1SYXA

The crystal structure of a binary u5 snrnp complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
135
structure length
135
Chain Sequence
YMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation/immune system
molecule keywords Spliceosomal U5 snRNP-specific 15 kDa protein
publication title Structural basis for the bifunctionality of the U5 snRNP 52K protein (CD2BP2).
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 135
sequence length 135
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2004-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02966 DIM1 Mitosis protein DIM1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1syxA00
3TGZA 4ZL7A 1NSWA 2OKAA 1SL1B 2TRCP 4I6XA 1ZCPA 4N30A 2YJHA 3LYPA 2WGRA 2NDOA 5G5FA 3HA9A 3FZ4A 3D22A 3GRXA 3WT2A 2WCIA 1EP8A 3GN3A 1ZL9A 4XS1A 2DC5A 1G6WA 2MMOA 5KN2A 3CTFA 3CBUA 1F6MC 3TUEA 3HZ4A 3LG6A 3W8JA 5IMAA 1QK8A 3P8WA 3IR4A 1LJRA 4EXJA 2PWJA 4HU7A 2F8FA 1EEMA 2AYTA 2GQMA 2PBJA 2CVBA 4V1Ap 3QPMA 1DSBA 5C04A 5HFKA 3HZ8A 4KW6A 1THXA 2QKEA 4HI7A 3IPZA 4PUFC 3GX0A 4ZB8A 5F05A 3TCOA 1R26A 2L4CA 1GUHA 2FD3A 1SKWB 1R5PA 2E7PA 3R2QA 3EVIA 5AGYA 4IQ1A 3IV4A 1B9XC 4JR4A 4ACSA 2C4JA 2IFQB 3RPPA 1OC8A 5CRWA 4ZB6A 1C72A 2I81A 4J57E 1AAZA 3KEBA 4FH8A 2N5FA 1GSEA 4KA0A 5JWRB 3ZRDA 3TKRA 3QFBC 2PU9C 2X8CA 4TR3A 2LEGA 3Q74A 1ZZYA 1F3AA 5G1LA 3KD0A 4KGIA 2WZ9A 3HJOA 2X8HA 2M46A 1ERVA 2F8AA 5DQSA 1EEJA 1J9BA 3HY2A 5D96A 4AJ7A 4ZBDA 3GMFA 4ML1A 2B1KA 2DIYA 3ZIVA 1B4PA 4AF2A 2WULA 2LRCA 2HSYA 2VD1A 5E4WA 1SENA 1XW9A 1Z6MA 1DE1A 4EDYA 1Z7RA 1GSDA 2CZ3A 2LJKA 3HCZA 3L9UA 4NMUA 5FWGA 4GF0A 4X1UA 5L71A 1K0AA 5DALA 4PQ1A 1U3IA 3KJYA 4KAEA 2JSZA 2P5RA 2DJ3A 3FHKA 5DBQA 3TOUA 5JWOB 2O85A 5A5KA 2PVOC 5D9WA 3BJ5A 1GNWA 1OKTA 4IJ3A 3CMIA 5ECOB 4NPBA 1TRUA 17GSA 2VOCA 5GZZB 1ERTA 2H19A 3LORA 1JLVA 1WJKA 1XZOA 2FWEA 3U5RE 1SKRB 5F07A 4TN8A 1ZYQB 1Q4JA 3C7MA 1GWCA 5DCGA 1MTCA 1X5EA 5ECMB 2FCHA 3IXRA 5G30A 1GSYA 1N8JA 5G1KA 1EOGA 3WGEA 1OC9A 2D2ZA 2IMEA 1SJIA 2XBIA 3UJ1A 3VI7A 1RW1A 1XOAA 2TIRA 4WBJA 2GT5A 1TOFA 1T1VA 1SD9A 4MF6A 2AV4A 2K8SA 5EY6A 1OAZA 5J4UA 4MH3A 3PGTA 1ACVA 5LNKe 1EV9A 3I43A 4HUAA 1S3AA 2YV7A 4F03A 1QGVA 4WKWA 2P5QA 3LQ7A 4RI6A 4ECJA 5A4UA 3IK7A 3MSZA 3CRTA 2IMFA 2X99A 4ZBBA 2FWFA 3DXBA 5JCUA 1V98A 1AXDA 4IKHA 2GTUA 4AJ6A 20GSA 3M8NA 1PKWA 4KDUA 2GSTA 1FAAA 3HXSA 2H71A 2YANA 1GTUA 2DJ1A 4JU5A 1M2BA 4ID0A 3EURA 5GAND 1BX9A 2AB6A 2H8LA 3L78A 6GSSA 2MZCA 2HE3A 4K8MA 5AN1A 3CTGA 2CVKA 2GZZA 2HZFA 4FIWA 1O85A 3C73A 4D73A 4LA1A 1PX6A 1FB0A 2IMDA 5HR1A 5IMCA 1U6TA 2XHFA 2B5XA 1QQ2A 2LKUA 2EIRA 2OA7A 1JZWA 1JZRA 3KMNA 4PX1A 1QXHA 4GQFA 2IMKA 2BJXA 5IOWA 2LS5A 3QD9A 1JHBA 3KH7A 3DMLA 3VWUA 2CAQA 2G2QA 5ECRB 4WF5A 3P2AA 3UOMA 3GUSA 4TR4A 1ZOFA 2C3QA 1GTIA 3CRUA 4G19A 2R6KA 1RQMA 5J9BA 5DAKA 4Q5QA 1H75A 2JACA 1YF1A 4O92A 3DVXA 5FT3A 5JWQB 4IGJA 5ID2B 2J9HA 4TR1A 2V32A 3BCIA 6GSVA 3KMOA 1SJZA 5D73A 1H4OA 11GSA 1HQOA 6GSTA 2LSTA 2CT6A 2H6ZA 3O6TA 4LMWA 3FYGA 2H0GA 2PERA 3EINA 3DYRA 1TJDA 4NWYA 14GSA 5F06A 4N0ZA 2B3SA 5AIVA 2R3XA 4KDYA 3ME7A 4KSMA 1ZMAA 5GAPD 2HYXA 4I97A 4OO4A 3TKQA 3QCPA 1EZKA 2VD0A 1EGRA 3UAPA 2PVQA 1NW2A 3WT1A 2YZHA 4XCSA 1FVKA 1SU9A 1A2LA 1TDIA 5J41A 3AY8A 7GSSA 4YQUA 2HZEB 3UMAA 4KCEA 2LNTA 3SWLA 4WETA 5CRGA 4WF4A 4HEA2 2FUG2 1AIUA 2LJRA 4IP1A 4PNFA 4BVXA 2OE3A 1X5CA 3VWVA 3GL3A 5DVBA 3TJKA 1BG5A 2V6OA 1PN9A 2KOKA 13GSA 2R5GA 3VWWA 5LD0A 2NVLA 3HKRA 4JEDA 1HNBA 5B6NA 2IFQA 2P31A 1TI3A 2LV3A 4NV2A 1K0DA 1M9BA 2H1GA 3KXOA 1MD4A 4OCEA 3M9JA 3GKKA 3UL3A 3A2VA 1XWBA 3HVVA 3ZVJD 4KSOA 2H6XA 3KZQA 5C00A 3EC3A 3A2WA 5IPHA 3EMXA 2VCZA 1SK0A 4FYUA 2X64A 1SYRA 4I5QA 2GSRA 2B6MA 2L5OA 3ZFBA 1W4VA 3GA4A 3FRCA 2VCQA 2HRFA 2J23A 3K8NA 5DJMA 3FZ5A 2C0DA 5HR0A 3QAGA 1PL1A 5IMDA 5ECLB 4TR1B 3EU4A 2YNXA 1K0MA 3QAWA 2L5LA 2FNOA 4MLYA 2LQOA 1YQ1A 1X9WB 2YCDA 5CYYA 1K0OA 4NXIA 1GSUA 2O89A 3Q6OA 4F0CA 5IO0A 2AJQB 5DDLA 1PA3A 1U88A 2O87A 4GRFA 3IC4A 2GZPA 4K7OA 3A2XA 3P7XA 3L9SA 3W8SA 1HYUA 2LUSA 2E2GA 1AC1A 2C3NA 2HRNA 2ZUPA 3BD2A 2CAIA 2R37A 5G31A 2FY6A 4MPFA 3C1RA 12GSA 3FEUA 5HR2A 2NBSA 3F3QA 5IOXA 2WDUA 2M80A 4ZIJA 4PQIA 1K0NA 1BJXA 3GV1A 2GVPA 2OBKA 3VPQA 2JU5A 3F0IA 3G7JA 3M0FA 3F4TA 3TDGA 2XPEA 4ZILA 1E2YA 2ON7A 4MJCA 4PQHA 3E0UA 4CW9A 2A2SA 2BMXA 4GCIA 3HJMA 1K3YA 2EIOA 1I9DA 3I6AA 5DJLA 3NOFA 10GSA 3DVWA 1GNEA 5D8IA 3GKNA 2K9FA 1BYEA 1Q98A 2YZUA 3F6FA 5JCWA 1WOUA 1EOHA 1OC3A 3WD6A 1DUGA 4XRAA 2PGTA 2FWGA 2ZCTA 3ZIJA 4WR5A 1SD8A 2VIMA 2GSSA 1BQ7A 5FHIA 5ABRA 4RQXA 4PXOA 3ERWA 1VF1A 2H75A 4FYBA 4WR4A 3L0HA 1A0RP 3DGQA 1UA5A 1UN2A 5CRHA 5EVOA 2H72A 3F3RA 2C3TA 2H76A 4X43A 1QFNA 2ZNMA 1TRVA 2RUFA 3GKMA 1JLWA 3HVXA 3LFLA 2QC7A 5B6MA 2GZYA 5IPGA 3GH6A 2VO4A 2L6CA 5HR3A 1F9MA 2HFDA 3F9UA 4L5LA 4MDCA 3US3A 5ECHB 1TRSA 3O76A 3JCML 4O7HA 1X9SB 1E6BA 2A4VA 2IN3A 5GSSA 2VM2A 5ENUA 1X0RA 4XS4B 1JFUA 1A8LA 3LXTA 1O8XA 4KDXA 4POKA 1GSQA 1T4YA 4OFTA 2WJUA 3O3TA 4XS6A 1SKSB 1T3BA 5AISA 1K3OA 4IHUA 3ED3A 4O32A 5CNWA 1EWXA 4PGTA 1VGLA 4XIHA 4JBBA 5IMFA 1O73A 2FHEA 3RPNA 1SL0B 5ID2A 4ECCA 4G10A 1N2AA 5INYA 2HNLA 3TB2A 4KCAA 4DSQA 1KEBA 3WGXA 1QMVA 5ECPB 3FR6A 4NAXA 1K0CA 3ZMKA 3ZL5A 1PMTA 4NHWA 3QMXA 2DBCA 2MMNA 3D5JA 4LMVA 5ECQB 2KHPA 4I2UA 3L4NA 4BPYA 1BEDA 2F3MA 1XWAA 4V2NA 3ZREA 4MZCA 1OVNA 2VLUA 4L0UA 2K8VA 3C8EA 3GX8A 3RDWA 2OJLA 4JZQA 2NPBA 4G2EA 4GWRA 4IVFA 5A4WA 4HU9A 6GSWA 2QSIA 3DWVA 4TRXA 1XPVA 4OMVA 3HYPA 2JADA 3EYTA 2HZEA 4HS1A 4K6XA 3RHBA 4LL1B 3IAM2 3G7YA 1WWJA 2LRNA 5CP1A 3IK9A 5ELGA 4ECBA 3UVTA 3RAZA 1S3DA 2HT9A 4FO5A 4GXZA 2CVDA 5ECNB 4ECIA 1VF3A 5IIZA 1BAYA 4Z7XA 1YJ6A 2GQLA 1T7PB 1M2DA 1HD2A 4ZL9A 3Q19A 2E0QA 3TJFA 2ALBA 1TTZA 3RHCA 1X9MB 1OKDA 2DLXA 1A24A 3GL5A 2XPDA 4XRDA 4I2TA 4JR6A 1OYJA 3D6IA 4RQRA 3FZ9A 1G7OA 3G7IA 1NHOA 3M1GA 3IDVA 2RLIA 3GNJA 2GLRA 4HZ2A 5AIXA 2CX4A 3FR9A 2LNSA 3TRXA 1JZDA 2AHEA 3H4KA 4IQAA 3ME8A 4MA9A 1XWGA 3Q18A 4QL7A 5KN1A 4DSSB 5EL8A 3CYNA 4TOPA 2VAFA 3GTUB 4MPGA 3NZNA 2ON5A 3F8UA 3M3MA 3IAS2 8GSSA 3TJGA 4TR0A 3TKSA 4XHMA 2V2GA 5KEJA 3J7Yb 4EVMA 2IL3A 4PUAA 4K9ZA 1TI1A 2JZSA 4O5RA 1J08A 3EU3A 1T8EB 1G7EA 2H01A 2XC2A 1XXUA 1R7HA 3D0ZA 2C80A 2B5EA 2C0EA 3VWXA 4OO5A 5ELAA 4IP6A 1CQHA 3D21A 1O6JA 1GUMA 1M2AA 4MF5A 2LTKA 5HFIA 1FW1A 4ISDA 2WRTA 2ES7A 3FKFA 4OD7A 2RUEA 1M0UA 4HZ4A 1XIYA 4EUYA 1URMA 1PGTA 2V6KA 3ZMLA 3VK9A 4Q5RA 1RK4A 4F2IA 2L4QA 1OE7A 3F4SA 3TKPA 4K7NA 1LBKA 2A2RA 3UBLA 4JRRA 2MBTA 3L9VA 4TW5A 2VL9A 4V2LA 1MD3A 2H1DA 3J7Yk 1TK8B 2H0IA 5J3RA 4IELA 3EE2A 5IMZA 4K0GA 2N5AA 4BL7A 4H86A 3IHQA 2VL3A 1XW5A 1VF2A 2O7KA 2XBQA 4JE1A 3HHVA 3ERFA 2H1AA 2MYGA 1WIKA 2L59A 1F37A 3TJBA 5LCZA 2DIZA 2DMLA 3ZFLA 4POLA 3SBCA 4MJBA 2I1UA 3VI5A 2P0GA 4RI7A 3FK8A 5H5RA 4XTSA 3M9KA 4G9HA 1R5AA 5H5QA 4MMMA 1O7UA 5H5SA 2QGVA 1GTAA 4I8BA 2LJAA 1NHYA 2C0FA 3N5OA 3UVHA 4EO3A 2RM6A 4HQSA 2YWOA 1K0BA 2EC4A 2I3YA 1GSSA 5KN3A 1EGOA 2OADA 4ML6A 5D9TA 4P3YB 2I4AA 4IS0A 5F8BA 4GLTA 2NTOA 3TKSE 3VFIA 4N0VA 1TU7A 1YDKA 4BA7A 1O81A 1X5DA 2LQQA 3LYKA 5DCHA 4EL1A 1B48A 2AUVA 4AJ8A 1ERWA 2FA4A 1FHEA 4KH7A 1UVZA 2K6VA 4XS4A 3ERGA 1AUCA 5D9VA 1MDIA 4CHSA 1PL2A 4V1Ag 5CO3A 4MJEA 3QAVA 1Y25A 1G6YA 2FWHA 4OWYA 4WXTA 18GSA 1M9AA 3ZITA 2H70A 3MAKA 3KP9A 1XWKA 2WB9A 5J9CA 4BWQA 3UARA 5G5EA 3H93A 4IBPA 1A2JA 3NIVA 1YEXA 4TKYA 4QL9A 2MBSA 1VRSD 4N11A 3ZLPA 1PD21 1Z7PA 3BCKA 2H74A 4PURA 3LSZA 1SYXA 1V40A 1I5GA 3GH9A 3BBYA 3TRPA 1XFLA 5IO2A 3KH9A 4MP4A 2VCWA 1XVQA 4X0XA 1SJ6A 2X8GA 4EKZA 3PR8A 1YF0A 5G2ZA 4YQVA 1TRWA 4KUNA 1YZXA 4GTUA 5E59A 4OFNA 3KTBA 4AGSA 2H6YA 3IRAA 4TXOB 4YAVA 1PSQA 3WYWA 2N5BA 4F9ZA 2VLVA 2MMAA 4OCFA 1MDJA 2KLXA 4GSTA 2B1LA 4RUVA 1IYHA 2I9HA 2GQKA 4HJMA 4QQ7A 1Z3EA 2OACA 2YWNA 1DE2A 5ECSA 1ZGNA 1F2EA 4CDOA 3KIJA 1B9YC 1NM3A 1XW6A 1GLQA 1O8WA 3ISOA 1PQNA 1GP1A 4FYCA 2YV9A 1Z9HA 2B7KA 2YOIA 4ILFA 3BOAA 1U87A 1A23A 6GSUA 1KTEA 1ST9A 1MDKA 3APQA 5ECKB 2RIIA 5CREA 1V2AA 5GSTA 4YQMA 2JZRA 4IJIA 2OE1A 2YN1A 4GSNA 3KP8A 3HD5A 4BVYA 3C71A 4OFMA 2K18A 3CSIA 3KGKA 2OE0A 5IM9A 2HSHA 3GIXA 1TW9A 3LGCA 4KE3A 1V9WA 2DJ0A 5JCGA 4ZB9A 3H8QA 4LLRA 2KP1A 3IOSA 5A4VA 5COHA 3IBHA 1AQWA 1U3AA 2G0FA 3ZZXA 2V41A 3W6GA 1YEPA 2PPTA 3I9V2 4K7IA 4IW9A 5HFGA 4DSSA 3GSSA 3FY7A 1GULA 4EC0A 3TJJA 3UEMA 5IQYA 1EV4A 3U6VA 4HQZA 3GTUA 3DEXA 1WMJA 3V1WA 2C1YA 2F51A 2H73A 3F4RA 1B4QA 2GS3A 3A3TA 4ZL8A 1SK1A 3D4TA 2VCVA 3FR3A 4Q5NA 4ULXA 1YY7A 1LU4A 1KNGA 3GSTA 5CAXA 4DVCA 2GSQA 3F63A 5D9XA 5HQPA 1GRXA 1PX7A 1YKCA 3HJPA 4J2FA 5EPFA 4HOJA 2IPAA 2LRTA 5ECIB 1GTBA 1TK0B 1IYIA 5B7CA 3LEFA 3MWHA 3EMPA 4YH2A 4YAPA 5IMVA 2FA8A 3DIEA 5CRDA 5B8BA 1TU8A 2DSAA 2JSYA 1V57A 5F0GA 2HXKA 3CSHA 2VUPA 1Z5YE 1EP7A 2IJYA 1THOA 4F82A 2YJ7A 3DKSA 1A0FA 3HVSA 2R2JA 2L6DA 2YWMA 3GHAA 1ABAA 1Z6NA 4KB3A 4ZXGA 1FG4A 1DBYA 3MNGA 3QOUA 22GSA 1ILOA 4PNGA 4EF0A 2WS2A 3LJRA 3FZAA 2EIQA 3MDKA 4POBA 3EWLA 2VCTA 2FLSA 4MZBA 4ZBAA 2E2MA 1Y6EA 1FVJA 1USBA 2PMTA 5DALB 2JZTA 1TK5B 3QFAC 4L8EA 4J56E 3LXZA 1A8YA 3UIWA 1ML6A 2IIYA 3GKXA 4WEYA 3KTLA 2KP2A 3KM6A 4WBRD 1G0TA 3QR6A 3UBKA 1PKZA 4MJAA 2AAWA 2F9SA 1SL2B 2REMA 1OE8A 3F6DA 3LWAA 1KBNA 2C0GA 3DRNA 2BTOT 4K1FA 5B8AA 2IWTA 2VM1A 4GQCA 1XVWA 2H30A 1MEKA 2HLSA 2H66A 1AQXA 5DQYA 4L0WA 3VURA 1AW9A 4MCUA 3D4MA 2DJKA 2CQ9A 1XWCA 1S3CA 2YWIA 2WFCA 1ERUA 1WP0A 3TOTA 1OC9B 1FB6A 4E8HA 3IE3A 4GSSA 3RBTA 4KNDA 3S9FA 2M72A 3APSA 3I69A 2L57A 2H1BA 4EDZA 3ZYWA 4Q5FA 3GURA 1XCCA 1GSFA 2B5YA 4K0NA 2TRXA 2H0HA 1WE0A 4POMA 1VF4A 5D93A 3DD3A 1QUWA 1FO5A 6GSXA 3VPTA 2DMMA 1T00A 2VL2A 1JZOA 3APOA 3IA1A 2OBIA 4KX4A 4HJ2A 4DEJA 1FOVA 1R4WA 2R4VA 1M7TA 4MABA 3TKSC 3QDNA 2HI7A 1F3BA 2YP6A 3PINA 3PH9A 1SK2A 2FGXA 4F0BA 1GUKA 4TVEA 4N10A 4MZWA 4E8EA 19GSA 1WRYA 2V1MA 1GLPA 3GYKA 1A2MA 3E9JB 1GL8A 5KN0A 2Z9SA 4TXOA 1B8XA 2VL2C 4MK3A 2C8UA 1WPIA 1HNAA 3ZTLA 4D73B 4LL4B 3VLNA 2MMZA 1AQVA 4NV5A 1UC7A 2CZ2A 2YPMA 4DSRA 1GH2A 4NHZA 9GSSA 3GFKA 2CV4A 3WGDA 1V58A 2JL4A 4EE0A 2GDRA 2CA8A 1TP9A 1M99A 2VCXA 5J5NA 1XBSA 1W89A 4HDEA 1K3LA 2VLTA 1ZYEA 1PRXA 2DJ2A 2IMIA 3E3EA 3H79A 3N9JA 4V2MA 3CXGA 3H1NA 6GSYA 2DJJA 2PUKC 4BWSA 2GGTA 3KCMA 2B7JA 1CQGA 1T4ZA 2GT6A 1XOBA 4IN0A 3P90A 3C1SA 2PN8A 2RM5A 5DAKB 4L5OA 3G9BA 1TKDB 3A5WA 2CX3A 16GSA 3OR5A 2O8VB 1J0FA 4K2DA 1YKAA 2KUCA 3FW2A 4MH2A 1ON4A 4TXVA 1TXXA 3TRQA 4MF7A 3ZVJA 3CSJA 1HNCA 3HDCA
chains in the Genus database with same CATH superfamily
3TGZA 4ZL7A 1NSWA 2OKAA 1SL1B 2TRCP 4I6XA 1ZCPA 4N30A 2YJHA 3LYPA 2WGRA 3IC8A 2NDOA 5G5FA 3HA9A 3FZ4A 3D22A 3GRXA 3WT2A 2WCIA 1EP8A 3GN3A 1ZL9A 4XS1A 2DC5A 1G6WA 2MMOA 5KN2A 3CTFA 3CBUA 1F6MC 3TUEA 3HZ4A 3LG6A 3W8JA 5IMAA 1QK8A 3P8WA 3IR4A 1LJRA 4EXJA 2PWJA 4HU7A 2F8FA 1EEMA 2AYTA 2GQMA 2PBJA 2CVBA 4V1Ap 3QPMA 1DSBA 5C04A 5HFKA 3HZ8A 4KW6A 1THXA 2QKEA 4HI7A 3IPZA 4PUFC 3GX0A 4ZB8A 5F05A 3TCOA 1R26A 2L4CA 1GUHA 2FD3A 1SKWB 1R5PA 2E7PA 3R2QA 3EVIA 5AGYA 4IQ1A 3IV4A 1B9XC 4JR4A 4ACSA 2C4JA 2IFQB 3RPPA 1OC8A 5CRWA 4ZB6A 1C72A 2I81A 4J57E 1AAZA 3KEBA 4FH8A 2N5FA 1GSEA 4KA0A 5JWRB 3ZRDA 3TKRA 3QFBC 2PU9C 2X8CA 4TR3A 2LEGA 3Q74A 1ZZYA 1F3AA 5G1LA 3KD0A 4KGIA 2WZ9A 3HJOA 2X8HA 2M46A 1ERVA 2F8AA 5DQSA 1EEJA 1J9BA 3HY2A 5D96A 4AJ7A 4ZBDA 3GMFA 4ML1A 2B1KA 2DIYA 3ZIVA 1B4PA 4AF2A 2WULA 2LRCA 2HSYA 2VD1A 5E4WA 1SENA 1XW9A 1Z6MA 1DE1A 4EDYA 1Z7RA 1GSDA 2R0GA 2CZ3A 2LJKA 3HCZA 3L9UA 4NMUA 5FWGA 4GF0A 4X1UA 5L71A 1K0AA 5DALA 4PQ1A 1U3IA 3KJYA 4KAEA 4YKFA 2JSZA 2P5RA 2DJ3A 3FHKA 5DBQA 3TOUA 5JWOB 2O85A 5A5KA 4USSA 2PVOC 5D9WA 3BJ5A 1GNWA 1OKTA 4IJ3A 3CMIA 5ECOB 4NPBA 1TRUA 17GSA 2VOCA 5GZZB 1ERTA 2H19A 3LORA 1JLVA 1WJKA 1XZOA 2FWEA 3U5RE 1SKRB 5F07A 4TN8A 1ZYQB 1Q4JA 3C7MA 1GWCA 5DCGA 1MTCA 1X5EA 5ECMB 2X4AA 2FCHA 3IXRA 5G30A 1GSYA 1N8JA 5G1KA 1EOGA 2HRKA 3WGEA 1OC9A 2D2ZA 2IMEA 1SJIA 2XBIA 3UJ1A 3VI7A 1RW1A 1XOAA 2TIRA 4WBJA 2GT5A 1TOFA 1T1VA 1SD9A 4MF6A 2AV4A 2K8SA 5EY6A 1OAZA 5J4UA 4MH3A 3PGTA 1ACVA 5LNKe 1EV9A 3I43A 4HUAA 1S3AA 2YV7A 4F03A 1QGVA 4WKWA 2P5QA 3LQ7A 4RI6A 4ECJA 5A4UA 3IK7A 3MSZA 3CRTA 2IMFA 2X99A 4ZBBA 2FWFA 3DXBA 5JCUA 2QA1A 1V98A 1AXDA 3CQFA 2GTUA 4IKHA 4AJ6A 3IHGA 20GSA 3M8NA 1PKWA 4KDUA 2GSTA 1FAAA 3HXSA 2H71A 2YANA 1GTUA 2DJ1A 4JU5A 1M2BA 4ID0A 3EURA 5GAND 1BX9A 2AB6A 2H8LA 3L78A 6GSSA 2MZCA 2HE3A 4K8MA 5AN1A 3CTGA 2CVKA 2GZZA 2HZFA 4FIWA 1O85A 3C73A 4D73A 4LA1A 1PX6A 1FB0A 3PPUA 2IMDA 5HR1A 5IMCA 1U6TA 5KOXA 2XHFA 2B5XA 1QQ2A 2LKUA 2EIRA 2OA7A 1JZWA 1JZRA 3KMNA 4PX1A 1QXHA 4GQFA 2IMKA 2BJXA 5IOWA 2LS5A 3QD9A 1JHBA 3KH7A 3DMLA 3VWUA 2CAQA 2G2QA 5ECRB 4WF5A 3P2AA 3UOMA 3GUSA 4TR4A 1ZOFA 2C3QA 1GTIA 3CRUA 4G19A 2R6KA 1RQMA 5J9BA 5DAKA 4Q5QA 2R0CA 1H75A 2JACA 1YF1A 4O92A 3DVXA 5FT3A 5JWQB 4IGJA 5ID2B 2J9HA 4TR1A 2V32A 3BCIA 6GSVA 3KMOA 1SJZA 5D73A 1H4OA 11GSA 1HQOA 6GSTA 2LSTA 2CT6A 2H6ZA 3O6TA 4LMWA 3FYGA 3LW9A 2H0GA 2PERA 3EINA 3DYRA 1TJDA 4NWYA 14GSA 5F06A 4N0ZA 2B3SA 5AIVA 2R3XA 2HRAA 4KDYA 3ME7A 4KSMA 1ZMAA 5GAPD 2HYXA 4I97A 4OO4A 3TKQA 3QCPA 1EZKA 2VD0A 1EGRA 3UAPA 2PVQA 1NW2A 4A5PA 3WT1A 2YZHA 4XCSA 1FVKA 1SU9A 1A2LA 1TDIA 5J41A 3AY8A 7GSSA 4YQUA 2HZEB 3UMAA 4KCEA 2LNTA 3SWLA 4WETA 5CRGA 4WF4A 4HEA2 2FUG2 1AIUA 2LJRA 4IP1A 4PNFA 4BVXA 4G0KA 2OE3A 1X5CA 3VWVA 3GL3A 5DVBA 3TJKA 1BG5A 2V6OA 1PN9A 2KOKA 13GSA 2R5GA 3VWWA 5LD0A 2NVLA 3HKRA 4JEDA 1HNBA 5B6NA 2IFQA 2P31A 1TI3A 2LV3A 4NV2A 1K0DA 1M9BA 2H1GA 3KXOA 1MD4A 4OCEA 3M9JA 3GKKA 3UL3A 3A2VA 1XWBA 3HVVA 3ZVJD 2HSMA 4KSOA 2H6XA 3KZQA 5C00A 3EC3A 3A2WA 5IPHA 3EMXA 2VCZA 1SK0A 4FYUA 2X64A 1SYRA 4K5RA 4I5QA 2GSRA 2B6MA 2L5OA 3ZFBA 1W4VA 3GA4A 3FRCA 2VCQA 2HRFA 2J23A 3K8NA 5DJMA 3FZ5A 2C0DA 5HR0A 3QAGA 1PL1A 5IMDA 5ECLB 4TR1B 3EU4A 2YNXA 1K0MA 3QAWA 2L5LA 2FNOA 4MLYA 2LQOA 1YQ1A 1X9WB 2YCDA 5CYYA 1K0OA 4NXIA 1GSUA 2O89A 3Q6OA 4F0CA 5IO0A 2AJQB 5DDLA 1PA3A 1U88A 2O87A 4GRFA 3IC4A 2GZPA 4K7OA 3A2XA 3P7XA 3L9SA 3W8SA 1HYUA 2LUSA 2E2GA 1AC1A 1PN0A 2C3NA 2HRNA 2ZUPA 3BD2A 2CAIA 2R37A 5G31A 2FY6A 4MPFA 3C1RA 12GSA 3FEUA 5HR2A 1ZYPA 2NBSA 3F3QA 1M3JA 5IOXA 2WDUA 2M80A 4ZIJA 4PQIA 1K0NA 1BJXA 3GV1A 2GVPA 2OBKA 3VPQA 2JU5A 3F0IA 3G7JA 3M0FA 3F4TA 3TDGA 2XPEA 4ZILA 1E2YA 4BVXB 2ON7A 4MJCA 4PQHA 3E0UA 4CW9A 2A2SA 2BMXA 4GCIA 3HJMA 2A2PA 1K3YA 2EIOA 1I9DA 3I6AA 5DJLA 3NOFA 10GSA 3DVWA 1GNEA 5D8IA 3GKNA 2K9FA 1BYEA 1Q98A 2YZUA 3F6FA 5JCWA 1WOUA 4O5QA 1EOHA 1OC3A 3WD6A 1DUGA 4XRAA 2PGTA 1FOHA 2FWGA 2ZCTA 3ZIJA 4WR5A 1SD8A 2VIMA 2GSSA 1BQ7A 5FHIA 5ABRA 4RQXA 4PXOA 3ERWA 1VF1A 2H75A 4FYBA 4WR4A 3L0HA 1A0RP 3DGQA 4K5SA 1UA5A 1UN2A 5BMUA 5CRHA 5EVOA 2H72A 3F3RA 2C3TA 2H76A 4X43A 1QFNA 2ZNMA 1TRVA 2RUFA 3GKMA 4PTSA 1JLWA 3HVXA 3LFLA 1S3RA 2QC7A 4X4JA 5B6MA 2GZYA 4HSCX 5IPGA 3GH6A 2VO4A 2L6CA 5HR3A 1F9MA 2HFDA 3F9UA 4L5LA 4MDCA 3US3A 5ECHB 1TRSA 3O76A 3JCML 4O7HA 1X9SB 1E6BA 2A4VA 2IN3A 5GSSA 2VM2A 5ENUA 4BIKA 1X0RA 4XS4B 1JFUA 4ICYA 1A8LA 2DKHA 3LXTA 1O8XA 4KDXA 4POKA 1GSQA 1T4YA 4OFTA 2WJUA 3O3TA 4XS6A 1SKSB 1T3BA 5AISA 1K3OA 4IHUA 3ED3A 4O32A 5CNWA 3EPTA 1EWXA 4PGTA 1VGLA 4XIHA 4JBBA 5IMFA 1O73A 2FHEA 3RPNA 1SL0B 5ID2A 4ECCA 4G10A 1N2AA 5INYA 2HNLA 3TB2A 4KCAA 4DSQA 1KEBA 3WGXA 1QMVA 5ECPB 3FR6A 4NAXA 1K0CA 3ZMKA 3ZL5A 1PMTA 4NHWA 3QMXA 2DBCA 2MMNA 3D5JA 4LMVA 5ECQB 2KHPA 4I2UA 3L4NA 4BPYA 1BEDA 2F3MA 1XWAA 4V2NA 3ZREA 4MZCA 1OVNA 2VLUA 4L0UA 2K8VA 3C8EA 3GX8A 3RDWA 2OJLA 4JZQA 2NPBA 4G2EA 4GWRA 4IVFA 2UZ8A 5A4WA 4HU9A 6GSWA 2QSIA 3DWVA 4TRXA 1XPVA 4OMVA 3HYPA 2JADA 3EYTA 2HZEA 4HS1A 4K6XA 3RHBA 4LL1B 3IAM2 3G7YA 1WWJA 2LRNA 5CP1A 3IK9A 5ELGA 4ECBA 3UVTA 3RAZA 1S3DA 2HT9A 4FO5A 4GXZA 2CVDA 5ECNB 4ECIA 1VF3A 5IIZA 1BAYA 4Z7XA 1YJ6A 2GQLA 1T7PB 1M2DA 1HD2A 4ZL9A 3Q19A 2E0QA 4Z2UA 3TJFA 2ALBA 1TTZA 3RHCA 1X9MB 1OKDA 2DLXA 1A24A 3GL5A 4BVYB 2XPDA 4XRDA 4I2TA 4JR6A 1OYJA 3D6IA 4RQRA 3FZ9A 1G7OA 3G7IA 4CY8A 1NHOA 3M1GA 3IDVA 2RLIA 3GNJA 2GLRA 4HZ2A 5AIXA 2CX4A 3FR9A 2LNSA 3TRXA 1JZDA 2AHEA 3H4KA 4IQAA 3ME8A 4MA9A 1XWGA 3Q18A 4QL7A 3MYDA 5KN1A 4DSSB 5EL8A 3CYNA 4TOPA 2VAFA 4Z2TA 3GTUB 4MPGA 3NZNA 2ON5A 3F8UA 3M3MA 3IAS2 8GSSA 3TJGA 4TR0A 2X49A 3TKSA 4XHMA 2V2GA 5KEJA 3J7Yb 4EVMA 2IL3A 4PUAA 4K9ZA 1TI1A 2JZSA 4O5RA 1J08A 3EU3A 1T8EB 1G7EA 2H01A 2XC2A 1XXUA 1R7HA 3D0ZA 2C80A 2B5EA 2C0EA 3VWXA 4OO5A 5ELAA 4IP6A 1CQHA 3D21A 1O6JA 1GUMA 1M2AA 4MF5A 2LTKA 5HFIA 1FW1A 4ISDA 2WRTA 2ES7A 3FKFA 4OD7A 2RUEA 1M0UA 4HZ4A 1XIYA 4EUYA 1URMA 1PGTA 2V6KA 3ZMLA 3VK9A 4KF9A 4Q5RA 1RK4A 4F2IA 2L4QA 1OE7A 3F4SA 3TKPA 4K7NA 1LBKA 2A2RA 3UBLA 4JRRA 2MBTA 3L9VA 4TW5A 4Z2RA 2VL9A 4V2LA 1MD3A 4YKGA 2H1DA 3J7Yk 1TK8B 2H0IA 5J3RA 4IELA 3EE2A 5IMZA 4G0IA 4K0GA 2N5AA 4BL7A 4H86A 3IHQA 2VL3A 1XW5A 1VF2A 2O7KA 2XBQA 4JE1A 3HHVA 3ERFA 2H1AA 2MYGA 1WIKA 2L59A 5KOWA 1F37A 3TJBA 5LCZA 2DIZA 2DMLA 3ZFLA 4POLA 3SBCA 4MJBA 2I1UA 3VI5A 2P0GA 4RI7A 3FK8A 5H5RA 4XTSA 3M9KA 4G9HA 1R5AA 5H5QA 4MMMA 1O7UA 5H5SA 2QGVA 1GTAA 4I8BA 2LJAA 1NHYA 2C0FA 3N5OA 3UVHA 4EO3A 2RM6A 4HQSA 2YWOA 1K0BA 2EC4A 2I3YA 1GSSA 5KN3A 1EGOA 2OADA 4ML6A 5D9TA 4P3YB 2I4AA 4IS0A 5F8BA 4GLTA 2NTOA 3TKSE 3VFIA 4N0VA 1TU7A 1YDKA 4BA7A 1O81A 1X5DA 2LQQA 3LYKA 5DCHA 4EL1A 1B48A 2AUVA 4AJ8A 1ERWA 2FA4A 1FHEA 4KH7A 1UVZA 2K6VA 4XS4A 3ERGA 1AUCA 5D9VA 1MDIA 4CHSA 1PL2A 4V1Ag 5CO3A 4MJEA 3QAVA 4FQUA 1Y25A 1G6YA 2FWHA 4OWYA 4WXTA 18GSA 1M9AA 3ZITA 2H70A 3MAKA 3KP9A 1XWKA 2WB9A 5J9CA 4BWQA 3UARA 5G5EA 3H93A 4IBPA 1A2JA 3NIVA 4O5UA 1YEXA 4TKYA 4QL9A 2MBSA 1VRSD 4N11A 1M3IA 3ZLPA 1PD21 1Z7PA 3BCKA 2H74A 4PURA 3LSZA 1SYXA 1V40A 1I5GA 3GH9A 3BBYA 3TRPA 1XFLA 5IO2A 2QA2A 3KH9A 4MP4A 2VCWA 1XVQA 4X0XA 1SJ6A 2X8GA 4EKZA 3PR8A 1YF0A 5G2ZA 4YQVA 1TRWA 4KUNA 1YZXA 4GTUA 5E59A 4OFNA 3KTBA 4AGSA 2H6YA 3IRAA 4BL7B 4TXOB 4YAVA 1PSQA 3WYWA 2N5BA 4F9ZA 2VLVA 2MMAA 4OCFA 1MDJA 2KLXA 4GSTA 2B1LA 4RUVA 1IYHA 2I9HA 2GQKA 4HJMA 4QQ7A 1Z3EA 2OACA 2YWNA 1DE2A 5ECSA 1ZGNA 1F2EA 4CDOA 3KIJA 1B9YC 1NM3A 1XW6A 1GLQA 1O8WA 3ISOA 1PQNA 1GP1A 4FYCA 3FMWA 2YV9A 3R3EA 4K2XA 1Z9HA 2B7KA 2YOIA 4ILFA 3BOAA 1U87A 1A23A 6GSUA 1KTEA 1ST9A 1MDKA 3APQA 5ECKB 2RIIA 5CREA 1V2AA 5GSTA 3A5IA 4YQMA 2JZRA 4IJIA 2OE1A 2YN1A 4GSNA 3KP8A 3HD5A 4BVYA 3C71A 4OFMA 2K18A 3CSIA 3KGKA 2OE0A 5IM9A 2HSHA 3GIXA 1TW9A 3LGCA 4KE3A 1V9WA 2DJ0A 5JCGA 4ZB9A 3H8QA 4LLRA 2KP1A 3IOSA 5A4VA 5COHA 3IBHA 1AQWA 1U3AA 2G0FA 3ZZXA 2V41A 3W6GA 1YEPA 2PPTA 3I9V2 4K7IA 4IW9A 5HFGA 4DSSA 3GSSA 3FY7A 1GULA 4EC0A 3TJJA 3UEMA 5IQYA 1EV4A 3U6VA 4HQZA 1ZYNA 3GTUA 3DEXA 1WMJA 3V1WA 4CY6A 2C1YA 2F51A 2H73A 3F4RA 4MNNA 1B4QA 2GS3A 3A3TA 4ZL8A 1SK1A 3D4TA 2VCVA 3FR3A 4Q5NA 4ULXA 1YY7A 1LU4A 1KNGA 3GSTA 5CAXA 4DVCA 2GSQA 3F63A 5D9XA 5HQPA 2R0PA 1GRXA 1XG8A 1PX7A 1YKCA 2DKIA 3HJPA 4J2FA 5EPFA 4HOJA 2IPAA 2LRTA 5ECIB 1GTBA 1TK0B 1IYIA 5B7CA 3LEFA 3MWHA 3EMPA 4YH2A 1PFOA 4YAPA 5IMVA 2FA8A 3DIEA 5CRDA 5B8BA 1TU8A 2DSAA 2JSYA 1V57A 5F0GA 2HXKA 3CSHA 2VUPA 1Z5YE 1EP7A 2IJYA 1THOA 4F82A 2YJ7A 3DKSA 1A0FA 2A4HA 3HVSA 3MIXA 2R2JA 2L6DA 2YWMA 3GHAA 1ABAA 1Z6NA 4KB3A 4ZXGA 1FG4A 1DBYA 3MNGA 3QOUA 22GSA 1ILOA 4PNGA 4EF0A 2WS2A 3LJRA 3FZAA 2EIQA 3MDKA 4POBA 3EWLA 2VCTA 2FLSA 4MZBA 4ZBAA 2E2MA 1Y6EA 1FVJA 4G0LA 1USBA 2PMTA 5DALB 2JZTA 1TK5B 3QFAC 4L8EA 4J56E 3LXZA 1A8YA 3UIWA 1ML6A 2IIYA 3GKXA 4WEYA 3KTLA 2KP2A 3KM6A 4WBRD 4EIQA 1G0TA 3QR6A 3UBKA 1PKZA 4MJAA 2AAWA 2F9SA 1SL2B 2REMA 1OE8A 3F6DA 3LWAA 1KBNA 2C0GA 3DRNA 2BTOT 4K1FA 5B8AA 2IWTA 2VM1A 4GQCA 5BRTA 1XVWA 2H30A 1MEKA 2HLSA 2H66A 1AQXA 5DQYA 4L0WA 3VURA 1AW9A 4MCUA 3D4MA 2DJKA 2CQ9A 1XWCA 1S3CA 2YWIA 2WFCA 1ERUA 1WP0A 3TOTA 1OC9B 1FB6A 4E8HA 3IE3A 4GSSA 3RBTA 4KNDA 3S9FA 2M72A 3APSA 3I69A 2L57A 2H1BA 4EDZA 3ZYWA 4Q5FA 3GURA 1XCCA 1GSFA 2B5YA 4K0NA 2TRXA 2H0HA 1WE0A 4POMA 1VF4A 5D93A 3DD3A 1QUWA 1FO5A 6GSXA 3VPTA 2DMMA 1T00A 2VL2A 1JZOA 3APOA 3IA1A 2OBIA 4KX4A 4HJ2A 3HVNA 4DEJA 1FOVA 1R4WA 2R4VA 1M7TA 4MABA 3TKSC 3QDNA 2HI7A 1F3BA 2YP6A 3PINA 3PH9A 1SK2A 2FGXA 4F0BA 1GUKA 4TVEA 4N10A 4MZWA 4E8EA 19GSA 1WRYA 2V1MA 1GLPA 3GYKA 1A2MA 3E9JB 1GL8A 5KN0A 2Z9SA 4TXOA 1B8XA 2VL2C 4MK3A 2C8UA 1WPIA 1HNAA 3ZTLA 4D73B 4LL4B 3VLNA 2MMZA 1AQVA 4NV5A 1UC7A 2CZ2A 2YPMA 4DSRA 1GH2A 4NHZA 9GSSA 3GFKA 2CV4A 3WGDA 1V58A 2JL4A 4EE0A 2GDRA 2CA8A 1TP9A 1M99A 2VCXA 5J5NA 1XBSA 1W89A 4HDEA 1K3LA 2VLTA 1ZYEA 1PRXA 2DJ2A 2IMIA 3E3EA 3H79A 3N9JA 4V2MA 3CXGA 3H1NA 6GSYA 2DJJA 2PUKC 4BWSA 2GGTA 3KCMA 2B7JA 1CQGA 1T4ZA 2GT6A 1XOBA 4IN0A 3P90A 3C1SA 2PN8A 2RM5A 5DAKB 4L5OA 3G9BA 1TKDB 3A5WA 2CX3A 16GSA 3OR5A 2O8VB 1J0FA 4K2DA 4EIPA 1YKAA 2KUCA 3FW2A 4MH2A 1ON4A 4TXVA 1TXXA 3TRQA 4MF7A 3ZVJA 3CSJA 1HNCA 3HDCA
chains in the Genus database with same CATH topology
3TGZA 4ZL7A 1NSWA 2OKAA 1SL1B 2TRCP 4I6XA 1ZCPA 4N30A 2YJHA 3LYPA 2WGRA 3IC8A 2NDOA 5G5FA 3HA9A 3FZ4A 3D22A 3GRXA 3WT2A 2WCIA 1EP8A 3GN3A 1ZL9A 4XS1A 2DC5A 1G6WA 2MMOA 5KN2A 3CTFA 3CBUA 1F6MC 3TUEA 3HZ4A 3LG6A 3W8JA 5IMAA 1QK8A 3P8WA 3IR4A 1LJRA 4EXJA 2PWJA 4HU7A 2F8FA 1EEMA 2AYTA 2GQMA 2PBJA 2CVBA 4V1Ap 3QPMA 1DSBA 5C04A 5HFKA 3HZ8A 4KW6A 1THXA 2QKEA 4HI7A 3IPZA 4PUFC 3GX0A 4ZB8A 5F05A 3TCOA 1R26A 2L4CA 1GUHA 2FD3A 1SKWB 1R5PA 2E7PA 3R2QA 3EVIA 5AGYA 4IQ1A 3IV4A 1B9XC 4JR4A 4ACSA 2C4JA 2IFQB 3RPPA 1OC8A 5CRWA 4ZB6A 1C72A 2I81A 4J57E 1AAZA 3KEBA 4FH8A 2N5FA 1GSEA 4KA0A 5JWRB 3ZRDA 3TKRA 3QFBC 2PU9C 2X8CA 4TR3A 2LEGA 3Q74A 1ZZYA 1F3AA 5G1LA 3KD0A 4KGIA 2WZ9A 3HJOA 2X8HA 2M46A 1ERVA 2F8AA 5DQSA 1EEJA 1J9BA 3HY2A 5D96A 4AJ7A 4ZBDA 3GMFA 4ML1A 2B1KA 2DIYA 3ZIVA 1B4PA 4AF2A 2WULA 2LRCA 2HSYA 2VD1A 5E4WA 1SENA 1XW9A 1Z6MA 1DE1A 4EDYA 1Z7RA 1GSDA 2R0GA 2CZ3A 2LJKA 3HCZA 3L9UA 4NMUA 5FWGA 4GF0A 4X1UA 5L71A 1K0AA 5DALA 4PQ1A 1U3IA 3KJYA 4KAEA 4YKFA 2JSZA 2P5RA 2DJ3A 3FHKA 5DBQA 3TOUA 5JWOB 2O85A 5A5KA 4USSA 2PVOC 5D9WA 3BJ5A 1GNWA 1OKTA 4IJ3A 3CMIA 5ECOB 4NPBA 1TRUA 17GSA 2VOCA 5GZZB 1ERTA 2H19A 3LORA 1JLVA 1WJKA 1XZOA 2FWEA 3U5RE 1SKRB 5F07A 4TN8A 1ZYQB 1Q4JA 3C7MA 1GWCA 5DCGA 1MTCA 1X5EA 5ECMB 2X4AA 2FCHA 3IXRA 5G30A 1GSYA 1N8JA 5G1KA 1EOGA 2HRKA 3WGEA 1OC9A 2D2ZA 2IMEA 1SJIA 2XBIA 3UJ1A 3VI7A 1RW1A 1XOAA 2TIRA 4WBJA 2GT5A 1TOFA 1T1VA 1SD9A 4MF6A 2AV4A 2K8SA 5EY6A 1OAZA 5J4UA 4MH3A 3PGTA 1ACVA 5LNKe 1EV9A 3I43A 4HUAA 1S3AA 2YV7A 4F03A 1QGVA 4WKWA 2P5QA 3LQ7A 4RI6A 4ECJA 5A4UA 3IK7A 3MSZA 3CRTA 2IMFA 2X99A 4ZBBA 2FWFA 3DXBA 5JCUA 2QA1A 1V98A 1AXDA 4IKHA 2GTUA 4AJ6A 3IHGA 20GSA 3M8NA 1PKWA 4KDUA 2GSTA 1FAAA 3HXSA 2H71A 2YANA 1GTUA 2DJ1A 4JU5A 1M2BA 4ID0A 3EURA 5GAND 1BX9A 2AB6A 2H8LA 3L78A 6GSSA 2MZCA 2HE3A 4K8MA 5AN1A 3CTGA 2CVKA 2GZZA 2HZFA 4FIWA 1O85A 3C73A 4D73A 4LA1A 1PX6A 1FB0A 3PPUA 2IMDA 5HR1A 5IMCA 1U6TA 5KOXA 2XHFA 2B5XA 1QQ2A 2LKUA 2EIRA 2OA7A 1JZWA 1JZRA 3KMNA 4PX1A 1QXHA 4GQFA 2IMKA 2BJXA 5IOWA 2LS5A 3QD9A 1JHBA 3KH7A 3DMLA 3VWUA 2CAQA 2G2QA 5ECRB 4WF5A 3P2AA 3UOMA 3GUSA 4TR4A 1ZOFA 2C3QA 1GTIA 3CRUA 4G19A 2R6KA 1RQMA 5J9BA 5DAKA 4Q5QA 2R0CA 1H75A 2JACA 1YF1A 4O92A 3DVXA 5FT3A 5JWQB 4IGJA 5ID2B 2J9HA 4TR1A 2V32A 3BCIA 6GSVA 3KMOA 1SJZA 5D73A 1H4OA 11GSA 1HQOA 6GSTA 2LSTA 2CT6A 2H6ZA 3O6TA 4LMWA 3FYGA 3LW9A 2H0GA 2PERA 3EINA 3DYRA 1TJDA 4NWYA 14GSA 5F06A 4N0ZA 2B3SA 5AIVA 2R3XA 2HRAA 4KDYA 3ME7A 4KSMA 1ZMAA 5GAPD 2HYXA 4I97A 4OO4A 3TKQA 3QCPA 1EZKA 2VD0A 1EGRA 3UAPA 2PVQA 1NW2A 4A5PA 3WT1A 2YZHA 4XCSA 1FVKA 1SU9A 1A2LA 1TDIA 5J41A 3AY8A 7GSSA 4YQUA 2HZEB 3UMAA 4KCEA 2LNTA 3SWLA 4WETA 5CRGA 4WF4A 4HEA2 2FUG2 1AIUA 2LJRA 4IP1A 4PNFA 4BVXA 4G0KA 2OE3A 1X5CA 3VWVA 3GL3A 5DVBA 3TJKA 1BG5A 2V6OA 1PN9A 2KOKA 13GSA 2R5GA 3VWWA 5LD0A 2NVLA 3HKRA 4JEDA 1HNBA 5B6NA 2IFQA 2P31A 1TI3A 2LV3A 4NV2A 1K0DA 1M9BA 2H1GA 3KXOA 1MD4A 4OCEA 3M9JA 3GKKA 3UL3A 3A2VA 1XWBA 3HVVA 3ZVJD 2HSMA 4KSOA 2H6XA 3KZQA 5C00A 3EC3A 3A2WA 5IPHA 3EMXA 2VCZA 1SK0A 4FYUA 2X64A 1SYRA 4K5RA 4I5QA 2GSRA 2B6MA 2L5OA 3ZFBA 1W4VA 3GA4A 3FRCA 2VCQA 2HRFA 2J23A 3K8NA 5DJMA 3FZ5A 2C0DA 5HR0A 3QAGA 1PL1A 5IMDA 5ECLB 4TR1B 3EU4A 2YNXA 1K0MA 3QAWA 2L5LA 2FNOA 4MLYA 2LQOA 1YQ1A 1X9WB 2YCDA 5CYYA 1K0OA 4NXIA 1GSUA 2O89A 3Q6OA 4F0CA 5IO0A 2AJQB 5DDLA 1PA3A 1U88A 2O87A 4GRFA 3IC4A 2GZPA 4K7OA 3A2XA 3P7XA 3L9SA 3W8SA 1HYUA 2LUSA 2E2GA 1AC1A 1PN0A 2C3NA 2HRNA 2ZUPA 3BD2A 2CAIA 2R37A 5G31A 2FY6A 4MPFA 3C1RA 12GSA 3FEUA 5HR2A 1ZYPA 2NBSA 3F3QA 5IOXA 2WDUA 2M80A 4ZIJA 4PQIA 1K0NA 1BJXA 3GV1A 2GVPA 2OBKA 3VPQA 2JU5A 3F0IA 3G7JA 3M0FA 3F4TA 3TDGA 2XPEA 4ZILA 1E2YA 4BVXB 2ON7A 4MJCA 4PQHA 3E0UA 4CW9A 2A2SA 2BMXA 4GCIA 3HJMA 2A2PA 1K3YA 2EIOA 1I9DA 3I6AA 5DJLA 3NOFA 10GSA 3DVWA 1GNEA 5D8IA 3GKNA 2K9FA 1BYEA 1Q98A 2YZUA 3F6FA 5JCWA 1WOUA 4O5QA 1EOHA 1OC3A 3WD6A 1DUGA 4XRAA 2PGTA 1FOHA 2FWGA 2ZCTA 3ZIJA 4WR5A 1SD8A 2VIMA 2GSSA 1BQ7A 5FHIA 5ABRA 4RQXA 4PXOA 3ERWA 1VF1A 2H75A 4FYBA 4WR4A 3L0HA 1A0RP 3DGQA 4K5SA 1UA5A 1UN2A 5BMUA 5CRHA 5EVOA 2H72A 3F3RA 2C3TA 2H76A 4X43A 1QFNA 2ZNMA 1TRVA 2RUFA 3GKMA 4PTSA 1JLWA 3HVXA 3LFLA 2QC7A 4X4JA 5B6MA 2GZYA 5IPGA 3GH6A 2VO4A 2L6CA 5HR3A 1F9MA 2HFDA 3F9UA 4L5LA 4MDCA 3US3A 5ECHB 1TRSA 3O76A 3JCML 4O7HA 1X9SB 1E6BA 2A4VA 2IN3A 5GSSA 2VM2A 5ENUA 1X0RA 4XS4B 1JFUA 4ICYA 1A8LA 2DKHA 3LXTA 1O8XA 4KDXA 4POKA 1GSQA 1T4YA 4OFTA 2WJUA 3O3TA 4XS6A 1SKSB 1T3BA 5AISA 1K3OA 4IHUA 3ED3A 4O32A 5CNWA 3EPTA 1EWXA 4PGTA 1VGLA 4XIHA 4JBBA 5IMFA 1O73A 2FHEA 3RPNA 1SL0B 5ID2A 4ECCA 4G10A 1N2AA 5INYA 2HNLA 3TB2A 4KCAA 4DSQA 1KEBA 3WGXA 1QMVA 5ECPB 3FR6A 4NAXA 1K0CA 3ZMKA 3ZL5A 1PMTA 4NHWA 3QMXA 2DBCA 2MMNA 3D5JA 4LMVA 5ECQB 2KHPA 4I2UA 3L4NA 4BPYA 1BEDA 2F3MA 1XWAA 4V2NA 3ZREA 4MZCA 1OVNA 2VLUA 4L0UA 2K8VA 3C8EA 3GX8A 3RDWA 2OJLA 4JZQA 2NPBA 4G2EA 4GWRA 4IVFA 2UZ8A 5A4WA 4HU9A 6GSWA 2QSIA 3DWVA 4TRXA 1XPVA 4OMVA 3HYPA 2JADA 3EYTA 2HZEA 4HS1A 4K6XA 3RHBA 4LL1B 3IAM2 3G7YA 1WWJA 2LRNA 5CP1A 3IK9A 5ELGA 4ECBA 3UVTA 3RAZA 1S3DA 2HT9A 4FO5A 4GXZA 2CVDA 5ECNB 4ECIA 1VF3A 5IIZA 1BAYA 4Z7XA 1YJ6A 2GQLA 1T7PB 1M2DA 1HD2A 4ZL9A 3Q19A 2E0QA 4Z2UA 3TJFA 2ALBA 1TTZA 3RHCA 1X9MB 1OKDA 2DLXA 1A24A 3GL5A 4BVYB 2XPDA 4XRDA 4I2TA 4JR6A 1OYJA 3D6IA 4RQRA 3FZ9A 1G7OA 3G7IA 4CY8A 1NHOA 3M1GA 3IDVA 2RLIA 3GNJA 2GLRA 4HZ2A 5AIXA 2CX4A 3FR9A 2LNSA 3TRXA 1JZDA 2AHEA 3H4KA 4IQAA 3ME8A 4MA9A 1XWGA 3Q18A 4QL7A 3MYDA 5KN1A 4DSSB 5EL8A 3CYNA 4TOPA 2VAFA 4Z2TA 3GTUB 4MPGA 3NZNA 2ON5A 3F8UA 3M3MA 3IAS2 8GSSA 3TJGA 4TR0A 2X49A 3TKSA 4XHMA 2V2GA 5KEJA 3J7Yb 4EVMA 2IL3A 4PUAA 4K9ZA 1TI1A 2JZSA 4O5RA 1J08A 3EU3A 1T8EB 1G7EA 2H01A 2XC2A 1XXUA 1R7HA 3D0ZA 2C80A 2B5EA 2C0EA 3VWXA 4OO5A 5ELAA 4IP6A 1CQHA 3D21A 1O6JA 1GUMA 1M2AA 4MF5A 2LTKA 5HFIA 1FW1A 4ISDA 2WRTA 2ES7A 3FKFA 4OD7A 2RUEA 1M0UA 4HZ4A 1XIYA 4EUYA 1URMA 1PGTA 2V6KA 3ZMLA 3VK9A 4KF9A 4Q5RA 1RK4A 4F2IA 2L4QA 1OE7A 3F4SA 3TKPA 4K7NA 1LBKA 2A2RA 3UBLA 4JRRA 2MBTA 3L9VA 4TW5A 4Z2RA 2VL9A 4V2LA 1MD3A 4YKGA 2H1DA 3J7Yk 1TK8B 2H0IA 5J3RA 4IELA 3EE2A 5IMZA 4G0IA 4K0GA 2N5AA 4BL7A 4H86A 3IHQA 2VL3A 1XW5A 1VF2A 2O7KA 2XBQA 4JE1A 3HHVA 3ERFA 2H1AA 2MYGA 1WIKA 2L59A 5KOWA 1F37A 3TJBA 5LCZA 2DIZA 2DMLA 3ZFLA 4POLA 3SBCA 4MJBA 2I1UA 3VI5A 2P0GA 4RI7A 3FK8A 5H5RA 4XTSA 3M9KA 4G9HA 1R5AA 5H5QA 4MMMA 1O7UA 5H5SA 2QGVA 1GTAA 4I8BA 2LJAA 1NHYA 2C0FA 3N5OA 3UVHA 4EO3A 2RM6A 4HQSA 2YWOA 1K0BA 2EC4A 2I3YA 1GSSA 5KN3A 1EGOA 2OADA 4ML6A 5D9TA 4P3YB 2I4AA 4IS0A 5F8BA 4GLTA 2NTOA 3TKSE 3VFIA 4N0VA 1TU7A 1YDKA 4BA7A 1O81A 1X5DA 2LQQA 3LYKA 5DCHA 4EL1A 1B48A 2AUVA 4AJ8A 1ERWA 2FA4A 1FHEA 4KH7A 1UVZA 2K6VA 4XS4A 3ERGA 1AUCA 5D9VA 1MDIA 4CHSA 1PL2A 4V1Ag 5CO3A 4MJEA 3QAVA 4FQUA 1Y25A 1G6YA 2FWHA 4OWYA 4WXTA 18GSA 1M9AA 3ZITA 2H70A 3MAKA 3KP9A 1XWKA 2WB9A 5J9CA 4BWQA 3UARA 5G5EA 3H93A 4IBPA 1A2JA 3NIVA 4O5UA 1YEXA 4TKYA 4QL9A 2MBSA 1VRSD 4N11A 3ZLPA 1PD21 1Z7PA 3BCKA 2H74A 4PURA 3LSZA 1SYXA 1V40A 1I5GA 3GH9A 3BBYA 3TRPA 1XFLA 5IO2A 2QA2A 3KH9A 4MP4A 2VCWA 1XVQA 4X0XA 1SJ6A 2X8GA 4EKZA 3PR8A 1YF0A 5G2ZA 4YQVA 1TRWA 4KUNA 1YZXA 4GTUA 5E59A 4OFNA 3KTBA 4AGSA 2H6YA 3IRAA 4BL7B 4TXOB 4YAVA 1PSQA 3WYWA 2N5BA 4F9ZA 2VLVA 2MMAA 4OCFA 1MDJA 2KLXA 4GSTA 2B1LA 4RUVA 1IYHA 2I9HA 2GQKA 4HJMA 4QQ7A 1Z3EA 2OACA 2YWNA 1DE2A 5ECSA 1ZGNA 1F2EA 4CDOA 3KIJA 1B9YC 1NM3A 1XW6A 1GLQA 1O8WA 3ISOA 1PQNA 1GP1A 4FYCA 3FMWA 2YV9A 3R3EA 4K2XA 1Z9HA 2B7KA 2YOIA 4ILFA 3BOAA 1U87A 1A23A 6GSUA 1KTEA 1ST9A 1MDKA 3APQA 5ECKB 2RIIA 5CREA 1V2AA 5GSTA 3A5IA 4YQMA 2JZRA 4IJIA 2OE1A 2YN1A 4GSNA 3KP8A 3HD5A 4BVYA 3C71A 4OFMA 2K18A 3CSIA 3KGKA 2OE0A 5IM9A 2HSHA 3GIXA 1TW9A 3LGCA 4KE3A 1V9WA 2DJ0A 5JCGA 4ZB9A 3H8QA 4LLRA 2KP1A 3IOSA 5A4VA 5COHA 3IBHA 1AQWA 1U3AA 2G0FA 3ZZXA 2V41A 3W6GA 1YEPA 2PPTA 3I9V2 4K7IA 4IW9A 5HFGA 4DSSA 3GSSA 3FY7A 1GULA 4EC0A 3TJJA 3UEMA 5IQYA 1EV4A 3U6VA 4HQZA 1ZYNA 3GTUA 3DEXA 1WMJA 3V1WA 4CY6A 2C1YA 2F51A 2H73A 3F4RA 4MNNA 1B4QA 2GS3A 3A3TA 4ZL8A 1SK1A 3D4TA 2VCVA 3FR3A 4Q5NA 4ULXA 1YY7A 1LU4A 1KNGA 3GSTA 5CAXA 4DVCA 2GSQA 3F63A 5D9XA 5HQPA 2R0PA 1GRXA 1PX7A 1YKCA 2DKIA 3HJPA 4J2FA 5EPFA 4HOJA 2IPAA 2LRTA 5ECIB 1GTBA 1TK0B 1IYIA 5B7CA 3LEFA 3MWHA 3EMPA 4YH2A 4YAPA 5IMVA 2FA8A 3DIEA 5CRDA 5B8BA 1TU8A 2DSAA 2JSYA 1V57A 5F0GA 2HXKA 3CSHA 2VUPA 1Z5YE 1EP7A 2IJYA 1THOA 4F82A 2YJ7A 3DKSA 1A0FA 2A4HA 3HVSA 3MIXA 2R2JA 2L6DA 2YWMA 3GHAA 1ABAA 1Z6NA 4KB3A 4ZXGA 1FG4A 1DBYA 3MNGA 3QOUA 22GSA 1ILOA 4PNGA 4EF0A 2WS2A 3LJRA 3FZAA 2EIQA 3MDKA 4POBA 3EWLA 2VCTA 2FLSA 4MZBA 4ZBAA 2E2MA 1Y6EA 1FVJA 4G0LA 1USBA 2PMTA 5DALB 2JZTA 1TK5B 3QFAC 4L8EA 4J56E 3LXZA 1A8YA 3UIWA 1ML6A 2IIYA 3GKXA 4WEYA 3KTLA 2KP2A 3KM6A 4WBRD 4EIQA 1G0TA 3QR6A 3UBKA 1PKZA 4MJAA 2AAWA 2F9SA 1SL2B 2REMA 1OE8A 3F6DA 3LWAA 1KBNA 2C0GA 3DRNA 2BTOT 4K1FA 5B8AA 2IWTA 2VM1A 4GQCA 5BRTA 1XVWA 2H30A 1MEKA 2HLSA 2H66A 1AQXA 5DQYA 4L0WA 3VURA 1AW9A 4MCUA 3D4MA 2DJKA 2CQ9A 1XWCA 1S3CA 2YWIA 2WFCA 1ERUA 1WP0A 3TOTA 1OC9B 1FB6A 4E8HA 3IE3A 4GSSA 3RBTA 4KNDA 3S9FA 2M72A 3APSA 3I69A 2L57A 2H1BA 4EDZA 3ZYWA 4Q5FA 3GURA 1XCCA 1GSFA 2B5YA 4K0NA 2TRXA 2H0HA 1WE0A 4POMA 1VF4A 5D93A 3DD3A 1QUWA 1FO5A 6GSXA 3VPTA 2DMMA 1T00A 2VL2A 1JZOA 3APOA 3IA1A 2OBIA 4KX4A 4HJ2A 4DEJA 1FOVA 1R4WA 2R4VA 1M7TA 4MABA 3TKSC 3QDNA 2HI7A 1F3BA 2YP6A 3PINA 3PH9A 1SK2A 2FGXA 4F0BA 1GUKA 4TVEA 4N10A 4MZWA 4E8EA 19GSA 1WRYA 2V1MA 1GLPA 3GYKA 1A2MA 3E9JB 1GL8A 5KN0A 2Z9SA 4TXOA 1B8XA 2VL2C 4MK3A 2C8UA 1WPIA 1HNAA 3ZTLA 4D73B 4LL4B 3VLNA 2MMZA 1AQVA 4NV5A 1UC7A 2CZ2A 2YPMA 4DSRA 1GH2A 4NHZA 9GSSA 3GFKA 2CV4A 3WGDA 1V58A 2JL4A 4EE0A 2GDRA 2CA8A 1TP9A 1M99A 2VCXA 5J5NA 1XBSA 1W89A 4HDEA 1K3LA 2VLTA 1ZYEA 1PRXA 2DJ2A 2IMIA 3E3EA 3H79A 3N9JA 4V2MA 3CXGA 3H1NA 6GSYA 2DJJA 2PUKC 4BWSA 2GGTA 3KCMA 2B7JA 1CQGA 1T4ZA 2GT6A 1XOBA 4IN0A 3P90A 3C1SA 2PN8A 2RM5A 5DAKB 4L5OA 3G9BA 1TKDB 3A5WA 2CX3A 16GSA 3OR5A 2O8VB 1J0FA 4K2DA 4EIPA 1YKAA 2KUCA 3FW2A 4MH2A 1ON4A 4TXVA 1TXXA 3TRQA 4MF7A 3ZVJA 3CSJA 1HNCA 3HDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TGZ A;  4ZL7 A;  1NSW A;  2OKA A;  1SL1 B;  2TRC P;  4I6X A;  1ZCP A;  4N30 A;  2YJH A;  3LYP A;  2WGR A;  2NDO A;  5G5F A;  3HA9 A;  3FZ4 A;  3D22 A;  3GRX A;  3WT2 A;  2WCI A;  1EP8 A;  3GN3 A;  1ZL9 A;  4XS1 A;  2DC5 A;  1G6W A;  2MMO A;  5KN2 A;  3CTF A;  3CBU A;  1F6M C;  3TUE A;  3HZ4 A;  3LG6 A;  3W8J A;  5IMA A;  1QK8 A;  3P8W A;  3IR4 A;  1LJR A;  4EXJ A;  2PWJ A;  4HU7 A;  2F8F A;  1EEM A;  2AYT A;  2GQM A;  2PBJ A;  2CVB A;  4V1A p;  3QPM A;  1DSB A;  5C04 A;  5HFK A;  3HZ8 A;  4KW6 A;  1THX A;  2QKE A;  4HI7 A;  3IPZ A;  4PUF C;  3GX0 A;  4ZB8 A;  5F05 A;  3TCO A;  1R26 A;  2L4C A;  1GUH A;  2FD3 A;  1SKW B;  1R5P A;  2E7P A;  3R2Q A;  3EVI A;  5AGY A;  4IQ1 A;  3IV4 A;  1B9X C;  4JR4 A;  4ACS A;  2C4J A;  2IFQ B;  3RPP A;  1OC8 A;  5CRW A;  4ZB6 A;  1C72 A;  2I81 A;  4J57 E;  1AAZ A;  3KEB A;  4FH8 A;  2N5F A;  1GSE A;  4KA0 A;  5JWR B;  3ZRD A;  3TKR A;  3QFB C;  2PU9 C;  2X8C A;  4TR3 A;  2LEG A;  3Q74 A;  1ZZY A;  1F3A A;  5G1L A;  3KD0 A;  4KGI A;  2WZ9 A;  3HJO A;  2X8H A;  2M46 A;  1ERV A;  2F8A A;  5DQS A;  1EEJ A;  1J9B A;  3HY2 A;  5D96 A;  4AJ7 A;  4ZBD A;  3GMF A;  4ML1 A;  2B1K A;  2DIY A;  3ZIV A;  1B4P A;  4AF2 A;  2WUL A;  2LRC A;  2HSY A;  2VD1 A;  5E4W A;  1SEN A;  1XW9 A;  1Z6M A;  1DE1 A;  4EDY A;  1Z7R A;  1GSD A;  2CZ3 A;  2LJK A;  3HCZ A;  3L9U A;  4NMU A;  5FWG A;  4GF0 A;  4X1U A;  5L71 A;  1K0A A;  5DAL A;  4PQ1 A;  1U3I A;  3KJY A;  4KAE A;  2JSZ A;  2P5R A;  2DJ3 A;  3FHK A;  5DBQ A;  3TOU A;  5JWO B;  2O85 A;  5A5K A;  2PVO C;  5D9W A;  3BJ5 A;  1GNW A;  1OKT A;  4IJ3 A;  3CMI A;  5ECO B;  4NPB A;  1TRU A;  17GS A;  2VOC A;  5GZZ B;  1ERT A;  2H19 A;  3LOR A;  1JLV A;  1WJK A;  1XZO A;  2FWE A;  3U5R E;  1SKR B;  5F07 A;  4TN8 A;  1ZYQ B;  1Q4J A;  3C7M A;  1GWC A;  5DCG A;  1MTC A;  1X5E A;  5ECM B;  2FCH A;  3IXR A;  5G30 A;  1GSY A;  1N8J A;  5G1K A;  1EOG A;  3WGE A;  1OC9 A;  2D2Z A;  2IME A;  1SJI A;  2XBI A;  3UJ1 A;  3VI7 A;  1RW1 A;  1XOA A;  2TIR A;  4WBJ A;  2GT5 A;  1TOF A;  1T1V A;  1SD9 A;  4MF6 A;  2AV4 A;  2K8S A;  5EY6 A;  1OAZ A;  5J4U A;  4MH3 A;  3PGT A;  1ACV A;  5LNK e;  1EV9 A;  3I43 A;  4HUA A;  1S3A A;  2YV7 A;  4F03 A;  1QGV A;  4WKW A;  2P5Q A;  3LQ7 A;  4RI6 A;  4ECJ A;  5A4U A;  3IK7 A;  3MSZ A;  3CRT A;  2IMF A;  2X99 A;  4ZBB A;  2FWF A;  3DXB A;  5JCU A;  1V98 A;  1AXD A;  4IKH A;  2GTU A;  4AJ6 A;  20GS A;  3M8N A;  1PKW A;  4KDU A;  2GST A;  1FAA A;  3HXS A;  2H71 A;  2YAN A;  1GTU A;  2DJ1 A;  4JU5 A;  1M2B A;  4ID0 A;  3EUR A;  5GAN D;  1BX9 A;  2AB6 A;  2H8L A;  3L78 A;  6GSS A;  2MZC A;  2HE3 A;  4K8M A;  5AN1 A;  3CTG A;  2CVK A;  2GZZ A;  2HZF A;  4FIW A;  1O85 A;  3C73 A;  4D73 A;  4LA1 A;  1PX6 A;  1FB0 A;  2IMD A;  5HR1 A;  5IMC A;  1U6T A;  2XHF A;  2B5X A;  1QQ2 A;  2LKU A;  2EIR A;  2OA7 A;  1JZW A;  1JZR A;  3KMN A;  4PX1 A;  1QXH A;  4GQF A;  2IMK A;  2BJX A;  5IOW A;  2LS5 A;  3QD9 A;  1JHB A;  3KH7 A;  3DML A;  3VWU A;  2CAQ A;  2G2Q A;  5ECR B;  4WF5 A;  3P2A A;  3UOM A;  3GUS A;  4TR4 A;  1ZOF A;  2C3Q A;  1GTI A;  3CRU A;  4G19 A;  2R6K A;  1RQM A;  5J9B A;  5DAK A;  4Q5Q A;  1H75 A;  2JAC A;  1YF1 A;  4O92 A;  3DVX A;  5FT3 A;  5JWQ B;  4IGJ A;  5ID2 B;  2J9H A;  4TR1 A;  2V32 A;  3BCI A;  6GSV A;  3KMO A;  1SJZ A;  5D73 A;  1H4O A;  11GS A;  1HQO A;  6GST A;  2LST A;  2CT6 A;  2H6Z A;  3O6T A;  4LMW A;  3FYG A;  2H0G A;  2PER A;  3EIN A;  3DYR A;  1TJD A;  4NWY A;  14GS A;  5F06 A;  4N0Z A;  2B3S A;  5AIV A;  2R3X A;  4KDY A;  3ME7 A;  4KSM A;  1ZMA A;  5GAP D;  2HYX A;  4I97 A;  4OO4 A;  3TKQ A;  3QCP A;  1EZK A;  2VD0 A;  1EGR A;  3UAP A;  2PVQ A;  1NW2 A;  3WT1 A;  2YZH A;  4XCS A;  1FVK A;  1SU9 A;  1A2L A;  1TDI A;  5J41 A;  3AY8 A;  7GSS A;  4YQU A;  2HZE B;  3UMA A;  4KCE A;  2LNT A;  3SWL A;  4WET A;  5CRG A;  4WF4 A;  4HEA 2;  2FUG 2;  1AIU A;  2LJR A;  4IP1 A;  4PNF A;  4BVX A;  2OE3 A;  1X5C A;  3VWV A;  3GL3 A;  5DVB A;  3TJK A;  1BG5 A;  2V6O A;  1PN9 A;  2KOK A;  13GS A;  2R5G A;  3VWW A;  5LD0 A;  2NVL A;  3HKR A;  4JED A;  1HNB A;  5B6N A;  2IFQ A;  2P31 A;  1TI3 A;  2LV3 A;  4NV2 A;  1K0D A;  1M9B A;  2H1G A;  3KXO A;  1MD4 A;  4OCE A;  3M9J A;  3GKK A;  3UL3 A;  3A2V A;  1XWB A;  3HVV A;  3ZVJ D;  4KSO A;  2H6X A;  3KZQ A;  5C00 A;  3EC3 A;  3A2W A;  5IPH A;  3EMX A;  2VCZ A;  1SK0 A;  4FYU A;  2X64 A;  1SYR A;  4I5Q A;  2GSR A;  2B6M A;  2L5O A;  3ZFB A;  1W4V A;  3GA4 A;  3FRC A;  2VCQ A;  2HRF A;  2J23 A;  3K8N A;  5DJM A;  3FZ5 A;  2C0D A;  5HR0 A;  3QAG A;  1PL1 A;  5IMD A;  5ECL B;  4TR1 B;  3EU4 A;  2YNX A;  1K0M A;  3QAW A;  2L5L A;  2FNO A;  4MLY A;  2LQO A;  1YQ1 A;  1X9W B;  2YCD A;  5CYY A;  1K0O A;  4NXI A;  1GSU A;  2O89 A;  3Q6O A;  4F0C A;  5IO0 A;  2AJQ B;  5DDL A;  1PA3 A;  1U88 A;  2O87 A;  4GRF A;  3IC4 A;  2GZP A;  4K7O A;  3A2X A;  3P7X A;  3L9S A;  3W8S A;  1HYU A;  2LUS A;  2E2G A;  1AC1 A;  2C3N A;  2HRN A;  2ZUP A;  3BD2 A;  2CAI A;  2R37 A;  5G31 A;  2FY6 A;  4MPF A;  3C1R A;  12GS A;  3FEU A;  5HR2 A;  2NBS A;  3F3Q A;  5IOX A;  2WDU A;  2M80 A;  4ZIJ A;  4PQI A;  1K0N A;  1BJX A;  3GV1 A;  2GVP A;  2OBK A;  3VPQ A;  2JU5 A;  3F0I A;  3G7J A;  3M0F A;  3F4T A;  3TDG A;  2XPE A;  4ZIL A;  1E2Y A;  2ON7 A;  4MJC A;  4PQH A;  3E0U A;  4CW9 A;  2A2S A;  2BMX A;  4GCI A;  3HJM A;  1K3Y A;  2EIO A;  1I9D A;  3I6A A;  5DJL A;  3NOF A;  10GS A;  3DVW A;  1GNE A;  5D8I A;  3GKN A;  2K9F A;  1BYE A;  1Q98 A;  2YZU A;  3F6F A;  5JCW A;  1WOU A;  1EOH A;  1OC3 A;  3WD6 A;  1DUG A;  4XRA A;  2PGT A;  2FWG A;  2ZCT A;  3ZIJ A;  4WR5 A;  1SD8 A;  2VIM A;  2GSS A;  1BQ7 A;  5FHI A;  5ABR A;  4RQX A;  4PXO A;  3ERW A;  1VF1 A;  2H75 A;  4FYB A;  4WR4 A;  3L0H A;  1A0R P;  3DGQ A;  1UA5 A;  1UN2 A;  5CRH A;  5EVO A;  2H72 A;  3F3R A;  2C3T A;  2H76 A;  4X43 A;  1QFN A;  2ZNM A;  1TRV A;  2RUF A;  3GKM A;  1JLW A;  3HVX A;  3LFL A;  2QC7 A;  5B6M A;  2GZY A;  5IPG A;  3GH6 A;  2VO4 A;  2L6C A;  5HR3 A;  1F9M A;  2HFD A;  3F9U A;  4L5L A;  4MDC A;  3US3 A;  5ECH B;  1TRS A;  3O76 A;  3JCM L;  4O7H A;  1X9S B;  1E6B A;  2A4V A;  2IN3 A;  5GSS A;  2VM2 A;  5ENU A;  1X0R A;  4XS4 B;  1JFU A;  1A8L A;  3LXT A;  1O8X A;  4KDX A;  4POK A;  1GSQ A;  1T4Y A;  4OFT A;  2WJU A;  3O3T A;  4XS6 A;  1SKS B;  1T3B A;  5AIS A;  1K3O A;  4IHU A;  3ED3 A;  4O32 A;  5CNW A;  1EWX A;  4PGT A;  1VGL A;  4XIH A;  4JBB A;  5IMF A;  1O73 A;  2FHE A;  3RPN A;  1SL0 B;  5ID2 A;  4ECC A;  4G10 A;  1N2A A;  5INY A;  2HNL A;  3TB2 A;  4KCA A;  4DSQ A;  1KEB A;  3WGX A;  1QMV A;  5ECP B;  3FR6 A;  4NAX A;  1K0C A;  3ZMK A;  3ZL5 A;  1PMT A;  4NHW A;  3QMX A;  2DBC A;  2MMN A;  3D5J A;  4LMV A;  5ECQ B;  2KHP A;  4I2U A;  3L4N A;  4BPY A;  1BED A;  2F3M A;  1XWA A;  4V2N A;  3ZRE A;  4MZC A;  1OVN A;  2VLU A;  4L0U A;  2K8V A;  3C8E A;  3GX8 A;  3RDW A;  2OJL A;  4JZQ A;  2NPB A;  4G2E A;  4GWR A;  4IVF A;  5A4W A;  4HU9 A;  6GSW A;  2QSI A;  3DWV A;  4TRX A;  1XPV A;  4OMV A;  3HYP A;  2JAD A;  3EYT A;  2HZE A;  4HS1 A;  4K6X A;  3RHB A;  4LL1 B;  3IAM 2;  3G7Y A;  1WWJ A;  2LRN A;  5CP1 A;  3IK9 A;  5ELG A;  4ECB A;  3UVT A;  3RAZ A;  1S3D A;  2HT9 A;  4FO5 A;  4GXZ A;  2CVD A;  5ECN B;  4ECI A;  1VF3 A;  5IIZ A;  1BAY A;  4Z7X A;  1YJ6 A;  2GQL A;  1T7P B;  1M2D A;  1HD2 A;  4ZL9 A;  3Q19 A;  2E0Q A;  3TJF A;  2ALB A;  1TTZ A;  3RHC A;  1X9M B;  1OKD A;  2DLX A;  1A24 A;  3GL5 A;  2XPD A;  4XRD A;  4I2T A;  4JR6 A;  1OYJ A;  3D6I A;  4RQR A;  3FZ9 A;  1G7O A;  3G7I A;  1NHO A;  3M1G A;  3IDV A;  2RLI A;  3GNJ A;  2GLR A;  4HZ2 A;  5AIX A;  2CX4 A;  3FR9 A;  2LNS A;  3TRX A;  1JZD A;  2AHE A;  3H4K A;  4IQA A;  3ME8 A;  4MA9 A;  1XWG A;  3Q18 A;  4QL7 A;  5KN1 A;  4DSS B;  5EL8 A;  3CYN A;  4TOP A;  2VAF A;  3GTU B;  4MPG A;  3NZN A;  2ON5 A;  3F8U A;  3M3M A;  3IAS 2;  8GSS A;  3TJG A;  4TR0 A;  3TKS A;  4XHM A;  2V2G A;  5KEJ A;  3J7Y b;  4EVM A;  2IL3 A;  4PUA A;  4K9Z A;  1TI1 A;  2JZS A;  4O5R A;  1J08 A;  3EU3 A;  1T8E B;  1G7E A;  2H01 A;  2XC2 A;  1XXU A;  1R7H A;  3D0Z A;  2C80 A;  2B5E A;  2C0E A;  3VWX A;  4OO5 A;  5ELA A;  4IP6 A;  1CQH A;  3D21 A;  1O6J A;  1GUM A;  1M2A A;  4MF5 A;  2LTK A;  5HFI A;  1FW1 A;  4ISD A;  2WRT A;  2ES7 A;  3FKF A;  4OD7 A;  2RUE A;  1M0U A;  4HZ4 A;  1XIY A;  4EUY A;  1URM A;  1PGT A;  2V6K A;  3ZML A;  3VK9 A;  4Q5R A;  1RK4 A;  4F2I A;  2L4Q A;  1OE7 A;  3F4S A;  3TKP A;  4K7N A;  1LBK A;  2A2R A;  3UBL A;  4JRR A;  2MBT A;  3L9V A;  4TW5 A;  2VL9 A;  4V2L A;  1MD3 A;  2H1D A;  3J7Y k;  1TK8 B;  2H0I A;  5J3R A;  4IEL A;  3EE2 A;  5IMZ A;  4K0G A;  2N5A A;  4BL7 A;  4H86 A;  3IHQ A;  2VL3 A;  1XW5 A;  1VF2 A;  2O7K A;  2XBQ A;  4JE1 A;  3HHV A;  3ERF A;  2H1A A;  2MYG A;  1WIK A;  2L59 A;  1F37 A;  3TJB A;  5LCZ A;  2DIZ A;  2DML A;  3ZFL A;  4POL A;  3SBC A;  4MJB A;  2I1U A;  3VI5 A;  2P0G A;  4RI7 A;  3FK8 A;  5H5R A;  4XTS A;  3M9K A;  4G9H A;  1R5A A;  5H5Q A;  4MMM A;  1O7U A;  5H5S A;  2QGV A;  1GTA A;  4I8B A;  2LJA A;  1NHY A;  2C0F A;  3N5O A;  3UVH A;  4EO3 A;  2RM6 A;  4HQS A;  2YWO A;  1K0B A;  2EC4 A;  2I3Y A;  1GSS A;  5KN3 A;  1EGO A;  2OAD A;  4ML6 A;  5D9T A;  4P3Y B;  2I4A A;  4IS0 A;  5F8B A;  4GLT A;  2NTO A;  3TKS E;  3VFI A;  4N0V A;  1TU7 A;  1YDK A;  4BA7 A;  1O81 A;  1X5D A;  2LQQ A;  3LYK A;  5DCH A;  4EL1 A;  1B48 A;  2AUV A;  4AJ8 A;  1ERW A;  2FA4 A;  1FHE A;  4KH7 A;  1UVZ A;  2K6V A;  4XS4 A;  3ERG A;  1AUC A;  5D9V A;  1MDI A;  4CHS A;  1PL2 A;  4V1A g;  5CO3 A;  4MJE A;  3QAV A;  1Y25 A;  1G6Y A;  2FWH A;  4OWY A;  4WXT A;  18GS A;  1M9A A;  3ZIT A;  2H70 A;  3MAK A;  3KP9 A;  1XWK A;  2WB9 A;  5J9C A;  4BWQ A;  3UAR A;  5G5E A;  3H93 A;  4IBP A;  1A2J A;  3NIV A;  1YEX A;  4TKY A;  4QL9 A;  2MBS A;  1VRS D;  4N11 A;  3ZLP A;  1PD2 1;  1Z7P A;  3BCK A;  2H74 A;  4PUR A;  3LSZ A;  1SYX A;  1V40 A;  1I5G A;  3GH9 A;  3BBY A;  3TRP A;  1XFL A;  5IO2 A;  3KH9 A;  4MP4 A;  2VCW A;  1XVQ A;  4X0X A;  1SJ6 A;  2X8G A;  4EKZ A;  3PR8 A;  1YF0 A;  5G2Z A;  4YQV A;  1TRW A;  4KUN A;  1YZX A;  4GTU A;  5E59 A;  4OFN A;  3KTB A;  4AGS A;  2H6Y A;  3IRA A;  4TXO B;  4YAV A;  1PSQ A;  3WYW A;  2N5B A;  4F9Z A;  2VLV A;  2MMA A;  4OCF A;  1MDJ A;  2KLX A;  4GST A;  2B1L A;  4RUV A;  1IYH A;  2I9H A;  2GQK A;  4HJM A;  4QQ7 A;  1Z3E A;  2OAC A;  2YWN A;  1DE2 A;  5ECS A;  1ZGN A;  1F2E A;  4CDO A;  3KIJ A;  1B9Y C;  1NM3 A;  1XW6 A;  1GLQ A;  1O8W A;  3ISO A;  1PQN A;  1GP1 A;  4FYC A;  2YV9 A;  1Z9H A;  2B7K A;  2YOI A;  4ILF A;  3BOA A;  1U87 A;  1A23 A;  6GSU A;  1KTE A;  1ST9 A;  1MDK A;  3APQ A;  5ECK B;  2RII A;  5CRE A;  1V2A A;  5GST A;  4YQM A;  2JZR A;  4IJI A;  2OE1 A;  2YN1 A;  4GSN A;  3KP8 A;  3HD5 A;  4BVY A;  3C71 A;  4OFM A;  2K18 A;  3CSI A;  3KGK A;  2OE0 A;  5IM9 A;  2HSH A;  3GIX A;  1TW9 A;  3LGC A;  4KE3 A;  1V9W A;  2DJ0 A;  5JCG A;  4ZB9 A;  3H8Q A;  4LLR A;  2KP1 A;  3IOS A;  5A4V A;  5COH A;  3IBH A;  1AQW A;  1U3A A;  2G0F A;  3ZZX A;  2V41 A;  3W6G A;  1YEP A;  2PPT A;  3I9V 2;  4K7I A;  4IW9 A;  5HFG A;  4DSS A;  3GSS A;  3FY7 A;  1GUL A;  4EC0 A;  3TJJ A;  3UEM A;  5IQY A;  1EV4 A;  3U6V A;  4HQZ A;  3GTU A;  3DEX A;  1WMJ A;  3V1W A;  2C1Y A;  2F51 A;  2H73 A;  3F4R A;  1B4Q A;  2GS3 A;  3A3T A;  4ZL8 A;  1SK1 A;  3D4T A;  2VCV A;  3FR3 A;  4Q5N A;  4ULX A;  1YY7 A;  1LU4 A;  1KNG A;  3GST A;  5CAX A;  4DVC A;  2GSQ A;  3F63 A;  5D9X A;  5HQP A;  1GRX A;  1PX7 A;  1YKC A;  3HJP A;  4J2F A;  5EPF A;  4HOJ A;  2IPA A;  2LRT A;  5ECI B;  1GTB A;  1TK0 B;  1IYI A;  5B7C A;  3LEF A;  3MWH A;  3EMP A;  4YH2 A;  4YAP A;  5IMV A;  2FA8 A;  3DIE A;  5CRD A;  5B8B A;  1TU8 A;  2DSA A;  2JSY A;  1V57 A;  5F0G A;  2HXK A;  3CSH A;  2VUP A;  1Z5Y E;  1EP7 A;  2IJY A;  1THO A;  4F82 A;  2YJ7 A;  3DKS A;  1A0F A;  3HVS A;  2R2J A;  2L6D A;  2YWM A;  3GHA A;  1ABA A;  1Z6N A;  4KB3 A;  4ZXG A;  1FG4 A;  1DBY A;  3MNG A;  3QOU A;  22GS A;  1ILO A;  4PNG A;  4EF0 A;  2WS2 A;  3LJR A;  3FZA A;  2EIQ A;  3MDK A;  4POB A;  3EWL A;  2VCT A;  2FLS A;  4MZB A;  4ZBA A;  2E2M A;  1Y6E A;  1FVJ A;  1USB A;  2PMT A;  5DAL B;  2JZT A;  1TK5 B;  3QFA C;  4L8E A;  4J56 E;  3LXZ A;  1A8Y A;  3UIW A;  1ML6 A;  2IIY A;  3GKX A;  4WEY A;  3KTL A;  2KP2 A;  3KM6 A;  4WBR D;  1G0T A;  3QR6 A;  3UBK A;  1PKZ A;  4MJA A;  2AAW A;  2F9S A;  1SL2 B;  2REM A;  1OE8 A;  3F6D A;  3LWA A;  1KBN A;  2C0G A;  3DRN A;  2BTO T;  4K1F A;  5B8A A;  2IWT A;  2VM1 A;  4GQC A;  1XVW A;  2H30 A;  1MEK A;  2HLS A;  2H66 A;  1AQX A;  5DQY A;  4L0W A;  3VUR A;  1AW9 A;  4MCU A;  3D4M A;  2DJK A;  2CQ9 A;  1XWC A;  1S3C A;  2YWI A;  2WFC A;  1ERU A;  1WP0 A;  3TOT A;  1OC9 B;  1FB6 A;  4E8H A;  3IE3 A;  4GSS A;  3RBT A;  4KND A;  3S9F A;  2M72 A;  3APS A;  3I69 A;  2L57 A;  2H1B A;  4EDZ A;  3ZYW A;  4Q5F A;  3GUR A;  1XCC A;  1GSF A;  2B5Y A;  4K0N A;  2TRX A;  2H0H A;  1WE0 A;  4POM A;  1VF4 A;  5D93 A;  3DD3 A;  1QUW A;  1FO5 A;  6GSX A;  3VPT A;  2DMM A;  1T00 A;  2VL2 A;  1JZO A;  3APO A;  3IA1 A;  2OBI A;  4KX4 A;  4HJ2 A;  4DEJ A;  1FOV A;  1R4W A;  2R4V A;  1M7T A;  4MAB A;  3TKS C;  3QDN A;  2HI7 A;  1F3B A;  2YP6 A;  3PIN A;  3PH9 A;  1SK2 A;  2FGX A;  4F0B A;  1GUK A;  4TVE A;  4N10 A;  4MZW A;  4E8E A;  19GS A;  1WRY A;  2V1M A;  1GLP A;  3GYK A;  1A2M A;  3E9J B;  1GL8 A;  5KN0 A;  2Z9S A;  4TXO A;  1B8X A;  2VL2 C;  4MK3 A;  2C8U A;  1WPI A;  1HNA A;  3ZTL A;  4D73 B;  4LL4 B;  3VLN A;  2MMZ A;  1AQV A;  4NV5 A;  1UC7 A;  2CZ2 A;  2YPM A;  4DSR A;  1GH2 A;  4NHZ A;  9GSS A;  3GFK A;  2CV4 A;  3WGD A;  1V58 A;  2JL4 A;  4EE0 A;  2GDR A;  2CA8 A;  1TP9 A;  1M99 A;  2VCX A;  5J5N A;  1XBS A;  1W89 A;  4HDE A;  1K3L A;  2VLT A;  1ZYE A;  1PRX A;  2DJ2 A;  2IMI A;  3E3E A;  3H79 A;  3N9J A;  4V2M A;  3CXG A;  3H1N A;  6GSY A;  2DJJ A;  2PUK C;  4BWS A;  2GGT A;  3KCM A;  2B7J A;  1CQG A;  1T4Z A;  2GT6 A;  1XOB A;  4IN0 A;  3P90 A;  3C1S A;  2PN8 A;  2RM5 A;  5DAK B;  4L5O A;  3G9B A;  1TKD B;  3A5W A;  2CX3 A;  16GS A;  3OR5 A;  2O8V B;  1J0F A;  4K2D A;  1YKA A;  2KUC A;  3FW2 A;  4MH2 A;  1ON4 A;  4TXV A;  1TXX A;  3TRQ A;  4MF7 A;  3ZVJ A;  3CSJ A;  1HNC A;  3HDC A; 
#chains in the Genus database with same CATH topology
 3TGZ A;  4ZL7 A;  1NSW A;  2OKA A;  1SL1 B;  2TRC P;  4I6X A;  1ZCP A;  4N30 A;  2YJH A;  3LYP A;  2WGR A;  3IC8 A;  2NDO A;  5G5F A;  3HA9 A;  3FZ4 A;  3D22 A;  3GRX A;  3WT2 A;  2WCI A;  1EP8 A;  3GN3 A;  1ZL9 A;  4XS1 A;  2DC5 A;  1G6W A;  2MMO A;  5KN2 A;  3CTF A;  3CBU A;  1F6M C;  3TUE A;  3HZ4 A;  3LG6 A;  3W8J A;  5IMA A;  1QK8 A;  3P8W A;  3IR4 A;  1LJR A;  4EXJ A;  2PWJ A;  4HU7 A;  2F8F A;  1EEM A;  2AYT A;  2GQM A;  2PBJ A;  2CVB A;  4V1A p;  3QPM A;  1DSB A;  5C04 A;  5HFK A;  3HZ8 A;  4KW6 A;  1THX A;  2QKE A;  4HI7 A;  3IPZ A;  4PUF C;  3GX0 A;  4ZB8 A;  5F05 A;  3TCO A;  1R26 A;  2L4C A;  1GUH A;  2FD3 A;  1SKW B;  1R5P A;  2E7P A;  3R2Q A;  3EVI A;  5AGY A;  4IQ1 A;  3IV4 A;  1B9X C;  4JR4 A;  4ACS A;  2C4J A;  2IFQ B;  3RPP A;  1OC8 A;  5CRW A;  4ZB6 A;  1C72 A;  2I81 A;  4J57 E;  1AAZ A;  3KEB A;  4FH8 A;  2N5F A;  1GSE A;  4KA0 A;  5JWR B;  3ZRD A;  3TKR A;  3QFB C;  2PU9 C;  2X8C A;  4TR3 A;  2LEG A;  3Q74 A;  1ZZY A;  1F3A A;  5G1L A;  3KD0 A;  4KGI A;  2WZ9 A;  3HJO A;  2X8H A;  2M46 A;  1ERV A;  2F8A A;  5DQS A;  1EEJ A;  1J9B A;  3HY2 A;  5D96 A;  4AJ7 A;  4ZBD A;  3GMF A;  4ML1 A;  2B1K A;  2DIY A;  3ZIV A;  1B4P A;  4AF2 A;  2WUL A;  2LRC A;  2HSY A;  2VD1 A;  5E4W A;  1SEN A;  1XW9 A;  1Z6M A;  1DE1 A;  4EDY A;  1Z7R A;  1GSD A;  2R0G A;  2CZ3 A;  2LJK A;  3HCZ A;  3L9U A;  4NMU A;  5FWG A;  4GF0 A;  4X1U A;  5L71 A;  1K0A A;  5DAL A;  4PQ1 A;  1U3I A;  3KJY A;  4KAE A;  4YKF A;  2JSZ A;  2P5R A;  2DJ3 A;  3FHK A;  5DBQ A;  3TOU A;  5JWO B;  2O85 A;  5A5K A;  4USS A;  2PVO C;  5D9W A;  3BJ5 A;  1GNW A;  1OKT A;  4IJ3 A;  3CMI A;  5ECO B;  4NPB A;  1TRU A;  17GS A;  2VOC A;  5GZZ B;  1ERT A;  2H19 A;  3LOR A;  1JLV A;  1WJK A;  1XZO A;  2FWE A;  3U5R E;  1SKR B;  5F07 A;  4TN8 A;  1ZYQ B;  1Q4J A;  3C7M A;  1GWC A;  5DCG A;  1MTC A;  1X5E A;  5ECM B;  2X4A A;  2FCH A;  3IXR A;  5G30 A;  1GSY A;  1N8J A;  5G1K A;  1EOG A;  2HRK A;  3WGE A;  1OC9 A;  2D2Z A;  2IME A;  1SJI A;  2XBI A;  3UJ1 A;  3VI7 A;  1RW1 A;  1XOA A;  2TIR A;  4WBJ A;  2GT5 A;  1TOF A;  1T1V A;  1SD9 A;  4MF6 A;  2AV4 A;  2K8S A;  5EY6 A;  1OAZ A;  5J4U A;  4MH3 A;  3PGT A;  1ACV A;  5LNK e;  1EV9 A;  3I43 A;  4HUA A;  1S3A A;  2YV7 A;  4F03 A;  1QGV A;  4WKW A;  2P5Q A;  3LQ7 A;  4RI6 A;  4ECJ A;  5A4U A;  3IK7 A;  3MSZ A;  3CRT A;  2IMF A;  2X99 A;  4ZBB A;  2FWF A;  3DXB A;  5JCU A;  2QA1 A;  1V98 A;  1AXD A;  3CQF A;  2GTU A;  4IKH A;  4AJ6 A;  3IHG A;  20GS A;  3M8N A;  1PKW A;  4KDU A;  2GST A;  1FAA A;  3HXS A;  2H71 A;  2YAN A;  1GTU A;  2DJ1 A;  4JU5 A;  1M2B A;  4ID0 A;  3EUR A;  5GAN D;  1BX9 A;  2AB6 A;  2H8L A;  3L78 A;  6GSS A;  2MZC A;  2HE3 A;  4K8M A;  5AN1 A;  3CTG A;  2CVK A;  2GZZ A;  2HZF A;  4FIW A;  1O85 A;  3C73 A;  4D73 A;  4LA1 A;  1PX6 A;  1FB0 A;  3PPU A;  2IMD A;  5HR1 A;  5IMC A;  1U6T A;  5KOX A;  2XHF A;  2B5X A;  1QQ2 A;  2LKU A;  2EIR A;  2OA7 A;  1JZW A;  1JZR A;  3KMN A;  4PX1 A;  1QXH A;  4GQF A;  2IMK A;  2BJX A;  5IOW A;  2LS5 A;  3QD9 A;  1JHB A;  3KH7 A;  3DML A;  3VWU A;  2CAQ A;  2G2Q A;  5ECR B;  4WF5 A;  3P2A A;  3UOM A;  3GUS A;  4TR4 A;  1ZOF A;  2C3Q A;  1GTI A;  3CRU A;  4G19 A;  2R6K A;  1RQM A;  5J9B A;  5DAK A;  4Q5Q A;  2R0C A;  1H75 A;  2JAC A;  1YF1 A;  4O92 A;  3DVX A;  5FT3 A;  5JWQ B;  4IGJ A;  5ID2 B;  2J9H A;  4TR1 A;  2V32 A;  3BCI A;  6GSV A;  3KMO A;  1SJZ A;  5D73 A;  1H4O A;  11GS A;  1HQO A;  6GST A;  2LST A;  2CT6 A;  2H6Z A;  3O6T A;  4LMW A;  3FYG A;  3LW9 A;  2H0G A;  2PER A;  3EIN A;  3DYR A;  1TJD A;  4NWY A;  14GS A;  5F06 A;  4N0Z A;  2B3S A;  5AIV A;  2R3X A;  2HRA A;  4KDY A;  3ME7 A;  4KSM A;  1ZMA A;  5GAP D;  2HYX A;  4I97 A;  4OO4 A;  3TKQ A;  3QCP A;  1EZK A;  2VD0 A;  1EGR A;  3UAP A;  2PVQ A;  1NW2 A;  4A5P A;  3WT1 A;  2YZH A;  4XCS A;  1FVK A;  1SU9 A;  1A2L A;  1TDI A;  5J41 A;  3AY8 A;  7GSS A;  4YQU A;  2HZE B;  3UMA A;  4KCE A;  2LNT A;  3SWL A;  4WET A;  5CRG A;  4WF4 A;  4HEA 2;  2FUG 2;  1AIU A;  2LJR A;  4IP1 A;  4PNF A;  4BVX A;  4G0K A;  2OE3 A;  1X5C A;  3VWV A;  3GL3 A;  5DVB A;  3TJK A;  1BG5 A;  2V6O A;  1PN9 A;  2KOK A;  13GS A;  2R5G A;  3VWW A;  5LD0 A;  2NVL A;  3HKR A;  4JED A;  1HNB A;  5B6N A;  2IFQ A;  2P31 A;  1TI3 A;  2LV3 A;  4NV2 A;  1K0D A;  1M9B A;  2H1G A;  3KXO A;  1MD4 A;  4OCE A;  3M9J A;  3GKK A;  3UL3 A;  3A2V A;  1XWB A;  3HVV A;  3ZVJ D;  2HSM A;  4KSO A;  2H6X A;  3KZQ A;  5C00 A;  3EC3 A;  3A2W A;  5IPH A;  3EMX A;  2VCZ A;  1SK0 A;  4FYU A;  2X64 A;  1SYR A;  4K5R A;  4I5Q A;  2GSR A;  2B6M A;  2L5O A;  3ZFB A;  1W4V A;  3GA4 A;  3FRC A;  2VCQ A;  2HRF A;  2J23 A;  3K8N A;  5DJM A;  3FZ5 A;  2C0D A;  5HR0 A;  3QAG A;  1PL1 A;  5IMD A;  5ECL B;  4TR1 B;  3EU4 A;  2YNX A;  1K0M A;  3QAW A;  2L5L A;  2FNO A;  4MLY A;  2LQO A;  1YQ1 A;  1X9W B;  2YCD A;  5CYY A;  1K0O A;  4NXI A;  1GSU A;  2O89 A;  3Q6O A;  4F0C A;  5IO0 A;  2AJQ B;  5DDL A;  1PA3 A;  1U88 A;  2O87 A;  4GRF A;  3IC4 A;  2GZP A;  4K7O A;  3A2X A;  3P7X A;  3L9S A;  3W8S A;  1HYU A;  2LUS A;  2E2G A;  1AC1 A;  1PN0 A;  2C3N A;  2HRN A;  2ZUP A;  3BD2 A;  2CAI A;  2R37 A;  5G31 A;  2FY6 A;  4MPF A;  3C1R A;  12GS A;  3FEU A;  5HR2 A;  1ZYP A;  2NBS A;  3F3Q A;  1M3J A;  5IOX A;  2WDU A;  2M80 A;  4ZIJ A;  4PQI A;  1K0N A;  1BJX A;  3GV1 A;  2GVP A;  2OBK A;  3VPQ A;  2JU5 A;  3F0I A;  3G7J A;  3M0F A;  3F4T A;  3TDG A;  2XPE A;  4ZIL A;  1E2Y A;  4BVX B;  2ON7 A;  4MJC A;  4PQH A;  3E0U A;  4CW9 A;  2A2S A;  2BMX A;  4GCI A;  3HJM A;  2A2P A;  1K3Y A;  2EIO A;  1I9D A;  3I6A A;  5DJL A;  3NOF A;  10GS A;  3DVW A;  1GNE A;  5D8I A;  3GKN A;  2K9F A;  1BYE A;  1Q98 A;  2YZU A;  3F6F A;  5JCW A;  1WOU A;  4O5Q A;  1EOH A;  1OC3 A;  3WD6 A;  1DUG A;  4XRA A;  2PGT A;  1FOH A;  2FWG A;  2ZCT A;  3ZIJ A;  4WR5 A;  1SD8 A;  2VIM A;  2GSS A;  1BQ7 A;  5FHI A;  5ABR A;  4RQX A;  4PXO A;  3ERW A;  1VF1 A;  2H75 A;  4FYB A;  4WR4 A;  3L0H A;  1A0R P;  3DGQ A;  4K5S A;  1UA5 A;  1UN2 A;  5BMU A;  5CRH A;  5EVO A;  2H72 A;  3F3R A;  2C3T A;  2H76 A;  4X43 A;  1QFN A;  2ZNM A;  1TRV A;  2RUF A;  3GKM A;  4PTS A;  1JLW A;  3HVX A;  3LFL A;  1S3R A;  2QC7 A;  4X4J A;  5B6M A;  2GZY A;  4HSC X;  5IPG A;  3GH6 A;  2VO4 A;  2L6C A;  5HR3 A;  1F9M A;  2HFD A;  3F9U A;  4L5L A;  4MDC A;  3US3 A;  5ECH B;  1TRS A;  3O76 A;  3JCM L;  4O7H A;  1X9S B;  1E6B A;  2A4V A;  2IN3 A;  5GSS A;  2VM2 A;  5ENU A;  4BIK A;  1X0R A;  4XS4 B;  1JFU A;  4ICY A;  1A8L A;  2DKH A;  3LXT A;  1O8X A;  4KDX A;  4POK A;  1GSQ A;  1T4Y A;  4OFT A;  2WJU A;  3O3T A;  4XS6 A;  1SKS B;  1T3B A;  5AIS A;  1K3O A;  4IHU A;  3ED3 A;  4O32 A;  5CNW A;  3EPT A;  1EWX A;  4PGT A;  1VGL A;  4XIH A;  4JBB A;  5IMF A;  1O73 A;  2FHE A;  3RPN A;  1SL0 B;  5ID2 A;  4ECC A;  4G10 A;  1N2A A;  5INY A;  2HNL A;  3TB2 A;  4KCA A;  4DSQ A;  1KEB A;  3WGX A;  1QMV A;  5ECP B;  3FR6 A;  4NAX A;  1K0C A;  3ZMK A;  3ZL5 A;  1PMT A;  4NHW A;  3QMX A;  2DBC A;  2MMN A;  3D5J A;  4LMV A;  5ECQ B;  2KHP A;  4I2U A;  3L4N A;  4BPY A;  1BED A;  2F3M A;  1XWA A;  4V2N A;  3ZRE A;  4MZC A;  1OVN A;  2VLU A;  4L0U A;  2K8V A;  3C8E A;  3GX8 A;  3RDW A;  2OJL A;  4JZQ A;  2NPB A;  4G2E A;  4GWR A;  4IVF A;  2UZ8 A;  5A4W A;  4HU9 A;  6GSW A;  2QSI A;  3DWV A;  4TRX A;  1XPV A;  4OMV A;  3HYP A;  2JAD A;  3EYT A;  2HZE A;  4HS1 A;  4K6X A;  3RHB A;  4LL1 B;  3IAM 2;  3G7Y A;  1WWJ A;  2LRN A;  5CP1 A;  3IK9 A;  5ELG A;  4ECB A;  3UVT A;  3RAZ A;  1S3D A;  2HT9 A;  4FO5 A;  4GXZ A;  2CVD A;  5ECN B;  4ECI A;  1VF3 A;  5IIZ A;  1BAY A;  4Z7X A;  1YJ6 A;  2GQL A;  1T7P B;  1M2D A;  1HD2 A;  4ZL9 A;  3Q19 A;  2E0Q A;  4Z2U A;  3TJF A;  2ALB A;  1TTZ A;  3RHC A;  1X9M B;  1OKD A;  2DLX A;  1A24 A;  3GL5 A;  4BVY B;  2XPD A;  4XRD A;  4I2T A;  4JR6 A;  1OYJ A;  3D6I A;  4RQR A;  3FZ9 A;  1G7O A;  3G7I A;  4CY8 A;  1NHO A;  3M1G A;  3IDV A;  2RLI A;  3GNJ A;  2GLR A;  4HZ2 A;  5AIX A;  2CX4 A;  3FR9 A;  2LNS A;  3TRX A;  1JZD A;  2AHE A;  3H4K A;  4IQA A;  3ME8 A;  4MA9 A;  1XWG A;  3Q18 A;  4QL7 A;  3MYD A;  5KN1 A;  4DSS B;  5EL8 A;  3CYN A;  4TOP A;  2VAF A;  4Z2T A;  3GTU B;  4MPG A;  3NZN A;  2ON5 A;  3F8U A;  3M3M A;  3IAS 2;  8GSS A;  3TJG A;  4TR0 A;  2X49 A;  3TKS A;  4XHM A;  2V2G A;  5KEJ A;  3J7Y b;  4EVM A;  2IL3 A;  4PUA A;  4K9Z A;  1TI1 A;  2JZS A;  4O5R A;  1J08 A;  3EU3 A;  1T8E B;  1G7E A;  2H01 A;  2XC2 A;  1XXU A;  1R7H A;  3D0Z A;  2C80 A;  2B5E A;  2C0E A;  3VWX A;  4OO5 A;  5ELA A;  4IP6 A;  1CQH A;  3D21 A;  1O6J A;  1GUM A;  1M2A A;  4MF5 A;  2LTK A;  5HFI A;  1FW1 A;  4ISD A;  2WRT A;  2ES7 A;  3FKF A;  4OD7 A;  2RUE A;  1M0U A;  4HZ4 A;  1XIY A;  4EUY A;  1URM A;  1PGT A;  2V6K A;  3ZML A;  3VK9 A;  4KF9 A;  4Q5R A;  1RK4 A;  4F2I A;  2L4Q A;  1OE7 A;  3F4S A;  3TKP A;  4K7N A;  1LBK A;  2A2R A;  3UBL A;  4JRR A;  2MBT A;  3L9V A;  4TW5 A;  4Z2R A;  2VL9 A;  4V2L A;  1MD3 A;  4YKG A;  2H1D A;  3J7Y k;  1TK8 B;  2H0I A;  5J3R A;  4IEL A;  3EE2 A;  5IMZ A;  4G0I A;  4K0G A;  2N5A A;  4BL7 A;  4H86 A;  3IHQ A;  2VL3 A;  1XW5 A;  1VF2 A;  2O7K A;  2XBQ A;  4JE1 A;  3HHV A;  3ERF A;  2H1A A;  2MYG A;  1WIK A;  2L59 A;  5KOW A;  1F37 A;  3TJB A;  5LCZ A;  2DIZ A;  2DML A;  3ZFL A;  4POL A;  3SBC A;  4MJB A;  2I1U A;  3VI5 A;  2P0G A;  4RI7 A;  3FK8 A;  5H5R A;  4XTS A;  3M9K A;  4G9H A;  1R5A A;  5H5Q A;  4MMM A;  1O7U A;  5H5S A;  2QGV A;  1GTA A;  4I8B A;  2LJA A;  1NHY A;  2C0F A;  3N5O A;  3UVH A;  4EO3 A;  2RM6 A;  4HQS A;  2YWO A;  1K0B A;  2EC4 A;  2I3Y A;  1GSS A;  5KN3 A;  1EGO A;  2OAD A;  4ML6 A;  5D9T A;  4P3Y B;  2I4A A;  4IS0 A;  5F8B A;  4GLT A;  2NTO A;  3TKS E;  3VFI A;  4N0V A;  1TU7 A;  1YDK A;  4BA7 A;  1O81 A;  1X5D A;  2LQQ A;  3LYK A;  5DCH A;  4EL1 A;  1B48 A;  2AUV A;  4AJ8 A;  1ERW A;  2FA4 A;  1FHE A;  4KH7 A;  1UVZ A;  2K6V A;  4XS4 A;  3ERG A;  1AUC A;  5D9V A;  1MDI A;  4CHS A;  1PL2 A;  4V1A g;  5CO3 A;  4MJE A;  3QAV A;  4FQU A;  1Y25 A;  1G6Y A;  2FWH A;  4OWY A;  4WXT A;  18GS A;  1M9A A;  3ZIT A;  2H70 A;  3MAK A;  3KP9 A;  1XWK A;  2WB9 A;  5J9C A;  4BWQ A;  3UAR A;  5G5E A;  3H93 A;  4IBP A;  1A2J A;  3NIV A;  4O5U A;  1YEX A;  4TKY A;  4QL9 A;  2MBS A;  1VRS D;  4N11 A;  1M3I A;  3ZLP A;  1PD2 1;  1Z7P A;  3BCK A;  2H74 A;  4PUR A;  3LSZ A;  1SYX A;  1V40 A;  1I5G A;  3GH9 A;  3BBY A;  3TRP A;  1XFL A;  5IO2 A;  2QA2 A;  3KH9 A;  4MP4 A;  2VCW A;  1XVQ A;  4X0X A;  1SJ6 A;  2X8G A;  4EKZ A;  3PR8 A;  1YF0 A;  5G2Z A;  4YQV A;  1TRW A;  4KUN A;  1YZX A;  4GTU A;  5E59 A;  4OFN A;  3KTB A;  4AGS A;  2H6Y A;  3IRA A;  4BL7 B;  4TXO B;  4YAV A;  1PSQ A;  3WYW A;  2N5B A;  4F9Z A;  2VLV A;  2MMA A;  4OCF A;  1MDJ A;  2KLX A;  4GST A;  2B1L A;  4RUV A;  1IYH A;  2I9H A;  2GQK A;  4HJM A;  4QQ7 A;  1Z3E A;  2OAC A;  2YWN A;  1DE2 A;  5ECS A;  1ZGN A;  1F2E A;  4CDO A;  3KIJ A;  1B9Y C;  1NM3 A;  1XW6 A;  1GLQ A;  1O8W A;  3ISO A;  1PQN A;  1GP1 A;  4FYC A;  3FMW A;  2YV9 A;  3R3E A;  4K2X A;  1Z9H A;  2B7K A;  2YOI A;  4ILF A;  3BOA A;  1U87 A;  1A23 A;  6GSU A;  1KTE A;  1ST9 A;  1MDK A;  3APQ A;  5ECK B;  2RII A;  5CRE A;  1V2A A;  5GST A;  3A5I A;  4YQM A;  2JZR A;  4IJI A;  2OE1 A;  2YN1 A;  4GSN A;  3KP8 A;  3HD5 A;  4BVY A;  3C71 A;  4OFM A;  2K18 A;  3CSI A;  3KGK A;  2OE0 A;  5IM9 A;  2HSH A;  3GIX A;  1TW9 A;  3LGC A;  4KE3 A;  1V9W A;  2DJ0 A;  5JCG A;  4ZB9 A;  3H8Q A;  4LLR A;  2KP1 A;  3IOS A;  5A4V A;  5COH A;  3IBH A;  1AQW A;  1U3A A;  2G0F A;  3ZZX A;  2V41 A;  3W6G A;  1YEP A;  2PPT A;  3I9V 2;  4K7I A;  4IW9 A;  5HFG A;  4DSS A;  3GSS A;  3FY7 A;  1GUL A;  4EC0 A;  3TJJ A;  3UEM A;  5IQY A;  1EV4 A;  3U6V A;  4HQZ A;  1ZYN A;  3GTU A;  3DEX A;  1WMJ A;  3V1W A;  4CY6 A;  2C1Y A;  2F51 A;  2H73 A;  3F4R A;  4MNN A;  1B4Q A;  2GS3 A;  3A3T A;  4ZL8 A;  1SK1 A;  3D4T A;  2VCV A;  3FR3 A;  4Q5N A;  4ULX A;  1YY7 A;  1LU4 A;  1KNG A;  3GST A;  5CAX A;  4DVC A;  2GSQ A;  3F63 A;  5D9X A;  5HQP A;  2R0P A;  1GRX A;  1XG8 A;  1PX7 A;  1YKC A;  2DKI A;  3HJP A;  4J2F A;  5EPF A;  4HOJ A;  2IPA A;  2LRT A;  5ECI B;  1GTB A;  1TK0 B;  1IYI A;  5B7C A;  3LEF A;  3MWH A;  3EMP A;  4YH2 A;  1PFO A;  4YAP A;  5IMV A;  2FA8 A;  3DIE A;  5CRD A;  5B8B A;  1TU8 A;  2DSA A;  2JSY A;  1V57 A;  5F0G A;  2HXK A;  3CSH A;  2VUP A;  1Z5Y E;  1EP7 A;  2IJY A;  1THO A;  4F82 A;  2YJ7 A;  3DKS A;  1A0F A;  2A4H A;  3HVS A;  3MIX A;  2R2J A;  2L6D A;  2YWM A;  3GHA A;  1ABA A;  1Z6N A;  4KB3 A;  4ZXG A;  1FG4 A;  1DBY A;  3MNG A;  3QOU A;  22GS A;  1ILO A;  4PNG A;  4EF0 A;  2WS2 A;  3LJR A;  3FZA A;  2EIQ A;  3MDK A;  4POB A;  3EWL A;  2VCT A;  2FLS A;  4MZB A;  4ZBA A;  2E2M A;  1Y6E A;  1FVJ A;  4G0L A;  1USB A;  2PMT A;  5DAL B;  2JZT A;  1TK5 B;  3QFA C;  4L8E A;  4J56 E;  3LXZ A;  1A8Y A;  3UIW A;  1ML6 A;  2IIY A;  3GKX A;  4WEY A;  3KTL A;  2KP2 A;  3KM6 A;  4WBR D;  4EIQ A;  1G0T A;  3QR6 A;  3UBK A;  1PKZ A;  4MJA A;  2AAW A;  2F9S A;  1SL2 B;  2REM A;  1OE8 A;  3F6D A;  3LWA A;  1KBN A;  2C0G A;  3DRN A;  2BTO T;  4K1F A;  5B8A A;  2IWT A;  2VM1 A;  4GQC A;  5BRT A;  1XVW A;  2H30 A;  1MEK A;  2HLS A;  2H66 A;  1AQX A;  5DQY A;  4L0W A;  3VUR A;  1AW9 A;  4MCU A;  3D4M A;  2DJK A;  2CQ9 A;  1XWC A;  1S3C A;  2YWI A;  2WFC A;  1ERU A;  1WP0 A;  3TOT A;  1OC9 B;  1FB6 A;  4E8H A;  3IE3 A;  4GSS A;  3RBT A;  4KND A;  3S9F A;  2M72 A;  3APS A;  3I69 A;  2L57 A;  2H1B A;  4EDZ A;  3ZYW A;  4Q5F A;  3GUR A;  1XCC A;  1GSF A;  2B5Y A;  4K0N A;  2TRX A;  2H0H A;  1WE0 A;  4POM A;  1VF4 A;  5D93 A;  3DD3 A;  1QUW A;  1FO5 A;  6GSX A;  3VPT A;  2DMM A;  1T00 A;  2VL2 A;  1JZO A;  3APO A;  3IA1 A;  2OBI A;  4KX4 A;  4HJ2 A;  3HVN A;  4DEJ A;  1FOV A;  1R4W A;  2R4V A;  1M7T A;  4MAB A;  3TKS C;  3QDN A;  2HI7 A;  1F3B A;  2YP6 A;  3PIN A;  3PH9 A;  1SK2 A;  2FGX A;  4F0B A;  1GUK A;  4TVE A;  4N10 A;  4MZW A;  4E8E A;  19GS A;  1WRY A;  2V1M A;  1GLP A;  3GYK A;  1A2M A;  3E9J B;  1GL8 A;  5KN0 A;  2Z9S A;  4TXO A;  1B8X A;  2VL2 C;  4MK3 A;  2C8U A;  1WPI A;  1HNA A;  3ZTL A;  4D73 B;  4LL4 B;  3VLN A;  2MMZ A;  1AQV A;  4NV5 A;  1UC7 A;  2CZ2 A;  2YPM A;  4DSR A;  1GH2 A;  4NHZ A;  9GSS A;  3GFK A;  2CV4 A;  3WGD A;  1V58 A;  2JL4 A;  4EE0 A;  2GDR A;  2CA8 A;  1TP9 A;  1M99 A;  2VCX A;  5J5N A;  1XBS A;  1W89 A;  4HDE A;  1K3L A;  2VLT A;  1ZYE A;  1PRX A;  2DJ2 A;  2IMI A;  3E3E A;  3H79 A;  3N9J A;  4V2M A;  3CXG A;  3H1N A;  6GSY A;  2DJJ A;  2PUK C;  4BWS A;  2GGT A;  3KCM A;  2B7J A;  1CQG A;  1T4Z A;  2GT6 A;  1XOB A;  4IN0 A;  3P90 A;  3C1S A;  2PN8 A;  2RM5 A;  5DAK B;  4L5O A;  3G9B A;  1TKD B;  3A5W A;  2CX3 A;  16GS A;  3OR5 A;  2O8V B;  1J0F A;  4K2D A;  4EIP A;  1YKA A;  2KUC A;  3FW2 A;  4MH2 A;  1ON4 A;  4TXV A;  1TXX A;  3TRQ A;  4MF7 A;  3ZVJ A;  3CSJ A;  1HNC A;  3HDC A; 
#chains in the Genus database with same CATH homology
 3TGZ A;  4ZL7 A;  1NSW A;  2OKA A;  1SL1 B;  2TRC P;  4I6X A;  1ZCP A;  4N30 A;  2YJH A;  3LYP A;  2WGR A;  3IC8 A;  2NDO A;  5G5F A;  3HA9 A;  3FZ4 A;  3D22 A;  3GRX A;  3WT2 A;  2WCI A;  1EP8 A;  3GN3 A;  1ZL9 A;  4XS1 A;  2DC5 A;  1G6W A;  2MMO A;  5KN2 A;  3CTF A;  3CBU A;  1F6M C;  3TUE A;  3HZ4 A;  3LG6 A;  3W8J A;  5IMA A;  1QK8 A;  3P8W A;  3IR4 A;  1LJR A;  4EXJ A;  2PWJ A;  4HU7 A;  2F8F A;  1EEM A;  2AYT A;  2GQM A;  2PBJ A;  2CVB A;  4V1A p;  3QPM A;  1DSB A;  5C04 A;  5HFK A;  3HZ8 A;  4KW6 A;  1THX A;  2QKE A;  4HI7 A;  3IPZ A;  4PUF C;  3GX0 A;  4ZB8 A;  5F05 A;  3TCO A;  1R26 A;  2L4C A;  1GUH A;  2FD3 A;  1SKW B;  1R5P A;  2E7P A;  3R2Q A;  3EVI A;  5AGY A;  4IQ1 A;  3IV4 A;  1B9X C;  4JR4 A;  4ACS A;  2C4J A;  2IFQ B;  3RPP A;  1OC8 A;  5CRW A;  4ZB6 A;  1C72 A;  2I81 A;  4J57 E;  1AAZ A;  3KEB A;  4FH8 A;  2N5F A;  1GSE A;  4KA0 A;  5JWR B;  3ZRD A;  3TKR A;  3QFB C;  2PU9 C;  2X8C A;  4TR3 A;  2LEG A;  3Q74 A;  1ZZY A;  1F3A A;  5G1L A;  3KD0 A;  4KGI A;  2WZ9 A;  3HJO A;  2X8H A;  2M46 A;  1ERV A;  2F8A A;  5DQS A;  1EEJ A;  1J9B A;  3HY2 A;  5D96 A;  4AJ7 A;  4ZBD A;  3GMF A;  4ML1 A;  2B1K A;  2DIY A;  3ZIV A;  1B4P A;  4AF2 A;  2WUL A;  2LRC A;  2HSY A;  2VD1 A;  5E4W A;  1SEN A;  1XW9 A;  1Z6M A;  1DE1 A;  4EDY A;  1Z7R A;  1GSD A;  2R0G A;  2CZ3 A;  2LJK A;  3HCZ A;  3L9U A;  4NMU A;  5FWG A;  4GF0 A;  4X1U A;  5L71 A;  1K0A A;  5DAL A;  4PQ1 A;  1U3I A;  3KJY A;  4KAE A;  4YKF A;  2JSZ A;  2P5R A;  2DJ3 A;  3FHK A;  5DBQ A;  3TOU A;  5JWO B;  2O85 A;  5A5K A;  4USS A;  2PVO C;  5D9W A;  3BJ5 A;  1GNW A;  1OKT A;  4IJ3 A;  3CMI A;  5ECO B;  4NPB A;  1TRU A;  17GS A;  2VOC A;  5GZZ B;  1ERT A;  2H19 A;  3LOR A;  1JLV A;  1WJK A;  1XZO A;  2FWE A;  3U5R E;  1SKR B;  5F07 A;  4TN8 A;  1ZYQ B;  1Q4J A;  3C7M A;  1GWC A;  5DCG A;  1MTC A;  1X5E A;  5ECM B;  2X4A A;  2FCH A;  3IXR A;  5G30 A;  1GSY A;  1N8J A;  5G1K A;  1EOG A;  2HRK A;  3WGE A;  1OC9 A;  2D2Z A;  2IME A;  1SJI A;  2XBI A;  3UJ1 A;  3VI7 A;  1RW1 A;  1XOA A;  2TIR A;  4WBJ A;  2GT5 A;  1TOF A;  1T1V A;  1SD9 A;  4MF6 A;  2AV4 A;  2K8S A;  5EY6 A;  1OAZ A;  5J4U A;  4MH3 A;  3PGT A;  1ACV A;  5LNK e;  1EV9 A;  3I43 A;  4HUA A;  1S3A A;  2YV7 A;  4F03 A;  1QGV A;  4WKW A;  2P5Q A;  3LQ7 A;  4RI6 A;  4ECJ A;  5A4U A;  3IK7 A;  3MSZ A;  3CRT A;  2IMF A;  2X99 A;  4ZBB A;  2FWF A;  3DXB A;  5JCU A;  2QA1 A;  1V98 A;  1AXD A;  4IKH A;  2GTU A;  4AJ6 A;  3IHG A;  20GS A;  3M8N A;  1PKW A;  4KDU A;  2GST A;  1FAA A;  3HXS A;  2H71 A;  2YAN A;  1GTU A;  2DJ1 A;  4JU5 A;  1M2B A;  4ID0 A;  3EUR A;  5GAN D;  1BX9 A;  2AB6 A;  2H8L A;  3L78 A;  6GSS A;  2MZC A;  2HE3 A;  4K8M A;  5AN1 A;  3CTG A;  2CVK A;  2GZZ A;  2HZF A;  4FIW A;  1O85 A;  3C73 A;  4D73 A;  4LA1 A;  1PX6 A;  1FB0 A;  3PPU A;  2IMD A;  5HR1 A;  5IMC A;  1U6T A;  5KOX A;  2XHF A;  2B5X A;  1QQ2 A;  2LKU A;  2EIR A;  2OA7 A;  1JZW A;  1JZR A;  3KMN A;  4PX1 A;  1QXH A;  4GQF A;  2IMK A;  2BJX A;  5IOW A;  2LS5 A;  3QD9 A;  1JHB A;  3KH7 A;  3DML A;  3VWU A;  2CAQ A;  2G2Q A;  5ECR B;  4WF5 A;  3P2A A;  3UOM A;  3GUS A;  4TR4 A;  1ZOF A;  2C3Q A;  1GTI A;  3CRU A;  4G19 A;  2R6K A;  1RQM A;  5J9B A;  5DAK A;  4Q5Q A;  2R0C A;  1H75 A;  2JAC A;  1YF1 A;  4O92 A;  3DVX A;  5FT3 A;  5JWQ B;  4IGJ A;  5ID2 B;  2J9H A;  4TR1 A;  2V32 A;  3BCI A;  6GSV A;  3KMO A;  1SJZ A;  5D73 A;  1H4O A;  11GS A;  1HQO A;  6GST A;  2LST A;  2CT6 A;  2H6Z A;  3O6T A;  4LMW A;  3FYG A;  3LW9 A;  2H0G A;  2PER A;  3EIN A;  3DYR A;  1TJD A;  4NWY A;  14GS A;  5F06 A;  4N0Z A;  2B3S A;  5AIV A;  2R3X A;  2HRA A;  4KDY A;  3ME7 A;  4KSM A;  1ZMA A;  5GAP D;  2HYX A;  4I97 A;  4OO4 A;  3TKQ A;  3QCP A;  1EZK A;  2VD0 A;  1EGR A;  3UAP A;  2PVQ A;  1NW2 A;  4A5P A;  3WT1 A;  2YZH A;  4XCS A;  1FVK A;  1SU9 A;  1A2L A;  1TDI A;  5J41 A;  3AY8 A;  7GSS A;  4YQU A;  2HZE B;  3UMA A;  4KCE A;  2LNT A;  3SWL A;  4WET A;  5CRG A;  4WF4 A;  4HEA 2;  2FUG 2;  1AIU A;  2LJR A;  4IP1 A;  4PNF A;  4BVX A;  4G0K A;  2OE3 A;  1X5C A;  3VWV A;  3GL3 A;  5DVB A;  3TJK A;  1BG5 A;  2V6O A;  1PN9 A;  2KOK A;  13GS A;  2R5G A;  3VWW A;  5LD0 A;  2NVL A;  3HKR A;  4JED A;  1HNB A;  5B6N A;  2IFQ A;  2P31 A;  1TI3 A;  2LV3 A;  4NV2 A;  1K0D A;  1M9B A;  2H1G A;  3KXO A;  1MD4 A;  4OCE A;  3M9J A;  3GKK A;  3UL3 A;  3A2V A;  1XWB A;  3HVV A;  3ZVJ D;  2HSM A;  4KSO A;  2H6X A;  3KZQ A;  5C00 A;  3EC3 A;  3A2W A;  5IPH A;  3EMX A;  2VCZ A;  1SK0 A;  4FYU A;  2X64 A;  1SYR A;  4K5R A;  4I5Q A;  2GSR A;  2B6M A;  2L5O A;  3ZFB A;  1W4V A;  3GA4 A;  3FRC A;  2VCQ A;  2HRF A;  2J23 A;  3K8N A;  5DJM A;  3FZ5 A;  2C0D A;  5HR0 A;  3QAG A;  1PL1 A;  5IMD A;  5ECL B;  4TR1 B;  3EU4 A;  2YNX A;  1K0M A;  3QAW A;  2L5L A;  2FNO A;  4MLY A;  2LQO A;  1YQ1 A;  1X9W B;  2YCD A;  5CYY A;  1K0O A;  4NXI A;  1GSU A;  2O89 A;  3Q6O A;  4F0C A;  5IO0 A;  2AJQ B;  5DDL A;  1PA3 A;  1U88 A;  2O87 A;  4GRF A;  3IC4 A;  2GZP A;  4K7O A;  3A2X A;  3P7X A;  3L9S A;  3W8S A;  1HYU A;  2LUS A;  2E2G A;  1AC1 A;  1PN0 A;  2C3N A;  2HRN A;  2ZUP A;  3BD2 A;  2CAI A;  2R37 A;  5G31 A;  2FY6 A;  4MPF A;  3C1R A;  12GS A;  3FEU A;  5HR2 A;  1ZYP A;  2NBS A;  3F3Q A;  5IOX A;  2WDU A;  2M80 A;  4ZIJ A;  4PQI A;  1K0N A;  1BJX A;  3GV1 A;  2GVP A;  2OBK A;  3VPQ A;  2JU5 A;  3F0I A;  3G7J A;  3M0F A;  3F4T A;  3TDG A;  2XPE A;  4ZIL A;  1E2Y A;  4BVX B;  2ON7 A;  4MJC A;  4PQH A;  3E0U A;  4CW9 A;  2A2S A;  2BMX A;  4GCI A;  3HJM A;  2A2P A;  1K3Y A;  2EIO A;  1I9D A;  3I6A A;  5DJL A;  3NOF A;  10GS A;  3DVW A;  1GNE A;  5D8I A;  3GKN A;  2K9F A;  1BYE A;  1Q98 A;  2YZU A;  3F6F A;  5JCW A;  1WOU A;  4O5Q A;  1EOH A;  1OC3 A;  3WD6 A;  1DUG A;  4XRA A;  2PGT A;  1FOH A;  2FWG A;  2ZCT A;  3ZIJ A;  4WR5 A;  1SD8 A;  2VIM A;  2GSS A;  1BQ7 A;  5FHI A;  5ABR A;  4RQX A;  4PXO A;  3ERW A;  1VF1 A;  2H75 A;  4FYB A;  4WR4 A;  3L0H A;  1A0R P;  3DGQ A;  4K5S A;  1UA5 A;  1UN2 A;  5BMU A;  5CRH A;  5EVO A;  2H72 A;  3F3R A;  2C3T A;  2H76 A;  4X43 A;  1QFN A;  2ZNM A;  1TRV A;  2RUF A;  3GKM A;  4PTS A;  1JLW A;  3HVX A;  3LFL A;  2QC7 A;  4X4J A;  5B6M A;  2GZY A;  5IPG A;  3GH6 A;  2VO4 A;  2L6C A;  5HR3 A;  1F9M A;  2HFD A;  3F9U A;  4L5L A;  4MDC A;  3US3 A;  5ECH B;  1TRS A;  3O76 A;  3JCM L;  4O7H A;  1X9S B;  1E6B A;  2A4V A;  2IN3 A;  5GSS A;  2VM2 A;  5ENU A;  1X0R A;  4XS4 B;  1JFU A;  4ICY A;  1A8L A;  2DKH A;  3LXT A;  1O8X A;  4KDX A;  4POK A;  1GSQ A;  1T4Y A;  4OFT A;  2WJU A;  3O3T A;  4XS6 A;  1SKS B;  1T3B A;  5AIS A;  1K3O A;  4IHU A;  3ED3 A;  4O32 A;  5CNW A;  3EPT A;  1EWX A;  4PGT A;  1VGL A;  4XIH A;  4JBB A;  5IMF A;  1O73 A;  2FHE A;  3RPN A;  1SL0 B;  5ID2 A;  4ECC A;  4G10 A;  1N2A A;  5INY A;  2HNL A;  3TB2 A;  4KCA A;  4DSQ A;  1KEB A;  3WGX A;  1QMV A;  5ECP B;  3FR6 A;  4NAX A;  1K0C A;  3ZMK A;  3ZL5 A;  1PMT A;  4NHW A;  3QMX A;  2DBC A;  2MMN A;  3D5J A;  4LMV A;  5ECQ B;  2KHP A;  4I2U A;  3L4N A;  4BPY A;  1BED A;  2F3M A;  1XWA A;  4V2N A;  3ZRE A;  4MZC A;  1OVN A;  2VLU A;  4L0U A;  2K8V A;  3C8E A;  3GX8 A;  3RDW A;  2OJL A;  4JZQ A;  2NPB A;  4G2E A;  4GWR A;  4IVF A;  2UZ8 A;  5A4W A;  4HU9 A;  6GSW A;  2QSI A;  3DWV A;  4TRX A;  1XPV A;  4OMV A;  3HYP A;  2JAD A;  3EYT A;  2HZE A;  4HS1 A;  4K6X A;  3RHB A;  4LL1 B;  3IAM 2;  3G7Y A;  1WWJ A;  2LRN A;  5CP1 A;  3IK9 A;  5ELG A;  4ECB A;  3UVT A;  3RAZ A;  1S3D A;  2HT9 A;  4FO5 A;  4GXZ A;  2CVD A;  5ECN B;  4ECI A;  1VF3 A;  5IIZ A;  1BAY A;  4Z7X A;  1YJ6 A;  2GQL A;  1T7P B;  1M2D A;  1HD2 A;  4ZL9 A;  3Q19 A;  2E0Q A;  4Z2U A;  3TJF A;  2ALB A;  1TTZ A;  3RHC A;  1X9M B;  1OKD A;  2DLX A;  1A24 A;  3GL5 A;  4BVY B;  2XPD A;  4XRD A;  4I2T A;  4JR6 A;  1OYJ A;  3D6I A;  4RQR A;  3FZ9 A;  1G7O A;  3G7I A;  4CY8 A;  1NHO A;  3M1G A;  3IDV A;  2RLI A;  3GNJ A;  2GLR A;  4HZ2 A;  5AIX A;  2CX4 A;  3FR9 A;  2LNS A;  3TRX A;  1JZD A;  2AHE A;  3H4K A;  4IQA A;  3ME8 A;  4MA9 A;  1XWG A;  3Q18 A;  4QL7 A;  3MYD A;  5KN1 A;  4DSS B;  5EL8 A;  3CYN A;  4TOP A;  2VAF A;  4Z2T A;  3GTU B;  4MPG A;  3NZN A;  2ON5 A;  3F8U A;  3M3M A;  3IAS 2;  8GSS A;  3TJG A;  4TR0 A;  2X49 A;  3TKS A;  4XHM A;  2V2G A;  5KEJ A;  3J7Y b;  4EVM A;  2IL3 A;  4PUA A;  4K9Z A;  1TI1 A;  2JZS A;  4O5R A;  1J08 A;  3EU3 A;  1T8E B;  1G7E A;  2H01 A;  2XC2 A;  1XXU A;  1R7H A;  3D0Z A;  2C80 A;  2B5E A;  2C0E A;  3VWX A;  4OO5 A;  5ELA A;  4IP6 A;  1CQH A;  3D21 A;  1O6J A;  1GUM A;  1M2A A;  4MF5 A;  2LTK A;  5HFI A;  1FW1 A;  4ISD A;  2WRT A;  2ES7 A;  3FKF A;  4OD7 A;  2RUE A;  1M0U A;  4HZ4 A;  1XIY A;  4EUY A;  1URM A;  1PGT A;  2V6K A;  3ZML A;  3VK9 A;  4KF9 A;  4Q5R A;  1RK4 A;  4F2I A;  2L4Q A;  1OE7 A;  3F4S A;  3TKP A;  4K7N A;  1LBK A;  2A2R A;  3UBL A;  4JRR A;  2MBT A;  3L9V A;  4TW5 A;  4Z2R A;  2VL9 A;  4V2L A;  1MD3 A;  4YKG A;  2H1D A;  3J7Y k;  1TK8 B;  2H0I A;  5J3R A;  4IEL A;  3EE2 A;  5IMZ A;  4G0I A;  4K0G A;  2N5A A;  4BL7 A;  4H86 A;  3IHQ A;  2VL3 A;  1XW5 A;  1VF2 A;  2O7K A;  2XBQ A;  4JE1 A;  3HHV A;  3ERF A;  2H1A A;  2MYG A;  1WIK A;  2L59 A;  5KOW A;  1F37 A;  3TJB A;  5LCZ A;  2DIZ A;  2DML A;  3ZFL A;  4POL A;  3SBC A;  4MJB A;  2I1U A;  3VI5 A;  2P0G A;  4RI7 A;  3FK8 A;  5H5R A;  4XTS A;  3M9K A;  4G9H A;  1R5A A;  5H5Q A;  4MMM A;  1O7U A;  5H5S A;  2QGV A;  1GTA A;  4I8B A;  2LJA A;  1NHY A;  2C0F A;  3N5O A;  3UVH A;  4EO3 A;  2RM6 A;  4HQS A;  2YWO A;  1K0B A;  2EC4 A;  2I3Y A;  1GSS A;  5KN3 A;  1EGO A;  2OAD A;  4ML6 A;  5D9T A;  4P3Y B;  2I4A A;  4IS0 A;  5F8B A;  4GLT A;  2NTO A;  3TKS E;  3VFI A;  4N0V A;  1TU7 A;  1YDK A;  4BA7 A;  1O81 A;  1X5D A;  2LQQ A;  3LYK A;  5DCH A;  4EL1 A;  1B48 A;  2AUV A;  4AJ8 A;  1ERW A;  2FA4 A;  1FHE A;  4KH7 A;  1UVZ A;  2K6V A;  4XS4 A;  3ERG A;  1AUC A;  5D9V A;  1MDI A;  4CHS A;  1PL2 A;  4V1A g;  5CO3 A;  4MJE A;  3QAV A;  4FQU A;  1Y25 A;  1G6Y A;  2FWH A;  4OWY A;  4WXT A;  18GS A;  1M9A A;  3ZIT A;  2H70 A;  3MAK A;  3KP9 A;  1XWK A;  2WB9 A;  5J9C A;  4BWQ A;  3UAR A;  5G5E A;  3H93 A;  4IBP A;  1A2J A;  3NIV A;  4O5U A;  1YEX A;  4TKY A;  4QL9 A;  2MBS A;  1VRS D;  4N11 A;  3ZLP A;  1PD2 1;  1Z7P A;  3BCK A;  2H74 A;  4PUR A;  3LSZ A;  1SYX A;  1V40 A;  1I5G A;  3GH9 A;  3BBY A;  3TRP A;  1XFL A;  5IO2 A;  2QA2 A;  3KH9 A;  4MP4 A;  2VCW A;  1XVQ A;  4X0X A;  1SJ6 A;  2X8G A;  4EKZ A;  3PR8 A;  1YF0 A;  5G2Z A;  4YQV A;  1TRW A;  4KUN A;  1YZX A;  4GTU A;  5E59 A;  4OFN A;  3KTB A;  4AGS A;  2H6Y A;  3IRA A;  4BL7 B;  4TXO B;  4YAV A;  1PSQ A;  3WYW A;  2N5B A;  4F9Z A;  2VLV A;  2MMA A;  4OCF A;  1MDJ A;  2KLX A;  4GST A;  2B1L A;  4RUV A;  1IYH A;  2I9H A;  2GQK A;  4HJM A;  4QQ7 A;  1Z3E A;  2OAC A;  2YWN A;  1DE2 A;  5ECS A;  1ZGN A;  1F2E A;  4CDO A;  3KIJ A;  1B9Y C;  1NM3 A;  1XW6 A;  1GLQ A;  1O8W A;  3ISO A;  1PQN A;  1GP1 A;  4FYC A;  3FMW A;  2YV9 A;  3R3E A;  4K2X A;  1Z9H A;  2B7K A;  2YOI A;  4ILF A;  3BOA A;  1U87 A;  1A23 A;  6GSU A;  1KTE A;  1ST9 A;  1MDK A;  3APQ A;  5ECK B;  2RII A;  5CRE A;  1V2A A;  5GST A;  3A5I A;  4YQM A;  2JZR A;  4IJI A;  2OE1 A;  2YN1 A;  4GSN A;  3KP8 A;  3HD5 A;  4BVY A;  3C71 A;  4OFM A;  2K18 A;  3CSI A;  3KGK A;  2OE0 A;  5IM9 A;  2HSH A;  3GIX A;  1TW9 A;  3LGC A;  4KE3 A;  1V9W A;  2DJ0 A;  5JCG A;  4ZB9 A;  3H8Q A;  4LLR A;  2KP1 A;  3IOS A;  5A4V A;  5COH A;  3IBH A;  1AQW A;  1U3A A;  2G0F A;  3ZZX A;  2V41 A;  3W6G A;  1YEP A;  2PPT A;  3I9V 2;  4K7I A;  4IW9 A;  5HFG A;  4DSS A;  3GSS A;  3FY7 A;  1GUL A;  4EC0 A;  3TJJ A;  3UEM A;  5IQY A;  1EV4 A;  3U6V A;  4HQZ A;  1ZYN A;  3GTU A;  3DEX A;  1WMJ A;  3V1W A;  4CY6 A;  2C1Y A;  2F51 A;  2H73 A;  3F4R A;  4MNN A;  1B4Q A;  2GS3 A;  3A3T A;  4ZL8 A;  1SK1 A;  3D4T A;  2VCV A;  3FR3 A;  4Q5N A;  4ULX A;  1YY7 A;  1LU4 A;  1KNG A;  3GST A;  5CAX A;  4DVC A;  2GSQ A;  3F63 A;  5D9X A;  5HQP A;  2R0P A;  1GRX A;  1PX7 A;  1YKC A;  2DKI A;  3HJP A;  4J2F A;  5EPF A;  4HOJ A;  2IPA A;  2LRT A;  5ECI B;  1GTB A;  1TK0 B;  1IYI A;  5B7C A;  3LEF A;  3MWH A;  3EMP A;  4YH2 A;  4YAP A;  5IMV A;  2FA8 A;  3DIE A;  5CRD A;  5B8B A;  1TU8 A;  2DSA A;  2JSY A;  1V57 A;  5F0G A;  2HXK A;  3CSH A;  2VUP A;  1Z5Y E;  1EP7 A;  2IJY A;  1THO A;  4F82 A;  2YJ7 A;  3DKS A;  1A0F A;  2A4H A;  3HVS A;  3MIX A;  2R2J A;  2L6D A;  2YWM A;  3GHA A;  1ABA A;  1Z6N A;  4KB3 A;  4ZXG A;  1FG4 A;  1DBY A;  3MNG A;  3QOU A;  22GS A;  1ILO A;  4PNG A;  4EF0 A;  2WS2 A;  3LJR A;  3FZA A;  2EIQ A;  3MDK A;  4POB A;  3EWL A;  2VCT A;  2FLS A;  4MZB A;  4ZBA A;  2E2M A;  1Y6E A;  1FVJ A;  4G0L A;  1USB A;  2PMT A;  5DAL B;  2JZT A;  1TK5 B;  3QFA C;  4L8E A;  4J56 E;  3LXZ A;  1A8Y A;  3UIW A;  1ML6 A;  2IIY A;  3GKX A;  4WEY A;  3KTL A;  2KP2 A;  3KM6 A;  4WBR D;  4EIQ A;  1G0T A;  3QR6 A;  3UBK A;  1PKZ A;  4MJA A;  2AAW A;  2F9S A;  1SL2 B;  2REM A;  1OE8 A;  3F6D A;  3LWA A;  1KBN A;  2C0G A;  3DRN A;  2BTO T;  4K1F A;  5B8A A;  2IWT A;  2VM1 A;  4GQC A;  5BRT A;  1XVW A;  2H30 A;  1MEK A;  2HLS A;  2H66 A;  1AQX A;  5DQY A;  4L0W A;  3VUR A;  1AW9 A;  4MCU A;  3D4M A;  2DJK A;  2CQ9 A;  1XWC A;  1S3C A;  2YWI A;  2WFC A;  1ERU A;  1WP0 A;  3TOT A;  1OC9 B;  1FB6 A;  4E8H A;  3IE3 A;  4GSS A;  3RBT A;  4KND A;  3S9F A;  2M72 A;  3APS A;  3I69 A;  2L57 A;  2H1B A;  4EDZ A;  3ZYW A;  4Q5F A;  3GUR A;  1XCC A;  1GSF A;  2B5Y A;  4K0N A;  2TRX A;  2H0H A;  1WE0 A;  4POM A;  1VF4 A;  5D93 A;  3DD3 A;  1QUW A;  1FO5 A;  6GSX A;  3VPT A;  2DMM A;  1T00 A;  2VL2 A;  1JZO A;  3APO A;  3IA1 A;  2OBI A;  4KX4 A;  4HJ2 A;  4DEJ A;  1FOV A;  1R4W A;  2R4V A;  1M7T A;  4MAB A;  3TKS C;  3QDN A;  2HI7 A;  1F3B A;  2YP6 A;  3PIN A;  3PH9 A;  1SK2 A;  2FGX A;  4F0B A;  1GUK A;  4TVE A;  4N10 A;  4MZW A;  4E8E A;  19GS A;  1WRY A;  2V1M A;  1GLP A;  3GYK A;  1A2M A;  3E9J B;  1GL8 A;  5KN0 A;  2Z9S A;  4TXO A;  1B8X A;  2VL2 C;  4MK3 A;  2C8U A;  1WPI A;  1HNA A;  3ZTL A;  4D73 B;  4LL4 B;  3VLN A;  2MMZ A;  1AQV A;  4NV5 A;  1UC7 A;  2CZ2 A;  2YPM A;  4DSR A;  1GH2 A;  4NHZ A;  9GSS A;  3GFK A;  2CV4 A;  3WGD A;  1V58 A;  2JL4 A;  4EE0 A;  2GDR A;  2CA8 A;  1TP9 A;  1M99 A;  2VCX A;  5J5N A;  1XBS A;  1W89 A;  4HDE A;  1K3L A;  2VLT A;  1ZYE A;  1PRX A;  2DJ2 A;  2IMI A;  3E3E A;  3H79 A;  3N9J A;  4V2M A;  3CXG A;  3H1N A;  6GSY A;  2DJJ A;  2PUK C;  4BWS A;  2GGT A;  3KCM A;  2B7J A;  1CQG A;  1T4Z A;  2GT6 A;  1XOB A;  4IN0 A;  3P90 A;  3C1S A;  2PN8 A;  2RM5 A;  5DAK B;  4L5O A;  3G9B A;  1TKD B;  3A5W A;  2CX3 A;  16GS A;  3OR5 A;  2O8V B;  1J0F A;  4K2D A;  4EIP A;  1YKA A;  2KUC A;  3FW2 A;  4MH2 A;  1ON4 A;  4TXV A;  1TXX A;  3TRQ A;  4MF7 A;  3ZVJ A;  3CSJ A;  1HNC A;  3HDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...