2L5OA

Solution structure of a putative thioredoxin from neisseria meningitidis
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
150
structure length
150
Chain Sequence
DSKTAPAFSLPDLHGKTVSNADLQGKVTLINFWFPSCPGCVSEMPKIIKTANDYKNKNFQVLAVAQPIDPIESVRQYVKDYGLPFTVMYDADKAVGQAFGTQVYPTSVLIGKKGEILKTYVGEPDFGKLYQEIDTAWRNSDAEGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative thioredoxin
publication title Solution Structure of a Putative Thioredoxin from Neisseria meningitidis
rcsb
source organism Neisseria meningitidis serogroup b
total genus 46
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2010-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2l5oA00
1YJ6A 1FVJA 2MMZA 3ZTLA 4D73A 4LLRA 3M1GA 4OWYA 1J08A 3A5WA 1O7UA 2B7JA 1FB6A 5DAKA 2H74A 5IQYA 2DMLA 3LXTA 2N5FA 1DE1A 3KMNA 2P5RA 4FYCA 2VL2A 2OE1A 2RLIA 1T7PB 4TW5A 2DBCA 1FVKA 3P90A 2HNLA 4X43A 2HSYA 1HNCA 1A0FA 2D2ZA 5F06A 2H0HA 4EVMA 4ECIA 1Z9HA 3EC3A 5D9WA 5F0GA 4TR3A 4F0CA 1QMVA 5ECHB 1CQGA 2IL3A 2L6DA 3KD0A 2FWEA 3W8SA 3LORA 1URMA 3CRTA 1WRYA 2R4VA 4MZWA 2DSAA 2LQQA 3FR9A 4KSMA 1A24A 4K0GA 3UVHA 1QXHA 2R6KA 3IDVA 1GLPA 3IXRA 2PUKC 1V40A 3M9KA 13GSA 1DUGA 1VF2A 3WYWA 4YAPA 4OO4A 1J9BA 1F9MA 3QAVA 1XVQA 3KH7A 2NVLA 2V1MA 2H6ZA 4GQFA 1BAYA 4MPFA 3HY2A 1AW9A 1QK8A 1MD4A 5JWRB 3GNJA 3IR4A 4GSNA 4OMVA 4YH2A 2E2GA 1SKSB 4OD7A 1JZDA 3FW2A 3LYKA 2GLRA 1H4OA 1M2AA 3RHBA 7GSSA 1SL0B 1XWBA 4F82A 1B9XC 3APOA 1ZGNA 1TW9A 4KW6A 2GSQA 2IMIA 1AQXA 4RI6A 1GLQA 3EU3A 4N30A 1MEKA 2HXKA 3KH9A 2XPEA 5C00A 4V1Ag 3ZMLA 4HOJA 3U6VA 2DJ0A 3CXGA 3EMXA 2H1BA 2GSRA 1XW9A 2MMAA 4KA0A 2B6MA 3I69A 3TOTA 1XOAA 3F9UA 3HHVA 1W4VA 3L9VA 4Q5NA 3FZ4A 2O7KA 3GKNA 2E0QA 1GUMA 2GQMA 1F6MC 1HNAA 4XRDA 2YJHA 4LL4B 4IP6A 2C0DA 4DSSA 1XW6A 1OE7A 4TKYA 4KDYA 3GH9A 2LQOA 3P7XA 1PL2A 2L57A 4ISDA 2RM5A 1BQ7A 4RI7A 2OBKA 4ILFA 1XBSA 1VGLA 4Q5QA 3ERWA 2VL2C 4I8BA 3TKPA 3TDGA 2WCIA 4I5QA 2YN1A 3F8UA 1X5DA 1XPVA 3IK9A 2VUPA 4F0BA 2ALBA 1XCCA 1EWXA 3BOAA 2DIYA 3LFLA 5KN0A 2H6XA 3TCOA 3TGZA 2YANA 4NXIA 3WGXA 4GSTA 2A4VA 2AJQB 3C1SA 3G7IA 5B8BA 3Q19A 3HVSA 1T1VA 5IMZA 4G2EA 2C3QA 3KJYA 1USBA 3GA4A 3DGQA 4AJ7A 4E8EA 3FR6A 4JU5A 2R37A 3VURA 1GSUA 3P2AA 3ERFA 1F3AA 5ELAA 2HT9A 4HZ2A 4O32A 4EDZA 4IHUA 1TOFA 4QL9A 3ZVJD 1M9AA 2FLSA 4TN8A 3VI5A 5IM9A 5ECLB 3N9JA 3TJGA 5AN1A 4JR4A 2IMFA 5CP1A 3A2VA 1XWGA 1M7TA 2CAIA 3GTUA 1ZOFA 2MBSA 2PVQA 3ZVJA 2M80A 3UBKA 3DEXA 3TKSA 2RUFA 4N0VA 1W89A 2ON7A 4GSSA 1T8EB 3H4KA 5G30A 2REMA 5KEJA 2OKAA 4G19A 1ERUA 2H1DA 3KMOA 4TXOA 1I5GA 3VWWA 5JCWA 2V6OA 4V2LA 3DD3A 1GRXA 2H6YA 2MMOA 2B3SA 2VAFA 4PQHA 5LD0A 3ZIVA 1E6BA 2V41A 1M99A 4NPBA 3MDKA 3GX8A 5DALB 2JSZA 1TU7A 1EGOA 1Y6EA 2LRTA 3HYPA 1Y25A 4F03A 4I97A 4ZXGA 1ZZYA 2FA4A 6GSSA 2DJ2A 1UC7A 3V1WA 4XTSA 2LNSA 5IMAA 5A4UA 8GSSA 2BMXA 2V32A 4ZBDA 5B6NA 1N2AA 3LYPA 3FHKA 4N11A 1TRSA 1WOUA 5GZZB 2I4AA 5DALA 1PN9A 2YV7A 1EEJA 3GRXA 4BVYA 4EL1A 1JFUA 3H1NA 2F3MA 2WFCA 11GSA 4IBPA 3EWLA 1WPIA 3ZITA 2X8CA 4HDEA 2H19A 2FHEA 3EE2A 2H73A 4TOPA 2HSHA 2FWHA 4TVEA 3GHAA 1O73A 1PMTA 2HZFA 4K7NA 3VLNA 2XBIA 1SK0A 1ZCPA 3EYTA 1OKTA 4HZ4A 3ERGA 4WBRD 2CVKA 3EINA 5G5FA 3LG6A 3DYRA 5GAND 2QGVA 1DBYA 5HR3A 2FGXA 20GSA 4TRXA 1X9MB 1AAZA 4K6XA 3BBYA 4IN0A 2QC7A 2L59A 2H01A 5DBQA 4MLYA 4L0UA 1NHYA 3EURA 2DJJA 2C3TA 2CVBA 4O5RA 1AUCA 5L71A 4BPYA 2K9FA 1U6TA 1O8WA 4HEA2 4O7HA 4L8EA 2WJUA 6GSWA 3K8NA 2IWTA 2VD1A 3DXBA 4WEYA 3G7YA 1BJXA 4X1UA 4K2DA 2PMTA 2X8HA 3ZFBA 4QL7A 3VPQA 1JZRA 2WZ9A 3TKSC 3IK7A 3QAWA 3TKRA 1IYHA 3OR5A 1ZYEA 1AQVA 5JWQB 1WP0A 4ULXA 2L5OA 1K0OA 1GL8A 1OE8A 3A2XA 5CRGA 3NIVA 1UA5A 4XIHA 5DCGA 3ZIJA 5AIVA 5ID2A 4ECCA 1JLVA 2VD0A 1A0RP 1NHOA 4PGTA 3TKSE 3FYGA 3D21A 2YWMA 4CDOA 3CTGA 3O3TA 5FHIA 1TK0B 1PKWA 1TI3A 4ML1A 4OCEA 4JZQA 4K9ZA 3EMPA 3F4RA 1GTAA 2JADA 3C71A 3UOMA 2PN8A 1TRUA 5KN2A 3ME8A 2JL4A 1TK8B 1VF3A 1YEPA 2KLXA 5B8AA 2GSTA 3L9UA 1KTEA 3GX0A 3F63A 1YEXA 5EL8A 1BEDA 4MMMA 1E2YA 4KDXA 4XS1A 2K6VA 3LJRA 3LQ7A 1R5PA 5ECMB 3IHQA 1UN2A 2EIQA 1R7HA 4EE0A 3L78A 5B6MA 1EV4A 2DLXA 4KH7A 2FWGA 4EC0A 2R3XA 2VCQA 5AGYA 1GTIA 1AIUA 3UARA 1N8JA 3SWLA 2C1YA 4RUVA 1WMJA 5F05A 2GZYA 1T3BA 3M9JA 5D9VA 4G10A 1AXDA 2B5XA 4KUNA 4GWRA 3HCZA 3Q18A 2J23A 2H76A 3MNGA 2HLSA 3HJPA 4BWQA 5FT3A 4MF7A 2IFQB 4PURA 3HXSA 4DVCA 4FO5A 1YF0A 2B1LA 3NZNA 4NWYA 2RUEA 5FWGA 3RDWA 3D4TA 2JSYA 1FO5A 3TUEA 3GSSA 1PL1A 4IQ1A 2H72A 2GQLA 1A8LA 2RIIA 2G2QA 2R2JA 2I1UA 3HKRA 1PD21 3CMIA 5HFIA 2IFQA 5GAPD 2IPAA 3CSHA 1SK1A 4EKZA 2C4JA 4AJ8A 2AAWA 3QOUA 2YWNA 5B7CA 3VWVA 4GF0A 3DKSA 1JHBA 2LRCA 4AJ6A 4IJIA 5DJMA 1PGTA 1GULA 1GH2A 5DQSA 3WGEA 2EIRA 1YY7A 3FY7A 5D9XA 1K0DA 1TTZA 1F37A 3UMAA 2XC2A 4IS0A 1U3AA 2B5EA 2N5AA 2GT5A 5J4UA 3QPMA 5IOWA 1OC3A 4OFNA 2CA8A 2LJAA 5J9BA 1XWCA 3RHCA 3GV1A 5J41A 4PX1A 5EVOA 2X64A 1ST9A 3EVIA 3RPNA 3J7Yb 4ZL8A 4PXOA 5ECQB 4MDCA 3W8JA 2AHEA 3ZRDA 2LEGA 2B1KA 1IYIA 5E4WA 3GN3A 2DJ3A 4O92A 19GSA 2VCZA 5CNWA 3CBUA 1M9BA 4GQCA 5HFKA 2A2SA 4KDUA 4JE1A 4YAVA 2GTUA 5COHA 1V9WA 4KNDA 5H5QA 3FZAA 2YV9A 3C1RA 4MH3A 12GSA 3E0UA 1KNGA 3IAM2 2WGRA 3IA1A 4KCAA 4PUFC 1MTCA 3WT1A 4L5LA 1GTBA 5G31A 3KM6A 1EEMA 4KGIA 2WB9A 1T4YA 2NTOA 5H5RA 3TKQA 1CQHA 1QGVA 5F8BA 1HNBA 4IELA 3M3MA 1TI1A 2F8FA 3UAPA 1FOVA 2GVPA 3H79A 1SL2B 1G6WA 3CSJA 1ON4A 1Q98A 1AC1A 3Q6OA 2GDRA 3IOSA 4NV2A 16GSA 2VCTA 4MJBA 1SK2A 2VL3A 2VL9A 3FZ9A 1DSBA 3AY8A 5C04A 3IV4A 2IMDA 2OE3A 3QCPA 4F9ZA 4OCFA 2HZEB 2BTOT 2ZCTA 3VK9A 4WF5A 1QUWA 1ACVA 4OO5A 3GL5A 3RBTA 2KP2A 4GCIA 5EY6A 3P8WA 3TOUA 3KTBA 1S3DA 3GH6A 1TDIA 4MP4A 3GKKA 4NMUA 1QQ2A 1C72A 1EP7A 1K3OA 2OJLA 5D73A 3D0ZA 4POMA 1B4PA 2H75A 4FYBA 1RK4A 5HQPA 2VOCA 3US3A 1Z5YE 4NHZA 2HZEA 1LU4A 3E9JB 1HYUA 2AV4A 3IPZA 4K7OA 2ON5A 1TRWA 4L0WA 2WRTA 1TXXA 4MZBA 1PX6A 2VCXA 5GSTA 3QR6A 1PSQA 3TJBA 2DMMA 3GYKA 4QQ7A 5A4VA 1XW5A 4J56E 3QFBC 9GSSA 3PH9A 1GWCA 2H8LA 4TR0A 1O8XA 4Q5RA 2LSTA 1RQMA 4J2FA 2LTKA 3A3TA 2YZHA 4JBBA 4PQ1A 3SBCA 4RQRA 4WF4A 4F2IA 4POBA 3D4MA 5G1KA 1R5AA 5AIXA 1I9DA 4ECJA 4P3YB 2C0GA 3GKXA 4MJCA 2YPMA 4BWSA 2L6CA 3HZ4A 3CYNA 5ECRB 2KHPA 3APSA 3J7Yk 2C0FA 2IMKA 3BCIA 3LXZA 4KSOA 4WXTA 4HUAA 14GSA 3QFAC 4L5OA 4ZL9A 3MSZA 4IGJA 3IBHA 2YJ7A 1HQOA 5DCHA 1SD9A 3RPPA 1V2AA 5CYYA 4MZCA 5E59A 3CRUA 4MJEA 4MCUA 1Z7RA 5J9CA 2QKEA 1GSSA 1K0NA 4RQXA 4EDYA 2O8VB 17GSA 1BG5A 3DWVA 3L9SA 1OYJA 1U3IA 4FH8A 2KP1A 4K0NA 2QSIA 1PA3A 1OC8A 2NPBA 1U88A 2AUVA 1WWJA 1LBKA 1GSYA 2M72A 3HVXA 4MF5A 3C8EA 1T4ZA 1SYRA 1V58A 2VIMA 4MF6A 5ENUA 1B4QA 3GFKA 3FR3A 1K3LA 1ZL9A 3ISOA 2DIZA 2GZPA 4I2TA 2K18A 2MBTA 4IP1A 2KUCA 5HFGA 5ECKB 4E8HA 4WBJA 2LNTA 4I2UA 1A2MA 4IJ3A 2KOKA 3KTLA 3WD6A 1Z3EA 1LJRA 4ML6A 1XXUA 3C73A 4IQAA 3F3RA 1GNEA 2LRNA 5HR2A 2HYXA 1AQWA 2F9SA 1TKDB 3G9BA 1XZOA 5KN1A 3TJJA 5G1LA 5CRDA 1SENA 4KAEA 1TJDA 4TR4A 4XRAA 4POKA 2GZZA 2H70A 3DVXA 1ERWA 1UVZA 2P31A 2CZ3A 1WE0A 3ZL5A 1EV9A 2OACA 2FD3A 1MDJA 2P5QA 2OE0A 3R2QA 4WR4A 2LKUA 4V2NA 4Q5FA 5ECOB 2EC4A 1DE2A 1X9WB 2H66A 2LJRA 2X99A 4ZB8A 5IMFA 4IW9A 2GS3A 5A4WA 1FAAA 3GSTA 2VM2A 1WJKA 3D5JA 4PUAA 5EPFA 4XHMA 3KP9A 3GKMA 2CQ9A 2PBJA 2HI7A 4V2MA 3LSZA 2A2RA 5HR1A 2CAQA 5CRHA 4OFMA 3S9FA 4EXJA 4XS4B 1EOGA 2I81A 4LMWA 2VLUA 4DSRA 2CV4A 2TRXA 1MDIA 1K3YA 2O89A 3DMLA 2Z9SA 5IO0A 4JRRA 3MAKA 1GSEA 1SKRB 5HR0A 3JCML 1JZOA 1WIKA 4PQIA 2I9HA 1ZMAA 1QFNA 2FY6A 3F4SA 4WETA 4XS4A 1XOBA 5JCUA 5D96A 3UBLA 4PNFA 3GUSA 2DJKA 5DDLA 1OKDA 3KXOA 4ID0A 3PGTA 2M46A 5IPGA 10GSA 4PNGA 5A5KA 3TB2A 1K0BA 5DVBA 1BYEA 3ZZXA 4MH2A 2G0FA 1THXA 3UL3A 2YWIA 2H1GA 5IO2A 4IKHA 5J5NA 1KEBA 1SJ6A 3UEMA 2VLVA 2L4QA 4EF0A 1G7EA 1SJIA 4ZILA 1TU8A 5D93A 6GSUA 4TR1B 1EP8A 2BJXA 1XWAA 1GUHA 4BL7A 2PVOC 2YWOA 1O81A 2HRNA 3IE3A 4YQUA 1FG4A 2RM6A 2EIOA 1OVNA 4GXZA 3BJ5A 3A2WA 5CO3A 5G2ZA 2XBQA 5LNKe 1NM3A 4H86A 2C0EA 1XIYA 3APQA 4BA7A 2LJKA 2H0IA 3EU4A 3DIEA 1YF1A 1JZWA 4TR1A 4KE3A 1ABAA 1X5CA 3FRCA 5CAXA 4CHSA 2AB6A 2XPDA 3QD9A 3HJOA 2PU9C 2C3NA 2V2GA 3O76A 3WGDA 2VLTA 4ZB9A 4IVFA 5J3RA 1ML6A 3M0FA 1S3CA 2DC5A 1G0TA 1NSWA 4AGSA 2V6KA 3IRAA 5IOXA 3PINA 4JR6A 2GQKA 4ZBBA 4LMVA 3I9V2 2I3YA 2CZ2A 4POLA 4DSSB 1A23A 3D22A 1SJZA 3D6IA 1ZYQB 4ACSA 5DJLA 4FYUA 5DQYA 3KZQA 2CX3A 1GUKA 1KBNA 1PQNA 3G7JA 1OC9B 5F07A 3IAS2 2H71A 1FHEA 3BD2A 3FEUA 4WR5A 2YNXA 5JCGA 1VRSD 1B48A 3H8QA 4BVXA 2ZUPA 2LV3A 3UJ1A 6GSXA 5IIZA 1MDKA 1X5EA 2C80A 1EOHA 2HRFA 1Z6NA 5IMDA 2FA8A 4MA9A 1OC9A 2PWJA 3PR8A 3VWXA 2E2MA 1M0UA 2HE3A 1H75A 4ECBA 2YP6A 4ZB6A 2CX4A 4OFTA 4HS1A 4G9HA 3DRNA 2GSSA 3LEFA 4HJ2A 2NBSA 1Z6MA 1X9SB 2AYTA 2P0GA 2XHFA 2ZNMA 1R26A 3QDNA 2ES7A 3ZLPA 5G5EA 1SYXA 4XS6A 3HDCA 1K0MA 2O85A 1GSQA 1JLWA 2WS2A 2F51A 1T00A 2O87A 1FW1A 3UVTA 5ECIB 3KCMA 3GTUB 3F4TA 5ABRA 4GRFA 3ME7A 4MABA 4YQMA 1GTUA 1YKCA 2B7KA 5ECNB 3F6DA 4N10A 2DJ1A 1VF1A 2PERA 2H30A 3N5OA 4X0XA 3ZMKA 4GTUA 4HU9A 1GSFA 5ECSA 1PKZA 4XCSA 4TXOB 2YZUA 2VCVA 3L4NA 2NDOA 1YDKA 2MMNA 3F0IA 3F6FA 3C7MA 3O6TA 3I43A 1EZKA 4K1FA 3GURA 3ZYWA 3HZ8A 3H93A 1M2DA 3TRQA 2OBIA 3NOFA 5IMVA 3W6GA 3KGKA 1SD8A 4Z7XA 2IIYA 4N0ZA 5JWOB 2IN3A 1OAZA 2YOIA 3VWUA 3ZFLA 3VI7A 4MJAA 1ERTA 2C8UA 4HU7A 2X8GA 1RW1A 5D9TA 4AF2A 3U5RE 3QAGA 1R4WA 1B8XA 1YZXA 4HJMA 2JACA 1X0RA 2GGTA 2VCWA 2N5BA 1V98A 3ED3A 4ZIJA 3GL3A 3M8NA 3BCKA 3VFIA 3FKFA 1M2BA 2FWFA 1SU9A 2JZTA 2L4CA 3GIXA 4I6XA 5AISA 2LUSA 1O6JA 4LL1B 3HJMA 1XFLA 5ELGA 1SL1B 2OA7A 2VM1A 2CT6A 2MZCA 2H0GA 1NW2A 3FK8A 3I6AA 3HVVA 5ECPB 1XVWA 4NAXA 5IPHA 2JZRA 3UIWA 2J9HA 5KN3A 3L0HA 4JEDA 1O85A 4ZBAA 4DSQA 4MK3A 3QMXA 1Z7PA 2FUG2 1F3BA 3CSIA 3TRPA 1GSDA 4V1Ap 1THOA 4J57E 4KCEA 2F8AA 1FB0A 4GLTA 3KP8A 1J0FA 1MD3A 3LWAA 4FIWA 3TJKA 4DEJA 4NV5A 4KX4A 1EGRA 1GNWA 1TP9A 3F3QA 1ERVA 2LS5A 3WT2A 1GP1A 5H5SA 1PRXA 3HD5A 2WDUA 2PGTA 2JU5A 2B5YA 3VPTA 4MPGA 2R5GA 5ID2B 2TIRA 1V57A 4HQZA 1K0CA 1Q4JA 2H1AA 2IMEA 1U87A 1G7OA 4ZL7A 4EUYA 5CRWA 2JZSA 2CVDA 1ILOA 1TK5B 2MYGA 1YKAA 4CW9A 3GMFA 4LA1A 2HFDA 1BX9A 2GT6A 4HI7A 4HQSA 2FCHA 2L5LA 4KB3A 6GSVA 22GSA 6GSTA 1TRVA 1A2JA 4WKWA 3DVWA 5INYA 4K7IA 5LCZA 1PX7A 2OADA 2VO4A 2YCDA 5D8IA 1XWKA 3FZ5A 1A2LA 1VF4A 4YQVA 1G6YA 2WULA 3Q74A 3TJFA 4NHWA 3IC4A 3MWHA 2TRCP 5CREA 1SKWB 1A8YA 3TRXA 2K8SA 4D73B 1S3AA 2K8VA 2FNOA 3ZREA 4K8MA 3E3EA 1F2EA 5DAKB 3KEBA 18GSA 1B9YC 3LGCA 6GSYA 2PPTA 1HD2A 5GSSA 3HA9A 2IJYA 3CTFA 3KIJA 1YQ1A 2E7PA 4EO3A 5IMCA 3RAZA 4TXVA 1K0AA
chains in the Genus database with same CATH superfamily
1YJ6A 1FVJA 2MMZA 3ZTLA 4D73A 4LLRA 3M1GA 2HRKA 4OWYA 1J08A 3A5WA 1O7UA 4O5UA 3CQFA 2B7JA 1FB6A 5DAKA 2H74A 5IQYA 2DMLA 3LXTA 2N5FA 1DE1A 3KMNA 2P5RA 4FYCA 2VL2A 2OE1A 2RLIA 1T7PB 4TW5A 2DBCA 1FVKA 3P90A 2HNLA 4X43A 2HSYA 1HNCA 1A0FA 2D2ZA 5F06A 2H0HA 4EVMA 4ECIA 1Z9HA 3EC3A 5D9WA 5F0GA 4TR3A 4F0CA 1QMVA 5ECHB 1CQGA 2IL3A 2L6DA 3KD0A 2FWEA 3W8SA 3LORA 1URMA 3CRTA 1WRYA 2R4VA 4MZWA 2DSAA 2LQQA 3FR9A 4KSMA 1A24A 4K0GA 3UVHA 1QXHA 2R6KA 3IDVA 1GLPA 3IXRA 2PUKC 1V40A 3M9KA 13GSA 1DUGA 1VF2A 3WYWA 4YAPA 4OO4A 1J9BA 1F9MA 3QAVA 1XVQA 3KH7A 2NVLA 2V1MA 2H6ZA 4GQFA 1BAYA 4MPFA 3HY2A 1AW9A 1QK8A 1MD4A 5JWRB 3GNJA 3IR4A 4GSNA 4OMVA 4YH2A 2E2GA 1SKSB 4OD7A 1JZDA 2A4HA 3FW2A 4O5QA 3LYKA 2GLRA 1H4OA 1M2AA 3RHBA 7GSSA 1SL0B 1XWBA 4F82A 1B9XC 3APOA 1ZGNA 1TW9A 4KW6A 2GSQA 2IMIA 1AQXA 4RI6A 1GLQA 3EU3A 4N30A 1MEKA 2HXKA 3KH9A 2XPEA 5C00A 4V1Ag 3ZMLA 4HOJA 3U6VA 2DJ0A 3CXGA 3EMXA 2H1BA 2GSRA 1XW9A 2MMAA 4KA0A 3HVNA 2B6MA 3I69A 3TOTA 1XOAA 3F9UA 3HHVA 1W4VA 3L9VA 4Q5NA 3FZ4A 2O7KA 3GKNA 2E0QA 1GUMA 2GQMA 1F6MC 1HNAA 4XRDA 4EIQA 2YJHA 4LL4B 4IP6A 2C0DA 4DSSA 1XW6A 1OE7A 4TKYA 4KDYA 3GH9A 2LQOA 3P7XA 1PL2A 2L57A 4ISDA 2RM5A 1BQ7A 4RI7A 2OBKA 4ILFA 1XBSA 1VGLA 4Q5QA 3ERWA 2VL2C 4I8BA 3TKPA 3TDGA 2WCIA 4I5QA 2QA2A 2YN1A 3F8UA 1X5DA 1XPVA 3IK9A 2VUPA 4F0BA 2ALBA 1XCCA 1EWXA 3BOAA 2DIYA 3LFLA 5KN0A 2H6XA 3TCOA 3TGZA 2YANA 4NXIA 3WGXA 4GSTA 2A4VA 2AJQB 3C1SA 3G7IA 5B8BA 3Q19A 2DKIA 1T1VA 3HVSA 5IMZA 4G2EA 2C3QA 3KJYA 1USBA 3GA4A 3DGQA 4AJ7A 4E8EA 3FR6A 4JU5A 2R37A 3VURA 1GSUA 3P2AA 3ERFA 1F3AA 5ELAA 3IHGA 2HT9A 4HZ2A 4O32A 3IC8A 4EDZA 4IHUA 1TOFA 4QL9A 3ZVJD 1M9AA 2FLSA 4TN8A 3VI5A 5IM9A 5ECLB 3N9JA 3TJGA 5AN1A 4JR4A 2IMFA 5CP1A 3A2VA 1XWGA 1M7TA 2CAIA 3GTUA 5BRTA 1ZOFA 2MBSA 2PVQA 3ZVJA 2M80A 3UBKA 3DEXA 3TKSA 2RUFA 4N0VA 1W89A 2ON7A 4GSSA 1T8EB 3H4KA 5G30A 2REMA 5KEJA 2OKAA 4G19A 1ERUA 2H1DA 3KMOA 4TXOA 1I5GA 3VWWA 5JCWA 2V6OA 2X49A 4V2LA 3DD3A 1GRXA 2H6YA 2MMOA 2B3SA 2VAFA 4PQHA 5LD0A 3ZIVA 1E6BA 2V41A 1M99A 4NPBA 3MDKA 3GX8A 5DALB 2JSZA 1TU7A 1EGOA 1Y6EA 2LRTA 3HYPA 1Y25A 4BVYB 4F03A 4I97A 4ZXGA 1ZZYA 2FA4A 6GSSA 2DJ2A 1UC7A 3V1WA 4XTSA 2LNSA 5IMAA 5A4UA 8GSSA 2BMXA 2V32A 4ZBDA 5B6NA 1N2AA 3LYPA 3FHKA 4N11A 1TRSA 1WOUA 2X4AA 5GZZB 2I4AA 5DALA 1PN9A 2YV7A 1EEJA 3GRXA 4BVYA 4EL1A 1JFUA 3H1NA 2F3MA 2WFCA 11GSA 4IBPA 3EWLA 1WPIA 3ZITA 2X8CA 4HDEA 2H19A 2FHEA 3EE2A 2H73A 4TOPA 2HSHA 2FWHA 4TVEA 3GHAA 1O73A 1PMTA 2HZFA 4K7NA 4CY6A 3VLNA 2XBIA 1SK0A 1ZCPA 3EYTA 1OKTA 4HZ4A 3ERGA 4WBRD 2CVKA 3EINA 5G5FA 3LG6A 3DYRA 5GAND 2QGVA 1DBYA 5HR3A 2FGXA 20GSA 4TRXA 1X9MB 1AAZA 4K6XA 3BBYA 4IN0A 4K2XA 2QC7A 2L59A 2H01A 5DBQA 4MLYA 4L0UA 1NHYA 3EURA 2DJJA 2C3TA 2CVBA 4O5RA 1AUCA 5L71A 4BPYA 2K9FA 1U6TA 2HRAA 1O8WA 4HEA2 4O7HA 4L8EA 2WJUA 6GSWA 3K8NA 2IWTA 2VD1A 3DXBA 4WEYA 3G7YA 1XG8A 1BJXA 4X1UA 4K2DA 2PMTA 2X8HA 3ZFBA 4QL7A 3VPQA 1JZRA 2WZ9A 3TKSC 3IK7A 3QAWA 3TKRA 1IYHA 3OR5A 1ZYEA 1AQVA 5JWQB 1WP0A 4ULXA 2L5OA 1K0OA 1GL8A 1OE8A 3A2XA 5CRGA 3NIVA 1UA5A 4XIHA 5DCGA 3ZIJA 5AIVA 5ID2A 4ECCA 1JLVA 2VD0A 1A0RP 1NHOA 4PGTA 3TKSE 3FYGA 3D21A 2YWMA 4CDOA 3CTGA 3O3TA 5FHIA 1TK0B 1PKWA 1TI3A 4A5PA 4ML1A 4OCEA 4JZQA 4K9ZA 3EMPA 3F4RA 1GTAA 2JADA 3C71A 3UOMA 2PN8A 4KF9A 1TRUA 5KN2A 3ME8A 5KOXA 2JL4A 1TK8B 1VF3A 1YEPA 2KLXA 5B8AA 2GSTA 3L9UA 1KTEA 3GX0A 3F63A 1YEXA 5EL8A 1BEDA 4MMMA 1E2YA 4KDXA 4XS1A 2K6VA 3LJRA 3LQ7A 1R5PA 5ECMB 3IHQA 3LW9A 1UN2A 2EIQA 1R7HA 4EE0A 3L78A 5B6MA 1EV4A 2DLXA 4KH7A 2FWGA 4EC0A 2R3XA 2VCQA 5AGYA 1GTIA 1AIUA 3UARA 1N8JA 3SWLA 4G0IA 2C1YA 4RUVA 1WMJA 5F05A 2GZYA 1T3BA 3M9JA 5D9VA 4G10A 1AXDA 2B5XA 4KUNA 4GWRA 3HCZA 3Q18A 2J23A 2H76A 3MNGA 2HLSA 3HJPA 4BWQA 5FT3A 4MF7A 2IFQB 4PURA 3HXSA 4DVCA 4FO5A 1YF0A 2B1LA 3NZNA 4NWYA 2RUEA 5FWGA 3RDWA 3D4TA 2JSYA 1FO5A 4BL7B 3TUEA 3GSSA 1PL1A 4IQ1A 2H72A 2GQLA 1A8LA 2RIIA 2G2QA 2R2JA 2I1UA 3HKRA 1PD21 3CMIA 5HFIA 4Z2TA 2IFQA 5GAPD 2IPAA 3CSHA 1SK1A 4EKZA 2C4JA 4AJ8A 2AAWA 3QOUA 2YWNA 5B7CA 3VWVA 4GF0A 3DKSA 1JHBA 2LRCA 4AJ6A 4IJIA 5DJMA 1PGTA 1GULA 1GH2A 5DQSA 3WGEA 2EIRA 1YY7A 3FY7A 5D9XA 1K0DA 1TTZA 1F37A 3UMAA 2XC2A 4IS0A 1U3AA 2B5EA 2N5AA 2GT5A 5J4UA 3QPMA 5IOWA 1OC3A 4OFNA 2CA8A 2LJAA 5J9BA 1XWCA 2R0GA 3RHCA 3GV1A 5J41A 4PX1A 5EVOA 2X64A 1ST9A 3EVIA 3RPNA 3J7Yb 4ZL8A 4PXOA 5ECQB 4MDCA 3W8JA 2AHEA 3ZRDA 2LEGA 2B1KA 1IYIA 3FMWA 5E4WA 3GN3A 2DJ3A 4O92A 19GSA 2VCZA 2UZ8A 5CNWA 3CBUA 1M9BA 4GQCA 5HFKA 2A2SA 4KDUA 4JE1A 4YAVA 2GTUA 4BVXB 5COHA 1V9WA 4KNDA 5H5QA 3FZAA 4CY8A 2YV9A 4FQUA 3C1RA 4MH3A 12GSA 3E0UA 1KNGA 3IAM2 2WGRA 3IA1A 4KCAA 4PUFC 1MTCA 3WT1A 4L5LA 1GTBA 5G31A 3KM6A 1EEMA 1PN0A 4KGIA 2WB9A 1T4YA 2NTOA 4G0KA 5H5RA 3TKQA 1CQHA 1QGVA 5F8BA 1HNBA 4IELA 3M3MA 1TI1A 2F8FA 3UAPA 1FOVA 2GVPA 3H79A 1SL2B 1G6WA 3CSJA 1ON4A 1Q98A 1AC1A 3Q6OA 2GDRA 3IOSA 4NV2A 16GSA 2VCTA 4MJBA 1SK2A 2VL3A 2VL9A 3FZ9A 1DSBA 3AY8A 5C04A 3IV4A 2IMDA 2OE3A 3A5IA 3QCPA 4F9ZA 4OCFA 2HZEB 2BTOT 2ZCTA 3VK9A 4WF5A 1QUWA 1ACVA 4OO5A 3GL5A 3RBTA 2KP2A 4GCIA 5EY6A 3P8WA 3TOUA 3KTBA 1S3DA 3GH6A 1TDIA 4MP4A 3GKKA 4NMUA 1QQ2A 1C72A 1EP7A 1K3OA 2OJLA 5D73A 3D0ZA 4POMA 1B4PA 2H75A 4FYBA 1RK4A 5HQPA 2VOCA 4Z2RA 3US3A 1Z5YE 4NHZA 2HZEA 1LU4A 3E9JB 3MIXA 1HYUA 2AV4A 3IPZA 4K7OA 4MNNA 2ON5A 1TRWA 4L0WA 2WRTA 1TXXA 4MZBA 1PX6A 2VCXA 5GSTA 3QR6A 1PSQA 3TJBA 2DMMA 3GYKA 4QQ7A 5A4VA 1XW5A 4J56E 3QFBC 9GSSA 3PH9A 1GWCA 3MYDA 2H8LA 4TR0A 1O8XA 4Q5RA 2LSTA 1RQMA 4J2FA 2LTKA 3A3TA 2YZHA 4JBBA 4PQ1A 3SBCA 4RQRA 4K5RA 4WF4A 4F2IA 4POBA 3D4MA 5G1KA 1R5AA 5AIXA 1I9DA 4ECJA 4P3YB 2C0GA 3GKXA 4MJCA 2YPMA 4BWSA 2L6CA 3HZ4A 3CYNA 5ECRB 2KHPA 3APSA 3J7Yk 2C0FA 2IMKA 3BCIA 3LXZA 4KSOA 4WXTA 4HUAA 14GSA 3QFAC 4L5OA 4ZL9A 3MSZA 4IGJA 3IBHA 2YJ7A 1HQOA 5DCHA 1SD9A 3RPPA 1V2AA 5CYYA 4MZCA 1FOHA 5E59A 3CRUA 4MJEA 4MCUA 1Z7RA 5J9CA 1M3JA 2QKEA 1GSSA 1K0NA 4ICYA 4RQXA 4EDYA 2O8VB 17GSA 1BG5A 4EIPA 3DWVA 3L9SA 1OYJA 1U3IA 4FH8A 2KP1A 4K0NA 2QSIA 1PA3A 1OC8A 2NPBA 1U88A 2AUVA 1WWJA 1LBKA 1GSYA 2M72A 3HVXA 4MF5A 3C8EA 1T4ZA 1SYRA 1V58A 4YKFA 2R0PA 2VIMA 4MF6A 5ENUA 1B4QA 3GFKA 3FR3A 1K3LA 1ZL9A 3ISOA 2DIZA 2GZPA 4I2TA 2K18A 4YKGA 2MBTA 4IP1A 1PFOA 2KUCA 5HFGA 5ECKB 4E8HA 4WBJA 2LNTA 4I2UA 1A2MA 4IJ3A 2KOKA 3KTLA 3WD6A 1Z3EA 1LJRA 4ML6A 1XXUA 3C73A 4IQAA 1S3RA 3F3RA 1GNEA 2LRNA 5HR2A 2HYXA 1AQWA 2F9SA 4HSCX 1TKDB 3G9BA 1XZOA 5KN1A 3TJJA 5G1LA 5CRDA 1SENA 4KAEA 1TJDA 4TR4A 4XRAA 4POKA 2GZZA 2H70A 3DVXA 1ERWA 1UVZA 2P31A 2CZ3A 1WE0A 3ZL5A 1EV9A 2OACA 2FD3A 2HSMA 1MDJA 2P5QA 2OE0A 3R2QA 4WR4A 2LKUA 4V2NA 4Q5FA 5ECOB 2EC4A 1DE2A 1X9WB 2H66A 2LJRA 2X99A 4ZB8A 5IMFA 4IW9A 2GS3A 5A4WA 1FAAA 3GSTA 2VM2A 1WJKA 3D5JA 4PUAA 5EPFA 4XHMA 3KP9A 3GKMA 2CQ9A 2PBJA 2HI7A 4V2MA 3LSZA 2A2RA 5HR1A 2CAQA 5CRHA 4OFMA 3S9FA 4EXJA 4XS4B 1EOGA 2I81A 4LMWA 2VLUA 4DSRA 2CV4A 2TRXA 1MDIA 1K3YA 2O89A 3DMLA 2Z9SA 5IO0A 4JRRA 3MAKA 1GSEA 1SKRB 5HR0A 3JCML 1JZOA 1WIKA 4PQIA 2I9HA 1ZMAA 1QFNA 2FY6A 3F4SA 4WETA 4XS4A 1XOBA 5JCUA 5D96A 3UBLA 4PNFA 3GUSA 2DJKA 5DDLA 1OKDA 3KXOA 4ID0A 3PGTA 2M46A 5IPGA 10GSA 4PNGA 5A5KA 3TB2A 1K0BA 5DVBA 1BYEA 3ZZXA 4MH2A 2G0FA 1THXA 3UL3A 2YWIA 2H1GA 5IO2A 4IKHA 5J5NA 1KEBA 1SJ6A 3UEMA 2VLVA 4Z2UA 2L4QA 4EF0A 1G7EA 1SJIA 4ZILA 1TU8A 5D93A 6GSUA 4TR1B 1EP8A 2BJXA 1XWAA 1GUHA 4BL7A 2PVOC 2YWOA 2A2PA 1O81A 2HRNA 3IE3A 4YQUA 1FG4A 2RM6A 2EIOA 1OVNA 4GXZA 3BJ5A 3A2WA 5CO3A 5G2ZA 2XBQA 5LNKe 1NM3A 4H86A 2C0EA 1XIYA 3APQA 4BA7A 2LJKA 2H0IA 3EU4A 3DIEA 1YF1A 1JZWA 4TR1A 4KE3A 1ABAA 1X5CA 3FRCA 5CAXA 4CHSA 2AB6A 2XPDA 3QD9A 3HJOA 2PU9C 2C3NA 2V2GA 3O76A 3WGDA 2VLTA 4ZB9A 4IVFA 5J3RA 1ML6A 3M0FA 1S3CA 2DC5A 1G0TA 1NSWA 4AGSA 2V6KA 3IRAA 5IOXA 3PINA 4JR6A 2GQKA 4ZBBA 4LMVA 3I9V2 2I3YA 1ZYNA 2CZ2A 4POLA 3EPTA 4DSSB 1A23A 3D22A 1SJZA 3D6IA 1ZYQB 4ACSA 5DJLA 4FYUA 5DQYA 3KZQA 2CX3A 1GUKA 1KBNA 1PQNA 3G7JA 1OC9B 5F07A 3IAS2 2H71A 5KOWA 1FHEA 3BD2A 3FEUA 4WR5A 2YNXA 5JCGA 1VRSD 1B48A 3H8QA 4BVXA 2ZUPA 2LV3A 3UJ1A 6GSXA 5IIZA 1MDKA 1X5EA 2C80A 1M3IA 1EOHA 2HRFA 1Z6NA 5IMDA 2FA8A 4MA9A 1OC9A 2PWJA 3PR8A 3VWXA 2E2MA 1M0UA 2HE3A 1H75A 4ECBA 2YP6A 4ZB6A 2CX4A 4OFTA 4HS1A 4G9HA 3DRNA 2GSSA 3LEFA 4HJ2A 2NBSA 1Z6MA 1X9SB 2AYTA 2P0GA 2XHFA 2ZNMA 1R26A 3QDNA 2ES7A 3ZLPA 5G5EA 1SYXA 4XS6A 3HDCA 1K0MA 2O85A 1GSQA 1JLWA 2WS2A 2F51A 1T00A 2O87A 1FW1A 3UVTA 5ECIB 3KCMA 3GTUB 3F4TA 1ZYPA 5ABRA 4GRFA 3ME7A 4MABA 4PTSA 4YQMA 1GTUA 1YKCA 2B7KA 5ECNB 3F6DA 4N10A 2DJ1A 1VF1A 2PERA 2H30A 3N5OA 4X0XA 3ZMKA 4HU9A 4GTUA 1GSFA 5ECSA 1PKZA 4XCSA 4TXOB 2YZUA 2VCVA 3L4NA 2NDOA 1YDKA 2MMNA 3F0IA 3F6FA 3C7MA 3O6TA 3I43A 1EZKA 4K1FA 3GURA 3ZYWA 3HZ8A 3H93A 1M2DA 3TRQA 2OBIA 3NOFA 5IMVA 3W6GA 3KGKA 1SD8A 4Z7XA 2IIYA 4N0ZA 5JWOB 2IN3A 1OAZA 2YOIA 3VWUA 3ZFLA 3VI7A 4MJAA 1ERTA 2C8UA 4HU7A 2X8GA 1RW1A 5D9TA 4AF2A 3U5RE 3QAGA 1R4WA 1B8XA 1YZXA 4HJMA 2JACA 1X0RA 2GGTA 2VCWA 2N5BA 1V98A 3ED3A 4ZIJA 3GL3A 3M8NA 3BCKA 3VFIA 3FKFA 1M2BA 2FWFA 1SU9A 2JZTA 2L4CA 3GIXA 3R3EA 4I6XA 5AISA 2LUSA 1O6JA 4LL1B 3HJMA 1XFLA 5ELGA 1SL1B 2OA7A 2VM1A 5BMUA 2CT6A 2MZCA 2H0GA 1NW2A 3FK8A 3I6AA 3HVVA 5ECPB 1XVWA 4NAXA 5IPHA 2JZRA 3UIWA 2J9HA 5KN3A 3L0HA 4JEDA 1O85A 4ZBAA 4DSQA 4MK3A 3QMXA 1Z7PA 2FUG2 1F3BA 3CSIA 3TRPA 1GSDA 4V1Ap 1THOA 4J57E 4KCEA 2F8AA 1FB0A 4GLTA 3KP8A 1J0FA 1MD3A 3LWAA 4FIWA 3TJKA 4DEJA 3PPUA 4NV5A 4KX4A 1EGRA 1GNWA 1TP9A 3F3QA 1ERVA 2LS5A 3WT2A 1GP1A 5H5SA 1PRXA 3HD5A 2WDUA 2PGTA 2JU5A 2B5YA 3VPTA 4MPGA 2R5GA 5ID2B 2TIRA 1V57A 4HQZA 1K0CA 1Q4JA 2H1AA 2IMEA 1U87A 1G7OA 4USSA 4K5SA 4ZL7A 4EUYA 5CRWA 2JZSA 4G0LA 2CVDA 1ILOA 1TK5B 2MYGA 1YKAA 4CW9A 3GMFA 4LA1A 2HFDA 1BX9A 2GT6A 4HI7A 4HQSA 2FCHA 2L5LA 4KB3A 6GSVA 22GSA 6GSTA 1TRVA 1A2JA 4WKWA 3DVWA 5INYA 2QA1A 4K7IA 5LCZA 1PX7A 2OADA 2VO4A 2YCDA 5D8IA 1XWKA 3FZ5A 1A2LA 1VF4A 4YQVA 1G6YA 2WULA 3Q74A 3TJFA 4BIKA 4NHWA 3IC4A 2R0CA 4X4JA 3MWHA 2TRCP 5CREA 1SKWB 1A8YA 3TRXA 2K8SA 4D73B 2DKHA 1S3AA 2K8VA 2FNOA 3ZREA 4K8MA 3E3EA 1F2EA 5DAKB 3KEBA 18GSA 1B9YC 3LGCA 6GSYA 2PPTA 1HD2A 5GSSA 3HA9A 2IJYA 3CTFA 3KIJA 1YQ1A 2E7PA 4EO3A 5IMCA 3RAZA 4TXVA 1K0AA
chains in the Genus database with same CATH topology
1YJ6A 1FVJA 2MMZA 3ZTLA 4D73A 4LLRA 3M1GA 2HRKA 4OWYA 1J08A 3A5WA 1O7UA 4O5UA 2B7JA 1FB6A 5DAKA 2H74A 5IQYA 2DMLA 3LXTA 2N5FA 1DE1A 3KMNA 2P5RA 4FYCA 2VL2A 2OE1A 2RLIA 1T7PB 4TW5A 2DBCA 1FVKA 3P90A 2HNLA 4X43A 2HSYA 1HNCA 1A0FA 2D2ZA 5F06A 2H0HA 4EVMA 4ECIA 1Z9HA 3EC3A 5D9WA 5F0GA 4TR3A 4F0CA 1QMVA 5ECHB 1CQGA 2IL3A 2L6DA 3KD0A 2FWEA 3W8SA 3LORA 1URMA 3CRTA 1WRYA 2R4VA 4MZWA 2DSAA 2LQQA 3FR9A 4KSMA 1A24A 4K0GA 3UVHA 1QXHA 2R6KA 3IDVA 1GLPA 3IXRA 2PUKC 1V40A 3M9KA 13GSA 1DUGA 1VF2A 3WYWA 4YAPA 4OO4A 1J9BA 1F9MA 3QAVA 1XVQA 3KH7A 2NVLA 2V1MA 2H6ZA 4GQFA 1BAYA 4MPFA 3HY2A 1AW9A 1QK8A 1MD4A 5JWRB 3GNJA 3IR4A 4GSNA 4OMVA 4YH2A 2E2GA 1SKSB 4OD7A 1JZDA 2A4HA 3FW2A 4O5QA 3LYKA 2GLRA 1H4OA 1M2AA 3RHBA 7GSSA 1SL0B 1XWBA 4F82A 1B9XC 3APOA 1ZGNA 1TW9A 4KW6A 2GSQA 2IMIA 1AQXA 4RI6A 1GLQA 3EU3A 4N30A 1MEKA 2HXKA 3KH9A 2XPEA 5C00A 4V1Ag 3ZMLA 4HOJA 3U6VA 2DJ0A 3CXGA 3EMXA 2H1BA 2GSRA 1XW9A 2MMAA 4KA0A 2B6MA 3I69A 3TOTA 1XOAA 3F9UA 3HHVA 1W4VA 3L9VA 4Q5NA 3FZ4A 2O7KA 3GKNA 2E0QA 1GUMA 2GQMA 1F6MC 1HNAA 4XRDA 4EIQA 2YJHA 4LL4B 4IP6A 2C0DA 4DSSA 1XW6A 1OE7A 4TKYA 4KDYA 3GH9A 2LQOA 3P7XA 1PL2A 2L57A 4ISDA 2RM5A 1BQ7A 4RI7A 2OBKA 4ILFA 1XBSA 1VGLA 4Q5QA 3ERWA 2VL2C 4I8BA 3TKPA 3TDGA 2WCIA 4I5QA 2QA2A 2YN1A 3F8UA 1X5DA 1XPVA 3IK9A 2VUPA 4F0BA 2ALBA 1XCCA 1EWXA 3BOAA 2DIYA 3LFLA 5KN0A 2H6XA 3TCOA 3TGZA 2YANA 4NXIA 3WGXA 4GSTA 2A4VA 2AJQB 3C1SA 3G7IA 5B8BA 3Q19A 2DKIA 1T1VA 3HVSA 5IMZA 4G2EA 2C3QA 3KJYA 1USBA 3GA4A 3DGQA 4AJ7A 4E8EA 3FR6A 4JU5A 2R37A 3VURA 1GSUA 3P2AA 3ERFA 1F3AA 5ELAA 3IHGA 2HT9A 4HZ2A 4O32A 3IC8A 4EDZA 4IHUA 1TOFA 4QL9A 3ZVJD 1M9AA 2FLSA 4TN8A 3VI5A 5IM9A 5ECLB 3N9JA 3TJGA 5AN1A 4JR4A 2IMFA 5CP1A 3A2VA 1XWGA 1M7TA 2CAIA 3GTUA 5BRTA 1ZOFA 2MBSA 2PVQA 3ZVJA 2M80A 3UBKA 3DEXA 3TKSA 2RUFA 4N0VA 1W89A 2ON7A 4GSSA 1T8EB 3H4KA 5G30A 2REMA 5KEJA 2OKAA 4G19A 1ERUA 2H1DA 3KMOA 4TXOA 1I5GA 3VWWA 5JCWA 2V6OA 2X49A 4V2LA 3DD3A 1GRXA 2H6YA 2MMOA 2B3SA 2VAFA 4PQHA 5LD0A 3ZIVA 1E6BA 2V41A 1M99A 4NPBA 3MDKA 3GX8A 5DALB 2JSZA 1TU7A 1EGOA 1Y6EA 2LRTA 3HYPA 1Y25A 4BVYB 4F03A 4I97A 4ZXGA 1ZZYA 2FA4A 6GSSA 2DJ2A 1UC7A 3V1WA 4XTSA 2LNSA 5IMAA 5A4UA 8GSSA 2BMXA 2V32A 4ZBDA 5B6NA 1N2AA 3LYPA 3FHKA 4N11A 1TRSA 1WOUA 2X4AA 5GZZB 2I4AA 5DALA 1PN9A 2YV7A 1EEJA 3GRXA 4BVYA 4EL1A 1JFUA 3H1NA 2F3MA 2WFCA 11GSA 4IBPA 3EWLA 1WPIA 3ZITA 2X8CA 4HDEA 2H19A 2FHEA 3EE2A 2H73A 4TOPA 2HSHA 2FWHA 4TVEA 3GHAA 1O73A 1PMTA 2HZFA 4K7NA 4CY6A 3VLNA 2XBIA 1SK0A 1ZCPA 3EYTA 1OKTA 4HZ4A 3ERGA 4WBRD 2CVKA 3EINA 5G5FA 3LG6A 3DYRA 5GAND 2QGVA 1DBYA 5HR3A 2FGXA 20GSA 4TRXA 1X9MB 1AAZA 4K6XA 3BBYA 4IN0A 4K2XA 2QC7A 2L59A 2H01A 5DBQA 4MLYA 4L0UA 1NHYA 3EURA 2DJJA 2C3TA 2CVBA 4O5RA 1AUCA 5L71A 4BPYA 2K9FA 1U6TA 2HRAA 1O8WA 4HEA2 4O7HA 4L8EA 2WJUA 6GSWA 3K8NA 2IWTA 2VD1A 3DXBA 4WEYA 3G7YA 1BJXA 4X1UA 4K2DA 2PMTA 2X8HA 3ZFBA 4QL7A 3VPQA 1JZRA 2WZ9A 3TKSC 3IK7A 3QAWA 3TKRA 1IYHA 3OR5A 1ZYEA 1AQVA 5JWQB 1WP0A 4ULXA 2L5OA 1K0OA 1GL8A 1OE8A 3A2XA 5CRGA 3NIVA 1UA5A 4XIHA 5DCGA 3ZIJA 5AIVA 5ID2A 4ECCA 1JLVA 2VD0A 1A0RP 1NHOA 4PGTA 3TKSE 3FYGA 3D21A 2YWMA 4CDOA 3CTGA 3O3TA 5FHIA 1TK0B 1PKWA 1TI3A 4A5PA 4ML1A 4OCEA 4JZQA 4K9ZA 3EMPA 3F4RA 1GTAA 2JADA 3C71A 3UOMA 2PN8A 4KF9A 1TRUA 5KN2A 3ME8A 5KOXA 2JL4A 1TK8B 1VF3A 1YEPA 2KLXA 5B8AA 2GSTA 3L9UA 1KTEA 3GX0A 3F63A 1YEXA 5EL8A 1BEDA 4MMMA 1E2YA 4KDXA 4XS1A 2K6VA 3LJRA 3LQ7A 1R5PA 5ECMB 3IHQA 3LW9A 1UN2A 2EIQA 1R7HA 4EE0A 3L78A 5B6MA 1EV4A 2DLXA 4KH7A 2FWGA 4EC0A 2R3XA 2VCQA 5AGYA 1GTIA 1AIUA 3UARA 1N8JA 3SWLA 4G0IA 2C1YA 4RUVA 1WMJA 5F05A 2GZYA 1T3BA 3M9JA 5D9VA 4G10A 1AXDA 2B5XA 4KUNA 4GWRA 3HCZA 3Q18A 2J23A 2H76A 3MNGA 2HLSA 3HJPA 4BWQA 5FT3A 4MF7A 2IFQB 4PURA 3HXSA 4DVCA 4FO5A 1YF0A 2B1LA 3NZNA 4NWYA 2RUEA 5FWGA 3RDWA 3D4TA 2JSYA 1FO5A 4BL7B 3TUEA 3GSSA 1PL1A 4IQ1A 2H72A 2GQLA 1A8LA 2RIIA 2G2QA 2R2JA 2I1UA 3HKRA 1PD21 3CMIA 5HFIA 4Z2TA 2IFQA 5GAPD 2IPAA 3CSHA 1SK1A 4EKZA 2C4JA 4AJ8A 2AAWA 3QOUA 2YWNA 5B7CA 3VWVA 4GF0A 3DKSA 1JHBA 2LRCA 4AJ6A 4IJIA 5DJMA 1PGTA 1GULA 1GH2A 5DQSA 3WGEA 2EIRA 1YY7A 3FY7A 5D9XA 1K0DA 1TTZA 1F37A 3UMAA 2XC2A 4IS0A 1U3AA 2B5EA 2N5AA 2GT5A 5J4UA 3QPMA 5IOWA 1OC3A 4OFNA 2CA8A 2LJAA 5J9BA 1XWCA 2R0GA 3RHCA 3GV1A 5J41A 4PX1A 5EVOA 2X64A 1ST9A 3EVIA 3RPNA 3J7Yb 4ZL8A 4PXOA 5ECQB 4MDCA 3W8JA 2AHEA 3ZRDA 2LEGA 2B1KA 1IYIA 3FMWA 5E4WA 3GN3A 2DJ3A 4O92A 19GSA 2VCZA 2UZ8A 5CNWA 3CBUA 1M9BA 4GQCA 5HFKA 2A2SA 4KDUA 4JE1A 4YAVA 2GTUA 4BVXB 5COHA 1V9WA 4KNDA 5H5QA 3FZAA 4CY8A 2YV9A 4FQUA 3C1RA 4MH3A 12GSA 3E0UA 1KNGA 3IAM2 2WGRA 3IA1A 4KCAA 4PUFC 1MTCA 3WT1A 4L5LA 1GTBA 5G31A 3KM6A 1EEMA 1PN0A 4KGIA 2WB9A 1T4YA 2NTOA 4G0KA 5H5RA 3TKQA 1CQHA 1QGVA 5F8BA 1HNBA 4IELA 3M3MA 1TI1A 2F8FA 3UAPA 1FOVA 2GVPA 3H79A 1SL2B 1G6WA 3CSJA 1ON4A 1Q98A 1AC1A 3Q6OA 2GDRA 3IOSA 4NV2A 16GSA 2VCTA 4MJBA 1SK2A 2VL3A 2VL9A 3FZ9A 1DSBA 3AY8A 5C04A 3IV4A 2IMDA 2OE3A 3A5IA 3QCPA 4F9ZA 4OCFA 2HZEB 2BTOT 2ZCTA 3VK9A 4WF5A 1QUWA 1ACVA 4OO5A 3GL5A 3RBTA 2KP2A 4GCIA 5EY6A 3P8WA 3TOUA 3KTBA 1S3DA 3GH6A 1TDIA 4MP4A 3GKKA 4NMUA 1QQ2A 1C72A 1EP7A 1K3OA 2OJLA 5D73A 3D0ZA 4POMA 1B4PA 2H75A 4FYBA 1RK4A 5HQPA 2VOCA 4Z2RA 3US3A 1Z5YE 4NHZA 2HZEA 1LU4A 3E9JB 3MIXA 1HYUA 2AV4A 3IPZA 4K7OA 4MNNA 2ON5A 1TRWA 4L0WA 2WRTA 1TXXA 4MZBA 1PX6A 2VCXA 5GSTA 3QR6A 1PSQA 3TJBA 2DMMA 3GYKA 4QQ7A 5A4VA 1XW5A 4J56E 3QFBC 9GSSA 3PH9A 1GWCA 3MYDA 2H8LA 4TR0A 1O8XA 4Q5RA 2LSTA 1RQMA 4J2FA 2LTKA 3A3TA 2YZHA 4JBBA 4PQ1A 3SBCA 4RQRA 4K5RA 4WF4A 4F2IA 4POBA 3D4MA 5G1KA 1R5AA 5AIXA 1I9DA 4ECJA 4P3YB 2C0GA 3GKXA 4MJCA 2YPMA 4BWSA 2L6CA 3HZ4A 3CYNA 5ECRB 2KHPA 3APSA 3J7Yk 2C0FA 2IMKA 3BCIA 3LXZA 4KSOA 4WXTA 4HUAA 14GSA 3QFAC 4L5OA 4ZL9A 3MSZA 4IGJA 3IBHA 2YJ7A 1HQOA 5DCHA 1SD9A 3RPPA 1V2AA 5CYYA 4MZCA 1FOHA 5E59A 3CRUA 4MJEA 4MCUA 1Z7RA 5J9CA 2QKEA 1GSSA 1K0NA 4ICYA 4RQXA 4EDYA 2O8VB 17GSA 1BG5A 4EIPA 3DWVA 3L9SA 1OYJA 1U3IA 4FH8A 2KP1A 4K0NA 2QSIA 1PA3A 1OC8A 2NPBA 1U88A 2AUVA 1WWJA 1LBKA 1GSYA 2M72A 3HVXA 4MF5A 3C8EA 1T4ZA 1SYRA 1V58A 4YKFA 2R0PA 2VIMA 4MF6A 5ENUA 1B4QA 3GFKA 3FR3A 1K3LA 1ZL9A 3ISOA 2DIZA 2GZPA 4I2TA 2K18A 4YKGA 2MBTA 4IP1A 2KUCA 5HFGA 5ECKB 4E8HA 4WBJA 2LNTA 4I2UA 1A2MA 4IJ3A 2KOKA 3KTLA 3WD6A 1Z3EA 1LJRA 4ML6A 1XXUA 3C73A 4IQAA 3F3RA 1GNEA 2LRNA 5HR2A 2HYXA 1AQWA 2F9SA 1TKDB 3G9BA 1XZOA 5KN1A 3TJJA 5G1LA 5CRDA 1SENA 4KAEA 1TJDA 4TR4A 4XRAA 4POKA 2GZZA 2H70A 3DVXA 1ERWA 1UVZA 2P31A 2CZ3A 1WE0A 3ZL5A 1EV9A 2OACA 2FD3A 2HSMA 1MDJA 2P5QA 2OE0A 3R2QA 4WR4A 2LKUA 4V2NA 4Q5FA 5ECOB 2EC4A 1DE2A 1X9WB 2H66A 2LJRA 2X99A 4ZB8A 5IMFA 4IW9A 2GS3A 5A4WA 1FAAA 3GSTA 2VM2A 1WJKA 3D5JA 4PUAA 5EPFA 4XHMA 3KP9A 3GKMA 2CQ9A 2PBJA 2HI7A 4V2MA 3LSZA 2A2RA 5HR1A 2CAQA 5CRHA 4OFMA 3S9FA 4EXJA 4XS4B 1EOGA 2I81A 4LMWA 2VLUA 4DSRA 2CV4A 2TRXA 1MDIA 1K3YA 2O89A 3DMLA 2Z9SA 5IO0A 4JRRA 3MAKA 1GSEA 1SKRB 5HR0A 3JCML 1JZOA 1WIKA 4PQIA 2I9HA 1ZMAA 1QFNA 2FY6A 3F4SA 4WETA 4XS4A 1XOBA 5JCUA 5D96A 3UBLA 4PNFA 3GUSA 2DJKA 5DDLA 1OKDA 3KXOA 4ID0A 3PGTA 2M46A 5IPGA 10GSA 4PNGA 5A5KA 3TB2A 1K0BA 5DVBA 1BYEA 3ZZXA 4MH2A 2G0FA 1THXA 3UL3A 2YWIA 2H1GA 5IO2A 4IKHA 5J5NA 1KEBA 1SJ6A 3UEMA 2VLVA 4Z2UA 2L4QA 4EF0A 1G7EA 1SJIA 4ZILA 1TU8A 5D93A 6GSUA 4TR1B 1EP8A 2BJXA 1XWAA 1GUHA 4BL7A 2PVOC 2YWOA 2A2PA 1O81A 2HRNA 3IE3A 4YQUA 1FG4A 2RM6A 2EIOA 1OVNA 4GXZA 3BJ5A 3A2WA 5CO3A 5G2ZA 2XBQA 5LNKe 1NM3A 4H86A 2C0EA 1XIYA 3APQA 4BA7A 2LJKA 2H0IA 3EU4A 3DIEA 1YF1A 1JZWA 4TR1A 4KE3A 1ABAA 1X5CA 3FRCA 5CAXA 4CHSA 2AB6A 2XPDA 3QD9A 3HJOA 2PU9C 2C3NA 2V2GA 3O76A 3WGDA 2VLTA 4ZB9A 4IVFA 5J3RA 1ML6A 3M0FA 1S3CA 2DC5A 1G0TA 1NSWA 4AGSA 2V6KA 3IRAA 5IOXA 3PINA 4JR6A 2GQKA 4ZBBA 4LMVA 3I9V2 2I3YA 1ZYNA 2CZ2A 4POLA 3EPTA 4DSSB 1A23A 3D22A 1SJZA 3D6IA 1ZYQB 4ACSA 5DJLA 4FYUA 5DQYA 3KZQA 2CX3A 1GUKA 1KBNA 1PQNA 3G7JA 1OC9B 5F07A 3IAS2 2H71A 5KOWA 1FHEA 3BD2A 3FEUA 4WR5A 2YNXA 5JCGA 1VRSD 1B48A 3H8QA 4BVXA 2ZUPA 2LV3A 3UJ1A 6GSXA 5IIZA 1MDKA 1X5EA 2C80A 1EOHA 2HRFA 1Z6NA 5IMDA 2FA8A 4MA9A 1OC9A 2PWJA 3PR8A 3VWXA 2E2MA 1M0UA 2HE3A 1H75A 4ECBA 2YP6A 4ZB6A 2CX4A 4OFTA 4HS1A 4G9HA 3DRNA 2GSSA 3LEFA 4HJ2A 2NBSA 1Z6MA 1X9SB 2AYTA 2P0GA 2XHFA 2ZNMA 1R26A 3QDNA 2ES7A 3ZLPA 5G5EA 1SYXA 4XS6A 3HDCA 1K0MA 2O85A 1GSQA 1JLWA 2WS2A 2F51A 1T00A 2O87A 1FW1A 3UVTA 5ECIB 3KCMA 3GTUB 3F4TA 1ZYPA 5ABRA 4GRFA 3ME7A 4MABA 4PTSA 4YQMA 1GTUA 1YKCA 2B7KA 5ECNB 3F6DA 4N10A 2DJ1A 1VF1A 2PERA 2H30A 3N5OA 4X0XA 3ZMKA 4HU9A 4GTUA 1GSFA 5ECSA 1PKZA 4XCSA 4TXOB 2YZUA 2VCVA 3L4NA 2NDOA 1YDKA 2MMNA 3F0IA 3F6FA 3C7MA 3O6TA 3I43A 1EZKA 4K1FA 3GURA 3ZYWA 3HZ8A 3H93A 1M2DA 3TRQA 2OBIA 3NOFA 5IMVA 3W6GA 3KGKA 1SD8A 4Z7XA 2IIYA 4N0ZA 5JWOB 2IN3A 1OAZA 2YOIA 3VWUA 3ZFLA 3VI7A 4MJAA 1ERTA 2C8UA 4HU7A 2X8GA 1RW1A 5D9TA 4AF2A 3U5RE 3QAGA 1R4WA 1B8XA 1YZXA 4HJMA 2JACA 1X0RA 2GGTA 2VCWA 2N5BA 1V98A 3ED3A 4ZIJA 3GL3A 3M8NA 3BCKA 3VFIA 3FKFA 1M2BA 2FWFA 1SU9A 2JZTA 2L4CA 3GIXA 3R3EA 4I6XA 5AISA 2LUSA 1O6JA 4LL1B 3HJMA 1XFLA 5ELGA 1SL1B 2OA7A 2VM1A 5BMUA 2CT6A 2MZCA 2H0GA 1NW2A 3FK8A 3I6AA 3HVVA 5ECPB 1XVWA 4NAXA 5IPHA 2JZRA 3UIWA 2J9HA 5KN3A 3L0HA 4JEDA 1O85A 4ZBAA 4DSQA 4MK3A 3QMXA 1Z7PA 2FUG2 1F3BA 3CSIA 3TRPA 1GSDA 4V1Ap 1THOA 4J57E 4KCEA 2F8AA 1FB0A 4GLTA 3KP8A 1J0FA 1MD3A 3LWAA 4FIWA 3TJKA 4DEJA 3PPUA 4NV5A 4KX4A 1EGRA 1GNWA 1TP9A 3F3QA 1ERVA 2LS5A 3WT2A 1GP1A 5H5SA 1PRXA 3HD5A 2WDUA 2PGTA 2JU5A 2B5YA 3VPTA 4MPGA 2R5GA 5ID2B 2TIRA 1V57A 4HQZA 1K0CA 1Q4JA 2H1AA 2IMEA 1U87A 1G7OA 4USSA 4K5SA 4ZL7A 4EUYA 5CRWA 2JZSA 4G0LA 2CVDA 1ILOA 1TK5B 2MYGA 1YKAA 4CW9A 3GMFA 4LA1A 2HFDA 1BX9A 2GT6A 4HI7A 4HQSA 2FCHA 2L5LA 4KB3A 6GSVA 22GSA 6GSTA 1TRVA 1A2JA 4WKWA 3DVWA 5INYA 2QA1A 4K7IA 5LCZA 1PX7A 2OADA 2VO4A 2YCDA 5D8IA 1XWKA 3FZ5A 1A2LA 1VF4A 4YQVA 1G6YA 2WULA 3Q74A 3TJFA 4NHWA 3IC4A 2R0CA 4X4JA 3MWHA 2TRCP 5CREA 1SKWB 1A8YA 3TRXA 2K8SA 4D73B 2DKHA 1S3AA 2K8VA 2FNOA 3ZREA 4K8MA 3E3EA 1F2EA 5DAKB 3KEBA 18GSA 1B9YC 3LGCA 6GSYA 2PPTA 1HD2A 5GSSA 3HA9A 2IJYA 3CTFA 3KIJA 1YQ1A 2E7PA 4EO3A 5IMCA 3RAZA 4TXVA 1K0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ6 A;  1FVJ A;  2MMZ A;  3ZTL A;  4D73 A;  4LLR A;  3M1G A;  4OWY A;  1J08 A;  3A5W A;  1O7U A;  2B7J A;  1FB6 A;  5DAK A;  2H74 A;  5IQY A;  2DML A;  3LXT A;  2N5F A;  1DE1 A;  3KMN A;  2P5R A;  4FYC A;  2VL2 A;  2OE1 A;  2RLI A;  1T7P B;  4TW5 A;  2DBC A;  1FVK A;  3P90 A;  2HNL A;  4X43 A;  2HSY A;  1HNC A;  1A0F A;  2D2Z A;  5F06 A;  2H0H A;  4EVM A;  4ECI A;  1Z9H A;  3EC3 A;  5D9W A;  5F0G A;  4TR3 A;  4F0C A;  1QMV A;  5ECH B;  1CQG A;  2IL3 A;  2L6D A;  3KD0 A;  2FWE A;  3W8S A;  3LOR A;  1URM A;  3CRT A;  1WRY A;  2R4V A;  4MZW A;  2DSA A;  2LQQ A;  3FR9 A;  4KSM A;  1A24 A;  4K0G A;  3UVH A;  1QXH A;  2R6K A;  3IDV A;  1GLP A;  3IXR A;  2PUK C;  1V40 A;  3M9K A;  13GS A;  1DUG A;  1VF2 A;  3WYW A;  4YAP A;  4OO4 A;  1J9B A;  1F9M A;  3QAV A;  1XVQ A;  3KH7 A;  2NVL A;  2V1M A;  2H6Z A;  4GQF A;  1BAY A;  4MPF A;  3HY2 A;  1AW9 A;  1QK8 A;  1MD4 A;  5JWR B;  3GNJ A;  3IR4 A;  4GSN A;  4OMV A;  4YH2 A;  2E2G A;  1SKS B;  4OD7 A;  1JZD A;  3FW2 A;  3LYK A;  2GLR A;  1H4O A;  1M2A A;  3RHB A;  7GSS A;  1SL0 B;  1XWB A;  4F82 A;  1B9X C;  3APO A;  1ZGN A;  1TW9 A;  4KW6 A;  2GSQ A;  2IMI A;  1AQX A;  4RI6 A;  1GLQ A;  3EU3 A;  4N30 A;  1MEK A;  2HXK A;  3KH9 A;  2XPE A;  5C00 A;  4V1A g;  3ZML A;  4HOJ A;  3U6V A;  2DJ0 A;  3CXG A;  3EMX A;  2H1B A;  2GSR A;  1XW9 A;  2MMA A;  4KA0 A;  2B6M A;  3I69 A;  3TOT A;  1XOA A;  3F9U A;  3HHV A;  1W4V A;  3L9V A;  4Q5N A;  3FZ4 A;  2O7K A;  3GKN A;  2E0Q A;  1GUM A;  2GQM A;  1F6M C;  1HNA A;  4XRD A;  2YJH A;  4LL4 B;  4IP6 A;  2C0D A;  4DSS A;  1XW6 A;  1OE7 A;  4TKY A;  4KDY A;  3GH9 A;  2LQO A;  3P7X A;  1PL2 A;  2L57 A;  4ISD A;  2RM5 A;  1BQ7 A;  4RI7 A;  2OBK A;  4ILF A;  1XBS A;  1VGL A;  4Q5Q A;  3ERW A;  2VL2 C;  4I8B A;  3TKP A;  3TDG A;  2WCI A;  4I5Q A;  2YN1 A;  3F8U A;  1X5D A;  1XPV A;  3IK9 A;  2VUP A;  4F0B A;  2ALB A;  1XCC A;  1EWX A;  3BOA A;  2DIY A;  3LFL A;  5KN0 A;  2H6X A;  3TCO A;  3TGZ A;  2YAN A;  4NXI A;  3WGX A;  4GST A;  2A4V A;  2AJQ B;  3C1S A;  3G7I A;  5B8B A;  3Q19 A;  3HVS A;  1T1V A;  5IMZ A;  4G2E A;  2C3Q A;  3KJY A;  1USB A;  3GA4 A;  3DGQ A;  4AJ7 A;  4E8E A;  3FR6 A;  4JU5 A;  2R37 A;  3VUR A;  1GSU A;  3P2A A;  3ERF A;  1F3A A;  5ELA A;  2HT9 A;  4HZ2 A;  4O32 A;  4EDZ A;  4IHU A;  1TOF A;  4QL9 A;  3ZVJ D;  1M9A A;  2FLS A;  4TN8 A;  3VI5 A;  5IM9 A;  5ECL B;  3N9J A;  3TJG A;  5AN1 A;  4JR4 A;  2IMF A;  5CP1 A;  3A2V A;  1XWG A;  1M7T A;  2CAI A;  3GTU A;  1ZOF A;  2MBS A;  2PVQ A;  3ZVJ A;  2M80 A;  3UBK A;  3DEX A;  3TKS A;  2RUF A;  4N0V A;  1W89 A;  2ON7 A;  4GSS A;  1T8E B;  3H4K A;  5G30 A;  2REM A;  5KEJ A;  2OKA A;  4G19 A;  1ERU A;  2H1D A;  3KMO A;  4TXO A;  1I5G A;  3VWW A;  5JCW A;  2V6O A;  4V2L A;  3DD3 A;  1GRX A;  2H6Y A;  2MMO A;  2B3S A;  2VAF A;  4PQH A;  5LD0 A;  3ZIV A;  1E6B A;  2V41 A;  1M99 A;  4NPB A;  3MDK A;  3GX8 A;  5DAL B;  2JSZ A;  1TU7 A;  1EGO A;  1Y6E A;  2LRT A;  3HYP A;  1Y25 A;  4F03 A;  4I97 A;  4ZXG A;  1ZZY A;  2FA4 A;  6GSS A;  2DJ2 A;  1UC7 A;  3V1W A;  4XTS A;  2LNS A;  5IMA A;  5A4U A;  8GSS A;  2BMX A;  2V32 A;  4ZBD A;  5B6N A;  1N2A A;  3LYP A;  3FHK A;  4N11 A;  1TRS A;  1WOU A;  5GZZ B;  2I4A A;  5DAL A;  1PN9 A;  2YV7 A;  1EEJ A;  3GRX A;  4BVY A;  4EL1 A;  1JFU A;  3H1N A;  2F3M A;  2WFC A;  11GS A;  4IBP A;  3EWL A;  1WPI A;  3ZIT A;  2X8C A;  4HDE A;  2H19 A;  2FHE A;  3EE2 A;  2H73 A;  4TOP A;  2HSH A;  2FWH A;  4TVE A;  3GHA A;  1O73 A;  1PMT A;  2HZF A;  4K7N A;  3VLN A;  2XBI A;  1SK0 A;  1ZCP A;  3EYT A;  1OKT A;  4HZ4 A;  3ERG A;  4WBR D;  2CVK A;  3EIN A;  5G5F A;  3LG6 A;  3DYR A;  5GAN D;  2QGV A;  1DBY A;  5HR3 A;  2FGX A;  20GS A;  4TRX A;  1X9M B;  1AAZ A;  4K6X A;  3BBY A;  4IN0 A;  2QC7 A;  2L59 A;  2H01 A;  5DBQ A;  4MLY A;  4L0U A;  1NHY A;  3EUR A;  2DJJ A;  2C3T A;  2CVB A;  4O5R A;  1AUC A;  5L71 A;  4BPY A;  2K9F A;  1U6T A;  1O8W A;  4HEA 2;  4O7H A;  4L8E A;  2WJU A;  6GSW A;  3K8N A;  2IWT A;  2VD1 A;  3DXB A;  4WEY A;  3G7Y A;  1BJX A;  4X1U A;  4K2D A;  2PMT A;  2X8H A;  3ZFB A;  4QL7 A;  3VPQ A;  1JZR A;  2WZ9 A;  3TKS C;  3IK7 A;  3QAW A;  3TKR A;  1IYH A;  3OR5 A;  1ZYE A;  1AQV A;  5JWQ B;  1WP0 A;  4ULX A;  2L5O A;  1K0O A;  1GL8 A;  1OE8 A;  3A2X A;  5CRG A;  3NIV A;  1UA5 A;  4XIH A;  5DCG A;  3ZIJ A;  5AIV A;  5ID2 A;  4ECC A;  1JLV A;  2VD0 A;  1A0R P;  1NHO A;  4PGT A;  3TKS E;  3FYG A;  3D21 A;  2YWM A;  4CDO A;  3CTG A;  3O3T A;  5FHI A;  1TK0 B;  1PKW A;  1TI3 A;  4ML1 A;  4OCE A;  4JZQ A;  4K9Z A;  3EMP A;  3F4R A;  1GTA A;  2JAD A;  3C71 A;  3UOM A;  2PN8 A;  1TRU A;  5KN2 A;  3ME8 A;  2JL4 A;  1TK8 B;  1VF3 A;  1YEP A;  2KLX A;  5B8A A;  2GST A;  3L9U A;  1KTE A;  3GX0 A;  3F63 A;  1YEX A;  5EL8 A;  1BED A;  4MMM A;  1E2Y A;  4KDX A;  4XS1 A;  2K6V A;  3LJR A;  3LQ7 A;  1R5P A;  5ECM B;  3IHQ A;  1UN2 A;  2EIQ A;  1R7H A;  4EE0 A;  3L78 A;  5B6M A;  1EV4 A;  2DLX A;  4KH7 A;  2FWG A;  4EC0 A;  2R3X A;  2VCQ A;  5AGY A;  1GTI A;  1AIU A;  3UAR A;  1N8J A;  3SWL A;  2C1Y A;  4RUV A;  1WMJ A;  5F05 A;  2GZY A;  1T3B A;  3M9J A;  5D9V A;  4G10 A;  1AXD A;  2B5X A;  4KUN A;  4GWR A;  3HCZ A;  3Q18 A;  2J23 A;  2H76 A;  3MNG A;  2HLS A;  3HJP A;  4BWQ A;  5FT3 A;  4MF7 A;  2IFQ B;  4PUR A;  3HXS A;  4DVC A;  4FO5 A;  1YF0 A;  2B1L A;  3NZN A;  4NWY A;  2RUE A;  5FWG A;  3RDW A;  3D4T A;  2JSY A;  1FO5 A;  3TUE A;  3GSS A;  1PL1 A;  4IQ1 A;  2H72 A;  2GQL A;  1A8L A;  2RII A;  2G2Q A;  2R2J A;  2I1U A;  3HKR A;  1PD2 1;  3CMI A;  5HFI A;  2IFQ A;  5GAP D;  2IPA A;  3CSH A;  1SK1 A;  4EKZ A;  2C4J A;  4AJ8 A;  2AAW A;  3QOU A;  2YWN A;  5B7C A;  3VWV A;  4GF0 A;  3DKS A;  1JHB A;  2LRC A;  4AJ6 A;  4IJI A;  5DJM A;  1PGT A;  1GUL A;  1GH2 A;  5DQS A;  3WGE A;  2EIR A;  1YY7 A;  3FY7 A;  5D9X A;  1K0D A;  1TTZ A;  1F37 A;  3UMA A;  2XC2 A;  4IS0 A;  1U3A A;  2B5E A;  2N5A A;  2GT5 A;  5J4U A;  3QPM A;  5IOW A;  1OC3 A;  4OFN A;  2CA8 A;  2LJA A;  5J9B A;  1XWC A;  3RHC A;  3GV1 A;  5J41 A;  4PX1 A;  5EVO A;  2X64 A;  1ST9 A;  3EVI A;  3RPN A;  3J7Y b;  4ZL8 A;  4PXO A;  5ECQ B;  4MDC A;  3W8J A;  2AHE A;  3ZRD A;  2LEG A;  2B1K A;  1IYI A;  5E4W A;  3GN3 A;  2DJ3 A;  4O92 A;  19GS A;  2VCZ A;  5CNW A;  3CBU A;  1M9B A;  4GQC A;  5HFK A;  2A2S A;  4KDU A;  4JE1 A;  4YAV A;  2GTU A;  5COH A;  1V9W A;  4KND A;  5H5Q A;  3FZA A;  2YV9 A;  3C1R A;  4MH3 A;  12GS A;  3E0U A;  1KNG A;  3IAM 2;  2WGR A;  3IA1 A;  4KCA A;  4PUF C;  1MTC A;  3WT1 A;  4L5L A;  1GTB A;  5G31 A;  3KM6 A;  1EEM A;  4KGI A;  2WB9 A;  1T4Y A;  2NTO A;  5H5R A;  3TKQ A;  1CQH A;  1QGV A;  5F8B A;  1HNB A;  4IEL A;  3M3M A;  1TI1 A;  2F8F A;  3UAP A;  1FOV A;  2GVP A;  3H79 A;  1SL2 B;  1G6W A;  3CSJ A;  1ON4 A;  1Q98 A;  1AC1 A;  3Q6O A;  2GDR A;  3IOS A;  4NV2 A;  16GS A;  2VCT A;  4MJB A;  1SK2 A;  2VL3 A;  2VL9 A;  3FZ9 A;  1DSB A;  3AY8 A;  5C04 A;  3IV4 A;  2IMD A;  2OE3 A;  3QCP A;  4F9Z A;  4OCF A;  2HZE B;  2BTO T;  2ZCT A;  3VK9 A;  4WF5 A;  1QUW A;  1ACV A;  4OO5 A;  3GL5 A;  3RBT A;  2KP2 A;  4GCI A;  5EY6 A;  3P8W A;  3TOU A;  3KTB A;  1S3D A;  3GH6 A;  1TDI A;  4MP4 A;  3GKK A;  4NMU A;  1QQ2 A;  1C72 A;  1EP7 A;  1K3O A;  2OJL A;  5D73 A;  3D0Z A;  4POM A;  1B4P A;  2H75 A;  4FYB A;  1RK4 A;  5HQP A;  2VOC A;  3US3 A;  1Z5Y E;  4NHZ A;  2HZE A;  1LU4 A;  3E9J B;  1HYU A;  2AV4 A;  3IPZ A;  4K7O A;  2ON5 A;  1TRW A;  4L0W A;  2WRT A;  1TXX A;  4MZB A;  1PX6 A;  2VCX A;  5GST A;  3QR6 A;  1PSQ A;  3TJB A;  2DMM A;  3GYK A;  4QQ7 A;  5A4V A;  1XW5 A;  4J56 E;  3QFB C;  9GSS A;  3PH9 A;  1GWC A;  2H8L A;  4TR0 A;  1O8X A;  4Q5R A;  2LST A;  1RQM A;  4J2F A;  2LTK A;  3A3T A;  2YZH A;  4JBB A;  4PQ1 A;  3SBC A;  4RQR A;  4WF4 A;  4F2I A;  4POB A;  3D4M A;  5G1K A;  1R5A A;  5AIX A;  1I9D A;  4ECJ A;  4P3Y B;  2C0G A;  3GKX A;  4MJC A;  2YPM A;  4BWS A;  2L6C A;  3HZ4 A;  3CYN A;  5ECR B;  2KHP A;  3APS A;  3J7Y k;  2C0F A;  2IMK A;  3BCI A;  3LXZ A;  4KSO A;  4WXT A;  4HUA A;  14GS A;  3QFA C;  4L5O A;  4ZL9 A;  3MSZ A;  4IGJ A;  3IBH A;  2YJ7 A;  1HQO A;  5DCH A;  1SD9 A;  3RPP A;  1V2A A;  5CYY A;  4MZC A;  5E59 A;  3CRU A;  4MJE A;  4MCU A;  1Z7R A;  5J9C A;  2QKE A;  1GSS A;  1K0N A;  4RQX A;  4EDY A;  2O8V B;  17GS A;  1BG5 A;  3DWV A;  3L9S A;  1OYJ A;  1U3I A;  4FH8 A;  2KP1 A;  4K0N A;  2QSI A;  1PA3 A;  1OC8 A;  2NPB A;  1U88 A;  2AUV A;  1WWJ A;  1LBK A;  1GSY A;  2M72 A;  3HVX A;  4MF5 A;  3C8E A;  1T4Z A;  1SYR A;  1V58 A;  2VIM A;  4MF6 A;  5ENU A;  1B4Q A;  3GFK A;  3FR3 A;  1K3L A;  1ZL9 A;  3ISO A;  2DIZ A;  2GZP A;  4I2T A;  2K18 A;  2MBT A;  4IP1 A;  2KUC A;  5HFG A;  5ECK B;  4E8H A;  4WBJ A;  2LNT A;  4I2U A;  1A2M A;  4IJ3 A;  2KOK A;  3KTL A;  3WD6 A;  1Z3E A;  1LJR A;  4ML6 A;  1XXU A;  3C73 A;  4IQA A;  3F3R A;  1GNE A;  2LRN A;  5HR2 A;  2HYX A;  1AQW A;  2F9S A;  1TKD B;  3G9B A;  1XZO A;  5KN1 A;  3TJJ A;  5G1L A;  5CRD A;  1SEN A;  4KAE A;  1TJD A;  4TR4 A;  4XRA A;  4POK A;  2GZZ A;  2H70 A;  3DVX A;  1ERW A;  1UVZ A;  2P31 A;  2CZ3 A;  1WE0 A;  3ZL5 A;  1EV9 A;  2OAC A;  2FD3 A;  1MDJ A;  2P5Q A;  2OE0 A;  3R2Q A;  4WR4 A;  2LKU A;  4V2N A;  4Q5F A;  5ECO B;  2EC4 A;  1DE2 A;  1X9W B;  2H66 A;  2LJR A;  2X99 A;  4ZB8 A;  5IMF A;  4IW9 A;  2GS3 A;  5A4W A;  1FAA A;  3GST A;  2VM2 A;  1WJK A;  3D5J A;  4PUA A;  5EPF A;  4XHM A;  3KP9 A;  3GKM A;  2CQ9 A;  2PBJ A;  2HI7 A;  4V2M A;  3LSZ A;  2A2R A;  5HR1 A;  2CAQ A;  5CRH A;  4OFM A;  3S9F A;  4EXJ A;  4XS4 B;  1EOG A;  2I81 A;  4LMW A;  2VLU A;  4DSR A;  2CV4 A;  2TRX A;  1MDI A;  1K3Y A;  2O89 A;  3DML A;  2Z9S A;  5IO0 A;  4JRR A;  3MAK A;  1GSE A;  1SKR B;  5HR0 A;  3JCM L;  1JZO A;  1WIK A;  4PQI A;  2I9H A;  1ZMA A;  1QFN A;  2FY6 A;  3F4S A;  4WET A;  4XS4 A;  1XOB A;  5JCU A;  5D96 A;  3UBL A;  4PNF A;  3GUS A;  2DJK A;  5DDL A;  1OKD A;  3KXO A;  4ID0 A;  3PGT A;  2M46 A;  5IPG A;  10GS A;  4PNG A;  5A5K A;  3TB2 A;  1K0B A;  5DVB A;  1BYE A;  3ZZX A;  4MH2 A;  2G0F A;  1THX A;  3UL3 A;  2YWI A;  2H1G A;  5IO2 A;  4IKH A;  5J5N A;  1KEB A;  1SJ6 A;  3UEM A;  2VLV A;  2L4Q A;  4EF0 A;  1G7E A;  1SJI A;  4ZIL A;  1TU8 A;  5D93 A;  6GSU A;  4TR1 B;  1EP8 A;  2BJX A;  1XWA A;  1GUH A;  4BL7 A;  2PVO C;  2YWO A;  1O81 A;  2HRN A;  3IE3 A;  4YQU A;  1FG4 A;  2RM6 A;  2EIO A;  1OVN A;  4GXZ A;  3BJ5 A;  3A2W A;  5CO3 A;  5G2Z A;  2XBQ A;  5LNK e;  1NM3 A;  4H86 A;  2C0E A;  1XIY A;  3APQ A;  4BA7 A;  2LJK A;  2H0I A;  3EU4 A;  3DIE A;  1YF1 A;  1JZW A;  4TR1 A;  4KE3 A;  1ABA A;  1X5C A;  3FRC A;  5CAX A;  4CHS A;  2AB6 A;  2XPD A;  3QD9 A;  3HJO A;  2PU9 C;  2C3N A;  2V2G A;  3O76 A;  3WGD A;  2VLT A;  4ZB9 A;  4IVF A;  5J3R A;  1ML6 A;  3M0F A;  1S3C A;  2DC5 A;  1G0T A;  1NSW A;  4AGS A;  2V6K A;  3IRA A;  5IOX A;  3PIN A;  4JR6 A;  2GQK A;  4ZBB A;  4LMV A;  3I9V 2;  2I3Y A;  2CZ2 A;  4POL A;  4DSS B;  1A23 A;  3D22 A;  1SJZ A;  3D6I A;  1ZYQ B;  4ACS A;  5DJL A;  4FYU A;  5DQY A;  3KZQ A;  2CX3 A;  1GUK A;  1KBN A;  1PQN A;  3G7J A;  1OC9 B;  5F07 A;  3IAS 2;  2H71 A;  1FHE A;  3BD2 A;  3FEU A;  4WR5 A;  2YNX A;  5JCG A;  1VRS D;  1B48 A;  3H8Q A;  4BVX A;  2ZUP A;  2LV3 A;  3UJ1 A;  6GSX A;  5IIZ A;  1MDK A;  1X5E A;  2C80 A;  1EOH A;  2HRF A;  1Z6N A;  5IMD A;  2FA8 A;  4MA9 A;  1OC9 A;  2PWJ A;  3PR8 A;  3VWX A;  2E2M A;  1M0U A;  2HE3 A;  1H75 A;  4ECB A;  2YP6 A;  4ZB6 A;  2CX4 A;  4OFT A;  4HS1 A;  4G9H A;  3DRN A;  2GSS A;  3LEF A;  4HJ2 A;  2NBS A;  1Z6M A;  1X9S B;  2AYT A;  2P0G A;  2XHF A;  2ZNM A;  1R26 A;  3QDN A;  2ES7 A;  3ZLP A;  5G5E A;  1SYX A;  4XS6 A;  3HDC A;  1K0M A;  2O85 A;  1GSQ A;  1JLW A;  2WS2 A;  2F51 A;  1T00 A;  2O87 A;  1FW1 A;  3UVT A;  5ECI B;  3KCM A;  3GTU B;  3F4T A;  5ABR A;  4GRF A;  3ME7 A;  4MAB A;  4YQM A;  1GTU A;  1YKC A;  2B7K A;  5ECN B;  3F6D A;  4N10 A;  2DJ1 A;  1VF1 A;  2PER A;  2H30 A;  3N5O A;  4X0X A;  3ZMK A;  4GTU A;  4HU9 A;  1GSF A;  5ECS A;  1PKZ A;  4XCS A;  4TXO B;  2YZU A;  2VCV A;  3L4N A;  2NDO A;  1YDK A;  2MMN A;  3F0I A;  3F6F A;  3C7M A;  3O6T A;  3I43 A;  1EZK A;  4K1F A;  3GUR A;  3ZYW A;  3HZ8 A;  3H93 A;  1M2D A;  3TRQ A;  2OBI A;  3NOF A;  5IMV A;  3W6G A;  3KGK A;  1SD8 A;  4Z7X A;  2IIY A;  4N0Z A;  5JWO B;  2IN3 A;  1OAZ A;  2YOI A;  3VWU A;  3ZFL A;  3VI7 A;  4MJA A;  1ERT A;  2C8U A;  4HU7 A;  2X8G A;  1RW1 A;  5D9T A;  4AF2 A;  3U5R E;  3QAG A;  1R4W A;  1B8X A;  1YZX A;  4HJM A;  2JAC A;  1X0R A;  2GGT A;  2VCW A;  2N5B A;  1V98 A;  3ED3 A;  4ZIJ A;  3GL3 A;  3M8N A;  3BCK A;  3VFI A;  3FKF A;  1M2B A;  2FWF A;  1SU9 A;  2JZT A;  2L4C A;  3GIX A;  4I6X A;  5AIS A;  2LUS A;  1O6J A;  4LL1 B;  3HJM A;  1XFL A;  5ELG A;  1SL1 B;  2OA7 A;  2VM1 A;  2CT6 A;  2MZC A;  2H0G A;  1NW2 A;  3FK8 A;  3I6A A;  3HVV A;  5ECP B;  1XVW A;  4NAX A;  5IPH A;  2JZR A;  3UIW A;  2J9H A;  5KN3 A;  3L0H A;  4JED A;  1O85 A;  4ZBA A;  4DSQ A;  4MK3 A;  3QMX A;  1Z7P A;  2FUG 2;  1F3B A;  3CSI A;  3TRP A;  1GSD A;  4V1A p;  1THO A;  4J57 E;  4KCE A;  2F8A A;  1FB0 A;  4GLT A;  3KP8 A;  1J0F A;  1MD3 A;  3LWA A;  4FIW A;  3TJK A;  4DEJ A;  4NV5 A;  4KX4 A;  1EGR A;  1GNW A;  1TP9 A;  3F3Q A;  1ERV A;  2LS5 A;  3WT2 A;  1GP1 A;  5H5S A;  1PRX A;  3HD5 A;  2WDU A;  2PGT A;  2JU5 A;  2B5Y A;  3VPT A;  4MPG A;  2R5G A;  5ID2 B;  2TIR A;  1V57 A;  4HQZ A;  1K0C A;  1Q4J A;  2H1A A;  2IME A;  1U87 A;  1G7O A;  4ZL7 A;  4EUY A;  5CRW A;  2JZS A;  2CVD A;  1ILO A;  1TK5 B;  2MYG A;  1YKA A;  4CW9 A;  3GMF A;  4LA1 A;  2HFD A;  1BX9 A;  2GT6 A;  4HI7 A;  4HQS A;  2FCH A;  2L5L A;  4KB3 A;  6GSV A;  22GS A;  6GST A;  1TRV A;  1A2J A;  4WKW A;  3DVW A;  5INY A;  4K7I A;  5LCZ A;  1PX7 A;  2OAD A;  2VO4 A;  2YCD A;  5D8I A;  1XWK A;  3FZ5 A;  1A2L A;  1VF4 A;  4YQV A;  1G6Y A;  2WUL A;  3Q74 A;  3TJF A;  4NHW A;  3IC4 A;  3MWH A;  2TRC P;  5CRE A;  1SKW B;  1A8Y A;  3TRX A;  2K8S A;  4D73 B;  1S3A A;  2K8V A;  2FNO A;  3ZRE A;  4K8M A;  3E3E A;  1F2E A;  5DAK B;  3KEB A;  18GS A;  1B9Y C;  3LGC A;  6GSY A;  2PPT A;  1HD2 A;  5GSS A;  3HA9 A;  2IJY A;  3CTF A;  3KIJ A;  1YQ1 A;  2E7P A;  4EO3 A;  5IMC A;  3RAZ A;  4TXV A;  1K0A A; 
#chains in the Genus database with same CATH topology
 1YJ6 A;  1FVJ A;  2MMZ A;  3ZTL A;  4D73 A;  4LLR A;  3M1G A;  2HRK A;  4OWY A;  1J08 A;  3A5W A;  1O7U A;  4O5U A;  3CQF A;  2B7J A;  1FB6 A;  5DAK A;  2H74 A;  5IQY A;  2DML A;  3LXT A;  2N5F A;  1DE1 A;  3KMN A;  2P5R A;  4FYC A;  2VL2 A;  2OE1 A;  2RLI A;  1T7P B;  4TW5 A;  2DBC A;  1FVK A;  3P90 A;  2HNL A;  4X43 A;  2HSY A;  1HNC A;  1A0F A;  2D2Z A;  5F06 A;  2H0H A;  4EVM A;  4ECI A;  1Z9H A;  3EC3 A;  5D9W A;  5F0G A;  4TR3 A;  4F0C A;  1QMV A;  5ECH B;  1CQG A;  2IL3 A;  2L6D A;  3KD0 A;  2FWE A;  3W8S A;  3LOR A;  1URM A;  3CRT A;  1WRY A;  2R4V A;  4MZW A;  2DSA A;  2LQQ A;  3FR9 A;  4KSM A;  1A24 A;  4K0G A;  3UVH A;  1QXH A;  2R6K A;  3IDV A;  1GLP A;  3IXR A;  2PUK C;  1V40 A;  3M9K A;  13GS A;  1DUG A;  1VF2 A;  3WYW A;  4YAP A;  4OO4 A;  1J9B A;  1F9M A;  3QAV A;  1XVQ A;  3KH7 A;  2NVL A;  2V1M A;  2H6Z A;  4GQF A;  1BAY A;  4MPF A;  3HY2 A;  1AW9 A;  1QK8 A;  1MD4 A;  5JWR B;  3GNJ A;  3IR4 A;  4GSN A;  4OMV A;  4YH2 A;  2E2G A;  1SKS B;  4OD7 A;  1JZD A;  2A4H A;  3FW2 A;  4O5Q A;  3LYK A;  2GLR A;  1H4O A;  1M2A A;  3RHB A;  7GSS A;  1SL0 B;  1XWB A;  4F82 A;  1B9X C;  3APO A;  1ZGN A;  1TW9 A;  4KW6 A;  2GSQ A;  2IMI A;  1AQX A;  4RI6 A;  1GLQ A;  3EU3 A;  4N30 A;  1MEK A;  2HXK A;  3KH9 A;  2XPE A;  5C00 A;  4V1A g;  3ZML A;  4HOJ A;  3U6V A;  2DJ0 A;  3CXG A;  3EMX A;  2H1B A;  2GSR A;  1XW9 A;  2MMA A;  4KA0 A;  3HVN A;  2B6M A;  3I69 A;  3TOT A;  1XOA A;  3F9U A;  3HHV A;  1W4V A;  3L9V A;  4Q5N A;  3FZ4 A;  2O7K A;  3GKN A;  2E0Q A;  1GUM A;  2GQM A;  1F6M C;  1HNA A;  4XRD A;  4EIQ A;  2YJH A;  4LL4 B;  4IP6 A;  2C0D A;  4DSS A;  1XW6 A;  1OE7 A;  4TKY A;  4KDY A;  3GH9 A;  2LQO A;  3P7X A;  1PL2 A;  2L57 A;  4ISD A;  2RM5 A;  1BQ7 A;  4RI7 A;  2OBK A;  4ILF A;  1XBS A;  1VGL A;  4Q5Q A;  3ERW A;  2VL2 C;  4I8B A;  3TKP A;  3TDG A;  2WCI A;  4I5Q A;  2QA2 A;  2YN1 A;  3F8U A;  1X5D A;  1XPV A;  3IK9 A;  2VUP A;  4F0B A;  2ALB A;  1XCC A;  1EWX A;  3BOA A;  2DIY A;  3LFL A;  5KN0 A;  2H6X A;  3TCO A;  3TGZ A;  2YAN A;  4NXI A;  3WGX A;  4GST A;  2A4V A;  2AJQ B;  3C1S A;  3G7I A;  5B8B A;  3Q19 A;  2DKI A;  1T1V A;  3HVS A;  5IMZ A;  4G2E A;  2C3Q A;  3KJY A;  1USB A;  3GA4 A;  3DGQ A;  4AJ7 A;  4E8E A;  3FR6 A;  4JU5 A;  2R37 A;  3VUR A;  1GSU A;  3P2A A;  3ERF A;  1F3A A;  5ELA A;  3IHG A;  2HT9 A;  4HZ2 A;  4O32 A;  3IC8 A;  4EDZ A;  4IHU A;  1TOF A;  4QL9 A;  3ZVJ D;  1M9A A;  2FLS A;  4TN8 A;  3VI5 A;  5IM9 A;  5ECL B;  3N9J A;  3TJG A;  5AN1 A;  4JR4 A;  2IMF A;  5CP1 A;  3A2V A;  1XWG A;  1M7T A;  2CAI A;  3GTU A;  5BRT A;  1ZOF A;  2MBS A;  2PVQ A;  3ZVJ A;  2M80 A;  3UBK A;  3DEX A;  3TKS A;  2RUF A;  4N0V A;  1W89 A;  2ON7 A;  4GSS A;  1T8E B;  3H4K A;  5G30 A;  2REM A;  5KEJ A;  2OKA A;  4G19 A;  1ERU A;  2H1D A;  3KMO A;  4TXO A;  1I5G A;  3VWW A;  5JCW A;  2V6O A;  2X49 A;  4V2L A;  3DD3 A;  1GRX A;  2H6Y A;  2MMO A;  2B3S A;  2VAF A;  4PQH A;  5LD0 A;  3ZIV A;  1E6B A;  2V41 A;  1M99 A;  4NPB A;  3MDK A;  3GX8 A;  5DAL B;  2JSZ A;  1TU7 A;  1EGO A;  1Y6E A;  2LRT A;  3HYP A;  1Y25 A;  4BVY B;  4F03 A;  4I97 A;  4ZXG A;  1ZZY A;  2FA4 A;  6GSS A;  2DJ2 A;  1UC7 A;  3V1W A;  4XTS A;  2LNS A;  5IMA A;  5A4U A;  8GSS A;  2BMX A;  2V32 A;  4ZBD A;  5B6N A;  1N2A A;  3LYP A;  3FHK A;  4N11 A;  1TRS A;  1WOU A;  2X4A A;  5GZZ B;  2I4A A;  5DAL A;  1PN9 A;  2YV7 A;  1EEJ A;  3GRX A;  4BVY A;  4EL1 A;  1JFU A;  3H1N A;  2F3M A;  2WFC A;  11GS A;  4IBP A;  3EWL A;  1WPI A;  3ZIT A;  2X8C A;  4HDE A;  2H19 A;  2FHE A;  3EE2 A;  2H73 A;  4TOP A;  2HSH A;  2FWH A;  4TVE A;  3GHA A;  1O73 A;  1PMT A;  2HZF A;  4K7N A;  4CY6 A;  3VLN A;  2XBI A;  1SK0 A;  1ZCP A;  3EYT A;  1OKT A;  4HZ4 A;  3ERG A;  4WBR D;  2CVK A;  3EIN A;  5G5F A;  3LG6 A;  3DYR A;  5GAN D;  2QGV A;  1DBY A;  5HR3 A;  2FGX A;  20GS A;  4TRX A;  1X9M B;  1AAZ A;  4K6X A;  3BBY A;  4IN0 A;  4K2X A;  2QC7 A;  2L59 A;  2H01 A;  5DBQ A;  4MLY A;  4L0U A;  1NHY A;  3EUR A;  2DJJ A;  2C3T A;  2CVB A;  4O5R A;  1AUC A;  5L71 A;  4BPY A;  2K9F A;  1U6T A;  2HRA A;  1O8W A;  4HEA 2;  4O7H A;  4L8E A;  2WJU A;  6GSW A;  3K8N A;  2IWT A;  2VD1 A;  3DXB A;  4WEY A;  3G7Y A;  1XG8 A;  1BJX A;  4X1U A;  4K2D A;  2PMT A;  2X8H A;  3ZFB A;  4QL7 A;  3VPQ A;  1JZR A;  2WZ9 A;  3TKS C;  3IK7 A;  3QAW A;  3TKR A;  1IYH A;  3OR5 A;  1ZYE A;  1AQV A;  5JWQ B;  1WP0 A;  4ULX A;  2L5O A;  1K0O A;  1GL8 A;  1OE8 A;  3A2X A;  5CRG A;  3NIV A;  1UA5 A;  4XIH A;  5DCG A;  3ZIJ A;  5AIV A;  5ID2 A;  4ECC A;  1JLV A;  2VD0 A;  1A0R P;  1NHO A;  4PGT A;  3TKS E;  3FYG A;  3D21 A;  2YWM A;  4CDO A;  3CTG A;  3O3T A;  5FHI A;  1TK0 B;  1PKW A;  1TI3 A;  4A5P A;  4ML1 A;  4OCE A;  4JZQ A;  4K9Z A;  3EMP A;  3F4R A;  1GTA A;  2JAD A;  3C71 A;  3UOM A;  2PN8 A;  4KF9 A;  1TRU A;  5KN2 A;  3ME8 A;  5KOX A;  2JL4 A;  1TK8 B;  1VF3 A;  1YEP A;  2KLX A;  5B8A A;  2GST A;  3L9U A;  1KTE A;  3GX0 A;  3F63 A;  1YEX A;  5EL8 A;  1BED A;  4MMM A;  1E2Y A;  4KDX A;  4XS1 A;  2K6V A;  3LJR A;  3LQ7 A;  1R5P A;  5ECM B;  3IHQ A;  3LW9 A;  1UN2 A;  2EIQ A;  1R7H A;  4EE0 A;  3L78 A;  5B6M A;  1EV4 A;  2DLX A;  4KH7 A;  2FWG A;  4EC0 A;  2R3X A;  2VCQ A;  5AGY A;  1GTI A;  1AIU A;  3UAR A;  1N8J A;  3SWL A;  4G0I A;  2C1Y A;  4RUV A;  1WMJ A;  5F05 A;  2GZY A;  1T3B A;  3M9J A;  5D9V A;  4G10 A;  1AXD A;  2B5X A;  4KUN A;  4GWR A;  3HCZ A;  3Q18 A;  2J23 A;  2H76 A;  3MNG A;  2HLS A;  3HJP A;  4BWQ A;  5FT3 A;  4MF7 A;  2IFQ B;  4PUR A;  3HXS A;  4DVC A;  4FO5 A;  1YF0 A;  2B1L A;  3NZN A;  4NWY A;  2RUE A;  5FWG A;  3RDW A;  3D4T A;  2JSY A;  1FO5 A;  4BL7 B;  3TUE A;  3GSS A;  1PL1 A;  4IQ1 A;  2H72 A;  2GQL A;  1A8L A;  2RII A;  2G2Q A;  2R2J A;  2I1U A;  3HKR A;  1PD2 1;  3CMI A;  5HFI A;  4Z2T A;  2IFQ A;  5GAP D;  2IPA A;  3CSH A;  1SK1 A;  4EKZ A;  2C4J A;  4AJ8 A;  2AAW A;  3QOU A;  2YWN A;  5B7C A;  3VWV A;  4GF0 A;  3DKS A;  1JHB A;  2LRC A;  4AJ6 A;  4IJI A;  5DJM A;  1PGT A;  1GUL A;  1GH2 A;  5DQS A;  3WGE A;  2EIR A;  1YY7 A;  3FY7 A;  5D9X A;  1K0D A;  1TTZ A;  1F37 A;  3UMA A;  2XC2 A;  4IS0 A;  1U3A A;  2B5E A;  2N5A A;  2GT5 A;  5J4U A;  3QPM A;  5IOW A;  1OC3 A;  4OFN A;  2CA8 A;  2LJA A;  5J9B A;  1XWC A;  2R0G A;  3RHC A;  3GV1 A;  5J41 A;  4PX1 A;  5EVO A;  2X64 A;  1ST9 A;  3EVI A;  3RPN A;  3J7Y b;  4ZL8 A;  4PXO A;  5ECQ B;  4MDC A;  3W8J A;  2AHE A;  3ZRD A;  2LEG A;  2B1K A;  1IYI A;  3FMW A;  5E4W A;  3GN3 A;  2DJ3 A;  4O92 A;  19GS A;  2VCZ A;  2UZ8 A;  5CNW A;  3CBU A;  1M9B A;  4GQC A;  5HFK A;  2A2S A;  4KDU A;  4JE1 A;  4YAV A;  2GTU A;  4BVX B;  5COH A;  1V9W A;  4KND A;  5H5Q A;  3FZA A;  4CY8 A;  2YV9 A;  4FQU A;  3C1R A;  4MH3 A;  12GS A;  3E0U A;  1KNG A;  3IAM 2;  2WGR A;  3IA1 A;  4KCA A;  4PUF C;  1MTC A;  3WT1 A;  4L5L A;  1GTB A;  5G31 A;  3KM6 A;  1EEM A;  1PN0 A;  4KGI A;  2WB9 A;  1T4Y A;  2NTO A;  4G0K A;  5H5R A;  3TKQ A;  1CQH A;  1QGV A;  5F8B A;  1HNB A;  4IEL A;  3M3M A;  1TI1 A;  2F8F A;  3UAP A;  1FOV A;  2GVP A;  3H79 A;  1SL2 B;  1G6W A;  3CSJ A;  1ON4 A;  1Q98 A;  1AC1 A;  3Q6O A;  2GDR A;  3IOS A;  4NV2 A;  16GS A;  2VCT A;  4MJB A;  1SK2 A;  2VL3 A;  2VL9 A;  3FZ9 A;  1DSB A;  3AY8 A;  5C04 A;  3IV4 A;  2IMD A;  2OE3 A;  3A5I A;  3QCP A;  4F9Z A;  4OCF A;  2HZE B;  2BTO T;  2ZCT A;  3VK9 A;  4WF5 A;  1QUW A;  1ACV A;  4OO5 A;  3GL5 A;  3RBT A;  2KP2 A;  4GCI A;  5EY6 A;  3P8W A;  3TOU A;  3KTB A;  1S3D A;  3GH6 A;  1TDI A;  4MP4 A;  3GKK A;  4NMU A;  1QQ2 A;  1C72 A;  1EP7 A;  1K3O A;  2OJL A;  5D73 A;  3D0Z A;  4POM A;  1B4P A;  2H75 A;  4FYB A;  1RK4 A;  5HQP A;  2VOC A;  4Z2R A;  3US3 A;  1Z5Y E;  4NHZ A;  2HZE A;  1LU4 A;  3E9J B;  3MIX A;  1HYU A;  2AV4 A;  3IPZ A;  4K7O A;  4MNN A;  2ON5 A;  1TRW A;  4L0W A;  2WRT A;  1TXX A;  4MZB A;  1PX6 A;  2VCX A;  5GST A;  3QR6 A;  1PSQ A;  3TJB A;  2DMM A;  3GYK A;  4QQ7 A;  5A4V A;  1XW5 A;  4J56 E;  3QFB C;  9GSS A;  3PH9 A;  1GWC A;  3MYD A;  2H8L A;  4TR0 A;  1O8X A;  4Q5R A;  2LST A;  1RQM A;  4J2F A;  2LTK A;  3A3T A;  2YZH A;  4JBB A;  4PQ1 A;  3SBC A;  4RQR A;  4K5R A;  4WF4 A;  4F2I A;  4POB A;  3D4M A;  5G1K A;  1R5A A;  5AIX A;  1I9D A;  4ECJ A;  4P3Y B;  2C0G A;  3GKX A;  4MJC A;  2YPM A;  4BWS A;  2L6C A;  3HZ4 A;  3CYN A;  5ECR B;  2KHP A;  3APS A;  3J7Y k;  2C0F A;  2IMK A;  3BCI A;  3LXZ A;  4KSO A;  4WXT A;  4HUA A;  14GS A;  3QFA C;  4L5O A;  4ZL9 A;  3MSZ A;  4IGJ A;  3IBH A;  2YJ7 A;  1HQO A;  5DCH A;  1SD9 A;  3RPP A;  1V2A A;  5CYY A;  4MZC A;  1FOH A;  5E59 A;  3CRU A;  4MJE A;  4MCU A;  1Z7R A;  5J9C A;  1M3J A;  2QKE A;  1GSS A;  1K0N A;  4ICY A;  4RQX A;  4EDY A;  2O8V B;  17GS A;  1BG5 A;  4EIP A;  3DWV A;  3L9S A;  1OYJ A;  1U3I A;  4FH8 A;  2KP1 A;  4K0N A;  2QSI A;  1PA3 A;  1OC8 A;  2NPB A;  1U88 A;  2AUV A;  1WWJ A;  1LBK A;  1GSY A;  2M72 A;  3HVX A;  4MF5 A;  3C8E A;  1T4Z A;  1SYR A;  1V58 A;  4YKF A;  2R0P A;  2VIM A;  4MF6 A;  5ENU A;  1B4Q A;  3GFK A;  3FR3 A;  1K3L A;  1ZL9 A;  3ISO A;  2DIZ A;  2GZP A;  4I2T A;  2K18 A;  4YKG A;  2MBT A;  4IP1 A;  1PFO A;  2KUC A;  5HFG A;  5ECK B;  4E8H A;  4WBJ A;  2LNT A;  4I2U A;  1A2M A;  4IJ3 A;  2KOK A;  3KTL A;  3WD6 A;  1Z3E A;  1LJR A;  4ML6 A;  1XXU A;  3C73 A;  4IQA A;  1S3R A;  3F3R A;  1GNE A;  2LRN A;  5HR2 A;  2HYX A;  1AQW A;  2F9S A;  4HSC X;  1TKD B;  3G9B A;  1XZO A;  5KN1 A;  3TJJ A;  5G1L A;  5CRD A;  1SEN A;  4KAE A;  1TJD A;  4TR4 A;  4XRA A;  4POK A;  2GZZ A;  2H70 A;  3DVX A;  1ERW A;  1UVZ A;  2P31 A;  2CZ3 A;  1WE0 A;  3ZL5 A;  1EV9 A;  2OAC A;  2FD3 A;  2HSM A;  1MDJ A;  2P5Q A;  2OE0 A;  3R2Q A;  4WR4 A;  2LKU A;  4V2N A;  4Q5F A;  5ECO B;  2EC4 A;  1DE2 A;  1X9W B;  2H66 A;  2LJR A;  2X99 A;  4ZB8 A;  5IMF A;  4IW9 A;  2GS3 A;  5A4W A;  1FAA A;  3GST A;  2VM2 A;  1WJK A;  3D5J A;  4PUA A;  5EPF A;  4XHM A;  3KP9 A;  3GKM A;  2CQ9 A;  2PBJ A;  2HI7 A;  4V2M A;  3LSZ A;  2A2R A;  5HR1 A;  2CAQ A;  5CRH A;  4OFM A;  3S9F A;  4EXJ A;  4XS4 B;  1EOG A;  2I81 A;  4LMW A;  2VLU A;  4DSR A;  2CV4 A;  2TRX A;  1MDI A;  1K3Y A;  2O89 A;  3DML A;  2Z9S A;  5IO0 A;  4JRR A;  3MAK A;  1GSE A;  1SKR B;  5HR0 A;  3JCM L;  1JZO A;  1WIK A;  4PQI A;  2I9H A;  1ZMA A;  1QFN A;  2FY6 A;  3F4S A;  4WET A;  4XS4 A;  1XOB A;  5JCU A;  5D96 A;  3UBL A;  4PNF A;  3GUS A;  2DJK A;  5DDL A;  1OKD A;  3KXO A;  4ID0 A;  3PGT A;  2M46 A;  5IPG A;  10GS A;  4PNG A;  5A5K A;  3TB2 A;  1K0B A;  5DVB A;  1BYE A;  3ZZX A;  4MH2 A;  2G0F A;  1THX A;  3UL3 A;  2YWI A;  2H1G A;  5IO2 A;  4IKH A;  5J5N A;  1KEB A;  1SJ6 A;  3UEM A;  2VLV A;  4Z2U A;  2L4Q A;  4EF0 A;  1G7E A;  1SJI A;  4ZIL A;  1TU8 A;  5D93 A;  6GSU A;  4TR1 B;  1EP8 A;  2BJX A;  1XWA A;  1GUH A;  4BL7 A;  2PVO C;  2YWO A;  2A2P A;  1O81 A;  2HRN A;  3IE3 A;  4YQU A;  1FG4 A;  2RM6 A;  2EIO A;  1OVN A;  4GXZ A;  3BJ5 A;  3A2W A;  5CO3 A;  5G2Z A;  2XBQ A;  5LNK e;  1NM3 A;  4H86 A;  2C0E A;  1XIY A;  3APQ A;  4BA7 A;  2LJK A;  2H0I A;  3EU4 A;  3DIE A;  1YF1 A;  1JZW A;  4TR1 A;  4KE3 A;  1ABA A;  1X5C A;  3FRC A;  5CAX A;  4CHS A;  2AB6 A;  2XPD A;  3QD9 A;  3HJO A;  2PU9 C;  2C3N A;  2V2G A;  3O76 A;  3WGD A;  2VLT A;  4ZB9 A;  4IVF A;  5J3R A;  1ML6 A;  3M0F A;  1S3C A;  2DC5 A;  1G0T A;  1NSW A;  4AGS A;  2V6K A;  3IRA A;  5IOX A;  3PIN A;  4JR6 A;  2GQK A;  4ZBB A;  4LMV A;  3I9V 2;  2I3Y A;  1ZYN A;  2CZ2 A;  4POL A;  3EPT A;  4DSS B;  1A23 A;  3D22 A;  1SJZ A;  3D6I A;  1ZYQ B;  4ACS A;  5DJL A;  4FYU A;  5DQY A;  3KZQ A;  2CX3 A;  1GUK A;  1KBN A;  1PQN A;  3G7J A;  1OC9 B;  5F07 A;  3IAS 2;  2H71 A;  5KOW A;  1FHE A;  3BD2 A;  3FEU A;  4WR5 A;  2YNX A;  5JCG A;  1VRS D;  1B48 A;  3H8Q A;  4BVX A;  2ZUP A;  2LV3 A;  3UJ1 A;  6GSX A;  5IIZ A;  1MDK A;  1X5E A;  2C80 A;  1M3I A;  1EOH A;  2HRF A;  1Z6N A;  5IMD A;  2FA8 A;  4MA9 A;  1OC9 A;  2PWJ A;  3PR8 A;  3VWX A;  2E2M A;  1M0U A;  2HE3 A;  1H75 A;  4ECB A;  2YP6 A;  4ZB6 A;  2CX4 A;  4OFT A;  4HS1 A;  4G9H A;  3DRN A;  2GSS A;  3LEF A;  4HJ2 A;  2NBS A;  1Z6M A;  1X9S B;  2AYT A;  2P0G A;  2XHF A;  2ZNM A;  1R26 A;  3QDN A;  2ES7 A;  3ZLP A;  5G5E A;  1SYX A;  4XS6 A;  3HDC A;  1K0M A;  2O85 A;  1GSQ A;  1JLW A;  2WS2 A;  2F51 A;  1T00 A;  2O87 A;  1FW1 A;  3UVT A;  5ECI B;  3KCM A;  3GTU B;  3F4T A;  1ZYP A;  5ABR A;  4GRF A;  3ME7 A;  4MAB A;  4PTS A;  4YQM A;  1GTU A;  1YKC A;  2B7K A;  5ECN B;  3F6D A;  4N10 A;  2DJ1 A;  1VF1 A;  2PER A;  2H30 A;  3N5O A;  4X0X A;  3ZMK A;  4HU9 A;  4GTU A;  1GSF A;  5ECS A;  1PKZ A;  4XCS A;  4TXO B;  2YZU A;  2VCV A;  3L4N A;  2NDO A;  1YDK A;  2MMN A;  3F0I A;  3F6F A;  3C7M A;  3O6T A;  3I43 A;  1EZK A;  4K1F A;  3GUR A;  3ZYW A;  3HZ8 A;  3H93 A;  1M2D A;  3TRQ A;  2OBI A;  3NOF A;  5IMV A;  3W6G A;  3KGK A;  1SD8 A;  4Z7X A;  2IIY A;  4N0Z A;  5JWO B;  2IN3 A;  1OAZ A;  2YOI A;  3VWU A;  3ZFL A;  3VI7 A;  4MJA A;  1ERT A;  2C8U A;  4HU7 A;  2X8G A;  1RW1 A;  5D9T A;  4AF2 A;  3U5R E;  3QAG A;  1R4W A;  1B8X A;  1YZX A;  4HJM A;  2JAC A;  1X0R A;  2GGT A;  2VCW A;  2N5B A;  1V98 A;  3ED3 A;  4ZIJ A;  3GL3 A;  3M8N A;  3BCK A;  3VFI A;  3FKF A;  1M2B A;  2FWF A;  1SU9 A;  2JZT A;  2L4C A;  3GIX A;  3R3E A;  4I6X A;  5AIS A;  2LUS A;  1O6J A;  4LL1 B;  3HJM A;  1XFL A;  5ELG A;  1SL1 B;  2OA7 A;  2VM1 A;  5BMU A;  2CT6 A;  2MZC A;  2H0G A;  1NW2 A;  3FK8 A;  3I6A A;  3HVV A;  5ECP B;  1XVW A;  4NAX A;  5IPH A;  2JZR A;  3UIW A;  2J9H A;  5KN3 A;  3L0H A;  4JED A;  1O85 A;  4ZBA A;  4DSQ A;  4MK3 A;  3QMX A;  1Z7P A;  2FUG 2;  1F3B A;  3CSI A;  3TRP A;  1GSD A;  4V1A p;  1THO A;  4J57 E;  4KCE A;  2F8A A;  1FB0 A;  4GLT A;  3KP8 A;  1J0F A;  1MD3 A;  3LWA A;  4FIW A;  3TJK A;  4DEJ A;  3PPU A;  4NV5 A;  4KX4 A;  1EGR A;  1GNW A;  1TP9 A;  3F3Q A;  1ERV A;  2LS5 A;  3WT2 A;  1GP1 A;  5H5S A;  1PRX A;  3HD5 A;  2WDU A;  2PGT A;  2JU5 A;  2B5Y A;  3VPT A;  4MPG A;  2R5G A;  5ID2 B;  2TIR A;  1V57 A;  4HQZ A;  1K0C A;  1Q4J A;  2H1A A;  2IME A;  1U87 A;  1G7O A;  4USS A;  4K5S A;  4ZL7 A;  4EUY A;  5CRW A;  2JZS A;  4G0L A;  2CVD A;  1ILO A;  1TK5 B;  2MYG A;  1YKA A;  4CW9 A;  3GMF A;  4LA1 A;  2HFD A;  1BX9 A;  2GT6 A;  4HI7 A;  4HQS A;  2FCH A;  2L5L A;  4KB3 A;  6GSV A;  22GS A;  6GST A;  1TRV A;  1A2J A;  4WKW A;  3DVW A;  5INY A;  2QA1 A;  4K7I A;  5LCZ A;  1PX7 A;  2OAD A;  2VO4 A;  2YCD A;  5D8I A;  1XWK A;  3FZ5 A;  1A2L A;  1VF4 A;  4YQV A;  1G6Y A;  2WUL A;  3Q74 A;  3TJF A;  4BIK A;  4NHW A;  3IC4 A;  2R0C A;  4X4J A;  3MWH A;  2TRC P;  5CRE A;  1SKW B;  1A8Y A;  3TRX A;  2K8S A;  4D73 B;  2DKH A;  1S3A A;  2K8V A;  2FNO A;  3ZRE A;  4K8M A;  3E3E A;  1F2E A;  5DAK B;  3KEB A;  18GS A;  1B9Y C;  3LGC A;  6GSY A;  2PPT A;  1HD2 A;  5GSS A;  3HA9 A;  2IJY A;  3CTF A;  3KIJ A;  1YQ1 A;  2E7P A;  4EO3 A;  5IMC A;  3RAZ A;  4TXV A;  1K0A A; 
#chains in the Genus database with same CATH homology
 1YJ6 A;  1FVJ A;  2MMZ A;  3ZTL A;  4D73 A;  4LLR A;  3M1G A;  2HRK A;  4OWY A;  1J08 A;  3A5W A;  1O7U A;  4O5U A;  2B7J A;  1FB6 A;  5DAK A;  2H74 A;  5IQY A;  2DML A;  3LXT A;  2N5F A;  1DE1 A;  3KMN A;  2P5R A;  4FYC A;  2VL2 A;  2OE1 A;  2RLI A;  1T7P B;  4TW5 A;  2DBC A;  1FVK A;  3P90 A;  2HNL A;  4X43 A;  2HSY A;  1HNC A;  1A0F A;  2D2Z A;  5F06 A;  2H0H A;  4EVM A;  4ECI A;  1Z9H A;  3EC3 A;  5D9W A;  5F0G A;  4TR3 A;  4F0C A;  1QMV A;  5ECH B;  1CQG A;  2IL3 A;  2L6D A;  3KD0 A;  2FWE A;  3W8S A;  3LOR A;  1URM A;  3CRT A;  1WRY A;  2R4V A;  4MZW A;  2DSA A;  2LQQ A;  3FR9 A;  4KSM A;  1A24 A;  4K0G A;  3UVH A;  1QXH A;  2R6K A;  3IDV A;  1GLP A;  3IXR A;  2PUK C;  1V40 A;  3M9K A;  13GS A;  1DUG A;  1VF2 A;  3WYW A;  4YAP A;  4OO4 A;  1J9B A;  1F9M A;  3QAV A;  1XVQ A;  3KH7 A;  2NVL A;  2V1M A;  2H6Z A;  4GQF A;  1BAY A;  4MPF A;  3HY2 A;  1AW9 A;  1QK8 A;  1MD4 A;  5JWR B;  3GNJ A;  3IR4 A;  4GSN A;  4OMV A;  4YH2 A;  2E2G A;  1SKS B;  4OD7 A;  1JZD A;  2A4H A;  3FW2 A;  4O5Q A;  3LYK A;  2GLR A;  1H4O A;  1M2A A;  3RHB A;  7GSS A;  1SL0 B;  1XWB A;  4F82 A;  1B9X C;  3APO A;  1ZGN A;  1TW9 A;  4KW6 A;  2GSQ A;  2IMI A;  1AQX A;  4RI6 A;  1GLQ A;  3EU3 A;  4N30 A;  1MEK A;  2HXK A;  3KH9 A;  2XPE A;  5C00 A;  4V1A g;  3ZML A;  4HOJ A;  3U6V A;  2DJ0 A;  3CXG A;  3EMX A;  2H1B A;  2GSR A;  1XW9 A;  2MMA A;  4KA0 A;  2B6M A;  3I69 A;  3TOT A;  1XOA A;  3F9U A;  3HHV A;  1W4V A;  3L9V A;  4Q5N A;  3FZ4 A;  2O7K A;  3GKN A;  2E0Q A;  1GUM A;  2GQM A;  1F6M C;  1HNA A;  4XRD A;  4EIQ A;  2YJH A;  4LL4 B;  4IP6 A;  2C0D A;  4DSS A;  1XW6 A;  1OE7 A;  4TKY A;  4KDY A;  3GH9 A;  2LQO A;  3P7X A;  1PL2 A;  2L57 A;  4ISD A;  2RM5 A;  1BQ7 A;  4RI7 A;  2OBK A;  4ILF A;  1XBS A;  1VGL A;  4Q5Q A;  3ERW A;  2VL2 C;  4I8B A;  3TKP A;  3TDG A;  2WCI A;  4I5Q A;  2QA2 A;  2YN1 A;  3F8U A;  1X5D A;  1XPV A;  3IK9 A;  2VUP A;  4F0B A;  2ALB A;  1XCC A;  1EWX A;  3BOA A;  2DIY A;  3LFL A;  5KN0 A;  2H6X A;  3TCO A;  3TGZ A;  2YAN A;  4NXI A;  3WGX A;  4GST A;  2A4V A;  2AJQ B;  3C1S A;  3G7I A;  5B8B A;  3Q19 A;  2DKI A;  1T1V A;  3HVS A;  5IMZ A;  4G2E A;  2C3Q A;  3KJY A;  1USB A;  3GA4 A;  3DGQ A;  4AJ7 A;  4E8E A;  3FR6 A;  4JU5 A;  2R37 A;  3VUR A;  1GSU A;  3P2A A;  3ERF A;  1F3A A;  5ELA A;  3IHG A;  2HT9 A;  4HZ2 A;  4O32 A;  3IC8 A;  4EDZ A;  4IHU A;  1TOF A;  4QL9 A;  3ZVJ D;  1M9A A;  2FLS A;  4TN8 A;  3VI5 A;  5IM9 A;  5ECL B;  3N9J A;  3TJG A;  5AN1 A;  4JR4 A;  2IMF A;  5CP1 A;  3A2V A;  1XWG A;  1M7T A;  2CAI A;  3GTU A;  5BRT A;  1ZOF A;  2MBS A;  2PVQ A;  3ZVJ A;  2M80 A;  3UBK A;  3DEX A;  3TKS A;  2RUF A;  4N0V A;  1W89 A;  2ON7 A;  4GSS A;  1T8E B;  3H4K A;  5G30 A;  2REM A;  5KEJ A;  2OKA A;  4G19 A;  1ERU A;  2H1D A;  3KMO A;  4TXO A;  1I5G A;  3VWW A;  5JCW A;  2V6O A;  2X49 A;  4V2L A;  3DD3 A;  1GRX A;  2H6Y A;  2MMO A;  2B3S A;  2VAF A;  4PQH A;  5LD0 A;  3ZIV A;  1E6B A;  2V41 A;  1M99 A;  4NPB A;  3MDK A;  3GX8 A;  5DAL B;  2JSZ A;  1TU7 A;  1EGO A;  1Y6E A;  2LRT A;  3HYP A;  1Y25 A;  4BVY B;  4F03 A;  4I97 A;  4ZXG A;  1ZZY A;  2FA4 A;  6GSS A;  2DJ2 A;  1UC7 A;  3V1W A;  4XTS A;  2LNS A;  5IMA A;  5A4U A;  8GSS A;  2BMX A;  2V32 A;  4ZBD A;  5B6N A;  1N2A A;  3LYP A;  3FHK A;  4N11 A;  1TRS A;  1WOU A;  2X4A A;  5GZZ B;  2I4A A;  5DAL A;  1PN9 A;  2YV7 A;  1EEJ A;  3GRX A;  4BVY A;  4EL1 A;  1JFU A;  3H1N A;  2F3M A;  2WFC A;  11GS A;  4IBP A;  3EWL A;  1WPI A;  3ZIT A;  2X8C A;  4HDE A;  2H19 A;  2FHE A;  3EE2 A;  2H73 A;  4TOP A;  2HSH A;  2FWH A;  4TVE A;  3GHA A;  1O73 A;  1PMT A;  2HZF A;  4K7N A;  4CY6 A;  3VLN A;  2XBI A;  1SK0 A;  1ZCP A;  3EYT A;  1OKT A;  4HZ4 A;  3ERG A;  4WBR D;  2CVK A;  3EIN A;  5G5F A;  3LG6 A;  3DYR A;  5GAN D;  2QGV A;  1DBY A;  5HR3 A;  2FGX A;  20GS A;  4TRX A;  1X9M B;  1AAZ A;  4K6X A;  3BBY A;  4IN0 A;  4K2X A;  2QC7 A;  2L59 A;  2H01 A;  5DBQ A;  4MLY A;  4L0U A;  1NHY A;  3EUR A;  2DJJ A;  2C3T A;  2CVB A;  4O5R A;  1AUC A;  5L71 A;  4BPY A;  2K9F A;  1U6T A;  2HRA A;  1O8W A;  4HEA 2;  4O7H A;  4L8E A;  2WJU A;  6GSW A;  3K8N A;  2IWT A;  2VD1 A;  3DXB A;  4WEY A;  3G7Y A;  1BJX A;  4X1U A;  4K2D A;  2PMT A;  2X8H A;  3ZFB A;  4QL7 A;  3VPQ A;  1JZR A;  2WZ9 A;  3TKS C;  3IK7 A;  3QAW A;  3TKR A;  1IYH A;  3OR5 A;  1ZYE A;  1AQV A;  5JWQ B;  1WP0 A;  4ULX A;  2L5O A;  1K0O A;  1GL8 A;  1OE8 A;  3A2X A;  5CRG A;  3NIV A;  1UA5 A;  4XIH A;  5DCG A;  3ZIJ A;  5AIV A;  5ID2 A;  4ECC A;  1JLV A;  2VD0 A;  1A0R P;  1NHO A;  4PGT A;  3TKS E;  3FYG A;  3D21 A;  2YWM A;  4CDO A;  3CTG A;  3O3T A;  5FHI A;  1TK0 B;  1PKW A;  1TI3 A;  4A5P A;  4ML1 A;  4OCE A;  4JZQ A;  4K9Z A;  3EMP A;  3F4R A;  1GTA A;  2JAD A;  3C71 A;  3UOM A;  2PN8 A;  4KF9 A;  1TRU A;  5KN2 A;  3ME8 A;  5KOX A;  2JL4 A;  1TK8 B;  1VF3 A;  1YEP A;  2KLX A;  5B8A A;  2GST A;  3L9U A;  1KTE A;  3GX0 A;  3F63 A;  1YEX A;  5EL8 A;  1BED A;  4MMM A;  1E2Y A;  4KDX A;  4XS1 A;  2K6V A;  3LJR A;  3LQ7 A;  1R5P A;  5ECM B;  3IHQ A;  3LW9 A;  1UN2 A;  2EIQ A;  1R7H A;  4EE0 A;  3L78 A;  5B6M A;  1EV4 A;  2DLX A;  4KH7 A;  2FWG A;  4EC0 A;  2R3X A;  2VCQ A;  5AGY A;  1GTI A;  1AIU A;  3UAR A;  1N8J A;  3SWL A;  4G0I A;  2C1Y A;  4RUV A;  1WMJ A;  5F05 A;  2GZY A;  1T3B A;  3M9J A;  5D9V A;  4G10 A;  1AXD A;  2B5X A;  4KUN A;  4GWR A;  3HCZ A;  3Q18 A;  2J23 A;  2H76 A;  3MNG A;  2HLS A;  3HJP A;  4BWQ A;  5FT3 A;  4MF7 A;  2IFQ B;  4PUR A;  3HXS A;  4DVC A;  4FO5 A;  1YF0 A;  2B1L A;  3NZN A;  4NWY A;  2RUE A;  5FWG A;  3RDW A;  3D4T A;  2JSY A;  1FO5 A;  4BL7 B;  3TUE A;  3GSS A;  1PL1 A;  4IQ1 A;  2H72 A;  2GQL A;  1A8L A;  2RII A;  2G2Q A;  2R2J A;  2I1U A;  3HKR A;  1PD2 1;  3CMI A;  5HFI A;  4Z2T A;  2IFQ A;  5GAP D;  2IPA A;  3CSH A;  1SK1 A;  4EKZ A;  2C4J A;  4AJ8 A;  2AAW A;  3QOU A;  2YWN A;  5B7C A;  3VWV A;  4GF0 A;  3DKS A;  1JHB A;  2LRC A;  4AJ6 A;  4IJI A;  5DJM A;  1PGT A;  1GUL A;  1GH2 A;  5DQS A;  3WGE A;  2EIR A;  1YY7 A;  3FY7 A;  5D9X A;  1K0D A;  1TTZ A;  1F37 A;  3UMA A;  2XC2 A;  4IS0 A;  1U3A A;  2B5E A;  2N5A A;  2GT5 A;  5J4U A;  3QPM A;  5IOW A;  1OC3 A;  4OFN A;  2CA8 A;  2LJA A;  5J9B A;  1XWC A;  2R0G A;  3RHC A;  3GV1 A;  5J41 A;  4PX1 A;  5EVO A;  2X64 A;  1ST9 A;  3EVI A;  3RPN A;  3J7Y b;  4ZL8 A;  4PXO A;  5ECQ B;  4MDC A;  3W8J A;  2AHE A;  3ZRD A;  2LEG A;  2B1K A;  1IYI A;  3FMW A;  5E4W A;  3GN3 A;  2DJ3 A;  4O92 A;  19GS A;  2VCZ A;  2UZ8 A;  5CNW A;  3CBU A;  1M9B A;  4GQC A;  5HFK A;  2A2S A;  4KDU A;  4JE1 A;  4YAV A;  2GTU A;  4BVX B;  5COH A;  1V9W A;  4KND A;  5H5Q A;  3FZA A;  4CY8 A;  2YV9 A;  4FQU A;  3C1R A;  4MH3 A;  12GS A;  3E0U A;  1KNG A;  3IAM 2;  2WGR A;  3IA1 A;  4KCA A;  4PUF C;  1MTC A;  3WT1 A;  4L5L A;  1GTB A;  5G31 A;  3KM6 A;  1EEM A;  1PN0 A;  4KGI A;  2WB9 A;  1T4Y A;  2NTO A;  4G0K A;  5H5R A;  3TKQ A;  1CQH A;  1QGV A;  5F8B A;  1HNB A;  4IEL A;  3M3M A;  1TI1 A;  2F8F A;  3UAP A;  1FOV A;  2GVP A;  3H79 A;  1SL2 B;  1G6W A;  3CSJ A;  1ON4 A;  1Q98 A;  1AC1 A;  3Q6O A;  2GDR A;  3IOS A;  4NV2 A;  16GS A;  2VCT A;  4MJB A;  1SK2 A;  2VL3 A;  2VL9 A;  3FZ9 A;  1DSB A;  3AY8 A;  5C04 A;  3IV4 A;  2IMD A;  2OE3 A;  3A5I A;  3QCP A;  4F9Z A;  4OCF A;  2HZE B;  2BTO T;  2ZCT A;  3VK9 A;  4WF5 A;  1QUW A;  1ACV A;  4OO5 A;  3GL5 A;  3RBT A;  2KP2 A;  4GCI A;  5EY6 A;  3P8W A;  3TOU A;  3KTB A;  1S3D A;  3GH6 A;  1TDI A;  4MP4 A;  3GKK A;  4NMU A;  1QQ2 A;  1C72 A;  1EP7 A;  1K3O A;  2OJL A;  5D73 A;  3D0Z A;  4POM A;  1B4P A;  2H75 A;  4FYB A;  1RK4 A;  5HQP A;  2VOC A;  4Z2R A;  3US3 A;  1Z5Y E;  4NHZ A;  2HZE A;  1LU4 A;  3E9J B;  3MIX A;  1HYU A;  2AV4 A;  3IPZ A;  4K7O A;  4MNN A;  2ON5 A;  1TRW A;  4L0W A;  2WRT A;  1TXX A;  4MZB A;  1PX6 A;  2VCX A;  5GST A;  3QR6 A;  1PSQ A;  3TJB A;  2DMM A;  3GYK A;  4QQ7 A;  5A4V A;  1XW5 A;  4J56 E;  3QFB C;  9GSS A;  3PH9 A;  1GWC A;  3MYD A;  2H8L A;  4TR0 A;  1O8X A;  4Q5R A;  2LST A;  1RQM A;  4J2F A;  2LTK A;  3A3T A;  2YZH A;  4JBB A;  4PQ1 A;  3SBC A;  4RQR A;  4K5R A;  4WF4 A;  4F2I A;  4POB A;  3D4M A;  5G1K A;  1R5A A;  5AIX A;  1I9D A;  4ECJ A;  4P3Y B;  2C0G A;  3GKX A;  4MJC A;  2YPM A;  4BWS A;  2L6C A;  3HZ4 A;  3CYN A;  5ECR B;  2KHP A;  3APS A;  3J7Y k;  2C0F A;  2IMK A;  3BCI A;  3LXZ A;  4KSO A;  4WXT A;  4HUA A;  14GS A;  3QFA C;  4L5O A;  4ZL9 A;  3MSZ A;  4IGJ A;  3IBH A;  2YJ7 A;  1HQO A;  5DCH A;  1SD9 A;  3RPP A;  1V2A A;  5CYY A;  4MZC A;  1FOH A;  5E59 A;  3CRU A;  4MJE A;  4MCU A;  1Z7R A;  5J9C A;  2QKE A;  1GSS A;  1K0N A;  4ICY A;  4RQX A;  4EDY A;  2O8V B;  17GS A;  1BG5 A;  4EIP A;  3DWV A;  3L9S A;  1OYJ A;  1U3I A;  4FH8 A;  2KP1 A;  4K0N A;  2QSI A;  1PA3 A;  1OC8 A;  2NPB A;  1U88 A;  2AUV A;  1WWJ A;  1LBK A;  1GSY A;  2M72 A;  3HVX A;  4MF5 A;  3C8E A;  1T4Z A;  1SYR A;  1V58 A;  4YKF A;  2R0P A;  2VIM A;  4MF6 A;  5ENU A;  1B4Q A;  3GFK A;  3FR3 A;  1K3L A;  1ZL9 A;  3ISO A;  2DIZ A;  2GZP A;  4I2T A;  2K18 A;  4YKG A;  2MBT A;  4IP1 A;  2KUC A;  5HFG A;  5ECK B;  4E8H A;  4WBJ A;  2LNT A;  4I2U A;  1A2M A;  4IJ3 A;  2KOK A;  3KTL A;  3WD6 A;  1Z3E A;  1LJR A;  4ML6 A;  1XXU A;  3C73 A;  4IQA A;  3F3R A;  1GNE A;  2LRN A;  5HR2 A;  2HYX A;  1AQW A;  2F9S A;  1TKD B;  3G9B A;  1XZO A;  5KN1 A;  3TJJ A;  5G1L A;  5CRD A;  1SEN A;  4KAE A;  1TJD A;  4TR4 A;  4XRA A;  4POK A;  2GZZ A;  2H70 A;  3DVX A;  1ERW A;  1UVZ A;  2P31 A;  2CZ3 A;  1WE0 A;  3ZL5 A;  1EV9 A;  2OAC A;  2FD3 A;  2HSM A;  1MDJ A;  2P5Q A;  2OE0 A;  3R2Q A;  4WR4 A;  2LKU A;  4V2N A;  4Q5F A;  5ECO B;  2EC4 A;  1DE2 A;  1X9W B;  2H66 A;  2LJR A;  2X99 A;  4ZB8 A;  5IMF A;  4IW9 A;  2GS3 A;  5A4W A;  1FAA A;  3GST A;  2VM2 A;  1WJK A;  3D5J A;  4PUA A;  5EPF A;  4XHM A;  3KP9 A;  3GKM A;  2CQ9 A;  2PBJ A;  2HI7 A;  4V2M A;  3LSZ A;  2A2R A;  5HR1 A;  2CAQ A;  5CRH A;  4OFM A;  3S9F A;  4EXJ A;  4XS4 B;  1EOG A;  2I81 A;  4LMW A;  2VLU A;  4DSR A;  2CV4 A;  2TRX A;  1MDI A;  1K3Y A;  2O89 A;  3DML A;  2Z9S A;  5IO0 A;  4JRR A;  3MAK A;  1GSE A;  1SKR B;  5HR0 A;  3JCM L;  1JZO A;  1WIK A;  4PQI A;  2I9H A;  1ZMA A;  1QFN A;  2FY6 A;  3F4S A;  4WET A;  4XS4 A;  1XOB A;  5JCU A;  5D96 A;  3UBL A;  4PNF A;  3GUS A;  2DJK A;  5DDL A;  1OKD A;  3KXO A;  4ID0 A;  3PGT A;  2M46 A;  5IPG A;  10GS A;  4PNG A;  5A5K A;  3TB2 A;  1K0B A;  5DVB A;  1BYE A;  3ZZX A;  4MH2 A;  2G0F A;  1THX A;  3UL3 A;  2YWI A;  2H1G A;  5IO2 A;  4IKH A;  5J5N A;  1KEB A;  1SJ6 A;  3UEM A;  2VLV A;  4Z2U A;  2L4Q A;  4EF0 A;  1G7E A;  1SJI A;  4ZIL A;  1TU8 A;  5D93 A;  6GSU A;  4TR1 B;  1EP8 A;  2BJX A;  1XWA A;  1GUH A;  4BL7 A;  2PVO C;  2YWO A;  2A2P A;  1O81 A;  2HRN A;  3IE3 A;  4YQU A;  1FG4 A;  2RM6 A;  2EIO A;  1OVN A;  4GXZ A;  3BJ5 A;  3A2W A;  5CO3 A;  5G2Z A;  2XBQ A;  5LNK e;  1NM3 A;  4H86 A;  2C0E A;  1XIY A;  3APQ A;  4BA7 A;  2LJK A;  2H0I A;  3EU4 A;  3DIE A;  1YF1 A;  1JZW A;  4TR1 A;  4KE3 A;  1ABA A;  1X5C A;  3FRC A;  5CAX A;  4CHS A;  2AB6 A;  2XPD A;  3QD9 A;  3HJO A;  2PU9 C;  2C3N A;  2V2G A;  3O76 A;  3WGD A;  2VLT A;  4ZB9 A;  4IVF A;  5J3R A;  1ML6 A;  3M0F A;  1S3C A;  2DC5 A;  1G0T A;  1NSW A;  4AGS A;  2V6K A;  3IRA A;  5IOX A;  3PIN A;  4JR6 A;  2GQK A;  4ZBB A;  4LMV A;  3I9V 2;  2I3Y A;  1ZYN A;  2CZ2 A;  4POL A;  3EPT A;  4DSS B;  1A23 A;  3D22 A;  1SJZ A;  3D6I A;  1ZYQ B;  4ACS A;  5DJL A;  4FYU A;  5DQY A;  3KZQ A;  2CX3 A;  1GUK A;  1KBN A;  1PQN A;  3G7J A;  1OC9 B;  5F07 A;  3IAS 2;  2H71 A;  5KOW A;  1FHE A;  3BD2 A;  3FEU A;  4WR5 A;  2YNX A;  5JCG A;  1VRS D;  1B48 A;  3H8Q A;  4BVX A;  2ZUP A;  2LV3 A;  3UJ1 A;  6GSX A;  5IIZ A;  1MDK A;  1X5E A;  2C80 A;  1EOH A;  2HRF A;  1Z6N A;  5IMD A;  2FA8 A;  4MA9 A;  1OC9 A;  2PWJ A;  3PR8 A;  3VWX A;  2E2M A;  1M0U A;  2HE3 A;  1H75 A;  4ECB A;  2YP6 A;  4ZB6 A;  2CX4 A;  4OFT A;  4HS1 A;  4G9H A;  3DRN A;  2GSS A;  3LEF A;  4HJ2 A;  2NBS A;  1Z6M A;  1X9S B;  2AYT A;  2P0G A;  2XHF A;  2ZNM A;  1R26 A;  3QDN A;  2ES7 A;  3ZLP A;  5G5E A;  1SYX A;  4XS6 A;  3HDC A;  1K0M A;  2O85 A;  1GSQ A;  1JLW A;  2WS2 A;  2F51 A;  1T00 A;  2O87 A;  1FW1 A;  3UVT A;  5ECI B;  3KCM A;  3GTU B;  3F4T A;  1ZYP A;  5ABR A;  4GRF A;  3ME7 A;  4MAB A;  4PTS A;  4YQM A;  1GTU A;  1YKC A;  2B7K A;  5ECN B;  3F6D A;  4N10 A;  2DJ1 A;  1VF1 A;  2PER A;  2H30 A;  3N5O A;  4X0X A;  3ZMK A;  4HU9 A;  4GTU A;  1GSF A;  5ECS A;  1PKZ A;  4XCS A;  4TXO B;  2YZU A;  2VCV A;  3L4N A;  2NDO A;  1YDK A;  2MMN A;  3F0I A;  3F6F A;  3C7M A;  3O6T A;  3I43 A;  1EZK A;  4K1F A;  3GUR A;  3ZYW A;  3HZ8 A;  3H93 A;  1M2D A;  3TRQ A;  2OBI A;  3NOF A;  5IMV A;  3W6G A;  3KGK A;  1SD8 A;  4Z7X A;  2IIY A;  4N0Z A;  5JWO B;  2IN3 A;  1OAZ A;  2YOI A;  3VWU A;  3ZFL A;  3VI7 A;  4MJA A;  1ERT A;  2C8U A;  4HU7 A;  2X8G A;  1RW1 A;  5D9T A;  4AF2 A;  3U5R E;  3QAG A;  1R4W A;  1B8X A;  1YZX A;  4HJM A;  2JAC A;  1X0R A;  2GGT A;  2VCW A;  2N5B A;  1V98 A;  3ED3 A;  4ZIJ A;  3GL3 A;  3M8N A;  3BCK A;  3VFI A;  3FKF A;  1M2B A;  2FWF A;  1SU9 A;  2JZT A;  2L4C A;  3GIX A;  3R3E A;  4I6X A;  5AIS A;  2LUS A;  1O6J A;  4LL1 B;  3HJM A;  1XFL A;  5ELG A;  1SL1 B;  2OA7 A;  2VM1 A;  5BMU A;  2CT6 A;  2MZC A;  2H0G A;  1NW2 A;  3FK8 A;  3I6A A;  3HVV A;  5ECP B;  1XVW A;  4NAX A;  5IPH A;  2JZR A;  3UIW A;  2J9H A;  5KN3 A;  3L0H A;  4JED A;  1O85 A;  4ZBA A;  4DSQ A;  4MK3 A;  3QMX A;  1Z7P A;  2FUG 2;  1F3B A;  3CSI A;  3TRP A;  1GSD A;  4V1A p;  1THO A;  4J57 E;  4KCE A;  2F8A A;  1FB0 A;  4GLT A;  3KP8 A;  1J0F A;  1MD3 A;  3LWA A;  4FIW A;  3TJK A;  4DEJ A;  3PPU A;  4NV5 A;  4KX4 A;  1EGR A;  1GNW A;  1TP9 A;  3F3Q A;  1ERV A;  2LS5 A;  3WT2 A;  1GP1 A;  5H5S A;  1PRX A;  3HD5 A;  2WDU A;  2PGT A;  2JU5 A;  2B5Y A;  3VPT A;  4MPG A;  2R5G A;  5ID2 B;  2TIR A;  1V57 A;  4HQZ A;  1K0C A;  1Q4J A;  2H1A A;  2IME A;  1U87 A;  1G7O A;  4USS A;  4K5S A;  4ZL7 A;  4EUY A;  5CRW A;  2JZS A;  4G0L A;  2CVD A;  1ILO A;  1TK5 B;  2MYG A;  1YKA A;  4CW9 A;  3GMF A;  4LA1 A;  2HFD A;  1BX9 A;  2GT6 A;  4HI7 A;  4HQS A;  2FCH A;  2L5L A;  4KB3 A;  6GSV A;  22GS A;  6GST A;  1TRV A;  1A2J A;  4WKW A;  3DVW A;  5INY A;  2QA1 A;  4K7I A;  5LCZ A;  1PX7 A;  2OAD A;  2VO4 A;  2YCD A;  5D8I A;  1XWK A;  3FZ5 A;  1A2L A;  1VF4 A;  4YQV A;  1G6Y A;  2WUL A;  3Q74 A;  3TJF A;  4NHW A;  3IC4 A;  2R0C A;  4X4J A;  3MWH A;  2TRC P;  5CRE A;  1SKW B;  1A8Y A;  3TRX A;  2K8S A;  4D73 B;  2DKH A;  1S3A A;  2K8V A;  2FNO A;  3ZRE A;  4K8M A;  3E3E A;  1F2E A;  5DAK B;  3KEB A;  18GS A;  1B9Y C;  3LGC A;  6GSY A;  2PPT A;  1HD2 A;  5GSS A;  3HA9 A;  2IJY A;  3CTF A;  3KIJ A;  1YQ1 A;  2E7P A;  4EO3 A;  5IMC A;  3RAZ A;  4TXV A;  1K0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...