1GH2A

Crystal structure of the catalytic domain of a new human thioredoxin-like protein
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
107
structure length
107
Chain Sequence
VGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFQFFRNKVRIDQYQGADAVGLEEKIKQHLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords THIOREDOXIN-LIKE PROTEIN
publication title Crystal structure of the catalytic domain of a human thioredoxin-like protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2000-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1gh2A00
2LRCA 5ECNB 4F9ZA 3D22A 4AGSA 1JHBA 3P2AA 3ERFA 4XRDA 4ZBDA 2C80A 4QQ7A 3LYKA 3IK7A 2HLSA 4GF0A 5IOWA 1RW1A 3FKFA 1T7PB 2DJ2A 1EWXA 1W89A 6GSVA 2BTOT 2VL9A 4WEYA 4ID0A 1SKSB 5AIVA 4KCEA 3ZREA 4O92A 3RPNA 4ZBBA 1Z7PA 2K9FA 5L71A 5F05A 2H73A 2C4JA 1EV4A 1NM3A 2FWFA 1UVZA 3MSZA 1O85A 4DSQA 1K0MA 2IFQA 5GSSA 2H8LA 1GUMA 2JACA 3F4SA 3GH6A 4ZB9A 4HUAA 4NV5A 3DD3A 3GX8A 4IHUA 1TOFA 2XC2A 5CNWA 2R6KA 5KN1A 5DALB 1XWKA 2EIOA 1VF3A 3L78A 1I5GA 2L6CA 4MCUA 1T8EB 1EEMA 4I97A 2WULA 4ML1A 4MK3A 1TU8A 2PERA 5IO2A 2CZ2A 3KMNA 5EPFA 3PH9A 1WPIA 4HQZA 1XCCA 4MJBA 5CRHA 2OE0A 1VF1A 2H75A 4CDOA 3OR5A 1OC9A 2DIYA 1B8XA 3I9V2 1TI1A 1GL8A 1M2DA 1HNCA 3DRNA 5DJMA 5JCUA 1R4WA 3EWLA 3DIEA 5G5FA 1O6JA 2J9HA 4GWRA 5B7CA 3IDVA 3UARA 1EGRA 1YKAA 2MMAA 1ZYEA 4PURA 4HJ2A 2ON5A 5AIXA 1DUGA 4I5QA 1Q4JA 2R2JA 5ELAA 3DVXA 4JBBA 1EP8A 2CVBA 4PQ1A 2H0GA 1B48A 2YWMA 3EMXA 3E0UA 4IW9A 3KP9A 4YAVA 2CV4A 2EIQA 4WF5A 1BEDA 1GLQA 3LYPA 1U3IA 1CQHA 3GKKA 5J41A 3NOFA 4LMVA 6GSYA 4GSSA 5AGYA 2H1BA 3IV4A 2AB6A 3NIVA 4DSSA 2XPDA 2V1MA 5DBQA 2LNSA 2DC5A 1R5AA 1TI3A 2KHPA 5CAXA 4GQCA 4E8HA 3TJFA 1I9DA 3LXZA 1X5EA 1TW9A 5ECPB 5A4UA 5D9XA 2B1LA 1WE0A 5D9WA 2PPTA 1Q98A 5B8BA 3A2VA 4MA9A 1NHOA 1C72A 1BAYA 1JZOA 4H86A 3GMFA 1URMA 2C3TA 5ECKB 2XHFA 1FVJA 5G30A 5G1LA 3K8NA 3QAVA 2JSYA 4XS1A 1PSQA 3F9UA 2LQQA 3KH7A 1OC3A 3U5RE 3R2QA 4IBPA 5ABRA 5F0GA 4TOPA 1EOHA 1T4YA 1K0AA 4FIWA 1VRSD 4FYCA 4GSNA 1E6BA 4X0XA 2O8VB 3CTGA 2P5RA 1LBKA 3FYGA 1SL0B 1Z9HA 2GQMA 3TB2A 3HCZA 2GQKA 4OMVA 1ERTA 3PINA 5JWRB 17GSA 1PKZA 5DAKB 2H76A 4NPBA 3KP8A 2L6DA 1R5PA 4IN0A 1PD21 1V58A 2TIRA 3QD9A 4AJ7A 4OO5A 1QXHA 4LL4B 2LQOA 2H66A 1S3CA 3GURA 1GLPA 1FAAA 5ECQB 2R5GA 1DE1A 2B3SA 2GSSA 2H1DA 2V41A 2L4CA 3KTLA 3MDKA 3Q74A 2LTKA 2DIZA 13GSA 2DLXA 2OBKA 6GSTA 2DJ1A 1MDJA 3EE2A 3GL5A 1EP7A 16GSA 3IPZA 3JCML 1O8WA 4ZL9A 4GRFA 2O87A 3F6DA 2YANA 2B5EA 5G31A 1EEJA 5ID2B 1S3AA 1AAZA 1ZZYA 1FOVA 1TRWA 1WP0A 2KP2A 2YJ7A 4IELA 3EYTA 5IM9A 4IS0A 14GSA 4NV2A 1VF2A 1MEKA 5LCZA 3BD2A 3LXTA 2YWIA 2B7JA 2VLVA 4K0GA 4HOJA 5CP1A 2BJXA 2NDOA 3APSA 1A0RP 3APOA 4OO4A 7GSSA 2IIYA 2VIMA 2R4VA 2QKEA 1ERVA 1M9BA 1X5DA 4ML6A 1GULA 2IMKA 3GRXA 5DCGA 3DMLA 1J08A 3CTFA 3TKPA 3KMOA 4G2EA 4MJAA 3VI5A 3C71A 4MP4A 3I69A 5ECHB 4BA7A 2VOCA 1MDKA 1V9WA 3F6FA 2RIIA 11GSA 3QOUA 2H0IA 4TR1A 1TDIA 1BQ7A 2C3NA 2F9SA 2HXKA 2HZEA 1M2BA 3GN3A 1B4QA 5INYA 4D73B 1GSEA 1AQXA 2B6MA 3FK8A 4POLA 3KEBA 3D4MA 2LSTA 1AC1A 3TRXA 5J5NA 1SD8A 4K9ZA 2L4QA 2V6KA 4YH2A 3D21A 4K7IA 5G2ZA 2L59A 3W8SA 3LWAA 2X64A 5B6NA 2CX3A 3FR3A 2TRCP 5CO3A 5ECLB 3ISOA 2P31A 1XFLA 4OFTA 5G1KA 3GSTA 2C1YA 1KNGA 2C0EA 5ECSA 18GSA 3UBKA 1TXXA 1OAZA 4IGJA 2RUFA 2MZCA 5G5EA 3UOMA 1YDKA 2ZUPA 4KSMA 2NBSA 1Z7RA 2VUPA 4OFNA 2FWEA 4HU7A 3TOTA 2HYXA 1YF0A 5CRDA 4WXTA 1DE2A 5D8IA 3ED3A 2HRFA 3KM6A 1MDIA 2VM1A 4KX4A 1FO5A 5IMFA 2HRNA 1JZDA 3D0ZA 1O81A 2GT6A 4ZB6A 10GSA 4ECBA 2F51A 4XS4B 1GUHA 1NW2A 4WF4A 5ECOB 4YQVA 2F8FA 2O89A 4NMUA 5DQSA 4NHZA 4ZIJA 3CYNA 1A0FA 2PVQA 2YN1A 4WBJA 1GSSA 2CZ3A 2HSHA 3O6TA 3CRUA 4ZXGA 3HXSA 4K7NA 5C04A 1FVKA 1RQMA 6GSWA 2HSYA 3KH9A 4TW5A 2JL4A 4FYUA 4MF6A 3HJOA 3WGXA 3BJ5A 1M9AA 3E9JB 1M0UA 1GH2A 3KD0A 5H5QA 1WWJA 3DEXA 1GTIA 2DJJA 3UVHA 4TXOA 5DALA 2CAQA 3IAM2 2H6XA 5IQYA 1SENA 2A2SA 1AXDA 3EURA 2ON7A 3C1SA 1Y25A 1F37A 1WMJA 3RHCA 1OKDA 2MMOA 3KGKA 3PR8A 2C0GA 1PRXA 1TU7A 4IP6A 1PX7A 1WJKA 2XBIA 3FR6A 4KA0A 2MMNA 2YP6A 2GZPA 1GSFA 1VF4A 4TVEA 3TJGA 4MLYA 5J9BA 1GNEA 3GNJA 3WYWA 3P7XA 1GNWA 2L5OA 3L9VA 1UC7A 3F8UA 1ON4A 3TOUA 1PL2A 4RI6A 2YPMA 1FB0A 4MPGA 4IJ3A 5FT3A 1NSWA 1BJXA 1GP1A 1UA5A 2H30A 1XW6A 1MTCA 4JU5A 4RQXA 1OE7A 3MNGA 2K8VA 20GSA 2JADA 2OA7A 2JSZA 2GLRA 1B9XC 2VCQA 4I6XA 4K8MA 2JZTA 4L8EA 3TKQA 1EZKA 3QDNA 3UL3A 2RM6A 3L0HA 2IFQB 4AJ6A 1WOUA 4YAPA 4IQAA 1USBA 3G7IA 3I43A 2VLUA 2VL2A 2HNLA 3HY2A 4JR6A 5J9CA 4MABA 3L4NA 3ZLPA 1Z3EA 2N5AA 3QMXA 2ZCTA 1JZRA 1SYRA 1T00A 1SU9A 4EF0A 2YZUA 3ZVJD 3C1RA 4GQFA 3F63A 1X5CA 4KSOA 4LLRA 4LA1A 3L9UA 3ERWA 3AY8A 4KCAA 1A8YA 1BX9A 3FW2A 4ZL8A 1TK5B 1AIUA 2P0GA 1FG4A 2WCIA 4HZ2A 2KOKA 3EVIA 4LMWA 3M9KA 1RK4A 4KW6A 1WIKA 3VK9A 4RUVA 3GKXA 4K2DA 1YKCA 4I2TA 2YZHA 1QFNA 5D9TA 2OBIA 4XRAA 4JR4A 3ZFLA 3IC4A 1EOGA 2DJKA 2LJRA 4EUYA 4V2NA 2BMXA 1U88A 4AJ8A 1AQVA 1K0DA 1N8JA 5JCGA 3HHVA 3GX0A 3F4RA 3VLNA 4OD7A 6GSXA 4WETA 5ELGA 1SD9A 4POKA 1KEBA 2WFCA 3HKRA 1OYJA 3GIXA 3IE3A 3QPMA 1JLWA 3WT2A 9GSSA 1XWCA 3IOSA 2CVKA 5CRWA 2FY6A 2HZFA 2DMMA 4XHMA 2GVPA 1YZXA 2WGRA 3IXRA 5EL8A 1XVQA 4DSSB 1B9YC 2I1UA 4ZB8A 2E7PA 2Z9SA 2I81A 2CVDA 4ILFA 1GTBA 2H0HA 2K18A 3KIJA 3UBLA 1M7TA 1O7UA 4WKWA 3FZ5A 4HDEA 2QC7A 3GKMA 4KE3A 3FZAA 3QAWA 3TRPA 3BCKA 1U6TA 4IVFA 2GS3A 4BVYA 4IJIA 5A4WA 1JLVA 5IMVA 4EE0A 2D2ZA 3U6VA 4MJCA 4K0NA 1MD4A 1NHYA 1T4ZA 3F3RA 3TJKA 3IHQA 3GA4A 3ZRDA 2VD1A 3QAGA 5D9VA 1TK0B 1FB6A 3MAKA 2YJHA 2H6ZA 3TUEA 4XS6A 5HFIA 2CAIA 1GSYA 4GCIA 5GZZB 2LJKA 3QFBC 1SKRB 1GRXA 3IA1A 1THXA 2VAFA 4FH8A 4N10A 3HA9A 3LORA 2ALBA 1SL1B 1TRUA 1ZCPA 2C3QA 3CMIA 1ZGNA 2VM2A 1A8LA 3D5JA 2LEGA 3TCOA 1V40A 4I8BA 5J4UA 4GXZA 3DVWA 5IPGA 3C7MA 3H1NA 3CSIA 4PNGA 2YOIA 4QL7A 2MYGA 3WGEA 1A23A 4PUFC 2LS5A 4JRRA 2A2RA 1VGLA 1GSDA 2C0DA 3QR6A 4PUAA 4D73A 3VI7A 3VWWA 4KDYA 1H4OA 5J3RA 4ECJA 1F3BA 1WRYA 1PGTA 4F0CA 1Z5YE 3TJJA 1O8XA 2HI7A 3DWVA 2NVLA 5EY6A 4ACSA 4NHWA 3S9FA 3KJYA 5GAND 3TKSA 3KXOA 4WR4A 3ZL5A 2YNXA 2IMFA 2YCDA 1SJZA 4EDYA 4HEA2 5KN2A 2OKAA 3RBTA 1GTUA 3A2WA 3EU3A 1ERUA 2GZYA 3GTUA 2FWHA 4ECIA 1M2AA 4ISDA 3FHKA 4L5LA 3ZVJA 1V57A 2YWOA 4PQIA 1QGVA 4OCFA 4BL7A 1OC8A 3GL3A 1AW9A 3H93A 2AYTA 2AUVA 1K0OA 3VURA 6GSUA 2H70A 2FA8A 2ZNMA 1F3AA 1LU4A 4KDUA 3W6GA 4Z7XA 1XPVA 2V32A 2H1AA 2HT9A 3ZMKA 5DDLA 4N0VA 4WBRD 4E8EA 3PGTA 1TP9A 4MZBA 1FHEA 2PMTA 1TRVA 3C73A 2PVOC 3KZQA 1XIYA 5A5KA 2H71A 1OE8A 5DVBA 3P8WA 1PA3A 2N5FA 4Q5FA 3M0FA 3P90A 1CQGA 5IO0A 2QGVA 2WS2A 4PGTA 1G6YA 1PKWA 2PWJA 2B5YA 3BCIA 4OWYA 4HI7A 3D4TA 4TR1B 4F2IA 3J7Yb 1ZMAA 3N9JA 5HFKA 8GSSA 1U87A 3WD6A 3RDWA 4PX1A 4YQUA 4TXVA 1E2YA 3SBCA 4G10A 5LNKe 3UIWA 2E2GA 3M8NA 2DJ0A 4HJMA 3TDGA 2LRTA 3GYKA 1G0TA 1K3LA 2B7KA 3DKSA 5JWOB 12GSA 1XOBA 3F4TA 2NPBA 4G9HA 2ES7A 2IN3A 5C00A 2DSAA 3EINA 1SK1A 4V1Ag 1S3DA 2WB9A 4BWQA 2B5XA 2VCXA 2L57A 4NAXA 2G0FA 4PNFA 4CW9A 5E59A 3M9JA 2V6OA 5IMZA 4KUNA 4NWYA 5HR1A 4KAEA 4MPFA 3ZYWA 1AUCA 4Q5NA 2XBQA 1UN2A 2OJLA 1XXUA 2PGTA 2GGTA 3G7JA 1A2MA 4KH7A 5HR0A 5IIZA 4EC0A 4GSTA 3ZFBA 2FUG2 2VL3A 3BBYA 2H72A 1TK8B 3VFIA 2WZ9A 2IMDA 3TKRA 4TN8A 3DYRA 3V1WA 1J0FA 5E4WA 2O85A 5KEJA 3NZNA 2I3YA 2IL3A 1PQNA 5D93A 1R26A 1M99A 2C0FA 2WJUA 2AAWA 1GUKA 4X1UA 1T3BA 1ST9A 2K8SA 2CT6A 4TRXA 1PMTA 4BVXA 2X8GA 1PL1A 2I9HA 4MZCA 4HZ4A 2F8AA 2OE1A 1QMVA 4RQRA 3FY7A 3CSHA 1HD2A 3G7YA 4IQ1A 2LV3A 1EGOA 2LKUA 1DBYA 5GSTA 4KDXA 1TKDB 3VPTA 4HU9A 4CHSA 3HVVA 4AF2A 5KN0A 2MBTA 4TXOB 3A3TA 4MZWA 3LJRA 5CYYA 3TRQA 3WGDA 2RLIA 4MJEA 5CREA 1X9WB 1IYIA 3EC3A 4TKYA 5ECIB 1GWCA 2VCZA 2VL2C 1BYEA 3C8EA 4K6XA 1XZOA 4L0WA 2JZRA 1Z6MA 4O5RA 3ZZXA 1K0BA 3TKSE 3HVXA 2M72A 4O32A 1R7HA 2G2QA 2NTOA 4BWSA 2GQLA 4F0BA 2IWTA 1EV9A 3F3QA 4X43A 4G19A 4EO3A 4V1Ap 3H79A 3Q19A 2KLXA 1FW1A 1SK2A 2LNTA 4ULXA 2HFDA 1ERWA 1F2EA 5F06A 4TR4A 2QSIA 2M46A 4NXIA 5H5RA 1PN9A 3GH9A 3KCMA 1Y6EA 1X9MB 4MDCA 2CX4A 4TR3A 2AJQB 1A2JA 3W8JA 2KP1A 3HJMA 2H1GA 1XVWA 3ERGA 3ZIVA 4GLTA 2E0QA 1SL2B 4KB3A 2V2GA 2IPAA 3FEUA 2OADA 3O3TA 3LFLA 4F82A 5A4VA 1OC9B 5D96A 2PU9C 3VPQA 1F6MC 3WT1A 1DSBA 2FHEA 5DCHA 3HJPA 4JZQA 2H74A 1W4VA 1YJ6A 4HS1A 4J57E 4N11A 2L5LA 1J9BA 2PUKC 2WRTA 3ZTLA 3UAPA 3IK9A 3VWVA 5B8AA 3FZ4A 2VLTA 4N30A 4L0UA 1YY7A 3RPPA 1XW5A 2IJYA 2R3XA 4YQMA 2FA4A 1ILOA 2CA8A 5COHA 4XCSA 4QL9A 5H5SA 2I4AA 2JU5A 1SJ6A 3FRCA 5IOXA 5HR2A 3L9SA 1AQWA 1TTZA 22GSA 3GFKA 2EC4A 1GSUA 1KBNA 5DAKA 4IKHA 2LUSA 5IMAA 5IPHA 5AN1A 2VCWA 2C8UA 5JWQB 4BPYA 1G6WA 1XWBA 3G9BA 4EDZA 1ACVA 2VCTA 3D6IA 3O76A 1G7EA 19GSA 2GZZA 3UJ1A 1QQ2A 1TJDA 2LJAA 1HNBA 4FYBA 1B4PA 3US3A 2A4VA 3ZITA 3HVSA 4V2MA 1SK0A 5D73A 4RI7A 2GT5A 5ID2A 3EMPA 1X9SB 1HNAA 3HDCA 4FO5A 4HQSA 2OE3A 2RUEA 4F03A 3H4KA 3GV1A 2E2MA 2GSTA 2AHEA 2VCVA 3M1GA 3UVTA 2FNOA 2X99A 1Z6NA 2M80A 4MF7A 4WR5A 2KUCA 4J2FA 2GDRA 1KTEA 3LSZA 4I2UA 2MBSA 3LEFA 2X8HA 2PN8A 5JCWA 2MMZA 5IMDA 4ZL7A 2LRNA 5GAPD 4EXJA 1THOA 5EVOA 2R37A 2P5QA 4MMMA 1JFUA 5HQPA 4GTUA 2J23A 3DGQA 2B1KA 3CSJA 2FGXA 5KN3A 4XIHA 1SJIA 3GUSA 3MWHA 4KNDA 1YQ1A 3A5WA 3BOAA 5IMCA 3FZ9A 1PX6A 2N5BA 2FCHA 1LJRA 3M3MA 2FWGA 3VWXA 4K7OA 1O73A 2FLSA 5LD0A 3N5OA 2IMEA 3TKSC 4Q5RA 1F9MA 1K3YA 4POMA 3LGCA 4DVCA 2HE3A 4J56E 1GSQA 4K1FA 2H01A 3E3EA 2EIRA 1N2AA 1ML6A 1V2AA 4EKZA 2AV4A 1X0RA 5B6MA 2WDUA 4P3YB 4N0ZA 1TRSA 2YV7A 1YEPA 4L5OA 1QK8A 2O7KA 3GHAA 3ZIJA 1JZWA 2FD3A 1ZL9A 5ECRB 4IP1A 4V2LA 5AISA 2GTUA 1HQOA 2GSRA 3HYPA 1QUWA 3TJBA 2GSQA 1XBSA 1OVNA 3QCPA 3DXBA 3RHBA 1YF1A 1XWGA 2DBCA 3IR4A 1HYUA 1H75A 4MF5A 3HZ4A 5HR3A 3I6AA 3GKNA 5DQYA 2IMIA 3FR9A 1OKTA 4OCEA 3ME7A 3RAZA 1G7OA 2DMLA 4POBA 5F07A 4MH2A 1XWAA 5F8BA 4XTSA 3H8QA 5ENUA 5FWGA 2YWNA 4OFMA 1A2LA 3LQ7A 3APQA 2XPEA 4XS4A 3CXGA 1V98A 1IYHA 2K6VA 3CRTA 2PBJA 1ZYQB 5CRGA 4PXOA 3UEMA 3Q6OA 3GTUB 2OACA 2H6YA 4DEJA 3IBHA 2REMA 3TGZA 2F3MA 3QFAC 1T1VA 2CQ9A 2HZEB 3EU4A 4EL1A 4JEDA 1K0CA 1GTAA 4DSRA 1XOAA 2TRXA 2DJ3A 5ECMB 3HZ8A 3IAS2 4EVMA 5DJLA 1BG5A 1K0NA 4TR0A 3UMAA 1A24A 1U3AA 3CBUA 5FHIA 4JE1A 3IRAA 1MD3A 3ZMLA 2RM5A 3J7Yk 4LL1B 3VWUA 2VD0A 3Q18A 3ME8A 6GSSA 2H19A 1ZOFA 5HFGA 3LG6A 4ZILA 2X8CA 4O7HA 1ABAA 4ZBAA 4Q5QA 1SYXA 3F0IA 3GSSA 4MH3A 4PQHA 3A2XA 4ECCA 3SWLA 2JZSA 1SKWB 1YEXA 2YV9A 3HD5A 1K3OA 2VO4A 1XW9A 4KGIA 3KTBA
chains in the Genus database with same CATH superfamily
2LRCA 5ECNB 4F9ZA 3D22A 4AGSA 1JHBA 3P2AA 3ERFA 4XRDA 4ZBDA 2C80A 4QQ7A 3LYKA 3IK7A 2HLSA 4GF0A 5IOWA 1RW1A 3FKFA 1T7PB 2DJ2A 4ICYA 1EWXA 1W89A 6GSVA 2BTOT 2VL9A 4WEYA 4ID0A 1SKSB 5AIVA 4KCEA 3ZREA 4O92A 3RPNA 4ZBBA 1Z7PA 3LW9A 2K9FA 5L71A 5F05A 2H73A 2C4JA 1EV4A 1NM3A 2FWFA 1UVZA 2R0GA 3MSZA 1O85A 4DSQA 1K0MA 2IFQA 5GSSA 2H8LA 1GUMA 2HRKA 2JACA 3F4SA 3GH6A 4ZB9A 5KOWA 4HUAA 4NV5A 3DD3A 3GX8A 4IHUA 1TOFA 2XC2A 5CNWA 2R6KA 5KN1A 5DALB 1XWKA 2EIOA 1VF3A 3L78A 1I5GA 2L6CA 4MCUA 1T8EB 1EEMA 4I97A 2WULA 4ML1A 4MK3A 1TU8A 2PERA 5IO2A 2CZ2A 3KMNA 5EPFA 3PH9A 1WPIA 4HQZA 1XCCA 4MJBA 5CRHA 2OE0A 1S3RA 1VF1A 2H75A 4CDOA 3OR5A 1OC9A 2DIYA 1B8XA 3I9V2 1TI1A 1GL8A 1M2DA 1HNCA 3DRNA 5DJMA 5JCUA 2X4AA 1R4WA 3EWLA 3DIEA 5G5FA 1O6JA 2J9HA 3CQFA 4GWRA 5B7CA 3IDVA 3UARA 1EGRA 1YKAA 2MMAA 1ZYEA 4PURA 4HJ2A 2ON5A 5AIXA 1DUGA 4I5QA 1Q4JA 2R2JA 5ELAA 3DVXA 4JBBA 1EP8A 2CVBA 4PQ1A 4USSA 2H0GA 1B48A 2YWMA 3EMXA 3E0UA 4IW9A 3KP9A 4YAVA 2CV4A 2EIQA 4WF5A 1BEDA 1GLQA 3LYPA 1U3IA 1CQHA 3GKKA 5J41A 3NOFA 4LMVA 6GSYA 4GSSA 5AGYA 2H1BA 3IV4A 2AB6A 3NIVA 4DSSA 2XPDA 2V1MA 5DBQA 2LNSA 2DC5A 1FOHA 1R5AA 1TI3A 2KHPA 5CAXA 4GQCA 4E8HA 3TJFA 1I9DA 3LXZA 1X5EA 1TW9A 5ECPB 5A4UA 5D9XA 2B1LA 1WE0A 5D9WA 2PPTA 1Q98A 5B8BA 3A2VA 4MA9A 1NHOA 1C72A 1BAYA 1JZOA 4H86A 3GMFA 1URMA 2C3TA 5ECKB 2XHFA 1FVJA 5G30A 5G1LA 3K8NA 3QAVA 2JSYA 4XS1A 1PSQA 3F9UA 2LQQA 3KH7A 1OC3A 3U5RE 3R2QA 4IBPA 5ABRA 4K5SA 5F0GA 4TOPA 1EOHA 1T4YA 1K0AA 4FIWA 4G0IA 1VRSD 4FYCA 4GSNA 1E6BA 4X0XA 2O8VB 3CTGA 2P5RA 1LBKA 3FYGA 4O5UA 1SL0B 1Z9HA 2GQMA 3TB2A 3HCZA 2GQKA 4OMVA 1ERTA 3PINA 5JWRB 17GSA 1PKZA 5DAKB 2H76A 4NPBA 3KP8A 2L6DA 1R5PA 4IN0A 1PD21 1V58A 2TIRA 3QD9A 4AJ7A 4OO5A 1QXHA 4LL4B 2LQOA 2H66A 1S3CA 3GURA 1GLPA 1FAAA 5ECQB 2R5GA 1DE1A 2B3SA 2GSSA 2H1DA 2V41A 1ZYNA 2L4CA 3KTLA 3MDKA 3Q74A 2LTKA 2DIZA 13GSA 2DLXA 2OBKA 6GSTA 2DJ1A 1MDJA 3EE2A 3GL5A 1EP7A 16GSA 3IPZA 3JCML 1O8WA 4ZL9A 4GRFA 2O87A 3F6DA 2YANA 2B5EA 5G31A 1EEJA 5ID2B 1S3AA 1AAZA 1ZZYA 1FOVA 1TRWA 1WP0A 2KP2A 2YJ7A 4IELA 3EYTA 4EIPA 5IM9A 4IS0A 14GSA 4NV2A 1VF2A 1MEKA 5LCZA 3BD2A 3LXTA 2YWIA 2B7JA 2VLVA 4K0GA 4HOJA 5CP1A 2BJXA 2NDOA 3APSA 1A0RP 3APOA 4OO4A 7GSSA 2IIYA 2VIMA 2R4VA 2QKEA 1ERVA 1M9BA 1X5DA 4ML6A 1GULA 2IMKA 3GRXA 5DCGA 3DMLA 1J08A 3CTFA 3TKPA 3KMOA 4G2EA 4MJAA 3VI5A 3C71A 4MP4A 2DKIA 3I69A 5ECHB 4BA7A 2VOCA 1MDKA 1V9WA 3F6FA 2RIIA 11GSA 3QOUA 2H0IA 4TR1A 1TDIA 1BQ7A 2C3NA 2F9SA 2HXKA 2HZEA 1M2BA 3GN3A 1B4QA 5INYA 4D73B 1GSEA 1AQXA 2B6MA 3FK8A 4POLA 3KEBA 3D4MA 2LSTA 1AC1A 3TRXA 5J5NA 1SD8A 4K9ZA 2L4QA 2V6KA 4YH2A 3D21A 4K7IA 5G2ZA 2L59A 3W8SA 3LWAA 2X64A 5B6NA 2CX3A 3FR3A 2TRCP 5CO3A 5ECLB 3ISOA 2P31A 1XFLA 4OFTA 5G1KA 3GSTA 2C1YA 1KNGA 2C0EA 5ECSA 18GSA 3UBKA 1TXXA 1OAZA 4IGJA 2RUFA 2MZCA 4BL7B 5G5EA 3UOMA 1YDKA 2ZUPA 4KSMA 2NBSA 1Z7RA 2VUPA 4OFNA 2FWEA 4HU7A 4PTSA 3TOTA 2HYXA 1YF0A 5CRDA 4WXTA 1DE2A 5D8IA 3ED3A 2HRFA 3KM6A 1MDIA 2VM1A 4KX4A 1FO5A 5IMFA 2HRNA 1JZDA 3D0ZA 1O81A 2GT6A 4ZB6A 10GSA 2QA2A 4ECBA 2F51A 4XS4B 1GUHA 1NW2A 4WF4A 5ECOB 4YQVA 2F8FA 2O89A 4NMUA 5DQSA 4NHZA 4ZIJA 3CYNA 1A0FA 2PVQA 2YN1A 4WBJA 1GSSA 2CZ3A 2HSHA 3O6TA 3CRUA 4ZXGA 3HXSA 4K7NA 5C04A 1FVKA 1RQMA 6GSWA 2HSYA 3KH9A 4TW5A 2JL4A 4FYUA 4MF6A 3HJOA 3WGXA 3BJ5A 1M9AA 3E9JB 1M0UA 4FQUA 1GH2A 3KD0A 5H5QA 1WWJA 3DEXA 4CY6A 1GTIA 2DJJA 3UVHA 4TXOA 5DALA 2CAQA 3IAM2 2H6XA 5IQYA 1SENA 2A2SA 4EIQA 2DKHA 1AXDA 3EURA 2ON7A 3C1SA 1Y25A 1F37A 1WMJA 3RHCA 1OKDA 2MMOA 3KGKA 3PR8A 2C0GA 1PRXA 1TU7A 4IP6A 1PX7A 1WJKA 2XBIA 3FR6A 4KA0A 2MMNA 2YP6A 2GZPA 1GSFA 1VF4A 4TVEA 3TJGA 4MLYA 4KF9A 5J9BA 1GNEA 3GNJA 3WYWA 3P7XA 1GNWA 2L5OA 3L9VA 1UC7A 3F8UA 1ON4A 3TOUA 1PL2A 4RI6A 2YPMA 1FB0A 4MPGA 4IJ3A 5FT3A 1NSWA 1BJXA 1GP1A 1UA5A 4O5QA 2H30A 1XW6A 1MTCA 4JU5A 4RQXA 1OE7A 3MNGA 2K8VA 20GSA 2JADA 2OA7A 2JSZA 2GLRA 1B9XC 2VCQA 4I6XA 4K8MA 2JZTA 4L8EA 3TKQA 1EZKA 4BVXB 3QDNA 3UL3A 2RM6A 3L0HA 2IFQB 4AJ6A 1WOUA 4YAPA 3IHGA 4IQAA 1USBA 3G7IA 3I43A 2VLUA 2VL2A 2HNLA 3HY2A 4JR6A 5J9CA 4MABA 3L4NA 3ZLPA 1Z3EA 2N5AA 3QMXA 2ZCTA 1JZRA 1SYRA 1T00A 1SU9A 4EF0A 2YZUA 3ZVJD 3C1RA 4GQFA 3F63A 1X5CA 4KSOA 4LLRA 4LA1A 3L9UA 3ERWA 3AY8A 4KCAA 1A8YA 1BX9A 3FW2A 4ZL8A 1TK5B 1AIUA 2P0GA 1FG4A 2WCIA 4HZ2A 2KOKA 3EVIA 4LMWA 3M9KA 1RK4A 4KW6A 1WIKA 3VK9A 4HSCX 4RUVA 3GKXA 4K2DA 1YKCA 4I2TA 2YZHA 1QFNA 5D9TA 2OBIA 4XRAA 4JR4A 4K2XA 3ZFLA 3IC4A 1EOGA 2DJKA 2LJRA 4EUYA 4V2NA 2BMXA 1U88A 4AJ8A 1AQVA 1K0DA 1N8JA 5JCGA 3HHVA 3GX0A 3F4RA 3VLNA 4OD7A 6GSXA 4WETA 3A5IA 5ELGA 1SD9A 4POKA 1KEBA 2WFCA 3HKRA 1OYJA 3GIXA 3IE3A 3QPMA 1JLWA 3WT2A 9GSSA 1XWCA 3IOSA 2CVKA 5CRWA 2FY6A 2HZFA 2DMMA 4XHMA 2GVPA 1YZXA 1PN0A 2WGRA 3IXRA 5EL8A 1XVQA 4DSSB 1B9YC 1XG8A 2I1UA 4ZB8A 2E7PA 2Z9SA 2I81A 2CVDA 4ILFA 1GTBA 2H0HA 2K18A 3KIJA 3UBLA 4A5PA 1M7TA 1O7UA 3MYDA 4WKWA 3FZ5A 4HDEA 2QC7A 3GKMA 4KE3A 3FZAA 3QAWA 3TRPA 3BCKA 1U6TA 4IVFA 2R0PA 4G0LA 2GS3A 4BVYA 4IJIA 5A4WA 1JLVA 5IMVA 4EE0A 2D2ZA 3U6VA 4MJCA 4K0NA 1MD4A 1NHYA 1T4ZA 3F3RA 3TJKA 3IHQA 3GA4A 3ZRDA 2VD1A 3QAGA 5D9VA 1TK0B 1FB6A 3MAKA 2YJHA 2H6ZA 3TUEA 4XS6A 5HFIA 2CAIA 2A2PA 1GSYA 4GCIA 5GZZB 2LJKA 3QFBC 1SKRB 1GRXA 3IA1A 1THXA 2VAFA 4FH8A 4N10A 3HA9A 3LORA 2ALBA 3HVNA 1SL1B 1TRUA 1ZCPA 2C3QA 3CMIA 1ZGNA 2VM2A 1A8LA 3D5JA 2LEGA 3TCOA 1V40A 4I8BA 5J4UA 4GXZA 3DVWA 5IPGA 3C7MA 3H1NA 3CSIA 4PNGA 2YOIA 4QL7A 2MYGA 3WGEA 1A23A 4PUFC 2LS5A 4JRRA 2A2RA 1VGLA 1GSDA 2C0DA 3QR6A 4PUAA 4D73A 3VI7A 3VWWA 4KDYA 1H4OA 5J3RA 4ECJA 1F3BA 1WRYA 1PGTA 4F0CA 1Z5YE 3TJJA 1O8XA 2HI7A 3DWVA 2NVLA 5EY6A 4ACSA 4NHWA 3S9FA 3KJYA 5GAND 3TKSA 3KXOA 4WR4A 3R3EA 3ZL5A 2YNXA 2IMFA 2YCDA 1SJZA 4EDYA 4HEA2 5KN2A 2QA1A 2OKAA 2A4HA 3RBTA 1GTUA 3A2WA 3PPUA 3EU3A 1ERUA 3MIXA 2GZYA 3GTUA 2FWHA 4ECIA 1M2AA 4ISDA 3EPTA 3FHKA 4L5LA 4YKFA 3ZVJA 1V57A 2YWOA 4PQIA 1QGVA 4OCFA 4BL7A 1OC8A 3GL3A 1AW9A 3H93A 2AYTA 2AUVA 4CY8A 4X4JA 1K0OA 3VURA 6GSUA 2H70A 2FA8A 2ZNMA 1F3AA 1LU4A 4KDUA 3W6GA 4Z7XA 1XPVA 2V32A 2H1AA 2HT9A 3ZMKA 5DDLA 4N0VA 4WBRD 4E8EA 3PGTA 1TP9A 4MZBA 1FHEA 2PMTA 1TRVA 3C73A 2PVOC 3KZQA 1XIYA 5A5KA 2H71A 1OE8A 5DVBA 3P8WA 1PA3A 2N5FA 4Q5FA 3M0FA 3P90A 1CQGA 5IO0A 2QGVA 2WS2A 4PGTA 1G6YA 1PKWA 2PWJA 2B5YA 3BCIA 1ZYPA 4OWYA 4HI7A 3D4TA 4TR1B 4F2IA 3J7Yb 1ZMAA 3N9JA 5HFKA 8GSSA 1U87A 3WD6A 3RDWA 4PX1A 4YQUA 4TXVA 1E2YA 3SBCA 4G10A 5LNKe 3UIWA 2E2GA 3M8NA 2DJ0A 4HJMA 3TDGA 2LRTA 3GYKA 1G0TA 1K3LA 2B7KA 3DKSA 5JWOB 12GSA 1XOBA 3F4TA 2NPBA 4G9HA 2ES7A 2IN3A 5C00A 2DSAA 3EINA 1SK1A 4V1Ag 1S3DA 2WB9A 4BWQA 2B5XA 2VCXA 2L57A 4NAXA 2G0FA 4PNFA 4CW9A 5E59A 3M9JA 2V6OA 5IMZA 4KUNA 4NWYA 5HR1A 4KAEA 4MPFA 3ZYWA 1AUCA 4Q5NA 2XBQA 1UN2A 2OJLA 2R0CA 1XXUA 2PGTA 2GGTA 3G7JA 1A2MA 4KH7A 5HR0A 5IIZA 4EC0A 4GSTA 3ZFBA 2FUG2 2VL3A 3BBYA 2H72A 1TK8B 3VFIA 2WZ9A 2IMDA 3TKRA 4TN8A 3DYRA 3V1WA 1J0FA 5E4WA 2O85A 5KEJA 3NZNA 2I3YA 2IL3A 1PQNA 5D93A 1R26A 1M99A 2C0FA 2WJUA 2AAWA 1GUKA 4X1UA 1T3BA 4Z2RA 1ST9A 2K8SA 2CT6A 4TRXA 1PMTA 4BVXA 2X8GA 1PL1A 2I9HA 4MZCA 4HZ4A 2F8AA 2OE1A 1QMVA 4RQRA 3FY7A 3CSHA 1HD2A 3G7YA 4IQ1A 2LV3A 1EGOA 2LKUA 1DBYA 5GSTA 4KDXA 1TKDB 3VPTA 4HU9A 4CHSA 3HVVA 4AF2A 5KN0A 2MBTA 4TXOB 3A3TA 4MZWA 3LJRA 5CYYA 3TRQA 3WGDA 2RLIA 4MJEA 5CREA 1X9WB 1IYIA 3EC3A 4TKYA 5ECIB 1GWCA 2VCZA 1PFOA 2VL2C 1BYEA 3C8EA 4K6XA 1XZOA 4L0WA 2JZRA 1Z6MA 4O5RA 3ZZXA 1K0BA 3TKSE 3HVXA 2M72A 4O32A 1R7HA 1M3IA 2G2QA 2NTOA 4BWSA 2GQLA 4F0BA 2IWTA 1EV9A 3F3QA 4X43A 4G19A 4EO3A 4V1Ap 3H79A 3Q19A 2KLXA 1FW1A 1SK2A 2LNTA 4ULXA 2HSMA 2HFDA 1ERWA 1F2EA 5F06A 4TR4A 2QSIA 2M46A 4NXIA 5H5RA 1PN9A 3GH9A 3KCMA 1Y6EA 1X9MB 4MDCA 2CX4A 4TR3A 2AJQB 1A2JA 3W8JA 2KP1A 3HJMA 2H1GA 1XVWA 3ERGA 3ZIVA 4GLTA 2E0QA 1SL2B 4KB3A 2V2GA 2IPAA 3FEUA 2OADA 3O3TA 3LFLA 4F82A 5A4VA 1OC9B 5D96A 2PU9C 3VPQA 1F6MC 3WT1A 1DSBA 2FHEA 5DCHA 3HJPA 4JZQA 2H74A 1M3JA 1W4VA 1YJ6A 4HS1A 4J57E 4N11A 2L5LA 1J9BA 2PUKC 2WRTA 3ZTLA 3UAPA 3IK9A 3VWVA 5B8AA 3FZ4A 4Z2TA 2VLTA 4N30A 4L0UA 1YY7A 3RPPA 1XW5A 2IJYA 2R3XA 4YQMA 2FA4A 1ILOA 2CA8A 5COHA 4XCSA 4QL9A 5H5SA 2I4AA 2JU5A 1SJ6A 3FRCA 5IOXA 5HR2A 3L9SA 1AQWA 3FMWA 1TTZA 22GSA 3GFKA 2EC4A 1GSUA 1KBNA 5DAKA 4IKHA 2LUSA 5IMAA 5IPHA 5AN1A 2VCWA 2C8UA 5JWQB 4BPYA 1G6WA 1XWBA 3G9BA 4EDZA 1ACVA 2VCTA 3D6IA 3O76A 1G7EA 19GSA 2GZZA 3UJ1A 1QQ2A 1TJDA 2LJAA 1HNBA 4FYBA 1B4PA 3US3A 2A4VA 3ZITA 3HVSA 4V2MA 5BRTA 1SK0A 5D73A 4RI7A 2GT5A 5ID2A 3EMPA 1X9SB 1HNAA 3HDCA 4FO5A 4HQSA 2OE3A 2RUEA 4F03A 3H4KA 3GV1A 2E2MA 2GSTA 2AHEA 2VCVA 3M1GA 3UVTA 2FNOA 2X99A 1Z6NA 2M80A 4MF7A 4WR5A 2KUCA 4J2FA 2GDRA 4K5RA 1KTEA 3LSZA 4I2UA 2MBSA 3LEFA 2X8HA 2PN8A 5JCWA 2MMZA 5IMDA 4ZL7A 2LRNA 5GAPD 4EXJA 1THOA 5EVOA 2R37A 2P5QA 4MMMA 1JFUA 5HQPA 4GTUA 2J23A 3DGQA 2B1KA 3CSJA 4BVYB 2FGXA 5KN3A 4XIHA 1SJIA 3GUSA 3MWHA 4KNDA 1YQ1A 3A5WA 3BOAA 5IMCA 3FZ9A 1PX6A 2N5BA 2FCHA 1LJRA 3M3MA 2FWGA 4MNNA 3VWXA 4K7OA 1O73A 2FLSA 5LD0A 3N5OA 2IMEA 3TKSC 4Q5RA 1F9MA 1K3YA 5BMUA 4POMA 3LGCA 4DVCA 2HE3A 4Z2UA 4J56E 1GSQA 4K1FA 2H01A 3E3EA 2EIRA 1N2AA 1ML6A 1V2AA 4EKZA 2AV4A 1X0RA 5B6MA 2WDUA 4P3YB 4N0ZA 1TRSA 2YV7A 1YEPA 4L5OA 1QK8A 2UZ8A 2O7KA 3GHAA 3ZIJA 1JZWA 2FD3A 1ZL9A 5ECRB 4IP1A 4V2LA 5AISA 4BIKA 2GTUA 1HQOA 2GSRA 3HYPA 1QUWA 3TJBA 2GSQA 1XBSA 1OVNA 3QCPA 3DXBA 3RHBA 1YF1A 1XWGA 2DBCA 3IR4A 1HYUA 1H75A 4MF5A 3IC8A 3HZ4A 5HR3A 3I6AA 3GKNA 2HRAA 5DQYA 2IMIA 3FR9A 4YKGA 1OKTA 4OCEA 3ME7A 3RAZA 1G7OA 2DMLA 4POBA 5F07A 4MH2A 1XWAA 5F8BA 4XTSA 3H8QA 5ENUA 5KOXA 5FWGA 2YWNA 4OFMA 1A2LA 3LQ7A 3APQA 2XPEA 4XS4A 3CXGA 1V98A 1IYHA 2K6VA 3CRTA 2PBJA 1ZYQB 5CRGA 4PXOA 3UEMA 3Q6OA 3GTUB 2OACA 2H6YA 4DEJA 3IBHA 2REMA 3TGZA 2F3MA 3QFAC 1T1VA 2CQ9A 2HZEB 3EU4A 4EL1A 4JEDA 1K0CA 1GTAA 4DSRA 1XOAA 2TRXA 2DJ3A 5ECMB 3HZ8A 3IAS2 4EVMA 5DJLA 1BG5A 1K0NA 4TR0A 3UMAA 2X49A 1A24A 1U3AA 3CBUA 5FHIA 4JE1A 3IRAA 1MD3A 3ZMLA 2RM5A 3J7Yk 4LL1B 3VWUA 2VD0A 3Q18A 3ME8A 6GSSA 2H19A 1ZOFA 5HFGA 3LG6A 4ZILA 2X8CA 4O7HA 1ABAA 4ZBAA 4Q5QA 1SYXA 3F0IA 3GSSA 4MH3A 4PQHA 3A2XA 4G0KA 4ECCA 3SWLA 2JZSA 1SKWB 1YEXA 3HD5A 2YV9A 1K3OA 2VO4A 1XW9A 4KGIA 3KTBA
chains in the Genus database with same CATH topology
2LRCA 5ECNB 4F9ZA 3D22A 4AGSA 1JHBA 3P2AA 3ERFA 4XRDA 4ZBDA 2C80A 4QQ7A 3LYKA 3IK7A 2HLSA 4GF0A 5IOWA 1RW1A 3FKFA 1T7PB 2DJ2A 4ICYA 1EWXA 1W89A 6GSVA 2BTOT 2VL9A 4WEYA 4ID0A 1SKSB 5AIVA 4KCEA 3ZREA 4O92A 3RPNA 4ZBBA 1Z7PA 3LW9A 2K9FA 5L71A 5F05A 2H73A 2C4JA 1EV4A 1NM3A 2FWFA 1UVZA 2R0GA 3MSZA 1O85A 4DSQA 1K0MA 2IFQA 5GSSA 2H8LA 1GUMA 2HRKA 2JACA 3F4SA 3GH6A 4ZB9A 5KOWA 4HUAA 4NV5A 3DD3A 3GX8A 4IHUA 1TOFA 2XC2A 5CNWA 2R6KA 5KN1A 5DALB 1XWKA 2EIOA 1VF3A 3L78A 1I5GA 2L6CA 4MCUA 1T8EB 1EEMA 4I97A 2WULA 4ML1A 4MK3A 1TU8A 2PERA 5IO2A 2CZ2A 3KMNA 5EPFA 3PH9A 1WPIA 4HQZA 1XCCA 4MJBA 5CRHA 2OE0A 1VF1A 2H75A 4CDOA 3OR5A 1OC9A 2DIYA 1B8XA 3I9V2 1TI1A 1GL8A 1M2DA 1HNCA 3DRNA 5DJMA 5JCUA 2X4AA 1R4WA 3EWLA 3DIEA 5G5FA 1O6JA 2J9HA 4GWRA 5B7CA 3IDVA 3UARA 1EGRA 1YKAA 2MMAA 1ZYEA 4PURA 4HJ2A 2ON5A 5AIXA 1DUGA 4I5QA 1Q4JA 2R2JA 5ELAA 3DVXA 4JBBA 1EP8A 2CVBA 4PQ1A 4USSA 2H0GA 1B48A 2YWMA 3EMXA 3E0UA 4IW9A 3KP9A 4YAVA 2CV4A 2EIQA 4WF5A 1BEDA 1GLQA 3LYPA 1U3IA 1CQHA 3GKKA 5J41A 3NOFA 4LMVA 6GSYA 4GSSA 5AGYA 2H1BA 3IV4A 2AB6A 3NIVA 4DSSA 2XPDA 2V1MA 5DBQA 2LNSA 2DC5A 1FOHA 1R5AA 1TI3A 2KHPA 5CAXA 4GQCA 4E8HA 3TJFA 1I9DA 3LXZA 1X5EA 1TW9A 5ECPB 5A4UA 5D9XA 2B1LA 1WE0A 5D9WA 2PPTA 1Q98A 5B8BA 3A2VA 4MA9A 1NHOA 1C72A 1BAYA 1JZOA 4H86A 3GMFA 1URMA 2C3TA 5ECKB 2XHFA 1FVJA 5G30A 5G1LA 3K8NA 3QAVA 2JSYA 4XS1A 1PSQA 3F9UA 2LQQA 3KH7A 1OC3A 3U5RE 3R2QA 4IBPA 5ABRA 4K5SA 5F0GA 4TOPA 1EOHA 1T4YA 1K0AA 4FIWA 4G0IA 1VRSD 4FYCA 4GSNA 1E6BA 4X0XA 2O8VB 3CTGA 2P5RA 1LBKA 3FYGA 4O5UA 1SL0B 1Z9HA 2GQMA 3TB2A 3HCZA 2GQKA 4OMVA 1ERTA 3PINA 5JWRB 17GSA 1PKZA 5DAKB 2H76A 4NPBA 3KP8A 2L6DA 1R5PA 4IN0A 1PD21 1V58A 2TIRA 3QD9A 4AJ7A 4OO5A 1QXHA 4LL4B 2LQOA 2H66A 1S3CA 3GURA 1GLPA 1FAAA 5ECQB 2R5GA 1DE1A 2B3SA 2GSSA 2H1DA 2V41A 1ZYNA 2L4CA 3KTLA 3MDKA 3Q74A 2LTKA 2DIZA 13GSA 2DLXA 2OBKA 6GSTA 2DJ1A 1MDJA 3EE2A 3GL5A 1EP7A 16GSA 3IPZA 3JCML 1O8WA 4ZL9A 4GRFA 2O87A 3F6DA 2YANA 2B5EA 5G31A 1EEJA 5ID2B 1S3AA 1AAZA 1ZZYA 1FOVA 1TRWA 1WP0A 2KP2A 2YJ7A 4IELA 3EYTA 4EIPA 5IM9A 4IS0A 14GSA 4NV2A 1VF2A 1MEKA 5LCZA 3BD2A 3LXTA 2YWIA 2B7JA 2VLVA 4K0GA 4HOJA 5CP1A 2BJXA 2NDOA 3APSA 1A0RP 3APOA 4OO4A 7GSSA 2IIYA 2VIMA 2R4VA 2QKEA 1ERVA 1M9BA 1X5DA 4ML6A 1GULA 2IMKA 3GRXA 5DCGA 3DMLA 1J08A 3CTFA 3TKPA 3KMOA 4G2EA 4MJAA 3VI5A 3C71A 4MP4A 2DKIA 3I69A 5ECHB 4BA7A 2VOCA 1MDKA 1V9WA 3F6FA 2RIIA 11GSA 3QOUA 2H0IA 4TR1A 1TDIA 1BQ7A 2C3NA 2F9SA 2HXKA 2HZEA 1M2BA 3GN3A 1B4QA 5INYA 4D73B 1GSEA 1AQXA 2B6MA 3FK8A 4POLA 3KEBA 3D4MA 2LSTA 1AC1A 3TRXA 5J5NA 1SD8A 4K9ZA 2L4QA 2V6KA 4YH2A 3D21A 4K7IA 5G2ZA 2L59A 3W8SA 3LWAA 2X64A 5B6NA 2CX3A 3FR3A 2TRCP 5CO3A 5ECLB 3ISOA 2P31A 1XFLA 4OFTA 5G1KA 3GSTA 2C1YA 1KNGA 2C0EA 5ECSA 18GSA 3UBKA 1TXXA 1OAZA 4IGJA 2RUFA 2MZCA 4BL7B 5G5EA 3UOMA 1YDKA 2ZUPA 4KSMA 2NBSA 1Z7RA 2VUPA 4OFNA 2FWEA 4HU7A 4PTSA 3TOTA 2HYXA 1YF0A 5CRDA 4WXTA 1DE2A 5D8IA 3ED3A 2HRFA 3KM6A 1MDIA 2VM1A 4KX4A 1FO5A 5IMFA 2HRNA 1JZDA 3D0ZA 1O81A 2GT6A 4ZB6A 10GSA 2QA2A 4ECBA 2F51A 4XS4B 1GUHA 1NW2A 4WF4A 5ECOB 4YQVA 2F8FA 2O89A 4NMUA 5DQSA 4NHZA 4ZIJA 3CYNA 1A0FA 2PVQA 2YN1A 4WBJA 1GSSA 2CZ3A 2HSHA 3O6TA 3CRUA 4ZXGA 3HXSA 4K7NA 5C04A 1FVKA 1RQMA 6GSWA 2HSYA 3KH9A 4TW5A 2JL4A 4FYUA 4MF6A 3HJOA 3WGXA 3BJ5A 1M9AA 3E9JB 1M0UA 4FQUA 1GH2A 3KD0A 5H5QA 1WWJA 3DEXA 4CY6A 1GTIA 2DJJA 3UVHA 4TXOA 5DALA 2CAQA 3IAM2 2H6XA 5IQYA 1SENA 2A2SA 4EIQA 2DKHA 1AXDA 3EURA 2ON7A 3C1SA 1Y25A 1F37A 1WMJA 3RHCA 1OKDA 2MMOA 3KGKA 3PR8A 2C0GA 1PRXA 1TU7A 4IP6A 1PX7A 1WJKA 2XBIA 3FR6A 4KA0A 2MMNA 2YP6A 2GZPA 1GSFA 1VF4A 4TVEA 3TJGA 4MLYA 4KF9A 5J9BA 1GNEA 3GNJA 3WYWA 3P7XA 1GNWA 2L5OA 3L9VA 1UC7A 3F8UA 1ON4A 3TOUA 1PL2A 4RI6A 2YPMA 1FB0A 4MPGA 4IJ3A 5FT3A 1NSWA 1BJXA 1GP1A 1UA5A 4O5QA 2H30A 1XW6A 1MTCA 4JU5A 4RQXA 1OE7A 3MNGA 2K8VA 20GSA 2JADA 2OA7A 2JSZA 2GLRA 1B9XC 2VCQA 4I6XA 4K8MA 2JZTA 4L8EA 3TKQA 1EZKA 4BVXB 3QDNA 3UL3A 2RM6A 3L0HA 2IFQB 4AJ6A 1WOUA 4YAPA 3IHGA 4IQAA 1USBA 3G7IA 3I43A 2VLUA 2VL2A 2HNLA 3HY2A 4JR6A 5J9CA 4MABA 3L4NA 3ZLPA 1Z3EA 2N5AA 3QMXA 2ZCTA 1JZRA 1SYRA 1T00A 1SU9A 4EF0A 2YZUA 3ZVJD 3C1RA 4GQFA 3F63A 1X5CA 4KSOA 4LLRA 4LA1A 3L9UA 3ERWA 3AY8A 4KCAA 1A8YA 1BX9A 3FW2A 4ZL8A 1TK5B 1AIUA 2P0GA 1FG4A 2WCIA 4HZ2A 2KOKA 3EVIA 4LMWA 3M9KA 1RK4A 4KW6A 1WIKA 3VK9A 4RUVA 3GKXA 4K2DA 1YKCA 4I2TA 2YZHA 1QFNA 5D9TA 2OBIA 4XRAA 4JR4A 4K2XA 3ZFLA 3IC4A 1EOGA 2DJKA 2LJRA 4EUYA 4V2NA 2BMXA 1U88A 4AJ8A 1AQVA 1K0DA 1N8JA 5JCGA 3HHVA 3GX0A 3F4RA 3VLNA 4OD7A 6GSXA 4WETA 3A5IA 5ELGA 1SD9A 4POKA 1KEBA 2WFCA 3HKRA 1OYJA 3GIXA 3IE3A 3QPMA 1JLWA 3WT2A 9GSSA 1XWCA 3IOSA 2CVKA 5CRWA 2FY6A 2HZFA 2DMMA 4XHMA 2GVPA 1YZXA 1PN0A 2WGRA 3IXRA 5EL8A 1XVQA 4DSSB 1B9YC 2I1UA 4ZB8A 2E7PA 2Z9SA 2I81A 2CVDA 4ILFA 1GTBA 2H0HA 2K18A 3KIJA 3UBLA 4A5PA 1M7TA 1O7UA 3MYDA 4WKWA 3FZ5A 4HDEA 2QC7A 3GKMA 4KE3A 3FZAA 3QAWA 3TRPA 3BCKA 1U6TA 4IVFA 2R0PA 4G0LA 2GS3A 4BVYA 4IJIA 5A4WA 1JLVA 5IMVA 4EE0A 2D2ZA 3U6VA 4MJCA 4K0NA 1MD4A 1NHYA 1T4ZA 3F3RA 3TJKA 3IHQA 3GA4A 3ZRDA 2VD1A 3QAGA 5D9VA 1TK0B 1FB6A 3MAKA 2YJHA 2H6ZA 3TUEA 4XS6A 5HFIA 2CAIA 2A2PA 1GSYA 4GCIA 5GZZB 2LJKA 3QFBC 1SKRB 1GRXA 3IA1A 1THXA 2VAFA 4FH8A 4N10A 3HA9A 3LORA 2ALBA 1SL1B 1TRUA 1ZCPA 2C3QA 3CMIA 1ZGNA 2VM2A 1A8LA 3D5JA 2LEGA 3TCOA 1V40A 4I8BA 5J4UA 4GXZA 3DVWA 5IPGA 3C7MA 3H1NA 3CSIA 4PNGA 2YOIA 4QL7A 2MYGA 3WGEA 1A23A 4PUFC 2LS5A 4JRRA 2A2RA 1VGLA 1GSDA 2C0DA 3QR6A 4PUAA 4D73A 3VI7A 3VWWA 4KDYA 1H4OA 5J3RA 4ECJA 1F3BA 1WRYA 1PGTA 4F0CA 1Z5YE 3TJJA 1O8XA 2HI7A 3DWVA 2NVLA 5EY6A 4ACSA 4NHWA 3S9FA 3KJYA 5GAND 3TKSA 3KXOA 4WR4A 3R3EA 3ZL5A 2YNXA 2IMFA 2YCDA 1SJZA 4EDYA 4HEA2 5KN2A 2QA1A 2OKAA 2A4HA 3RBTA 1GTUA 3A2WA 3PPUA 3EU3A 1ERUA 3MIXA 2GZYA 3GTUA 2FWHA 4ECIA 1M2AA 4ISDA 3EPTA 3FHKA 4L5LA 4YKFA 3ZVJA 1V57A 2YWOA 4PQIA 1QGVA 4OCFA 4BL7A 1OC8A 3GL3A 1AW9A 3H93A 2AYTA 2AUVA 4CY8A 4X4JA 1K0OA 3VURA 6GSUA 2H70A 2FA8A 2ZNMA 1F3AA 1LU4A 4KDUA 3W6GA 4Z7XA 1XPVA 2V32A 2H1AA 2HT9A 3ZMKA 5DDLA 4N0VA 4WBRD 4E8EA 3PGTA 1TP9A 4MZBA 1FHEA 2PMTA 1TRVA 3C73A 2PVOC 3KZQA 1XIYA 5A5KA 2H71A 1OE8A 5DVBA 3P8WA 1PA3A 2N5FA 4Q5FA 3M0FA 3P90A 1CQGA 5IO0A 2QGVA 2WS2A 4PGTA 1G6YA 1PKWA 2PWJA 2B5YA 3BCIA 1ZYPA 4OWYA 4HI7A 3D4TA 4TR1B 4F2IA 3J7Yb 1ZMAA 3N9JA 5HFKA 8GSSA 1U87A 3WD6A 3RDWA 4PX1A 4YQUA 4TXVA 1E2YA 3SBCA 4G10A 5LNKe 3UIWA 2E2GA 3M8NA 2DJ0A 4HJMA 3TDGA 2LRTA 3GYKA 1G0TA 1K3LA 2B7KA 3DKSA 5JWOB 12GSA 1XOBA 3F4TA 2NPBA 4G9HA 2ES7A 2IN3A 5C00A 2DSAA 3EINA 1SK1A 4V1Ag 1S3DA 2WB9A 4BWQA 2B5XA 2VCXA 2L57A 4NAXA 2G0FA 4PNFA 4CW9A 5E59A 3M9JA 2V6OA 5IMZA 4KUNA 4NWYA 5HR1A 4KAEA 4MPFA 3ZYWA 1AUCA 4Q5NA 2XBQA 1UN2A 2OJLA 2R0CA 1XXUA 2PGTA 2GGTA 3G7JA 1A2MA 4KH7A 5HR0A 5IIZA 4EC0A 4GSTA 3ZFBA 2FUG2 2VL3A 3BBYA 2H72A 1TK8B 3VFIA 2WZ9A 2IMDA 3TKRA 4TN8A 3DYRA 3V1WA 1J0FA 5E4WA 2O85A 5KEJA 3NZNA 2I3YA 2IL3A 1PQNA 5D93A 1R26A 1M99A 2C0FA 2WJUA 2AAWA 1GUKA 4X1UA 1T3BA 4Z2RA 1ST9A 2K8SA 2CT6A 4TRXA 1PMTA 4BVXA 2X8GA 1PL1A 2I9HA 4MZCA 4HZ4A 2F8AA 2OE1A 1QMVA 4RQRA 3FY7A 3CSHA 1HD2A 3G7YA 4IQ1A 2LV3A 1EGOA 2LKUA 1DBYA 5GSTA 4KDXA 1TKDB 3VPTA 4HU9A 4CHSA 3HVVA 4AF2A 5KN0A 2MBTA 4TXOB 3A3TA 4MZWA 3LJRA 5CYYA 3TRQA 3WGDA 2RLIA 4MJEA 5CREA 1X9WB 1IYIA 3EC3A 4TKYA 5ECIB 1GWCA 2VCZA 2VL2C 1BYEA 3C8EA 4K6XA 1XZOA 4L0WA 2JZRA 1Z6MA 4O5RA 3ZZXA 1K0BA 3TKSE 3HVXA 2M72A 4O32A 1R7HA 2G2QA 2NTOA 4BWSA 2GQLA 4F0BA 2IWTA 1EV9A 3F3QA 4X43A 4G19A 4EO3A 4V1Ap 3H79A 3Q19A 2KLXA 1FW1A 1SK2A 2LNTA 4ULXA 2HSMA 2HFDA 1ERWA 1F2EA 5F06A 4TR4A 2QSIA 2M46A 4NXIA 5H5RA 1PN9A 3GH9A 3KCMA 1Y6EA 1X9MB 4MDCA 2CX4A 4TR3A 2AJQB 1A2JA 3W8JA 2KP1A 3HJMA 2H1GA 1XVWA 3ERGA 3ZIVA 4GLTA 2E0QA 1SL2B 4KB3A 2V2GA 2IPAA 3FEUA 2OADA 3O3TA 3LFLA 4F82A 5A4VA 1OC9B 5D96A 2PU9C 3VPQA 1F6MC 3WT1A 1DSBA 2FHEA 5DCHA 3HJPA 4JZQA 2H74A 1W4VA 1YJ6A 4HS1A 4J57E 4N11A 2L5LA 1J9BA 2PUKC 2WRTA 3ZTLA 3UAPA 3IK9A 3VWVA 5B8AA 3FZ4A 4Z2TA 2VLTA 4N30A 4L0UA 1YY7A 3RPPA 1XW5A 2IJYA 2R3XA 4YQMA 2FA4A 1ILOA 2CA8A 5COHA 4XCSA 4QL9A 5H5SA 2I4AA 2JU5A 1SJ6A 3FRCA 5IOXA 5HR2A 3L9SA 1AQWA 3FMWA 1TTZA 22GSA 3GFKA 2EC4A 1GSUA 1KBNA 5DAKA 4IKHA 2LUSA 5IMAA 5IPHA 5AN1A 2VCWA 2C8UA 5JWQB 4BPYA 1G6WA 1XWBA 3G9BA 4EDZA 1ACVA 2VCTA 3D6IA 3O76A 1G7EA 19GSA 2GZZA 3UJ1A 1QQ2A 1TJDA 2LJAA 1HNBA 4FYBA 1B4PA 3US3A 2A4VA 3ZITA 3HVSA 4V2MA 5BRTA 1SK0A 5D73A 4RI7A 2GT5A 5ID2A 3EMPA 1X9SB 1HNAA 3HDCA 4FO5A 4HQSA 2OE3A 2RUEA 4F03A 3H4KA 3GV1A 2E2MA 2GSTA 2AHEA 2VCVA 3M1GA 3UVTA 2FNOA 2X99A 1Z6NA 2M80A 4MF7A 4WR5A 2KUCA 4J2FA 2GDRA 4K5RA 1KTEA 3LSZA 4I2UA 2MBSA 3LEFA 2X8HA 2PN8A 5JCWA 2MMZA 5IMDA 4ZL7A 2LRNA 5GAPD 4EXJA 1THOA 5EVOA 2R37A 2P5QA 4MMMA 1JFUA 5HQPA 4GTUA 2J23A 3DGQA 2B1KA 3CSJA 4BVYB 2FGXA 5KN3A 4XIHA 1SJIA 3GUSA 3MWHA 4KNDA 1YQ1A 3A5WA 3BOAA 5IMCA 3FZ9A 1PX6A 2N5BA 2FCHA 1LJRA 3M3MA 2FWGA 4MNNA 3VWXA 4K7OA 1O73A 2FLSA 5LD0A 3N5OA 2IMEA 3TKSC 4Q5RA 1F9MA 1K3YA 5BMUA 4POMA 3LGCA 4DVCA 2HE3A 4Z2UA 4J56E 1GSQA 4K1FA 2H01A 3E3EA 2EIRA 1N2AA 1ML6A 1V2AA 4EKZA 2AV4A 1X0RA 5B6MA 2WDUA 4P3YB 4N0ZA 1TRSA 2YV7A 1YEPA 4L5OA 1QK8A 2UZ8A 2O7KA 3GHAA 3ZIJA 1JZWA 2FD3A 1ZL9A 5ECRB 4IP1A 4V2LA 5AISA 2GTUA 1HQOA 2GSRA 3HYPA 1QUWA 3TJBA 2GSQA 1XBSA 1OVNA 3QCPA 3DXBA 3RHBA 1YF1A 1XWGA 2DBCA 3IR4A 1HYUA 1H75A 4MF5A 3IC8A 3HZ4A 5HR3A 3I6AA 3GKNA 2HRAA 5DQYA 2IMIA 3FR9A 4YKGA 1OKTA 4OCEA 3ME7A 3RAZA 1G7OA 2DMLA 4POBA 5F07A 4MH2A 1XWAA 5F8BA 4XTSA 3H8QA 5ENUA 5KOXA 5FWGA 2YWNA 4OFMA 1A2LA 3LQ7A 3APQA 2XPEA 4XS4A 3CXGA 1V98A 1IYHA 2K6VA 3CRTA 2PBJA 1ZYQB 5CRGA 4PXOA 3UEMA 3Q6OA 3GTUB 2OACA 2H6YA 4DEJA 3IBHA 2REMA 3TGZA 2F3MA 3QFAC 1T1VA 2CQ9A 2HZEB 3EU4A 4EL1A 4JEDA 1K0CA 1GTAA 4DSRA 1XOAA 2TRXA 2DJ3A 5ECMB 3HZ8A 3IAS2 4EVMA 5DJLA 1BG5A 1K0NA 4TR0A 3UMAA 2X49A 1A24A 1U3AA 3CBUA 5FHIA 4JE1A 3IRAA 1MD3A 3ZMLA 2RM5A 3J7Yk 4LL1B 3VWUA 2VD0A 3Q18A 3ME8A 6GSSA 2H19A 1ZOFA 5HFGA 3LG6A 4ZILA 2X8CA 4O7HA 1ABAA 4ZBAA 4Q5QA 1SYXA 3F0IA 3GSSA 4MH3A 4PQHA 3A2XA 4G0KA 4ECCA 3SWLA 2JZSA 1SKWB 1YEXA 3HD5A 2YV9A 1K3OA 2VO4A 1XW9A 4KGIA 3KTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRC A;  5ECN B;  4F9Z A;  3D22 A;  4AGS A;  1JHB A;  3P2A A;  3ERF A;  4XRD A;  4ZBD A;  2C80 A;  4QQ7 A;  3LYK A;  3IK7 A;  2HLS A;  4GF0 A;  5IOW A;  1RW1 A;  3FKF A;  1T7P B;  2DJ2 A;  1EWX A;  1W89 A;  6GSV A;  2BTO T;  2VL9 A;  4WEY A;  4ID0 A;  1SKS B;  5AIV A;  4KCE A;  3ZRE A;  4O92 A;  3RPN A;  4ZBB A;  1Z7P A;  2K9F A;  5L71 A;  5F05 A;  2H73 A;  2C4J A;  1EV4 A;  1NM3 A;  2FWF A;  1UVZ A;  3MSZ A;  1O85 A;  4DSQ A;  1K0M A;  2IFQ A;  5GSS A;  2H8L A;  1GUM A;  2JAC A;  3F4S A;  3GH6 A;  4ZB9 A;  4HUA A;  4NV5 A;  3DD3 A;  3GX8 A;  4IHU A;  1TOF A;  2XC2 A;  5CNW A;  2R6K A;  5KN1 A;  5DAL B;  1XWK A;  2EIO A;  1VF3 A;  3L78 A;  1I5G A;  2L6C A;  4MCU A;  1T8E B;  1EEM A;  4I97 A;  2WUL A;  4ML1 A;  4MK3 A;  1TU8 A;  2PER A;  5IO2 A;  2CZ2 A;  3KMN A;  5EPF A;  3PH9 A;  1WPI A;  4HQZ A;  1XCC A;  4MJB A;  5CRH A;  2OE0 A;  1VF1 A;  2H75 A;  4CDO A;  3OR5 A;  1OC9 A;  2DIY A;  1B8X A;  3I9V 2;  1TI1 A;  1GL8 A;  1M2D A;  1HNC A;  3DRN A;  5DJM A;  5JCU A;  1R4W A;  3EWL A;  3DIE A;  5G5F A;  1O6J A;  2J9H A;  4GWR A;  5B7C A;  3IDV A;  3UAR A;  1EGR A;  1YKA A;  2MMA A;  1ZYE A;  4PUR A;  4HJ2 A;  2ON5 A;  5AIX A;  1DUG A;  4I5Q A;  1Q4J A;  2R2J A;  5ELA A;  3DVX A;  4JBB A;  1EP8 A;  2CVB A;  4PQ1 A;  2H0G A;  1B48 A;  2YWM A;  3EMX A;  3E0U A;  4IW9 A;  3KP9 A;  4YAV A;  2CV4 A;  2EIQ A;  4WF5 A;  1BED A;  1GLQ A;  3LYP A;  1U3I A;  1CQH A;  3GKK A;  5J41 A;  3NOF A;  4LMV A;  6GSY A;  4GSS A;  5AGY A;  2H1B A;  3IV4 A;  2AB6 A;  3NIV A;  4DSS A;  2XPD A;  2V1M A;  5DBQ A;  2LNS A;  2DC5 A;  1R5A A;  1TI3 A;  2KHP A;  5CAX A;  4GQC A;  4E8H A;  3TJF A;  1I9D A;  3LXZ A;  1X5E A;  1TW9 A;  5ECP B;  5A4U A;  5D9X A;  2B1L A;  1WE0 A;  5D9W A;  2PPT A;  1Q98 A;  5B8B A;  3A2V A;  4MA9 A;  1NHO A;  1C72 A;  1BAY A;  1JZO A;  4H86 A;  3GMF A;  1URM A;  2C3T A;  5ECK B;  2XHF A;  1FVJ A;  5G30 A;  5G1L A;  3K8N A;  3QAV A;  2JSY A;  4XS1 A;  1PSQ A;  3F9U A;  2LQQ A;  3KH7 A;  1OC3 A;  3U5R E;  3R2Q A;  4IBP A;  5ABR A;  5F0G A;  4TOP A;  1EOH A;  1T4Y A;  1K0A A;  4FIW A;  1VRS D;  4FYC A;  4GSN A;  1E6B A;  4X0X A;  2O8V B;  3CTG A;  2P5R A;  1LBK A;  3FYG A;  1SL0 B;  1Z9H A;  2GQM A;  3TB2 A;  3HCZ A;  2GQK A;  4OMV A;  1ERT A;  3PIN A;  5JWR B;  17GS A;  1PKZ A;  5DAK B;  2H76 A;  4NPB A;  3KP8 A;  2L6D A;  1R5P A;  4IN0 A;  1PD2 1;  1V58 A;  2TIR A;  3QD9 A;  4AJ7 A;  4OO5 A;  1QXH A;  4LL4 B;  2LQO A;  2H66 A;  1S3C A;  3GUR A;  1GLP A;  1FAA A;  5ECQ B;  2R5G A;  1DE1 A;  2B3S A;  2GSS A;  2H1D A;  2V41 A;  2L4C A;  3KTL A;  3MDK A;  3Q74 A;  2LTK A;  2DIZ A;  13GS A;  2DLX A;  2OBK A;  6GST A;  2DJ1 A;  1MDJ A;  3EE2 A;  3GL5 A;  1EP7 A;  16GS A;  3IPZ A;  3JCM L;  1O8W A;  4ZL9 A;  4GRF A;  2O87 A;  3F6D A;  2YAN A;  2B5E A;  5G31 A;  1EEJ A;  5ID2 B;  1S3A A;  1AAZ A;  1ZZY A;  1FOV A;  1TRW A;  1WP0 A;  2KP2 A;  2YJ7 A;  4IEL A;  3EYT A;  5IM9 A;  4IS0 A;  14GS A;  4NV2 A;  1VF2 A;  1MEK A;  5LCZ A;  3BD2 A;  3LXT A;  2YWI A;  2B7J A;  2VLV A;  4K0G A;  4HOJ A;  5CP1 A;  2BJX A;  2NDO A;  3APS A;  1A0R P;  3APO A;  4OO4 A;  7GSS A;  2IIY A;  2VIM A;  2R4V A;  2QKE A;  1ERV A;  1M9B A;  1X5D A;  4ML6 A;  1GUL A;  2IMK A;  3GRX A;  5DCG A;  3DML A;  1J08 A;  3CTF A;  3TKP A;  3KMO A;  4G2E A;  4MJA A;  3VI5 A;  3C71 A;  4MP4 A;  3I69 A;  5ECH B;  4BA7 A;  2VOC A;  1MDK A;  1V9W A;  3F6F A;  2RII A;  11GS A;  3QOU A;  2H0I A;  4TR1 A;  1TDI A;  1BQ7 A;  2C3N A;  2F9S A;  2HXK A;  2HZE A;  1M2B A;  3GN3 A;  1B4Q A;  5INY A;  4D73 B;  1GSE A;  1AQX A;  2B6M A;  3FK8 A;  4POL A;  3KEB A;  3D4M A;  2LST A;  1AC1 A;  3TRX A;  5J5N A;  1SD8 A;  4K9Z A;  2L4Q A;  2V6K A;  4YH2 A;  3D21 A;  4K7I A;  5G2Z A;  2L59 A;  3W8S A;  3LWA A;  2X64 A;  5B6N A;  2CX3 A;  3FR3 A;  2TRC P;  5CO3 A;  5ECL B;  3ISO A;  2P31 A;  1XFL A;  4OFT A;  5G1K A;  3GST A;  2C1Y A;  1KNG A;  2C0E A;  5ECS A;  18GS A;  3UBK A;  1TXX A;  1OAZ A;  4IGJ A;  2RUF A;  2MZC A;  5G5E A;  3UOM A;  1YDK A;  2ZUP A;  4KSM A;  2NBS A;  1Z7R A;  2VUP A;  4OFN A;  2FWE A;  4HU7 A;  3TOT A;  2HYX A;  1YF0 A;  5CRD A;  4WXT A;  1DE2 A;  5D8I A;  3ED3 A;  2HRF A;  3KM6 A;  1MDI A;  2VM1 A;  4KX4 A;  1FO5 A;  5IMF A;  2HRN A;  1JZD A;  3D0Z A;  1O81 A;  2GT6 A;  4ZB6 A;  10GS A;  4ECB A;  2F51 A;  4XS4 B;  1GUH A;  1NW2 A;  4WF4 A;  5ECO B;  4YQV A;  2F8F A;  2O89 A;  4NMU A;  5DQS A;  4NHZ A;  4ZIJ A;  3CYN A;  1A0F A;  2PVQ A;  2YN1 A;  4WBJ A;  1GSS A;  2CZ3 A;  2HSH A;  3O6T A;  3CRU A;  4ZXG A;  3HXS A;  4K7N A;  5C04 A;  1FVK A;  1RQM A;  6GSW A;  2HSY A;  3KH9 A;  4TW5 A;  2JL4 A;  4FYU A;  4MF6 A;  3HJO A;  3WGX A;  3BJ5 A;  1M9A A;  3E9J B;  1M0U A;  1GH2 A;  3KD0 A;  5H5Q A;  1WWJ A;  3DEX A;  1GTI A;  2DJJ A;  3UVH A;  4TXO A;  5DAL A;  2CAQ A;  3IAM 2;  2H6X A;  5IQY A;  1SEN A;  2A2S A;  1AXD A;  3EUR A;  2ON7 A;  3C1S A;  1Y25 A;  1F37 A;  1WMJ A;  3RHC A;  1OKD A;  2MMO A;  3KGK A;  3PR8 A;  2C0G A;  1PRX A;  1TU7 A;  4IP6 A;  1PX7 A;  1WJK A;  2XBI A;  3FR6 A;  4KA0 A;  2MMN A;  2YP6 A;  2GZP A;  1GSF A;  1VF4 A;  4TVE A;  3TJG A;  4MLY A;  5J9B A;  1GNE A;  3GNJ A;  3WYW A;  3P7X A;  1GNW A;  2L5O A;  3L9V A;  1UC7 A;  3F8U A;  1ON4 A;  3TOU A;  1PL2 A;  4RI6 A;  2YPM A;  1FB0 A;  4MPG A;  4IJ3 A;  5FT3 A;  1NSW A;  1BJX A;  1GP1 A;  1UA5 A;  2H30 A;  1XW6 A;  1MTC A;  4JU5 A;  4RQX A;  1OE7 A;  3MNG A;  2K8V A;  20GS A;  2JAD A;  2OA7 A;  2JSZ A;  2GLR A;  1B9X C;  2VCQ A;  4I6X A;  4K8M A;  2JZT A;  4L8E A;  3TKQ A;  1EZK A;  3QDN A;  3UL3 A;  2RM6 A;  3L0H A;  2IFQ B;  4AJ6 A;  1WOU A;  4YAP A;  4IQA A;  1USB A;  3G7I A;  3I43 A;  2VLU A;  2VL2 A;  2HNL A;  3HY2 A;  4JR6 A;  5J9C A;  4MAB A;  3L4N A;  3ZLP A;  1Z3E A;  2N5A A;  3QMX A;  2ZCT A;  1JZR A;  1SYR A;  1T00 A;  1SU9 A;  4EF0 A;  2YZU A;  3ZVJ D;  3C1R A;  4GQF A;  3F63 A;  1X5C A;  4KSO A;  4LLR A;  4LA1 A;  3L9U A;  3ERW A;  3AY8 A;  4KCA A;  1A8Y A;  1BX9 A;  3FW2 A;  4ZL8 A;  1TK5 B;  1AIU A;  2P0G A;  1FG4 A;  2WCI A;  4HZ2 A;  2KOK A;  3EVI A;  4LMW A;  3M9K A;  1RK4 A;  4KW6 A;  1WIK A;  3VK9 A;  4RUV A;  3GKX A;  4K2D A;  1YKC A;  4I2T A;  2YZH A;  1QFN A;  5D9T A;  2OBI A;  4XRA A;  4JR4 A;  3ZFL A;  3IC4 A;  1EOG A;  2DJK A;  2LJR A;  4EUY A;  4V2N A;  2BMX A;  1U88 A;  4AJ8 A;  1AQV A;  1K0D A;  1N8J A;  5JCG A;  3HHV A;  3GX0 A;  3F4R A;  3VLN A;  4OD7 A;  6GSX A;  4WET A;  5ELG A;  1SD9 A;  4POK A;  1KEB A;  2WFC A;  3HKR A;  1OYJ A;  3GIX A;  3IE3 A;  3QPM A;  1JLW A;  3WT2 A;  9GSS A;  1XWC A;  3IOS A;  2CVK A;  5CRW A;  2FY6 A;  2HZF A;  2DMM A;  4XHM A;  2GVP A;  1YZX A;  2WGR A;  3IXR A;  5EL8 A;  1XVQ A;  4DSS B;  1B9Y C;  2I1U A;  4ZB8 A;  2E7P A;  2Z9S A;  2I81 A;  2CVD A;  4ILF A;  1GTB A;  2H0H A;  2K18 A;  3KIJ A;  3UBL A;  1M7T A;  1O7U A;  4WKW A;  3FZ5 A;  4HDE A;  2QC7 A;  3GKM A;  4KE3 A;  3FZA A;  3QAW A;  3TRP A;  3BCK A;  1U6T A;  4IVF A;  2GS3 A;  4BVY A;  4IJI A;  5A4W A;  1JLV A;  5IMV A;  4EE0 A;  2D2Z A;  3U6V A;  4MJC A;  4K0N A;  1MD4 A;  1NHY A;  1T4Z A;  3F3R A;  3TJK A;  3IHQ A;  3GA4 A;  3ZRD A;  2VD1 A;  3QAG A;  5D9V A;  1TK0 B;  1FB6 A;  3MAK A;  2YJH A;  2H6Z A;  3TUE A;  4XS6 A;  5HFI A;  2CAI A;  1GSY A;  4GCI A;  5GZZ B;  2LJK A;  3QFB C;  1SKR B;  1GRX A;  3IA1 A;  1THX A;  2VAF A;  4FH8 A;  4N10 A;  3HA9 A;  3LOR A;  2ALB A;  1SL1 B;  1TRU A;  1ZCP A;  2C3Q A;  3CMI A;  1ZGN A;  2VM2 A;  1A8L A;  3D5J A;  2LEG A;  3TCO A;  1V40 A;  4I8B A;  5J4U A;  4GXZ A;  3DVW A;  5IPG A;  3C7M A;  3H1N A;  3CSI A;  4PNG A;  2YOI A;  4QL7 A;  2MYG A;  3WGE A;  1A23 A;  4PUF C;  2LS5 A;  4JRR A;  2A2R A;  1VGL A;  1GSD A;  2C0D A;  3QR6 A;  4PUA A;  4D73 A;  3VI7 A;  3VWW A;  4KDY A;  1H4O A;  5J3R A;  4ECJ A;  1F3B A;  1WRY A;  1PGT A;  4F0C A;  1Z5Y E;  3TJJ A;  1O8X A;  2HI7 A;  3DWV A;  2NVL A;  5EY6 A;  4ACS A;  4NHW A;  3S9F A;  3KJY A;  5GAN D;  3TKS A;  3KXO A;  4WR4 A;  3ZL5 A;  2YNX A;  2IMF A;  2YCD A;  1SJZ A;  4EDY A;  4HEA 2;  5KN2 A;  2OKA A;  3RBT A;  1GTU A;  3A2W A;  3EU3 A;  1ERU A;  2GZY A;  3GTU A;  2FWH A;  4ECI A;  1M2A A;  4ISD A;  3FHK A;  4L5L A;  3ZVJ A;  1V57 A;  2YWO A;  4PQI A;  1QGV A;  4OCF A;  4BL7 A;  1OC8 A;  3GL3 A;  1AW9 A;  3H93 A;  2AYT A;  2AUV A;  1K0O A;  3VUR A;  6GSU A;  2H70 A;  2FA8 A;  2ZNM A;  1F3A A;  1LU4 A;  4KDU A;  3W6G A;  4Z7X A;  1XPV A;  2V32 A;  2H1A A;  2HT9 A;  3ZMK A;  5DDL A;  4N0V A;  4WBR D;  4E8E A;  3PGT A;  1TP9 A;  4MZB A;  1FHE A;  2PMT A;  1TRV A;  3C73 A;  2PVO C;  3KZQ A;  1XIY A;  5A5K A;  2H71 A;  1OE8 A;  5DVB A;  3P8W A;  1PA3 A;  2N5F A;  4Q5F A;  3M0F A;  3P90 A;  1CQG A;  5IO0 A;  2QGV A;  2WS2 A;  4PGT A;  1G6Y A;  1PKW A;  2PWJ A;  2B5Y A;  3BCI A;  4OWY A;  4HI7 A;  3D4T A;  4TR1 B;  4F2I A;  3J7Y b;  1ZMA A;  3N9J A;  5HFK A;  8GSS A;  1U87 A;  3WD6 A;  3RDW A;  4PX1 A;  4YQU A;  4TXV A;  1E2Y A;  3SBC A;  4G10 A;  5LNK e;  3UIW A;  2E2G A;  3M8N A;  2DJ0 A;  4HJM A;  3TDG A;  2LRT A;  3GYK A;  1G0T A;  1K3L A;  2B7K A;  3DKS A;  5JWO B;  12GS A;  1XOB A;  3F4T A;  2NPB A;  4G9H A;  2ES7 A;  2IN3 A;  5C00 A;  2DSA A;  3EIN A;  1SK1 A;  4V1A g;  1S3D A;  2WB9 A;  4BWQ A;  2B5X A;  2VCX A;  2L57 A;  4NAX A;  2G0F A;  4PNF A;  4CW9 A;  5E59 A;  3M9J A;  2V6O A;  5IMZ A;  4KUN A;  4NWY A;  5HR1 A;  4KAE A;  4MPF A;  3ZYW A;  1AUC A;  4Q5N A;  2XBQ A;  1UN2 A;  2OJL A;  1XXU A;  2PGT A;  2GGT A;  3G7J A;  1A2M A;  4KH7 A;  5HR0 A;  5IIZ A;  4EC0 A;  4GST A;  3ZFB A;  2FUG 2;  2VL3 A;  3BBY A;  2H72 A;  1TK8 B;  3VFI A;  2WZ9 A;  2IMD A;  3TKR A;  4TN8 A;  3DYR A;  3V1W A;  1J0F A;  5E4W A;  2O85 A;  5KEJ A;  3NZN A;  2I3Y A;  2IL3 A;  1PQN A;  5D93 A;  1R26 A;  1M99 A;  2C0F A;  2WJU A;  2AAW A;  1GUK A;  4X1U A;  1T3B A;  1ST9 A;  2K8S A;  2CT6 A;  4TRX A;  1PMT A;  4BVX A;  2X8G A;  1PL1 A;  2I9H A;  4MZC A;  4HZ4 A;  2F8A A;  2OE1 A;  1QMV A;  4RQR A;  3FY7 A;  3CSH A;  1HD2 A;  3G7Y A;  4IQ1 A;  2LV3 A;  1EGO A;  2LKU A;  1DBY A;  5GST A;  4KDX A;  1TKD B;  3VPT A;  4HU9 A;  4CHS A;  3HVV A;  4AF2 A;  5KN0 A;  2MBT A;  4TXO B;  3A3T A;  4MZW A;  3LJR A;  5CYY A;  3TRQ A;  3WGD A;  2RLI A;  4MJE A;  5CRE A;  1X9W B;  1IYI A;  3EC3 A;  4TKY A;  5ECI B;  1GWC A;  2VCZ A;  2VL2 C;  1BYE A;  3C8E A;  4K6X A;  1XZO A;  4L0W A;  2JZR A;  1Z6M A;  4O5R A;  3ZZX A;  1K0B A;  3TKS E;  3HVX A;  2M72 A;  4O32 A;  1R7H A;  2G2Q A;  2NTO A;  4BWS A;  2GQL A;  4F0B A;  2IWT A;  1EV9 A;  3F3Q A;  4X43 A;  4G19 A;  4EO3 A;  4V1A p;  3H79 A;  3Q19 A;  2KLX A;  1FW1 A;  1SK2 A;  2LNT A;  4ULX A;  2HFD A;  1ERW A;  1F2E A;  5F06 A;  4TR4 A;  2QSI A;  2M46 A;  4NXI A;  5H5R A;  1PN9 A;  3GH9 A;  3KCM A;  1Y6E A;  1X9M B;  4MDC A;  2CX4 A;  4TR3 A;  2AJQ B;  1A2J A;  3W8J A;  2KP1 A;  3HJM A;  2H1G A;  1XVW A;  3ERG A;  3ZIV A;  4GLT A;  2E0Q A;  1SL2 B;  4KB3 A;  2V2G A;  2IPA A;  3FEU A;  2OAD A;  3O3T A;  3LFL A;  4F82 A;  5A4V A;  1OC9 B;  5D96 A;  2PU9 C;  3VPQ A;  1F6M C;  3WT1 A;  1DSB A;  2FHE A;  5DCH A;  3HJP A;  4JZQ A;  2H74 A;  1W4V A;  1YJ6 A;  4HS1 A;  4J57 E;  4N11 A;  2L5L A;  1J9B A;  2PUK C;  2WRT A;  3ZTL A;  3UAP A;  3IK9 A;  3VWV A;  5B8A A;  3FZ4 A;  2VLT A;  4N30 A;  4L0U A;  1YY7 A;  3RPP A;  1XW5 A;  2IJY A;  2R3X A;  4YQM A;  2FA4 A;  1ILO A;  2CA8 A;  5COH A;  4XCS A;  4QL9 A;  5H5S A;  2I4A A;  2JU5 A;  1SJ6 A;  3FRC A;  5IOX A;  5HR2 A;  3L9S A;  1AQW A;  1TTZ A;  22GS A;  3GFK A;  2EC4 A;  1GSU A;  1KBN A;  5DAK A;  4IKH A;  2LUS A;  5IMA A;  5IPH A;  5AN1 A;  2VCW A;  2C8U A;  5JWQ B;  4BPY A;  1G6W A;  1XWB A;  3G9B A;  4EDZ A;  1ACV A;  2VCT A;  3D6I A;  3O76 A;  1G7E A;  19GS A;  2GZZ A;  3UJ1 A;  1QQ2 A;  1TJD A;  2LJA A;  1HNB A;  4FYB A;  1B4P A;  3US3 A;  2A4V A;  3ZIT A;  3HVS A;  4V2M A;  1SK0 A;  5D73 A;  4RI7 A;  2GT5 A;  5ID2 A;  3EMP A;  1X9S B;  1HNA A;  3HDC A;  4FO5 A;  4HQS A;  2OE3 A;  2RUE A;  4F03 A;  3H4K A;  3GV1 A;  2E2M A;  2GST A;  2AHE A;  2VCV A;  3M1G A;  3UVT A;  2FNO A;  2X99 A;  1Z6N A;  2M80 A;  4MF7 A;  4WR5 A;  2KUC A;  4J2F A;  2GDR A;  1KTE A;  3LSZ A;  4I2U A;  2MBS A;  3LEF A;  2X8H A;  2PN8 A;  5JCW A;  2MMZ A;  5IMD A;  4ZL7 A;  2LRN A;  5GAP D;  4EXJ A;  1THO A;  5EVO A;  2R37 A;  2P5Q A;  4MMM A;  1JFU A;  5HQP A;  4GTU A;  2J23 A;  3DGQ A;  2B1K A;  3CSJ A;  2FGX A;  5KN3 A;  4XIH A;  1SJI A;  3GUS A;  3MWH A;  4KND A;  1YQ1 A;  3A5W A;  3BOA A;  5IMC A;  3FZ9 A;  1PX6 A;  2N5B A;  2FCH A;  1LJR A;  3M3M A;  2FWG A;  3VWX A;  4K7O A;  1O73 A;  2FLS A;  5LD0 A;  3N5O A;  2IME A;  3TKS C;  4Q5R A;  1F9M A;  1K3Y A;  4POM A;  3LGC A;  4DVC A;  2HE3 A;  4J56 E;  1GSQ A;  4K1F A;  2H01 A;  3E3E A;  2EIR A;  1N2A A;  1ML6 A;  1V2A A;  4EKZ A;  2AV4 A;  1X0R A;  5B6M A;  2WDU A;  4P3Y B;  4N0Z A;  1TRS A;  2YV7 A;  1YEP A;  4L5O A;  1QK8 A;  2O7K A;  3GHA A;  3ZIJ A;  1JZW A;  2FD3 A;  1ZL9 A;  5ECR B;  4IP1 A;  4V2L A;  5AIS A;  2GTU A;  1HQO A;  2GSR A;  3HYP A;  1QUW A;  3TJB A;  2GSQ A;  1XBS A;  1OVN A;  3QCP A;  3DXB A;  3RHB A;  1YF1 A;  1XWG A;  2DBC A;  3IR4 A;  1HYU A;  1H75 A;  4MF5 A;  3HZ4 A;  5HR3 A;  3I6A A;  3GKN A;  5DQY A;  2IMI A;  3FR9 A;  1OKT A;  4OCE A;  3ME7 A;  3RAZ A;  1G7O A;  2DML A;  4POB A;  5F07 A;  4MH2 A;  1XWA A;  5F8B A;  4XTS A;  3H8Q A;  5ENU A;  5FWG A;  2YWN A;  4OFM A;  1A2L A;  3LQ7 A;  3APQ A;  2XPE A;  4XS4 A;  3CXG A;  1V98 A;  1IYH A;  2K6V A;  3CRT A;  2PBJ A;  1ZYQ B;  5CRG A;  4PXO A;  3UEM A;  3Q6O A;  3GTU B;  2OAC A;  2H6Y A;  4DEJ A;  3IBH A;  2REM A;  3TGZ A;  2F3M A;  3QFA C;  1T1V A;  2CQ9 A;  2HZE B;  3EU4 A;  4EL1 A;  4JED A;  1K0C A;  1GTA A;  4DSR A;  1XOA A;  2TRX A;  2DJ3 A;  5ECM B;  3HZ8 A;  3IAS 2;  4EVM A;  5DJL A;  1BG5 A;  1K0N A;  4TR0 A;  3UMA A;  1A24 A;  1U3A A;  3CBU A;  5FHI A;  4JE1 A;  3IRA A;  1MD3 A;  3ZML A;  2RM5 A;  3J7Y k;  4LL1 B;  3VWU A;  2VD0 A;  3Q18 A;  3ME8 A;  6GSS A;  2H19 A;  1ZOF A;  5HFG A;  3LG6 A;  4ZIL A;  2X8C A;  4O7H A;  1ABA A;  4ZBA A;  4Q5Q A;  1SYX A;  3F0I A;  3GSS A;  4MH3 A;  4PQH A;  3A2X A;  4ECC A;  3SWL A;  2JZS A;  1SKW B;  1YEX A;  2YV9 A;  3HD5 A;  1K3O A;  2VO4 A;  1XW9 A;  4KGI A;  3KTB A; 
#chains in the Genus database with same CATH topology
 2LRC A;  5ECN B;  4F9Z A;  3D22 A;  4AGS A;  1JHB A;  3P2A A;  3ERF A;  4XRD A;  4ZBD A;  2C80 A;  4QQ7 A;  3LYK A;  3IK7 A;  2HLS A;  4GF0 A;  5IOW A;  1RW1 A;  3FKF A;  1T7P B;  2DJ2 A;  4ICY A;  1EWX A;  1W89 A;  6GSV A;  2BTO T;  2VL9 A;  4WEY A;  4ID0 A;  1SKS B;  5AIV A;  4KCE A;  3ZRE A;  4O92 A;  3RPN A;  4ZBB A;  1Z7P A;  3LW9 A;  2K9F A;  5L71 A;  5F05 A;  2H73 A;  2C4J A;  1EV4 A;  1NM3 A;  2FWF A;  1UVZ A;  2R0G A;  3MSZ A;  1O85 A;  4DSQ A;  1K0M A;  2IFQ A;  5GSS A;  2H8L A;  1GUM A;  2HRK A;  2JAC A;  3F4S A;  3GH6 A;  4ZB9 A;  5KOW A;  4HUA A;  4NV5 A;  3DD3 A;  3GX8 A;  4IHU A;  1TOF A;  2XC2 A;  5CNW A;  2R6K A;  5KN1 A;  5DAL B;  1XWK A;  2EIO A;  1VF3 A;  3L78 A;  1I5G A;  2L6C A;  4MCU A;  1T8E B;  1EEM A;  4I97 A;  2WUL A;  4ML1 A;  4MK3 A;  1TU8 A;  2PER A;  5IO2 A;  2CZ2 A;  3KMN A;  5EPF A;  3PH9 A;  1WPI A;  4HQZ A;  1XCC A;  4MJB A;  5CRH A;  2OE0 A;  1S3R A;  1VF1 A;  2H75 A;  4CDO A;  3OR5 A;  1OC9 A;  2DIY A;  1B8X A;  3I9V 2;  1TI1 A;  1GL8 A;  1M2D A;  1HNC A;  3DRN A;  5DJM A;  5JCU A;  2X4A A;  1R4W A;  3EWL A;  3DIE A;  5G5F A;  1O6J A;  2J9H A;  3CQF A;  4GWR A;  5B7C A;  3IDV A;  3UAR A;  1EGR A;  1YKA A;  2MMA A;  1ZYE A;  4PUR A;  4HJ2 A;  2ON5 A;  5AIX A;  1DUG A;  4I5Q A;  1Q4J A;  2R2J A;  5ELA A;  3DVX A;  4JBB A;  1EP8 A;  2CVB A;  4PQ1 A;  4USS A;  2H0G A;  1B48 A;  2YWM A;  3EMX A;  3E0U A;  4IW9 A;  3KP9 A;  4YAV A;  2CV4 A;  2EIQ A;  4WF5 A;  1BED A;  1GLQ A;  3LYP A;  1U3I A;  1CQH A;  3GKK A;  5J41 A;  3NOF A;  4LMV A;  6GSY A;  4GSS A;  5AGY A;  2H1B A;  3IV4 A;  2AB6 A;  3NIV A;  4DSS A;  2XPD A;  2V1M A;  5DBQ A;  2LNS A;  2DC5 A;  1FOH A;  1R5A A;  1TI3 A;  2KHP A;  5CAX A;  4GQC A;  4E8H A;  3TJF A;  1I9D A;  3LXZ A;  1X5E A;  1TW9 A;  5ECP B;  5A4U A;  5D9X A;  2B1L A;  1WE0 A;  5D9W A;  2PPT A;  1Q98 A;  5B8B A;  3A2V A;  4MA9 A;  1NHO A;  1C72 A;  1BAY A;  1JZO A;  4H86 A;  3GMF A;  1URM A;  2C3T A;  5ECK B;  2XHF A;  1FVJ A;  5G30 A;  5G1L A;  3K8N A;  3QAV A;  2JSY A;  4XS1 A;  1PSQ A;  3F9U A;  2LQQ A;  3KH7 A;  1OC3 A;  3U5R E;  3R2Q A;  4IBP A;  5ABR A;  4K5S A;  5F0G A;  4TOP A;  1EOH A;  1T4Y A;  1K0A A;  4FIW A;  4G0I A;  1VRS D;  4FYC A;  4GSN A;  1E6B A;  4X0X A;  2O8V B;  3CTG A;  2P5R A;  1LBK A;  3FYG A;  4O5U A;  1SL0 B;  1Z9H A;  2GQM A;  3TB2 A;  3HCZ A;  2GQK A;  4OMV A;  1ERT A;  3PIN A;  5JWR B;  17GS A;  1PKZ A;  5DAK B;  2H76 A;  4NPB A;  3KP8 A;  2L6D A;  1R5P A;  4IN0 A;  1PD2 1;  1V58 A;  2TIR A;  3QD9 A;  4AJ7 A;  4OO5 A;  1QXH A;  4LL4 B;  2LQO A;  2H66 A;  1S3C A;  3GUR A;  1GLP A;  1FAA A;  5ECQ B;  2R5G A;  1DE1 A;  2B3S A;  2GSS A;  2H1D A;  2V41 A;  1ZYN A;  2L4C A;  3KTL A;  3MDK A;  3Q74 A;  2LTK A;  2DIZ A;  13GS A;  2DLX A;  2OBK A;  6GST A;  2DJ1 A;  1MDJ A;  3EE2 A;  3GL5 A;  1EP7 A;  16GS A;  3IPZ A;  3JCM L;  1O8W A;  4ZL9 A;  4GRF A;  2O87 A;  3F6D A;  2YAN A;  2B5E A;  5G31 A;  1EEJ A;  5ID2 B;  1S3A A;  1AAZ A;  1ZZY A;  1FOV A;  1TRW A;  1WP0 A;  2KP2 A;  2YJ7 A;  4IEL A;  3EYT A;  4EIP A;  5IM9 A;  4IS0 A;  14GS A;  4NV2 A;  1VF2 A;  1MEK A;  5LCZ A;  3BD2 A;  3LXT A;  2YWI A;  2B7J A;  2VLV A;  4K0G A;  4HOJ A;  5CP1 A;  2BJX A;  2NDO A;  3APS A;  1A0R P;  3APO A;  4OO4 A;  7GSS A;  2IIY A;  2VIM A;  2R4V A;  2QKE A;  1ERV A;  1M9B A;  1X5D A;  4ML6 A;  1GUL A;  2IMK A;  3GRX A;  5DCG A;  3DML A;  1J08 A;  3CTF A;  3TKP A;  3KMO A;  4G2E A;  4MJA A;  3VI5 A;  3C71 A;  4MP4 A;  2DKI A;  3I69 A;  5ECH B;  4BA7 A;  2VOC A;  1MDK A;  1V9W A;  3F6F A;  2RII A;  11GS A;  3QOU A;  2H0I A;  4TR1 A;  1TDI A;  1BQ7 A;  2C3N A;  2F9S A;  2HXK A;  2HZE A;  1M2B A;  3GN3 A;  1B4Q A;  5INY A;  4D73 B;  1GSE A;  1AQX A;  2B6M A;  3FK8 A;  4POL A;  3KEB A;  3D4M A;  2LST A;  1AC1 A;  3TRX A;  5J5N A;  1SD8 A;  4K9Z A;  2L4Q A;  2V6K A;  4YH2 A;  3D21 A;  4K7I A;  5G2Z A;  2L59 A;  3W8S A;  3LWA A;  2X64 A;  5B6N A;  2CX3 A;  3FR3 A;  2TRC P;  5CO3 A;  5ECL B;  3ISO A;  2P31 A;  1XFL A;  4OFT A;  5G1K A;  3GST A;  2C1Y A;  1KNG A;  2C0E A;  5ECS A;  18GS A;  3UBK A;  1TXX A;  1OAZ A;  4IGJ A;  2RUF A;  2MZC A;  4BL7 B;  5G5E A;  3UOM A;  1YDK A;  2ZUP A;  4KSM A;  2NBS A;  1Z7R A;  2VUP A;  4OFN A;  2FWE A;  4HU7 A;  4PTS A;  3TOT A;  2HYX A;  1YF0 A;  5CRD A;  4WXT A;  1DE2 A;  5D8I A;  3ED3 A;  2HRF A;  3KM6 A;  1MDI A;  2VM1 A;  4KX4 A;  1FO5 A;  5IMF A;  2HRN A;  1JZD A;  3D0Z A;  1O81 A;  2GT6 A;  4ZB6 A;  10GS A;  2QA2 A;  4ECB A;  2F51 A;  4XS4 B;  1GUH A;  1NW2 A;  4WF4 A;  5ECO B;  4YQV A;  2F8F A;  2O89 A;  4NMU A;  5DQS A;  4NHZ A;  4ZIJ A;  3CYN A;  1A0F A;  2PVQ A;  2YN1 A;  4WBJ A;  1GSS A;  2CZ3 A;  2HSH A;  3O6T A;  3CRU A;  4ZXG A;  3HXS A;  4K7N A;  5C04 A;  1FVK A;  1RQM A;  6GSW A;  2HSY A;  3KH9 A;  4TW5 A;  2JL4 A;  4FYU A;  4MF6 A;  3HJO A;  3WGX A;  3BJ5 A;  1M9A A;  3E9J B;  1M0U A;  4FQU A;  1GH2 A;  3KD0 A;  5H5Q A;  1WWJ A;  3DEX A;  4CY6 A;  1GTI A;  2DJJ A;  3UVH A;  4TXO A;  5DAL A;  2CAQ A;  3IAM 2;  2H6X A;  5IQY A;  1SEN A;  2A2S A;  4EIQ A;  2DKH A;  1AXD A;  3EUR A;  2ON7 A;  3C1S A;  1Y25 A;  1F37 A;  1WMJ A;  3RHC A;  1OKD A;  2MMO A;  3KGK A;  3PR8 A;  2C0G A;  1PRX A;  1TU7 A;  4IP6 A;  1PX7 A;  1WJK A;  2XBI A;  3FR6 A;  4KA0 A;  2MMN A;  2YP6 A;  2GZP A;  1GSF A;  1VF4 A;  4TVE A;  3TJG A;  4MLY A;  4KF9 A;  5J9B A;  1GNE A;  3GNJ A;  3WYW A;  3P7X A;  1GNW A;  2L5O A;  3L9V A;  1UC7 A;  3F8U A;  1ON4 A;  3TOU A;  1PL2 A;  4RI6 A;  2YPM A;  1FB0 A;  4MPG A;  4IJ3 A;  5FT3 A;  1NSW A;  1BJX A;  1GP1 A;  1UA5 A;  4O5Q A;  2H30 A;  1XW6 A;  1MTC A;  4JU5 A;  4RQX A;  1OE7 A;  3MNG A;  2K8V A;  20GS A;  2JAD A;  2OA7 A;  2JSZ A;  2GLR A;  1B9X C;  2VCQ A;  4I6X A;  4K8M A;  2JZT A;  4L8E A;  3TKQ A;  1EZK A;  4BVX B;  3QDN A;  3UL3 A;  2RM6 A;  3L0H A;  2IFQ B;  4AJ6 A;  1WOU A;  4YAP A;  3IHG A;  4IQA A;  1USB A;  3G7I A;  3I43 A;  2VLU A;  2VL2 A;  2HNL A;  3HY2 A;  4JR6 A;  5J9C A;  4MAB A;  3L4N A;  3ZLP A;  1Z3E A;  2N5A A;  3QMX A;  2ZCT A;  1JZR A;  1SYR A;  1T00 A;  1SU9 A;  4EF0 A;  2YZU A;  3ZVJ D;  3C1R A;  4GQF A;  3F63 A;  1X5C A;  4KSO A;  4LLR A;  4LA1 A;  3L9U A;  3ERW A;  3AY8 A;  4KCA A;  1A8Y A;  1BX9 A;  3FW2 A;  4ZL8 A;  1TK5 B;  1AIU A;  2P0G A;  1FG4 A;  2WCI A;  4HZ2 A;  2KOK A;  3EVI A;  4LMW A;  3M9K A;  1RK4 A;  4KW6 A;  1WIK A;  3VK9 A;  4HSC X;  4RUV A;  3GKX A;  4K2D A;  1YKC A;  4I2T A;  2YZH A;  1QFN A;  5D9T A;  2OBI A;  4XRA A;  4JR4 A;  4K2X A;  3ZFL A;  3IC4 A;  1EOG A;  2DJK A;  2LJR A;  4EUY A;  4V2N A;  2BMX A;  1U88 A;  4AJ8 A;  1AQV A;  1K0D A;  1N8J A;  5JCG A;  3HHV A;  3GX0 A;  3F4R A;  3VLN A;  4OD7 A;  6GSX A;  4WET A;  3A5I A;  5ELG A;  1SD9 A;  4POK A;  1KEB A;  2WFC A;  3HKR A;  1OYJ A;  3GIX A;  3IE3 A;  3QPM A;  1JLW A;  3WT2 A;  9GSS A;  1XWC A;  3IOS A;  2CVK A;  5CRW A;  2FY6 A;  2HZF A;  2DMM A;  4XHM A;  2GVP A;  1YZX A;  1PN0 A;  2WGR A;  3IXR A;  5EL8 A;  1XVQ A;  4DSS B;  1B9Y C;  1XG8 A;  2I1U A;  4ZB8 A;  2E7P A;  2Z9S A;  2I81 A;  2CVD A;  4ILF A;  1GTB A;  2H0H A;  2K18 A;  3KIJ A;  3UBL A;  4A5P A;  1M7T A;  1O7U A;  3MYD A;  4WKW A;  3FZ5 A;  4HDE A;  2QC7 A;  3GKM A;  4KE3 A;  3FZA A;  3QAW A;  3TRP A;  3BCK A;  1U6T A;  4IVF A;  2R0P A;  4G0L A;  2GS3 A;  4BVY A;  4IJI A;  5A4W A;  1JLV A;  5IMV A;  4EE0 A;  2D2Z A;  3U6V A;  4MJC A;  4K0N A;  1MD4 A;  1NHY A;  1T4Z A;  3F3R A;  3TJK A;  3IHQ A;  3GA4 A;  3ZRD A;  2VD1 A;  3QAG A;  5D9V A;  1TK0 B;  1FB6 A;  3MAK A;  2YJH A;  2H6Z A;  3TUE A;  4XS6 A;  5HFI A;  2CAI A;  2A2P A;  1GSY A;  4GCI A;  5GZZ B;  2LJK A;  3QFB C;  1SKR B;  1GRX A;  3IA1 A;  1THX A;  2VAF A;  4FH8 A;  4N10 A;  3HA9 A;  3LOR A;  2ALB A;  3HVN A;  1SL1 B;  1TRU A;  1ZCP A;  2C3Q A;  3CMI A;  1ZGN A;  2VM2 A;  1A8L A;  3D5J A;  2LEG A;  3TCO A;  1V40 A;  4I8B A;  5J4U A;  4GXZ A;  3DVW A;  5IPG A;  3C7M A;  3H1N A;  3CSI A;  4PNG A;  2YOI A;  4QL7 A;  2MYG A;  3WGE A;  1A23 A;  4PUF C;  2LS5 A;  4JRR A;  2A2R A;  1VGL A;  1GSD A;  2C0D A;  3QR6 A;  4PUA A;  4D73 A;  3VI7 A;  3VWW A;  4KDY A;  1H4O A;  5J3R A;  4ECJ A;  1F3B A;  1WRY A;  1PGT A;  4F0C A;  1Z5Y E;  3TJJ A;  1O8X A;  2HI7 A;  3DWV A;  2NVL A;  5EY6 A;  4ACS A;  4NHW A;  3S9F A;  3KJY A;  5GAN D;  3TKS A;  3KXO A;  4WR4 A;  3R3E A;  3ZL5 A;  2YNX A;  2IMF A;  2YCD A;  1SJZ A;  4EDY A;  4HEA 2;  5KN2 A;  2QA1 A;  2OKA A;  2A4H A;  3RBT A;  1GTU A;  3A2W A;  3PPU A;  3EU3 A;  1ERU A;  3MIX A;  2GZY A;  3GTU A;  2FWH A;  4ECI A;  1M2A A;  4ISD A;  3EPT A;  3FHK A;  4L5L A;  4YKF A;  3ZVJ A;  1V57 A;  2YWO A;  4PQI A;  1QGV A;  4OCF A;  4BL7 A;  1OC8 A;  3GL3 A;  1AW9 A;  3H93 A;  2AYT A;  2AUV A;  4CY8 A;  4X4J A;  1K0O A;  3VUR A;  6GSU A;  2H70 A;  2FA8 A;  2ZNM A;  1F3A A;  1LU4 A;  4KDU A;  3W6G A;  4Z7X A;  1XPV A;  2V32 A;  2H1A A;  2HT9 A;  3ZMK A;  5DDL A;  4N0V A;  4WBR D;  4E8E A;  3PGT A;  1TP9 A;  4MZB A;  1FHE A;  2PMT A;  1TRV A;  3C73 A;  2PVO C;  3KZQ A;  1XIY A;  5A5K A;  2H71 A;  1OE8 A;  5DVB A;  3P8W A;  1PA3 A;  2N5F A;  4Q5F A;  3M0F A;  3P90 A;  1CQG A;  5IO0 A;  2QGV A;  2WS2 A;  4PGT A;  1G6Y A;  1PKW A;  2PWJ A;  2B5Y A;  3BCI A;  1ZYP A;  4OWY A;  4HI7 A;  3D4T A;  4TR1 B;  4F2I A;  3J7Y b;  1ZMA A;  3N9J A;  5HFK A;  8GSS A;  1U87 A;  3WD6 A;  3RDW A;  4PX1 A;  4YQU A;  4TXV A;  1E2Y A;  3SBC A;  4G10 A;  5LNK e;  3UIW A;  2E2G A;  3M8N A;  2DJ0 A;  4HJM A;  3TDG A;  2LRT A;  3GYK A;  1G0T A;  1K3L A;  2B7K A;  3DKS A;  5JWO B;  12GS A;  1XOB A;  3F4T A;  2NPB A;  4G9H A;  2ES7 A;  2IN3 A;  5C00 A;  2DSA A;  3EIN A;  1SK1 A;  4V1A g;  1S3D A;  2WB9 A;  4BWQ A;  2B5X A;  2VCX A;  2L57 A;  4NAX A;  2G0F A;  4PNF A;  4CW9 A;  5E59 A;  3M9J A;  2V6O A;  5IMZ A;  4KUN A;  4NWY A;  5HR1 A;  4KAE A;  4MPF A;  3ZYW A;  1AUC A;  4Q5N A;  2XBQ A;  1UN2 A;  2OJL A;  2R0C A;  1XXU A;  2PGT A;  2GGT A;  3G7J A;  1A2M A;  4KH7 A;  5HR0 A;  5IIZ A;  4EC0 A;  4GST A;  3ZFB A;  2FUG 2;  2VL3 A;  3BBY A;  2H72 A;  1TK8 B;  3VFI A;  2WZ9 A;  2IMD A;  3TKR A;  4TN8 A;  3DYR A;  3V1W A;  1J0F A;  5E4W A;  2O85 A;  5KEJ A;  3NZN A;  2I3Y A;  2IL3 A;  1PQN A;  5D93 A;  1R26 A;  1M99 A;  2C0F A;  2WJU A;  2AAW A;  1GUK A;  4X1U A;  1T3B A;  4Z2R A;  1ST9 A;  2K8S A;  2CT6 A;  4TRX A;  1PMT A;  4BVX A;  2X8G A;  1PL1 A;  2I9H A;  4MZC A;  4HZ4 A;  2F8A A;  2OE1 A;  1QMV A;  4RQR A;  3FY7 A;  3CSH A;  1HD2 A;  3G7Y A;  4IQ1 A;  2LV3 A;  1EGO A;  2LKU A;  1DBY A;  5GST A;  4KDX A;  1TKD B;  3VPT A;  4HU9 A;  4CHS A;  3HVV A;  4AF2 A;  5KN0 A;  2MBT A;  4TXO B;  3A3T A;  4MZW A;  3LJR A;  5CYY A;  3TRQ A;  3WGD A;  2RLI A;  4MJE A;  5CRE A;  1X9W B;  1IYI A;  3EC3 A;  4TKY A;  5ECI B;  1GWC A;  2VCZ A;  1PFO A;  2VL2 C;  1BYE A;  3C8E A;  4K6X A;  1XZO A;  4L0W A;  2JZR A;  1Z6M A;  4O5R A;  3ZZX A;  1K0B A;  3TKS E;  3HVX A;  2M72 A;  4O32 A;  1R7H A;  1M3I A;  2G2Q A;  2NTO A;  4BWS A;  2GQL A;  4F0B A;  2IWT A;  1EV9 A;  3F3Q A;  4X43 A;  4G19 A;  4EO3 A;  4V1A p;  3H79 A;  3Q19 A;  2KLX A;  1FW1 A;  1SK2 A;  2LNT A;  4ULX A;  2HSM A;  2HFD A;  1ERW A;  1F2E A;  5F06 A;  4TR4 A;  2QSI A;  2M46 A;  4NXI A;  5H5R A;  1PN9 A;  3GH9 A;  3KCM A;  1Y6E A;  1X9M B;  4MDC A;  2CX4 A;  4TR3 A;  2AJQ B;  1A2J A;  3W8J A;  2KP1 A;  3HJM A;  2H1G A;  1XVW A;  3ERG A;  3ZIV A;  4GLT A;  2E0Q A;  1SL2 B;  4KB3 A;  2V2G A;  2IPA A;  3FEU A;  2OAD A;  3O3T A;  3LFL A;  4F82 A;  5A4V A;  1OC9 B;  5D96 A;  2PU9 C;  3VPQ A;  1F6M C;  3WT1 A;  1DSB A;  2FHE A;  5DCH A;  3HJP A;  4JZQ A;  2H74 A;  1M3J A;  1W4V A;  1YJ6 A;  4HS1 A;  4J57 E;  4N11 A;  2L5L A;  1J9B A;  2PUK C;  2WRT A;  3ZTL A;  3UAP A;  3IK9 A;  3VWV A;  5B8A A;  3FZ4 A;  4Z2T A;  2VLT A;  4N30 A;  4L0U A;  1YY7 A;  3RPP A;  1XW5 A;  2IJY A;  2R3X A;  4YQM A;  2FA4 A;  1ILO A;  2CA8 A;  5COH A;  4XCS A;  4QL9 A;  5H5S A;  2I4A A;  2JU5 A;  1SJ6 A;  3FRC A;  5IOX A;  5HR2 A;  3L9S A;  1AQW A;  3FMW A;  1TTZ A;  22GS A;  3GFK A;  2EC4 A;  1GSU A;  1KBN A;  5DAK A;  4IKH A;  2LUS A;  5IMA A;  5IPH A;  5AN1 A;  2VCW A;  2C8U A;  5JWQ B;  4BPY A;  1G6W A;  1XWB A;  3G9B A;  4EDZ A;  1ACV A;  2VCT A;  3D6I A;  3O76 A;  1G7E A;  19GS A;  2GZZ A;  3UJ1 A;  1QQ2 A;  1TJD A;  2LJA A;  1HNB A;  4FYB A;  1B4P A;  3US3 A;  2A4V A;  3ZIT A;  3HVS A;  4V2M A;  5BRT A;  1SK0 A;  5D73 A;  4RI7 A;  2GT5 A;  5ID2 A;  3EMP A;  1X9S B;  1HNA A;  3HDC A;  4FO5 A;  4HQS A;  2OE3 A;  2RUE A;  4F03 A;  3H4K A;  3GV1 A;  2E2M A;  2GST A;  2AHE A;  2VCV A;  3M1G A;  3UVT A;  2FNO A;  2X99 A;  1Z6N A;  2M80 A;  4MF7 A;  4WR5 A;  2KUC A;  4J2F A;  2GDR A;  4K5R A;  1KTE A;  3LSZ A;  4I2U A;  2MBS A;  3LEF A;  2X8H A;  2PN8 A;  5JCW A;  2MMZ A;  5IMD A;  4ZL7 A;  2LRN A;  5GAP D;  4EXJ A;  1THO A;  5EVO A;  2R37 A;  2P5Q A;  4MMM A;  1JFU A;  5HQP A;  4GTU A;  2J23 A;  3DGQ A;  2B1K A;  3CSJ A;  4BVY B;  2FGX A;  5KN3 A;  4XIH A;  1SJI A;  3GUS A;  3MWH A;  4KND A;  1YQ1 A;  3A5W A;  3BOA A;  5IMC A;  3FZ9 A;  1PX6 A;  2N5B A;  2FCH A;  1LJR A;  3M3M A;  2FWG A;  4MNN A;  3VWX A;  4K7O A;  1O73 A;  2FLS A;  5LD0 A;  3N5O A;  2IME A;  3TKS C;  4Q5R A;  1F9M A;  1K3Y A;  5BMU A;  4POM A;  3LGC A;  4DVC A;  2HE3 A;  4Z2U A;  4J56 E;  1GSQ A;  4K1F A;  2H01 A;  3E3E A;  2EIR A;  1N2A A;  1ML6 A;  1V2A A;  4EKZ A;  2AV4 A;  1X0R A;  5B6M A;  2WDU A;  4P3Y B;  4N0Z A;  1TRS A;  2YV7 A;  1YEP A;  4L5O A;  1QK8 A;  2UZ8 A;  2O7K A;  3GHA A;  3ZIJ A;  1JZW A;  2FD3 A;  1ZL9 A;  5ECR B;  4IP1 A;  4V2L A;  5AIS A;  4BIK A;  2GTU A;  1HQO A;  2GSR A;  3HYP A;  1QUW A;  3TJB A;  2GSQ A;  1XBS A;  1OVN A;  3QCP A;  3DXB A;  3RHB A;  1YF1 A;  1XWG A;  2DBC A;  3IR4 A;  1HYU A;  1H75 A;  4MF5 A;  3IC8 A;  3HZ4 A;  5HR3 A;  3I6A A;  3GKN A;  2HRA A;  5DQY A;  2IMI A;  3FR9 A;  4YKG A;  1OKT A;  4OCE A;  3ME7 A;  3RAZ A;  1G7O A;  2DML A;  4POB A;  5F07 A;  4MH2 A;  1XWA A;  5F8B A;  4XTS A;  3H8Q A;  5ENU A;  5KOX A;  5FWG A;  2YWN A;  4OFM A;  1A2L A;  3LQ7 A;  3APQ A;  2XPE A;  4XS4 A;  3CXG A;  1V98 A;  1IYH A;  2K6V A;  3CRT A;  2PBJ A;  1ZYQ B;  5CRG A;  4PXO A;  3UEM A;  3Q6O A;  3GTU B;  2OAC A;  2H6Y A;  4DEJ A;  3IBH A;  2REM A;  3TGZ A;  2F3M A;  3QFA C;  1T1V A;  2CQ9 A;  2HZE B;  3EU4 A;  4EL1 A;  4JED A;  1K0C A;  1GTA A;  4DSR A;  1XOA A;  2TRX A;  2DJ3 A;  5ECM B;  3HZ8 A;  3IAS 2;  4EVM A;  5DJL A;  1BG5 A;  1K0N A;  4TR0 A;  3UMA A;  2X49 A;  1A24 A;  1U3A A;  3CBU A;  5FHI A;  4JE1 A;  3IRA A;  1MD3 A;  3ZML A;  2RM5 A;  3J7Y k;  4LL1 B;  3VWU A;  2VD0 A;  3Q18 A;  3ME8 A;  6GSS A;  2H19 A;  1ZOF A;  5HFG A;  3LG6 A;  4ZIL A;  2X8C A;  4O7H A;  1ABA A;  4ZBA A;  4Q5Q A;  1SYX A;  3F0I A;  3GSS A;  4MH3 A;  4PQH A;  3A2X A;  4G0K A;  4ECC A;  3SWL A;  2JZS A;  1SKW B;  1YEX A;  3HD5 A;  2YV9 A;  1K3O A;  2VO4 A;  1XW9 A;  4KGI A;  3KTB A; 
#chains in the Genus database with same CATH homology
 2LRC A;  5ECN B;  4F9Z A;  3D22 A;  4AGS A;  1JHB A;  3P2A A;  3ERF A;  4XRD A;  4ZBD A;  2C80 A;  4QQ7 A;  3LYK A;  3IK7 A;  2HLS A;  4GF0 A;  5IOW A;  1RW1 A;  3FKF A;  1T7P B;  2DJ2 A;  4ICY A;  1EWX A;  1W89 A;  6GSV A;  2BTO T;  2VL9 A;  4WEY A;  4ID0 A;  1SKS B;  5AIV A;  4KCE A;  3ZRE A;  4O92 A;  3RPN A;  4ZBB A;  1Z7P A;  3LW9 A;  2K9F A;  5L71 A;  5F05 A;  2H73 A;  2C4J A;  1EV4 A;  1NM3 A;  2FWF A;  1UVZ A;  2R0G A;  3MSZ A;  1O85 A;  4DSQ A;  1K0M A;  2IFQ A;  5GSS A;  2H8L A;  1GUM A;  2HRK A;  2JAC A;  3F4S A;  3GH6 A;  4ZB9 A;  5KOW A;  4HUA A;  4NV5 A;  3DD3 A;  3GX8 A;  4IHU A;  1TOF A;  2XC2 A;  5CNW A;  2R6K A;  5KN1 A;  5DAL B;  1XWK A;  2EIO A;  1VF3 A;  3L78 A;  1I5G A;  2L6C A;  4MCU A;  1T8E B;  1EEM A;  4I97 A;  2WUL A;  4ML1 A;  4MK3 A;  1TU8 A;  2PER A;  5IO2 A;  2CZ2 A;  3KMN A;  5EPF A;  3PH9 A;  1WPI A;  4HQZ A;  1XCC A;  4MJB A;  5CRH A;  2OE0 A;  1VF1 A;  2H75 A;  4CDO A;  3OR5 A;  1OC9 A;  2DIY A;  1B8X A;  3I9V 2;  1TI1 A;  1GL8 A;  1M2D A;  1HNC A;  3DRN A;  5DJM A;  5JCU A;  2X4A A;  1R4W A;  3EWL A;  3DIE A;  5G5F A;  1O6J A;  2J9H A;  4GWR A;  5B7C A;  3IDV A;  3UAR A;  1EGR A;  1YKA A;  2MMA A;  1ZYE A;  4PUR A;  4HJ2 A;  2ON5 A;  5AIX A;  1DUG A;  4I5Q A;  1Q4J A;  2R2J A;  5ELA A;  3DVX A;  4JBB A;  1EP8 A;  2CVB A;  4PQ1 A;  4USS A;  2H0G A;  1B48 A;  2YWM A;  3EMX A;  3E0U A;  4IW9 A;  3KP9 A;  4YAV A;  2CV4 A;  2EIQ A;  4WF5 A;  1BED A;  1GLQ A;  3LYP A;  1U3I A;  1CQH A;  3GKK A;  5J41 A;  3NOF A;  4LMV A;  6GSY A;  4GSS A;  5AGY A;  2H1B A;  3IV4 A;  2AB6 A;  3NIV A;  4DSS A;  2XPD A;  2V1M A;  5DBQ A;  2LNS A;  2DC5 A;  1FOH A;  1R5A A;  1TI3 A;  2KHP A;  5CAX A;  4GQC A;  4E8H A;  3TJF A;  1I9D A;  3LXZ A;  1X5E A;  1TW9 A;  5ECP B;  5A4U A;  5D9X A;  2B1L A;  1WE0 A;  5D9W A;  2PPT A;  1Q98 A;  5B8B A;  3A2V A;  4MA9 A;  1NHO A;  1C72 A;  1BAY A;  1JZO A;  4H86 A;  3GMF A;  1URM A;  2C3T A;  5ECK B;  2XHF A;  1FVJ A;  5G30 A;  5G1L A;  3K8N A;  3QAV A;  2JSY A;  4XS1 A;  1PSQ A;  3F9U A;  2LQQ A;  3KH7 A;  1OC3 A;  3U5R E;  3R2Q A;  4IBP A;  5ABR A;  4K5S A;  5F0G A;  4TOP A;  1EOH A;  1T4Y A;  1K0A A;  4FIW A;  4G0I A;  1VRS D;  4FYC A;  4GSN A;  1E6B A;  4X0X A;  2O8V B;  3CTG A;  2P5R A;  1LBK A;  3FYG A;  4O5U A;  1SL0 B;  1Z9H A;  2GQM A;  3TB2 A;  3HCZ A;  2GQK A;  4OMV A;  1ERT A;  3PIN A;  5JWR B;  17GS A;  1PKZ A;  5DAK B;  2H76 A;  4NPB A;  3KP8 A;  2L6D A;  1R5P A;  4IN0 A;  1PD2 1;  1V58 A;  2TIR A;  3QD9 A;  4AJ7 A;  4OO5 A;  1QXH A;  4LL4 B;  2LQO A;  2H66 A;  1S3C A;  3GUR A;  1GLP A;  1FAA A;  5ECQ B;  2R5G A;  1DE1 A;  2B3S A;  2GSS A;  2H1D A;  2V41 A;  1ZYN A;  2L4C A;  3KTL A;  3MDK A;  3Q74 A;  2LTK A;  2DIZ A;  13GS A;  2DLX A;  2OBK A;  6GST A;  2DJ1 A;  1MDJ A;  3EE2 A;  3GL5 A;  1EP7 A;  16GS A;  3IPZ A;  3JCM L;  1O8W A;  4ZL9 A;  4GRF A;  2O87 A;  3F6D A;  2YAN A;  2B5E A;  5G31 A;  1EEJ A;  5ID2 B;  1S3A A;  1AAZ A;  1ZZY A;  1FOV A;  1TRW A;  1WP0 A;  2KP2 A;  2YJ7 A;  4IEL A;  3EYT A;  4EIP A;  5IM9 A;  4IS0 A;  14GS A;  4NV2 A;  1VF2 A;  1MEK A;  5LCZ A;  3BD2 A;  3LXT A;  2YWI A;  2B7J A;  2VLV A;  4K0G A;  4HOJ A;  5CP1 A;  2BJX A;  2NDO A;  3APS A;  1A0R P;  3APO A;  4OO4 A;  7GSS A;  2IIY A;  2VIM A;  2R4V A;  2QKE A;  1ERV A;  1M9B A;  1X5D A;  4ML6 A;  1GUL A;  2IMK A;  3GRX A;  5DCG A;  3DML A;  1J08 A;  3CTF A;  3TKP A;  3KMO A;  4G2E A;  4MJA A;  3VI5 A;  3C71 A;  4MP4 A;  2DKI A;  3I69 A;  5ECH B;  4BA7 A;  2VOC A;  1MDK A;  1V9W A;  3F6F A;  2RII A;  11GS A;  3QOU A;  2H0I A;  4TR1 A;  1TDI A;  1BQ7 A;  2C3N A;  2F9S A;  2HXK A;  2HZE A;  1M2B A;  3GN3 A;  1B4Q A;  5INY A;  4D73 B;  1GSE A;  1AQX A;  2B6M A;  3FK8 A;  4POL A;  3KEB A;  3D4M A;  2LST A;  1AC1 A;  3TRX A;  5J5N A;  1SD8 A;  4K9Z A;  2L4Q A;  2V6K A;  4YH2 A;  3D21 A;  4K7I A;  5G2Z A;  2L59 A;  3W8S A;  3LWA A;  2X64 A;  5B6N A;  2CX3 A;  3FR3 A;  2TRC P;  5CO3 A;  5ECL B;  3ISO A;  2P31 A;  1XFL A;  4OFT A;  5G1K A;  3GST A;  2C1Y A;  1KNG A;  2C0E A;  5ECS A;  18GS A;  3UBK A;  1TXX A;  1OAZ A;  4IGJ A;  2RUF A;  2MZC A;  4BL7 B;  5G5E A;  3UOM A;  1YDK A;  2ZUP A;  4KSM A;  2NBS A;  1Z7R A;  2VUP A;  4OFN A;  2FWE A;  4HU7 A;  4PTS A;  3TOT A;  2HYX A;  1YF0 A;  5CRD A;  4WXT A;  1DE2 A;  5D8I A;  3ED3 A;  2HRF A;  3KM6 A;  1MDI A;  2VM1 A;  4KX4 A;  1FO5 A;  5IMF A;  2HRN A;  1JZD A;  3D0Z A;  1O81 A;  2GT6 A;  4ZB6 A;  10GS A;  2QA2 A;  4ECB A;  2F51 A;  4XS4 B;  1GUH A;  1NW2 A;  4WF4 A;  5ECO B;  4YQV A;  2F8F A;  2O89 A;  4NMU A;  5DQS A;  4NHZ A;  4ZIJ A;  3CYN A;  1A0F A;  2PVQ A;  2YN1 A;  4WBJ A;  1GSS A;  2CZ3 A;  2HSH A;  3O6T A;  3CRU A;  4ZXG A;  3HXS A;  4K7N A;  5C04 A;  1FVK A;  1RQM A;  6GSW A;  2HSY A;  3KH9 A;  4TW5 A;  2JL4 A;  4FYU A;  4MF6 A;  3HJO A;  3WGX A;  3BJ5 A;  1M9A A;  3E9J B;  1M0U A;  4FQU A;  1GH2 A;  3KD0 A;  5H5Q A;  1WWJ A;  3DEX A;  4CY6 A;  1GTI A;  2DJJ A;  3UVH A;  4TXO A;  5DAL A;  2CAQ A;  3IAM 2;  2H6X A;  5IQY A;  1SEN A;  2A2S A;  4EIQ A;  2DKH A;  1AXD A;  3EUR A;  2ON7 A;  3C1S A;  1Y25 A;  1F37 A;  1WMJ A;  3RHC A;  1OKD A;  2MMO A;  3KGK A;  3PR8 A;  2C0G A;  1PRX A;  1TU7 A;  4IP6 A;  1PX7 A;  1WJK A;  2XBI A;  3FR6 A;  4KA0 A;  2MMN A;  2YP6 A;  2GZP A;  1GSF A;  1VF4 A;  4TVE A;  3TJG A;  4MLY A;  4KF9 A;  5J9B A;  1GNE A;  3GNJ A;  3WYW A;  3P7X A;  1GNW A;  2L5O A;  3L9V A;  1UC7 A;  3F8U A;  1ON4 A;  3TOU A;  1PL2 A;  4RI6 A;  2YPM A;  1FB0 A;  4MPG A;  4IJ3 A;  5FT3 A;  1NSW A;  1BJX A;  1GP1 A;  1UA5 A;  4O5Q A;  2H30 A;  1XW6 A;  1MTC A;  4JU5 A;  4RQX A;  1OE7 A;  3MNG A;  2K8V A;  20GS A;  2JAD A;  2OA7 A;  2JSZ A;  2GLR A;  1B9X C;  2VCQ A;  4I6X A;  4K8M A;  2JZT A;  4L8E A;  3TKQ A;  1EZK A;  4BVX B;  3QDN A;  3UL3 A;  2RM6 A;  3L0H A;  2IFQ B;  4AJ6 A;  1WOU A;  4YAP A;  3IHG A;  4IQA A;  1USB A;  3G7I A;  3I43 A;  2VLU A;  2VL2 A;  2HNL A;  3HY2 A;  4JR6 A;  5J9C A;  4MAB A;  3L4N A;  3ZLP A;  1Z3E A;  2N5A A;  3QMX A;  2ZCT A;  1JZR A;  1SYR A;  1T00 A;  1SU9 A;  4EF0 A;  2YZU A;  3ZVJ D;  3C1R A;  4GQF A;  3F63 A;  1X5C A;  4KSO A;  4LLR A;  4LA1 A;  3L9U A;  3ERW A;  3AY8 A;  4KCA A;  1A8Y A;  1BX9 A;  3FW2 A;  4ZL8 A;  1TK5 B;  1AIU A;  2P0G A;  1FG4 A;  2WCI A;  4HZ2 A;  2KOK A;  3EVI A;  4LMW A;  3M9K A;  1RK4 A;  4KW6 A;  1WIK A;  3VK9 A;  4RUV A;  3GKX A;  4K2D A;  1YKC A;  4I2T A;  2YZH A;  1QFN A;  5D9T A;  2OBI A;  4XRA A;  4JR4 A;  4K2X A;  3ZFL A;  3IC4 A;  1EOG A;  2DJK A;  2LJR A;  4EUY A;  4V2N A;  2BMX A;  1U88 A;  4AJ8 A;  1AQV A;  1K0D A;  1N8J A;  5JCG A;  3HHV A;  3GX0 A;  3F4R A;  3VLN A;  4OD7 A;  6GSX A;  4WET A;  3A5I A;  5ELG A;  1SD9 A;  4POK A;  1KEB A;  2WFC A;  3HKR A;  1OYJ A;  3GIX A;  3IE3 A;  3QPM A;  1JLW A;  3WT2 A;  9GSS A;  1XWC A;  3IOS A;  2CVK A;  5CRW A;  2FY6 A;  2HZF A;  2DMM A;  4XHM A;  2GVP A;  1YZX A;  1PN0 A;  2WGR A;  3IXR A;  5EL8 A;  1XVQ A;  4DSS B;  1B9Y C;  2I1U A;  4ZB8 A;  2E7P A;  2Z9S A;  2I81 A;  2CVD A;  4ILF A;  1GTB A;  2H0H A;  2K18 A;  3KIJ A;  3UBL A;  4A5P A;  1M7T A;  1O7U A;  3MYD A;  4WKW A;  3FZ5 A;  4HDE A;  2QC7 A;  3GKM A;  4KE3 A;  3FZA A;  3QAW A;  3TRP A;  3BCK A;  1U6T A;  4IVF A;  2R0P A;  4G0L A;  2GS3 A;  4BVY A;  4IJI A;  5A4W A;  1JLV A;  5IMV A;  4EE0 A;  2D2Z A;  3U6V A;  4MJC A;  4K0N A;  1MD4 A;  1NHY A;  1T4Z A;  3F3R A;  3TJK A;  3IHQ A;  3GA4 A;  3ZRD A;  2VD1 A;  3QAG A;  5D9V A;  1TK0 B;  1FB6 A;  3MAK A;  2YJH A;  2H6Z A;  3TUE A;  4XS6 A;  5HFI A;  2CAI A;  2A2P A;  1GSY A;  4GCI A;  5GZZ B;  2LJK A;  3QFB C;  1SKR B;  1GRX A;  3IA1 A;  1THX A;  2VAF A;  4FH8 A;  4N10 A;  3HA9 A;  3LOR A;  2ALB A;  1SL1 B;  1TRU A;  1ZCP A;  2C3Q A;  3CMI A;  1ZGN A;  2VM2 A;  1A8L A;  3D5J A;  2LEG A;  3TCO A;  1V40 A;  4I8B A;  5J4U A;  4GXZ A;  3DVW A;  5IPG A;  3C7M A;  3H1N A;  3CSI A;  4PNG A;  2YOI A;  4QL7 A;  2MYG A;  3WGE A;  1A23 A;  4PUF C;  2LS5 A;  4JRR A;  2A2R A;  1VGL A;  1GSD A;  2C0D A;  3QR6 A;  4PUA A;  4D73 A;  3VI7 A;  3VWW A;  4KDY A;  1H4O A;  5J3R A;  4ECJ A;  1F3B A;  1WRY A;  1PGT A;  4F0C A;  1Z5Y E;  3TJJ A;  1O8X A;  2HI7 A;  3DWV A;  2NVL A;  5EY6 A;  4ACS A;  4NHW A;  3S9F A;  3KJY A;  5GAN D;  3TKS A;  3KXO A;  4WR4 A;  3R3E A;  3ZL5 A;  2YNX A;  2IMF A;  2YCD A;  1SJZ A;  4EDY A;  4HEA 2;  5KN2 A;  2QA1 A;  2OKA A;  2A4H A;  3RBT A;  1GTU A;  3A2W A;  3PPU A;  3EU3 A;  1ERU A;  3MIX A;  2GZY A;  3GTU A;  2FWH A;  4ECI A;  1M2A A;  4ISD A;  3EPT A;  3FHK A;  4L5L A;  4YKF A;  3ZVJ A;  1V57 A;  2YWO A;  4PQI A;  1QGV A;  4OCF A;  4BL7 A;  1OC8 A;  3GL3 A;  1AW9 A;  3H93 A;  2AYT A;  2AUV A;  4CY8 A;  4X4J A;  1K0O A;  3VUR A;  6GSU A;  2H70 A;  2FA8 A;  2ZNM A;  1F3A A;  1LU4 A;  4KDU A;  3W6G A;  4Z7X A;  1XPV A;  2V32 A;  2H1A A;  2HT9 A;  3ZMK A;  5DDL A;  4N0V A;  4WBR D;  4E8E A;  3PGT A;  1TP9 A;  4MZB A;  1FHE A;  2PMT A;  1TRV A;  3C73 A;  2PVO C;  3KZQ A;  1XIY A;  5A5K A;  2H71 A;  1OE8 A;  5DVB A;  3P8W A;  1PA3 A;  2N5F A;  4Q5F A;  3M0F A;  3P90 A;  1CQG A;  5IO0 A;  2QGV A;  2WS2 A;  4PGT A;  1G6Y A;  1PKW A;  2PWJ A;  2B5Y A;  3BCI A;  1ZYP A;  4OWY A;  4HI7 A;  3D4T A;  4TR1 B;  4F2I A;  3J7Y b;  1ZMA A;  3N9J A;  5HFK A;  8GSS A;  1U87 A;  3WD6 A;  3RDW A;  4PX1 A;  4YQU A;  4TXV A;  1E2Y A;  3SBC A;  4G10 A;  5LNK e;  3UIW A;  2E2G A;  3M8N A;  2DJ0 A;  4HJM A;  3TDG A;  2LRT A;  3GYK A;  1G0T A;  1K3L A;  2B7K A;  3DKS A;  5JWO B;  12GS A;  1XOB A;  3F4T A;  2NPB A;  4G9H A;  2ES7 A;  2IN3 A;  5C00 A;  2DSA A;  3EIN A;  1SK1 A;  4V1A g;  1S3D A;  2WB9 A;  4BWQ A;  2B5X A;  2VCX A;  2L57 A;  4NAX A;  2G0F A;  4PNF A;  4CW9 A;  5E59 A;  3M9J A;  2V6O A;  5IMZ A;  4KUN A;  4NWY A;  5HR1 A;  4KAE A;  4MPF A;  3ZYW A;  1AUC A;  4Q5N A;  2XBQ A;  1UN2 A;  2OJL A;  2R0C A;  1XXU A;  2PGT A;  2GGT A;  3G7J A;  1A2M A;  4KH7 A;  5HR0 A;  5IIZ A;  4EC0 A;  4GST A;  3ZFB A;  2FUG 2;  2VL3 A;  3BBY A;  2H72 A;  1TK8 B;  3VFI A;  2WZ9 A;  2IMD A;  3TKR A;  4TN8 A;  3DYR A;  3V1W A;  1J0F A;  5E4W A;  2O85 A;  5KEJ A;  3NZN A;  2I3Y A;  2IL3 A;  1PQN A;  5D93 A;  1R26 A;  1M99 A;  2C0F A;  2WJU A;  2AAW A;  1GUK A;  4X1U A;  1T3B A;  4Z2R A;  1ST9 A;  2K8S A;  2CT6 A;  4TRX A;  1PMT A;  4BVX A;  2X8G A;  1PL1 A;  2I9H A;  4MZC A;  4HZ4 A;  2F8A A;  2OE1 A;  1QMV A;  4RQR A;  3FY7 A;  3CSH A;  1HD2 A;  3G7Y A;  4IQ1 A;  2LV3 A;  1EGO A;  2LKU A;  1DBY A;  5GST A;  4KDX A;  1TKD B;  3VPT A;  4HU9 A;  4CHS A;  3HVV A;  4AF2 A;  5KN0 A;  2MBT A;  4TXO B;  3A3T A;  4MZW A;  3LJR A;  5CYY A;  3TRQ A;  3WGD A;  2RLI A;  4MJE A;  5CRE A;  1X9W B;  1IYI A;  3EC3 A;  4TKY A;  5ECI B;  1GWC A;  2VCZ A;  2VL2 C;  1BYE A;  3C8E A;  4K6X A;  1XZO A;  4L0W A;  2JZR A;  1Z6M A;  4O5R A;  3ZZX A;  1K0B A;  3TKS E;  3HVX A;  2M72 A;  4O32 A;  1R7H A;  2G2Q A;  2NTO A;  4BWS A;  2GQL A;  4F0B A;  2IWT A;  1EV9 A;  3F3Q A;  4X43 A;  4G19 A;  4EO3 A;  4V1A p;  3H79 A;  3Q19 A;  2KLX A;  1FW1 A;  1SK2 A;  2LNT A;  4ULX A;  2HSM A;  2HFD A;  1ERW A;  1F2E A;  5F06 A;  4TR4 A;  2QSI A;  2M46 A;  4NXI A;  5H5R A;  1PN9 A;  3GH9 A;  3KCM A;  1Y6E A;  1X9M B;  4MDC A;  2CX4 A;  4TR3 A;  2AJQ B;  1A2J A;  3W8J A;  2KP1 A;  3HJM A;  2H1G A;  1XVW A;  3ERG A;  3ZIV A;  4GLT A;  2E0Q A;  1SL2 B;  4KB3 A;  2V2G A;  2IPA A;  3FEU A;  2OAD A;  3O3T A;  3LFL A;  4F82 A;  5A4V A;  1OC9 B;  5D96 A;  2PU9 C;  3VPQ A;  1F6M C;  3WT1 A;  1DSB A;  2FHE A;  5DCH A;  3HJP A;  4JZQ A;  2H74 A;  1W4V A;  1YJ6 A;  4HS1 A;  4J57 E;  4N11 A;  2L5L A;  1J9B A;  2PUK C;  2WRT A;  3ZTL A;  3UAP A;  3IK9 A;  3VWV A;  5B8A A;  3FZ4 A;  4Z2T A;  2VLT A;  4N30 A;  4L0U A;  1YY7 A;  3RPP A;  1XW5 A;  2IJY A;  2R3X A;  4YQM A;  2FA4 A;  1ILO A;  2CA8 A;  5COH A;  4XCS A;  4QL9 A;  5H5S A;  2I4A A;  2JU5 A;  1SJ6 A;  3FRC A;  5IOX A;  5HR2 A;  3L9S A;  1AQW A;  3FMW A;  1TTZ A;  22GS A;  3GFK A;  2EC4 A;  1GSU A;  1KBN A;  5DAK A;  4IKH A;  2LUS A;  5IMA A;  5IPH A;  5AN1 A;  2VCW A;  2C8U A;  5JWQ B;  4BPY A;  1G6W A;  1XWB A;  3G9B A;  4EDZ A;  1ACV A;  2VCT A;  3D6I A;  3O76 A;  1G7E A;  19GS A;  2GZZ A;  3UJ1 A;  1QQ2 A;  1TJD A;  2LJA A;  1HNB A;  4FYB A;  1B4P A;  3US3 A;  2A4V A;  3ZIT A;  3HVS A;  4V2M A;  5BRT A;  1SK0 A;  5D73 A;  4RI7 A;  2GT5 A;  5ID2 A;  3EMP A;  1X9S B;  1HNA A;  3HDC A;  4FO5 A;  4HQS A;  2OE3 A;  2RUE A;  4F03 A;  3H4K A;  3GV1 A;  2E2M A;  2GST A;  2AHE A;  2VCV A;  3M1G A;  3UVT A;  2FNO A;  2X99 A;  1Z6N A;  2M80 A;  4MF7 A;  4WR5 A;  2KUC A;  4J2F A;  2GDR A;  4K5R A;  1KTE A;  3LSZ A;  4I2U A;  2MBS A;  3LEF A;  2X8H A;  2PN8 A;  5JCW A;  2MMZ A;  5IMD A;  4ZL7 A;  2LRN A;  5GAP D;  4EXJ A;  1THO A;  5EVO A;  2R37 A;  2P5Q A;  4MMM A;  1JFU A;  5HQP A;  4GTU A;  2J23 A;  3DGQ A;  2B1K A;  3CSJ A;  4BVY B;  2FGX A;  5KN3 A;  4XIH A;  1SJI A;  3GUS A;  3MWH A;  4KND A;  1YQ1 A;  3A5W A;  3BOA A;  5IMC A;  3FZ9 A;  1PX6 A;  2N5B A;  2FCH A;  1LJR A;  3M3M A;  2FWG A;  4MNN A;  3VWX A;  4K7O A;  1O73 A;  2FLS A;  5LD0 A;  3N5O A;  2IME A;  3TKS C;  4Q5R A;  1F9M A;  1K3Y A;  5BMU A;  4POM A;  3LGC A;  4DVC A;  2HE3 A;  4Z2U A;  4J56 E;  1GSQ A;  4K1F A;  2H01 A;  3E3E A;  2EIR A;  1N2A A;  1ML6 A;  1V2A A;  4EKZ A;  2AV4 A;  1X0R A;  5B6M A;  2WDU A;  4P3Y B;  4N0Z A;  1TRS A;  2YV7 A;  1YEP A;  4L5O A;  1QK8 A;  2UZ8 A;  2O7K A;  3GHA A;  3ZIJ A;  1JZW A;  2FD3 A;  1ZL9 A;  5ECR B;  4IP1 A;  4V2L A;  5AIS A;  2GTU A;  1HQO A;  2GSR A;  3HYP A;  1QUW A;  3TJB A;  2GSQ A;  1XBS A;  1OVN A;  3QCP A;  3DXB A;  3RHB A;  1YF1 A;  1XWG A;  2DBC A;  3IR4 A;  1HYU A;  1H75 A;  4MF5 A;  3IC8 A;  3HZ4 A;  5HR3 A;  3I6A A;  3GKN A;  2HRA A;  5DQY A;  2IMI A;  3FR9 A;  4YKG A;  1OKT A;  4OCE A;  3ME7 A;  3RAZ A;  1G7O A;  2DML A;  4POB A;  5F07 A;  4MH2 A;  1XWA A;  5F8B A;  4XTS A;  3H8Q A;  5ENU A;  5KOX A;  5FWG A;  2YWN A;  4OFM A;  1A2L A;  3LQ7 A;  3APQ A;  2XPE A;  4XS4 A;  3CXG A;  1V98 A;  1IYH A;  2K6V A;  3CRT A;  2PBJ A;  1ZYQ B;  5CRG A;  4PXO A;  3UEM A;  3Q6O A;  3GTU B;  2OAC A;  2H6Y A;  4DEJ A;  3IBH A;  2REM A;  3TGZ A;  2F3M A;  3QFA C;  1T1V A;  2CQ9 A;  2HZE B;  3EU4 A;  4EL1 A;  4JED A;  1K0C A;  1GTA A;  4DSR A;  1XOA A;  2TRX A;  2DJ3 A;  5ECM B;  3HZ8 A;  3IAS 2;  4EVM A;  5DJL A;  1BG5 A;  1K0N A;  4TR0 A;  3UMA A;  2X49 A;  1A24 A;  1U3A A;  3CBU A;  5FHI A;  4JE1 A;  3IRA A;  1MD3 A;  3ZML A;  2RM5 A;  3J7Y k;  4LL1 B;  3VWU A;  2VD0 A;  3Q18 A;  3ME8 A;  6GSS A;  2H19 A;  1ZOF A;  5HFG A;  3LG6 A;  4ZIL A;  2X8C A;  4O7H A;  1ABA A;  4ZBA A;  4Q5Q A;  1SYX A;  3F0I A;  3GSS A;  4MH3 A;  4PQH A;  3A2X A;  4G0K A;  4ECC A;  3SWL A;  2JZS A;  1SKW B;  1YEX A;  3HD5 A;  2YV9 A;  1K3O A;  2VO4 A;  1XW9 A;  4KGI A;  3KTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...