A A;  2R3X A;  1F3A A;  2HSM A;  2LS5 A;  3H93 A;  1SK1 A;  2PUK C;  3HVS A;  4MH3 A;  4O5U A;  1AW9 A;  4ML6 A;  4OO4 A;  4ZL7 A;  4AGS A;  2YWN A;  5DQY A;  1GSQ A;  2HRA A;  3FW2 A;  3Q74 A;  2VL3 A;  1XWB A;  1MTC A;  2EIR A;  2PER A;  5IMZ A;  2ZNM A;  1AXD A;  4K5R A;  2JAC A;  3L78 A;  3KH9 A;  1PN0 A;  4ZBA A;  3UL3 A;  1QFN A;  2KP1 A;  5AN1 A;  5G5E A;  1BX9 A;  2RUF A;  4ILF A;  4FYC A;  1F3B A;  1BJX A;  1O85 A;  3GV1 A;  2IJY A;  5DCH A;  1X5D A;  2GQM A;  4FH8 A;  3KIJ A;  1WMJ A;  1MD4 A;  3IPZ A;  4HU9 A;  3PPU A;  1R5P A;  1O81 A;  3GST A;  5AIS A;  3QAV A;  3IAM 2;  3UEM A;  4GWR A;  4AJ7 A;  1T7P B;  16GS A;  5F07 A;  5C00 A;  3VUR A;  4PNF A;  4RI6 A;  1V2A A;  5JCW A;  2H6Y A;  1J08 A;  1SJ6 A;  1ZMA A;  3H1N A;  1UC7 A;  3NOF A;  4ZIL A;  1DSB A;  4X0X A;  3TJB A;  4ECB A;  2H8L A;  1K0M A;  4O5Q A;  5AGY A;  2NPB A;  1DE1 A;  1Z7R A;  2JZT A;  5G30 A;  3BJ5 A;  1XZO A;  2YP6 A;  4EUY A;  2I9H A;  1NSW A;  2E0Q A;  4TR1 A;  2CVB A;  4YKF A;  5D9V A;  1TOF A;  2VAF A;  1BED A;  2N5A A;  2H1B A;  2CX3 A;  4IJI A;  5KEJ A;  9GSS A;  1OC8 A;  3F3Q A;  1Q98 A;  5ENU A;  2MMZ A;  5B6N A;  3KD0 A;  1V40 A;  1I9D A;  3FZ5 A;  1K0A A;  2IMF A;  3GA4 A;  2IME A;  2FHE A;  3AY8 A;  1TRU A;  3ME7 A;  5GAN D;  3TKP A;  3VWV A;  4P3Y B;  2H1A A;  1ILO A;  3MAK A;  2L57 A;  1VF2 A;  4HZ2 A;  4LA1 A;  2DIZ A;  1XOA A;  4Z2U A;  1ERU A;  3QFB C;  4I5Q A;  1NHY A;  8GSS A;  3NIV A;  2OA7 A;  5IM9 A;  3FEU A;  3GIX A;  3EC3 A;  3LQ7 A;  4V2M A;  3OR5 A;  2CX4 A;  4EXJ A;  2AV4 A;  1EOH A;  1PRX A;  5ELG A;  4JBB A;  4MPG A;  4OD7 A;  1TU7 A;  4BA7 A;  2IMK A;  4PTS A;  3UAP A;  4XRD A;  1T00 A;  3F3R A;  3R3E A;  5A4U A;  1TI3 A;  4TKY A;  2FWE A;  1ZYQ B;  1TK8 B;  4XS4 A;  5B8B A;  3QMX A;  5ELA A;  2FWF A;  3EUR A;  3D22 A;  4MNN A;  2YZH A;  4OMV A;  3EIN A;  3WGX A;  3VWU A;  3TOU A;  3IK9 A;  5F06 A;  4KAE A;  2V6K A;  4K9Z A;  4OFN A;  4F2I A;  1MD3 A;  2YV9 A;  4EIQ A;  2KLX A;  2M72 A;  5HR0 A;  3GKK A;  1G0T A;  3GL3 A;  3VPT A;  3MYD A;  4KW6 A;  1W89 A;  2H70 A;  1GLP A;  2GT5 A;  3IC4 A;  2I3Y A;  4HQZ A;  3L9V A;  3H79 A;  4BVX B;  1M3J A;  2K9F A;  1X5C A;  3MNG A;  4KSM A;  3D5J A;  4OWY A;  3WT1 A;  2CQ9 A;  3GTU A;  2RII A;  4O92 A;  1GL8 A;  2GZP A;  6GSV A;  1K3O A;  3IR4 A;  3HZ8 A;  3HVN A;  2IL3 A;  2RM6 A;  1CQH A;  2G2Q A;  2RUE A;  5D96 A;  2I81 A;  4PQ1 A;  1JLV A;  2QSI A;  2WCI A;  2H01 A;  2IIY A;  3CBU A;  1A8L A;  5AIV A;  3VLN A;  4I97 A;  1GTU A;  1AAZ A;  3S9F A;  2ON7 A;  2AAW A;  2H75 A;  4F82 A;  5JWQ B;  1X5E A;  2AYT A;  1Z3E A;  1TDI A;  3N9J A;  3M9K A;  3A5W A;  1TW9 A;  3TRQ A;  2PVQ A;  1W4V A;  3ME8 A;  3W8S A;  4G0L A;  3F4T A;  1Z6N A;  2HRK A;  1DBY A;  1XBS A;  1M0U A;  1FO5 A;  2E2G A;  1AIU A;  1AQV A;  2X49 A;  1OAZ A;  2EIQ A;  2VCQ A;  1SK2 A;  2CT6 A;  4MZB A;  2VCV A;  3VK9 A;  5J9C A;  4HS1 A;  3QFA C;  1HD2 A;  2OE0 A;  1XWC A;  3C1S A;  3IRA A;  4KA0 A;  1GTA A;  1O6J A;  5KOW A;  2YZU A;  2X64 A;  3DGQ A;  3RPP A;  1ABA A;  3LEF A;  5DCG A;  3DKS A;  2AJQ B;  2H0G A;  5AIX A;  19GS A;  1I5G A;  1GNE A;  4JU5 A;  4RUV A;  2L6C A;  12GS A;  4YKG A;  4NPB A;  3CSH A;  3GYK A;  4ZB8 A;  2IFQ B;  2VIM A;  5E59 A;  2FY6 A;  3F4S A;  3I9V 2;  5D9X A;  1JHB A;  2CAI A;  5C04 A;  3J7Y b;  2X8H A;  1WJK A;  3GN3 A;  3G7I A;  2DBC A;  2YWO A;  1SKR B;  1GRX A;  4JED A;  4IN0 A;  3UAR A;  3GUR A;  3Q18 A;  5DJL A;  3IBH A;  1DE2 A;  2IPA A;  1ZYN A;  4EKZ A;  1R4W A;  2L6D A;  1M2D A;  4NWY A;  2H19 A;  3BD2 A;  5HR1 A;  3UOM A;  4TXV A;  3FRC A;  3WGE A;  4USS A;  5EVO A;  4ZL8 A;  5DAL A;  3CXG A;  5DAK A;  1U3A A;  1RW1 A;  5LD0 A;  1G7O A;  3VI7 A;  2CVD A;  4QL7 A;  1UN2 A;  3TKR A;  1XW6 A;  1OC3 A;  2A2S A;  1M99 A;  1B4P A;  2LUS A;  3FR9 A;  1XXU A;  2VCT A;  2WDU A;  4ISD A;  4LMV A;  2E7P A;  5D9T A;  1M2A A;  2CA8 A;  1R7H A;  3ISO A;  1B4Q A;  2DJ3 A;  3DD3 A;  4PUR A;  4JZQ A;  3LSZ A;  2KP2 A;  2I1U A;  2DJJ A;  4MLY A;  5DQS A;  5KOX A;  1USB A;  2YWM A;  4I2T A;  5CP1 A;  3EWL A;  3C73 A;  1TK0 B;  2VD1 A;  5J9B A;  1V9W A;  2XPE A;  2VL9 A;  3I6A A;  1EP8 A;  2F3M A;  1PGT A;  5D93 A;  5J5N A;  3ZFL A;  4MJB A;  5DBQ A;  1WP0 A;  3QD9 A;  4WR4 A;  5BRT A;  1XVQ A;  5BMU A;  1GSU A;  2GZZ A;  2V2G A;  3LWA A;  4GQF A;  1A2M A;  3RHC A;  2DML A;  5B8A A;  4BVY A;  1QMV A;  3GKM A;  3EPT A;  2VLV A;  1PD2 1;  5GZZ B;  3QAG A;  5D73 A;  3LXZ A;  5G5F A;  2WFC A;  3FHK A;  3W8J A;  4MJC A;  2ZCT A;  5A4V A;  1PQN A;  4KDU A;  2DIY A;  2C0D A;  3M3M A;  4IKH A;  5JWO B;  2H6X A;  3O76 A;  1ZYP A;  2F51 A;  4DSR A;  5IPG A;  1TRS A;  3ZL5 A;  1WE0 A;  1GUM A;  4MF6 A;  2LNS A;  1TRV A;  3G7Y A;  1X9S B;  2GSQ A;  1KBN A;  4DEJ A;  2H0I A;  4K8M A;  2WJU A;  3KP8 A;  4JE1 A;  2YN1 A;  5IO0 A;  2YJH A;  5DVB A;  3FYG A;  1FVK A;  4ICY A;  2P31 A;  2V6O A;  2DKI A;  1ZCP A;  1MDI A;  1WRY A;  3U5R E;  1EGR A;  1Y6E A;  4BL7 B;  3ZRD A;  3TJF A;  2GQK A;  2LTK A;  1PSQ A;  5IMV A;  4MP4 A;  1KEB A;  4GQC A;  4EC0 A;  1R5A A;  3IXR A;  3BOA A;  2YCD A;  2JSZ A;  3ZVJ A;  4IP6 A;  2JZS A;  3CQF A;  2WB9 A;  5J41 A;  3KMN A;  3F0I A;  2OAC A;  2DKH A;  2K18 A;  4PGT A;  4XTS A;  5EY6 A;  1NM3 A;  2A2P A;  2GS3 A;  2H30 A;  2EIO A;  2NTO A;  2I4A A;  3O3T A;  1SYR A;  1A24 A;  5ECN B;  4MCU A;  4XIH A;  1F37 A;  1YF0 A;  2DJ1 A;  4L5O A;  3UVT A;  4AJ8 A;  2FNO A;  5GAP D;  2P5R A;  1VRS D;  2J9H A;  3MIX A;  1M3I A;  4DVC A;  1YEP A;  4QQ7 A;  2GVP A;  4GF0 A;  3DWV A;  4QL9 A;  2ES7 A;  1EV9 A;  4NXI A;  1HNA A;  1AUC A;  1SJI A;  2C8U A;  4HDE A;  3KMO A;  2GDR A;  4EDZ A;  3G9B A;  4ZXG A;  4OFM A;  4O5R A;  3KJY A;  5F05 A;  1GSF A;  4F03 A;  3SWL A;  2QGV A;  2TIR A;  4LL1 B;  4N0V A;  5KN2 A;  1Q4J A;  4WF4 A;  3HHV A;  4ZBD A;  1PL1 A;  1QGV A;  1UA5 A;  2HNL A;  3D6I A;  2CZ2 A;  4X43 A;  1DUG A;  2GSR A;  3M8N A;  4V1A p;  2PMT A;  4ZL9 A;  2MMN A;  2R6K A;  3TJK A;  4HQS A;  4G9H A;  3KH7 A;  4POB A;  3H4K A;  4NV2 A;  2PU9 C;  2FUG 2;  4J2F A;  4ZB6 A;  1XWA A;  4TOP A;  1ST9 A;  3M9J A;  4ZIJ A;  3C71 A;  2L5O A;  4ML1 A;  1PMT A;  1M9B A;  2A4H A;  2HT9 A;  2PGT A;  3IOS A;  3LYP A;  4N11 A;  3A2W A;  3LGC A;  1XCC A;  2VCZ A;  4TW5 A;  2DLX A;  3FMW A;  1KNG A;  4J56 E;  3V1W A;  4IQA A;  3ZML A;  2VO4 A;  2LQO A;  1IYH A;  4RQX A;  3BBY A;  4ZB9 A;  2V32 A;  3Q6O A;  2D2Z A;  2DMM A;  4JR6 A;  2O85 A;  4I2U A;  4EF0 A;  4WEY A;  2ON5 A;  3EMP A;  1GP1 A;  2IMI A;  5B6M A;  5IOX A;  1OE7 A;  5CRG A;  5ECL B;  4OCF A;  1NW2 A;  4KDY A;  4XS4 B;  3TKS E;  2K8S A;  3H8Q A;  5DDL A;  5IMF A;  2JU5 A;  3L0H A;  4GTU A;  1K0B A;  3F6F A;  4IQ1 A;  2TRX A;  4NHZ A;  4DSS B;  2OKA A;  4D73 B;  1N2A A;  2HZE B;  3FZA A;  6GSU A;  3D21 A;  2O7K A;  2HFD A;  3ZTL A;  2XC2 A;  2GT6 A;  5KN0 A;  4YAP A;  1R26 A;  1WOU A;  5L71 A; 
#chains in the Genus database with same CATH homology
 5ECP B;  4E8E A;  1FB0 A;  4GSS A;  3I43 A;  2MYG A;  3KTB A;  3GRX A;  1TTZ A;  3J7Y k;  1JZD A;  1U6T A;  3P8W A;  4EDY A;  1TKD B;  3ZLP A;  1ZOF A;  2Z9S A;  4K1F A;  1XWK A;  2HRF A;  4G2E A;  2WGR A;  3M1G A;  4IVF A;  3C8E A;  2CZ3 A;  4KND A;  1YJ6 A;  4LLR A;  3KEB A;  2FLS A;  3F63 A;  1GH2 A;  2LST A;  4BVX A;  1G6Y A;  1VF1 A;  2B1K A;  3ERG A;  5IMA A;  6GSW A;  1C72 A;  1LBK A;  1YF1 A;  1TU8 A;  2JL4 A;  3DVW A;  1Z6M A;  4YH2 A;  3HD5 A;  11GS A;  3TRX A;  3VWW A;  1QUW A;  1GLQ A;  2YV7 A;  4HI7 A;  2VD0 A;  5G31 A;  4TVE A;  4I6X A;  1OKT A;  4N10 A;  1H4O A;  4G10 A;  4YQU A;  2YNX A;  1B8X A;  1B9X C;  2CV4 A;  1YQ1 A;  2XBI A;  5G1L A;  2ZUP A;  1QXH A;  2V41 A;  2O87 A;  4L0U A;  3UIW A;  3ZMK A;  1T4Z A;  5COH A;  1B48 A;  2PVO C;  3FZ4 A;  5IMC A;  4Q5R A;  1PL2 A;  3QDN A;  5HR2 A;  4L5L A;  1FG4 A;  2WRT A;  4KE3 A;  3HA9 A;  3ZIT A;  4L0W A;  2A2R A;  5G1K A;  2L59 A;  2C1Y A;  1O8X A;  3VPQ A;  3ZIV A;  1T8E B;  3HVX A;  2KOK A;  3GMF A;  1K0O A;  3WT2 A;  5IQY A;  5E4W A;  1ZL9 A;  5IPH A;  1GSY A;  3QR6 A;  3ZZX A;  4Z2T A;  1Z5Y E;  4YQM A;  1EOG A;  2DSA A;  2FWH A;  3CRT A;  2M80 A;  1B9Y C;  3FK8 A;  4TXO B;  3O6T A;  4WKW A;  2LJA A;  4JRR A;  4PUA A;  4WXT A;  1TK5 B;  2IFQ A;  4TN8 A;  4ULX A;  3HKR A;  4HJ2 A;  4IBP A;  3IDV A;  3MWH A;  2L4Q A;  2HI7 A;  3LOR A;  2HRN A;  4MH2 A;  4WF5 A;  2YJ7 A;  3RDW A;  1JZW A;  4POL A;  5B7C A;  1OC9 B;  1EV4 A;  5H5S A;  1T1V A;  3A5I A;  4K7O A;  2H66 A;  3UBL A;  4GSN A;  1V58 A;  2OAD A;  5LNK e;  4HEA 2;  1THO A;  1PN9 A;  1Z9H A;  2B1L A;  3GSS A;  4HOJ A;  1SD8 A;  4K7I A;  4PX1 A;  2OBK A;  3HZ4 A;  1IYI A;  1EGO A;  4IGJ A;  5IMD A;  3HDC A;  2N5B A;  3P2A A;  2MZC A;  3LG6 A;  3GH9 A;  3D0Z A;  1TI1 A;  3HXS A;  4N0Z A;  4NHW A;  1ZGN A;  7GSS A;  2EC4 A;  3PIN A;  1KTE A;  1VGL A;  2FA8 A;  3TB2 A;  4ZBB A;  2AB6 A;  1YDK A;  4XCS A;  4KSO A;  4MA9 A;  2C0E A;  2QC7 A;  3TRP A;  3GX0 A;  2H1D A;  3F9U A;  1K0D A;  2VCX A;  5HFK A;  4BPY A;  1FOH A;  3PR8 A;  3TJG A;  3D4M A;  3TJJ A;  4POK A;  2MMA A;  4JR4 A;  2IWT A;  1LU4 A;  2AUV A;  3DML A;  2PWJ A;  1BAY A;  3A2X A;  4Z2R A;  2LRC A;  4MPF A;  4XHM A;  3QAW A;  3ERW A;  3NZN A;  4KB3 A;  4V2N A;  4LL4 B;  2VM1 A;  1JZO A;  3CTF A;  3IC8 A;  1U88 A;  3M0F A;  1GSS A;  1K3Y A;  2C80 A;  3R2Q A;  1SK0 A;  2DJK A;  5JCG A;  1XW5 A;  1EEJ A;  1X0R A;  3LW9 A;  1SL1 B;  3KGK A;  1J0F A;  3CTG A;  2MMO A;  3GHA A;  4KGI A;  4X1U A;  2QKE A;  2GST A;  3GKN A;  5ECR B;  2PN8 A;  4MZC A;  3CSJ A;  3EE2 A;  2MBS A;  4HUA A;  3F4R A;  2QA2 A;  4RQR A;  2FCH A;  5HQP A;  2YPM A;  4CHS A;  1A0F A;  3ZRE A;  2P5Q A;  3LJR A;  3HJM A;  1M7T A;  1XIY A;  1X9W B;  3EYT A;  5ECI B;  2GSS A;  3IE3 A;  4K2D A;  2NVL A;  4O7H A;  1MDJ A;  2NBS A;  5ID2 A;  13GS A;  1ON4 A;  4N30 A;  4I8B A;  1XWG A;  4AF2 A;  3FKF A;  4FYB A;  5IIZ A;  2O8V B;  3LYK A;  5CRH A;  1E6B A;  4Z7X A;  4YQV A;  1XW9 A;  1PKW A;  3SBC A;  2AHE A;  4WBR D;  5IO2 A;  3ZFB A;  2IN3 A;  5CRD A;  2H74 A;  3IHG A;  2K6V A;  2BJX A;  3GKX A;  4HJM A;  2JSY A;  1GSE A;  1Z7P A;  1ML6 A;  2CVK A;  3WYW A;  2GZY A;  1PX6 A;  4GLT A;  4MJE A;  5EPF A;  4K0G A;  4IHU A;  4HZ4 A;  4CY6 A;  3K8N A;  4BL7 A;  4POM A;  3IA1 A;  1CQG A;  1F2E A;  2HSY A;  2YWI A;  5CO3 A;  3CMI A;  3P7X A;  3A3T A;  3ZYW A;  3Q19 A;  1SEN A;  4WR5 A;  3ZVJ D;  4E8H A;  5HFG A;  1EWX A;  2OBI A;  3DRN A;  2LNT A;  2XHF A;  3EMX A;  2H76 A;  4A5P A;  1K0N A;  5J3R A;  3F8U A;  4MDC A;  3ZIJ A;  1HNC A;  1Y25 A;  4NV5 A;  1OE8 A;  3DXB A;  3RHB A;  1SL0 B;  3F6D A;  4EE0 A;  5ECO B;  3KZQ A;  1AQX A;  1S3D A;  4WET A;  1ERV A;  1MEK A;  1V98 A;  4OFT A;  2VCW A;  3UJ1 A;  2B3S A;  2B6M A;  4ECI A;  2C3Q A;  5ECQ B;  2X4A A;  3WD6 A;  4XS6 A;  2B7K A;  3W6G A;  1BYE A;  2R2J A;  5A5K A;  4MAB A;  1XOB A;  1YY7 A;  2TRC P;  1RQM A;  3GUS A;  2F9S A;  5FHI A;  5ECM B;  4TR1 B;  2F8F A;  1TXX A;  5INY A;  1M9A A;  1VF3 A;  3HJO A;  4BWQ A;  5KN1 A;  20GS A;  2B5Y A;  2FD3 A;  4MF7 A;  3E9J B;  5H5R A;  4IJ3 A;  4TR0 A;  3HJP A;  4KUN A;  3L4N A;  4IEL A;  1T4Y A;  1XPV A;  1WWJ A;  2H71 A;  4K0N A;  5CYY A;  3D4T A;  3TUE A;  5ABR A;  3US3 A;  1T3B A;  2H6Z A;  2R4V A;  1ZYE A;  1M2B A;  5FWG A;  3APQ A;  2DJ2 A;  3UMA A;  6GSX A;  3IAS 2;  3GH6 A;  1ZZY A;  4KCE A;  4KCA A;  5GSS A;  2X99 A;  3EU3 A;  2B5E A;  4IS0 A;  1SYX A;  3KM6 A;  3VFI A;  1WIK A;  2H72 A;  4OCE A;  4GRF A;  1BQ7 A;  2FWG A;  2HXK A;  2R5G A;  3U6V A;  3E0U A;  4CDO A;  3GFK A;  3KCM A;  3QPM A;  3DYR A;  5JWR B;  4PUF C;  3I69 A;  2HE3 A;  5D8I A;  4EL1 A;  4FIW A;  3BCI A;  1GUK A;  5LCZ A;  4Q5Q A;  5HFI A;  1A23 A;  3N5O A;  1EP7 A;  4KX4 A;  2B7J A;  2FGX A;  2L4C A;  5ECK B;  2HSH A;  14GS A;  4GST A;  1GSD A;  1X9M B;  1OYJ A;  2VUP A;  5ECS A;  1O73 A;  4YAV A;  4FO5 A;  2H1G A;  5J4U A;  2M46 A;  1HNB A;  4PQI A;  2R0G A;  4DSS A;  1E2Y A;  5F0G A;  4D73 A;  3MDK A;  4EO3 A;  4ECJ A;  2HZE A;  4K7N A;  1FW1 A;  2VLT A;  1GWC A;  3FY7 A;  4IW9 A;  4MJA A;  1ACV A;  1PA3 A;  1OKD A;  2CAQ A;  6GST A;  4V1A g;  4TR3 A;  4KH7 A;  2H73 A;  3L9S A;  10GS A;  3TCO A;  2K8V A;  3KP9 A;  2WZ9 A;  5ECH B;  4AJ6 A;  3DVX A;  4G0K A;  3GTU B;  5DJM A;  4ACS A;  1TRW A;  4PNG A;  2ALB A;  2KUC A;  4FYU A;  2RM5 A;  2LQQ A;  1EEM A;  1BG5 A;  1SU9 A;  2X8G A;  2C3N A;  1HQO A;  1NHO A;  5CRE A;  5CAX A;  1O8W A;  1A2L A;  2IMD A;  4RI7 A;  1JLW A;  1G7E A;  3GX8 A;  1U3I A;  1GTB A;  3TKS C;  1F9M A;  4KDX A;  4NAX A;  3GNJ A;  1YEX A;  5H5Q A;  2LRN A;  1YKC A;  2QA1 A;  2E2M A;  6GSS A;  4GXZ A;  4K2X A;  1G6W A;  3RAZ A;  4K6X A;  3E3E A;  2LJR A;  3LFL A;  1SKW B;  3ERF A;  1XFL A;  4Q5N A;  2DC5 A;  1AQW A;  3FZ9 A;  3VWX A;  5FT3 A;  2VOC A;  6GSY A;  3TDG A;  2J23 A;  3DIE A;  2LEG A;  1RK4 A;  3FR6 A;  5JCU A;  2PPT A;  2JAD A;  2GGT A;  2VL2 C;  1A0R P;  3EVI A;  22GS A;  4NMU A;  2REM A;  4EVM A;  3VI5 A;  3ED3 A;  2YOI A;  4LMW A;  1PX7 A;  1FOV A;  3CSI A;  4PXO A;  2LRT A;  2GTU A;  1AC1 A;  1MDK A;  2YAN A;  4KF9 A;  2BMX A;  4H86 A;  1PKZ A;  1A8Y A;  4MZW A;  3P90 A;  1FHE A;  4HU7 A;  3QCP A;  1O7U A;  1UVZ A;  3BCK A;  1SD9 A;  2O89 A;  4TXO A;  1S3A A;  5IOW A;  1GUH A;  2OE3 A;  1GTI A;  5D9W A;  3TGZ A;  2HZF A;  1SJZ A;  1K3L A;  1SKS B;  4K5S A;  2P0G A;  1LJR A;  1SL2 B;  2R0P A;  1J9B A;  5G2Z A;  2OE1 A;  2MBT A;  4BWS A;  4CW9 A;  4L8E A;  3MSZ A;  1K0C A;  3CYN A;  4FQU A;  4DSQ A;  1YKA A;  4IP1 A;  4TRX A;  2RLI A;  3RBT A;  4MMM A;  3APO A;  1EZK A;  1F6M C;  2C4J A;  1QK8 A;  4ID0 A;  5DAK B;  1OC9 A;  5DAL B;  2JZR A;  3CRU A;  4PQH A;  4V2L A;  2PBJ A;  3HYP A;  1XVW A;  1URM A;  3UVH A;  4XS1 A;  1QQ2 A;  1HYU A;  5HR3 A;  18GS A;  3C1R A;  3IHQ A;  2C0F A;  1GUL A;  4TR4 A;  1A2J A;  3LXT A;  3PH9 A;  2R37 A;  2WUL A;  1FVJ A;  1N8J A;  1JZR A;  2XBQ A;  2XPD A;  5CRW A;  3PGT A;  5EL8 A;  3C7M A;  5KN3 A;  3TOT A;  3A2V A;  4OO5 A;  1OVN A;  4O32 A;  1FB6 A;  5GST A;  2X8C A;  2GLR A;  2LJK A;  4J57 E;  4G19 A;  2WS2 A;  1YZX A;  4F9Z A;  2OJL A;  2C0G A;  2BTO T;  4GCI A;  2KHP A;  3FR3 A;  4CY8 A;  2HLS A;  1VF4 A;  2N5F A;  2LV3 A;  3APS A;  3RPN A;  3G7J A;  4WBJ A;  3IK7 A;  2FA4 A;  1WPI A;  5CNW A;  3KTL A;  3HCZ A;  4Q5F A;  2L5L A;  4BVY B;  3TKS A;  3L9U A;  3HY2 A;  1V57 A;  3QOU A;  2NDO A;  2H0H A;  5A4W A;  17GS A;  2B5X A;  4MK3 A;  3TKQ A;  1U87 A;  3HVV A;  3IV4 A;  1JFU A;  4EIP A;  2R0C A;  1FAA A;  2G0F A;  1TP9 A;  2VM2 A;  2LKU A;  5F8B A;  4XRA A;  1TJD A;  1THX A;  2V1M A;  2A4V A;  2VLU A;  3JCM L;  3GL5 A;  2HYX A;  1S3C A;  2C3T A;  5ID2 B;  3UBK A;  4G0I A;  2UZ8 A;  3EU4 A;  1GNW A;  3WGD A;  1H75 A;  4X4J A;  2DJ0 A;  2VL2 A;  4ECC A;  4F0B A;  3KXO A;  4F0C A;  2GQL A;  3DEX A;  1ERT A;  1ERW A;  4MF5 A;  2F8A A;  2R3X A;  1F3A A;  2HSM A;  2LS5 A;  3H93 A;  1SK1 A;  2PUK C;  3HVS A;  4MH3 A;  4O5U A;  1AW9 A;  4ML6 A;  4OO4 A;  4ZL7 A;  4AGS A;  2YWN A;  5DQY A;  1GSQ A;  2HRA A;  3FW2 A;  3Q74 A;  2VL3 A;  1XWB A;  1MTC A;  2EIR A;  2PER A;  5IMZ A;  2ZNM A;  1AXD A;  4K5R A;  2JAC A;  3L78 A;  3KH9 A;  1PN0 A;  4ZBA A;  3UL3 A;  1QFN A;  2KP1 A;  5AN1 A;  5G5E A;  1BX9 A;  2RUF A;  4ILF A;  4FYC A;  1F3B A;  1BJX A;  1O85 A;  3GV1 A;  2IJY A;  5DCH A;  1X5D A;  2GQM A;  4FH8 A;  3KIJ A;  1WMJ A;  1MD4 A;  3IPZ A;  4HU9 A;  3PPU A;  1R5P A;  1O81 A;  3GST A;  5AIS A;  3QAV A;  3IAM 2;  3UEM A;  4GWR A;  4AJ7 A;  1T7P B;  16GS A;  5F07 A;  5C00 A;  3VUR A;  4PNF A;  4RI6 A;  1V2A A;  5JCW A;  2H6Y A;  1J08 A;  1SJ6 A;  1ZMA A;  3H1N A;  1UC7 A;  3NOF A;  4ZIL A;  1DSB A;  4X0X A;  3TJB A;  4ECB A;  2H8L A;  1K0M A;  4O5Q A;  5AGY A;  2NPB A;  1DE1 A;  1Z7R A;  2JZT A;  5G30 A;  3BJ5 A;  1XZO A;  2YP6 A;  4EUY A;  2I9H A;  1NSW A;  2E0Q A;  4TR1 A;  2CVB A;  4YKF A;  5D9V A;  1TOF A;  2VAF A;  1BED A;  2N5A A;  2H1B A;  2CX3 A;  4IJI A;  5KEJ A;  9GSS A;  1OC8 A;  3F3Q A;  1Q98 A;  5ENU A;  2MMZ A;  5B6N A;  3KD0 A;  1V40 A;  1I9D A;  3FZ5 A;  1K0A A;  2IMF A;  3GA4 A;  2IME A;  2FHE A;  3AY8 A;  1TRU A;  3ME7 A;  5GAN D;  3TKP A;  3VWV A;  4P3Y B;  2H1A A;  1ILO A;  3MAK A;  2L57 A;  1VF2 A;  4HZ2 A;  4LA1 A;  2DIZ A;  1XOA A;  4Z2U A;  1ERU A;  3QFB C;  4I5Q A;  1NHY A;  8GSS A;  3NIV A;  2OA7 A;  5IM9 A;  3FEU A;  3GIX A;  3EC3 A;  3LQ7 A;  4V2M A;  3OR5 A;  2CX4 A;  4EXJ A;  2AV4 A;  1EOH A;  1PRX A;  5ELG A;  4JBB A;  4MPG A;  4OD7 A;  1TU7 A;  4BA7 A;  2IMK A;  4PTS A;  3UAP A;  4XRD A;  1T00 A;  3F3R A;  3R3E A;  5A4U A;  1TI3 A;  4TKY A;  2FWE A;  1ZYQ B;  1TK8 B;  4XS4 A;  5B8B A;  3QMX A;  5ELA A;  2FWF A;  3EUR A;  3D22 A;  4MNN A;  2YZH A;  4OMV A;  3EIN A;  3WGX A;  3VWU A;  3TOU A;  3IK9 A;  5F06 A;  4KAE A;  2V6K A;  4K9Z A;  4OFN A;  4F2I A;  1MD3 A;  2YV9 A;  4EIQ A;  2KLX A;  2M72 A;  5HR0 A;  3GKK A;  1G0T A;  3GL3 A;  3VPT A;  3MYD A;  4KW6 A;  1W89 A;  2H70 A;  1GLP A;  2GT5 A;  3IC4 A;  2I3Y A;  4HQZ A;  3L9V A;  3H79 A;  4BVX B;  2K9F A;  1X5C A;  3MNG A;  4KSM A;  3D5J A;  4OWY A;  3WT1 A;  2CQ9 A;  3GTU A;  2RII A;  4O92 A;  1GL8 A;  2GZP A;  6GSV A;  1K3O A;  3IR4 A;  3HZ8 A;  2IL3 A;  2RM6 A;  1CQH A;  2G2Q A;  2RUE A;  5D96 A;  2I81 A;  4PQ1 A;  1JLV A;  2QSI A;  2WCI A;  2H01 A;  2IIY A;  3CBU A;  1A8L A;  5AIV A;  3VLN A;  4I97 A;  1GTU A;  1AAZ A;  3S9F A;  2ON7 A;  2AAW A;  2H75 A;  4F82 A;  5JWQ B;  1X5E A;  2AYT A;  1Z3E A;  1TDI A;  3N9J A;  3M9K A;  3A5W A;  1TW9 A;  3TRQ A;  2PVQ A;  1W4V A;  3ME8 A;  3W8S A;  4G0L A;  3F4T A;  1Z6N A;  2HRK A;  1DBY A;  1XBS A;  1M0U A;  1FO5 A;  2E2G A;  1AIU A;  1AQV A;  2X49 A;  1OAZ A;  2EIQ A;  2VCQ A;  1SK2 A;  2CT6 A;  4MZB A;  2VCV A;  3VK9 A;  5J9C A;  4HS1 A;  3QFA C;  1HD2 A;  2OE0 A;  1XWC A;  3C1S A;  3IRA A;  4KA0 A;  1GTA A;  1O6J A;  5KOW A;  2YZU A;  2X64 A;  3DGQ A;  3RPP A;  1ABA A;  3LEF A;  5DCG A;  3DKS A;  2AJQ B;  2H0G A;  5AIX A;  19GS A;  1I5G A;  1GNE A;  4JU5 A;  4RUV A;  2L6C A;  12GS A;  4YKG A;  4NPB A;  3CSH A;  3GYK A;  4ZB8 A;  2IFQ B;  2VIM A;  5E59 A;  2FY6 A;  3F4S A;  3I9V 2;  5D9X A;  1JHB A;  2CAI A;  5C04 A;  3J7Y b;  2X8H A;  1WJK A;  3GN3 A;  3G7I A;  2DBC A;  2YWO A;  1SKR B;  1GRX A;  4JED A;  4IN0 A;  3UAR A;  3GUR A;  3Q18 A;  5DJL A;  3IBH A;  1DE2 A;  2IPA A;  1ZYN A;  4EKZ A;  1R4W A;  2L6D A;  1M2D A;  4NWY A;  2H19 A;  3BD2 A;  5HR1 A;  3UOM A;  4TXV A;  3FRC A;  3WGE A;  4USS A;  5EVO A;  4ZL8 A;  5DAL A;  3CXG A;  5DAK A;  1U3A A;  1RW1 A;  5LD0 A;  1G7O A;  3VI7 A;  2CVD A;  4QL7 A;  1UN2 A;  3TKR A;  1XW6 A;  1OC3 A;  2A2S A;  1M99 A;  1B4P A;  2LUS A;  3FR9 A;  1XXU A;  2VCT A;  2WDU A;  4ISD A;  4LMV A;  2E7P A;  5D9T A;  1M2A A;  2CA8 A;  1R7H A;  3ISO A;  1B4Q A;  2DJ3 A;  3DD3 A;  4PUR A;  4JZQ A;  3LSZ A;  2KP2 A;  2I1U A;  2DJJ A;  4MLY A;  5DQS A;  5KOX A;  1USB A;  2YWM A;  4I2T A;  5CP1 A;  3EWL A;  3C73 A;  1TK0 B;  2VD1 A;  5J9B A;  1V9W A;  2XPE A;  2VL9 A;  3I6A A;  1EP8 A;  2F3M A;  1PGT A;  5D93 A;  5J5N A;  3ZFL A;  4MJB A;  5DBQ A;  1WP0 A;  3QD9 A;  4WR4 A;  5BRT A;  1XVQ A;  5BMU A;  1GSU A;  2GZZ A;  2V2G A;  3LWA A;  4GQF A;  1A2M A;  3RHC A;  2DML A;  5B8A A;  4BVY A;  1QMV A;  3GKM A;  3EPT A;  2VLV A;  1PD2 1;  5GZZ B;  3QAG A;  5D73 A;  3LXZ A;  5G5F A;  2WFC A;  3FHK A;  3W8J A;  4MJC A;  2ZCT A;  5A4V A;  1PQN A;  4KDU A;  2DIY A;  2C0D A;  3M3M A;  4IKH A;  5JWO B;  2H6X A;  3O76 A;  1ZYP A;  2F51 A;  4DSR A;  5IPG A;  1TRS A;  3ZL5 A;  1WE0 A;  1GUM A;  4MF6 A;  2LNS A;  1TRV A;  3G7Y A;  1X9S B;  2GSQ A;  1KBN A;  4DEJ A;  2H0I A;  4K8M A;  2WJU A;  3KP8 A;  4JE1 A;  2YN1 A;  5IO0 A;  2YJH A;  5DVB A;  3FYG A;  1FVK A;  4ICY A;  2P31 A;  2V6O A;  2DKI A;  1ZCP A;  1MDI A;  1WRY A;  3U5R E;  1EGR A;  1Y6E A;  4BL7 B;  3ZRD A;  3TJF A;  2GQK A;  2LTK A;  1PSQ A;  5IMV A;  4MP4 A;  1KEB A;  4GQC A;  4EC0 A;  1R5A A;  3IXR A;  3BOA A;  2YCD A;  2JSZ A;  3ZVJ A;  4IP6 A;  2JZS A;  5J41 A;  2WB9 A;  3KMN A;  3F0I A;  2OAC A;  2DKH A;  2K18 A;  4PGT A;  4XTS A;  5EY6 A;  1NM3 A;  2A2P A;  2GS3 A;  2H30 A;  2EIO A;  2NTO A;  2I4A A;  3O3T A;  1SYR A;  1A24 A;  5ECN B;  4MCU A;  4XIH A;  1F37 A;  1YF0 A;  2DJ1 A;  4L5O A;  3UVT A;  4AJ8 A;  2FNO A;  5GAP D;  2P5R A;  1VRS D;  2J9H A;  3MIX A;  4DVC A;  1YEP A;  4QQ7 A;  2GVP A;  4GF0 A;  3DWV A;  4QL9 A;  2ES7 A;  1EV9 A;  4NXI A;  1HNA A;  1AUC A;  1SJI A;  2C8U A;  4HDE A;  3KMO A;  2GDR A;  4EDZ A;  3G9B A;  4ZXG A;  4OFM A;  4O5R A;  3KJY A;  5F05 A;  1GSF A;  4F03 A;  3SWL A;  2QGV A;  2TIR A;  4LL1 B;  4N0V A;  5KN2 A;  1Q4J A;  4WF4 A;  3HHV A;  4ZBD A;  1PL1 A;  1QGV A;  1UA5 A;  2HNL A;  3D6I A;  2CZ2 A;  4X43 A;  1DUG A;  2GSR A;  3M8N A;  4V1A p;  2PMT A;  4ZL9 A;  2MMN A;  2R6K A;  3TJK A;  4HQS A;  4G9H A;  3KH7 A;  4POB A;  3H4K A;  4NV2 A;  2PU9 C;  2FUG 2;  4J2F A;  4ZB6 A;  1XWA A;  4TOP A;  1ST9 A;  3M9J A;  4ZIJ A;  3C71 A;  2L5O A;  4ML1 A;  1PMT A;  1M9B A;  2A4H A;  2HT9 A;  2PGT A;  3IOS A;  3LYP A;  4N11 A;  3A2W A;  3LGC A;  1XCC A;  2VCZ A;  4TW5 A;  2DLX A;  3FMW A;  1KNG A;  4J56 E;  3V1W A;  4IQA A;  3ZML A;  2VO4 A;  2LQO A;  1IYH A;  4RQX A;  3BBY A;  4ZB9 A;  2V32 A;  3Q6O A;  2D2Z A;  2DMM A;  4JR6 A;  2O85 A;  4I2U A;  4EF0 A;  4WEY A;  2ON5 A;  3EMP A;  1GP1 A;  2IMI A;  5B6M A;  5IOX A;  1OE7 A;  5CRG A;  5ECL B;  4OCF A;  1NW2 A;  4KDY A;  4XS4 B;  3TKS E;  2K8S A;  3H8Q A;  5DDL A;  5IMF A;  2JU5 A;  3L0H A;  4GTU A;  1K0B A;  3F6F A;  4IQ1 A;  2TRX A;  4NHZ A;  4DSS B;  2OKA A;  4D73 B;  1N2A A;  2HZE B;  3FZA A;  6GSU A;  3D21 A;  2O7K A;  2HFD A;  3ZTL A;  2XC2 A;  2GT6 A;  5KN0 A;  4YAP A;  1R26 A;  1WOU A;  5L71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...