5ID2B

Asymmetry in the active site of mycobacterium tuberculosis ahpe upon exposure to mycothiol
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
157
structure length
157
Chain Sequence
HPMVMLNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGICQGELDQLRDHLPEFENDDSAALAISVGPPPTHKIWATQSGFTFPLLSDFWPHGAVSQAYGVFNEQAGIANRGTFVVDRSGIIRFAEMKQPGEVRDQRLWTDALAALTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative peroxiredoxin Rv2238c
publication title Redox chemistry of Mycobacterium tuberculosis alkylhydroperoxide reductase E (AhpE): Structural and mechanistic insight into a mycoredoxin-1 independent reductive pathway of AhpE via mycothiol
pubmed doi rcsb
source organism Mycobacterium tuberculosis h37rv
molecule tags Oxidoreductase
total genus 54
structure length 157
sequence length 157
chains with identical sequence C
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2016-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5id2B00
3DVXA 2N5BA 4GF0A 1Y25A 2R6KA 4ISDA 1BAYA 2R3XA 1F37A 2I1UA 4LL1B 4TR0A 3MNGA 3TDGA 3UEMA 3TOTA 2LNSA 2WRTA 5F8BA 2C0EA 3UMAA 3KEBA 2JSYA 1ERTA 2IWTA 4Q5QA 2CAIA 1SJIA 3KM6A 1DE2A 2TIRA 4HOJA 1GLPA 3ED3A 1YJ6A 4LLRA 2YCDA 5G1LA 1EP8A 1QQ2A 4MZCA 3G9BA 1QFNA 5IMZA 2VUPA 1QMVA 1M2DA 3Q18A 2MMNA 1X0RA 4JZQA 4TR3A 2EIOA 4PURA 1PA3A 2H1AA 2OJLA 5AN1A 5JCGA 4AJ7A 2IPAA 5IOWA 5EPFA 2H66A 5IQYA 3WGEA 1YEPA 3J7Yk 3GFKA 2ON5A 2F9SA 3GTUA 4JEDA 3KCMA 5HFIA 1GH2A 5ECRB 1OC9A 3OR5A 1KTEA 1Z7RA 2GQKA 1GP1A 4N10A 5JCWA 2PVQA 2RUFA 2B7KA 2H70A 3EU3A 1T7PB 2PMTA 3BCIA 3M1GA 3HHVA 4NHWA 5ECOB 3CYNA 4MDCA 3GHAA 1PL1A 4HDEA 1ML6A 3O76A 5ID2B 2FA8A 20GSA 2X8GA 2JZRA 3DKSA 2VO4A 1ZZYA 4KCAA 1JZOA 3HD5A 5ECQB 1MDJA 4G2EA 1BYEA 1HD2A 3FHKA 5KN2A 4ZBBA 2WGRA 3LXZA 2CVDA 2IL3A 2VL9A 4WF4A 4K1FA 1BQ7A 1SK2A 2DJJA 2V41A 4ID0A 4POMA 1Z9HA 22GSA 1EOGA 3US3A 1GWCA 5CRHA 4K2DA 3GN3A 1TK5B 3FZ5A 2O87A 5B8AA 3SBCA 1QXHA 4TRXA 2IFQA 1R7HA 2PBJA 2PGTA 4V2LA 2JACA 3F3RA 5H5RA 3FEUA 1PSQA 1ERWA 4TXOB 3LYKA 1VF2A 1XWKA 5ELGA 1FAAA 1T8EB 2LJAA 4LL4B 2VCVA 3ZFBA 3TRPA 4GCIA 4PX1A 2DJKA 1URMA 3G7IA 5HFGA 1E2YA 3KMNA 3M0FA 4MA9A 1GSSA 4DSSA 5JWOB 1PMTA 2QSIA 5IPHA 2VD0A 3GRXA 4EDZA 2F3MA 2XBIA 1TU8A 1SD9A 4FIWA 2LJRA 2GZYA 3BD2A 3QPMA 5F06A 4RI6A 1XW9A 4ULXA 1PX6A 2CA8A 4ZILA 2NBSA 2OACA 4TXVA 4PQHA 1GSQA 2NVLA 3LG6A 3GUSA 5CAXA 2ZCTA 2N5FA 2K8SA 2YNXA 3QR6A 5CP1A 1UVZA 18GSA 2HI7A 4ZB8A 10GSA 5ECLB 12GSA 3GIXA 3QMXA 2LNTA 1JLVA 1OE8A 3F0IA 4KA0A 2FLSA 2LQQA 6GSSA 1XPVA 3O3TA 2O8VB 1TRVA 1GL8A 4RI7A 3L0HA 3GKNA 4TKYA 3UIWA 1RQMA 1PL2A 2HXKA 2YWNA 1WRYA 4IP1A 2YP6A 2C8UA 2LTKA 3EYTA 1GUMA 1EWXA 3QD9A 4GRFA 1EEJA 3IC4A 5HR1A 1J0FA 4O32A 4ILFA 2OBKA 4ZIJA 3ME8A 1OAZA 1R5AA 2DC5A 2L4QA 3VFIA 1WE0A 3FY7A 3GH9A 1CQHA 1XWGA 3KH9A 2HT9A 4XS1A 2FNOA 3L9SA 4TR1B 1YZXA 1XXUA 1B9XC 1TI1A 3HJPA 4TVEA 1GSYA 3ZL5A 1SL2B 5KN3A 4HJMA 2ES7A 5DJLA 1O73A 1GTIA 3FKFA 2L6CA 3VWUA 1PD21 4ML6A 4RUVA 4IVFA 4KDYA 3UJ1A 2JADA 1V40A 2RIIA 4XIHA 1FO5A 1GSDA 5GZZB 4F0BA 3UVHA 1PKZA 2X8CA 2L5OA 5AIVA 3IXRA 2E2MA 2IMKA 1M7TA 13GSA 2FWHA 1T4ZA 4L8EA 1WIKA 1BJXA 3TCOA 2H8LA 5G31A 1U3IA 5ID2A 1XOBA 1XVQA 1LU4A 2C0GA 2HZFA 2LRCA 4DSQA 2H6XA 2YOIA 1GNWA 1YF1A 2QGVA 1T3BA 2C0DA 2CV4A 3RDWA 2H74A 2LQOA 3FW2A 1XVWA 4GQCA 1ERVA 5COHA 3D21A 2I81A 4IBPA 2KUCA 3PGTA 5IO0A 4WR5A 1HNCA 5CREA 3BJ5A 4PUFC 5H5QA 2DIZA 2EC4A 2BMXA 2C3NA 3IBHA 5DQYA 1A2MA 4JRRA 4TN8A 3SWLA 2OKAA 4MH3A 1A23A 1KNGA 4TOPA 2GT5A 1S3DA 4FYBA 4OD7A 4POKA 1XW6A 4X1UA 3DVWA 3LWAA 6GSTA 4OO5A 2REMA 2WZ9A 2X8HA 1JZWA 3TJBA 4NPBA 4F82A 2FWEA 3C73A 3VWXA 4TXOA 2V32A 4EUYA 4K7OA 3D4TA 3F6FA 2BTOT 3TKPA 5G2ZA 3DD3A 4EE0A 5AIXA 2MBTA 2H1BA 3QCPA 3A5WA 2H0GA 2WFCA 4G10A 2VLUA 3APQA 3ZVJA 4EF0A 2WDUA 3TJFA 1OC8A 2VCWA 2M80A 2H6YA 2VCZA 1SD8A 3HVXA 4MJBA 1G7EA 1XCCA 3EMPA 4F03A 2GVPA 4F9ZA 2HSHA 1YF0A 3VPTA 2GSRA 5G5FA 5B6MA 1XWAA 2GDRA 4LA1A 5DALB 3D5JA 4GLTA 1XOAA 3CTFA 1WWJA 7GSSA 2LUSA 2CVKA 3HZ8A 3MDKA 2G0FA 3MWHA 4KSOA 5F0GA 4IELA 4KNDA 2MMOA 1F3BA 3G7JA 4WXTA 4IQAA 1O81A 1GUKA 4NXIA 2P0GA 4CDOA 4HZ4A 1M9BA 3ZVJD 5IPGA 2IMIA 1RK4A 3F9UA 3TOUA 2DJ1A 4PUAA 4AF2A 1H4OA 1VRSD 3CSHA 4N0ZA 1DBYA 1USBA 4I8BA 3ZZXA 1O6JA 4EKZA 2KOKA 1AUCA 1JZRA 2HZEA 1YY7A 3E3EA 2H71A 2O85A 3NZNA 2TRXA 2P31A 3IDVA 2LSTA 1HNBA 4PNFA 3ZFLA 1G0TA 3H8QA 4IW9A 5ABRA 2VOCA 3LYPA 6GSWA 3DEXA 3QAGA 1TOFA 4TR1A 1MD4A 4EVMA 1B9YC 1SENA 2K6VA 1WP0A 4HS1A 3RPNA 4V2MA 3L9VA 3F3QA 3TJKA 4RQRA 5EL8A 3ME7A 1Y6EA 2GSTA 5DCGA 3TRXA 4X0XA 2B6MA 1K0CA 4HQZA 2C3QA 3VURA 1EEMA 4Q5RA 3CBUA 1ON4A 2FUG2 3PH9A 4XTSA 2F8AA 14GSA 3P7XA 1Z3EA 4TW5A 2K9FA 4K9ZA 1FB6A 1SYRA 4XCSA 3O6TA 1G6YA 2OBIA 4ZL8A 1TJDA 3GSSA 4DSRA 1AXDA 4V2NA 1NSWA 5ECNB 1A0FA 3HXSA 4FH8A 5CNWA 3A2WA 1S3AA 6GSYA 1SKSB 2IMFA 5A4UA 3FZAA 2MZCA 2MMAA 3QFBC 2GS3A 4E8EA 2X99A 3F6DA 3A2XA 5INYA 3RAZA 4YAVA 3DYRA 2FD3A 4GSTA 4KDUA 2AV4A 2F8FA 5ECIB 2AJQB 1H75A 2RM5A 1GLQA 2ZUPA 3QAWA 3IPZA 3FR3A 2VM1A 2FWGA 1AQVA 2V6OA 3UBLA 4EC0A 4J57E 1KBNA 1V58A 4K8MA 3IHQA 4HI7A 2H1GA 2PU9C 2JL4A 3GKKA 1DSBA 3BBYA 4IGJA 2L6DA 2P5QA 1AIUA 5LCZA 5J4UA 4RQXA 4I2TA 2I3YA 3I69A 3FZ4A 1U3AA 1M9AA 3LEFA 8GSSA 1TRSA 2RM6A 2VL2C 2LV3A 4NAXA 3GA4A 2Z9SA 2X64A 4BL7A 4AJ6A 1FVJA 4K7NA 2H76A 3LGCA 3UOMA 1AC1A 5FT3A 3ZITA 4MCUA 1K3YA 2HRNA 4OWYA 2ZNMA 1TK0B 4TR4A 1YKCA 3CSJA 4ECJA 3EMXA 4K0NA 4L5LA 4ML1A 1GTBA 2XHFA 5J41A 3WGXA 3TGZA 3EINA 3H1NA 3L9UA 4IKHA 3TUEA 5DCHA 1I5GA 3ZMLA 2I4AA 4MJEA 2XBQA 3TB2A 4ZBAA 2CX4A 4HU9A 2C4JA 3FR6A 5DALA 1K3OA 3RPPA 3UL3A 3DIEA 1SL1B 4BWQA 5EY6A 5J3RA 3UVTA 2LEGA 4OCEA 1N2AA 2L59A 2HSYA 3I9V2 3GURA 3KJYA 3F4SA 3RHBA 4NV5A 3PINA 1XZOA 3D0ZA 1SK0A 2VCTA 2WJUA 4K6XA 1VF1A 1X5DA 4JU5A 3FYGA 5DQSA 4JE1A 2XC2A 1J9BA 1T1VA 2MYGA 2JSZA 1ZCPA 6GSVA 1QK8A 4ZBDA 1B4PA 3W8JA 2K18A 3IAS2 4BA7A 3I43A 4YQUA 3ZRDA 3A2VA 4HEA2 5D9XA 3CRTA 5IMFA 2CZ2A 2YN1A 3F63A 2E0QA 1EGRA 4ZL7A 3F4RA 4JR4A 4YQVA 2LRNA 2FHEA 3IK7A 1XW5A 1PX7A 3LORA 3IA1A 1CQGA 4BWSA 5A4VA 2YJ7A 5AGYA 5F07A 3IRAA 2AB6A 4L0UA 2YV9A 3P2AA 2C80A 3ISOA 4MJAA 1F6MC 2R5GA 4JR6A 4QL9A 1BG5A 1UN2A 1ZOFA 2J9HA 2QC7A 4MF6A 2CQ9A 3GSTA 5JWRB 1R26A 1F9MA 4YH2A 1DUGA 1JLWA 1HNAA 1TDIA 1J08A 3C1SA 3TJJA 4XS6A 1XWCA 4BPYA 1M2AA 2K8VA 2GTUA 1GNEA 3KH7A 4X43A 5FHIA 5IM9A 1R5PA 4Q5FA 5ELAA 3M9KA 1XIYA 2YV7A 3HCZA 2B7JA 5FWGA 3Q19A 3W6GA 2GSSA 5D73A 4HQSA 3GKXA 4MZBA 3GH6A 3CMIA 5ECHB 2OE0A 11GSA 3C8EA 5CRGA 1UC7A 5H5SA 2FCHA 2B1LA 3FRCA 4MABA 2B5XA 1JFUA 2RLIA 2GQLA 4I5QA 1YKAA 1THOA 4DEJA 2H0IA 3DMLA 3R2QA 1XBSA 5AISA 3D22A 5ECPB 2PPTA 2D2ZA 2IN3A 4ACSA 1QUWA 3NOFA 5HFKA 3Q6OA 1Z6MA 4O92A 4ZB6A 2F51A 1MEKA 1OKDA 3HJMA 3Q74A 2RUEA 3KD0A 3KZQA 4F2IA 1B4QA 1ABAA 3F4TA 2VLVA 3KTBA 4MPFA 19GSA 9GSSA 3WGDA 4I97A 2HRFA 4WETA 1K0AA 2IJYA 4QQ7A 5L71A 2GZPA 2GZZA 1OE7A 5IMVA 3BCKA 1TW9A 1GTAA 3KP8A 4V1Ag 1U6TA 4MJCA 2H0HA 4GWRA 1TI3A 3TKSA 3G7YA 4HJ2A 1SU9A 3UARA 5IMAA 4N30A 3TKRA 1X9SB 1MD3A 4J56E 2GT6A 2DSAA 1FB0A 3ZIVA 3S9FA 3ZMKA 5GAPD 1O8WA 4ZXGA 5EVOA 2ON7A 2OE1A 3UBKA 4IHUA 1R4WA 1EZKA 5G5EA 3HJOA 1K3LA 1KEBA 4WF5A 5D9VA 1PKWA 1ZGNA 4WBJA 2E7PA 2H19A 1S3CA 4Q5NA 2XPDA 1V9WA 5ENUA 4MZWA 3GX8A 5HR3A 2L4CA 1A0RP 4V1Ap 1K0NA 2WB9A 2PN8A 4KH7A 2OADA 1NM3A 2FA4A 3HY2A 2MBSA 1AQWA 2FWFA 4IQ1A 2HYXA 3FZ9A 4MPGA 1FVKA 1M0UA 2KHPA 2IMDA 1X9MB 1TTZA 5IO2A 4OMVA 4EXJA 3QAVA 1Q98A 5JWQB 2B5EA 3RBTA 1O7UA 1BEDA 3D4MA 3HYPA 4YQMA 2VM2A 1A24A 2V1MA 5IMDA 4BVYA 3CRUA 4ZL9A 17GSA 4KE3A 4POLA 4OO4A 5DAKB 2TRCP 2WCIA 4LMWA 4ECBA 2AAWA 2B1KA 3DWVA 1IYHA 4IJ3A 3BOAA 1GSUA 1K0DA 1ST9A 2PVOC 5A5KA 4MK3A 3C1RA 4HU7A 4KW6A 3PR8A 1VF3A 3CTGA 5D8IA 2CT6A 3H4KA 4I6XA 2YPMA 3N9JA 1TP9A 3CXGA 2HFDA 1T4YA 3MSZA 1MDKA 3EC3A 2HNLA 3IAM2 4G9HA 4XRAA 5G1KA 1I9DA 3GV1A 3HVSA 3GL3A 3KIJA 4EDYA 1YEXA 1GUHA 1V2AA 1SJZA 4CW9A 4PQ1A 1B48A 4MP4A 1LBKA 5E59A 3LFLA 2A4VA 5CO3A 2YJHA 3AY8A 2CX3A 4XS4B 3D6IA 2LS5A 1OKTA 1F2EA 3DXBA 1O8XA 3IR4A 3WT2A 1C72A 1WMJA 2GQMA 5C04A 2DBCA 1NW2A 1JHBA 2VCQA 4L0WA 1SL0B 3QDNA 6GSXA 1WPIA 1K0OA 1ACVA 1TRUA 3ERGA 2H6ZA 5B6NA 1ZL9A 5E4WA 2OE3A 1DE1A 3WD6A 3ZREA 2FGXA 1UA5A 3GYKA 2I9HA 3KXOA 2LKUA 5CYYA 4L5OA 2R4VA 5C00A 4PXOA 3QOUA 3VI7A 1A8YA 4JBBA 2N5AA 1Z6NA 3EE2A 2DMMA 3FR9A 1W4VA 1PQNA 2ALBA 2NDOA 1LJRA 2VAFA 2LRTA 2DMLA 3FK8A 4OCFA 4D73B 2G2QA 3LSZA 3ERWA 2E2GA 3LQ7A 2WULA 2JU5A 1AQXA 4ECIA 3DRNA 1ZYEA 1G7OA 3CSIA 4N11A 1X9WB 4KSMA 1EP7A 4ECCA 1EV9A 3TRQA 3KP9A 5LD0A 4KB3A 1B8XA 3K8NA 2V6KA 2H1DA 1PGTA 2YANA 2AHEA 2EIRA 5LNKe 3P90A 2FY6A 2HLSA 2WS2A 1FG4A 1AAZA 4POBA 1G6WA 3IE3A 2H01A 3EURA 3L78A 4NMUA 5B8BA 3KTLA 3EVIA 3U5RE 3HDCA 2VLTA 1AW9A 1OYJA 3TKSC 3J7Yb 3IOSA 2DJ2A 4OFTA 3MAKA 5ECKB 2DJ3A 1BX9A 3M3MA 3N5OA 4KGIA 3W8SA 1XFLA 5CRDA 1SKWB 5J9BA 1Q4JA 4Z7XA 4WBRD 4E8HA 2HE3A 3ZTLA 1M99A 3C7MA 3VWWA 5CRWA 2NTOA 1JZDA 4FYUA 3LXTA 3RHCA 5G30A 2A2RA 1MTCA 1FHEA 1N8JA 4PQIA 3UAPA 4K7IA 2VL3A 2O7KA 4GXZA 2C1YA 4PNGA 5DAKA 4IS0A 5ECMB 4IP6A 5DVBA 1TXXA 4F0CA 4KDXA 1HQOA 3GNJA 1ILOA 1OC3A 3TJGA 2GGTA 3H93A 1GULA 4KAEA 5IOXA 5J9CA 4HZ2A 4YAPA 4DVCA 16GSA 4N0VA 4GTUA 4MMMA 2HZEB 5HR2A 3F8UA 3I6AA 2VD1A 2DLXA 4J2FA 4CHSA 4KCEA 2KP1A 1E6BA 1SYXA 4MH2A 3VI5A 1SJ6A 4H86A 3QFAC 3APSA 3H79A 5HQPA 3A3TA 1ERUA 4EO3A 5KN1A 5F05A 4GSNA 2DJ0A 4MF5A 4PGTA 3EWLA 2H30A 3HVVA 4GSSA 3HKRA 2O89A 2B5YA 2BJXA 3E9JB 5DDLA 1T00A 3GKMA 5D93A 4O7HA 5HR0A 3TKQA 2MMZA 2CZ3A 4NWYA 1U87A 4XS4A 3ERFA 1OVNA 3ZYWA 3LJRA 1ZMAA 3KMOA 4G19A 3IV4A 4MF7A 4IN0A 2C3TA 4NV2A 3U6VA 3GTUB 1QGVA 2M72A 1NHOA 3GX0A 6GSUA 4P3YB 1V57A 1OC9B 2M46A 3E0UA 5KEJA 3KGKA 1WJKA 4FYCA 5D9TA 1X5EA 5GAND 2CAQA 3EU4A 2VIMA 1EV4A 5JCUA 2QKEA 3L4NA 1PN9A 1EOHA 2H73A 3HA9A 4XRDA 1YQ1A 2R37A 2CVBA 1GTUA 2P5RA 1SK1A 2JZSA 3NIVA 1WOUA 4LMVA 4FO5A 5A4WA 2YWIA 2JZTA 5DBQA 3ZLPA 2VL2A 3GMFA 5IMCA 1GSFA 1ZYQB 4D73A 2LJKA 4AJ8A 1SKRB 2L5LA 1XWBA 3GL5A 4QL7A 5GSSA 1TK8B 1O85A 3ZIJA 1K0BA 3HZ4A 1GRXA 3WT1A 4GQFA 1FW1A 2R2JA 1Z7PA 4OFNA 3VPQA 2AUVA 2IFQB 1THXA 3V1WA 2PERA 4WR4A 3VLNA 1A8LA 4EL1A 2PUKC 1TU7A 2C0FA 2H72A 2IMEA 4IJIA 1X5CA 5ECSA 1VGLA 1TKDB 4K0GA 3M9JA 3DGQA 1NHYA 4MLYA 2VCXA 4BVXA 4WKWA 5KN0A 3M8NA 5D96A 1Z5YE 4WEYA 1MDIA 2NPBA 3JCML 4NHZA 2EIQA 1FOVA 1W89A 1PRXA 4ZB9A 1K0MA 2V2GA 5B7CA 2YZUA 4KUNA 1YDKA 5D9WA 1HYUA 1M2BA 3P8WA 5GSTA 4DSSB 1F3AA 3C71A 3APOA 5IIZA 1A2LA 1IYIA 4KX4A 3TKSE 5DJMA 2XPEA 5J5NA 2IIYA 1GSEA 2YWMA 4AGSA 2H75A 1A2JA 1VF4A 2KP2A 2YWOA 2A2SA 3VK9A 2L57A 2B3SA 2GLRA 1TRWA 4XHMA 2OA7A 1RW1A 2YZHA 1V98A 1U88A 3WYWA 3VWVA 2DIYA 2PWJA 4HUAA 1EGOA 4OFMA 2KLXA 2AYTA 2J23A 2GSQA 3IK9A 4I2UA 4O5RA
chains in the Genus database with same CATH superfamily
3DVXA 2N5BA 4GF0A 1Y25A 2R6KA 4ISDA 1BAYA 2R3XA 1F37A 2I1UA 4LL1B 4TR0A 3MNGA 3TDGA 3UEMA 3TOTA 2LNSA 2WRTA 5F8BA 2C0EA 3UMAA 3KEBA 2JSYA 1ERTA 2IWTA 4Q5QA 2CAIA 1M3IA 1SJIA 3KM6A 1DE2A 2TIRA 4HOJA 1GLPA 3ED3A 1YJ6A 4LLRA 2YCDA 5G1LA 1EP8A 1QQ2A 4MZCA 3G9BA 1QFNA 5IMZA 2VUPA 1QMVA 1M2DA 3Q18A 2MMNA 1X0RA 4JZQA 4TR3A 2EIOA 4PURA 1PA3A 2H1AA 2OJLA 5AN1A 5JCGA 4AJ7A 2IPAA 5IOWA 5EPFA 2H66A 5IQYA 3WGEA 3CQFA 1YEPA 3J7Yk 3GFKA 2ON5A 2F9SA 3GTUA 4JEDA 3KCMA 5HFIA 1GH2A 5ECRB 1OC9A 3OR5A 1KTEA 1Z7RA 2GQKA 1GP1A 4N10A 5JCWA 2PVQA 2RUFA 2B7KA 2H70A 3EU3A 1T7PB 2PMTA 3BCIA 3M1GA 3HHVA 4NHWA 5ECOB 3CYNA 2X49A 4MDCA 3GHAA 1PL1A 4HDEA 1ML6A 3O76A 5ID2B 2FA8A 20GSA 2X8GA 2JZRA 3DKSA 2VO4A 1ZZYA 4KCAA 1JZOA 3HD5A 5ECQB 1MDJA 4G2EA 1BYEA 1HD2A 3FHKA 5KN2A 4ZBBA 2WGRA 3LXZA 3LW9A 2CVDA 2IL3A 2VL9A 4WF4A 4K1FA 1BQ7A 1SK2A 2DJJA 2V41A 4ID0A 4POMA 1Z9HA 22GSA 1EOGA 3US3A 1GWCA 5CRHA 4K2DA 4CY8A 5BMUA 3GN3A 1TK5B 3FZ5A 2O87A 5B8AA 3SBCA 1QXHA 4TRXA 2IFQA 1R7HA 2PBJA 2PGTA 4V2LA 2JACA 3F3RA 2HRKA 5H5RA 3FEUA 1PSQA 1ERWA 3A5IA 4TXOB 3LYKA 1VF2A 1XWKA 5ELGA 1FAAA 1T8EB 2LJAA 4LL4B 4Z2UA 2VCVA 3ZFBA 3TRPA 4O5QA 4GCIA 4PX1A 2DJKA 1URMA 3G7IA 3MIXA 5HFGA 1E2YA 3KMNA 3M0FA 4MA9A 1GSSA 4DSSA 5JWOB 1PMTA 2QSIA 5IPHA 2QA2A 2VD0A 3GRXA 4EDZA 2F3MA 2XBIA 1TU8A 1SD9A 4FIWA 2LJRA 2GZYA 3EPTA 3BD2A 3QPMA 5F06A 4RI6A 1XW9A 4ULXA 1PX6A 2CA8A 4ZILA 2NBSA 2OACA 4TXVA 4PQHA 1GSQA 2NVLA 3LG6A 3GUSA 1XG8A 5CAXA 2ZCTA 2N5FA 2K8SA 2YNXA 3QR6A 5CP1A 1UVZA 18GSA 3IHGA 2HI7A 4ZB8A 10GSA 5ECLB 12GSA 3GIXA 3QMXA 2LNTA 1JLVA 1OE8A 3F0IA 4KA0A 2FLSA 2LQQA 6GSSA 1XPVA 3O3TA 2O8VB 1TRVA 1GL8A 4RI7A 3L0HA 3GKNA 4TKYA 3UIWA 1RQMA 1PL2A 2HXKA 2R0CA 2YWNA 1WRYA 4IP1A 2YP6A 2C8UA 2LTKA 3EYTA 1GUMA 1EWXA 3QD9A 4GRFA 1EEJA 3IC4A 5HR1A 1J0FA 4O32A 4ILFA 2OBKA 4PTSA 4ZIJA 3ME8A 1OAZA 1R5AA 2DC5A 2L4QA 3VFIA 1WE0A 3FY7A 3GH9A 1CQHA 1XWGA 3KH9A 4G0LA 2HT9A 4XS1A 2FNOA 3L9SA 4TR1B 1YZXA 1XXUA 1B9XC 1TI1A 3HJPA 4TVEA 1GSYA 3ZL5A 1SL2B 5KN3A 2R0GA 4HJMA 2ES7A 5DJLA 1O73A 1GTIA 3FKFA 2L6CA 3VWUA 1PD21 4ML6A 4RUVA 4X4JA 4IVFA 4KDYA 3UJ1A 2JADA 1V40A 2RIIA 4XIHA 1FO5A 1GSDA 5GZZB 2X4AA 3UVHA 4F0BA 1PKZA 2X8CA 2L5OA 5AIVA 3IXRA 2E2MA 2IMKA 1M7TA 13GSA 2FWHA 1T4ZA 4L8EA 1WIKA 1BJXA 3TCOA 2H8LA 5G31A 1U3IA 5ID2A 4O5UA 1XOBA 1XVQA 1LU4A 2C0GA 2HZFA 2LRCA 2R0PA 4DSQA 2H6XA 2YOIA 1GNWA 1YF1A 2QGVA 1T3BA 2C0DA 2CV4A 3RDWA 2H74A 2LQOA 3FW2A 1XVWA 4GQCA 1ERVA 5COHA 3D21A 2I81A 4IBPA 2KUCA 3PGTA 5IO0A 4WR5A 1HNCA 5CREA 3BJ5A 4PUFC 5H5QA 2DKHA 2DIZA 2EC4A 2BMXA 2C3NA 3IBHA 5DQYA 1A2MA 4JRRA 4TN8A 3SWLA 2OKAA 4MH3A 1A23A 1KNGA 4TOPA 2GT5A 1S3DA 4FYBA 4OD7A 4POKA 1XW6A 4X1UA 3DVWA 3LWAA 6GSTA 4OO5A 2REMA 2WZ9A 3IC8A 2HSMA 2X8HA 1JZWA 3TJBA 4NPBA 4F82A 2FWEA 3C73A 4BL7B 2A2PA 3VWXA 4TXOA 2V32A 4EUYA 4K7OA 3PPUA 3D4TA 3F6FA 2BTOT 3TKPA 5G2ZA 3DD3A 4EE0A 5AIXA 2MBTA 2H1BA 3QCPA 3A5WA 2H0GA 2WFCA 4G10A 2VLUA 3APQA 3ZVJA 4EF0A 2WDUA 3TJFA 1OC8A 2VCWA 2M80A 2H6YA 2VCZA 1SD8A 3HVXA 4MJBA 1G7EA 1XCCA 3EMPA 4F03A 2GVPA 4F9ZA 2HSHA 1YF0A 3VPTA 2GSRA 5G5FA 5B6MA 1XWAA 5KOXA 2GDRA 4LA1A 5DALB 3D5JA 4GLTA 1XOAA 3CTFA 1WWJA 7GSSA 2LUSA 2CVKA 3HZ8A 3MDKA 2G0FA 3MWHA 4KSOA 5F0GA 4IELA 4KNDA 2MMOA 1F3BA 3G7JA 4WXTA 4IQAA 1O81A 1GUKA 4NXIA 2P0GA 4CDOA 4HZ4A 1M9BA 3ZVJD 5IPGA 2IMIA 1RK4A 3F9UA 3TOUA 2DJ1A 4PUAA 2HRAA 4AF2A 1H4OA 1VRSD 3CSHA 3FMWA 4N0ZA 1DBYA 1USBA 4I8BA 3ZZXA 1O6JA 4EKZA 2KOKA 1AUCA 4HSCX 1JZRA 2HZEA 1YY7A 3E3EA 2H71A 2O85A 3NZNA 2TRXA 2P31A 3IDVA 2LSTA 1HNBA 4PNFA 2UZ8A 3ZFLA 1G0TA 3H8QA 4IW9A 5ABRA 2VOCA 3LYPA 6GSWA 3DEXA 3QAGA 1TOFA 4TR1A 1MD4A 4EVMA 1B9YC 2QA1A 1SENA 2K6VA 1WP0A 4HS1A 3RPNA 4KF9A 4V2MA 3L9VA 3F3QA 3TJKA 4RQRA 5EL8A 3ME7A 1Y6EA 2GSTA 5DCGA 3TRXA 4X0XA 2B6MA 1K0CA 4HQZA 2C3QA 3VURA 1EEMA 4Q5RA 3CBUA 1ON4A 2FUG2 3PH9A 4XTSA 2F8AA 14GSA 3P7XA 1Z3EA 4TW5A 2K9FA 4K9ZA 1FB6A 1SYRA 4XCSA 3O6TA 1G6YA 2OBIA 4ZL8A 1TJDA 3GSSA 4DSRA 1AXDA 4V2NA 1NSWA 5ECNB 1A0FA 3HXSA 4FH8A 5CNWA 3A2WA 1S3AA 6GSYA 1SKSB 2IMFA 5A4UA 3FZAA 2MZCA 2MMAA 3QFBC 2GS3A 4E8EA 2X99A 3F6DA 3A2XA 5INYA 3RAZA 4YAVA 3DYRA 2FD3A 4GSTA 4KDUA 2AV4A 2F8FA 5ECIB 2AJQB 1H75A 2RM5A 1GLQA 2ZUPA 3QAWA 3IPZA 3FR3A 2VM1A 2FWGA 1AQVA 2V6OA 3UBLA 4EC0A 4J57E 1KBNA 1V58A 4K8MA 3IHQA 4HI7A 2H1GA 2PU9C 2JL4A 3GKKA 1DSBA 3BBYA 4IGJA 2L6DA 2P5QA 1AIUA 5LCZA 5J4UA 4RQXA 4I2TA 2I3YA 3I69A 3FZ4A 1U3AA 1M9AA 3LEFA 8GSSA 1TRSA 2RM6A 2VL2C 2LV3A 4NAXA 3GA4A 2Z9SA 2X64A 4BL7A 4AJ6A 3MYDA 1FVJA 4K7NA 2H76A 3LGCA 3UOMA 1AC1A 5FT3A 3ZITA 4MCUA 1K3YA 2HRNA 4OWYA 2ZNMA 1TK0B 4TR4A 1YKCA 3CSJA 4ECJA 3EMXA 4K0NA 4L5LA 4ML1A 1GTBA 2XHFA 5J41A 3WGXA 3TGZA 3EINA 3H1NA 3L9UA 4IKHA 3TUEA 5DCHA 1I5GA 3ZMLA 2I4AA 4MJEA 2XBQA 3TB2A 4ZBAA 2CX4A 4HU9A 2C4JA 3FR6A 5DALA 1K3OA 3RPPA 3UL3A 3DIEA 1SL1B 4BWQA 5EY6A 5J3RA 3UVTA 2LEGA 4OCEA 1N2AA 2L59A 4ICYA 2HSYA 3I9V2 3GURA 3KJYA 3F4SA 3RHBA 4NV5A 3PINA 1XZOA 3D0ZA 1SK0A 2VCTA 2WJUA 4K6XA 1VF1A 1X5DA 4JU5A 4BVYB 3FYGA 5DQSA 4JE1A 2XC2A 1J9BA 1T1VA 4G0IA 2MYGA 2JSZA 1ZCPA 6GSVA 1QK8A 4ZBDA 1B4PA 3W8JA 2K18A 3IAS2 4BA7A 3I43A 4YQUA 3ZRDA 3A2VA 4HEA2 5D9XA 3CRTA 5IMFA 2CZ2A 2YN1A 3F63A 2E0QA 1EGRA 4ZL7A 3F4RA 4JR4A 4YQVA 2LRNA 2FHEA 3IK7A 1XW5A 1PX7A 3LORA 3IA1A 1CQGA 4BWSA 5A4VA 2YJ7A 5AGYA 5F07A 3IRAA 2AB6A 4L0UA 2YV9A 3P2AA 2C80A 3ISOA 4MJAA 1F6MC 2R5GA 4JR6A 4QL9A 1BG5A 1UN2A 1ZOFA 2J9HA 2QC7A 4MF6A 2CQ9A 3GSTA 5JWRB 1R26A 1F9MA 4YH2A 1DUGA 1JLWA 1HNAA 1TDIA 1J08A 3C1SA 3TJJA 4XS6A 1XWCA 4BPYA 1M2AA 2K8VA 2GTUA 1GNEA 3KH7A 4X43A 5FHIA 5IM9A 1R5PA 4CY6A 4Q5FA 5ELAA 3M9KA 1XIYA 2YV7A 3HCZA 2B7JA 5FWGA 3Q19A 3W6GA 2GSSA 5D73A 4HQSA 3GKXA 4MZBA 3GH6A 2DKIA 3CMIA 5ECHB 2OE0A 11GSA 3C8EA 5CRGA 1UC7A 5H5SA 2FCHA 2B1LA 3FRCA 4MABA 2B5XA 1JFUA 2RLIA 2GQLA 4I5QA 1YKAA 1THOA 4DEJA 2H0IA 3DMLA 3R2QA 1XBSA 5AISA 3D22A 5ECPB 2PPTA 2D2ZA 2IN3A 4ACSA 1QUWA 3NOFA 5HFKA 3Q6OA 1Z6MA 4O92A 4ZB6A 2F51A 1MEKA 1OKDA 3HJMA 3Q74A 2RUEA 3KD0A 3KZQA 4F2IA 1B4QA 1ABAA 3F4TA 2VLVA 3KTBA 4MPFA 19GSA 9GSSA 3WGDA 4I97A 2HRFA 4WETA 1K0AA 2IJYA 4QQ7A 5L71A 2GZPA 1M3JA 2GZZA 1OE7A 5IMVA 4FQUA 1FOHA 3BCKA 1TW9A 1GTAA 3KP8A 4V1Ag 1U6TA 4MJCA 2H0HA 4GWRA 1TI3A 4K5RA 3TKSA 3G7YA 4HJ2A 1SU9A 3UARA 5IMAA 4N30A 3TKRA 1X9SB 1MD3A 4J56E 2GT6A 2DSAA 1FB0A 3ZIVA 3S9FA 3ZMKA 5GAPD 1O8WA 4ZXGA 5EVOA 2ON7A 2OE1A 3UBKA 4IHUA 1R4WA 1EZKA 5G5EA 4USSA 3HJOA 1K3LA 1KEBA 4WF5A 5D9VA 1PKWA 1ZGNA 4WBJA 2E7PA 2H19A 1S3CA 4Q5NA 2XPDA 1V9WA 4K2XA 5ENUA 4MZWA 3GX8A 5HR3A 5BRTA 2L4CA 1A0RP 4V1Ap 1K0NA 2WB9A 2PN8A 4KH7A 2OADA 1NM3A 2FA4A 3HY2A 2MBSA 1AQWA 2FWFA 4IQ1A 2HYXA 3FZ9A 4MPGA 1FVKA 1M0UA 2KHPA 2IMDA 1X9MB 1TTZA 5IO2A 4OMVA 4EXJA 3QAVA 1Q98A 5JWQB 2B5EA 3RBTA 1O7UA 1BEDA 3D4MA 3HYPA 4YQMA 2VM2A 1A24A 2V1MA 5IMDA 4BVYA 3CRUA 4ZL9A 17GSA 4KE3A 4POLA 4MNNA 4OO4A 5DAKB 2TRCP 2WCIA 4LMWA 4ECBA 2AAWA 2B1KA 3DWVA 1IYHA 4IJ3A 3BOAA 1GSUA 1K0DA 1ST9A 2PVOC 5A5KA 4MK3A 3C1RA 4HU7A 4KW6A 1S3RA 1VF3A 3CTGA 3PR8A 1ZYNA 5D8IA 2CT6A 3H4KA 4I6XA 2YPMA 3N9JA 1TP9A 3CXGA 2HFDA 1T4YA 3MSZA 1MDKA 3EC3A 2HNLA 3IAM2 4G9HA 4XRAA 5G1KA 1I9DA 3GV1A 3HVSA 4YKGA 3GL3A 3KIJA 4EDYA 1YEXA 1GUHA 1V2AA 1SJZA 4CW9A 4PQ1A 1B48A 4MP4A 1LBKA 5E59A 3LFLA 2A4VA 5CO3A 2YJHA 3AY8A 2CX3A 4XS4B 3D6IA 2LS5A 1OKTA 1PN0A 1F2EA 3DXBA 4YKFA 1O8XA 3IR4A 3WT2A 1C72A 1WMJA 2GQMA 5C04A 2DBCA 1NW2A 1JHBA 2VCQA 4L0WA 1SL0B 3QDNA 4EIPA 6GSXA 1WPIA 1K0OA 1ACVA 1TRUA 3ERGA 2H6ZA 5B6NA 1ZL9A 5E4WA 2OE3A 1DE1A 3WD6A 3ZREA 2FGXA 1UA5A 3GYKA 2I9HA 3KXOA 2LKUA 5CYYA 4L5OA 2R4VA 5C00A 4PXOA 3QOUA 3VI7A 1A8YA 4JBBA 2N5AA 1Z6NA 3EE2A 2DMMA 3FR9A 1W4VA 1PQNA 2ALBA 2NDOA 1LJRA 2VAFA 2LRTA 2DMLA 3FK8A 4OCFA 1PFOA 4D73B 2G2QA 3LSZA 3ERWA 2E2GA 3LQ7A 1ZYPA 2WULA 2JU5A 1AQXA 4ECIA 3DRNA 1ZYEA 1G7OA 3CSIA 4N11A 1X9WB 4KSMA 1EP7A 4ECCA 1EV9A 3TRQA 3KP9A 5LD0A 4KB3A 1B8XA 3K8NA 2V6KA 2H1DA 1PGTA 2YANA 2AHEA 2EIRA 5LNKe 3P90A 4BVXB 2FY6A 2HLSA 2WS2A 1FG4A 1AAZA 4Z2RA 4POBA 1G6WA 3IE3A 2H01A 3EURA 3HVNA 3L78A 4NMUA 5B8BA 3KTLA 3EVIA 3U5RE 3HDCA 2VLTA 1AW9A 4G0KA 1OYJA 3TKSC 3J7Yb 3IOSA 2DJ2A 4OFTA 3MAKA 5ECKB 2DJ3A 1BX9A 3M3MA 3N5OA 4KGIA 3W8SA 1XFLA 5CRDA 1SKWB 5J9BA 1Q4JA 4Z7XA 4WBRD 4E8HA 2HE3A 3ZTLA 1M99A 3C7MA 3VWWA 5CRWA 3R3EA 2NTOA 1JZDA 4FYUA 3LXTA 3RHCA 5G30A 2A2RA 1MTCA 1FHEA 1N8JA 4PQIA 3UAPA 4K7IA 2VL3A 2O7KA 4GXZA 2C1YA 4PNGA 5DAKA 4IS0A 5ECMB 4IP6A 5DVBA 1TXXA 4F0CA 4KDXA 1HQOA 3GNJA 1ILOA 1OC3A 3TJGA 2GGTA 3H93A 1GULA 4KAEA 5IOXA 5J9CA 4HZ2A 4YAPA 4DVCA 16GSA 4N0VA 4GTUA 4MMMA 2HZEB 5HR2A 3F8UA 3I6AA 2VD1A 2DLXA 4J2FA 4CHSA 4KCEA 2KP1A 1E6BA 1SYXA 4MH2A 3VI5A 1SJ6A 4H86A 3QFAC 3APSA 3H79A 5HQPA 3A3TA 1ERUA 4EO3A 5KN1A 5F05A 4GSNA 2A4HA 2DJ0A 4MF5A 4PGTA 3EWLA 2H30A 3HVVA 4GSSA 3HKRA 2O89A 2B5YA 2BJXA 3E9JB 5DDLA 1T00A 3GKMA 5D93A 4O7HA 5HR0A 3TKQA 2MMZA 2CZ3A 4NWYA 1U87A 4XS4A 3ERFA 1OVNA 3ZYWA 3LJRA 1ZMAA 3KMOA 4G19A 3IV4A 4MF7A 4IN0A 2C3TA 4NV2A 3U6VA 3GTUB 1QGVA 2M72A 1NHOA 3GX0A 6GSUA 4P3YB 1V57A 1OC9B 2M46A 3E0UA 5KEJA 3KGKA 1WJKA 4FYCA 5D9TA 1X5EA 5GAND 2CAQA 3EU4A 2VIMA 1EV4A 5JCUA 2QKEA 3L4NA 1PN9A 4A5PA 1EOHA 2H73A 3HA9A 4XRDA 1YQ1A 2R37A 2CVBA 1GTUA 2P5RA 1SK1A 2JZSA 3NIVA 1WOUA 4LMVA 4FO5A 5A4WA 2YWIA 2JZTA 5DBQA 3ZLPA 2VL2A 3GMFA 5IMCA 1GSFA 1ZYQB 4D73A 2LJKA 4AJ8A 1SKRB 2L5LA 1XWBA 3GL5A 4QL7A 5GSSA 1TK8B 1O85A 3ZIJA 1K0BA 3HZ4A 1GRXA 3WT1A 4GQFA 1FW1A 2R2JA 1Z7PA 4OFNA 3VPQA 2AUVA 2IFQB 1THXA 3V1WA 4Z2TA 2PERA 4WR4A 3VLNA 1A8LA 4EL1A 2PUKC 1TU7A 2C0FA 2H72A 2IMEA 4IJIA 1X5CA 5ECSA 1VGLA 1TKDB 4K0GA 3M9JA 3DGQA 1NHYA 4MLYA 2VCXA 4BVXA 4WKWA 5KN0A 3M8NA 5D96A 1Z5YE 4WEYA 1MDIA 2NPBA 3JCML 4NHZA 2EIQA 1FOVA 5KOWA 1W89A 1PRXA 4ZB9A 1K0MA 2V2GA 5B7CA 2YZUA 4KUNA 1YDKA 5D9WA 1HYUA 1M2BA 3P8WA 5GSTA 4DSSB 1F3AA 3C71A 3APOA 4EIQA 5IIZA 1A2LA 1IYIA 4KX4A 3TKSE 5DJMA 2XPEA 5J5NA 2IIYA 4K5SA 1GSEA 2YWMA 4AGSA 2H75A 4BIKA 1A2JA 1VF4A 2KP2A 2YWOA 2A2SA 3VK9A 2L57A 2B3SA 2GLRA 1TRWA 4XHMA 2OA7A 1RW1A 2YZHA 1V98A 1U88A 3WYWA 3VWVA 2DIYA 2PWJA 4HUAA 1EGOA 4OFMA 2KLXA 2AYTA 2J23A 2GSQA 3IK9A 4I2UA 4O5RA
chains in the Genus database with same CATH topology
3DVXA 2N5BA 4GF0A 1Y25A 2R6KA 4ISDA 1BAYA 2R3XA 1F37A 2I1UA 4LL1B 4TR0A 3MNGA 3TDGA 3UEMA 3TOTA 2LNSA 2WRTA 5F8BA 2C0EA 3UMAA 3KEBA 2JSYA 1ERTA 2IWTA 4Q5QA 2CAIA 1SJIA 3KM6A 1DE2A 2TIRA 4HOJA 1GLPA 3ED3A 1YJ6A 4LLRA 2YCDA 5G1LA 1EP8A 1QQ2A 4MZCA 3G9BA 1QFNA 5IMZA 2VUPA 1QMVA 1M2DA 3Q18A 2MMNA 1X0RA 4JZQA 4TR3A 2EIOA 4PURA 1PA3A 2H1AA 2OJLA 5AN1A 5JCGA 4AJ7A 2IPAA 5IOWA 5EPFA 2H66A 5IQYA 3WGEA 1YEPA 3J7Yk 3GFKA 2ON5A 2F9SA 3GTUA 4JEDA 3KCMA 5HFIA 1GH2A 5ECRB 1OC9A 3OR5A 1KTEA 1Z7RA 2GQKA 1GP1A 4N10A 5JCWA 2PVQA 2RUFA 2B7KA 2H70A 3EU3A 1T7PB 2PMTA 3BCIA 3M1GA 3HHVA 4NHWA 5ECOB 3CYNA 2X49A 4MDCA 3GHAA 1PL1A 4HDEA 1ML6A 3O76A 5ID2B 2FA8A 20GSA 2X8GA 2JZRA 3DKSA 2VO4A 1ZZYA 4KCAA 1JZOA 3HD5A 5ECQB 1MDJA 4G2EA 1BYEA 1HD2A 3FHKA 5KN2A 4ZBBA 2WGRA 3LXZA 3LW9A 2CVDA 2IL3A 2VL9A 4WF4A 4K1FA 1BQ7A 1SK2A 2DJJA 2V41A 4ID0A 4POMA 1Z9HA 22GSA 1EOGA 3US3A 1GWCA 5CRHA 4K2DA 4CY8A 5BMUA 3GN3A 1TK5B 3FZ5A 2O87A 5B8AA 3SBCA 1QXHA 4TRXA 2IFQA 1R7HA 2PBJA 2PGTA 4V2LA 2JACA 3F3RA 2HRKA 5H5RA 3FEUA 1PSQA 1ERWA 3A5IA 4TXOB 3LYKA 1VF2A 1XWKA 5ELGA 1FAAA 1T8EB 2LJAA 4LL4B 4Z2UA 2VCVA 3ZFBA 3TRPA 4O5QA 4GCIA 4PX1A 2DJKA 1URMA 3G7IA 3MIXA 5HFGA 1E2YA 3KMNA 3M0FA 4MA9A 1GSSA 4DSSA 5JWOB 1PMTA 2QSIA 5IPHA 2QA2A 2VD0A 3GRXA 4EDZA 2F3MA 2XBIA 1TU8A 1SD9A 4FIWA 2LJRA 2GZYA 3EPTA 3BD2A 3QPMA 5F06A 4RI6A 1XW9A 4ULXA 1PX6A 2CA8A 4ZILA 2NBSA 2OACA 4TXVA 4PQHA 1GSQA 2NVLA 3LG6A 3GUSA 5CAXA 2ZCTA 2N5FA 2K8SA 2YNXA 3QR6A 5CP1A 1UVZA 18GSA 3IHGA 2HI7A 4ZB8A 10GSA 5ECLB 12GSA 3GIXA 3QMXA 2LNTA 1JLVA 1OE8A 3F0IA 4KA0A 2FLSA 2LQQA 6GSSA 1XPVA 3O3TA 2O8VB 1TRVA 1GL8A 4RI7A 3L0HA 3GKNA 4TKYA 3UIWA 1RQMA 1PL2A 2HXKA 2R0CA 2YWNA 1WRYA 4IP1A 2YP6A 2C8UA 2LTKA 3EYTA 1GUMA 1EWXA 3QD9A 4GRFA 1EEJA 3IC4A 5HR1A 1J0FA 4O32A 4ILFA 2OBKA 4PTSA 4ZIJA 3ME8A 1OAZA 1R5AA 2DC5A 2L4QA 3VFIA 1WE0A 3FY7A 3GH9A 1CQHA 1XWGA 3KH9A 4G0LA 2HT9A 4XS1A 2FNOA 3L9SA 4TR1B 1YZXA 1XXUA 1B9XC 1TI1A 3HJPA 4TVEA 1GSYA 3ZL5A 1SL2B 5KN3A 2R0GA 4HJMA 2ES7A 5DJLA 1O73A 1GTIA 3FKFA 2L6CA 3VWUA 1PD21 4ML6A 4RUVA 4X4JA 4IVFA 4KDYA 3UJ1A 2JADA 1V40A 2RIIA 4XIHA 1FO5A 1GSDA 5GZZB 2X4AA 3UVHA 4F0BA 1PKZA 2X8CA 2L5OA 5AIVA 3IXRA 2E2MA 2IMKA 1M7TA 13GSA 2FWHA 1T4ZA 4L8EA 1WIKA 1BJXA 3TCOA 2H8LA 5G31A 1U3IA 5ID2A 4O5UA 1XOBA 1XVQA 1LU4A 2C0GA 2HZFA 2LRCA 2R0PA 4DSQA 2H6XA 2YOIA 1GNWA 1YF1A 2QGVA 1T3BA 2C0DA 2CV4A 3RDWA 2H74A 2LQOA 3FW2A 1XVWA 4GQCA 1ERVA 5COHA 3D21A 2I81A 4IBPA 2KUCA 3PGTA 5IO0A 4WR5A 1HNCA 5CREA 3BJ5A 4PUFC 5H5QA 2DKHA 2DIZA 2EC4A 2BMXA 2C3NA 3IBHA 5DQYA 1A2MA 4JRRA 4TN8A 3SWLA 2OKAA 4MH3A 1A23A 1KNGA 4TOPA 2GT5A 1S3DA 4FYBA 4OD7A 4POKA 1XW6A 4X1UA 3DVWA 3LWAA 6GSTA 4OO5A 2REMA 2WZ9A 3IC8A 2HSMA 2X8HA 1JZWA 3TJBA 4NPBA 4F82A 2FWEA 3C73A 4BL7B 2A2PA 3VWXA 4TXOA 2V32A 4EUYA 4K7OA 3PPUA 3D4TA 3F6FA 2BTOT 3TKPA 5G2ZA 3DD3A 4EE0A 5AIXA 2MBTA 2H1BA 3QCPA 3A5WA 2H0GA 2WFCA 4G10A 2VLUA 3APQA 3ZVJA 4EF0A 2WDUA 3TJFA 1OC8A 2VCWA 2M80A 2H6YA 2VCZA 1SD8A 3HVXA 4MJBA 1G7EA 1XCCA 3EMPA 4F03A 2GVPA 4F9ZA 2HSHA 1YF0A 3VPTA 2GSRA 5G5FA 5B6MA 1XWAA 5KOXA 2GDRA 4LA1A 5DALB 3D5JA 4GLTA 1XOAA 3CTFA 1WWJA 7GSSA 2LUSA 2CVKA 3HZ8A 3MDKA 2G0FA 3MWHA 4KSOA 5F0GA 4IELA 4KNDA 2MMOA 1F3BA 3G7JA 4WXTA 4IQAA 1O81A 1GUKA 4NXIA 2P0GA 4CDOA 4HZ4A 1M9BA 3ZVJD 5IPGA 2IMIA 1RK4A 3F9UA 3TOUA 2DJ1A 4PUAA 2HRAA 4AF2A 1H4OA 1VRSD 3CSHA 3FMWA 4N0ZA 1DBYA 1USBA 4I8BA 3ZZXA 1O6JA 4EKZA 2KOKA 1AUCA 1JZRA 2HZEA 1YY7A 3E3EA 2H71A 2O85A 3NZNA 2TRXA 2P31A 3IDVA 2LSTA 1HNBA 4PNFA 2UZ8A 3ZFLA 1G0TA 3H8QA 4IW9A 5ABRA 2VOCA 3LYPA 6GSWA 3DEXA 3QAGA 1TOFA 4TR1A 1MD4A 4EVMA 1B9YC 2QA1A 1SENA 2K6VA 1WP0A 4HS1A 3RPNA 4KF9A 4V2MA 3L9VA 3F3QA 3TJKA 4RQRA 5EL8A 3ME7A 1Y6EA 2GSTA 5DCGA 3TRXA 4X0XA 2B6MA 1K0CA 4HQZA 2C3QA 3VURA 1EEMA 4Q5RA 3CBUA 1ON4A 2FUG2 3PH9A 4XTSA 2F8AA 14GSA 3P7XA 1Z3EA 4TW5A 2K9FA 4K9ZA 1FB6A 1SYRA 4XCSA 3O6TA 1G6YA 2OBIA 4ZL8A 1TJDA 3GSSA 4DSRA 1AXDA 4V2NA 1NSWA 5ECNB 1A0FA 3HXSA 4FH8A 5CNWA 3A2WA 1S3AA 6GSYA 1SKSB 2IMFA 5A4UA 3FZAA 2MZCA 2MMAA 3QFBC 2GS3A 4E8EA 2X99A 3F6DA 3A2XA 5INYA 3RAZA 4YAVA 3DYRA 2FD3A 4GSTA 4KDUA 2AV4A 2F8FA 5ECIB 2AJQB 1H75A 2RM5A 1GLQA 2ZUPA 3QAWA 3IPZA 3FR3A 2VM1A 2FWGA 1AQVA 2V6OA 3UBLA 4EC0A 4J57E 1KBNA 1V58A 4K8MA 3IHQA 4HI7A 2H1GA 2PU9C 2JL4A 3GKKA 1DSBA 3BBYA 4IGJA 2L6DA 2P5QA 1AIUA 5LCZA 5J4UA 4RQXA 4I2TA 2I3YA 3I69A 3FZ4A 1U3AA 1M9AA 3LEFA 8GSSA 1TRSA 2RM6A 2VL2C 2LV3A 4NAXA 3GA4A 2Z9SA 2X64A 4BL7A 4AJ6A 3MYDA 1FVJA 4K7NA 2H76A 3LGCA 3UOMA 1AC1A 5FT3A 3ZITA 4MCUA 1K3YA 2HRNA 4OWYA 2ZNMA 1TK0B 4TR4A 1YKCA 3CSJA 4ECJA 3EMXA 4K0NA 4L5LA 4ML1A 1GTBA 2XHFA 5J41A 3WGXA 3TGZA 3EINA 3H1NA 3L9UA 4IKHA 3TUEA 5DCHA 1I5GA 3ZMLA 2I4AA 4MJEA 2XBQA 3TB2A 4ZBAA 2CX4A 4HU9A 2C4JA 3FR6A 5DALA 1K3OA 3RPPA 3UL3A 3DIEA 1SL1B 4BWQA 5EY6A 5J3RA 3UVTA 2LEGA 4OCEA 1N2AA 2L59A 4ICYA 2HSYA 3I9V2 3GURA 3KJYA 3F4SA 3RHBA 4NV5A 3PINA 1XZOA 3D0ZA 1SK0A 2VCTA 2WJUA 4K6XA 1VF1A 1X5DA 4JU5A 4BVYB 3FYGA 5DQSA 4JE1A 2XC2A 1J9BA 1T1VA 4G0IA 2MYGA 2JSZA 1ZCPA 6GSVA 1QK8A 4ZBDA 1B4PA 3W8JA 2K18A 3IAS2 4BA7A 3I43A 4YQUA 3ZRDA 3A2VA 4HEA2 5D9XA 3CRTA 5IMFA 2CZ2A 2YN1A 3F63A 2E0QA 1EGRA 4ZL7A 3F4RA 4JR4A 4YQVA 2LRNA 2FHEA 3IK7A 1XW5A 1PX7A 3LORA 3IA1A 1CQGA 4BWSA 5A4VA 2YJ7A 5AGYA 5F07A 3IRAA 2AB6A 4L0UA 2YV9A 3P2AA 2C80A 3ISOA 4MJAA 1F6MC 2R5GA 4JR6A 4QL9A 1BG5A 1UN2A 1ZOFA 2J9HA 2QC7A 4MF6A 2CQ9A 3GSTA 5JWRB 1R26A 1F9MA 4YH2A 1DUGA 1JLWA 1HNAA 1TDIA 1J08A 3C1SA 3TJJA 4XS6A 1XWCA 4BPYA 1M2AA 2K8VA 2GTUA 1GNEA 3KH7A 4X43A 5FHIA 5IM9A 1R5PA 4CY6A 4Q5FA 5ELAA 3M9KA 1XIYA 2YV7A 3HCZA 2B7JA 5FWGA 3Q19A 3W6GA 2GSSA 5D73A 4HQSA 3GKXA 4MZBA 3GH6A 2DKIA 3CMIA 5ECHB 2OE0A 11GSA 3C8EA 5CRGA 1UC7A 5H5SA 2FCHA 2B1LA 3FRCA 4MABA 2B5XA 1JFUA 2RLIA 2GQLA 4I5QA 1YKAA 1THOA 4DEJA 2H0IA 3DMLA 3R2QA 1XBSA 5AISA 3D22A 5ECPB 2PPTA 2D2ZA 2IN3A 4ACSA 1QUWA 3NOFA 5HFKA 3Q6OA 1Z6MA 4O92A 4ZB6A 2F51A 1MEKA 1OKDA 3HJMA 3Q74A 2RUEA 3KD0A 3KZQA 4F2IA 1B4QA 1ABAA 3F4TA 2VLVA 3KTBA 4MPFA 19GSA 9GSSA 3WGDA 4I97A 2HRFA 4WETA 1K0AA 2IJYA 4QQ7A 5L71A 2GZPA 2GZZA 1OE7A 5IMVA 4FQUA 1FOHA 3BCKA 1TW9A 1GTAA 3KP8A 4V1Ag 1U6TA 4MJCA 2H0HA 4GWRA 1TI3A 4K5RA 3TKSA 3G7YA 4HJ2A 1SU9A 3UARA 5IMAA 4N30A 3TKRA 1X9SB 1MD3A 4J56E 2GT6A 2DSAA 1FB0A 3ZIVA 3S9FA 3ZMKA 5GAPD 1O8WA 4ZXGA 5EVOA 2ON7A 2OE1A 3UBKA 4IHUA 1R4WA 1EZKA 5G5EA 4USSA 3HJOA 1K3LA 1KEBA 4WF5A 5D9VA 1PKWA 1ZGNA 4WBJA 2E7PA 2H19A 1S3CA 4Q5NA 2XPDA 1V9WA 4K2XA 5ENUA 4MZWA 3GX8A 5HR3A 5BRTA 2L4CA 1A0RP 4V1Ap 1K0NA 2WB9A 2PN8A 4KH7A 2OADA 1NM3A 2FA4A 3HY2A 2MBSA 1AQWA 2FWFA 4IQ1A 2HYXA 3FZ9A 4MPGA 1FVKA 1M0UA 2KHPA 2IMDA 1X9MB 1TTZA 5IO2A 4OMVA 4EXJA 3QAVA 1Q98A 5JWQB 2B5EA 3RBTA 1O7UA 1BEDA 3D4MA 3HYPA 4YQMA 2VM2A 1A24A 2V1MA 5IMDA 4BVYA 3CRUA 4ZL9A 17GSA 4KE3A 4POLA 4MNNA 4OO4A 5DAKB 2TRCP 2WCIA 4LMWA 4ECBA 2AAWA 2B1KA 3DWVA 1IYHA 4IJ3A 3BOAA 1GSUA 1K0DA 1ST9A 2PVOC 5A5KA 4MK3A 3C1RA 4HU7A 4KW6A 3PR8A 1VF3A 3CTGA 1ZYNA 5D8IA 2CT6A 3H4KA 4I6XA 2YPMA 3N9JA 1TP9A 3CXGA 2HFDA 1T4YA 3MSZA 1MDKA 3EC3A 2HNLA 3IAM2 4G9HA 4XRAA 5G1KA 1I9DA 3GV1A 3HVSA 4YKGA 3GL3A 3KIJA 4EDYA 1YEXA 1GUHA 1V2AA 1SJZA 4CW9A 4PQ1A 1B48A 4MP4A 1LBKA 5E59A 3LFLA 2A4VA 5CO3A 2YJHA 3AY8A 2CX3A 4XS4B 3D6IA 2LS5A 1OKTA 1PN0A 1F2EA 3DXBA 4YKFA 1O8XA 3IR4A 3WT2A 1C72A 1WMJA 2GQMA 5C04A 2DBCA 1NW2A 1JHBA 2VCQA 4L0WA 1SL0B 3QDNA 4EIPA 6GSXA 1WPIA 1K0OA 1ACVA 1TRUA 3ERGA 2H6ZA 5B6NA 1ZL9A 5E4WA 2OE3A 1DE1A 3WD6A 3ZREA 2FGXA 1UA5A 3GYKA 2I9HA 3KXOA 2LKUA 5CYYA 4L5OA 2R4VA 5C00A 4PXOA 3QOUA 3VI7A 1A8YA 4JBBA 2N5AA 1Z6NA 3EE2A 2DMMA 3FR9A 1W4VA 1PQNA 2ALBA 2NDOA 1LJRA 2VAFA 2LRTA 2DMLA 3FK8A 4OCFA 4D73B 2G2QA 3LSZA 3ERWA 2E2GA 3LQ7A 1ZYPA 2WULA 2JU5A 1AQXA 4ECIA 3DRNA 1ZYEA 1G7OA 3CSIA 4N11A 1X9WB 4KSMA 1EP7A 4ECCA 1EV9A 3TRQA 3KP9A 5LD0A 4KB3A 1B8XA 3K8NA 2V6KA 2H1DA 1PGTA 2YANA 2AHEA 2EIRA 5LNKe 3P90A 4BVXB 2FY6A 2HLSA 2WS2A 1FG4A 1AAZA 4Z2RA 4POBA 1G6WA 3IE3A 2H01A 3EURA 3L78A 4NMUA 5B8BA 3KTLA 3EVIA 3U5RE 3HDCA 2VLTA 1AW9A 4G0KA 1OYJA 3TKSC 3J7Yb 3IOSA 2DJ2A 4OFTA 3MAKA 5ECKB 2DJ3A 1BX9A 3M3MA 3N5OA 4KGIA 3W8SA 1XFLA 5CRDA 1SKWB 5J9BA 1Q4JA 4Z7XA 4WBRD 4E8HA 2HE3A 3ZTLA 1M99A 3C7MA 3VWWA 5CRWA 3R3EA 2NTOA 1JZDA 4FYUA 3LXTA 3RHCA 5G30A 2A2RA 1MTCA 1FHEA 1N8JA 4PQIA 3UAPA 4K7IA 2VL3A 2O7KA 4GXZA 2C1YA 4PNGA 5DAKA 4IS0A 5ECMB 4IP6A 5DVBA 1TXXA 4F0CA 4KDXA 1HQOA 3GNJA 1ILOA 1OC3A 3TJGA 2GGTA 3H93A 1GULA 4KAEA 5IOXA 5J9CA 4HZ2A 4YAPA 4DVCA 16GSA 4N0VA 4GTUA 4MMMA 2HZEB 5HR2A 3F8UA 3I6AA 2VD1A 2DLXA 4J2FA 4CHSA 4KCEA 2KP1A 1E6BA 1SYXA 4MH2A 3VI5A 1SJ6A 4H86A 3QFAC 3APSA 3H79A 5HQPA 3A3TA 1ERUA 4EO3A 5KN1A 5F05A 4GSNA 2A4HA 2DJ0A 4MF5A 4PGTA 3EWLA 2H30A 3HVVA 4GSSA 3HKRA 2O89A 2B5YA 2BJXA 3E9JB 5DDLA 1T00A 3GKMA 5D93A 4O7HA 5HR0A 3TKQA 2MMZA 2CZ3A 4NWYA 1U87A 4XS4A 3ERFA 1OVNA 3ZYWA 3LJRA 1ZMAA 3KMOA 4G19A 3IV4A 4MF7A 4IN0A 2C3TA 4NV2A 3U6VA 3GTUB 1QGVA 2M72A 1NHOA 3GX0A 6GSUA 4P3YB 1V57A 1OC9B 2M46A 3E0UA 5KEJA 3KGKA 1WJKA 4FYCA 5D9TA 1X5EA 5GAND 2CAQA 3EU4A 2VIMA 1EV4A 5JCUA 2QKEA 3L4NA 1PN9A 4A5PA 1EOHA 2H73A 3HA9A 4XRDA 1YQ1A 2R37A 2CVBA 1GTUA 2P5RA 1SK1A 2JZSA 3NIVA 1WOUA 4LMVA 4FO5A 5A4WA 2YWIA 2JZTA 5DBQA 3ZLPA 2VL2A 3GMFA 5IMCA 1GSFA 1ZYQB 4D73A 2LJKA 4AJ8A 1SKRB 2L5LA 1XWBA 3GL5A 4QL7A 5GSSA 1TK8B 1O85A 3ZIJA 1K0BA 3HZ4A 1GRXA 3WT1A 4GQFA 1FW1A 2R2JA 1Z7PA 4OFNA 3VPQA 2AUVA 2IFQB 1THXA 3V1WA 4Z2TA 2PERA 4WR4A 3VLNA 1A8LA 4EL1A 2PUKC 1TU7A 2C0FA 2H72A 2IMEA 4IJIA 1X5CA 5ECSA 1VGLA 1TKDB 4K0GA 3M9JA 3DGQA 1NHYA 4MLYA 2VCXA 4BVXA 4WKWA 5KN0A 3M8NA 5D96A 1Z5YE 4WEYA 1MDIA 2NPBA 3JCML 4NHZA 2EIQA 1FOVA 5KOWA 1W89A 1PRXA 4ZB9A 1K0MA 2V2GA 5B7CA 2YZUA 4KUNA 1YDKA 5D9WA 1HYUA 1M2BA 3P8WA 5GSTA 4DSSB 1F3AA 3C71A 3APOA 4EIQA 5IIZA 1A2LA 1IYIA 4KX4A 3TKSE 5DJMA 2XPEA 5J5NA 2IIYA 4K5SA 1GSEA 2YWMA 4AGSA 2H75A 1A2JA 1VF4A 2KP2A 2YWOA 2A2SA 3VK9A 2L57A 2B3SA 2GLRA 1TRWA 4XHMA 2OA7A 1RW1A 2YZHA 1V98A 1U88A 3WYWA 3VWVA 2DIYA 2PWJA 4HUAA 1EGOA 4OFMA 2KLXA 2AYTA 2J23A 2GSQA 3IK9A 4I2UA 4O5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DVX A;  2N5B A;  4GF0 A;  1Y25 A;  2R6K A;  4ISD A;  1BAY A;  2R3X A;  1F37 A;  2I1U A;  4LL1 B;  4TR0 A;  3MNG A;  3TDG A;  3UEM A;  3TOT A;  2LNS A;  2WRT A;  5F8B A;  2C0E A;  3UMA A;  3KEB A;  2JSY A;  1ERT A;  2IWT A;  4Q5Q A;  2CAI A;  1SJI A;  3KM6 A;  1DE2 A;  2TIR A;  4HOJ A;  1GLP A;  3ED3 A;  1YJ6 A;  4LLR A;  2YCD A;  5G1L A;  1EP8 A;  1QQ2 A;  4MZC A;  3G9B A;  1QFN A;  5IMZ A;  2VUP A;  1QMV A;  1M2D A;  3Q18 A;  2MMN A;  1X0R A;  4JZQ A;  4TR3 A;  2EIO A;  4PUR A;  1PA3 A;  2H1A A;  2OJL A;  5AN1 A;  5JCG A;  4AJ7 A;  2IPA A;  5IOW A;  5EPF A;  2H66 A;  5IQY A;  3WGE A;  1YEP A;  3J7Y k;  3GFK A;  2ON5 A;  2F9S A;  3GTU A;  4JED A;  3KCM A;  5HFI A;  1GH2 A;  5ECR B;  1OC9 A;  3OR5 A;  1KTE A;  1Z7R A;  2GQK A;  1GP1 A;  4N10 A;  5JCW A;  2PVQ A;  2RUF A;  2B7K A;  2H70 A;  3EU3 A;  1T7P B;  2PMT A;  3BCI A;  3M1G A;  3HHV A;  4NHW A;  5ECO B;  3CYN A;  4MDC A;  3GHA A;  1PL1 A;  4HDE A;  1ML6 A;  3O76 A;  5ID2 B;  2FA8 A;  20GS A;  2X8G A;  2JZR A;  3DKS A;  2VO4 A;  1ZZY A;  4KCA A;  1JZO A;  3HD5 A;  5ECQ B;  1MDJ A;  4G2E A;  1BYE A;  1HD2 A;  3FHK A;  5KN2 A;  4ZBB A;  2WGR A;  3LXZ A;  2CVD A;  2IL3 A;  2VL9 A;  4WF4 A;  4K1F A;  1BQ7 A;  1SK2 A;  2DJJ A;  2V41 A;  4ID0 A;  4POM A;  1Z9H A;  22GS A;  1EOG A;  3US3 A;  1GWC A;  5CRH A;  4K2D A;  3GN3 A;  1TK5 B;  3FZ5 A;  2O87 A;  5B8A A;  3SBC A;  1QXH A;  4TRX A;  2IFQ A;  1R7H A;  2PBJ A;  2PGT A;  4V2L A;  2JAC A;  3F3R A;  5H5R A;  3FEU A;  1PSQ A;  1ERW A;  4TXO B;  3LYK A;  1VF2 A;  1XWK A;  5ELG A;  1FAA A;  1T8E B;  2LJA A;  4LL4 B;  2VCV A;  3ZFB A;  3TRP A;  4GCI A;  4PX1 A;  2DJK A;  1URM A;  3G7I A;  5HFG A;  1E2Y A;  3KMN A;  3M0F A;  4MA9 A;  1GSS A;  4DSS A;  5JWO B;  1PMT A;  2QSI A;  5IPH A;  2VD0 A;  3GRX A;  4EDZ A;  2F3M A;  2XBI A;  1TU8 A;  1SD9 A;  4FIW A;  2LJR A;  2GZY A;  3BD2 A;  3QPM A;  5F06 A;  4RI6 A;  1XW9 A;  4ULX A;  1PX6 A;  2CA8 A;  4ZIL A;  2NBS A;  2OAC A;  4TXV A;  4PQH A;  1GSQ A;  2NVL A;  3LG6 A;  3GUS A;  5CAX A;  2ZCT A;  2N5F A;  2K8S A;  2YNX A;  3QR6 A;  5CP1 A;  1UVZ A;  18GS A;  2HI7 A;  4ZB8 A;  10GS A;  5ECL B;  12GS A;  3GIX A;  3QMX A;  2LNT A;  1JLV A;  1OE8 A;  3F0I A;  4KA0 A;  2FLS A;  2LQQ A;  6GSS A;  1XPV A;  3O3T A;  2O8V B;  1TRV A;  1GL8 A;  4RI7 A;  3L0H A;  3GKN A;  4TKY A;  3UIW A;  1RQM A;  1PL2 A;  2HXK A;  2YWN A;  1WRY A;  4IP1 A;  2YP6 A;  2C8U A;  2LTK A;  3EYT A;  1GUM A;  1EWX A;  3QD9 A;  4GRF A;  1EEJ A;  3IC4 A;  5HR1 A;  1J0F A;  4O32 A;  4ILF A;  2OBK A;  4ZIJ A;  3ME8 A;  1OAZ A;  1R5A A;  2DC5 A;  2L4Q A;  3VFI A;  1WE0 A;  3FY7 A;  3GH9 A;  1CQH A;  1XWG A;  3KH9 A;  2HT9 A;  4XS1 A;  2FNO A;  3L9S A;  4TR1 B;  1YZX A;  1XXU A;  1B9X C;  1TI1 A;  3HJP A;  4TVE A;  1GSY A;  3ZL5 A;  1SL2 B;  5KN3 A;  4HJM A;  2ES7 A;  5DJL A;  1O73 A;  1GTI A;  3FKF A;  2L6C A;  3VWU A;  1PD2 1;  4ML6 A;  4RUV A;  4IVF A;  4KDY A;  3UJ1 A;  2JAD A;  1V40 A;  2RII A;  4XIH A;  1FO5 A;  1GSD A;  5GZZ B;  4F0B A;  3UVH A;  1PKZ A;  2X8C A;  2L5O A;  5AIV A;  3IXR A;  2E2M A;  2IMK A;  1M7T A;  13GS A;  2FWH A;  1T4Z A;  4L8E A;  1WIK A;  1BJX A;  3TCO A;  2H8L A;  5G31 A;  1U3I A;  5ID2 A;  1XOB A;  1XVQ A;  1LU4 A;  2C0G A;  2HZF A;  2LRC A;  4DSQ A;  2H6X A;  2YOI A;  1GNW A;  1YF1 A;  2QGV A;  1T3B A;  2C0D A;  2CV4 A;  3RDW A;  2H74 A;  2LQO A;  3FW2 A;  1XVW A;  4GQC A;  1ERV A;  5COH A;  3D21 A;  2I81 A;  4IBP A;  2KUC A;  3PGT A;  5IO0 A;  4WR5 A;  1HNC A;  5CRE A;  3BJ5 A;  4PUF C;  5H5Q A;  2DIZ A;  2EC4 A;  2BMX A;  2C3N A;  3IBH A;  5DQY A;  1A2M A;  4JRR A;  4TN8 A;  3SWL A;  2OKA A;  4MH3 A;  1A23 A;  1KNG A;  4TOP A;  2GT5 A;  1S3D A;  4FYB A;  4OD7 A;  4POK A;  1XW6 A;  4X1U A;  3DVW A;  3LWA A;  6GST A;  4OO5 A;  2REM A;  2WZ9 A;  2X8H A;  1JZW A;  3TJB A;  4NPB A;  4F82 A;  2FWE A;  3C73 A;  3VWX A;  4TXO A;  2V32 A;  4EUY A;  4K7O A;  3D4T A;  3F6F A;  2BTO T;  3TKP A;  5G2Z A;  3DD3 A;  4EE0 A;  5AIX A;  2MBT A;  2H1B A;  3QCP A;  3A5W A;  2H0G A;  2WFC A;  4G10 A;  2VLU A;  3APQ A;  3ZVJ A;  4EF0 A;  2WDU A;  3TJF A;  1OC8 A;  2VCW A;  2M80 A;  2H6Y A;  2VCZ A;  1SD8 A;  3HVX A;  4MJB A;  1G7E A;  1XCC A;  3EMP A;  4F03 A;  2GVP A;  4F9Z A;  2HSH A;  1YF0 A;  3VPT A;  2GSR A;  5G5F A;  5B6M A;  1XWA A;  2GDR A;  4LA1 A;  5DAL B;  3D5J A;  4GLT A;  1XOA A;  3CTF A;  1WWJ A;  7GSS A;  2LUS A;  2CVK A;  3HZ8 A;  3MDK A;  2G0F A;  3MWH A;  4KSO A;  5F0G A;  4IEL A;  4KND A;  2MMO A;  1F3B A;  3G7J A;  4WXT A;  4IQA A;  1O81 A;  1GUK A;  4NXI A;  2P0G A;  4CDO A;  4HZ4 A;  1M9B A;  3ZVJ D;  5IPG A;  2IMI A;  1RK4 A;  3F9U A;  3TOU A;  2DJ1 A;  4PUA A;  4AF2 A;  1H4O A;  1VRS D;  3CSH A;  4N0Z A;  1DBY A;  1USB A;  4I8B A;  3ZZX A;  1O6J A;  4EKZ A;  2KOK A;  1AUC A;  1JZR A;  2HZE A;  1YY7 A;  3E3E A;  2H71 A;  2O85 A;  3NZN A;  2TRX A;  2P31 A;  3IDV A;  2LST A;  1HNB A;  4PNF A;  3ZFL A;  1G0T A;  3H8Q A;  4IW9 A;  5ABR A;  2VOC A;  3LYP A;  6GSW A;  3DEX A;  3QAG A;  1TOF A;  4TR1 A;  1MD4 A;  4EVM A;  1B9Y C;  1SEN A;  2K6V A;  1WP0 A;  4HS1 A;  3RPN A;  4V2M A;  3L9V A;  3F3Q A;  3TJK A;  4RQR A;  5EL8 A;  3ME7 A;  1Y6E A;  2GST A;  5DCG A;  3TRX A;  4X0X A;  2B6M A;  1K0C A;  4HQZ A;  2C3Q A;  3VUR A;  1EEM A;  4Q5R A;  3CBU A;  1ON4 A;  2FUG 2;  3PH9 A;  4XTS A;  2F8A A;  14GS A;  3P7X A;  1Z3E A;  4TW5 A;  2K9F A;  4K9Z A;  1FB6 A;  1SYR A;  4XCS A;  3O6T A;  1G6Y A;  2OBI A;  4ZL8 A;  1TJD A;  3GSS A;  4DSR A;  1AXD A;  4V2N A;  1NSW A;  5ECN B;  1A0F A;  3HXS A;  4FH8 A;  5CNW A;  3A2W A;  1S3A A;  6GSY A;  1SKS B;  2IMF A;  5A4U A;  3FZA A;  2MZC A;  2MMA A;  3QFB C;  2GS3 A;  4E8E A;  2X99 A;  3F6D A;  3A2X A;  5INY A;  3RAZ A;  4YAV A;  3DYR A;  2FD3 A;  4GST A;  4KDU A;  2AV4 A;  2F8F A;  5ECI B;  2AJQ B;  1H75 A;  2RM5 A;  1GLQ A;  2ZUP A;  3QAW A;  3IPZ A;  3FR3 A;  2VM1 A;  2FWG A;  1AQV A;  2V6O A;  3UBL A;  4EC0 A;  4J57 E;  1KBN A;  1V58 A;  4K8M A;  3IHQ A;  4HI7 A;  2H1G A;  2PU9 C;  2JL4 A;  3GKK A;  1DSB A;  3BBY A;  4IGJ A;  2L6D A;  2P5Q A;  1AIU A;  5LCZ A;  5J4U A;  4RQX A;  4I2T A;  2I3Y A;  3I69 A;  3FZ4 A;  1U3A A;  1M9A A;  3LEF A;  8GSS A;  1TRS A;  2RM6 A;  2VL2 C;  2LV3 A;  4NAX A;  3GA4 A;  2Z9S A;  2X64 A;  4BL7 A;  4AJ6 A;  1FVJ A;  4K7N A;  2H76 A;  3LGC A;  3UOM A;  1AC1 A;  5FT3 A;  3ZIT A;  4MCU A;  1K3Y A;  2HRN A;  4OWY A;  2ZNM A;  1TK0 B;  4TR4 A;  1YKC A;  3CSJ A;  4ECJ A;  3EMX A;  4K0N A;  4L5L A;  4ML1 A;  1GTB A;  2XHF A;  5J41 A;  3WGX A;  3TGZ A;  3EIN A;  3H1N A;  3L9U A;  4IKH A;  3TUE A;  5DCH A;  1I5G A;  3ZML A;  2I4A A;  4MJE A;  2XBQ A;  3TB2 A;  4ZBA A;  2CX4 A;  4HU9 A;  2C4J A;  3FR6 A;  5DAL A;  1K3O A;  3RPP A;  3UL3 A;  3DIE A;  1SL1 B;  4BWQ A;  5EY6 A;  5J3R A;  3UVT A;  2LEG A;  4OCE A;  1N2A A;  2L59 A;  2HSY A;  3I9V 2;  3GUR A;  3KJY A;  3F4S A;  3RHB A;  4NV5 A;  3PIN A;  1XZO A;  3D0Z A;  1SK0 A;  2VCT A;  2WJU A;  4K6X A;  1VF1 A;  1X5D A;  4JU5 A;  3FYG A;  5DQS A;  4JE1 A;  2XC2 A;  1J9B A;  1T1V A;  2MYG A;  2JSZ A;  1ZCP A;  6GSV A;  1QK8 A;  4ZBD A;  1B4P A;  3W8J A;  2K18 A;  3IAS 2;  4BA7 A;  3I43 A;  4YQU A;  3ZRD A;  3A2V A;  4HEA 2;  5D9X A;  3CRT A;  5IMF A;  2CZ2 A;  2YN1 A;  3F63 A;  2E0Q A;  1EGR A;  4ZL7 A;  3F4R A;  4JR4 A;  4YQV A;  2LRN A;  2FHE A;  3IK7 A;  1XW5 A;  1PX7 A;  3LOR A;  3IA1 A;  1CQG A;  4BWS A;  5A4V A;  2YJ7 A;  5AGY A;  5F07 A;  3IRA A;  2AB6 A;  4L0U A;  2YV9 A;  3P2A A;  2C80 A;  3ISO A;  4MJA A;  1F6M C;  2R5G A;  4JR6 A;  4QL9 A;  1BG5 A;  1UN2 A;  1ZOF A;  2J9H A;  2QC7 A;  4MF6 A;  2CQ9 A;  3GST A;  5JWR B;  1R26 A;  1F9M A;  4YH2 A;  1DUG A;  1JLW A;  1HNA A;  1TDI A;  1J08 A;  3C1S A;  3TJJ A;  4XS6 A;  1XWC A;  4BPY A;  1M2A A;  2K8V A;  2GTU A;  1GNE A;  3KH7 A;  4X43 A;  5FHI A;  5IM9 A;  1R5P A;  4Q5F A;  5ELA A;  3M9K A;  1XIY A;  2YV7 A;  3HCZ A;  2B7J A;  5FWG A;  3Q19 A;  3W6G A;  2GSS A;  5D73 A;  4HQS A;  3GKX A;  4MZB A;  3GH6 A;  3CMI A;  5ECH B;  2OE0 A;  11GS A;  3C8E A;  5CRG A;  1UC7 A;  5H5S A;  2FCH A;  2B1L A;  3FRC A;  4MAB A;  2B5X A;  1JFU A;  2RLI A;  2GQL A;  4I5Q A;  1YKA A;  1THO A;  4DEJ A;  2H0I A;  3DML A;  3R2Q A;  1XBS A;  5AIS A;  3D22 A;  5ECP B;  2PPT A;  2D2Z A;  2IN3 A;  4ACS A;  1QUW A;  3NOF A;  5HFK A;  3Q6O A;  1Z6M A;  4O92 A;  4ZB6 A;  2F51 A;  1MEK A;  1OKD A;  3HJM A;  3Q74 A;  2RUE A;  3KD0 A;  3KZQ A;  4F2I A;  1B4Q A;  1ABA A;  3F4T A;  2VLV A;  3KTB A;  4MPF A;  19GS A;  9GSS A;  3WGD A;  4I97 A;  2HRF A;  4WET A;  1K0A A;  2IJY A;  4QQ7 A;  5L71 A;  2GZP A;  2GZZ A;  1OE7 A;  5IMV A;  3BCK A;  1TW9 A;  1GTA A;  3KP8 A;  4V1A g;  1U6T A;  4MJC A;  2H0H A;  4GWR A;  1TI3 A;  3TKS A;  3G7Y A;  4HJ2 A;  1SU9 A;  3UAR A;  5IMA A;  4N30 A;  3TKR A;  1X9S B;  1MD3 A;  4J56 E;  2GT6 A;  2DSA A;  1FB0 A;  3ZIV A;  3S9F A;  3ZMK A;  5GAP D;  1O8W A;  4ZXG A;  5EVO A;  2ON7 A;  2OE1 A;  3UBK A;  4IHU A;  1R4W A;  1EZK A;  5G5E A;  3HJO A;  1K3L A;  1KEB A;  4WF5 A;  5D9V A;  1PKW A;  1ZGN A;  4WBJ A;  2E7P A;  2H19 A;  1S3C A;  4Q5N A;  2XPD A;  1V9W A;  5ENU A;  4MZW A;  3GX8 A;  5HR3 A;  2L4C A;  1A0R P;  4V1A p;  1K0N A;  2WB9 A;  2PN8 A;  4KH7 A;  2OAD A;  1NM3 A;  2FA4 A;  3HY2 A;  2MBS A;  1AQW A;  2FWF A;  4IQ1 A;  2HYX A;  3FZ9 A;  4MPG A;  1FVK A;  1M0U A;  2KHP A;  2IMD A;  1X9M B;  1TTZ A;  5IO2 A;  4OMV A;  4EXJ A;  3QAV A;  1Q98 A;  5JWQ B;  2B5E A;  3RBT A;  1O7U A;  1BED A;  3D4M A;  3HYP A;  4YQM A;  2VM2 A;  1A24 A;  2V1M A;  5IMD A;  4BVY A;  3CRU A;  4ZL9 A;  17GS A;  4KE3 A;  4POL A;  4OO4 A;  5DAK B;  2TRC P;  2WCI A;  4LMW A;  4ECB A;  2AAW A;  2B1K A;  3DWV A;  1IYH A;  4IJ3 A;  3BOA A;  1GSU A;  1K0D A;  1ST9 A;  2PVO C;  5A5K A;  4MK3 A;  3C1R A;  4HU7 A;  4KW6 A;  3PR8 A;  1VF3 A;  3CTG A;  5D8I A;  2CT6 A;  3H4K A;  4I6X A;  2YPM A;  3N9J A;  1TP9 A;  3CXG A;  2HFD A;  1T4Y A;  3MSZ A;  1MDK A;  3EC3 A;  2HNL A;  3IAM 2;  4G9H A;  4XRA A;  5G1K A;  1I9D A;  3GV1 A;  3HVS A;  3GL3 A;  3KIJ A;  4EDY A;  1YEX A;  1GUH A;  1V2A A;  1SJZ A;  4CW9 A;  4PQ1 A;  1B48 A;  4MP4 A;  1LBK A;  5E59 A;  3LFL A;  2A4V A;  5CO3 A;  2YJH A;  3AY8 A;  2CX3 A;  4XS4 B;  3D6I A;  2LS5 A;  1OKT A;  1F2E A;  3DXB A;  1O8X A;  3IR4 A;  3WT2 A;  1C72 A;  1WMJ A;  2GQM A;  5C04 A;  2DBC A;  1NW2 A;  1JHB A;  2VCQ A;  4L0W A;  1SL0 B;  3QDN A;  6GSX A;  1WPI A;  1K0O A;  1ACV A;  1TRU A;  3ERG A;  2H6Z A;  5B6N A;  1ZL9 A;  5E4W A;  2OE3 A;  1DE1 A;  3WD6 A;  3ZRE A;  2FGX A;  1UA5 A;  3GYK A;  2I9H A;  3KXO A;  2LKU A;  5CYY A;  4L5O A;  2R4V A;  5C00 A;  4PXO A;  3QOU A;  3VI7 A;  1A8Y A;  4JBB A;  2N5A A;  1Z6N A;  3EE2 A;  2DMM A;  3FR9 A;  1W4V A;  1PQN A;  2ALB A;  2NDO A;  1LJR A;  2VAF A;  2LRT A;  2DML A;  3FK8 A;  4OCF A;  4D73 B;  2G2Q A;  3LSZ A;  3ERW A;  2E2G A;  3LQ7 A;  2WUL A;  2JU5 A;  1AQX A;  4ECI A;  3DRN A;  1ZYE A;  1G7O A;  3CSI A;  4N11 A;  1X9W B;  4KSM A;  1EP7 A;  4ECC A;  1EV9 A;  3TRQ A;  3KP9 A;  5LD0 A;  4KB3 A;  1B8X A;  3K8N A;  2V6K A;  2H1D A;  1PGT A;  2YAN A;  2AHE A;  2EIR A;  5LNK e;  3P90 A;  2FY6 A;  2HLS A;  2WS2 A;  1FG4 A;  1AAZ A;  4POB A;  1G6W A;  3IE3 A;  2H01 A;  3EUR A;  3L78 A;  4NMU A;  5B8B A;  3KTL A;  3EVI A;  3U5R E;  3HDC A;  2VLT A;  1AW9 A;  1OYJ A;  3TKS C;  3J7Y b;  3IOS A;  2DJ2 A;  4OFT A;  3MAK A;  5ECK B;  2DJ3 A;  1BX9 A;  3M3M A;  3N5O A;  4KGI A;  3W8S A;  1XFL A;  5CRD A;  1SKW B;  5J9B A;  1Q4J A;  4Z7X A;  4WBR D;  4E8H A;  2HE3 A;  3ZTL A;  1M99 A;  3C7M A;  3VWW A;  5CRW A;  2NTO A;  1JZD A;  4FYU A;  3LXT A;  3RHC A;  5G30 A;  2A2R A;  1MTC A;  1FHE A;  1N8J A;  4PQI A;  3UAP A;  4K7I A;  2VL3 A;  2O7K A;  4GXZ A;  2C1Y A;  4PNG A;  5DAK A;  4IS0 A;  5ECM B;  4IP6 A;  5DVB A;  1TXX A;  4F0C A;  4KDX A;  1HQO A;  3GNJ A;  1ILO A;  1OC3 A;  3TJG A;  2GGT A;  3H93 A;  1GUL A;  4KAE A;  5IOX A;  5J9C A;  4HZ2 A;  4YAP A;  4DVC A;  16GS A;  4N0V A;  4GTU A;  4MMM A;  2HZE B;  5HR2 A;  3F8U A;  3I6A A;  2VD1 A;  2DLX A;  4J2F A;  4CHS A;  4KCE A;  2KP1 A;  1E6B A;  1SYX A;  4MH2 A;  3VI5 A;  1SJ6 A;  4H86 A;  3QFA C;  3APS A;  3H79 A;  5HQP A;  3A3T A;  1ERU A;  4EO3 A;  5KN1 A;  5F05 A;  4GSN A;  2DJ0 A;  4MF5 A;  4PGT A;  3EWL A;  2H30 A;  3HVV A;  4GSS A;  3HKR A;  2O89 A;  2B5Y A;  2BJX A;  3E9J B;  5DDL A;  1T00 A;  3GKM A;  5D93 A;  4O7H A;  5HR0 A;  3TKQ A;  2MMZ A;  2CZ3 A;  4NWY A;  1U87 A;  4XS4 A;  3ERF A;  1OVN A;  3ZYW A;  3LJR A;  1ZMA A;  3KMO A;  4G19 A;  3IV4 A;  4MF7 A;  4IN0 A;  2C3T A;  4NV2 A;  3U6V A;  3GTU B;  1QGV A;  2M72 A;  1NHO A;  3GX0 A;  6GSU A;  4P3Y B;  1V57 A;  1OC9 B;  2M46 A;  3E0U A;  5KEJ A;  3KGK A;  1WJK A;  4FYC A;  5D9T A;  1X5E A;  5GAN D;  2CAQ A;  3EU4 A;  2VIM A;  1EV4 A;  5JCU A;  2QKE A;  3L4N A;  1PN9 A;  1EOH A;  2H73 A;  3HA9 A;  4XRD A;  1YQ1 A;  2R37 A;  2CVB A;  1GTU A;  2P5R A;  1SK1 A;  2JZS A;  3NIV A;  1WOU A;  4LMV A;  4FO5 A;  5A4W A;  2YWI A;  2JZT A;  5DBQ A;  3ZLP A;  2VL2 A;  3GMF A;  5IMC A;  1GSF A;  1ZYQ B;  4D73 A;  2LJK A;  4AJ8 A;  1SKR B;  2L5L A;  1XWB A;  3GL5 A;  4QL7 A;  5GSS A;  1TK8 B;  1O85 A;  3ZIJ A;  1K0B A;  3HZ4 A;  1GRX A;  3WT1 A;  4GQF A;  1FW1 A;  2R2J A;  1Z7P A;  4OFN A;  3VPQ A;  2AUV A;  2IFQ B;  1THX A;  3V1W A;  2PER A;  4WR4 A;  3VLN A;  1A8L A;  4EL1 A;  2PUK C;  1TU7 A;  2C0F A;  2H72 A;  2IME A;  4IJI A;  1X5C A;  5ECS A;  1VGL A;  1TKD B;  4K0G A;  3M9J A;  3DGQ A;  1NHY A;  4MLY A;  2VCX A;  4BVX A;  4WKW A;  5KN0 A;  3M8N A;  5D96 A;  1Z5Y E;  4WEY A;  1MDI A;  2NPB A;  3JCM L;  4NHZ A;  2EIQ A;  1FOV A;  1W89 A;  1PRX A;  4ZB9 A;  1K0M A;  2V2G A;  5B7C A;  2YZU A;  4KUN A;  1YDK A;  5D9W A;  1HYU A;  1M2B A;  3P8W A;  5GST A;  4DSS B;  1F3A A;  3C71 A;  3APO A;  5IIZ A;  1A2L A;  1IYI A;  4KX4 A;  3TKS E;  5DJM A;  2XPE A;  5J5N A;  2IIY A;  1GSE A;  2YWM A;  4AGS A;  2H75 A;  1A2J A;  1VF4 A;  2KP2 A;  2YWO A;  2A2S A;  3VK9 A;  2L57 A;  2B3S A;  2GLR A;  1TRW A;  4XHM A;  2OA7 A;  1RW1 A;  2YZH A;  1V98 A;  1U88 A;  3WYW A;  3VWV A;  2DIY A;  2PWJ A;  4HUA A;  1EGO A;  4OFM A;  2KLX A;  2AYT A;  2J23 A;  2GSQ A;  3IK9 A;  4I2U A;  4O5R A; 
#chains in the Genus database with same CATH topology
 3DVX A;  2N5B A;  4GF0 A;  1Y25 A;  2R6K A;  4ISD A;  1BAY A;  2R3X A;  1F37 A;  2I1U A;  4LL1 B;  4TR0 A;  3MNG A;  3TDG A;  3UEM A;  3TOT A;  2LNS A;  2WRT A;  5F8B A;  2C0E A;  3UMA A;  3KEB A;  2JSY A;  1ERT A;  2IWT A;  4Q5Q A;  2CAI A;  1M3I A;  1SJI A;  3KM6 A;  1DE2 A;  2TIR A;  4HOJ A;  1GLP A;  3ED3 A;  1YJ6 A;  4LLR A;  2YCD A;  5G1L A;  1EP8 A;  1QQ2 A;  4MZC A;  3G9B A;  1QFN A;  5IMZ A;  2VUP A;  1QMV A;  1M2D A;  3Q18 A;  2MMN A;  1X0R A;  4JZQ A;  4TR3 A;  2EIO A;  4PUR A;  1PA3 A;  2H1A A;  2OJL A;  5AN1 A;  5JCG A;  4AJ7 A;  2IPA A;  5IOW A;  5EPF A;  2H66 A;  5IQY A;  3WGE A;  3CQF A;  1YEP A;  3J7Y k;  3GFK A;  2ON5 A;  2F9S A;  3GTU A;  4JED A;  3KCM A;  5HFI A;  1GH2 A;  5ECR B;  1OC9 A;  3OR5 A;  1KTE A;  1Z7R A;  2GQK A;  1GP1 A;  4N10 A;  5JCW A;  2PVQ A;  2RUF A;  2B7K A;  2H70 A;  3EU3 A;  1T7P B;  2PMT A;  3BCI A;  3M1G A;  3HHV A;  4NHW A;  5ECO B;  3CYN A;  2X49 A;  4MDC A;  3GHA A;  1PL1 A;  4HDE A;  1ML6 A;  3O76 A;  5ID2 B;  2FA8 A;  20GS A;  2X8G A;  2JZR A;  3DKS A;  2VO4 A;  1ZZY A;  4KCA A;  1JZO A;  3HD5 A;  5ECQ B;  1MDJ A;  4G2E A;  1BYE A;  1HD2 A;  3FHK A;  5KN2 A;  4ZBB A;  2WGR A;  3LXZ A;  3LW9 A;  2CVD A;  2IL3 A;  2VL9 A;  4WF4 A;  4K1F A;  1BQ7 A;  1SK2 A;  2DJJ A;  2V41 A;  4ID0 A;  4POM A;  1Z9H A;  22GS A;  1EOG A;  3US3 A;  1GWC A;  5CRH A;  4K2D A;  4CY8 A;  5BMU A;  3GN3 A;  1TK5 B;  3FZ5 A;  2O87 A;  5B8A A;  3SBC A;  1QXH A;  4TRX A;  2IFQ A;  1R7H A;  2PBJ A;  2PGT A;  4V2L A;  2JAC A;  3F3R A;  2HRK A;  5H5R A;  3FEU A;  1PSQ A;  1ERW A;  3A5I A;  4TXO B;  3LYK A;  1VF2 A;  1XWK A;  5ELG A;  1FAA A;  1T8E B;  2LJA A;  4LL4 B;  4Z2U A;  2VCV A;  3ZFB A;  3TRP A;  4O5Q A;  4GCI A;  4PX1 A;  2DJK A;  1URM A;  3G7I A;  3MIX A;  5HFG A;  1E2Y A;  3KMN A;  3M0F A;  4MA9 A;  1GSS A;  4DSS A;  5JWO B;  1PMT A;  2QSI A;  5IPH A;  2QA2 A;  2VD0 A;  3GRX A;  4EDZ A;  2F3M A;  2XBI A;  1TU8 A;  1SD9 A;  4FIW A;  2LJR A;  2GZY A;  3EPT A;  3BD2 A;  3QPM A;  5F06 A;  4RI6 A;  1XW9 A;  4ULX A;  1PX6 A;  2CA8 A;  4ZIL A;  2NBS A;  2OAC A;  4TXV A;  4PQH A;  1GSQ A;  2NVL A;  3LG6 A;  3GUS A;  1XG8 A;  5CAX A;  2ZCT A;  2N5F A;  2K8S A;  2YNX A;  3QR6 A;  5CP1 A;  1UVZ A;  18GS A;  3IHG A;  2HI7 A;  4ZB8 A;  10GS A;  5ECL B;  12GS A;  3GIX A;  3QMX A;  2LNT A;  1JLV A;  1OE8 A;  3F0I A;  4KA0 A;  2FLS A;  2LQQ A;  6GSS A;  1XPV A;  3O3T A;  2O8V B;  1TRV A;  1GL8 A;  4RI7 A;  3L0H A;  3GKN A;  4TKY A;  3UIW A;  1RQM A;  1PL2 A;  2HXK A;  2R0C A;  2YWN A;  1WRY A;  4IP1 A;  2YP6 A;  2C8U A;  2LTK A;  3EYT A;  1GUM A;  1EWX A;  3QD9 A;  4GRF A;  1EEJ A;  3IC4 A;  5HR1 A;  1J0F A;  4O32 A;  4ILF A;  2OBK A;  4PTS A;  4ZIJ A;  3ME8 A;  1OAZ A;  1R5A A;  2DC5 A;  2L4Q A;  3VFI A;  1WE0 A;  3FY7 A;  3GH9 A;  1CQH A;  1XWG A;  3KH9 A;  4G0L A;  2HT9 A;  4XS1 A;  2FNO A;  3L9S A;  4TR1 B;  1YZX A;  1XXU A;  1B9X C;  1TI1 A;  3HJP A;  4TVE A;  1GSY A;  3ZL5 A;  1SL2 B;  5KN3 A;  2R0G A;  4HJM A;  2ES7 A;  5DJL A;  1O73 A;  1GTI A;  3FKF A;  2L6C A;  3VWU A;  1PD2 1;  4ML6 A;  4RUV A;  4X4J A;  4IVF A;  4KDY A;  3UJ1 A;  2JAD A;  1V40 A;  2RII A;  4XIH A;  1FO5 A;  1GSD A;  5GZZ B;  2X4A A;  3UVH A;  4F0B A;  1PKZ A;  2X8C A;  2L5O A;  5AIV A;  3IXR A;  2E2M A;  2IMK A;  1M7T A;  13GS A;  2FWH A;  1T4Z A;  4L8E A;  1WIK A;  1BJX A;  3TCO A;  2H8L A;  5G31 A;  1U3I A;  5ID2 A;  4O5U A;  1XOB A;  1XVQ A;  1LU4 A;  2C0G A;  2HZF A;  2LRC A;  2R0P A;  4DSQ A;  2H6X A;  2YOI A;  1GNW A;  1YF1 A;  2QGV A;  1T3B A;  2C0D A;  2CV4 A;  3RDW A;  2H74 A;  2LQO A;  3FW2 A;  1XVW A;  4GQC A;  1ERV A;  5COH A;  3D21 A;  2I81 A;  4IBP A;  2KUC A;  3PGT A;  5IO0 A;  4WR5 A;  1HNC A;  5CRE A;  3BJ5 A;  4PUF C;  5H5Q A;  2DKH A;  2DIZ A;  2EC4 A;  2BMX A;  2C3N A;  3IBH A;  5DQY A;  1A2M A;  4JRR A;  4TN8 A;  3SWL A;  2OKA A;  4MH3 A;  1A23 A;  1KNG A;  4TOP A;  2GT5 A;  1S3D A;  4FYB A;  4OD7 A;  4POK A;  1XW6 A;  4X1U A;  3DVW A;  3LWA A;  6GST A;  4OO5 A;  2REM A;  2WZ9 A;  3IC8 A;  2HSM A;  2X8H A;  1JZW A;  3TJB A;  4NPB A;  4F82 A;  2FWE A;  3C73 A;  4BL7 B;  2A2P A;  3VWX A;  4TXO A;  2V32 A;  4EUY A;  4K7O A;  3PPU A;  3D4T A;  3F6F A;  2BTO T;  3TKP A;  5G2Z A;  3DD3 A;  4EE0 A;  5AIX A;  2MBT A;  2H1B A;  3QCP A;  3A5W A;  2H0G A;  2WFC A;  4G10 A;  2VLU A;  3APQ A;  3ZVJ A;  4EF0 A;  2WDU A;  3TJF A;  1OC8 A;  2VCW A;  2M80 A;  2H6Y A;  2VCZ A;  1SD8 A;  3HVX A;  4MJB A;  1G7E A;  1XCC A;  3EMP A;  4F03 A;  2GVP A;  4F9Z A;  2HSH A;  1YF0 A;  3VPT A;  2GSR A;  5G5F A;  5B6M A;  1XWA A;  5KOX A;  2GDR A;  4LA1 A;  5DAL B;  3D5J A;  4GLT A;  1XOA A;  3CTF A;  1WWJ A;  7GSS A;  2LUS A;  2CVK A;  3HZ8 A;  3MDK A;  2G0F A;  3MWH A;  4KSO A;  5F0G A;  4IEL A;  4KND A;  2MMO A;  1F3B A;  3G7J A;  4WXT A;  4IQA A;  1O81 A;  1GUK A;  4NXI A;  2P0G A;  4CDO A;  4HZ4 A;  1M9B A;  3ZVJ D;  5IPG A;  2IMI A;  1RK4 A;  3F9U A;  3TOU A;  2DJ1 A;  4PUA A;  2HRA A;  4AF2 A;  1H4O A;  1VRS D;  3CSH A;  3FMW A;  4N0Z A;  1DBY A;  1USB A;  4I8B A;  3ZZX A;  1O6J A;  4EKZ A;  2KOK A;  1AUC A;  4HSC X;  1JZR A;  2HZE A;  1YY7 A;  3E3E A;  2H71 A;  2O85 A;  3NZN A;  2TRX A;  2P31 A;  3IDV A;  2LST A;  1HNB A;  4PNF A;  2UZ8 A;  3ZFL A;  1G0T A;  3H8Q A;  4IW9 A;  5ABR A;  2VOC A;  3LYP A;  6GSW A;  3DEX A;  3QAG A;  1TOF A;  4TR1 A;  1MD4 A;  4EVM A;  1B9Y C;  2QA1 A;  1SEN A;  2K6V A;  1WP0 A;  4HS1 A;  3RPN A;  4KF9 A;  4V2M A;  3L9V A;  3F3Q A;  3TJK A;  4RQR A;  5EL8 A;  3ME7 A;  1Y6E A;  2GST A;  5DCG A;  3TRX A;  4X0X A;  2B6M A;  1K0C A;  4HQZ A;  2C3Q A;  3VUR A;  1EEM A;  4Q5R A;  3CBU A;  1ON4 A;  2FUG 2;  3PH9 A;  4XTS A;  2F8A A;  14GS A;  3P7X A;  1Z3E A;  4TW5 A;  2K9F A;  4K9Z A;  1FB6 A;  1SYR A;  4XCS A;  3O6T A;  1G6Y A;  2OBI A;  4ZL8 A;  1TJD A;  3GSS A;  4DSR A;  1AXD A;  4V2N A;  1NSW A;  5ECN B;  1A0F A;  3HXS A;  4FH8 A;  5CNW A;  3A2W A;  1S3A A;  6GSY A;  1SKS B;  2IMF A;  5A4U A;  3FZA A;  2MZC A;  2MMA A;  3QFB C;  2GS3 A;  4E8E A;  2X99 A;  3F6D A;  3A2X A;  5INY A;  3RAZ A;  4YAV A;  3DYR A;  2FD3 A;  4GST A;  4KDU A;  2AV4 A;  2F8F A;  5ECI B;  2AJQ B;  1H75 A;  2RM5 A;  1GLQ A;  2ZUP A;  3QAW A;  3IPZ A;  3FR3 A;  2VM1 A;  2FWG A;  1AQV A;  2V6O A;  3UBL A;  4EC0 A;  4J57 E;  1KBN A;  1V58 A;  4K8M A;  3IHQ A;  4HI7 A;  2H1G A;  2PU9 C;  2JL4 A;  3GKK A;  1DSB A;  3BBY A;  4IGJ A;  2L6D A;  2P5Q A;  1AIU A;  5LCZ A;  5J4U A;  4RQX A;  4I2T A;  2I3Y A;  3I69 A;  3FZ4 A;  1U3A A;  1M9A A;  3LEF A;  8GSS A;  1TRS A;  2RM6 A;  2VL2 C;  2LV3 A;  4NAX A;  3GA4 A;  2Z9S A;  2X64 A;  4BL7 A;  4AJ6 A;  3MYD A;  1FVJ A;  4K7N A;  2H76 A;  3LGC A;  3UOM A;  1AC1 A;  5FT3 A;  3ZIT A;  4MCU A;  1K3Y A;  2HRN A;  4OWY A;  2ZNM A;  1TK0 B;  4TR4 A;  1YKC A;  3CSJ A;  4ECJ A;  3EMX A;  4K0N A;  4L5L A;  4ML1 A;  1GTB A;  2XHF A;  5J41 A;  3WGX A;  3TGZ A;  3EIN A;  3H1N A;  3L9U A;  4IKH A;  3TUE A;  5DCH A;  1I5G A;  3ZML A;  2I4A A;  4MJE A;  2XBQ A;  3TB2 A;  4ZBA A;  2CX4 A;  4HU9 A;  2C4J A;  3FR6 A;  5DAL A;  1K3O A;  3RPP A;  3UL3 A;  3DIE A;  1SL1 B;  4BWQ A;  5EY6 A;  5J3R A;  3UVT A;  2LEG A;  4OCE A;  1N2A A;  2L59 A;  4ICY A;  2HSY A;  3I9V 2;  3GUR A;  3KJY A;  3F4S A;  3RHB A;  4NV5 A;  3PIN A;  1XZO A;  3D0Z A;  1SK0 A;  2VCT A;  2WJU A;  4K6X A;  1VF1 A;  1X5D A;  4JU5 A;  4BVY B;  3FYG A;  5DQS A;  4JE1 A;  2XC2 A;  1J9B A;  1T1V A;  4G0I A;  2MYG A;  2JSZ A;  1ZCP A;  6GSV A;  1QK8 A;  4ZBD A;  1B4P A;  3W8J A;  2K18 A;  3IAS 2;  4BA7 A;  3I43 A;  4YQU A;  3ZRD A;  3A2V A;  4HEA 2;  5D9X A;  3CRT A;  5IMF A;  2CZ2 A;  2YN1 A;  3F63 A;  2E0Q A;  1EGR A;  4ZL7 A;  3F4R A;  4JR4 A;  4YQV A;  2LRN A;  2FHE A;  3IK7 A;  1XW5 A;  1PX7 A;  3LOR A;  3IA1 A;  1CQG A;  4BWS A;  5A4V A;  2YJ7 A;  5AGY A;  5F07 A;  3IRA A;  2AB6 A;  4L0U A;  2YV9 A;  3P2A A;  2C80 A;  3ISO A;  4MJA A;  1F6M C;  2R5G A;  4JR6 A;  4QL9 A;  1BG5 A;  1UN2 A;  1ZOF A;  2J9H A;  2QC7 A;  4MF6 A;  2CQ9 A;  3GST A;  5JWR B;  1R26 A;  1F9M A;  4YH2 A;  1DUG A;  1JLW A;  1HNA A;  1TDI A;  1J08 A;  3C1S A;  3TJJ A;  4XS6 A;  1XWC A;  4BPY A;  1M2A A;  2K8V A;  2GTU A;  1GNE A;  3KH7 A;  4X43 A;  5FHI A;  5IM9 A;  1R5P A;  4CY6 A;  4Q5F A;  5ELA A;  3M9K A;  1XIY A;  2YV7 A;  3HCZ A;  2B7J A;  5FWG A;  3Q19 A;  3W6G A;  2GSS A;  5D73 A;  4HQS A;  3GKX A;  4MZB A;  3GH6 A;  2DKI A;  3CMI A;  5ECH B;  2OE0 A;  11GS A;  3C8E A;  5CRG A;  1UC7 A;  5H5S A;  2FCH A;  2B1L A;  3FRC A;  4MAB A;  2B5X A;  1JFU A;  2RLI A;  2GQL A;  4I5Q A;  1YKA A;  1THO A;  4DEJ A;  2H0I A;  3DML A;  3R2Q A;  1XBS A;  5AIS A;  3D22 A;  5ECP B;  2PPT A;  2D2Z A;  2IN3 A;  4ACS A;  1QUW A;  3NOF A;  5HFK A;  3Q6O A;  1Z6M A;  4O92 A;  4ZB6 A;  2F51 A;  1MEK A;  1OKD A;  3HJM A;  3Q74 A;  2RUE A;  3KD0 A;  3KZQ A;  4F2I A;  1B4Q A;  1ABA A;  3F4T A;  2VLV A;  3KTB A;  4MPF A;  19GS A;  9GSS A;  3WGD A;  4I97 A;  2HRF A;  4WET A;  1K0A A;  2IJY A;  4QQ7 A;  5L71 A;  2GZP A;  1M3J A;  2GZZ A;  1OE7 A;  5IMV A;  4FQU A;  1FOH A;  3BCK A;  1TW9 A;  1GTA A;  3KP8 A;  4V1A g;  1U6T A;  4MJC A;  2H0H A;  4GWR A;  1TI3 A;  4K5R A;  3TKS A;  3G7Y A;  4HJ2 A;  1SU9 A;  3UAR A;  5IMA A;  4N30 A;  3TKR A;  1X9S B;  1MD3 A;  4J56 E;  2GT6 A;  2DSA A;  1FB0 A;  3ZIV A;  3S9F A;  3ZMK A;  5GAP D;  1O8W A;  4ZXG A;  5EVO A;  2ON7 A;  2OE1 A;  3UBK A;  4IHU A;  1R4W A;  1EZK A;  5G5E A;  4USS A;  3HJO A;  1K3L A;  1KEB A;  4WF5 A;  5D9V A;  1PKW A;  1ZGN A;  4WBJ A;  2E7P A;  2H19 A;  1S3C A;  4Q5N A;  2XPD A;  1V9W A;  4K2X A;  5ENU A;  4MZW A;  3GX8 A;  5HR3 A;  5BRT A;  2L4C A;  1A0R P;  4V1A p;  1K0N A;  2WB9 A;  2PN8 A;  4KH7 A;  2OAD A;  1NM3 A;  2FA4 A;  3HY2 A;  2MBS A;  1AQW A;  2FWF A;  4IQ1 A;  2HYX A;  3FZ9 A;  4MPG A;  1FVK A;  1M0U A;  2KHP A;  2IMD A;  1X9M B;  1TTZ A;  5IO2 A;  4OMV A;  4EXJ A;  3QAV A;  1Q98 A;  5JWQ B;  2B5E A;  3RBT A;  1O7U A;  1BED A;  3D4M A;  3HYP A;  4YQM A;  2VM2 A;  1A24 A;  2V1M A;  5IMD A;  4BVY A;  3CRU A;  4ZL9 A;  17GS A;  4KE3 A;  4POL A;  4MNN A;  4OO4 A;  5DAK B;  2TRC P;  2WCI A;  4LMW A;  4ECB A;  2AAW A;  2B1K A;  3DWV A;  1IYH A;  4IJ3 A;  3BOA A;  1GSU A;  1K0D A;  1ST9 A;  2PVO C;  5A5K A;  4MK3 A;  3C1R A;  4HU7 A;  4KW6 A;  1S3R A;  1VF3 A;  3CTG A;  3PR8 A;  1ZYN A;  5D8I A;  2CT6 A;  3H4K A;  4I6X A;  2YPM A;  3N9J A;  1TP9 A;  3CXG A;  2HFD A;  1T4Y A;  3MSZ A;  1MDK A;  3EC3 A;  2HNL A;  3IAM 2;  4G9H A;  4XRA A;  5G1K A;  1I9D A;  3GV1 A;  3HVS A;  4YKG A;  3GL3 A;  3KIJ A;  4EDY A;  1YEX A;  1GUH A;  1V2A A;  1SJZ A;  4CW9 A;  4PQ1 A;  1B48 A;  4MP4 A;  1LBK A;  5E59 A;  3LFL A;  2A4V A;  5CO3 A;  2YJH A;  3AY8 A;  2CX3 A;  4XS4 B;  3D6I A;  2LS5 A;  1OKT A;  1PN0 A;  1F2E A;  3DXB A;  4YKF A;  1O8X A;  3IR4 A;  3WT2 A;  1C72 A;  1WMJ A;  2GQM A;  5C04 A;  2DBC A;  1NW2 A;  1JHB A;  2VCQ A;  4L0W A;  1SL0 B;  3QDN A;  4EIP A;  6GSX A;  1WPI A;  1K0O A;  1ACV A;  1TRU A;  3ERG A;  2H6Z A;  5B6N A;  1ZL9 A;  5E4W A;  2OE3 A;  1DE1 A;  3WD6 A;  3ZRE A;  2FGX A;  1UA5 A;  3GYK A;  2I9H A;  3KXO A;  2LKU A;  5CYY A;  4L5O A;  2R4V A;  5C00 A;  4PXO A;  3QOU A;  3VI7 A;  1A8Y A;  4JBB A;  2N5A A;  1Z6N A;  3EE2 A;  2DMM A;  3FR9 A;  1W4V A;  1PQN A;  2ALB A;  2NDO A;  1LJR A;  2VAF A;  2LRT A;  2DML A;  3FK8 A;  4OCF A;  1PFO A;  4D73 B;  2G2Q A;  3LSZ A;  3ERW A;  2E2G A;  3LQ7 A;  1ZYP A;  2WUL A;  2JU5 A;  1AQX A;  4ECI A;  3DRN A;  1ZYE A;  1G7O A;  3CSI A;  4N11 A;  1X9W B;  4KSM A;  1EP7 A;  4ECC A;  1EV9 A;  3TRQ A;  3KP9 A;  5LD0 A;  4KB3 A;  1B8X A;  3K8N A;  2V6K A;  2H1D A;  1PGT A;  2YAN A;  2AHE A;  2EIR A;  5LNK e;  3P90 A;  4BVX B;  2FY6 A;  2HLS A;  2WS2 A;  1FG4 A;  1AAZ A;  4Z2R A;  4POB A;  1G6W A;  3IE3 A;  2H01 A;  3EUR A;  3HVN A;  3L78 A;  4NMU A;  5B8B A;  3KTL A;  3EVI A;  3U5R E;  3HDC A;  2VLT A;  1AW9 A;  4G0K A;  1OYJ A;  3TKS C;  3J7Y b;  3IOS A;  2DJ2 A;  4OFT A;  3MAK A;  5ECK B;  2DJ3 A;  1BX9 A;  3M3M A;  3N5O A;  4KGI A;  3W8S A;  1XFL A;  5CRD A;  1SKW B;  5J9B A;  1Q4J A;  4Z7X A;  4WBR D;  4E8H A;  2HE3 A;  3ZTL A;  1M99 A;  3C7M A;  3VWW A;  5CRW A;  3R3E A;  2NTO A;  1JZD A;  4FYU A;  3LXT A;  3RHC A;  5G30 A;  2A2R A;  1MTC A;  1FHE A;  1N8J A;  4PQI A;  3UAP A;  4K7I A;  2VL3 A;  2O7K A;  4GXZ A;  2C1Y A;  4PNG A;  5DAK A;  4IS0 A;  5ECM B;  4IP6 A;  5DVB A;  1TXX A;  4F0C A;  4KDX A;  1HQO A;  3GNJ A;  1ILO A;  1OC3 A;  3TJG A;  2GGT A;  3H93 A;  1GUL A;  4KAE A;  5IOX A;  5J9C A;  4HZ2 A;  4YAP A;  4DVC A;  16GS A;  4N0V A;  4GTU A;  4MMM A;  2HZE B;  5HR2 A;  3F8U A;  3I6A A;  2VD1 A;  2DLX A;  4J2F A;  4CHS A;  4KCE A;  2KP1 A;  1E6B A;  1SYX A;  4MH2 A;  3VI5 A;  1SJ6 A;  4H86 A;  3QFA C;  3APS A;  3H79 A;  5HQP A;  3A3T A;  1ERU A;  4EO3 A;  5KN1 A;  5F05 A;  4GSN A;  2A4H A;  2DJ0 A;  4MF5 A;  4PGT A;  3EWL A;  2H30 A;  3HVV A;  4GSS A;  3HKR A;  2O89 A;  2B5Y A;  2BJX A;  3E9J B;  5DDL A;  1T00 A;  3GKM A;  5D93 A;  4O7H A;  5HR0 A;  3TKQ A;  2MMZ A;  2CZ3 A;  4NWY A;  1U87 A;  4XS4 A;  3ERF A;  1OVN A;  3ZYW A;  3LJR A;  1ZMA A;  3KMO A;  4G19 A;  3IV4 A;  4MF7 A;  4IN0 A;  2C3T A;  4NV2 A;  3U6V A;  3GTU B;  1QGV A;  2M72 A;  1NHO A;  3GX0 A;  6GSU A;  4P3Y B;  1V57 A;  1OC9 B;  2M46 A;  3E0U A;  5KEJ A;  3KGK A;  1WJK A;  4FYC A;  5D9T A;  1X5E A;  5GAN D;  2CAQ A;  3EU4 A;  2VIM A;  1EV4 A;  5JCU A;  2QKE A;  3L4N A;  1PN9 A;  4A5P A;  1EOH A;  2H73 A;  3HA9 A;  4XRD A;  1YQ1 A;  2R37 A;  2CVB A;  1GTU A;  2P5R A;  1SK1 A;  2JZS A;  3NIV A;  1WOU A;  4LMV A;  4FO5 A;  5A4W A;  2YWI A;  2JZT A;  5DBQ A;  3ZLP A;  2VL2 A;  3GMF A;  5IMC A;  1GSF A;  1ZYQ B;  4D73 A;  2LJK A;  4AJ8 A;  1SKR B;  2L5L A;  1XWB A;  3GL5 A;  4QL7 A;  5GSS A;  1TK8 B;  1O85 A;  3ZIJ A;  1K0B A;  3HZ4 A;  1GRX A;  3WT1 A;  4GQF A;  1FW1 A;  2R2J A;  1Z7P A;  4OFN A;  3VPQ A;  2AUV A;  2IFQ B;  1THX A;  3V1W A;  4Z2T A;  2PER A;  4WR4 A;  3VLN A;  1A8L A;  4EL1 A;  2PUK C;  1TU7 A;  2C0F A;  2H72 A;  2IME A;  4IJI A;  1X5C A;  5ECS A;  1VGL A;  1TKD B;  4K0G A;  3M9J A;  3DGQ A;  1NHY A;  4MLY A;  2VCX A;  4BVX A;  4WKW A;  5KN0 A;  3M8N A;  5D96 A;  1Z5Y E;  4WEY A;  1MDI A;  2NPB A;  3JCM L;  4NHZ A;  2EIQ A;  1FOV A;  5KOW A;  1W89 A;  1PRX A;  4ZB9 A;  1K0M A;  2V2G A;  5B7C A;  2YZU A;  4KUN A;  1YDK A;  5D9W A;  1HYU A;  1M2B A;  3P8W A;  5GST A;  4DSS B;  1F3A A;  3C71 A;  3APO A;  4EIQ A;  5IIZ A;  1A2L A;  1IYI A;  4KX4 A;  3TKS E;  5DJM A;  2XPE A;  5J5N A;  2IIY A;  4K5S A;  1GSE A;  2YWM A;  4AGS A;  2H75 A;  4BIK A;  1A2J A;  1VF4 A;  2KP2 A;  2YWO A;  2A2S A;  3VK9 A;  2L57 A;  2B3S A;  2GLR A;  1TRW A;  4XHM A;  2OA7 A;  1RW1 A;  2YZH A;  1V98 A;  1U88 A;  3WYW A;  3VWV A;  2DIY A;  2PWJ A;  4HUA A;  1EGO A;  4OFM A;  2KLX A;  2AYT A;  2J23 A;  2GSQ A;  3IK9 A;  4I2U A;  4O5R A; 
#chains in the Genus database with same CATH homology
 3DVX A;  2N5B A;  4GF0 A;  1Y25 A;  2R6K A;  4ISD A;  1BAY A;  2R3X A;  1F37 A;  2I1U A;  4LL1 B;  4TR0 A;  3MNG A;  3TDG A;  3UEM A;  3TOT A;  2LNS A;  2WRT A;  5F8B A;  2C0E A;  3UMA A;  3KEB A;  2JSY A;  1ERT A;  2IWT A;  4Q5Q A;  2CAI A;  1SJI A;  3KM6 A;  1DE2 A;  2TIR A;  4HOJ A;  1GLP A;  3ED3 A;  1YJ6 A;  4LLR A;  2YCD A;  5G1L A;  1EP8 A;  1QQ2 A;  4MZC A;  3G9B A;  1QFN A;  5IMZ A;  2VUP A;  1QMV A;  1M2D A;  3Q18 A;  2MMN A;  1X0R A;  4JZQ A;  4TR3 A;  2EIO A;  4PUR A;  1PA3 A;  2H1A A;  2OJL A;  5AN1 A;  5JCG A;  4AJ7 A;  2IPA A;  5IOW A;  5EPF A;  2H66 A;  5IQY A;  3WGE A;  1YEP A;  3J7Y k;  3GFK A;  2ON5 A;  2F9S A;  3GTU A;  4JED A;  3KCM A;  5HFI A;  1GH2 A;  5ECR B;  1OC9 A;  3OR5 A;  1KTE A;  1Z7R A;  2GQK A;  1GP1 A;  4N10 A;  5JCW A;  2PVQ A;  2RUF A;  2B7K A;  2H70 A;  3EU3 A;  1T7P B;  2PMT A;  3BCI A;  3M1G A;  3HHV A;  4NHW A;  5ECO B;  3CYN A;  2X49 A;  4MDC A;  3GHA A;  1PL1 A;  4HDE A;  1ML6 A;  3O76 A;  5ID2 B;  2FA8 A;  20GS A;  2X8G A;  2JZR A;  3DKS A;  2VO4 A;  1ZZY A;  4KCA A;  1JZO A;  3HD5 A;  5ECQ B;  1MDJ A;  4G2E A;  1BYE A;  1HD2 A;  3FHK A;  5KN2 A;  4ZBB A;  2WGR A;  3LXZ A;  3LW9 A;  2CVD A;  2IL3 A;  2VL9 A;  4WF4 A;  4K1F A;  1BQ7 A;  1SK2 A;  2DJJ A;  2V41 A;  4ID0 A;  4POM A;  1Z9H A;  22GS A;  1EOG A;  3US3 A;  1GWC A;  5CRH A;  4K2D A;  4CY8 A;  5BMU A;  3GN3 A;  1TK5 B;  3FZ5 A;  2O87 A;  5B8A A;  3SBC A;  1QXH A;  4TRX A;  2IFQ A;  1R7H A;  2PBJ A;  2PGT A;  4V2L A;  2JAC A;  3F3R A;  2HRK A;  5H5R A;  3FEU A;  1PSQ A;  1ERW A;  3A5I A;  4TXO B;  3LYK A;  1VF2 A;  1XWK A;  5ELG A;  1FAA A;  1T8E B;  2LJA A;  4LL4 B;  4Z2U A;  2VCV A;  3ZFB A;  3TRP A;  4O5Q A;  4GCI A;  4PX1 A;  2DJK A;  1URM A;  3G7I A;  3MIX A;  5HFG A;  1E2Y A;  3KMN A;  3M0F A;  4MA9 A;  1GSS A;  4DSS A;  5JWO B;  1PMT A;  2QSI A;  5IPH A;  2QA2 A;  2VD0 A;  3GRX A;  4EDZ A;  2F3M A;  2XBI A;  1TU8 A;  1SD9 A;  4FIW A;  2LJR A;  2GZY A;  3EPT A;  3BD2 A;  3QPM A;  5F06 A;  4RI6 A;  1XW9 A;  4ULX A;  1PX6 A;  2CA8 A;  4ZIL A;  2NBS A;  2OAC A;  4TXV A;  4PQH A;  1GSQ A;  2NVL A;  3LG6 A;  3GUS A;  5CAX A;  2ZCT A;  2N5F A;  2K8S A;  2YNX A;  3QR6 A;  5CP1 A;  1UVZ A;  18GS A;  3IHG A;  2HI7 A;  4ZB8 A;  10GS A;  5ECL B;  12GS A;  3GIX A;  3QMX A;  2LNT A;  1JLV A;  1OE8 A;  3F0I A;  4KA0 A;  2FLS A;  2LQQ A;  6GSS A;  1XPV A;  3O3T A;  2O8V B;  1TRV A;  1GL8 A;  4RI7 A;  3L0H A;  3GKN A;  4TKY A;  3UIW A;  1RQM A;  1PL2 A;  2HXK A;  2R0C A;  2YWN A;  1WRY A;  4IP1 A;  2YP6 A;  2C8U A;  2LTK A;  3EYT A;  1GUM A;  1EWX A;  3QD9 A;  4GRF A;  1EEJ A;  3IC4 A;  5HR1 A;  1J0F A;  4O32 A;  4ILF A;  2OBK A;  4PTS A;  4ZIJ A;  3ME8 A;  1OAZ A;  1R5A A;  2DC5 A;  2L4Q A;  3VFI A;  1WE0 A;  3FY7 A;  3GH9 A;  1CQH A;  1XWG A;  3KH9 A;  4G0L A;  2HT9 A;  4XS1 A;  2FNO A;  3L9S A;  4TR1 B;  1YZX A;  1XXU A;  1B9X C;  1TI1 A;  3HJP A;  4TVE A;  1GSY A;  3ZL5 A;  1SL2 B;  5KN3 A;  2R0G A;  4HJM A;  2ES7 A;  5DJL A;  1O73 A;  1GTI A;  3FKF A;  2L6C A;  3VWU A;  1PD2 1;  4ML6 A;  4RUV A;  4X4J A;  4IVF A;  4KDY A;  3UJ1 A;  2JAD A;  1V40 A;  2RII A;  4XIH A;  1FO5 A;  1GSD A;  5GZZ B;  2X4A A;  3UVH A;  4F0B A;  1PKZ A;  2X8C A;  2L5O A;  5AIV A;  3IXR A;  2E2M A;  2IMK A;  1M7T A;  13GS A;  2FWH A;  1T4Z A;  4L8E A;  1WIK A;  1BJX A;  3TCO A;  2H8L A;  5G31 A;  1U3I A;  5ID2 A;  4O5U A;  1XOB A;  1XVQ A;  1LU4 A;  2C0G A;  2HZF A;  2LRC A;  2R0P A;  4DSQ A;  2H6X A;  2YOI A;  1GNW A;  1YF1 A;  2QGV A;  1T3B A;  2C0D A;  2CV4 A;  3RDW A;  2H74 A;  2LQO A;  3FW2 A;  1XVW A;  4GQC A;  1ERV A;  5COH A;  3D21 A;  2I81 A;  4IBP A;  2KUC A;  3PGT A;  5IO0 A;  4WR5 A;  1HNC A;  5CRE A;  3BJ5 A;  4PUF C;  5H5Q A;  2DKH A;  2DIZ A;  2EC4 A;  2BMX A;  2C3N A;  3IBH A;  5DQY A;  1A2M A;  4JRR A;  4TN8 A;  3SWL A;  2OKA A;  4MH3 A;  1A23 A;  1KNG A;  4TOP A;  2GT5 A;  1S3D A;  4FYB A;  4OD7 A;  4POK A;  1XW6 A;  4X1U A;  3DVW A;  3LWA A;  6GST A;  4OO5 A;  2REM A;  2WZ9 A;  3IC8 A;  2HSM A;  2X8H A;  1JZW A;  3TJB A;  4NPB A;  4F82 A;  2FWE A;  3C73 A;  4BL7 B;  2A2P A;  3VWX A;  4TXO A;  2V32 A;  4EUY A;  4K7O A;  3PPU A;  3D4T A;  3F6F A;  2BTO T;  3TKP A;  5G2Z A;  3DD3 A;  4EE0 A;  5AIX A;  2MBT A;  2H1B A;  3QCP A;  3A5W A;  2H0G A;  2WFC A;  4G10 A;  2VLU A;  3APQ A;  3ZVJ A;  4EF0 A;  2WDU A;  3TJF A;  1OC8 A;  2VCW A;  2M80 A;  2H6Y A;  2VCZ A;  1SD8 A;  3HVX A;  4MJB A;  1G7E A;  1XCC A;  3EMP A;  4F03 A;  2GVP A;  4F9Z A;  2HSH A;  1YF0 A;  3VPT A;  2GSR A;  5G5F A;  5B6M A;  1XWA A;  5KOX A;  2GDR A;  4LA1 A;  5DAL B;  3D5J A;  4GLT A;  1XOA A;  3CTF A;  1WWJ A;  7GSS A;  2LUS A;  2CVK A;  3HZ8 A;  3MDK A;  2G0F A;  3MWH A;  4KSO A;  5F0G A;  4IEL A;  4KND A;  2MMO A;  1F3B A;  3G7J A;  4WXT A;  4IQA A;  1O81 A;  1GUK A;  4NXI A;  2P0G A;  4CDO A;  4HZ4 A;  1M9B A;  3ZVJ D;  5IPG A;  2IMI A;  1RK4 A;  3F9U A;  3TOU A;  2DJ1 A;  4PUA A;  2HRA A;  4AF2 A;  1H4O A;  1VRS D;  3CSH A;  3FMW A;  4N0Z A;  1DBY A;  1USB A;  4I8B A;  3ZZX A;  1O6J A;  4EKZ A;  2KOK A;  1AUC A;  1JZR A;  2HZE A;  1YY7 A;  3E3E A;  2H71 A;  2O85 A;  3NZN A;  2TRX A;  2P31 A;  3IDV A;  2LST A;  1HNB A;  4PNF A;  2UZ8 A;  3ZFL A;  1G0T A;  3H8Q A;  4IW9 A;  5ABR A;  2VOC A;  3LYP A;  6GSW A;  3DEX A;  3QAG A;  1TOF A;  4TR1 A;  1MD4 A;  4EVM A;  1B9Y C;  2QA1 A;  1SEN A;  2K6V A;  1WP0 A;  4HS1 A;  3RPN A;  4KF9 A;  4V2M A;  3L9V A;  3F3Q A;  3TJK A;  4RQR A;  5EL8 A;  3ME7 A;  1Y6E A;  2GST A;  5DCG A;  3TRX A;  4X0X A;  2B6M A;  1K0C A;  4HQZ A;  2C3Q A;  3VUR A;  1EEM A;  4Q5R A;  3CBU A;  1ON4 A;  2FUG 2;  3PH9 A;  4XTS A;  2F8A A;  14GS A;  3P7X A;  1Z3E A;  4TW5 A;  2K9F A;  4K9Z A;  1FB6 A;  1SYR A;  4XCS A;  3O6T A;  1G6Y A;  2OBI A;  4ZL8 A;  1TJD A;  3GSS A;  4DSR A;  1AXD A;  4V2N A;  1NSW A;  5ECN B;  1A0F A;  3HXS A;  4FH8 A;  5CNW A;  3A2W A;  1S3A A;  6GSY A;  1SKS B;  2IMF A;  5A4U A;  3FZA A;  2MZC A;  2MMA A;  3QFB C;  2GS3 A;  4E8E A;  2X99 A;  3F6D A;  3A2X A;  5INY A;  3RAZ A;  4YAV A;  3DYR A;  2FD3 A;  4GST A;  4KDU A;  2AV4 A;  2F8F A;  5ECI B;  2AJQ B;  1H75 A;  2RM5 A;  1GLQ A;  2ZUP A;  3QAW A;  3IPZ A;  3FR3 A;  2VM1 A;  2FWG A;  1AQV A;  2V6O A;  3UBL A;  4EC0 A;  4J57 E;  1KBN A;  1V58 A;  4K8M A;  3IHQ A;  4HI7 A;  2H1G A;  2PU9 C;  2JL4 A;  3GKK A;  1DSB A;  3BBY A;  4IGJ A;  2L6D A;  2P5Q A;  1AIU A;  5LCZ A;  5J4U A;  4RQX A;  4I2T A;  2I3Y A;  3I69 A;  3FZ4 A;  1U3A A;  1M9A A;  3LEF A;  8GSS A;  1TRS A;  2RM6 A;  2VL2 C;  2LV3 A;  4NAX A;  3GA4 A;  2Z9S A;  2X64 A;  4BL7 A;  4AJ6 A;  3MYD A;  1FVJ A;  4K7N A;  2H76 A;  3LGC A;  3UOM A;  1AC1 A;  5FT3 A;  3ZIT A;  4MCU A;  1K3Y A;  2HRN A;  4OWY A;  2ZNM A;  1TK0 B;  4TR4 A;  1YKC A;  3CSJ A;  4ECJ A;  3EMX A;  4K0N A;  4L5L A;  4ML1 A;  1GTB A;  2XHF A;  5J41 A;  3WGX A;  3TGZ A;  3EIN A;  3H1N A;  3L9U A;  4IKH A;  3TUE A;  5DCH A;  1I5G A;  3ZML A;  2I4A A;  4MJE A;  2XBQ A;  3TB2 A;  4ZBA A;  2CX4 A;  4HU9 A;  2C4J A;  3FR6 A;  5DAL A;  1K3O A;  3RPP A;  3UL3 A;  3DIE A;  1SL1 B;  4BWQ A;  5EY6 A;  5J3R A;  3UVT A;  2LEG A;  4OCE A;  1N2A A;  2L59 A;  4ICY A;  2HSY A;  3I9V 2;  3GUR A;  3KJY A;  3F4S A;  3RHB A;  4NV5 A;  3PIN A;  1XZO A;  3D0Z A;  1SK0 A;  2VCT A;  2WJU A;  4K6X A;  1VF1 A;  1X5D A;  4JU5 A;  4BVY B;  3FYG A;  5DQS A;  4JE1 A;  2XC2 A;  1J9B A;  1T1V A;  4G0I A;  2MYG A;  2JSZ A;  1ZCP A;  6GSV A;  1QK8 A;  4ZBD A;  1B4P A;  3W8J A;  2K18 A;  3IAS 2;  4BA7 A;  3I43 A;  4YQU A;  3ZRD A;  3A2V A;  4HEA 2;  5D9X A;  3CRT A;  5IMF A;  2CZ2 A;  2YN1 A;  3F63 A;  2E0Q A;  1EGR A;  4ZL7 A;  3F4R A;  4JR4 A;  4YQV A;  2LRN A;  2FHE A;  3IK7 A;  1XW5 A;  1PX7 A;  3LOR A;  3IA1 A;  1CQG A;  4BWS A;  5A4V A;  2YJ7 A;  5AGY A;  5F07 A;  3IRA A;  2AB6 A;  4L0U A;  2YV9 A;  3P2A A;  2C80 A;  3ISO A;  4MJA A;  1F6M C;  2R5G A;  4JR6 A;  4QL9 A;  1BG5 A;  1UN2 A;  1ZOF A;  2J9H A;  2QC7 A;  4MF6 A;  2CQ9 A;  3GST A;  5JWR B;  1R26 A;  1F9M A;  4YH2 A;  1DUG A;  1JLW A;  1HNA A;  1TDI A;  1J08 A;  3C1S A;  3TJJ A;  4XS6 A;  1XWC A;  4BPY A;  1M2A A;  2K8V A;  2GTU A;  1GNE A;  3KH7 A;  4X43 A;  5FHI A;  5IM9 A;  1R5P A;  4CY6 A;  4Q5F A;  5ELA A;  3M9K A;  1XIY A;  2YV7 A;  3HCZ A;  2B7J A;  5FWG A;  3Q19 A;  3W6G A;  2GSS A;  5D73 A;  4HQS A;  3GKX A;  4MZB A;  3GH6 A;  2DKI A;  3CMI A;  5ECH B;  2OE0 A;  11GS A;  3C8E A;  5CRG A;  1UC7 A;  5H5S A;  2FCH A;  2B1L A;  3FRC A;  4MAB A;  2B5X A;  1JFU A;  2RLI A;  2GQL A;  4I5Q A;  1YKA A;  1THO A;  4DEJ A;  2H0I A;  3DML A;  3R2Q A;  1XBS A;  5AIS A;  3D22 A;  5ECP B;  2PPT A;  2D2Z A;  2IN3 A;  4ACS A;  1QUW A;  3NOF A;  5HFK A;  3Q6O A;  1Z6M A;  4O92 A;  4ZB6 A;  2F51 A;  1MEK A;  1OKD A;  3HJM A;  3Q74 A;  2RUE A;  3KD0 A;  3KZQ A;  4F2I A;  1B4Q A;  1ABA A;  3F4T A;  2VLV A;  3KTB A;  4MPF A;  19GS A;  9GSS A;  3WGD A;  4I97 A;  2HRF A;  4WET A;  1K0A A;  2IJY A;  4QQ7 A;  5L71 A;  2GZP A;  2GZZ A;  1OE7 A;  5IMV A;  4FQU A;  1FOH A;  3BCK A;  1TW9 A;  1GTA A;  3KP8 A;  4V1A g;  1U6T A;  4MJC A;  2H0H A;  4GWR A;  1TI3 A;  4K5R A;  3TKS A;  3G7Y A;  4HJ2 A;  1SU9 A;  3UAR A;  5IMA A;  4N30 A;  3TKR A;  1X9S B;  1MD3 A;  4J56 E;  2GT6 A;  2DSA A;  1FB0 A;  3ZIV A;  3S9F A;  3ZMK A;  5GAP D;  1O8W A;  4ZXG A;  5EVO A;  2ON7 A;  2OE1 A;  3UBK A;  4IHU A;  1R4W A;  1EZK A;  5G5E A;  4USS A;  3HJO A;  1K3L A;  1KEB A;  4WF5 A;  5D9V A;  1PKW A;  1ZGN A;  4WBJ A;  2E7P A;  2H19 A;  1S3C A;  4Q5N A;  2XPD A;  1V9W A;  4K2X A;  5ENU A;  4MZW A;  3GX8 A;  5HR3 A;  5BRT A;  2L4C A;  1A0R P;  4V1A p;  1K0N A;  2WB9 A;  2PN8 A;  4KH7 A;  2OAD A;  1NM3 A;  2FA4 A;  3HY2 A;  2MBS A;  1AQW A;  2FWF A;  4IQ1 A;  2HYX A;  3FZ9 A;  4MPG A;  1FVK A;  1M0U A;  2KHP A;  2IMD A;  1X9M B;  1TTZ A;  5IO2 A;  4OMV A;  4EXJ A;  3QAV A;  1Q98 A;  5JWQ B;  2B5E A;  3RBT A;  1O7U A;  1BED A;  3D4M A;  3HYP A;  4YQM A;  2VM2 A;  1A24 A;  2V1M A;  5IMD A;  4BVY A;  3CRU A;  4ZL9 A;  17GS A;  4KE3 A;  4POL A;  4MNN A;  4OO4 A;  5DAK B;  2TRC P;  2WCI A;  4LMW A;  4ECB A;  2AAW A;  2B1K A;  3DWV A;  1IYH A;  4IJ3 A;  3BOA A;  1GSU A;  1K0D A;  1ST9 A;  2PVO C;  5A5K A;  4MK3 A;  3C1R A;  4HU7 A;  4KW6 A;  3PR8 A;  1VF3 A;  3CTG A;  1ZYN A;  5D8I A;  2CT6 A;  3H4K A;  4I6X A;  2YPM A;  3N9J A;  1TP9 A;  3CXG A;  2HFD A;  1T4Y A;  3MSZ A;  1MDK A;  3EC3 A;  2HNL A;  3IAM 2;  4G9H A;  4XRA A;  5G1K A;  1I9D A;  3GV1 A;  3HVS A;  4YKG A;  3GL3 A;  3KIJ A;  4EDY A;  1YEX A;  1GUH A;  1V2A A;  1SJZ A;  4CW9 A;  4PQ1 A;  1B48 A;  4MP4 A;  1LBK A;  5E59 A;  3LFL A;  2A4V A;  5CO3 A;  2YJH A;  3AY8 A;  2CX3 A;  4XS4 B;  3D6I A;  2LS5 A;  1OKT A;  1PN0 A;  1F2E A;  3DXB A;  4YKF A;  1O8X A;  3IR4 A;  3WT2 A;  1C72 A;  1WMJ A;  2GQM A;  5C04 A;  2DBC A;  1NW2 A;  1JHB A;  2VCQ A;  4L0W A;  1SL0 B;  3QDN A;  4EIP A;  6GSX A;  1WPI A;  1K0O A;  1ACV A;  1TRU A;  3ERG A;  2H6Z A;  5B6N A;  1ZL9 A;  5E4W A;  2OE3 A;  1DE1 A;  3WD6 A;  3ZRE A;  2FGX A;  1UA5 A;  3GYK A;  2I9H A;  3KXO A;  2LKU A;  5CYY A;  4L5O A;  2R4V A;  5C00 A;  4PXO A;  3QOU A;  3VI7 A;  1A8Y A;  4JBB A;  2N5A A;  1Z6N A;  3EE2 A;  2DMM A;  3FR9 A;  1W4V A;  1PQN A;  2ALB A;  2NDO A;  1LJR A;  2VAF A;  2LRT A;  2DML A;  3FK8 A;  4OCF A;  4D73 B;  2G2Q A;  3LSZ A;  3ERW A;  2E2G A;  3LQ7 A;  1ZYP A;  2WUL A;  2JU5 A;  1AQX A;  4ECI A;  3DRN A;  1ZYE A;  1G7O A;  3CSI A;  4N11 A;  1X9W B;  4KSM A;  1EP7 A;  4ECC A;  1EV9 A;  3TRQ A;  3KP9 A;  5LD0 A;  4KB3 A;  1B8X A;  3K8N A;  2V6K A;  2H1D A;  1PGT A;  2YAN A;  2AHE A;  2EIR A;  5LNK e;  3P90 A;  4BVX B;  2FY6 A;  2HLS A;  2WS2 A;  1FG4 A;  1AAZ A;  4Z2R A;  4POB A;  1G6W A;  3IE3 A;  2H01 A;  3EUR A;  3L78 A;  4NMU A;  5B8B A;  3KTL A;  3EVI A;  3U5R E;  3HDC A;  2VLT A;  1AW9 A;  4G0K A;  1OYJ A;  3TKS C;  3J7Y b;  3IOS A;  2DJ2 A;  4OFT A;  3MAK A;  5ECK B;  2DJ3 A;  1BX9 A;  3M3M A;  3N5O A;  4KGI A;  3W8S A;  1XFL A;  5CRD A;  1SKW B;  5J9B A;  1Q4J A;  4Z7X A;  4WBR D;  4E8H A;  2HE3 A;  3ZTL A;  1M99 A;  3C7M A;  3VWW A;  5CRW A;  3R3E A;  2NTO A;  1JZD A;  4FYU A;  3LXT A;  3RHC A;  5G30 A;  2A2R A;  1MTC A;  1FHE A;  1N8J A;  4PQI A;  3UAP A;  4K7I A;  2VL3 A;  2O7K A;  4GXZ A;  2C1Y A;  4PNG A;  5DAK A;  4IS0 A;  5ECM B;  4IP6 A;  5DVB A;  1TXX A;  4F0C A;  4KDX A;  1HQO A;  3GNJ A;  1ILO A;  1OC3 A;  3TJG A;  2GGT A;  3H93 A;  1GUL A;  4KAE A;  5IOX A;  5J9C A;  4HZ2 A;  4YAP A;  4DVC A;  16GS A;  4N0V A;  4GTU A;  4MMM A;  2HZE B;  5HR2 A;  3F8U A;  3I6A A;  2VD1 A;  2DLX A;  4J2F A;  4CHS A;  4KCE A;  2KP1 A;  1E6B A;  1SYX A;  4MH2 A;  3VI5 A;  1SJ6 A;  4H86 A;  3QFA C;  3APS A;  3H79 A;  5HQP A;  3A3T A;  1ERU A;  4EO3 A;  5KN1 A;  5F05 A;  4GSN A;  2A4H A;  2DJ0 A;  4MF5 A;  4PGT A;  3EWL A;  2H30 A;  3HVV A;  4GSS A;  3HKR A;  2O89 A;  2B5Y A;  2BJX A;  3E9J B;  5DDL A;  1T00 A;  3GKM A;  5D93 A;  4O7H A;  5HR0 A;  3TKQ A;  2MMZ A;  2CZ3 A;  4NWY A;  1U87 A;  4XS4 A;  3ERF A;  1OVN A;  3ZYW A;  3LJR A;  1ZMA A;  3KMO A;  4G19 A;  3IV4 A;  4MF7 A;  4IN0 A;  2C3T A;  4NV2 A;  3U6V A;  3GTU B;  1QGV A;  2M72 A;  1NHO A;  3GX0 A;  6GSU A;  4P3Y B;  1V57 A;  1OC9 B;  2M46 A;  3E0U A;  5KEJ A;  3KGK A;  1WJK A;  4FYC A;  5D9T A;  1X5E A;  5GAN D;  2CAQ A;  3EU4 A;  2VIM A;  1EV4 A;  5JCU A;  2QKE A;  3L4N A;  1PN9 A;  4A5P A;  1EOH A;  2H73 A;  3HA9 A;  4XRD A;  1YQ1 A;  2R37 A;  2CVB A;  1GTU A;  2P5R A;  1SK1 A;  2JZS A;  3NIV A;  1WOU A;  4LMV A;  4FO5 A;  5A4W A;  2YWI A;  2JZT A;  5DBQ A;  3ZLP A;  2VL2 A;  3GMF A;  5IMC A;  1GSF A;  1ZYQ B;  4D73 A;  2LJK A;  4AJ8 A;  1SKR B;  2L5L A;  1XWB A;  3GL5 A;  4QL7 A;  5GSS A;  1TK8 B;  1O85 A;  3ZIJ A;  1K0B A;  3HZ4 A;  1GRX A;  3WT1 A;  4GQF A;  1FW1 A;  2R2J A;  1Z7P A;  4OFN A;  3VPQ A;  2AUV A;  2IFQ B;  1THX A;  3V1W A;  4Z2T A;  2PER A;  4WR4 A;  3VLN A;  1A8L A;  4EL1 A;  2PUK C;  1TU7 A;  2C0F A;  2H72 A;  2IME A;  4IJI A;  1X5C A;  5ECS A;  1VGL A;  1TKD B;  4K0G A;  3M9J A;  3DGQ A;  1NHY A;  4MLY A;  2VCX A;  4BVX A;  4WKW A;  5KN0 A;  3M8N A;  5D96 A;  1Z5Y E;  4WEY A;  1MDI A;  2NPB A;  3JCM L;  4NHZ A;  2EIQ A;  1FOV A;  5KOW A;  1W89 A;  1PRX A;  4ZB9 A;  1K0M A;  2V2G A;  5B7C A;  2YZU A;  4KUN A;  1YDK A;  5D9W A;  1HYU A;  1M2B A;  3P8W A;  5GST A;  4DSS B;  1F3A A;  3C71 A;  3APO A;  4EIQ A;  5IIZ A;  1A2L A;  1IYI A;  4KX4 A;  3TKS E;  5DJM A;  2XPE A;  5J5N A;  2IIY A;  4K5S A;  1GSE A;  2YWM A;  4AGS A;  2H75 A;  1A2J A;  1VF4 A;  2KP2 A;  2YWO A;  2A2S A;  3VK9 A;  2L57 A;  2B3S A;  2GLR A;  1TRW A;  4XHM A;  2OA7 A;  1RW1 A;  2YZH A;  1V98 A;  1U88 A;  3WYW A;  3VWV A;  2DIY A;  2PWJ A;  4HUA A;  1EGO A;  4OFM A;  2KLX A;  2AYT A;  2J23 A;  2GSQ A;  3IK9 A;  4I2U A;  4O5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...