5ID2B

Asymmetry in the active site of mycobacterium tuberculosis ahpe upon exposure to mycothiol
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
157
structure length
157
Chain Sequence
HPMVMLNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGICQGELDQLRDHLPEFENDDSAALAISVGPPPTHKIWATQSGFTFPLLSDFWPHGAVSQAYGVFNEQAGIANRGTFVVDRSGIIRFAEMKQPGEVRDQRLWTDALAALTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative peroxiredoxin Rv2238c
publication title Redox chemistry of Mycobacterium tuberculosis alkylhydroperoxide reductase E (AhpE): Structural and mechanistic insight into a mycoredoxin-1 independent reductive pathway of AhpE via mycothiol
pubmed doi rcsb
source organism Mycobacterium tuberculosis h37rv
total genus 54
structure length 157
sequence length 157
chains with identical sequence C
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2016-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5id2B00
1H4OA 5IIZA 4K0GA 2OBIA 4ZIJA 3TKSA 1XOAA 2OACA 2LRCA 3S9FA 1DE1A 3C73A 3GURA 4ML1A 2VCXA 5CRGA 3VWXA 5IMFA 2IMDA 3IDVA 4D73B 1Y6EA 1NM3A 2OE1A 2YANA 3TOTA 3EVIA 3WGDA 2CQ9A 3GA4A 4EVMA 2OA7A 3O76A 2H76A 2M80A 1GLQA 4ZL9A 4DSRA 4MJAA 1EEJA 5KN1A 2R37A 1OE8A 4I6XA 2KOKA 2FWGA 1CQGA 3IA1A 4WR5A 4KX4A 3GKXA 2C3QA 3EU4A 3P8WA 1ZOFA 4MP4A 4TN8A 1T4ZA 4IN0A 3QOUA 5IMZA 2GTUA 3M0FA 2JACA 2QC7A 3DXBA 1X5EA 6GSTA 1GL8A 3D21A 2HLSA 4MJCA 5CP1A 5JWQB 1GWCA 2VAFA 1ZL9A 3E9JB 5D8IA 4GSTA 1Z7PA 5KEJA 3CSJA 1TP9A 4XCSA 2AV4A 3MNGA 4AJ6A 3UBKA 4RQXA 2HT9A 1YDKA 3EINA 4IJ3A 3ZMLA 4WXTA 2V6KA 1G7EA 6GSSA 4TW5A 2K18A 5L71A 1Z6NA 1ZYEA 1WOUA 2IJYA 3LSZA 3ME8A 4EO3A 2WFCA 3IOSA 5LD0A 1GH2A 3L9SA 3J7Yb 2J9HA 1XW6A 3UVTA 5F07A 1PA3A 5B6NA 3APSA 2E0QA 4HI7A 4KAEA 1KEBA 3QMXA 4WF4A 1V2AA 5F06A 3HVXA 1PKWA 5FHIA 3TJGA 3CTFA 4HJ2A 1X5DA 4DEJA 1PGTA 3GL5A 3IC4A 3ZIJA 2XHFA 3GX0A 1EWXA 2V1MA 3FZ4A 1R26A 3GV1A 1PX7A 1XFLA 1W4VA 2VM2A 3GX8A 3DGQA 3RPPA 1B9XC 13GSA 3VWUA 3PR8A 1MD3A 5D9WA 5A5KA 11GSA 1FB6A 4WKWA 4ZL8A 4KW6A 1XPVA 1SK2A 3HDCA 4PURA 5CYYA 4EDZA 5CREA 4G19A 3A2WA 4TR1B 5B8AA 2A2RA 1TDIA 5FT3A 2YZUA 4EDYA 1SKWB 2HSHA 3IR4A 1XXUA 1MEKA 3ZTLA 2GQLA 5ID2B 5CRWA 4F0BA 2OE3A 1LU4A 2ON7A 4H86A 4XHMA 3CTGA 5EY6A 5LCZA 2C0EA 2HZFA 1A2JA 4Q5FA 4K6XA 2H19A 2YZHA 4PNGA 1SL1B 4OWYA 3KIJA 4JU5A 5DALA 2B7JA 2HNLA 1J08A 4OO5A 2L6CA 3GFKA 5J4UA 3IK7A 1KBNA 4N30A 3UBLA 1HD2A 2FWFA 1FHEA 3IAS2 1QXHA 5DBQA 1O7UA 2GDRA 4MDCA 1Z3EA 3TB2A 2YPMA 1U87A 1HNAA 2FGXA 2R6KA 3KTBA 4ZXGA 4ZILA 4QL9A 1TI1A 1ZCPA 2YN1A 1VF3A 2DIZA 4Q5RA 1ST9A 3M9KA 5H5QA 4FO5A 5ECSA 2B3SA 1AW9A 4GSSA 3FR6A 1AC1A 5LNKe 4E8EA 1YZXA 3FZ9A 4BWQA 1RK4A 1FW1A 4ECJA 1FOVA 3P2AA 1EGOA 1TK0B 2JU5A 2NVLA 4MK3A 3LEFA 3IV4A 2QGVA 1A23A 3US3A 3KEBA 2H6YA 2VCWA 1URMA 1EZKA 3A2XA 4L5OA 2ES7A 4ACSA 3D22A 2NTOA 3RHCA 4GQCA 3ZL5A 2H75A 4TRXA 4I5QA 3FZAA 5G1KA 2YNXA 1OC9A 2DMLA 4F9ZA 1SENA 2WS2A 2WGRA 4MABA 1IYHA 2GZPA 4IVFA 1TU7A 5IPGA 3I9V2 4TXOB 2RM6A 3HVVA 3IBHA 1EEMA 3QD9A 4MJEA 2CV4A 4X0XA 3OR5A 1U88A 2MMAA 4CW9A 2K8VA 1TKDB 1W89A 5ECMB 3RBTA 1B48A 2H1BA 5EPFA 3KD0A 1ON4A 2LJRA 1ERUA 3FHKA 7GSSA 2AB6A 3L78A 2VCZA 3ZFLA 2X99A 3SWLA 2MBTA 4J56E 4TR4A 1SKRB 2VIMA 5B8BA 4WF5A 1N8JA 2DJ3A 3H4KA 1WMJA 3MAKA 2MMNA 5G1LA 4RQRA 1GTUA 3HZ8A 4MMMA 5HFIA 3IAM2 2YOIA 2FWEA 5DQSA 3CXGA 1NSWA 2JZRA 2C4JA 5DAKA 1V58A 1GSYA 3VPTA 4TR3A 2O7KA 2HZEA 2LEGA 5CAXA 1DUGA 4V2MA 3EYTA 1XWKA 2WRTA 3IXRA 5J9CA 5ELGA 5F8BA 4LMVA 4KSMA 4ECIA 5F05A 2MBSA 1THXA 3D4TA 2VL2A 2PN8A 5G2ZA 1G6YA 2TIRA 5H5RA 1BG5A 3MWHA 4HDEA 1YJ6A 2H1DA 2GQMA 4HOJA 1G0TA 5CO3A 5F0GA 2X8HA 3H1NA 4O5RA 20GSA 2VLVA 1IYIA 1GUHA 4KGIA 4YQMA 3QAVA 1XCCA 1ML6A 3HJPA 1DE2A 3LFLA 2D2ZA 5C00A 3UJ1A 3TJBA 4AJ7A 3BCIA 3TJKA 1JZOA 3ZYWA 2V41A 3TKPA 4HU7A 1TXXA 3MSZA 4POKA 1K0DA 4ZBDA 4JEDA 4EKZA 1T7PB 4JE1A 3TJFA 3F3RA 3FEUA 4KUNA 5DCHA 2JADA 4Q5NA 2GSTA 2B5YA 2NDOA 1JFUA 4HQSA 2VD0A 2XC2A 4IHUA 5HR2A 1PN9A 1PD21 1FVKA 3EE2A 2KP2A 2L5LA 1EV9A 4RI6A 1X0RA 4PQHA 1AUCA 2LQQA 3VI5A 2M72A 2VOCA 6GSWA 2DJ0A 3D5JA 4N0ZA 1O81A 1KTEA 5CNWA 5HR1A 3BD2A 4RUVA 4ZL7A 1G6WA 2H73A 2C3TA 4IKHA 3UIWA 1HNBA 2DJJA 4NPBA 5IO2A 5E4WA 4I2TA 3TRQA 2L6DA 3IRAA 4F2IA 3TKRA 2IMEA 2K8SA 4XS4A 3C8EA 1OKTA 3U6VA 1TRSA 4E8HA 1LJRA 2B1KA 4PQ1A 3GHAA 3ED3A 2LJAA 2VD1A 1WPIA 1XBSA 1T1VA 1A2MA 2LUSA 2WZ9A 2CZ2A 4NHWA 3TKSC 2JL4A 4K7OA 3W8SA 4IQAA 3G7IA 5IMCA 3K8NA 4KDYA 3ISOA 4ECBA 1TRVA 2ALBA 4TKYA 4ML6A 2DC5A 4DVCA 4EUYA 5ECOB 1F37A 4XRAA 5DALB 3HYPA 4L0WA 2VL9A 1NHYA 1A24A 1YQ1A 4GSNA 3HJOA 4BWSA 3KCMA 2DMMA 2IFQA 3BJ5A 3Q18A 3EURA 2H01A 1M0UA 2K6VA 4GTUA 3TDGA 1PX6A 4O32A 1BQ7A 1WP0A 4IP1A 4EF0A 3E3EA 1HNCA 2IIYA 4MF7A 5GZZB 1T3BA 4GF0A 2AYTA 1SYXA 2AHEA 3ZFBA 1YKAA 4EC0A 3JCML 2X8CA 2LRNA 1Z7RA 1K0BA 4KNDA 1XVWA 2WULA 2XPEA 3QFAC 2YV9A 2TRXA 1PKZA 2PU9C 3GRXA 5IPHA 4YAPA 1U3IA 4QL7A 1ERVA 1I5GA 3ZZXA 2ZNMA 2PGTA 1J0FA 1JLWA 9GSSA 3C1RA 3L0HA 5J5NA 1BEDA 1TRUA 1TOFA 4OCEA 3RAZA 2LJKA 1X5CA 2YV7A 4WEYA 3LXZA 1XW9A 2LV3A 4KA0A 4JRRA 5D9TA 4X1UA 4LLRA 2HI7A 4BPYA 2C1YA 2AUVA 1M9BA 3G7JA 2YWMA 3CRTA 2LTKA 2F8AA 5DJLA 3GKMA 3KXOA 1A2LA 3KH9A 1SJ6A 1T00A 3FYGA 1K0NA 3ZLPA 1DBYA 3LJRA 4MZCA 1SL0B 10GSA 4I2UA 4KH7A 5HFGA 3EMXA 3GL3A 1FVJA 3WGXA 1A8LA 2M46A 3FY7A 1SJIA 3C7MA 3GH9A 3VFIA 3TCOA 1F2EA 3CSHA 5ECLB 2YJHA 5GSSA 2GZZA 3MDKA 3I69A 5G30A 2L5OA 4DSSB 2V32A 4NXIA 2KLXA 1X9WB 4EXJA 2P0GA 2B6MA 2CX3A 1EP8A 2GVPA 3EC3A 2DJKA 3RHBA 1USBA 2R2JA 1M2BA 3ZRDA 4MCUA 1K3YA 4LL4B 1HYUA 1TRWA 5DAKB 1CQHA 4F82A 2FA8A 4GLTA 2HZEB 1JLVA 1OVNA 1BYEA 2TRCP 1QUWA 1Z5YE 2K9FA 4ZBAA 1O6JA 4P3YB 1I9DA 2H0GA 3M1GA 3QAGA 5D96A 2IN3A 2YWNA 4OD7A 3CRUA 3Q6OA 4XTSA 2LS5A 4I97A 1B4QA 3F4SA 2VCQA 1TW9A 2EIOA 2H74A 5J9BA 4FYCA 2BJXA 5ECPB 3CYNA 4NHZA 5D9VA 2DIYA 4I8BA 3DIEA 2G0FA 4XS1A 1NHOA 1A0FA 1R5PA 1MDIA 3RDWA 4PX1A 2VUPA 5HFKA 1ZYQB 1OE7A 4AJ8A 4V2NA 4TVEA 18GSA 1Z9HA 1MD4A 3VI7A 1SD8A 4IGJA 3M9JA 2C80A 1PQNA 3ERFA 3KP9A 3GTUA 3FKFA 5J3RA 5GSTA 1F3BA 3M3MA 2L4QA 4K9ZA 3UARA 3TKSE 3DVXA 4JR6A 4OMVA 1GRXA 5JCWA 2OE0A 4HZ2A 3VWWA 3FZ5A 4MZWA 2ZCTA 2I3YA 1V9WA 1ZMAA 1K0MA 2E2GA 2E7PA 1SYRA 3GYKA 4FYUA 4ZB8A 3QAWA 1ZGNA 4HZ4A 2I4AA 4KSOA 1EOGA 2O85A 3W6GA 1B8XA 4KDXA 5FWGA 2DSAA 4F03A 3C71A 5HQPA 5G5FA 1ZZYA 3HKRA 3KMOA 2CAIA 2LRTA 4OO4A 2GQKA 3HXSA 4G9HA 2VCVA 2IMIA 1WWJA 1M99A 5EVOA 3LYKA 1GTAA 17GSA 2XBQA 4OFMA 2XPDA 2FHEA 3F6DA 4FH8A 1EV4A 3J7Yk 1PSQA 4OFNA 5C04A 1XVQA 4OFTA 5ELAA 5EL8A 3LWAA 2H6XA 4WR4A 2EIQA 2P5QA 4XS4B 1Q4JA 5G31A 3IPZA 5G5EA 3RPNA 2FA4A 1U3AA 3CBUA 2H0HA 2CVBA 3DYRA 4TXVA 1QFNA 2A4VA 3NZNA 2FCHA 3HZ4A 1SK0A 2PWJA 4ZB6A 1BX9A 2C8UA 3FRCA 2R3XA 2E2MA 4TR1A 3Q19A 3QR6A 4LA1A 2VM1A 5DDLA 2JSYA 3ZVJD 2MMZA 4ZBBA 5B7CA 5ID2A 1SKSB 4LMWA 3GSSA 3TUEA 4G10A 4K0NA 1PMTA 3APOA 1U6TA 3ZVJA 5B6MA 1AQVA 4XRDA 1FG4A 5HR0A 5AGYA 2CVKA 2LSTA 2C3NA 2V6OA 5JWOB 3O6TA 2HRFA 3UVHA 3LQ7A 3VURA 3ZIVA 4PXOA 1AQXA 4L0UA 4PUFC 5CRDA 2FNOA 2YJ7A 1GSUA 1SK1A 4BA7A 3TOUA 1XWBA 1VRSD 2PVQA 4XIHA 4KCEA 2GGTA 4FYBA 5DQYA 5KN0A 1SJZA 3D4MA 2VL2C 2RLIA 1R7HA 2LQOA 1S3AA 4L5LA 3VLNA 2H1AA 4YQUA 3VWVA 3FR9A 5ECHB 4KB3A 5IMDA 2PUKC 3AY8A 1OYJA 22GSA 3C1SA 2LKUA 1J9BA 2RM5A 3N9JA 1TK5B 2H72A 4NWYA 3KMNA 1F9MA 3HD5A 4GCIA 1X9SB 1OC8A 2IPAA 4J57E 2CA8A 3ERGA 2GSQA 1QMVA 4ID0A 2HXKA 5H5SA 3LYPA 3HVSA 1JZWA 3ZMKA 1GP1A 1JHBA 1TTZA 2CZ3A 4IP6A 4AGSA 3WD6A 2H1GA 1K3LA 4ECCA 2GSSA 2GS3A 2H8LA 1VF4A 2HYXA 3QPMA 4TXOA 5JWRB 2DJ2A 2RIIA 1B4PA 2N5FA 1PRXA 2I9HA 2O87A 1E2YA 2CAQA 3CMIA 2I1UA 1VF2A 1F3AA 1WRYA 4ULXA 1BAYA 2JSZA 4IBPA 5ABRA 2B1LA 4TOPA 3DD3A 4X43A 2OBKA 2AAWA 3UL3A 1WE0A 3F0IA 1JZDA 3WT1A 1YEXA 1R4WA 5IO0A 4CHSA 2NPBA 4HEA2 16GSA 4PQIA 5AN1A 2DLXA 2OKAA 2REMA 1ERWA 3W8JA 4ILFA 3M8NA 3KH7A 4O7HA 3KGKA 1THOA 1G7OA 1KNGA 1GUMA 2F9SA 2VL3A 4KE3A 1GNEA 1YKCA 1E6BA 2CX4A 4K1FA 1GTBA 4QQ7A 2R4VA 2HFDA 5ENUA 4YH2A 2OJLA 4NAXA 3DKSA 1M2DA 4NMUA 1M9AA 1T8EB 2B7KA 3F8UA 2AJQB 2WCIA 1WJKA 5CRHA 1BJXA 3GTUB 6GSXA 2RUEA 3Q74A 1SU9A 3WGEA 2IWTA 4L8EA 4MLYA 2BMXA 3KJYA 3EMPA 1O8XA 2V2GA 2MMOA 2F51A 2IL3A 1MDJA 2C0FA 1PL2A 1AAZA 1V98A 3VK9A 4ISDA 4IQ1A 3FR3A 2N5AA 3F3QA 5D73A 3LXTA 2OADA 1X9MB 1S3DA 2NBSA 3G7YA 4IW9A 4F0CA 1Y25A 4GRFA 4K8MA 4WBRD 3EU3A 4YQVA 1O85A 3TGZA 3GIXA 1OC9B 2F8FA 3TRXA 3HHVA 1DSBA 3A5WA 2YP6A 5D93A 1TJDA 4PGTA 1K3OA 1QGVA 4BL7A 4TR0A 1FAAA 4HUAA 4BVYA 1AXDA 5ECIB 2H6ZA 3D0ZA 1K0OA 2PPTA 12GSA 1C72A 2X64A 3DEXA 2RUFA 2KHPA 4Q5QA 1NW2A 3GMFA 2H0IA 2VO4A 1K0CA 3APQA 5INYA 6GSVA 4JR4A 2GZYA 3P7XA 4IELA 1TI3A 4FIWA 2O89A 4N0VA 4V2LA 1T4YA 2X8GA 4D73A 1GSDA 3A2VA 3DRNA 3TJJA 1GLPA 1V40A 5A4UA 3H93A 5ECRB 2IMKA 2CVDA 2GT6A 1MDKA 4PUAA 2C0DA 2H70A 1HQOA 2VLTA 2N5BA 2LNTA 1AIUA 4KCAA 6GSUA 4V1Ap 3TRPA 2PBJA 3WT2A 3PINA 1EOHA 2VLUA 1O73A 3ERWA 3FW2A 3GKKA 3F4TA 1R5AA 2L59A 3I6AA 1GNWA 4PNFA 1PL1A 4N10A 3BCKA 3F4RA 4IS0A 3HCZA 4XS6A 3EWLA 3N5OA 4GQFA 3DWVA 5AIXA 5A4WA 1A0RP 2DJ1A 2WJUA 1YF0A 4ZB9A 5IMAA 1WIKA 2MYGA 1XOBA 3FK8A 3LORA 1ILOA 3DMLA 4NV2A 3UEMA 5DVBA 3IHQA 1Z6MA 1GULA 1YF1A 2H71A 4IJIA 5J41A 2JZTA 3E0UA 4CDOA 4MA9A 1A8YA 1SD9A 5COHA 3F9UA 5GAND 3F63A 1MTCA 2JZSA 4EL1A 4MJBA 4MH2A 4MZBA 8GSSA 2QSIA 1K0AA 2FY6A 2GT5A 1Q98A 2CT6A 3GUSA 5HR3A 2QKEA 3UAPA 3KTLA 2R5GA 1B9YC 1UVZA 2GSRA 3V1WA 3DVWA 5E59A 2YWOA 4JBBA 5KN3A 3PH9A 5IOWA 3PGTA 2EC4A 2XBIA 3KZQA 5KN2A 2O8VB 2HRNA 2YWIA 3G9BA 4WETA 14GSA 4MPGA 2PMTA 1UC7A 1FB0A 1QQ2A 3QDNA 4V1Ag 4OCFA 1YEPA 5DCGA 1RQMA 4DSQA 4Z7XA 3IK9A 1YY7A 1SL2B 2FWHA 2A2SA 4O92A 1V57A 5DJMA 1M7TA 3KP8A 3HY2A 1XIYA 3LG6A 1EP7A 4BVXA 4HU9A 4G2EA 3D6IA 2HE3A 19GSA 1OC3A 4POLA 3HJMA 3ZITA 2PERA 2FD3A 3CSIA 1OKDA 1S3CA 3SBCA 1TK8B 5A4VA 5AIVA 4POBA 5AISA 3IE3A 1GUKA 2KP1A 4YAVA 4RI7A 1VF1A 1GSFA 3GH6A 3NOFA 1GSEA 3A3TA 2FUG2 4KDUA 2H66A 1H75A 5IMVA 3U5RE 4HQZA 4DSSA 2GLRA 4MF5A 1GTIA 2G2QA 1XWGA 3GKNA 1VGLA 4WBJA 4MPFA 3P90A 2WB9A 3NIVA 1N2AA 2BTOT 3L9UA 1OAZA 2KUCA 3LGCA 2FLSA 4MH3A 2L57A 3BOAA 2IFQB 4K2DA 1ERTA 4J2FA 5IOXA 1M2AA 2ZUPA 1UN2A 4POMA 3F6FA 1XW5A 2P31A 2H30A 1GSSA 4LL1B 1QK8A 5GAPD 1LBKA 5JCGA 1FO5A 2IMFA 1XZOA 3GSTA 3QCPA 3UMAA 5ECQB 3GN3A 1F6MC 1GSQA 3WYWA 4K7NA 1ACVA 2HSYA 5IM9A 1O8WA 4HS1A 1XWAA 3L4NA 2EIRA 2WDUA 3VPQA 1JZRA 3ZREA 4EE0A 5IQYA 3L9VA 2F3MA 6GSYA 2MZCA 1EGRA 3GNJA 3TKQA 3H79A 4NV5A 4K7IA 4N11A 3BBYA 2J23A 3R2QA 3O3TA 2I81A 2C0GA 3I43A 3H8QA 3ME7A 2DBCA 1TU8A 5D9XA 3QFBC 1RW1A 2P5RA 5ECNB 2VCTA 3HA9A 3UOMA 2LNSA 4GWRA 4GXZA 1XWCA 4JZQA 1UA5A 4MF6A 5ECKB 2L4CA 2PVOC 5JCUA 2YCDA 4HJMA 2B5EA 1ABAA 4AF2A 2ON5A 2Z9SA 1AQWA 2B5XA 3KM6A
chains in the Genus database with same CATH superfamily
1H4OA 5IIZA 4K0GA 2OBIA 4ZIJA 3TKSA 1XOAA 2OACA 2LRCA 3S9FA 1DE1A 3C73A 3GURA 4ML1A 2VCXA 5CRGA 3A5IA 3VWXA 5IMFA 2IMDA 3IDVA 4D73B 1Y6EA 1NM3A 2OE1A 2YANA 3TOTA 1ZYPA 3EVIA 3WGDA 2CQ9A 3GA4A 4EVMA 2OA7A 3O76A 2H76A 2M80A 1GLQA 4ZL9A 4DSRA 4MJAA 1EEJA 5KN1A 2R37A 1OE8A 4I6XA 2KOKA 2FWGA 1CQGA 3IA1A 4WR5A 2X4AA 4KX4A 3GKXA 2C3QA 3EU4A 3P8WA 1ZOFA 4MP4A 4TN8A 1T4ZA 4IN0A 3QOUA 2R0CA 5IMZA 2GTUA 3M0FA 2JACA 2QC7A 3DXBA 1X5EA 6GSTA 1GL8A 3D21A 2HLSA 4MJCA 5CP1A 5JWQB 1GWCA 2VAFA 1ZL9A 3E9JB 5D8IA 4GSTA 1Z7PA 5KEJA 3CSJA 1TP9A 4XCSA 2AV4A 3MNGA 4AJ6A 3UBKA 4RQXA 2HT9A 1YDKA 3EINA 4IJ3A 3ZMLA 4WXTA 2V6KA 1G7EA 6GSSA 4TW5A 2K18A 5L71A 1Z6NA 1ZYEA 1WOUA 2IJYA 3LSZA 3ME8A 4EO3A 2WFCA 3IOSA 5LD0A 1GH2A 3L9SA 3J7Yb 2J9HA 1XW6A 4MNNA 3UVTA 5F07A 1PA3A 5B6NA 3APSA 2E0QA 4A5PA 4HI7A 4KAEA 1KEBA 3QMXA 4WF4A 1V2AA 5F06A 4G0IA 3HVXA 1PKWA 5FHIA 3TJGA 4USSA 3CTFA 4HJ2A 1X5DA 4DEJA 1PGTA 3GL5A 3IC4A 3ZIJA 2XHFA 3GX0A 1EWXA 2V1MA 3FZ4A 1R26A 3GV1A 1PX7A 1XFLA 1W4VA 2VM2A 3GX8A 3DGQA 3RPPA 1B9XC 13GSA 4K5RA 3VWUA 3PR8A 1MD3A 5D9WA 2QA1A 5A5KA 11GSA 1FB6A 4WKWA 4ZL8A 4KW6A 1XPVA 1SK2A 3HDCA 4PURA 5CYYA 4EDZA 5CREA 4G19A 3A2WA 4TR1B 5B8AA 2A2RA 4O5QA 1TDIA 5FT3A 2YZUA 4EDYA 1SKWB 2HSHA 3IR4A 1XXUA 1MEKA 3ZTLA 2GQLA 5ID2B 5CRWA 4F0BA 2OE3A 1LU4A 2ON7A 4H86A 4XHMA 3CTGA 5EY6A 5LCZA 2C0EA 2HZFA 1A2JA 4Q5FA 4K6XA 2H19A 2YZHA 4PNGA 1SL1B 4OWYA 3KIJA 4JU5A 5DALA 3IC8A 2B7JA 2HNLA 1J08A 4OO5A 2L6CA 3GFKA 5J4UA 3IK7A 1KBNA 4N30A 3UBLA 1HD2A 2FWFA 1FHEA 3IAS2 1QXHA 5DBQA 1ZYNA 1O7UA 2GDRA 4MDCA 1Z3EA 3TB2A 2YPMA 1U87A 1HNAA 2FGXA 2R6KA 3KTBA 4ZXGA 4ZILA 4QL9A 1TI1A 1ZCPA 2YN1A 1VF3A 2DIZA 4Q5RA 1ST9A 3M9KA 5H5QA 4FO5A 5ECSA 2B3SA 1AW9A 4GSSA 3FR6A 1AC1A 5LNKe 4E8EA 1YZXA 3FZ9A 4BWQA 1RK4A 1FW1A 4ECJA 1FOVA 3P2AA 1EGOA 1TK0B 2JU5A 2NVLA 4MK3A 3LEFA 3IV4A 2QGVA 1A23A 3US3A 3KEBA 2H6YA 2VCWA 1URMA 1EZKA 3A2XA 4L5OA 2ES7A 4ACSA 3D22A 2NTOA 3RHCA 2QA2A 4GQCA 3ZL5A 2H75A 4TRXA 4I5QA 3FZAA 5G1KA 2YNXA 1OC9A 2DMLA 4F9ZA 1SENA 2WS2A 2WGRA 4MABA 1IYHA 2GZPA 4IVFA 1TU7A 5IPGA 3I9V2 4TXOB 2RM6A 3HVVA 3IBHA 1EEMA 3QD9A 4MJEA 2CV4A 4X0XA 3OR5A 1U88A 2MMAA 4CW9A 2K8VA 1TKDB 1W89A 4ICYA 5ECMB 3RBTA 1B48A 2H1BA 5EPFA 3KD0A 1ON4A 2LJRA 1ERUA 3FHKA 7GSSA 2AB6A 3L78A 2VCZA 4Z2RA 3ZFLA 2X99A 3SWLA 2MBTA 4J56E 4TR4A 1SKRB 2VIMA 5B8BA 4WF5A 1N8JA 2DJ3A 3H4KA 1WMJA 3MAKA 2MMNA 5G1LA 4RQRA 1GTUA 3HZ8A 4MMMA 5HFIA 3IAM2 2YOIA 2FWEA 5DQSA 3CXGA 1NSWA 2JZRA 2C4JA 5DAKA 1V58A 1GSYA 3VPTA 4G0KA 4TR3A 2O7KA 2HZEA 2LEGA 5CAXA 1DUGA 4V2MA 3EYTA 1XWKA 2WRTA 3IXRA 5J9CA 5ELGA 5F8BA 4LMVA 4KSMA 4ECIA 5F05A 2MBSA 1THXA 3D4TA 1FOHA 2VL2A 2PN8A 5G2ZA 1G6YA 2TIRA 5H5RA 1BG5A 3MWHA 4HDEA 1YJ6A 2H1DA 2GQMA 4HOJA 1G0TA 5CO3A 5F0GA 2X8HA 3H1NA 4O5RA 20GSA 2VLVA 1IYIA 1GUHA 4KGIA 4YQMA 3QAVA 1XCCA 1ML6A 3HJPA 1DE2A 3LFLA 2D2ZA 5C00A 3UJ1A 3TJBA 4AJ7A 4PTSA 3BCIA 3IHGA 3TJKA 1JZOA 3ZYWA 2V41A 3TKPA 4HU7A 1TXXA 3MSZA 4POKA 1K0DA 4ZBDA 4JEDA 4EKZA 1T7PB 4JE1A 2A2PA 1S3RA 3TJFA 3F3RA 3FEUA 4YKGA 4KUNA 5DCHA 4BL7B 2JADA 4Q5NA 2GSTA 4BVYB 2B5YA 2NDOA 1JFUA 4HQSA 2VD0A 2XC2A 4IHUA 5HR2A 1PN9A 1PD21 1FVKA 3EE2A 2KP2A 2L5LA 4Z2TA 1EV9A 3LW9A 4RI6A 1X0RA 4PQHA 1AUCA 2LQQA 3VI5A 2M72A 2VOCA 6GSWA 2DJ0A 3D5JA 4N0ZA 1O81A 1KTEA 3EPTA 5CNWA 5HR1A 4CY8A 3BD2A 4RUVA 4ZL7A 3MYDA 1G6WA 2R0PA 2A4HA 2H73A 2C3TA 4CY6A 4IKHA 3UIWA 1XG8A 1HNBA 2DJJA 4NPBA 5IO2A 5E4WA 4I2TA 3TRQA 2L6DA 3IRAA 4F2IA 3TKRA 2IMEA 2K8SA 4XS4A 3C8EA 1OKTA 3U6VA 1TRSA 4E8HA 1LJRA 2B1KA 4PQ1A 3GHAA 3ED3A 2LJAA 2VD1A 1WPIA 1XBSA 1T1VA 1A2MA 2LUSA 2WZ9A 2CZ2A 4NHWA 3TKSC 2JL4A 4K7OA 3W8SA 4IQAA 3G7IA 5IMCA 3K8NA 4KDYA 3ISOA 4ECBA 1TRVA 2ALBA 4TKYA 4ML6A 2DC5A 4DVCA 4EUYA 5ECOB 1F37A 4XRAA 5DALB 3HYPA 4L0WA 2VL9A 1NHYA 4K5SA 1A24A 1YQ1A 4GSNA 3HJOA 4BWSA 5BMUA 3KCMA 2DMMA 2IFQA 3BJ5A 3Q18A 3EURA 2H01A 1M0UA 2K6VA 4GTUA 3TDGA 1PX6A 4O32A 1BQ7A 1WP0A 4IP1A 4EF0A 3E3EA 1HNCA 2IIYA 4MF7A 5GZZB 1T3BA 4GF0A 2AYTA 1SYXA 2AHEA 3ZFBA 1YKAA 4EC0A 3JCML 2X8CA 2LRNA 1Z7RA 1K0BA 4KNDA 1XVWA 2WULA 2XPEA 3QFAC 2YV9A 2TRXA 1PKZA 2PU9C 3GRXA 5IPHA 4YAPA 1U3IA 4QL7A 1ERVA 1I5GA 3ZZXA 2ZNMA 2PGTA 1J0FA 1JLWA 9GSSA 3C1RA 3L0HA 5J5NA 1BEDA 1TRUA 1TOFA 4OCEA 3RAZA 2LJKA 1X5CA 2YV7A 4WEYA 3LXZA 1XW9A 2LV3A 4KA0A 1M3JA 4JRRA 3CQFA 5D9TA 4X1UA 3R3EA 4LLRA 2HI7A 4BPYA 2C1YA 2AUVA 1M9BA 3G7JA 4BVXB 2YWMA 3CRTA 2LTKA 2F8AA 5DJLA 3GKMA 3KXOA 1A2LA 3KH9A 1SJ6A 1T00A 3FYGA 4HSCX 1K0NA 3ZLPA 1DBYA 3LJRA 4MZCA 1SL0B 10GSA 4I2UA 4KH7A 5HFGA 3EMXA 3GL3A 1FVJA 3WGXA 1A8LA 2M46A 3FY7A 1SJIA 3C7MA 3GH9A 3VFIA 3TCOA 1F2EA 3CSHA 5ECLB 2YJHA 5GSSA 2GZZA 3MDKA 3I69A 5G30A 2L5OA 4DSSB 2V32A 4NXIA 2KLXA 1X9WB 4EXJA 2P0GA 2B6MA 2CX3A 1EP8A 2GVPA 3EC3A 2DJKA 3RHBA 1USBA 2R2JA 1M2BA 3ZRDA 4MCUA 1K3YA 4LL4B 1HYUA 1TRWA 5DAKB 1CQHA 4F82A 2FA8A 4GLTA 2HZEB 1JLVA 1OVNA 1BYEA 2TRCP 1QUWA 1Z5YE 2K9FA 4ZBAA 1O6JA 4P3YB 1I9DA 2H0GA 3M1GA 3QAGA 3PPUA 5D96A 4BIKA 2IN3A 2YWNA 4OD7A 3CRUA 3Q6OA 4XTSA 2LS5A 4I97A 1B4QA 3F4SA 2VCQA 1TW9A 2EIOA 2H74A 5J9BA 4FYCA 2BJXA 5ECPB 3CYNA 4NHZA 5D9VA 2DIYA 4I8BA 2HRAA 3DIEA 2G0FA 4XS1A 1NHOA 1A0FA 1R5PA 1MDIA 4G0LA 3RDWA 4PX1A 2VUPA 5HFKA 1ZYQB 1OE7A 5BRTA 4AJ8A 4V2NA 4TVEA 18GSA 1Z9HA 1MD4A 3VI7A 1SD8A 4IGJA 3M9JA 2C80A 1PQNA 3ERFA 3KP9A 3GTUA 3FKFA 5J3RA 5GSTA 1F3BA 3M3MA 2L4QA 4K9ZA 3UARA 3TKSE 3DVXA 4JR6A 4OMVA 1GRXA 5JCWA 2OE0A 4HZ2A 3VWWA 3FZ5A 4MZWA 2ZCTA 2I3YA 1V9WA 1ZMAA 1K0MA 1PN0A 2E2GA 2E7PA 4FQUA 1SYRA 3GYKA 4FYUA 4ZB8A 3QAWA 1ZGNA 4HZ4A 2I4AA 4KSOA 1EOGA 2O85A 3W6GA 1B8XA 4KDXA 3MIXA 5FWGA 2DSAA 4F03A 3C71A 5HQPA 5G5FA 1ZZYA 3HKRA 3KMOA 2CAIA 2LRTA 4OO4A 2GQKA 3HXSA 4G9HA 2VCVA 2IMIA 1WWJA 1M99A 5KOXA 5EVOA 3LYKA 1GTAA 17GSA 2XBQA 4OFMA 2XPDA 2R0GA 2FHEA 3F6DA 4FH8A 1EV4A 3J7Yk 1PSQA 4OFNA 5C04A 1XVQA 4OFTA 5ELAA 5EL8A 3LWAA 2H6XA 4WR4A 2EIQA 2P5QA 4XS4B 1Q4JA 5G31A 3IPZA 5G5EA 3RPNA 2FA4A 1U3AA 3CBUA 2H0HA 4X4JA 2CVBA 3DYRA 4TXVA 1QFNA 2A4VA 3NZNA 2FCHA 3HZ4A 1SK0A 2PWJA 4ZB6A 1BX9A 2C8UA 3FRCA 2R3XA 2E2MA 4K2XA 4TR1A 3Q19A 3QR6A 4LA1A 2VM1A 5DDLA 2JSYA 3ZVJD 2MMZA 4ZBBA 5B7CA 5ID2A 1SKSB 4LMWA 3GSSA 3TUEA 4G10A 4K0NA 1PMTA 3APOA 1U6TA 4O5UA 3ZVJA 5B6MA 1AQVA 4XRDA 1FG4A 5HR0A 5AGYA 2CVKA 2LSTA 2C3NA 2V6OA 5JWOB 3O6TA 2HRFA 3UVHA 3LQ7A 3VURA 3ZIVA 4PXOA 1AQXA 4L0UA 4PUFC 5CRDA 2FNOA 2YJ7A 1GSUA 1SK1A 4BA7A 3TOUA 1XWBA 1VRSD 2PVQA 4XIHA 4KCEA 2GGTA 4FYBA 5DQYA 5KN0A 1SJZA 3D4MA 2VL2C 2RLIA 1R7HA 2LQOA 1S3AA 4L5LA 3VLNA 2DKHA 2H1AA 4YQUA 3VWVA 3FR9A 5ECHB 2HSMA 4KB3A 5IMDA 2PUKC 3AY8A 1OYJA 22GSA 3C1SA 2LKUA 1J9BA 2RM5A 3N9JA 1TK5B 2H72A 4NWYA 3KMNA 1F9MA 3HD5A 4GCIA 1X9SB 1OC8A 2IPAA 4J57E 2CA8A 3ERGA 2GSQA 1QMVA 4ID0A 2HXKA 5H5SA 3LYPA 3HVSA 1JZWA 3ZMKA 1GP1A 1JHBA 1TTZA 2CZ3A 4IP6A 4AGSA 3WD6A 2H1GA 1K3LA 4ECCA 4EIQA 2GSSA 2GS3A 2H8LA 1VF4A 2HYXA 3QPMA 4TXOA 4Z2UA 5JWRB 2DJ2A 2RIIA 1B4PA 2N5FA 1PRXA 2I9HA 2O87A 1E2YA 2CAQA 3CMIA 2I1UA 1VF2A 1F3AA 1WRYA 4ULXA 1BAYA 2JSZA 4IBPA 5ABRA 2B1LA 4TOPA 3DD3A 4X43A 2OBKA 2AAWA 3UL3A 1WE0A 3F0IA 1JZDA 3WT1A 1YEXA 1R4WA 5IO0A 4CHSA 2NPBA 4HEA2 16GSA 4PQIA 5AN1A 2DLXA 2OKAA 2REMA 1ERWA 3W8JA 4ILFA 3M8NA 3KH7A 4O7HA 3KGKA 1THOA 1G7OA 1KNGA 1GUMA 2F9SA 2VL3A 4KE3A 1GNEA 1YKCA 1E6BA 2CX4A 4K1FA 1GTBA 4QQ7A 2R4VA 2HFDA 5ENUA 4YH2A 2OJLA 4NAXA 3DKSA 1M2DA 4NMUA 1M9AA 1T8EB 2B7KA 3F8UA 2AJQB 2WCIA 1WJKA 5CRHA 1BJXA 3GTUB 6GSXA 2RUEA 3Q74A 1SU9A 3WGEA 2IWTA 4L8EA 4MLYA 2BMXA 3KJYA 3EMPA 1O8XA 2V2GA 2MMOA 2F51A 2IL3A 1MDJA 2C0FA 1PL2A 1AAZA 1V98A 4EIPA 3VK9A 4ISDA 4IQ1A 3FR3A 2N5AA 3F3QA 5D73A 3LXTA 2OADA 1X9MB 1S3DA 2NBSA 3G7YA 4IW9A 4F0CA 1Y25A 4GRFA 4K8MA 4WBRD 3EU3A 4YQVA 1O85A 3TGZA 3GIXA 1OC9B 2F8FA 3TRXA 3HHVA 1DSBA 3A5WA 2YP6A 5D93A 1TJDA 4PGTA 3FMWA 1K3OA 1QGVA 4BL7A 4TR0A 1FAAA 4HUAA 4BVYA 1AXDA 5ECIB 2H6ZA 3D0ZA 1K0OA 2PPTA 12GSA 1C72A 2X64A 3DEXA 2RUFA 2KHPA 4Q5QA 1NW2A 3GMFA 2H0IA 2VO4A 1K0CA 3APQA 5INYA 6GSVA 4JR4A 2GZYA 3P7XA 4IELA 1TI3A 4FIWA 2O89A 4N0VA 4V2LA 1T4YA 2X8GA 4D73A 1GSDA 3A2VA 3DRNA 3TJJA 1GLPA 1V40A 5A4UA 3H93A 5ECRB 2IMKA 2CVDA 2GT6A 1MDKA 4PUAA 2C0DA 2H70A 1HQOA 2VLTA 2N5BA 2LNTA 1AIUA 4KCAA 6GSUA 4V1Ap 3TRPA 2DKIA 2PBJA 3WT2A 3PINA 1EOHA 2VLUA 1O73A 3ERWA 3FW2A 3GKKA 3F4TA 1R5AA 2L59A 3I6AA 1GNWA 4PNFA 1PL1A 4N10A 3BCKA 3F4RA 4IS0A 3HCZA 4XS6A 3EWLA 3N5OA 4GQFA 3DWVA 5AIXA 5A4WA 1A0RP 2DJ1A 2WJUA 1YF0A 4ZB9A 5IMAA 1WIKA 2MYGA 1XOBA 3FK8A 3LORA 2X49A 1ILOA 3DMLA 4NV2A 3UEMA 5DVBA 3IHQA 1Z6MA 1GULA 1YF1A 2H71A 4IJIA 5J41A 2JZTA 3E0UA 4CDOA 4MA9A 1A8YA 1SD9A 5COHA 3F9UA 5GAND 3F63A 1MTCA 2JZSA 4EL1A 4MJBA 4MH2A 4MZBA 8GSSA 4KF9A 2QSIA 5KOWA 1K0AA 2FY6A 2GT5A 1Q98A 2CT6A 3GUSA 5HR3A 2QKEA 3UAPA 3KTLA 2R5GA 1B9YC 1UVZA 2GSRA 3V1WA 3DVWA 5E59A 2YWOA 4JBBA 2HRKA 5KN3A 3PH9A 5IOWA 3PGTA 1M3IA 2EC4A 2XBIA 3KZQA 5KN2A 2O8VB 2HRNA 2YWIA 3G9BA 4WETA 14GSA 4MPGA 2PMTA 1UC7A 1FB0A 1QQ2A 3QDNA 4V1Ag 4OCFA 1YEPA 5DCGA 1RQMA 4DSQA 4Z7XA 3IK9A 1YY7A 1SL2B 2FWHA 2A2SA 4O92A 1V57A 5DJMA 1M7TA 3KP8A 3HY2A 1XIYA 3LG6A 1EP7A 4BVXA 4HU9A 4G2EA 3D6IA 2HE3A 19GSA 1OC3A 4POLA 3HJMA 3ZITA 2PERA 2FD3A 3CSIA 1OKDA 1S3CA 3SBCA 1TK8B 5A4VA 5AIVA 4POBA 5AISA 3IE3A 1GUKA 2KP1A 4YAVA 4RI7A 1VF1A 1GSFA 3GH6A 3NOFA 1GSEA 3A3TA 2FUG2 4KDUA 2H66A 1H75A 5IMVA 3U5RE 4HQZA 4DSSA 2GLRA 4MF5A 1GTIA 2G2QA 1XWGA 3GKNA 1VGLA 4WBJA 4MPFA 2UZ8A 3P90A 2WB9A 3NIVA 1N2AA 2BTOT 3L9UA 1OAZA 2KUCA 3LGCA 2FLSA 4MH3A 2L57A 3BOAA 2IFQB 4K2DA 1ERTA 4J2FA 5IOXA 1M2AA 2ZUPA 1UN2A 4POMA 3F6FA 1XW5A 2P31A 2H30A 1GSSA 4LL1B 1QK8A 5GAPD 1LBKA 5JCGA 1FO5A 2IMFA 1XZOA 3GSTA 3QCPA 3UMAA 5ECQB 3GN3A 1F6MC 1GSQA 3WYWA 4K7NA 1ACVA 2HSYA 5IM9A 1O8WA 4HS1A 1XWAA 1PFOA 3L4NA 2EIRA 2WDUA 3VPQA 1JZRA 3ZREA 4EE0A 5IQYA 3L9VA 2F3MA 6GSYA 2MZCA 1EGRA 3GNJA 3TKQA 3H79A 4NV5A 4K7IA 4N11A 4YKFA 3BBYA 2J23A 3R2QA 3O3TA 2I81A 2C0GA 3I43A 3H8QA 3ME7A 2DBCA 1TU8A 5D9XA 3QFBC 1RW1A 2P5RA 5ECNB 3HVNA 2VCTA 3HA9A 3UOMA 2LNSA 4GWRA 4GXZA 1XWCA 4JZQA 1UA5A 4MF6A 5ECKB 2L4CA 2PVOC 5JCUA 2YCDA 4HJMA 2B5EA 1ABAA 4AF2A 2ON5A 2Z9SA 1AQWA 2B5XA 3KM6A
chains in the Genus database with same CATH topology
1H4OA 5IIZA 4K0GA 2OBIA 4ZIJA 3TKSA 1XOAA 2OACA 2LRCA 3S9FA 1DE1A 3C73A 3GURA 4ML1A 2VCXA 5CRGA 3A5IA 3VWXA 5IMFA 2IMDA 3IDVA 4D73B 1Y6EA 1NM3A 2OE1A 2YANA 3TOTA 1ZYPA 3EVIA 3WGDA 2CQ9A 3GA4A 4EVMA 2OA7A 3O76A 2H76A 2M80A 1GLQA 4ZL9A 4DSRA 4MJAA 1EEJA 5KN1A 2R37A 1OE8A 4I6XA 2KOKA 2FWGA 1CQGA 3IA1A 4WR5A 2X4AA 4KX4A 3GKXA 2C3QA 3EU4A 3P8WA 1ZOFA 4MP4A 4TN8A 1T4ZA 4IN0A 3QOUA 2R0CA 5IMZA 2GTUA 3M0FA 2JACA 2QC7A 3DXBA 1X5EA 6GSTA 1GL8A 3D21A 2HLSA 4MJCA 5CP1A 5JWQB 1GWCA 2VAFA 1ZL9A 3E9JB 5D8IA 4GSTA 1Z7PA 5KEJA 3CSJA 1TP9A 4XCSA 2AV4A 3MNGA 4AJ6A 3UBKA 4RQXA 2HT9A 1YDKA 3EINA 4IJ3A 3ZMLA 4WXTA 2V6KA 1G7EA 6GSSA 4TW5A 2K18A 5L71A 1Z6NA 1ZYEA 1WOUA 2IJYA 3LSZA 3ME8A 4EO3A 2WFCA 3IOSA 5LD0A 1GH2A 3L9SA 3J7Yb 2J9HA 1XW6A 4MNNA 3UVTA 5F07A 1PA3A 5B6NA 3APSA 2E0QA 4A5PA 4HI7A 4KAEA 1KEBA 3QMXA 4WF4A 1V2AA 5F06A 4G0IA 3HVXA 1PKWA 5FHIA 3TJGA 4USSA 3CTFA 4HJ2A 1X5DA 4DEJA 1PGTA 3GL5A 3IC4A 3ZIJA 2XHFA 3GX0A 1EWXA 2V1MA 3FZ4A 1R26A 3GV1A 1PX7A 1XFLA 1W4VA 2VM2A 3GX8A 3DGQA 3RPPA 1B9XC 13GSA 4K5RA 3VWUA 3PR8A 1MD3A 5D9WA 2QA1A 5A5KA 11GSA 1FB6A 4WKWA 4ZL8A 4KW6A 1XPVA 1SK2A 3HDCA 4PURA 5CYYA 4EDZA 5CREA 4G19A 3A2WA 4TR1B 5B8AA 2A2RA 4O5QA 1TDIA 5FT3A 2YZUA 4EDYA 1SKWB 2HSHA 3IR4A 1XXUA 1MEKA 3ZTLA 2GQLA 5ID2B 5CRWA 4F0BA 2OE3A 1LU4A 2ON7A 4H86A 4XHMA 3CTGA 5EY6A 5LCZA 2C0EA 2HZFA 1A2JA 4Q5FA 4K6XA 2H19A 2YZHA 4PNGA 1SL1B 4OWYA 3KIJA 4JU5A 5DALA 3IC8A 2B7JA 2HNLA 1J08A 4OO5A 2L6CA 3GFKA 5J4UA 3IK7A 1KBNA 4N30A 3UBLA 1HD2A 2FWFA 1FHEA 3IAS2 1QXHA 5DBQA 1ZYNA 1O7UA 2GDRA 4MDCA 1Z3EA 3TB2A 2YPMA 1U87A 1HNAA 2FGXA 2R6KA 3KTBA 4ZXGA 4ZILA 4QL9A 1TI1A 1ZCPA 2YN1A 1VF3A 2DIZA 4Q5RA 1ST9A 3M9KA 5H5QA 4FO5A 5ECSA 2B3SA 1AW9A 4GSSA 3FR6A 1AC1A 5LNKe 4E8EA 1YZXA 3FZ9A 4BWQA 1RK4A 1FW1A 4ECJA 1FOVA 3P2AA 1EGOA 1TK0B 2JU5A 2NVLA 4MK3A 3LEFA 3IV4A 2QGVA 1A23A 3US3A 3KEBA 2H6YA 2VCWA 1URMA 1EZKA 3A2XA 4L5OA 2ES7A 4ACSA 3D22A 2NTOA 3RHCA 2QA2A 4GQCA 3ZL5A 2H75A 4TRXA 4I5QA 3FZAA 5G1KA 2YNXA 1OC9A 2DMLA 4F9ZA 1SENA 2WS2A 2WGRA 4MABA 1IYHA 2GZPA 4IVFA 1TU7A 5IPGA 3I9V2 4TXOB 2RM6A 3HVVA 3IBHA 1EEMA 3QD9A 4MJEA 2CV4A 4X0XA 3OR5A 1U88A 2MMAA 4CW9A 2K8VA 1TKDB 1W89A 4ICYA 5ECMB 3RBTA 1B48A 2H1BA 5EPFA 3KD0A 1ON4A 2LJRA 1ERUA 3FHKA 7GSSA 2AB6A 3L78A 2VCZA 4Z2RA 3ZFLA 2X99A 3SWLA 2MBTA 4J56E 4TR4A 1SKRB 2VIMA 5B8BA 4WF5A 1N8JA 2DJ3A 3H4KA 1WMJA 3MAKA 2MMNA 5G1LA 4RQRA 1GTUA 3HZ8A 4MMMA 5HFIA 3IAM2 2YOIA 2FWEA 5DQSA 3CXGA 1NSWA 2JZRA 2C4JA 5DAKA 1V58A 1GSYA 3VPTA 4G0KA 4TR3A 2O7KA 2HZEA 2LEGA 5CAXA 1DUGA 4V2MA 3EYTA 1XWKA 2WRTA 3IXRA 5J9CA 5ELGA 5F8BA 4LMVA 4KSMA 4ECIA 5F05A 2MBSA 1THXA 3D4TA 1FOHA 2VL2A 2PN8A 5G2ZA 1G6YA 2TIRA 5H5RA 1BG5A 3MWHA 4HDEA 1YJ6A 2H1DA 2GQMA 4HOJA 1G0TA 5CO3A 5F0GA 2X8HA 3H1NA 4O5RA 20GSA 2VLVA 1IYIA 1GUHA 4KGIA 4YQMA 3QAVA 1XCCA 1ML6A 3HJPA 1DE2A 3LFLA 2D2ZA 5C00A 3UJ1A 3TJBA 4AJ7A 4PTSA 3BCIA 3IHGA 3TJKA 1JZOA 3ZYWA 2V41A 3TKPA 4HU7A 1TXXA 3MSZA 4POKA 1K0DA 4ZBDA 4JEDA 4EKZA 1T7PB 4JE1A 2A2PA 3TJFA 3F3RA 3FEUA 4YKGA 4KUNA 5DCHA 4BL7B 2JADA 4Q5NA 2GSTA 4BVYB 2B5YA 2NDOA 1JFUA 4HQSA 2VD0A 2XC2A 4IHUA 5HR2A 1PN9A 1PD21 1FVKA 3EE2A 2KP2A 2L5LA 4Z2TA 1EV9A 3LW9A 4RI6A 1X0RA 4PQHA 1AUCA 2LQQA 3VI5A 2M72A 2VOCA 6GSWA 2DJ0A 3D5JA 4N0ZA 1O81A 1KTEA 3EPTA 5CNWA 5HR1A 4CY8A 3BD2A 4RUVA 4ZL7A 3MYDA 1G6WA 2R0PA 2A4HA 2H73A 2C3TA 4CY6A 4IKHA 3UIWA 1HNBA 2DJJA 4NPBA 5IO2A 5E4WA 4I2TA 3TRQA 2L6DA 3IRAA 4F2IA 3TKRA 2IMEA 2K8SA 4XS4A 3C8EA 1OKTA 3U6VA 1TRSA 4E8HA 1LJRA 2B1KA 4PQ1A 3GHAA 3ED3A 2LJAA 2VD1A 1WPIA 1XBSA 1T1VA 1A2MA 2LUSA 2WZ9A 2CZ2A 4NHWA 3TKSC 2JL4A 4K7OA 3W8SA 4IQAA 3G7IA 5IMCA 3K8NA 4KDYA 3ISOA 4ECBA 1TRVA 2ALBA 4TKYA 4ML6A 2DC5A 4DVCA 4EUYA 5ECOB 1F37A 4XRAA 5DALB 3HYPA 4L0WA 2VL9A 1NHYA 4K5SA 1A24A 1YQ1A 4GSNA 3HJOA 4BWSA 5BMUA 3KCMA 2DMMA 2IFQA 3BJ5A 3Q18A 3EURA 2H01A 1M0UA 2K6VA 4GTUA 3TDGA 1PX6A 4O32A 1BQ7A 1WP0A 4IP1A 4EF0A 3E3EA 1HNCA 2IIYA 4MF7A 5GZZB 1T3BA 4GF0A 2AYTA 1SYXA 2AHEA 3ZFBA 1YKAA 4EC0A 3JCML 2X8CA 2LRNA 1Z7RA 1K0BA 4KNDA 1XVWA 2WULA 2XPEA 3QFAC 2YV9A 2TRXA 1PKZA 2PU9C 3GRXA 5IPHA 4YAPA 1U3IA 4QL7A 1ERVA 1I5GA 3ZZXA 2ZNMA 2PGTA 1J0FA 1JLWA 9GSSA 3C1RA 3L0HA 5J5NA 1BEDA 1TRUA 1TOFA 4OCEA 3RAZA 2LJKA 1X5CA 2YV7A 4WEYA 3LXZA 1XW9A 2LV3A 4KA0A 4JRRA 5D9TA 4X1UA 3R3EA 4LLRA 2HI7A 4BPYA 2C1YA 2AUVA 1M9BA 3G7JA 4BVXB 2YWMA 3CRTA 2LTKA 2F8AA 5DJLA 3GKMA 3KXOA 1A2LA 3KH9A 1SJ6A 1T00A 3FYGA 1K0NA 3ZLPA 1DBYA 3LJRA 4MZCA 1SL0B 10GSA 4I2UA 4KH7A 5HFGA 3EMXA 3GL3A 1FVJA 3WGXA 1A8LA 2M46A 3FY7A 1SJIA 3C7MA 3GH9A 3VFIA 3TCOA 1F2EA 3CSHA 5ECLB 2YJHA 5GSSA 2GZZA 3MDKA 3I69A 5G30A 2L5OA 4DSSB 2V32A 4NXIA 2KLXA 1X9WB 4EXJA 2P0GA 2B6MA 2CX3A 1EP8A 2GVPA 3EC3A 2DJKA 3RHBA 1USBA 2R2JA 1M2BA 3ZRDA 4MCUA 1K3YA 4LL4B 1HYUA 1TRWA 5DAKB 1CQHA 4F82A 2FA8A 4GLTA 2HZEB 1JLVA 1OVNA 1BYEA 2TRCP 1QUWA 1Z5YE 2K9FA 4ZBAA 1O6JA 4P3YB 1I9DA 2H0GA 3M1GA 3QAGA 3PPUA 5D96A 2IN3A 2YWNA 4OD7A 3CRUA 3Q6OA 4XTSA 2LS5A 4I97A 1B4QA 3F4SA 2VCQA 1TW9A 2EIOA 2H74A 5J9BA 4FYCA 2BJXA 5ECPB 3CYNA 4NHZA 5D9VA 2DIYA 4I8BA 2HRAA 3DIEA 2G0FA 4XS1A 1NHOA 1A0FA 1R5PA 1MDIA 4G0LA 3RDWA 4PX1A 2VUPA 5HFKA 1ZYQB 1OE7A 5BRTA 4AJ8A 4V2NA 4TVEA 18GSA 1Z9HA 1MD4A 3VI7A 1SD8A 4IGJA 3M9JA 2C80A 1PQNA 3ERFA 3KP9A 3GTUA 3FKFA 5J3RA 5GSTA 1F3BA 3M3MA 2L4QA 4K9ZA 3UARA 3TKSE 3DVXA 4JR6A 4OMVA 1GRXA 5JCWA 2OE0A 4HZ2A 3VWWA 3FZ5A 4MZWA 2ZCTA 2I3YA 1V9WA 1ZMAA 1K0MA 1PN0A 2E2GA 2E7PA 4FQUA 1SYRA 3GYKA 4FYUA 4ZB8A 3QAWA 1ZGNA 4HZ4A 2I4AA 4KSOA 1EOGA 2O85A 3W6GA 1B8XA 4KDXA 3MIXA 5FWGA 2DSAA 4F03A 3C71A 5HQPA 5G5FA 1ZZYA 3HKRA 3KMOA 2CAIA 2LRTA 4OO4A 2GQKA 3HXSA 4G9HA 2VCVA 2IMIA 1WWJA 1M99A 5KOXA 5EVOA 3LYKA 1GTAA 17GSA 2XBQA 4OFMA 2XPDA 2R0GA 2FHEA 3F6DA 4FH8A 1EV4A 3J7Yk 1PSQA 4OFNA 5C04A 1XVQA 4OFTA 5ELAA 5EL8A 3LWAA 2H6XA 4WR4A 2EIQA 2P5QA 4XS4B 1Q4JA 5G31A 3IPZA 5G5EA 3RPNA 2FA4A 1U3AA 3CBUA 2H0HA 4X4JA 2CVBA 3DYRA 4TXVA 1QFNA 2A4VA 3NZNA 2FCHA 3HZ4A 1SK0A 2PWJA 4ZB6A 1BX9A 2C8UA 3FRCA 2R3XA 2E2MA 4K2XA 4TR1A 3Q19A 3QR6A 4LA1A 2VM1A 5DDLA 2JSYA 3ZVJD 2MMZA 4ZBBA 5B7CA 5ID2A 1SKSB 4LMWA 3GSSA 3TUEA 4G10A 4K0NA 1PMTA 3APOA 1U6TA 4O5UA 3ZVJA 5B6MA 1AQVA 4XRDA 1FG4A 5HR0A 5AGYA 2CVKA 2LSTA 2C3NA 2V6OA 5JWOB 3O6TA 2HRFA 3UVHA 3LQ7A 3VURA 3ZIVA 4PXOA 1AQXA 4L0UA 4PUFC 5CRDA 2FNOA 2YJ7A 1GSUA 1SK1A 4BA7A 3TOUA 1XWBA 1VRSD 2PVQA 4XIHA 4KCEA 2GGTA 4FYBA 5DQYA 5KN0A 1SJZA 3D4MA 2VL2C 2RLIA 1R7HA 2LQOA 1S3AA 4L5LA 3VLNA 2DKHA 2H1AA 4YQUA 3VWVA 3FR9A 5ECHB 2HSMA 4KB3A 5IMDA 2PUKC 3AY8A 1OYJA 22GSA 3C1SA 2LKUA 1J9BA 2RM5A 3N9JA 1TK5B 2H72A 4NWYA 3KMNA 1F9MA 3HD5A 4GCIA 1X9SB 1OC8A 2IPAA 4J57E 2CA8A 3ERGA 2GSQA 1QMVA 4ID0A 2HXKA 5H5SA 3LYPA 3HVSA 1JZWA 3ZMKA 1GP1A 1JHBA 1TTZA 2CZ3A 4IP6A 4AGSA 3WD6A 2H1GA 1K3LA 4ECCA 4EIQA 2GSSA 2GS3A 2H8LA 1VF4A 2HYXA 3QPMA 4TXOA 4Z2UA 5JWRB 2DJ2A 2RIIA 1B4PA 2N5FA 1PRXA 2I9HA 2O87A 1E2YA 2CAQA 3CMIA 2I1UA 1VF2A 1F3AA 1WRYA 4ULXA 1BAYA 2JSZA 4IBPA 5ABRA 2B1LA 4TOPA 3DD3A 4X43A 2OBKA 2AAWA 3UL3A 1WE0A 3F0IA 1JZDA 3WT1A 1YEXA 1R4WA 5IO0A 4CHSA 2NPBA 4HEA2 16GSA 4PQIA 5AN1A 2DLXA 2OKAA 2REMA 1ERWA 3W8JA 4ILFA 3M8NA 3KH7A 4O7HA 3KGKA 1THOA 1G7OA 1KNGA 1GUMA 2F9SA 2VL3A 4KE3A 1GNEA 1YKCA 1E6BA 2CX4A 4K1FA 1GTBA 4QQ7A 2R4VA 2HFDA 5ENUA 4YH2A 2OJLA 4NAXA 3DKSA 1M2DA 4NMUA 1M9AA 1T8EB 2B7KA 3F8UA 2AJQB 2WCIA 1WJKA 5CRHA 1BJXA 3GTUB 6GSXA 2RUEA 3Q74A 1SU9A 3WGEA 2IWTA 4L8EA 4MLYA 2BMXA 3KJYA 3EMPA 1O8XA 2V2GA 2MMOA 2F51A 2IL3A 1MDJA 2C0FA 1PL2A 1AAZA 1V98A 4EIPA 3VK9A 4ISDA 4IQ1A 3FR3A 2N5AA 3F3QA 5D73A 3LXTA 2OADA 1X9MB 1S3DA 2NBSA 3G7YA 4IW9A 4F0CA 1Y25A 4GRFA 4K8MA 4WBRD 3EU3A 4YQVA 1O85A 3TGZA 3GIXA 1OC9B 2F8FA 3TRXA 3HHVA 1DSBA 3A5WA 2YP6A 5D93A 1TJDA 4PGTA 3FMWA 1K3OA 1QGVA 4BL7A 4TR0A 1FAAA 4HUAA 4BVYA 1AXDA 5ECIB 2H6ZA 3D0ZA 1K0OA 2PPTA 12GSA 1C72A 2X64A 3DEXA 2RUFA 2KHPA 4Q5QA 1NW2A 3GMFA 2H0IA 2VO4A 1K0CA 3APQA 5INYA 6GSVA 4JR4A 2GZYA 3P7XA 4IELA 1TI3A 4FIWA 2O89A 4N0VA 4V2LA 1T4YA 2X8GA 4D73A 1GSDA 3A2VA 3DRNA 3TJJA 1GLPA 1V40A 5A4UA 3H93A 5ECRB 2IMKA 2CVDA 2GT6A 1MDKA 4PUAA 2C0DA 2H70A 1HQOA 2VLTA 2N5BA 2LNTA 1AIUA 4KCAA 6GSUA 4V1Ap 3TRPA 2DKIA 2PBJA 3WT2A 3PINA 1EOHA 2VLUA 1O73A 3ERWA 3FW2A 3GKKA 3F4TA 1R5AA 2L59A 3I6AA 1GNWA 4PNFA 1PL1A 4N10A 3BCKA 3F4RA 4IS0A 3HCZA 4XS6A 3EWLA 3N5OA 4GQFA 3DWVA 5AIXA 5A4WA 1A0RP 2DJ1A 2WJUA 1YF0A 4ZB9A 5IMAA 1WIKA 2MYGA 1XOBA 3FK8A 3LORA 2X49A 1ILOA 3DMLA 4NV2A 3UEMA 5DVBA 3IHQA 1Z6MA 1GULA 1YF1A 2H71A 4IJIA 5J41A 2JZTA 3E0UA 4CDOA 4MA9A 1A8YA 1SD9A 5COHA 3F9UA 5GAND 3F63A 1MTCA 2JZSA 4EL1A 4MJBA 4MH2A 4MZBA 8GSSA 4KF9A 2QSIA 5KOWA 1K0AA 2FY6A 2GT5A 1Q98A 2CT6A 3GUSA 5HR3A 2QKEA 3UAPA 3KTLA 2R5GA 1B9YC 1UVZA 2GSRA 3V1WA 3DVWA 5E59A 2YWOA 4JBBA 2HRKA 5KN3A 3PH9A 5IOWA 3PGTA 2EC4A 2XBIA 3KZQA 5KN2A 2O8VB 2HRNA 2YWIA 3G9BA 4WETA 14GSA 4MPGA 2PMTA 1UC7A 1FB0A 1QQ2A 3QDNA 4V1Ag 4OCFA 1YEPA 5DCGA 1RQMA 4DSQA 4Z7XA 3IK9A 1YY7A 1SL2B 2FWHA 2A2SA 4O92A 1V57A 5DJMA 1M7TA 3KP8A 3HY2A 1XIYA 3LG6A 1EP7A 4BVXA 4HU9A 4G2EA 3D6IA 2HE3A 19GSA 1OC3A 4POLA 3HJMA 3ZITA 2PERA 2FD3A 3CSIA 1OKDA 1S3CA 3SBCA 1TK8B 5A4VA 5AIVA 4POBA 5AISA 3IE3A 1GUKA 2KP1A 4YAVA 4RI7A 1VF1A 1GSFA 3GH6A 3NOFA 1GSEA 3A3TA 2FUG2 4KDUA 2H66A 1H75A 5IMVA 3U5RE 4HQZA 4DSSA 2GLRA 4MF5A 1GTIA 2G2QA 1XWGA 3GKNA 1VGLA 4WBJA 4MPFA 2UZ8A 3P90A 2WB9A 3NIVA 1N2AA 2BTOT 3L9UA 1OAZA 2KUCA 3LGCA 2FLSA 4MH3A 2L57A 3BOAA 2IFQB 4K2DA 1ERTA 4J2FA 5IOXA 1M2AA 2ZUPA 1UN2A 4POMA 3F6FA 1XW5A 2P31A 2H30A 1GSSA 4LL1B 1QK8A 5GAPD 1LBKA 5JCGA 1FO5A 2IMFA 1XZOA 3GSTA 3QCPA 3UMAA 5ECQB 3GN3A 1F6MC 1GSQA 3WYWA 4K7NA 1ACVA 2HSYA 5IM9A 1O8WA 4HS1A 1XWAA 3L4NA 2EIRA 2WDUA 3VPQA 1JZRA 3ZREA 4EE0A 5IQYA 3L9VA 2F3MA 6GSYA 2MZCA 1EGRA 3GNJA 3TKQA 3H79A 4NV5A 4K7IA 4N11A 4YKFA 3BBYA 2J23A 3R2QA 3O3TA 2I81A 2C0GA 3I43A 3H8QA 3ME7A 2DBCA 1TU8A 5D9XA 3QFBC 1RW1A 2P5RA 5ECNB 2VCTA 3HA9A 3UOMA 2LNSA 4GWRA 4GXZA 1XWCA 4JZQA 1UA5A 4MF6A 5ECKB 2L4CA 2PVOC 5JCUA 2YCDA 4HJMA 2B5EA 1ABAA 4AF2A 2ON5A 2Z9SA 1AQWA 2B5XA 3KM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H4O A;  5IIZ A;  4K0G A;  2OBI A;  4ZIJ A;  3TKS A;  1XOA A;  2OAC A;  2LRC A;  3S9F A;  1DE1 A;  3C73 A;  3GUR A;  4ML1 A;  2VCX A;  5CRG A;  3VWX A;  5IMF A;  2IMD A;  3IDV A;  4D73 B;  1Y6E A;  1NM3 A;  2OE1 A;  2YAN A;  3TOT A;  3EVI A;  3WGD A;  2CQ9 A;  3GA4 A;  4EVM A;  2OA7 A;  3O76 A;  2H76 A;  2M80 A;  1GLQ A;  4ZL9 A;  4DSR A;  4MJA A;  1EEJ A;  5KN1 A;  2R37 A;  1OE8 A;  4I6X A;  2KOK A;  2FWG A;  1CQG A;  3IA1 A;  4WR5 A;  4KX4 A;  3GKX A;  2C3Q A;  3EU4 A;  3P8W A;  1ZOF A;  4MP4 A;  4TN8 A;  1T4Z A;  4IN0 A;  3QOU A;  5IMZ A;  2GTU A;  3M0F A;  2JAC A;  2QC7 A;  3DXB A;  1X5E A;  6GST A;  1GL8 A;  3D21 A;  2HLS A;  4MJC A;  5CP1 A;  5JWQ B;  1GWC A;  2VAF A;  1ZL9 A;  3E9J B;  5D8I A;  4GST A;  1Z7P A;  5KEJ A;  3CSJ A;  1TP9 A;  4XCS A;  2AV4 A;  3MNG A;  4AJ6 A;  3UBK A;  4RQX A;  2HT9 A;  1YDK A;  3EIN A;  4IJ3 A;  3ZML A;  4WXT A;  2V6K A;  1G7E A;  6GSS A;  4TW5 A;  2K18 A;  5L71 A;  1Z6N A;  1ZYE A;  1WOU A;  2IJY A;  3LSZ A;  3ME8 A;  4EO3 A;  2WFC A;  3IOS A;  5LD0 A;  1GH2 A;  3L9S A;  3J7Y b;  2J9H A;  1XW6 A;  3UVT A;  5F07 A;  1PA3 A;  5B6N A;  3APS A;  2E0Q A;  4HI7 A;  4KAE A;  1KEB A;  3QMX A;  4WF4 A;  1V2A A;  5F06 A;  3HVX A;  1PKW A;  5FHI A;  3TJG A;  3CTF A;  4HJ2 A;  1X5D A;  4DEJ A;  1PGT A;  3GL5 A;  3IC4 A;  3ZIJ A;  2XHF A;  3GX0 A;  1EWX A;  2V1M A;  3FZ4 A;  1R26 A;  3GV1 A;  1PX7 A;  1XFL A;  1W4V A;  2VM2 A;  3GX8 A;  3DGQ A;  3RPP A;  1B9X C;  13GS A;  3VWU A;  3PR8 A;  1MD3 A;  5D9W A;  5A5K A;  11GS A;  1FB6 A;  4WKW A;  4ZL8 A;  4KW6 A;  1XPV A;  1SK2 A;  3HDC A;  4PUR A;  5CYY A;  4EDZ A;  5CRE A;  4G19 A;  3A2W A;  4TR1 B;  5B8A A;  2A2R A;  1TDI A;  5FT3 A;  2YZU A;  4EDY A;  1SKW B;  2HSH A;  3IR4 A;  1XXU A;  1MEK A;  3ZTL A;  2GQL A;  5ID2 B;  5CRW A;  4F0B A;  2OE3 A;  1LU4 A;  2ON7 A;  4H86 A;  4XHM A;  3CTG A;  5EY6 A;  5LCZ A;  2C0E A;  2HZF A;  1A2J A;  4Q5F A;  4K6X A;  2H19 A;  2YZH A;  4PNG A;  1SL1 B;  4OWY A;  3KIJ A;  4JU5 A;  5DAL A;  2B7J A;  2HNL A;  1J08 A;  4OO5 A;  2L6C A;  3GFK A;  5J4U A;  3IK7 A;  1KBN A;  4N30 A;  3UBL A;  1HD2 A;  2FWF A;  1FHE A;  3IAS 2;  1QXH A;  5DBQ A;  1O7U A;  2GDR A;  4MDC A;  1Z3E A;  3TB2 A;  2YPM A;  1U87 A;  1HNA A;  2FGX A;  2R6K A;  3KTB A;  4ZXG A;  4ZIL A;  4QL9 A;  1TI1 A;  1ZCP A;  2YN1 A;  1VF3 A;  2DIZ A;  4Q5R A;  1ST9 A;  3M9K A;  5H5Q A;  4FO5 A;  5ECS A;  2B3S A;  1AW9 A;  4GSS A;  3FR6 A;  1AC1 A;  5LNK e;  4E8E A;  1YZX A;  3FZ9 A;  4BWQ A;  1RK4 A;  1FW1 A;  4ECJ A;  1FOV A;  3P2A A;  1EGO A;  1TK0 B;  2JU5 A;  2NVL A;  4MK3 A;  3LEF A;  3IV4 A;  2QGV A;  1A23 A;  3US3 A;  3KEB A;  2H6Y A;  2VCW A;  1URM A;  1EZK A;  3A2X A;  4L5O A;  2ES7 A;  4ACS A;  3D22 A;  2NTO A;  3RHC A;  4GQC A;  3ZL5 A;  2H75 A;  4TRX A;  4I5Q A;  3FZA A;  5G1K A;  2YNX A;  1OC9 A;  2DML A;  4F9Z A;  1SEN A;  2WS2 A;  2WGR A;  4MAB A;  1IYH A;  2GZP A;  4IVF A;  1TU7 A;  5IPG A;  3I9V 2;  4TXO B;  2RM6 A;  3HVV A;  3IBH A;  1EEM A;  3QD9 A;  4MJE A;  2CV4 A;  4X0X A;  3OR5 A;  1U88 A;  2MMA A;  4CW9 A;  2K8V A;  1TKD B;  1W89 A;  5ECM B;  3RBT A;  1B48 A;  2H1B A;  5EPF A;  3KD0 A;  1ON4 A;  2LJR A;  1ERU A;  3FHK A;  7GSS A;  2AB6 A;  3L78 A;  2VCZ A;  3ZFL A;  2X99 A;  3SWL A;  2MBT A;  4J56 E;  4TR4 A;  1SKR B;  2VIM A;  5B8B A;  4WF5 A;  1N8J A;  2DJ3 A;  3H4K A;  1WMJ A;  3MAK A;  2MMN A;  5G1L A;  4RQR A;  1GTU A;  3HZ8 A;  4MMM A;  5HFI A;  3IAM 2;  2YOI A;  2FWE A;  5DQS A;  3CXG A;  1NSW A;  2JZR A;  2C4J A;  5DAK A;  1V58 A;  1GSY A;  3VPT A;  4TR3 A;  2O7K A;  2HZE A;  2LEG A;  5CAX A;  1DUG A;  4V2M A;  3EYT A;  1XWK A;  2WRT A;  3IXR A;  5J9C A;  5ELG A;  5F8B A;  4LMV A;  4KSM A;  4ECI A;  5F05 A;  2MBS A;  1THX A;  3D4T A;  2VL2 A;  2PN8 A;  5G2Z A;  1G6Y A;  2TIR A;  5H5R A;  1BG5 A;  3MWH A;  4HDE A;  1YJ6 A;  2H1D A;  2GQM A;  4HOJ A;  1G0T A;  5CO3 A;  5F0G A;  2X8H A;  3H1N A;  4O5R A;  20GS A;  2VLV A;  1IYI A;  1GUH A;  4KGI A;  4YQM A;  3QAV A;  1XCC A;  1ML6 A;  3HJP A;  1DE2 A;  3LFL A;  2D2Z A;  5C00 A;  3UJ1 A;  3TJB A;  4AJ7 A;  3BCI A;  3TJK A;  1JZO A;  3ZYW A;  2V41 A;  3TKP A;  4HU7 A;  1TXX A;  3MSZ A;  4POK A;  1K0D A;  4ZBD A;  4JED A;  4EKZ A;  1T7P B;  4JE1 A;  3TJF A;  3F3R A;  3FEU A;  4KUN A;  5DCH A;  2JAD A;  4Q5N A;  2GST A;  2B5Y A;  2NDO A;  1JFU A;  4HQS A;  2VD0 A;  2XC2 A;  4IHU A;  5HR2 A;  1PN9 A;  1PD2 1;  1FVK A;  3EE2 A;  2KP2 A;  2L5L A;  1EV9 A;  4RI6 A;  1X0R A;  4PQH A;  1AUC A;  2LQQ A;  3VI5 A;  2M72 A;  2VOC A;  6GSW A;  2DJ0 A;  3D5J A;  4N0Z A;  1O81 A;  1KTE A;  5CNW A;  5HR1 A;  3BD2 A;  4RUV A;  4ZL7 A;  1G6W A;  2H73 A;  2C3T A;  4IKH A;  3UIW A;  1HNB A;  2DJJ A;  4NPB A;  5IO2 A;  5E4W A;  4I2T A;  3TRQ A;  2L6D A;  3IRA A;  4F2I A;  3TKR A;  2IME A;  2K8S A;  4XS4 A;  3C8E A;  1OKT A;  3U6V A;  1TRS A;  4E8H A;  1LJR A;  2B1K A;  4PQ1 A;  3GHA A;  3ED3 A;  2LJA A;  2VD1 A;  1WPI A;  1XBS A;  1T1V A;  1A2M A;  2LUS A;  2WZ9 A;  2CZ2 A;  4NHW A;  3TKS C;  2JL4 A;  4K7O A;  3W8S A;  4IQA A;  3G7I A;  5IMC A;  3K8N A;  4KDY A;  3ISO A;  4ECB A;  1TRV A;  2ALB A;  4TKY A;  4ML6 A;  2DC5 A;  4DVC A;  4EUY A;  5ECO B;  1F37 A;  4XRA A;  5DAL B;  3HYP A;  4L0W A;  2VL9 A;  1NHY A;  1A24 A;  1YQ1 A;  4GSN A;  3HJO A;  4BWS A;  3KCM A;  2DMM A;  2IFQ A;  3BJ5 A;  3Q18 A;  3EUR A;  2H01 A;  1M0U A;  2K6V A;  4GTU A;  3TDG A;  1PX6 A;  4O32 A;  1BQ7 A;  1WP0 A;  4IP1 A;  4EF0 A;  3E3E A;  1HNC A;  2IIY A;  4MF7 A;  5GZZ B;  1T3B A;  4GF0 A;  2AYT A;  1SYX A;  2AHE A;  3ZFB A;  1YKA A;  4EC0 A;  3JCM L;  2X8C A;  2LRN A;  1Z7R A;  1K0B A;  4KND A;  1XVW A;  2WUL A;  2XPE A;  3QFA C;  2YV9 A;  2TRX A;  1PKZ A;  2PU9 C;  3GRX A;  5IPH A;  4YAP A;  1U3I A;  4QL7 A;  1ERV A;  1I5G A;  3ZZX A;  2ZNM A;  2PGT A;  1J0F A;  1JLW A;  9GSS A;  3C1R A;  3L0H A;  5J5N A;  1BED A;  1TRU A;  1TOF A;  4OCE A;  3RAZ A;  2LJK A;  1X5C A;  2YV7 A;  4WEY A;  3LXZ A;  1XW9 A;  2LV3 A;  4KA0 A;  4JRR A;  5D9T A;  4X1U A;  4LLR A;  2HI7 A;  4BPY A;  2C1Y A;  2AUV A;  1M9B A;  3G7J A;  2YWM A;  3CRT A;  2LTK A;  2F8A A;  5DJL A;  3GKM A;  3KXO A;  1A2L A;  3KH9 A;  1SJ6 A;  1T00 A;  3FYG A;  1K0N A;  3ZLP A;  1DBY A;  3LJR A;  4MZC A;  1SL0 B;  10GS A;  4I2U A;  4KH7 A;  5HFG A;  3EMX A;  3GL3 A;  1FVJ A;  3WGX A;  1A8L A;  2M46 A;  3FY7 A;  1SJI A;  3C7M A;  3GH9 A;  3VFI A;  3TCO A;  1F2E A;  3CSH A;  5ECL B;  2YJH A;  5GSS A;  2GZZ A;  3MDK A;  3I69 A;  5G30 A;  2L5O A;  4DSS B;  2V32 A;  4NXI A;  2KLX A;  1X9W B;  4EXJ A;  2P0G A;  2B6M A;  2CX3 A;  1EP8 A;  2GVP A;  3EC3 A;  2DJK A;  3RHB A;  1USB A;  2R2J A;  1M2B A;  3ZRD A;  4MCU A;  1K3Y A;  4LL4 B;  1HYU A;  1TRW A;  5DAK B;  1CQH A;  4F82 A;  2FA8 A;  4GLT A;  2HZE B;  1JLV A;  1OVN A;  1BYE A;  2TRC P;  1QUW A;  1Z5Y E;  2K9F A;  4ZBA A;  1O6J A;  4P3Y B;  1I9D A;  2H0G A;  3M1G A;  3QAG A;  5D96 A;  2IN3 A;  2YWN A;  4OD7 A;  3CRU A;  3Q6O A;  4XTS A;  2LS5 A;  4I97 A;  1B4Q A;  3F4S A;  2VCQ A;  1TW9 A;  2EIO A;  2H74 A;  5J9B A;  4FYC A;  2BJX A;  5ECP B;  3CYN A;  4NHZ A;  5D9V A;  2DIY A;  4I8B A;  3DIE A;  2G0F A;  4XS1 A;  1NHO A;  1A0F A;  1R5P A;  1MDI A;  3RDW A;  4PX1 A;  2VUP A;  5HFK A;  1ZYQ B;  1OE7 A;  4AJ8 A;  4V2N A;  4TVE A;  18GS A;  1Z9H A;  1MD4 A;  3VI7 A;  1SD8 A;  4IGJ A;  3M9J A;  2C80 A;  1PQN A;  3ERF A;  3KP9 A;  3GTU A;  3FKF A;  5J3R A;  5GST A;  1F3B A;  3M3M A;  2L4Q A;  4K9Z A;  3UAR A;  3TKS E;  3DVX A;  4JR6 A;  4OMV A;  1GRX A;  5JCW A;  2OE0 A;  4HZ2 A;  3VWW A;  3FZ5 A;  4MZW A;  2ZCT A;  2I3Y A;  1V9W A;  1ZMA A;  1K0M A;  2E2G A;  2E7P A;  1SYR A;  3GYK A;  4FYU A;  4ZB8 A;  3QAW A;  1ZGN A;  4HZ4 A;  2I4A A;  4KSO A;  1EOG A;  2O85 A;  3W6G A;  1B8X A;  4KDX A;  5FWG A;  2DSA A;  4F03 A;  3C71 A;  5HQP A;  5G5F A;  1ZZY A;  3HKR A;  3KMO A;  2CAI A;  2LRT A;  4OO4 A;  2GQK A;  3HXS A;  4G9H A;  2VCV A;  2IMI A;  1WWJ A;  1M99 A;  5EVO A;  3LYK A;  1GTA A;  17GS A;  2XBQ A;  4OFM A;  2XPD A;  2FHE A;  3F6D A;  4FH8 A;  1EV4 A;  3J7Y k;  1PSQ A;  4OFN A;  5C04 A;  1XVQ A;  4OFT A;  5ELA A;  5EL8 A;  3LWA A;  2H6X A;  4WR4 A;  2EIQ A;  2P5Q A;  4XS4 B;  1Q4J A;  5G31 A;  3IPZ A;  5G5E A;  3RPN A;  2FA4 A;  1U3A A;  3CBU A;  2H0H A;  2CVB A;  3DYR A;  4TXV A;  1QFN A;  2A4V A;  3NZN A;  2FCH A;  3HZ4 A;  1SK0 A;  2PWJ A;  4ZB6 A;  1BX9 A;  2C8U A;  3FRC A;  2R3X A;  2E2M A;  4TR1 A;  3Q19 A;  3QR6 A;  4LA1 A;  2VM1 A;  5DDL A;  2JSY A;  3ZVJ D;  2MMZ A;  4ZBB A;  5B7C A;  5ID2 A;  1SKS B;  4LMW A;  3GSS A;  3TUE A;  4G10 A;  4K0N A;  1PMT A;  3APO A;  1U6T A;  3ZVJ A;  5B6M A;  1AQV A;  4XRD A;  1FG4 A;  5HR0 A;  5AGY A;  2CVK A;  2LST A;  2C3N A;  2V6O A;  5JWO B;  3O6T A;  2HRF A;  3UVH A;  3LQ7 A;  3VUR A;  3ZIV A;  4PXO A;  1AQX A;  4L0U A;  4PUF C;  5CRD A;  2FNO A;  2YJ7 A;  1GSU A;  1SK1 A;  4BA7 A;  3TOU A;  1XWB A;  1VRS D;  2PVQ A;  4XIH A;  4KCE A;  2GGT A;  4FYB A;  5DQY A;  5KN0 A;  1SJZ A;  3D4M A;  2VL2 C;  2RLI A;  1R7H A;  2LQO A;  1S3A A;  4L5L A;  3VLN A;  2H1A A;  4YQU A;  3VWV A;  3FR9 A;  5ECH B;  4KB3 A;  5IMD A;  2PUK C;  3AY8 A;  1OYJ A;  22GS A;  3C1S A;  2LKU A;  1J9B A;  2RM5 A;  3N9J A;  1TK5 B;  2H72 A;  4NWY A;  3KMN A;  1F9M A;  3HD5 A;  4GCI A;  1X9S B;  1OC8 A;  2IPA A;  4J57 E;  2CA8 A;  3ERG A;  2GSQ A;  1QMV A;  4ID0 A;  2HXK A;  5H5S A;  3LYP A;  3HVS A;  1JZW A;  3ZMK A;  1GP1 A;  1JHB A;  1TTZ A;  2CZ3 A;  4IP6 A;  4AGS A;  3WD6 A;  2H1G A;  1K3L A;  4ECC A;  2GSS A;  2GS3 A;  2H8L A;  1VF4 A;  2HYX A;  3QPM A;  4TXO A;  5JWR B;  2DJ2 A;  2RII A;  1B4P A;  2N5F A;  1PRX A;  2I9H A;  2O87 A;  1E2Y A;  2CAQ A;  3CMI A;  2I1U A;  1VF2 A;  1F3A A;  1WRY A;  4ULX A;  1BAY A;  2JSZ A;  4IBP A;  5ABR A;  2B1L A;  4TOP A;  3DD3 A;  4X43 A;  2OBK A;  2AAW A;  3UL3 A;  1WE0 A;  3F0I A;  1JZD A;  3WT1 A;  1YEX A;  1R4W A;  5IO0 A;  4CHS A;  2NPB A;  4HEA 2;  16GS A;  4PQI A;  5AN1 A;  2DLX A;  2OKA A;  2REM A;  1ERW A;  3W8J A;  4ILF A;  3M8N A;  3KH7 A;  4O7H A;  3KGK A;  1THO A;  1G7O A;  1KNG A;  1GUM A;  2F9S A;  2VL3 A;  4KE3 A;  1GNE A;  1YKC A;  1E6B A;  2CX4 A;  4K1F A;  1GTB A;  4QQ7 A;  2R4V A;  2HFD A;  5ENU A;  4YH2 A;  2OJL A;  4NAX A;  3DKS A;  1M2D A;  4NMU A;  1M9A A;  1T8E B;  2B7K A;  3F8U A;  2AJQ B;  2WCI A;  1WJK A;  5CRH A;  1BJX A;  3GTU B;  6GSX A;  2RUE A;  3Q74 A;  1SU9 A;  3WGE A;  2IWT A;  4L8E A;  4MLY A;  2BMX A;  3KJY A;  3EMP A;  1O8X A;  2V2G A;  2MMO A;  2F51 A;  2IL3 A;  1MDJ A;  2C0F A;  1PL2 A;  1AAZ A;  1V98 A;  3VK9 A;  4ISD A;  4IQ1 A;  3FR3 A;  2N5A A;  3F3Q A;  5D73 A;  3LXT A;  2OAD A;  1X9M B;  1S3D A;  2NBS A;  3G7Y A;  4IW9 A;  4F0C A;  1Y25 A;  4GRF A;  4K8M A;  4WBR D;  3EU3 A;  4YQV A;  1O85 A;  3TGZ A;  3GIX A;  1OC9 B;  2F8F A;  3TRX A;  3HHV A;  1DSB A;  3A5W A;  2YP6 A;  5D93 A;  1TJD A;  4PGT A;  1K3O A;  1QGV A;  4BL7 A;  4TR0 A;  1FAA A;  4HUA A;  4BVY A;  1AXD A;  5ECI B;  2H6Z A;  3D0Z A;  1K0O A;  2PPT A;  12GS A;  1C72 A;  2X64 A;  3DEX A;  2RUF A;  2KHP A;  4Q5Q A;  1NW2 A;  3GMF A;  2H0I A;  2VO4 A;  1K0C A;  3APQ A;  5INY A;  6GSV A;  4JR4 A;  2GZY A;  3P7X A;  4IEL A;  1TI3 A;  4FIW A;  2O89 A;  4N0V A;  4V2L A;  1T4Y A;  2X8G A;  4D73 A;  1GSD A;  3A2V A;  3DRN A;  3TJJ A;  1GLP A;  1V40 A;  5A4U A;  3H93 A;  5ECR B;  2IMK A;  2CVD A;  2GT6 A;  1MDK A;  4PUA A;  2C0D A;  2H70 A;  1HQO A;  2VLT A;  2N5B A;  2LNT A;  1AIU A;  4KCA A;  6GSU A;  4V1A p;  3TRP A;  2PBJ A;  3WT2 A;  3PIN A;  1EOH A;  2VLU A;  1O73 A;  3ERW A;  3FW2 A;  3GKK A;  3F4T A;  1R5A A;  2L59 A;  3I6A A;  1GNW A;  4PNF A;  1PL1 A;  4N10 A;  3BCK A;  3F4R A;  4IS0 A;  3HCZ A;  4XS6 A;  3EWL A;  3N5O A;  4GQF A;  3DWV A;  5AIX A;  5A4W A;  1A0R P;  2DJ1 A;  2WJU A;  1YF0 A;  4ZB9 A;  5IMA A;  1WIK A;  2MYG A;  1XOB A;  3FK8 A;  3LOR A;  1ILO A;  3DML A;  4NV2 A;  3UEM A;  5DVB A;  3IHQ A;  1Z6M A;  1GUL A;  1YF1 A;  2H71 A;  4IJI A;  5J41 A;  2JZT A;  3E0U A;  4CDO A;  4MA9 A;  1A8Y A;  1SD9 A;  5COH A;  3F9U A;  5GAN D;  3F63 A;  1MTC A;  2JZS A;  4EL1 A;  4MJB A;  4MH2 A;  4MZB A;  8GSS A;  2QSI A;  1K0A A;  2FY6 A;  2GT5 A;  1Q98 A;  2CT6 A;  3GUS A;  5HR3 A;  2QKE A;  3UAP A;  3KTL A;  2R5G A;  1B9Y C;  1UVZ A;  2GSR A;  3V1W A;  3DVW A;  5E59 A;  2YWO A;  4JBB A;  5KN3 A;  3PH9 A;  5IOW A;  3PGT A;  2EC4 A;  2XBI A;  3KZQ A;  5KN2 A;  2O8V B;  2HRN A;  2YWI A;  3G9B A;  4WET A;  14GS A;  4MPG A;  2PMT A;  1UC7 A;  1FB0 A;  1QQ2 A;  3QDN A;  4V1A g;  4OCF A;  1YEP A;  5DCG A;  1RQM A;  4DSQ A;  4Z7X A;  3IK9 A;  1YY7 A;  1SL2 B;  2FWH A;  2A2S A;  4O92 A;  1V57 A;  5DJM A;  1M7T A;  3KP8 A;  3HY2 A;  1XIY A;  3LG6 A;  1EP7 A;  4BVX A;  4HU9 A;  4G2E A;  3D6I A;  2HE3 A;  19GS A;  1OC3 A;  4POL A;  3HJM A;  3ZIT A;  2PER A;  2FD3 A;  3CSI A;  1OKD A;  1S3C A;  3SBC A;  1TK8 B;  5A4V A;  5AIV A;  4POB A;  5AIS A;  3IE3 A;  1GUK A;  2KP1 A;  4YAV A;  4RI7 A;  1VF1 A;  1GSF A;  3GH6 A;  3NOF A;  1GSE A;  3A3T A;  2FUG 2;  4KDU A;  2H66 A;  1H75 A;  5IMV A;  3U5R E;  4HQZ A;  4DSS A;  2GLR A;  4MF5 A;  1GTI A;  2G2Q A;  1XWG A;  3GKN A;  1VGL A;  4WBJ A;  4MPF A;  3P90 A;  2WB9 A;  3NIV A;  1N2A A;  2BTO T;  3L9U A;  1OAZ A;  2KUC A;  3LGC A;  2FLS A;  4MH3 A;  2L57 A;  3BOA A;  2IFQ B;  4K2D A;  1ERT A;  4J2F A;  5IOX A;  1M2A A;  2ZUP A;  1UN2 A;  4POM A;  3F6F A;  1XW5 A;  2P31 A;  2H30 A;  1GSS A;  4LL1 B;  1QK8 A;  5GAP D;  1LBK A;  5JCG A;  1FO5 A;  2IMF A;  1XZO A;  3GST A;  3QCP A;  3UMA A;  5ECQ B;  3GN3 A;  1F6M C;  1GSQ A;  3WYW A;  4K7N A;  1ACV A;  2HSY A;  5IM9 A;  1O8W A;  4HS1 A;  1XWA A;  3L4N A;  2EIR A;  2WDU A;  3VPQ A;  1JZR A;  3ZRE A;  4EE0 A;  5IQY A;  3L9V A;  2F3M A;  6GSY A;  2MZC A;  1EGR A;  3GNJ A;  3TKQ A;  3H79 A;  4NV5 A;  4K7I A;  4N11 A;  3BBY A;  2J23 A;  3R2Q A;  3O3T A;  2I81 A;  2C0G A;  3I43 A;  3H8Q A;  3ME7 A;  2DBC A;  1TU8 A;  5D9X A;  3QFB C;  1RW1 A;  2P5R A;  5ECN B;  2VCT A;  3HA9 A;  3UOM A;  2LNS A;  4GWR A;  4GXZ A;  1XWC A;  4JZQ A;  1UA5 A;  4MF6 A;  5ECK B;  2L4C A;  2PVO C;  5JCU A;  2YCD A;  4HJM A;  2B5E A;  1ABA A;  4AF2 A;  2ON5 A;  2Z9S A;  1AQW A;  2B5X A;  3KM6 A; 
#chains in the Genus database with same CATH topology
 1H4O A;  5IIZ A;  4K0G A;  2OBI A;  4ZIJ A;  3TKS A;  1XOA A;  2OAC A;  2LRC A;  3S9F A;  1DE1 A;  3C73 A;  3GUR A;  4ML1 A;  2VCX A;  5CRG A;  3A5I A;  3VWX A;  5IMF A;  2IMD A;  3IDV A;  4D73 B;  1Y6E A;  1NM3 A;  2OE1 A;  2YAN A;  3TOT A;  1ZYP A;  3EVI A;  3WGD A;  2CQ9 A;  3GA4 A;  4EVM A;  2OA7 A;  3O76 A;  2H76 A;  2M80 A;  1GLQ A;  4ZL9 A;  4DSR A;  4MJA A;  1EEJ A;  5KN1 A;  2R37 A;  1OE8 A;  4I6X A;  2KOK A;  2FWG A;  1CQG A;  3IA1 A;  4WR5 A;  2X4A A;  4KX4 A;  3GKX A;  2C3Q A;  3EU4 A;  3P8W A;  1ZOF A;  4MP4 A;  4TN8 A;  1T4Z A;  4IN0 A;  3QOU A;  2R0C A;  5IMZ A;  2GTU A;  3M0F A;  2JAC A;  2QC7 A;  3DXB A;  1X5E A;  6GST A;  1GL8 A;  3D21 A;  2HLS A;  4MJC A;  5CP1 A;  5JWQ B;  1GWC A;  2VAF A;  1ZL9 A;  3E9J B;  5D8I A;  4GST A;  1Z7P A;  5KEJ A;  3CSJ A;  1TP9 A;  4XCS A;  2AV4 A;  3MNG A;  4AJ6 A;  3UBK A;  4RQX A;  2HT9 A;  1YDK A;  3EIN A;  4IJ3 A;  3ZML A;  4WXT A;  2V6K A;  1G7E A;  6GSS A;  4TW5 A;  2K18 A;  5L71 A;  1Z6N A;  1ZYE A;  1WOU A;  2IJY A;  3LSZ A;  3ME8 A;  4EO3 A;  2WFC A;  3IOS A;  5LD0 A;  1GH2 A;  3L9S A;  3J7Y b;  2J9H A;  1XW6 A;  4MNN A;  3UVT A;  5F07 A;  1PA3 A;  5B6N A;  3APS A;  2E0Q A;  4A5P A;  4HI7 A;  4KAE A;  1KEB A;  3QMX A;  4WF4 A;  1V2A A;  5F06 A;  4G0I A;  3HVX A;  1PKW A;  5FHI A;  3TJG A;  4USS A;  3CTF A;  4HJ2 A;  1X5D A;  4DEJ A;  1PGT A;  3GL5 A;  3IC4 A;  3ZIJ A;  2XHF A;  3GX0 A;  1EWX A;  2V1M A;  3FZ4 A;  1R26 A;  3GV1 A;  1PX7 A;  1XFL A;  1W4V A;  2VM2 A;  3GX8 A;  3DGQ A;  3RPP A;  1B9X C;  13GS A;  4K5R A;  3VWU A;  3PR8 A;  1MD3 A;  5D9W A;  2QA1 A;  5A5K A;  11GS A;  1FB6 A;  4WKW A;  4ZL8 A;  4KW6 A;  1XPV A;  1SK2 A;  3HDC A;  4PUR A;  5CYY A;  4EDZ A;  5CRE A;  4G19 A;  3A2W A;  4TR1 B;  5B8A A;  2A2R A;  4O5Q A;  1TDI A;  5FT3 A;  2YZU A;  4EDY A;  1SKW B;  2HSH A;  3IR4 A;  1XXU A;  1MEK A;  3ZTL A;  2GQL A;  5ID2 B;  5CRW A;  4F0B A;  2OE3 A;  1LU4 A;  2ON7 A;  4H86 A;  4XHM A;  3CTG A;  5EY6 A;  5LCZ A;  2C0E A;  2HZF A;  1A2J A;  4Q5F A;  4K6X A;  2H19 A;  2YZH A;  4PNG A;  1SL1 B;  4OWY A;  3KIJ A;  4JU5 A;  5DAL A;  3IC8 A;  2B7J A;  2HNL A;  1J08 A;  4OO5 A;  2L6C A;  3GFK A;  5J4U A;  3IK7 A;  1KBN A;  4N30 A;  3UBL A;  1HD2 A;  2FWF A;  1FHE A;  3IAS 2;  1QXH A;  5DBQ A;  1ZYN A;  1O7U A;  2GDR A;  4MDC A;  1Z3E A;  3TB2 A;  2YPM A;  1U87 A;  1HNA A;  2FGX A;  2R6K A;  3KTB A;  4ZXG A;  4ZIL A;  4QL9 A;  1TI1 A;  1ZCP A;  2YN1 A;  1VF3 A;  2DIZ A;  4Q5R A;  1ST9 A;  3M9K A;  5H5Q A;  4FO5 A;  5ECS A;  2B3S A;  1AW9 A;  4GSS A;  3FR6 A;  1AC1 A;  5LNK e;  4E8E A;  1YZX A;  3FZ9 A;  4BWQ A;  1RK4 A;  1FW1 A;  4ECJ A;  1FOV A;  3P2A A;  1EGO A;  1TK0 B;  2JU5 A;  2NVL A;  4MK3 A;  3LEF A;  3IV4 A;  2QGV A;  1A23 A;  3US3 A;  3KEB A;  2H6Y A;  2VCW A;  1URM A;  1EZK A;  3A2X A;  4L5O A;  2ES7 A;  4ACS A;  3D22 A;  2NTO A;  3RHC A;  2QA2 A;  4GQC A;  3ZL5 A;  2H75 A;  4TRX A;  4I5Q A;  3FZA A;  5G1K A;  2YNX A;  1OC9 A;  2DML A;  4F9Z A;  1SEN A;  2WS2 A;  2WGR A;  4MAB A;  1IYH A;  2GZP A;  4IVF A;  1TU7 A;  5IPG A;  3I9V 2;  4TXO B;  2RM6 A;  3HVV A;  3IBH A;  1EEM A;  3QD9 A;  4MJE A;  2CV4 A;  4X0X A;  3OR5 A;  1U88 A;  2MMA A;  4CW9 A;  2K8V A;  1TKD B;  1W89 A;  4ICY A;  5ECM B;  3RBT A;  1B48 A;  2H1B A;  5EPF A;  3KD0 A;  1ON4 A;  2LJR A;  1ERU A;  3FHK A;  7GSS A;  2AB6 A;  3L78 A;  2VCZ A;  4Z2R A;  3ZFL A;  2X99 A;  3SWL A;  2MBT A;  4J56 E;  4TR4 A;  1SKR B;  2VIM A;  5B8B A;  4WF5 A;  1N8J A;  2DJ3 A;  3H4K A;  1WMJ A;  3MAK A;  2MMN A;  5G1L A;  4RQR A;  1GTU A;  3HZ8 A;  4MMM A;  5HFI A;  3IAM 2;  2YOI A;  2FWE A;  5DQS A;  3CXG A;  1NSW A;  2JZR A;  2C4J A;  5DAK A;  1V58 A;  1GSY A;  3VPT A;  4G0K A;  4TR3 A;  2O7K A;  2HZE A;  2LEG A;  5CAX A;  1DUG A;  4V2M A;  3EYT A;  1XWK A;  2WRT A;  3IXR A;  5J9C A;  5ELG A;  5F8B A;  4LMV A;  4KSM A;  4ECI A;  5F05 A;  2MBS A;  1THX A;  3D4T A;  1FOH A;  2VL2 A;  2PN8 A;  5G2Z A;  1G6Y A;  2TIR A;  5H5R A;  1BG5 A;  3MWH A;  4HDE A;  1YJ6 A;  2H1D A;  2GQM A;  4HOJ A;  1G0T A;  5CO3 A;  5F0G A;  2X8H A;  3H1N A;  4O5R A;  20GS A;  2VLV A;  1IYI A;  1GUH A;  4KGI A;  4YQM A;  3QAV A;  1XCC A;  1ML6 A;  3HJP A;  1DE2 A;  3LFL A;  2D2Z A;  5C00 A;  3UJ1 A;  3TJB A;  4AJ7 A;  4PTS A;  3BCI A;  3IHG A;  3TJK A;  1JZO A;  3ZYW A;  2V41 A;  3TKP A;  4HU7 A;  1TXX A;  3MSZ A;  4POK A;  1K0D A;  4ZBD A;  4JED A;  4EKZ A;  1T7P B;  4JE1 A;  2A2P A;  1S3R A;  3TJF A;  3F3R A;  3FEU A;  4YKG A;  4KUN A;  5DCH A;  4BL7 B;  2JAD A;  4Q5N A;  2GST A;  4BVY B;  2B5Y A;  2NDO A;  1JFU A;  4HQS A;  2VD0 A;  2XC2 A;  4IHU A;  5HR2 A;  1PN9 A;  1PD2 1;  1FVK A;  3EE2 A;  2KP2 A;  2L5L A;  4Z2T A;  1EV9 A;  3LW9 A;  4RI6 A;  1X0R A;  4PQH A;  1AUC A;  2LQQ A;  3VI5 A;  2M72 A;  2VOC A;  6GSW A;  2DJ0 A;  3D5J A;  4N0Z A;  1O81 A;  1KTE A;  3EPT A;  5CNW A;  5HR1 A;  4CY8 A;  3BD2 A;  4RUV A;  4ZL7 A;  3MYD A;  1G6W A;  2R0P A;  2A4H A;  2H73 A;  2C3T A;  4CY6 A;  4IKH A;  3UIW A;  1XG8 A;  1HNB A;  2DJJ A;  4NPB A;  5IO2 A;  5E4W A;  4I2T A;  3TRQ A;  2L6D A;  3IRA A;  4F2I A;  3TKR A;  2IME A;  2K8S A;  4XS4 A;  3C8E A;  1OKT A;  3U6V A;  1TRS A;  4E8H A;  1LJR A;  2B1K A;  4PQ1 A;  3GHA A;  3ED3 A;  2LJA A;  2VD1 A;  1WPI A;  1XBS A;  1T1V A;  1A2M A;  2LUS A;  2WZ9 A;  2CZ2 A;  4NHW A;  3TKS C;  2JL4 A;  4K7O A;  3W8S A;  4IQA A;  3G7I A;  5IMC A;  3K8N A;  4KDY A;  3ISO A;  4ECB A;  1TRV A;  2ALB A;  4TKY A;  4ML6 A;  2DC5 A;  4DVC A;  4EUY A;  5ECO B;  1F37 A;  4XRA A;  5DAL B;  3HYP A;  4L0W A;  2VL9 A;  1NHY A;  4K5S A;  1A24 A;  1YQ1 A;  4GSN A;  3HJO A;  4BWS A;  5BMU A;  3KCM A;  2DMM A;  2IFQ A;  3BJ5 A;  3Q18 A;  3EUR A;  2H01 A;  1M0U A;  2K6V A;  4GTU A;  3TDG A;  1PX6 A;  4O32 A;  1BQ7 A;  1WP0 A;  4IP1 A;  4EF0 A;  3E3E A;  1HNC A;  2IIY A;  4MF7 A;  5GZZ B;  1T3B A;  4GF0 A;  2AYT A;  1SYX A;  2AHE A;  3ZFB A;  1YKA A;  4EC0 A;  3JCM L;  2X8C A;  2LRN A;  1Z7R A;  1K0B A;  4KND A;  1XVW A;  2WUL A;  2XPE A;  3QFA C;  2YV9 A;  2TRX A;  1PKZ A;  2PU9 C;  3GRX A;  5IPH A;  4YAP A;  1U3I A;  4QL7 A;  1ERV A;  1I5G A;  3ZZX A;  2ZNM A;  2PGT A;  1J0F A;  1JLW A;  9GSS A;  3C1R A;  3L0H A;  5J5N A;  1BED A;  1TRU A;  1TOF A;  4OCE A;  3RAZ A;  2LJK A;  1X5C A;  2YV7 A;  4WEY A;  3LXZ A;  1XW9 A;  2LV3 A;  4KA0 A;  1M3J A;  4JRR A;  3CQF A;  5D9T A;  4X1U A;  3R3E A;  4LLR A;  2HI7 A;  4BPY A;  2C1Y A;  2AUV A;  1M9B A;  3G7J A;  4BVX B;  2YWM A;  3CRT A;  2LTK A;  2F8A A;  5DJL A;  3GKM A;  3KXO A;  1A2L A;  3KH9 A;  1SJ6 A;  1T00 A;  3FYG A;  4HSC X;  1K0N A;  3ZLP A;  1DBY A;  3LJR A;  4MZC A;  1SL0 B;  10GS A;  4I2U A;  4KH7 A;  5HFG A;  3EMX A;  3GL3 A;  1FVJ A;  3WGX A;  1A8L A;  2M46 A;  3FY7 A;  1SJI A;  3C7M A;  3GH9 A;  3VFI A;  3TCO A;  1F2E A;  3CSH A;  5ECL B;  2YJH A;  5GSS A;  2GZZ A;  3MDK A;  3I69 A;  5G30 A;  2L5O A;  4DSS B;  2V32 A;  4NXI A;  2KLX A;  1X9W B;  4EXJ A;  2P0G A;  2B6M A;  2CX3 A;  1EP8 A;  2GVP A;  3EC3 A;  2DJK A;  3RHB A;  1USB A;  2R2J A;  1M2B A;  3ZRD A;  4MCU A;  1K3Y A;  4LL4 B;  1HYU A;  1TRW A;  5DAK B;  1CQH A;  4F82 A;  2FA8 A;  4GLT A;  2HZE B;  1JLV A;  1OVN A;  1BYE A;  2TRC P;  1QUW A;  1Z5Y E;  2K9F A;  4ZBA A;  1O6J A;  4P3Y B;  1I9D A;  2H0G A;  3M1G A;  3QAG A;  3PPU A;  5D96 A;  4BIK A;  2IN3 A;  2YWN A;  4OD7 A;  3CRU A;  3Q6O A;  4XTS A;  2LS5 A;  4I97 A;  1B4Q A;  3F4S A;  2VCQ A;  1TW9 A;  2EIO A;  2H74 A;  5J9B A;  4FYC A;  2BJX A;  5ECP B;  3CYN A;  4NHZ A;  5D9V A;  2DIY A;  4I8B A;  2HRA A;  3DIE A;  2G0F A;  4XS1 A;  1NHO A;  1A0F A;  1R5P A;  1MDI A;  4G0L A;  3RDW A;  4PX1 A;  2VUP A;  5HFK A;  1ZYQ B;  1OE7 A;  5BRT A;  4AJ8 A;  4V2N A;  4TVE A;  18GS A;  1Z9H A;  1MD4 A;  3VI7 A;  1SD8 A;  4IGJ A;  3M9J A;  2C80 A;  1PQN A;  3ERF A;  3KP9 A;  3GTU A;  3FKF A;  5J3R A;  5GST A;  1F3B A;  3M3M A;  2L4Q A;  4K9Z A;  3UAR A;  3TKS E;  3DVX A;  4JR6 A;  4OMV A;  1GRX A;  5JCW A;  2OE0 A;  4HZ2 A;  3VWW A;  3FZ5 A;  4MZW A;  2ZCT A;  2I3Y A;  1V9W A;  1ZMA A;  1K0M A;  1PN0 A;  2E2G A;  2E7P A;  4FQU A;  1SYR A;  3GYK A;  4FYU A;  4ZB8 A;  3QAW A;  1ZGN A;  4HZ4 A;  2I4A A;  4KSO A;  1EOG A;  2O85 A;  3W6G A;  1B8X A;  4KDX A;  3MIX A;  5FWG A;  2DSA A;  4F03 A;  3C71 A;  5HQP A;  5G5F A;  1ZZY A;  3HKR A;  3KMO A;  2CAI A;  2LRT A;  4OO4 A;  2GQK A;  3HXS A;  4G9H A;  2VCV A;  2IMI A;  1WWJ A;  1M99 A;  5KOX A;  5EVO A;  3LYK A;  1GTA A;  17GS A;  2XBQ A;  4OFM A;  2XPD A;  2R0G A;  2FHE A;  3F6D A;  4FH8 A;  1EV4 A;  3J7Y k;  1PSQ A;  4OFN A;  5C04 A;  1XVQ A;  4OFT A;  5ELA A;  5EL8 A;  3LWA A;  2H6X A;  4WR4 A;  2EIQ A;  2P5Q A;  4XS4 B;  1Q4J A;  5G31 A;  3IPZ A;  5G5E A;  3RPN A;  2FA4 A;  1U3A A;  3CBU A;  2H0H A;  4X4J A;  2CVB A;  3DYR A;  4TXV A;  1QFN A;  2A4V A;  3NZN A;  2FCH A;  3HZ4 A;  1SK0 A;  2PWJ A;  4ZB6 A;  1BX9 A;  2C8U A;  3FRC A;  2R3X A;  2E2M A;  4K2X A;  4TR1 A;  3Q19 A;  3QR6 A;  4LA1 A;  2VM1 A;  5DDL A;  2JSY A;  3ZVJ D;  2MMZ A;  4ZBB A;  5B7C A;  5ID2 A;  1SKS B;  4LMW A;  3GSS A;  3TUE A;  4G10 A;  4K0N A;  1PMT A;  3APO A;  1U6T A;  4O5U A;  3ZVJ A;  5B6M A;  1AQV A;  4XRD A;  1FG4 A;  5HR0 A;  5AGY A;  2CVK A;  2LST A;  2C3N A;  2V6O A;  5JWO B;  3O6T A;  2HRF A;  3UVH A;  3LQ7 A;  3VUR A;  3ZIV A;  4PXO A;  1AQX A;  4L0U A;  4PUF C;  5CRD A;  2FNO A;  2YJ7 A;  1GSU A;  1SK1 A;  4BA7 A;  3TOU A;  1XWB A;  1VRS D;  2PVQ A;  4XIH A;  4KCE A;  2GGT A;  4FYB A;  5DQY A;  5KN0 A;  1SJZ A;  3D4M A;  2VL2 C;  2RLI A;  1R7H A;  2LQO A;  1S3A A;  4L5L A;  3VLN A;  2DKH A;  2H1A A;  4YQU A;  3VWV A;  3FR9 A;  5ECH B;  2HSM A;  4KB3 A;  5IMD A;  2PUK C;  3AY8 A;  1OYJ A;  22GS A;  3C1S A;  2LKU A;  1J9B A;  2RM5 A;  3N9J A;  1TK5 B;  2H72 A;  4NWY A;  3KMN A;  1F9M A;  3HD5 A;  4GCI A;  1X9S B;  1OC8 A;  2IPA A;  4J57 E;  2CA8 A;  3ERG A;  2GSQ A;  1QMV A;  4ID0 A;  2HXK A;  5H5S A;  3LYP A;  3HVS A;  1JZW A;  3ZMK A;  1GP1 A;  1JHB A;  1TTZ A;  2CZ3 A;  4IP6 A;  4AGS A;  3WD6 A;  2H1G A;  1K3L A;  4ECC A;  4EIQ A;  2GSS A;  2GS3 A;  2H8L A;  1VF4 A;  2HYX A;  3QPM A;  4TXO A;  4Z2U A;  5JWR B;  2DJ2 A;  2RII A;  1B4P A;  2N5F A;  1PRX A;  2I9H A;  2O87 A;  1E2Y A;  2CAQ A;  3CMI A;  2I1U A;  1VF2 A;  1F3A A;  1WRY A;  4ULX A;  1BAY A;  2JSZ A;  4IBP A;  5ABR A;  2B1L A;  4TOP A;  3DD3 A;  4X43 A;  2OBK A;  2AAW A;  3UL3 A;  1WE0 A;  3F0I A;  1JZD A;  3WT1 A;  1YEX A;  1R4W A;  5IO0 A;  4CHS A;  2NPB A;  4HEA 2;  16GS A;  4PQI A;  5AN1 A;  2DLX A;  2OKA A;  2REM A;  1ERW A;  3W8J A;  4ILF A;  3M8N A;  3KH7 A;  4O7H A;  3KGK A;  1THO A;  1G7O A;  1KNG A;  1GUM A;  2F9S A;  2VL3 A;  4KE3 A;  1GNE A;  1YKC A;  1E6B A;  2CX4 A;  4K1F A;  1GTB A;  4QQ7 A;  2R4V A;  2HFD A;  5ENU A;  4YH2 A;  2OJL A;  4NAX A;  3DKS A;  1M2D A;  4NMU A;  1M9A A;  1T8E B;  2B7K A;  3F8U A;  2AJQ B;  2WCI A;  1WJK A;  5CRH A;  1BJX A;  3GTU B;  6GSX A;  2RUE A;  3Q74 A;  1SU9 A;  3WGE A;  2IWT A;  4L8E A;  4MLY A;  2BMX A;  3KJY A;  3EMP A;  1O8X A;  2V2G A;  2MMO A;  2F51 A;  2IL3 A;  1MDJ A;  2C0F A;  1PL2 A;  1AAZ A;  1V98 A;  4EIP A;  3VK9 A;  4ISD A;  4IQ1 A;  3FR3 A;  2N5A A;  3F3Q A;  5D73 A;  3LXT A;  2OAD A;  1X9M B;  1S3D A;  2NBS A;  3G7Y A;  4IW9 A;  4F0C A;  1Y25 A;  4GRF A;  4K8M A;  4WBR D;  3EU3 A;  4YQV A;  1O85 A;  3TGZ A;  3GIX A;  1OC9 B;  2F8F A;  3TRX A;  3HHV A;  1DSB A;  3A5W A;  2YP6 A;  5D93 A;  1TJD A;  4PGT A;  3FMW A;  1K3O A;  1QGV A;  4BL7 A;  4TR0 A;  1FAA A;  4HUA A;  4BVY A;  1AXD A;  5ECI B;  2H6Z A;  3D0Z A;  1K0O A;  2PPT A;  12GS A;  1C72 A;  2X64 A;  3DEX A;  2RUF A;  2KHP A;  4Q5Q A;  1NW2 A;  3GMF A;  2H0I A;  2VO4 A;  1K0C A;  3APQ A;  5INY A;  6GSV A;  4JR4 A;  2GZY A;  3P7X A;  4IEL A;  1TI3 A;  4FIW A;  2O89 A;  4N0V A;  4V2L A;  1T4Y A;  2X8G A;  4D73 A;  1GSD A;  3A2V A;  3DRN A;  3TJJ A;  1GLP A;  1V40 A;  5A4U A;  3H93 A;  5ECR B;  2IMK A;  2CVD A;  2GT6 A;  1MDK A;  4PUA A;  2C0D A;  2H70 A;  1HQO A;  2VLT A;  2N5B A;  2LNT A;  1AIU A;  4KCA A;  6GSU A;  4V1A p;  3TRP A;  2DKI A;  2PBJ A;  3WT2 A;  3PIN A;  1EOH A;  2VLU A;  1O73 A;  3ERW A;  3FW2 A;  3GKK A;  3F4T A;  1R5A A;  2L59 A;  3I6A A;  1GNW A;  4PNF A;  1PL1 A;  4N10 A;  3BCK A;  3F4R A;  4IS0 A;  3HCZ A;  4XS6 A;  3EWL A;  3N5O A;  4GQF A;  3DWV A;  5AIX A;  5A4W A;  1A0R P;  2DJ1 A;  2WJU A;  1YF0 A;  4ZB9 A;  5IMA A;  1WIK A;  2MYG A;  1XOB A;  3FK8 A;  3LOR A;  2X49 A;  1ILO A;  3DML A;  4NV2 A;  3UEM A;  5DVB A;  3IHQ A;  1Z6M A;  1GUL A;  1YF1 A;  2H71 A;  4IJI A;  5J41 A;  2JZT A;  3E0U A;  4CDO A;  4MA9 A;  1A8Y A;  1SD9 A;  5COH A;  3F9U A;  5GAN D;  3F63 A;  1MTC A;  2JZS A;  4EL1 A;  4MJB A;  4MH2 A;  4MZB A;  8GSS A;  4KF9 A;  2QSI A;  5KOW A;  1K0A A;  2FY6 A;  2GT5 A;  1Q98 A;  2CT6 A;  3GUS A;  5HR3 A;  2QKE A;  3UAP A;  3KTL A;  2R5G A;  1B9Y C;  1UVZ A;  2GSR A;  3V1W A;  3DVW A;  5E59 A;  2YWO A;  4JBB A;  2HRK A;  5KN3 A;  3PH9 A;  5IOW A;  3PGT A;  1M3I A;  2EC4 A;  2XBI A;  3KZQ A;  5KN2 A;  2O8V B;  2HRN A;  2YWI A;  3G9B A;  4WET A;  14GS A;  4MPG A;  2PMT A;  1UC7 A;  1FB0 A;  1QQ2 A;  3QDN A;  4V1A g;  4OCF A;  1YEP A;  5DCG A;  1RQM A;  4DSQ A;  4Z7X A;  3IK9 A;  1YY7 A;  1SL2 B;  2FWH A;  2A2S A;  4O92 A;  1V57 A;  5DJM A;  1M7T A;  3KP8 A;  3HY2 A;  1XIY A;  3LG6 A;  1EP7 A;  4BVX A;  4HU9 A;  4G2E A;  3D6I A;  2HE3 A;  19GS A;  1OC3 A;  4POL A;  3HJM A;  3ZIT A;  2PER A;  2FD3 A;  3CSI A;  1OKD A;  1S3C A;  3SBC A;  1TK8 B;  5A4V A;  5AIV A;  4POB A;  5AIS A;  3IE3 A;  1GUK A;  2KP1 A;  4YAV A;  4RI7 A;  1VF1 A;  1GSF A;  3GH6 A;  3NOF A;  1GSE A;  3A3T A;  2FUG 2;  4KDU A;  2H66 A;  1H75 A;  5IMV A;  3U5R E;  4HQZ A;  4DSS A;  2GLR A;  4MF5 A;  1GTI A;  2G2Q A;  1XWG A;  3GKN A;  1VGL A;  4WBJ A;  4MPF A;  2UZ8 A;  3P90 A;  2WB9 A;  3NIV A;  1N2A A;  2BTO T;  3L9U A;  1OAZ A;  2KUC A;  3LGC A;  2FLS A;  4MH3 A;  2L57 A;  3BOA A;  2IFQ B;  4K2D A;  1ERT A;  4J2F A;  5IOX A;  1M2A A;  2ZUP A;  1UN2 A;  4POM A;  3F6F A;  1XW5 A;  2P31 A;  2H30 A;  1GSS A;  4LL1 B;  1QK8 A;  5GAP D;  1LBK A;  5JCG A;  1FO5 A;  2IMF A;  1XZO A;  3GST A;  3QCP A;  3UMA A;  5ECQ B;  3GN3 A;  1F6M C;  1GSQ A;  3WYW A;  4K7N A;  1ACV A;  2HSY A;  5IM9 A;  1O8W A;  4HS1 A;  1XWA A;  1PFO A;  3L4N A;  2EIR A;  2WDU A;  3VPQ A;  1JZR A;  3ZRE A;  4EE0 A;  5IQY A;  3L9V A;  2F3M A;  6GSY A;  2MZC A;  1EGR A;  3GNJ A;  3TKQ A;  3H79 A;  4NV5 A;  4K7I A;  4N11 A;  4YKF A;  3BBY A;  2J23 A;  3R2Q A;  3O3T A;  2I81 A;  2C0G A;  3I43 A;  3H8Q A;  3ME7 A;  2DBC A;  1TU8 A;  5D9X A;  3QFB C;  1RW1 A;  2P5R A;  5ECN B;  3HVN A;  2VCT A;  3HA9 A;  3UOM A;  2LNS A;  4GWR A;  4GXZ A;  1XWC A;  4JZQ A;  1UA5 A;  4MF6 A;  5ECK B;  2L4C A;  2PVO C;  5JCU A;  2YCD A;  4HJM A;  2B5E A;  1ABA A;  4AF2 A;  2ON5 A;  2Z9S A;  1AQW A;  2B5X A;  3KM6 A; 
#chains in the Genus database with same CATH homology
 1H4O A;  5IIZ A;  4K0G A;  2OBI A;  4ZIJ A;  3TKS A;  1XOA A;  2OAC A;  2LRC A;  3S9F A;  1DE1 A;  3C73 A;  3GUR A;  4ML1 A;  2VCX A;  5CRG A;  3A5I A;  3VWX A;  5IMF A;  2IMD A;  3IDV A;  4D73 B;  1Y6E A;  1NM3 A;  2OE1 A;  2YAN A;  3TOT A;  1ZYP A;  3EVI A;  3WGD A;  2CQ9 A;  3GA4 A;  4EVM A;  2OA7 A;  3O76 A;  2H76 A;  2M80 A;  1GLQ A;  4ZL9 A;  4DSR A;  4MJA A;  1EEJ A;  5KN1 A;  2R37 A;  1OE8 A;  4I6X A;  2KOK A;  2FWG A;  1CQG A;  3IA1 A;  4WR5 A;  2X4A A;  4KX4 A;  3GKX A;  2C3Q A;  3EU4 A;  3P8W A;  1ZOF A;  4MP4 A;  4TN8 A;  1T4Z A;  4IN0 A;  3QOU A;  2R0C A;  5IMZ A;  2GTU A;  3M0F A;  2JAC A;  2QC7 A;  3DXB A;  1X5E A;  6GST A;  1GL8 A;  3D21 A;  2HLS A;  4MJC A;  5CP1 A;  5JWQ B;  1GWC A;  2VAF A;  1ZL9 A;  3E9J B;  5D8I A;  4GST A;  1Z7P A;  5KEJ A;  3CSJ A;  1TP9 A;  4XCS A;  2AV4 A;  3MNG A;  4AJ6 A;  3UBK A;  4RQX A;  2HT9 A;  1YDK A;  3EIN A;  4IJ3 A;  3ZML A;  4WXT A;  2V6K A;  1G7E A;  6GSS A;  4TW5 A;  2K18 A;  5L71 A;  1Z6N A;  1ZYE A;  1WOU A;  2IJY A;  3LSZ A;  3ME8 A;  4EO3 A;  2WFC A;  3IOS A;  5LD0 A;  1GH2 A;  3L9S A;  3J7Y b;  2J9H A;  1XW6 A;  4MNN A;  3UVT A;  5F07 A;  1PA3 A;  5B6N A;  3APS A;  2E0Q A;  4A5P A;  4HI7 A;  4KAE A;  1KEB A;  3QMX A;  4WF4 A;  1V2A A;  5F06 A;  4G0I A;  3HVX A;  1PKW A;  5FHI A;  3TJG A;  4USS A;  3CTF A;  4HJ2 A;  1X5D A;  4DEJ A;  1PGT A;  3GL5 A;  3IC4 A;  3ZIJ A;  2XHF A;  3GX0 A;  1EWX A;  2V1M A;  3FZ4 A;  1R26 A;  3GV1 A;  1PX7 A;  1XFL A;  1W4V A;  2VM2 A;  3GX8 A;  3DGQ A;  3RPP A;  1B9X C;  13GS A;  4K5R A;  3VWU A;  3PR8 A;  1MD3 A;  5D9W A;  2QA1 A;  5A5K A;  11GS A;  1FB6 A;  4WKW A;  4ZL8 A;  4KW6 A;  1XPV A;  1SK2 A;  3HDC A;  4PUR A;  5CYY A;  4EDZ A;  5CRE A;  4G19 A;  3A2W A;  4TR1 B;  5B8A A;  2A2R A;  4O5Q A;  1TDI A;  5FT3 A;  2YZU A;  4EDY A;  1SKW B;  2HSH A;  3IR4 A;  1XXU A;  1MEK A;  3ZTL A;  2GQL A;  5ID2 B;  5CRW A;  4F0B A;  2OE3 A;  1LU4 A;  2ON7 A;  4H86 A;  4XHM A;  3CTG A;  5EY6 A;  5LCZ A;  2C0E A;  2HZF A;  1A2J A;  4Q5F A;  4K6X A;  2H19 A;  2YZH A;  4PNG A;  1SL1 B;  4OWY A;  3KIJ A;  4JU5 A;  5DAL A;  3IC8 A;  2B7J A;  2HNL A;  1J08 A;  4OO5 A;  2L6C A;  3GFK A;  5J4U A;  3IK7 A;  1KBN A;  4N30 A;  3UBL A;  1HD2 A;  2FWF A;  1FHE A;  3IAS 2;  1QXH A;  5DBQ A;  1ZYN A;  1O7U A;  2GDR A;  4MDC A;  1Z3E A;  3TB2 A;  2YPM A;  1U87 A;  1HNA A;  2FGX A;  2R6K A;  3KTB A;  4ZXG A;  4ZIL A;  4QL9 A;  1TI1 A;  1ZCP A;  2YN1 A;  1VF3 A;  2DIZ A;  4Q5R A;  1ST9 A;  3M9K A;  5H5Q A;  4FO5 A;  5ECS A;  2B3S A;  1AW9 A;  4GSS A;  3FR6 A;  1AC1 A;  5LNK e;  4E8E A;  1YZX A;  3FZ9 A;  4BWQ A;  1RK4 A;  1FW1 A;  4ECJ A;  1FOV A;  3P2A A;  1EGO A;  1TK0 B;  2JU5 A;  2NVL A;  4MK3 A;  3LEF A;  3IV4 A;  2QGV A;  1A23 A;  3US3 A;  3KEB A;  2H6Y A;  2VCW A;  1URM A;  1EZK A;  3A2X A;  4L5O A;  2ES7 A;  4ACS A;  3D22 A;  2NTO A;  3RHC A;  2QA2 A;  4GQC A;  3ZL5 A;  2H75 A;  4TRX A;  4I5Q A;  3FZA A;  5G1K A;  2YNX A;  1OC9 A;  2DML A;  4F9Z A;  1SEN A;  2WS2 A;  2WGR A;  4MAB A;  1IYH A;  2GZP A;  4IVF A;  1TU7 A;  5IPG A;  3I9V 2;  4TXO B;  2RM6 A;  3HVV A;  3IBH A;  1EEM A;  3QD9 A;  4MJE A;  2CV4 A;  4X0X A;  3OR5 A;  1U88 A;  2MMA A;  4CW9 A;  2K8V A;  1TKD B;  1W89 A;  4ICY A;  5ECM B;  3RBT A;  1B48 A;  2H1B A;  5EPF A;  3KD0 A;  1ON4 A;  2LJR A;  1ERU A;  3FHK A;  7GSS A;  2AB6 A;  3L78 A;  2VCZ A;  4Z2R A;  3ZFL A;  2X99 A;  3SWL A;  2MBT A;  4J56 E;  4TR4 A;  1SKR B;  2VIM A;  5B8B A;  4WF5 A;  1N8J A;  2DJ3 A;  3H4K A;  1WMJ A;  3MAK A;  2MMN A;  5G1L A;  4RQR A;  1GTU A;  3HZ8 A;  4MMM A;  5HFI A;  3IAM 2;  2YOI A;  2FWE A;  5DQS A;  3CXG A;  1NSW A;  2JZR A;  2C4J A;  5DAK A;  1V58 A;  1GSY A;  3VPT A;  4G0K A;  4TR3 A;  2O7K A;  2HZE A;  2LEG A;  5CAX A;  1DUG A;  4V2M A;  3EYT A;  1XWK A;  2WRT A;  3IXR A;  5J9C A;  5ELG A;  5F8B A;  4LMV A;  4KSM A;  4ECI A;  5F05 A;  2MBS A;  1THX A;  3D4T A;  1FOH A;  2VL2 A;  2PN8 A;  5G2Z A;  1G6Y A;  2TIR A;  5H5R A;  1BG5 A;  3MWH A;  4HDE A;  1YJ6 A;  2H1D A;  2GQM A;  4HOJ A;  1G0T A;  5CO3 A;  5F0G A;  2X8H A;  3H1N A;  4O5R A;  20GS A;  2VLV A;  1IYI A;  1GUH A;  4KGI A;  4YQM A;  3QAV A;  1XCC A;  1ML6 A;  3HJP A;  1DE2 A;  3LFL A;  2D2Z A;  5C00 A;  3UJ1 A;  3TJB A;  4AJ7 A;  4PTS A;  3BCI A;  3IHG A;  3TJK A;  1JZO A;  3ZYW A;  2V41 A;  3TKP A;  4HU7 A;  1TXX A;  3MSZ A;  4POK A;  1K0D A;  4ZBD A;  4JED A;  4EKZ A;  1T7P B;  4JE1 A;  2A2P A;  3TJF A;  3F3R A;  3FEU A;  4YKG A;  4KUN A;  5DCH A;  4BL7 B;  2JAD A;  4Q5N A;  2GST A;  4BVY B;  2B5Y A;  2NDO A;  1JFU A;  4HQS A;  2VD0 A;  2XC2 A;  4IHU A;  5HR2 A;  1PN9 A;  1PD2 1;  1FVK A;  3EE2 A;  2KP2 A;  2L5L A;  4Z2T A;  1EV9 A;  3LW9 A;  4RI6 A;  1X0R A;  4PQH A;  1AUC A;  2LQQ A;  3VI5 A;  2M72 A;  2VOC A;  6GSW A;  2DJ0 A;  3D5J A;  4N0Z A;  1O81 A;  1KTE A;  3EPT A;  5CNW A;  5HR1 A;  4CY8 A;  3BD2 A;  4RUV A;  4ZL7 A;  3MYD A;  1G6W A;  2R0P A;  2A4H A;  2H73 A;  2C3T A;  4CY6 A;  4IKH A;  3UIW A;  1HNB A;  2DJJ A;  4NPB A;  5IO2 A;  5E4W A;  4I2T A;  3TRQ A;  2L6D A;  3IRA A;  4F2I A;  3TKR A;  2IME A;  2K8S A;  4XS4 A;  3C8E A;  1OKT A;  3U6V A;  1TRS A;  4E8H A;  1LJR A;  2B1K A;  4PQ1 A;  3GHA A;  3ED3 A;  2LJA A;  2VD1 A;  1WPI A;  1XBS A;  1T1V A;  1A2M A;  2LUS A;  2WZ9 A;  2CZ2 A;  4NHW A;  3TKS C;  2JL4 A;  4K7O A;  3W8S A;  4IQA A;  3G7I A;  5IMC A;  3K8N A;  4KDY A;  3ISO A;  4ECB A;  1TRV A;  2ALB A;  4TKY A;  4ML6 A;  2DC5 A;  4DVC A;  4EUY A;  5ECO B;  1F37 A;  4XRA A;  5DAL B;  3HYP A;  4L0W A;  2VL9 A;  1NHY A;  4K5S A;  1A24 A;  1YQ1 A;  4GSN A;  3HJO A;  4BWS A;  5BMU A;  3KCM A;  2DMM A;  2IFQ A;  3BJ5 A;  3Q18 A;  3EUR A;  2H01 A;  1M0U A;  2K6V A;  4GTU A;  3TDG A;  1PX6 A;  4O32 A;  1BQ7 A;  1WP0 A;  4IP1 A;  4EF0 A;  3E3E A;  1HNC A;  2IIY A;  4MF7 A;  5GZZ B;  1T3B A;  4GF0 A;  2AYT A;  1SYX A;  2AHE A;  3ZFB A;  1YKA A;  4EC0 A;  3JCM L;  2X8C A;  2LRN A;  1Z7R A;  1K0B A;  4KND A;  1XVW A;  2WUL A;  2XPE A;  3QFA C;  2YV9 A;  2TRX A;  1PKZ A;  2PU9 C;  3GRX A;  5IPH A;  4YAP A;  1U3I A;  4QL7 A;  1ERV A;  1I5G A;  3ZZX A;  2ZNM A;  2PGT A;  1J0F A;  1JLW A;  9GSS A;  3C1R A;  3L0H A;  5J5N A;  1BED A;  1TRU A;  1TOF A;  4OCE A;  3RAZ A;  2LJK A;  1X5C A;  2YV7 A;  4WEY A;  3LXZ A;  1XW9 A;  2LV3 A;  4KA0 A;  4JRR A;  5D9T A;  4X1U A;  3R3E A;  4LLR A;  2HI7 A;  4BPY A;  2C1Y A;  2AUV A;  1M9B A;  3G7J A;  4BVX B;  2YWM A;  3CRT A;  2LTK A;  2F8A A;  5DJL A;  3GKM A;  3KXO A;  1A2L A;  3KH9 A;  1SJ6 A;  1T00 A;  3FYG A;  1K0N A;  3ZLP A;  1DBY A;  3LJR A;  4MZC A;  1SL0 B;  10GS A;  4I2U A;  4KH7 A;  5HFG A;  3EMX A;  3GL3 A;  1FVJ A;  3WGX A;  1A8L A;  2M46 A;  3FY7 A;  1SJI A;  3C7M A;  3GH9 A;  3VFI A;  3TCO A;  1F2E A;  3CSH A;  5ECL B;  2YJH A;  5GSS A;  2GZZ A;  3MDK A;  3I69 A;  5G30 A;  2L5O A;  4DSS B;  2V32 A;  4NXI A;  2KLX A;  1X9W B;  4EXJ A;  2P0G A;  2B6M A;  2CX3 A;  1EP8 A;  2GVP A;  3EC3 A;  2DJK A;  3RHB A;  1USB A;  2R2J A;  1M2B A;  3ZRD A;  4MCU A;  1K3Y A;  4LL4 B;  1HYU A;  1TRW A;  5DAK B;  1CQH A;  4F82 A;  2FA8 A;  4GLT A;  2HZE B;  1JLV A;  1OVN A;  1BYE A;  2TRC P;  1QUW A;  1Z5Y E;  2K9F A;  4ZBA A;  1O6J A;  4P3Y B;  1I9D A;  2H0G A;  3M1G A;  3QAG A;  3PPU A;  5D96 A;  2IN3 A;  2YWN A;  4OD7 A;  3CRU A;  3Q6O A;  4XTS A;  2LS5 A;  4I97 A;  1B4Q A;  3F4S A;  2VCQ A;  1TW9 A;  2EIO A;  2H74 A;  5J9B A;  4FYC A;  2BJX A;  5ECP B;  3CYN A;  4NHZ A;  5D9V A;  2DIY A;  4I8B A;  2HRA A;  3DIE A;  2G0F A;  4XS1 A;  1NHO A;  1A0F A;  1R5P A;  1MDI A;  4G0L A;  3RDW A;  4PX1 A;  2VUP A;  5HFK A;  1ZYQ B;  1OE7 A;  5BRT A;  4AJ8 A;  4V2N A;  4TVE A;  18GS A;  1Z9H A;  1MD4 A;  3VI7 A;  1SD8 A;  4IGJ A;  3M9J A;  2C80 A;  1PQN A;  3ERF A;  3KP9 A;  3GTU A;  3FKF A;  5J3R A;  5GST A;  1F3B A;  3M3M A;  2L4Q A;  4K9Z A;  3UAR A;  3TKS E;  3DVX A;  4JR6 A;  4OMV A;  1GRX A;  5JCW A;  2OE0 A;  4HZ2 A;  3VWW A;  3FZ5 A;  4MZW A;  2ZCT A;  2I3Y A;  1V9W A;  1ZMA A;  1K0M A;  1PN0 A;  2E2G A;  2E7P A;  4FQU A;  1SYR A;  3GYK A;  4FYU A;  4ZB8 A;  3QAW A;  1ZGN A;  4HZ4 A;  2I4A A;  4KSO A;  1EOG A;  2O85 A;  3W6G A;  1B8X A;  4KDX A;  3MIX A;  5FWG A;  2DSA A;  4F03 A;  3C71 A;  5HQP A;  5G5F A;  1ZZY A;  3HKR A;  3KMO A;  2CAI A;  2LRT A;  4OO4 A;  2GQK A;  3HXS A;  4G9H A;  2VCV A;  2IMI A;  1WWJ A;  1M99 A;  5KOX A;  5EVO A;  3LYK A;  1GTA A;  17GS A;  2XBQ A;  4OFM A;  2XPD A;  2R0G A;  2FHE A;  3F6D A;  4FH8 A;  1EV4 A;  3J7Y k;  1PSQ A;  4OFN A;  5C04 A;  1XVQ A;  4OFT A;  5ELA A;  5EL8 A;  3LWA A;  2H6X A;  4WR4 A;  2EIQ A;  2P5Q A;  4XS4 B;  1Q4J A;  5G31 A;  3IPZ A;  5G5E A;  3RPN A;  2FA4 A;  1U3A A;  3CBU A;  2H0H A;  4X4J A;  2CVB A;  3DYR A;  4TXV A;  1QFN A;  2A4V A;  3NZN A;  2FCH A;  3HZ4 A;  1SK0 A;  2PWJ A;  4ZB6 A;  1BX9 A;  2C8U A;  3FRC A;  2R3X A;  2E2M A;  4K2X A;  4TR1 A;  3Q19 A;  3QR6 A;  4LA1 A;  2VM1 A;  5DDL A;  2JSY A;  3ZVJ D;  2MMZ A;  4ZBB A;  5B7C A;  5ID2 A;  1SKS B;  4LMW A;  3GSS A;  3TUE A;  4G10 A;  4K0N A;  1PMT A;  3APO A;  1U6T A;  4O5U A;  3ZVJ A;  5B6M A;  1AQV A;  4XRD A;  1FG4 A;  5HR0 A;  5AGY A;  2CVK A;  2LST A;  2C3N A;  2V6O A;  5JWO B;  3O6T A;  2HRF A;  3UVH A;  3LQ7 A;  3VUR A;  3ZIV A;  4PXO A;  1AQX A;  4L0U A;  4PUF C;  5CRD A;  2FNO A;  2YJ7 A;  1GSU A;  1SK1 A;  4BA7 A;  3TOU A;  1XWB A;  1VRS D;  2PVQ A;  4XIH A;  4KCE A;  2GGT A;  4FYB A;  5DQY A;  5KN0 A;  1SJZ A;  3D4M A;  2VL2 C;  2RLI A;  1R7H A;  2LQO A;  1S3A A;  4L5L A;  3VLN A;  2DKH A;  2H1A A;  4YQU A;  3VWV A;  3FR9 A;  5ECH B;  2HSM A;  4KB3 A;  5IMD A;  2PUK C;  3AY8 A;  1OYJ A;  22GS A;  3C1S A;  2LKU A;  1J9B A;  2RM5 A;  3N9J A;  1TK5 B;  2H72 A;  4NWY A;  3KMN A;  1F9M A;  3HD5 A;  4GCI A;  1X9S B;  1OC8 A;  2IPA A;  4J57 E;  2CA8 A;  3ERG A;  2GSQ A;  1QMV A;  4ID0 A;  2HXK A;  5H5S A;  3LYP A;  3HVS A;  1JZW A;  3ZMK A;  1GP1 A;  1JHB A;  1TTZ A;  2CZ3 A;  4IP6 A;  4AGS A;  3WD6 A;  2H1G A;  1K3L A;  4ECC A;  4EIQ A;  2GSS A;  2GS3 A;  2H8L A;  1VF4 A;  2HYX A;  3QPM A;  4TXO A;  4Z2U A;  5JWR B;  2DJ2 A;  2RII A;  1B4P A;  2N5F A;  1PRX A;  2I9H A;  2O87 A;  1E2Y A;  2CAQ A;  3CMI A;  2I1U A;  1VF2 A;  1F3A A;  1WRY A;  4ULX A;  1BAY A;  2JSZ A;  4IBP A;  5ABR A;  2B1L A;  4TOP A;  3DD3 A;  4X43 A;  2OBK A;  2AAW A;  3UL3 A;  1WE0 A;  3F0I A;  1JZD A;  3WT1 A;  1YEX A;  1R4W A;  5IO0 A;  4CHS A;  2NPB A;  4HEA 2;  16GS A;  4PQI A;  5AN1 A;  2DLX A;  2OKA A;  2REM A;  1ERW A;  3W8J A;  4ILF A;  3M8N A;  3KH7 A;  4O7H A;  3KGK A;  1THO A;  1G7O A;  1KNG A;  1GUM A;  2F9S A;  2VL3 A;  4KE3 A;  1GNE A;  1YKC A;  1E6B A;  2CX4 A;  4K1F A;  1GTB A;  4QQ7 A;  2R4V A;  2HFD A;  5ENU A;  4YH2 A;  2OJL A;  4NAX A;  3DKS A;  1M2D A;  4NMU A;  1M9A A;  1T8E B;  2B7K A;  3F8U A;  2AJQ B;  2WCI A;  1WJK A;  5CRH A;  1BJX A;  3GTU B;  6GSX A;  2RUE A;  3Q74 A;  1SU9 A;  3WGE A;  2IWT A;  4L8E A;  4MLY A;  2BMX A;  3KJY A;  3EMP A;  1O8X A;  2V2G A;  2MMO A;  2F51 A;  2IL3 A;  1MDJ A;  2C0F A;  1PL2 A;  1AAZ A;  1V98 A;  4EIP A;  3VK9 A;  4ISD A;  4IQ1 A;  3FR3 A;  2N5A A;  3F3Q A;  5D73 A;  3LXT A;  2OAD A;  1X9M B;  1S3D A;  2NBS A;  3G7Y A;  4IW9 A;  4F0C A;  1Y25 A;  4GRF A;  4K8M A;  4WBR D;  3EU3 A;  4YQV A;  1O85 A;  3TGZ A;  3GIX A;  1OC9 B;  2F8F A;  3TRX A;  3HHV A;  1DSB A;  3A5W A;  2YP6 A;  5D93 A;  1TJD A;  4PGT A;  3FMW A;  1K3O A;  1QGV A;  4BL7 A;  4TR0 A;  1FAA A;  4HUA A;  4BVY A;  1AXD A;  5ECI B;  2H6Z A;  3D0Z A;  1K0O A;  2PPT A;  12GS A;  1C72 A;  2X64 A;  3DEX A;  2RUF A;  2KHP A;  4Q5Q A;  1NW2 A;  3GMF A;  2H0I A;  2VO4 A;  1K0C A;  3APQ A;  5INY A;  6GSV A;  4JR4 A;  2GZY A;  3P7X A;  4IEL A;  1TI3 A;  4FIW A;  2O89 A;  4N0V A;  4V2L A;  1T4Y A;  2X8G A;  4D73 A;  1GSD A;  3A2V A;  3DRN A;  3TJJ A;  1GLP A;  1V40 A;  5A4U A;  3H93 A;  5ECR B;  2IMK A;  2CVD A;  2GT6 A;  1MDK A;  4PUA A;  2C0D A;  2H70 A;  1HQO A;  2VLT A;  2N5B A;  2LNT A;  1AIU A;  4KCA A;  6GSU A;  4V1A p;  3TRP A;  2DKI A;  2PBJ A;  3WT2 A;  3PIN A;  1EOH A;  2VLU A;  1O73 A;  3ERW A;  3FW2 A;  3GKK A;  3F4T A;  1R5A A;  2L59 A;  3I6A A;  1GNW A;  4PNF A;  1PL1 A;  4N10 A;  3BCK A;  3F4R A;  4IS0 A;  3HCZ A;  4XS6 A;  3EWL A;  3N5O A;  4GQF A;  3DWV A;  5AIX A;  5A4W A;  1A0R P;  2DJ1 A;  2WJU A;  1YF0 A;  4ZB9 A;  5IMA A;  1WIK A;  2MYG A;  1XOB A;  3FK8 A;  3LOR A;  2X49 A;  1ILO A;  3DML A;  4NV2 A;  3UEM A;  5DVB A;  3IHQ A;  1Z6M A;  1GUL A;  1YF1 A;  2H71 A;  4IJI A;  5J41 A;  2JZT A;  3E0U A;  4CDO A;  4MA9 A;  1A8Y A;  1SD9 A;  5COH A;  3F9U A;  5GAN D;  3F63 A;  1MTC A;  2JZS A;  4EL1 A;  4MJB A;  4MH2 A;  4MZB A;  8GSS A;  4KF9 A;  2QSI A;  5KOW A;  1K0A A;  2FY6 A;  2GT5 A;  1Q98 A;  2CT6 A;  3GUS A;  5HR3 A;  2QKE A;  3UAP A;  3KTL A;  2R5G A;  1B9Y C;  1UVZ A;  2GSR A;  3V1W A;  3DVW A;  5E59 A;  2YWO A;  4JBB A;  2HRK A;  5KN3 A;  3PH9 A;  5IOW A;  3PGT A;  2EC4 A;  2XBI A;  3KZQ A;  5KN2 A;  2O8V B;  2HRN A;  2YWI A;  3G9B A;  4WET A;  14GS A;  4MPG A;  2PMT A;  1UC7 A;  1FB0 A;  1QQ2 A;  3QDN A;  4V1A g;  4OCF A;  1YEP A;  5DCG A;  1RQM A;  4DSQ A;  4Z7X A;  3IK9 A;  1YY7 A;  1SL2 B;  2FWH A;  2A2S A;  4O92 A;  1V57 A;  5DJM A;  1M7T A;  3KP8 A;  3HY2 A;  1XIY A;  3LG6 A;  1EP7 A;  4BVX A;  4HU9 A;  4G2E A;  3D6I A;  2HE3 A;  19GS A;  1OC3 A;  4POL A;  3HJM A;  3ZIT A;  2PER A;  2FD3 A;  3CSI A;  1OKD A;  1S3C A;  3SBC A;  1TK8 B;  5A4V A;  5AIV A;  4POB A;  5AIS A;  3IE3 A;  1GUK A;  2KP1 A;  4YAV A;  4RI7 A;  1VF1 A;  1GSF A;  3GH6 A;  3NOF A;  1GSE A;  3A3T A;  2FUG 2;  4KDU A;  2H66 A;  1H75 A;  5IMV A;  3U5R E;  4HQZ A;  4DSS A;  2GLR A;  4MF5 A;  1GTI A;  2G2Q A;  1XWG A;  3GKN A;  1VGL A;  4WBJ A;  4MPF A;  2UZ8 A;  3P90 A;  2WB9 A;  3NIV A;  1N2A A;  2BTO T;  3L9U A;  1OAZ A;  2KUC A;  3LGC A;  2FLS A;  4MH3 A;  2L57 A;  3BOA A;  2IFQ B;  4K2D A;  1ERT A;  4J2F A;  5IOX A;  1M2A A;  2ZUP A;  1UN2 A;  4POM A;  3F6F A;  1XW5 A;  2P31 A;  2H30 A;  1GSS A;  4LL1 B;  1QK8 A;  5GAP D;  1LBK A;  5JCG A;  1FO5 A;  2IMF A;  1XZO A;  3GST A;  3QCP A;  3UMA A;  5ECQ B;  3GN3 A;  1F6M C;  1GSQ A;  3WYW A;  4K7N A;  1ACV A;  2HSY A;  5IM9 A;  1O8W A;  4HS1 A;  1XWA A;  3L4N A;  2EIR A;  2WDU A;  3VPQ A;  1JZR A;  3ZRE A;  4EE0 A;  5IQY A;  3L9V A;  2F3M A;  6GSY A;  2MZC A;  1EGR A;  3GNJ A;  3TKQ A;  3H79 A;  4NV5 A;  4K7I A;  4N11 A;  4YKF A;  3BBY A;  2J23 A;  3R2Q A;  3O3T A;  2I81 A;  2C0G A;  3I43 A;  3H8Q A;  3ME7 A;  2DBC A;  1TU8 A;  5D9X A;  3QFB C;  1RW1 A;  2P5R A;  5ECN B;  2VCT A;  3HA9 A;  3UOM A;  2LNS A;  4GWR A;  4GXZ A;  1XWC A;  4JZQ A;  1UA5 A;  4MF6 A;  5ECK B;  2L4C A;  2PVO C;  5JCU A;  2YCD A;  4HJM A;  2B5E A;  1ABA A;  4AF2 A;  2ON5 A;  2Z9S A;  1AQW A;  2B5X A;  3KM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...