3LGCA

Crystal structure of glutaredoxin 1 from francisella tularensis
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
89
structure length
89
Chain Sequence
SNAMKVKIYTRNGCPYCVWAKQWFEENNIAFDETIIDDYAQRSKFYDEMNQSGKVIFPISTVPQIFIDDEHIGGFTELKANADKILNKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Glutaredoxin 1
publication title Crystal Structure of Glutaredoxin 1 from Francisella tularensis
rcsb
source organism Francisella tularensis subsp. tularensis
total genus 24
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2010-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3lgcA00
4PXOA 2CVKA 2C80A 1K0NA 1XWGA 3WGXA 2KP2A 1XZOA 3CBUA 1X9SB 2XHFA 1NHYA 4OCFA 2RM6A 5H5QA 5EL8A 4ECJA 3HCZA 2DJ3A 1QUWA 3TJJA 5IPGA 5FWGA 3U5RE 1BG5A 4MCUA 1VF3A 3I69A 4HZ2A 3TOUA 1FVJA 2PUKC 4KDXA 3DIEA 2LJRA 4GF0A 4V2MA 2H01A 2LUSA 3G9BA 2AUVA 2K8SA 4TXOA 5DCHA 1F3BA 5IMAA 3GRXA 4XS4A 5F8BA 5CRDA 2ZUPA 2GSSA 2GLRA 3G7JA 1GP1A 4HUAA 4ZB6A 2AB6A 3DVXA 2MMNA 3CTFA 4KSMA 5HQPA 3GUSA 3PH9A 4OMVA 1TDIA 4KDYA 5G5EA 5HFIA 1PD21 2YV9A 5CP1A 2PN8A 4HQZA 1B9YC 4WR4A 1TI3A 2VCWA 3UVHA 1BYEA 2H6ZA 3C71A 2PBJA 1SK0A 4WKWA 4TW5A 1SD9A 1BX9A 3GSTA 4PURA 1B4QA 4O5RA 3IDVA 5IMVA 1U6TA 1M99A 1OKDA 2C3NA 4Q5QA 2V1MA 1T4ZA 1XWAA 4V1Ag 3MWHA 1VGLA 2EC4A 1QFNA 1Z5YE 4KGIA 3QCPA 4ZL8A 2O8VB 2K6VA 3WGEA 4NHZA 2X8GA 2C0FA 1I9DA 3DMLA 1R5PA 3DRNA 4RUVA 1Y6EA 1SJZA 3GH6A 1MEKA 1O73A 3KMNA 1M7TA 3EVIA 4MZCA 2LRTA 1YY7A 1T4YA 3GFKA 2F8FA 2GT6A 3VPQA 3F8UA 1SL2B 5GSTA 5D9TA 1IYIA 3UVTA 4DSSA 4Q5FA 4KCEA 3GURA 5H5SA 2YPMA 1V9WA 3ZMLA 2OBKA 1K0BA 2CVDA 4GWRA 2M46A 1OE8A 1THXA 1TKDB 3ZIJA 5GAPD 3HYPA 3BJ5A 4BL7A 1TK5B 1LBKA 3A2XA 5CO3A 1PMTA 4ZBDA 4DEJA 1KEBA 2AV4A 1SKSB 1AIUA 5DQSA 2O85A 6GSXA 1M2DA 1AW9A 4Q5NA 4PNGA 2WRTA 3TGZA 4OFNA 1WP0A 3LYPA 4GRFA 2JZTA 1E6BA 3IK7A 2FGXA 1VF4A 3F6DA 3BBYA 1MD4A 5D93A 1X5EA 2G0FA 2VCXA 2CA8A 3L9UA 1PX6A 2GSTA 3IC4A 3ZL5A 4X1UA 2L5LA 4TR4A 1EOHA 1YKCA 3HA9A 5DALA 3VWXA 5ECSA 1SK1A 1K0MA 4NAXA 5IMCA 2HRFA 5ELGA 2N5FA 2OE0A 2IJYA 2MMOA 4HI7A 4QL9A 1XCCA 4MPGA 3P7XA 1FG4A 5JWRB 5A4UA 2YP6A 2H1BA 3SBCA 4ZB9A 1SYXA 3HJOA 1GTAA 3A3TA 1KNGA 4RQRA 2F9SA 3UOMA 3FR6A 1T00A 1EGRA 3AY8A 1EV4A 2VD0A 3DWVA 2QC7A 4NHWA 3G7IA 2VM1A 4ID0A 5ENUA 1GH2A 3F6FA 3F4SA 1O81A 3L0HA 2EIQA 2YZHA 1GTUA 1S3CA 3TKQA 3H4KA 1WE0A 2C0EA 1XW6A 4MABA 5B6MA 2C1YA 5ECPB 3E3EA 1HYUA 5C00A 4IELA 1X5CA 3LXTA 2QSIA 5A4WA 4XS4B 4E8HA 2FHEA 2YCDA 2O7KA 5IPHA 1TJDA 4NXIA 1SKRB 2RIIA 3CSIA 1GSQA 4F9ZA 2L4QA 1OAZA 1G7EA 6GSWA 3GKMA 4MJCA 3A5WA 3C1SA 1NM3A 3TJFA 4IJIA 1A2LA 2M80A 2X64A 4KDUA 4OWYA 3GHAA 1XXUA 1X9WB 4MK3A 1JZWA 2WJUA 1SD8A 4E8EA 5IOXA 3H1NA 1H4OA 1Z7PA 1FAAA 2H76A 1ZOFA 3TJBA 4JRRA 3VWVA 1PQNA 1M0UA 3CYNA 2L59A 2LTKA 5AN1A 2C8UA 3M9JA 3Q19A 4I2UA 2BJXA 3FR9A 4TOPA 5JCGA 1T8EB 2PWJA 3E0UA 1ON4A 1F9MA 5ECNB 3I9V2 1TRUA 1Z3EA 2LS5A 4XS1A 3F63A 3LSZA 5ECHB 4YQUA 3O76A 1ZMAA 1FHEA 2XC2A 1MDJA 1Z9HA 1DBYA 1EV9A 1GNEA 2VL2C 4N30A 5GSSA 1QGVA 3VURA 4K6XA 2LJAA 1G0TA 4MH2A 4CW9A 1EEJA 4K0NA 1RQMA 1ERVA 4DSSB 3DKSA 2KOKA 1NHOA 1BEDA 2IMIA 6GSTA 1A8LA 5B6NA 2L6DA 4POMA 4FH8A 4F82A 4HJ2A 1TXXA 4OCEA 1UA5A 1ZYEA 2C3TA 1ML6A 3DYRA 2GS3A 4RI6A 3US3A 2V41A 3ISOA 1LJRA 4KNDA 3DVWA 2VCVA 3O3TA 1WIKA 4I5QA 5H5RA 4EE0A 5G1KA 4POKA 3ERGA 2WZ9A 6GSSA 3ME8A 3R2QA 4TN8A 4P3YB 4IVFA 3NOFA 5CYYA 2RM5A 1XOAA 4EO3A 4EVMA 1XWKA 5AGYA 3L9VA 1WMJA 2LV3A 5A5KA 3F4RA 1XVWA 3IA1A 2CX4A 4MZWA 2HXKA 2DIZA 2X99A 3ZFBA 3BCIA 4WETA 3APOA 4XCSA 2O87A 1V2AA 4PUAA 1A8YA 2OBIA 1EOGA 5IOWA 3IAM2 5CRHA 4ZIJA 3TRPA 2FCHA 1GL8A 2YWMA 4ZBAA 3ZMKA 4O7HA 1A0RP 3MDKA 3BOAA 4TKYA 3I43A 1ZZYA 2MYGA 3PGTA 4OFTA 1U3IA 3H93A 1XFLA 3ZREA 1PKWA 4N0VA 4ZL7A 2H75A 1U88A 2YANA 1FO5A 3H79A 4O92A 2XPDA 2DBCA 3EWLA 2KUCA 1WOUA 4V1Ap 1YEXA 4K7NA 3S9FA 3W8SA 1T3BA 1ZGNA 4XS6A 3EC3A 1ZCPA 1BQ7A 5HR0A 2DSAA 3TKSC 2LEGA 5B8AA 1H75A 1THOA 2PVOC 1YQ1A 5KN3A 6GSYA 2IN3A 4KAEA 4I8BA 1B8XA 1X5DA 4BWSA 3HJPA 4NV5A 1YF0A 3F9UA 2FWFA 5GAND 5J9CA 1PGTA 2IMEA 2C3QA 4JU5A 5AIVA 2HZEB 3BCKA 1YEPA 1OC3A 3HZ8A 1O8WA 3IRAA 2I3YA 4KW6A 2YJ7A 4K7OA 1A2JA 2VL2A 2A4VA 16GSA 3CTGA 2P5QA 3M8NA 4PQIA 3LG6A 1WPIA 1PA3A 5DJLA 3M9KA 1XIYA 3TJGA 1K0AA 2KHPA 4IQAA 5HR2A 1FB0A 2WCIA 14GSA 3TUEA 4BVXA 3D6IA 2R5GA 5DVBA 1PKZA 3ZZXA 3QOUA 1Z6MA 2VL9A 5HR3A 3GKKA 2OKAA 4MZBA 1FB6A 1B48A 4MMMA 5ECLB 1O8XA 2HYXA 4AJ8A 4IP1A 1S3AA 5AIXA 4FYUA 1MTCA 6GSVA 3KTBA 2XPEA 4KSOA 2RUFA 19GSA 4ULXA 11GSA 3F3RA 2WS2A 2H0IA 5IO0A 2VLVA 10GSA 2GSRA 3UEMA 1NW2A 1F6MC 3VI7A 3WGDA 1ERUA 3UJ1A 2G2QA 5D96A 2DJ2A 1XWCA 2EIOA 2L57A 1GULA 4RQXA 2WDUA 3TJKA 2WGRA 2B5YA 4OO5A 5DQYA 3M1GA 5JWOB 1K3YA 3KJYA 2H19A 2I1UA 4NWYA 2AJQB 2F3MA 2C0GA 3EYTA 2LJKA 1QXHA 1TOFA 4F03A 1WRYA 5IO2A 2R37A 2V2GA 3L9SA 1SKWB 4CHSA 4IP6A 1TRWA 3WD6A 2GQLA 4JBBA 4PNFA 2IL3A 3WYWA 4ZL9A 1YKAA 4L5LA 4LLRA 3LORA 1GSSA 1B4PA 5INYA 1JHBA 1PN9A 2VD1A 5EPFA 3W8JA 1XW9A 1HNBA 5HFGA 1G6YA 1C72A 3HHVA 2E7PA 4FYCA 3CRTA 2IPAA 5ELAA 2F8AA 2IFQB 1S3DA 12GSA 1PRXA 3TKSA 1OC9B 1YZXA 4GCIA 3ZLPA 1U3AA 3HKRA 1B9XC 2K9FA 2IMDA 1AQWA 4K0GA 4RI7A 1M2AA 2LNTA 4Z7XA 4HJMA 4F0CA 3TKSE 3F4TA 3RAZA 1R5AA 5HFKA 3KEBA 4HEA2 4TXVA 3FHKA 3C73A 2R3XA 2L5OA 2M72A 3MNGA 4ZXGA 3VFIA 5F07A 1SENA 2H30A 4L0WA 2BTOT 2DMMA 2REMA 1AQXA 1V98A 3KMOA 2I9HA 4YH2A 1K3OA 4WF4A 4XRAA 1J08A 4NV2A 2B1LA 3TB2A 22GSA 2CZ2A 1A23A 4PUFC 2H1AA 2KLXA 4FO5A 2VLTA 4WF5A 4IBPA 2H8LA 3VWUA 2B6MA 2HRNA 3K8NA 3UBLA 2FY6A 5IIZA 5F0GA 2JSYA 2DJKA 1GWCA 2XBIA 3UARA 1K3LA 3ZVJA 3UAPA 3ZVJD 3IV4A 3KTLA 3W6GA 2HZEA 1EGOA 3TRXA 1RW1A 3J7Yk 2H73A 4XTSA 5L71A 2WB9A 4K1FA 2VOCA 2AYTA 1XOBA 4BPYA 1RK4A 3FZ9A 3HY2A 2NDOA 3A2WA 1FVKA 2OE3A 1URMA 3KD0A 4CDOA 4ZB8A 4TR3A 1ZYQB 2K8VA 2GGTA 3EMPA 2N5BA 2JZSA 1QK8A 4PGTA 4H86A 1A24A 1XW5A 1J9BA 1TRVA 5IMZA 2JSZA 1TU8A 3ZYWA 2R4VA 1IYHA 1ERTA 1XBSA 1R4WA 2TRXA 1M9BA 3FW2A 5GZZB 3RBTA 5DJMA 3GX0A 3GIXA 3CMIA 1OYJA 1USBA 4MH3A 3BD2A 1U87A 3KH9A 5G5FA 2NBSA 2LQQA 3ERWA 3JCML 4HOJA 4KCAA 1GLPA 2YV7A 3FRCA 1V58A 1AC1A 2V6OA 3CRUA 2Z9SA 3GH9A 3TKRA 5D73A 3FZAA 2IMKA 1JFUA 2FLSA 1EEMA 5KEJA 2H6XA 5J5NA 4GQCA 3MAKA 3QFBC 2MZCA 8GSSA 4XIHA 5J9BA 3V1WA 2CAQA 4N11A 2YJHA 4EDYA 5JWQB 2DJ1A 2DJ0A 4TR0A 2ZNMA 1MDIA 2GSQA 3HVSA 4MJBA 2PGTA 3GA4A 1GSEA 4TRXA 2YOIA 1T1VA 1CQHA 1YF1A 3EURA 3HVVA 1K0DA 1PL1A 3KP9A 4OFMA 1A2MA 3VPTA 3DEXA 3IXRA 2J23A 3LQ7A 1JLWA 4LL4B 2PVQA 5ECQB 3VK9A 1SL0B 4WR5A 1SYRA 3FR3A 3UL3A 2JL4A 1GSDA 4EKZA 3IHQA 2FUG2 1LU4A 3NZNA 2PU9C 4LL1B 1NSWA 1O85A 1HNCA 5C04A 1OKTA 4ACSA 4F2IA 2P5RA 2YWOA 4V2NA 2IFQA 3GMFA 1G7OA 1F37A 1UC7A 4HQSA 5IQYA 1KBNA 2NTOA 1OC9A 2N5AA 1OC8A 1AUCA 4EL1A 1V40A 4ECBA 3KCMA 3QFAC 1SK2A 3VWWA 2LKUA 5J41A 3FY7A 4AF2A 1EP8A 4ML6A 1YDKA 3QAWA 2OA7A 1A0FA 1XWBA 5DAKB 4MLYA 5G31A 2LNSA 2GZPA 2KP1A 3A2VA 3Q18A 5HR1A 2QKEA 3H8QA 3LJRA 4EF0A 5CRGA 3LEFA 2E2GA 3DXBA 2BMXA 5B7CA 1VF1A 3GYKA 3F3QA 9GSSA 3M0FA 4AJ6A 1J0FA 3QR6A 2B3SA 2P0GA 2GT5A 2IIYA 3GV1A 1BAYA 1V57A 1K0CA 2F51A 1Z7RA 3TKPA 5ECRB 4HU9A 3RPPA 1HD2A 1M9AA 4Q5RA 3KGKA 1GTIA 4KA0A 2DLXA 5ECKB 2E2MA 1OE7A 3HDCA 3LGCA 2K18A 1TTZA 3HVXA 4L5OA 1JZDA 4GSTA 5COHA 3TDGA 1HNAA 4JR6A 4ISDA 2D2ZA 4L8EA 4TVEA 5DCGA 2H74A 4GQFA 4MDCA 2L4CA 2AHEA 2FNOA 4PQHA 4WXTA 1ILOA 3TOTA 3SWLA 2YN1A 2ALBA 3ZIVA 3E9JB 3ZTLA 4G2EA 2XBQA 4HZ4A 1SU9A 3IAS2 2ES7A 1XPVA 1O6JA 2YZUA 3UIWA 4X43A 4IS0A 2A2SA 2VO4A 5EVOA 1N2AA 2IMFA 2C4JA 1TK0B 1OVNA 17GSA 4MP4A 2DMLA 3IBHA 2R2JA 2PMTA 4DSQA 5LNKe 3HD5A 3IE3A 1AQVA 1ST9A 3D21A 4K8MA 1UN2A 1Y25A 1PSQA 4IJ3A 4I6XA 5KN0A 3FEUA 1BJXA 1VF2A 4QL7A 2H72A 3U6VA 2EIRA 2DJJA 4LMVA 2B7KA 4J2FA 3D22A 3FYGA 2VCTA 3HZ4A 1PX7A 5F05A 3EU4A 4IKHA 4GLTA 1F3AA 3N5OA 4IHUA 2J9HA 3KH7A 4HDEA 3QMXA 5D9VA 5KN2A 1TW9A 1GTBA 4QQ7A 2FA4A 2B7JA 4POBA 4BWQA 4I97A 3LYKA 2MMAA 1GLQA 1W4VA 2H0HA 2HZFA 1ACVA 4LMWA 6GSUA 2HNLA 3VI5A 4YAPA 1R26A 4TR1B 4XRDA 3HXSA 4NPBA 2HT9A 4YAVA 3APSA 3D4TA 2E0QA 3C8EA 3GNJA 4JEDA 4KH7A 1TRSA 2GZZA 4DSRA 5CNWA 1R7HA 3QAGA 1K0OA 5LCZA 1TI1A 1EZKA 2IWTA 4ILFA 3IR4A 3L78A 3D0ZA 4N0ZA 13GSA 4IQ1A 4BVYA 3PINA 3QD9A 2VL3A 2OACA 1AAZA 3GX8A 3N9JA 4G9HA 5G30A 1N8JA 4WBJA 5D9WA 4I2TA 1E2YA 3EE2A 3GTUB 3MSZA 4JZQA 4JE1A 2GVPA 1TU7A 2X8HA 5J4UA 1Q98A 1QMVA 1F2EA 1JLVA 2B5XA 3Q6OA 4XHMA 5IM9A 2YWIA 1MDKA 2FWEA 5ID2B 3ED3A 1GNWA 2OADA 3QDNA 3KXOA 4EDZA 1PL2A 3L4NA 5DDLA 4D73B 5JCWA 2OE1A 4YQMA 1FW1A 1DE2A 3GL5A 3EINA 1WJKA 2I4AA 1XVQA 4BA7A 4KX4A 2VCQA 4MJEA 1JZRA 1O7UA 2WULA 1GSYA 1GUMA 1EP7A 2H1GA 4YQVA 2H1DA 4ECCA 3ZRDA 4POLA 3KZQA 3QPMA 2WFCA 4AGSA 2LRCA 5DAKA 4HS1A 3IOSA 4MJAA 2CQ9A 2ON5A 3EU3A 3NIVA 4X0XA 3FK8A 4IW9A 4HU7A 3UMAA 1CQGA 5CREA 3P90A 1SL1B 3WT1A 3GKXA 3M3MA 1DSBA 1TK8B 4PX1A 2VAFA 4LA1A 2YNXA 5EY6A 3GSSA 3RPNA 4IN0A 3O6TA 2FA8A 3P2AA 3ERFA 2B5EA 2LSTA 1VRSD 1ZL9A 2H6YA 1GSUA 2CVBA 5ABRA 4IGJA 2OJLA 2GQKA 3P8WA 1Z6NA 3D5JA 3ZFLA 3ME7A 1DUGA 3FZ5A 3RHCA 3C1RA 3PR8A 2PPTA 5B8BA 4TXOB 3IK9A 4G10A 5A4VA 2QGVA 3CXGA 1GRXA 2H70A 3APQA 4L0UA 5KN1A 1M2BA 4KE3A 1UVZA 2FWGA 2PERA 4ZBBA 2NVLA 2HSHA 2JADA 3WT2A 3I6AA 1YJ6A 1KTEA 3GN3A 3LFLA 4AJ7A 4J57E 2V32A 1GSFA 5E59A 2ZCTA 3KM6A 4KUNA 2ON7A 4V2LA 3LWAA 4OO4A 5CAXA 1I5GA 1G6WA 3DGQA 2P31A 4DVCA 2VIMA 3FKFA 3GKNA 1X9MB 2MBTA 1SJ6A 2DIYA 3LXZA 2H66A 4OD7A 3GL3A 4EXJA 2CAIA 1ERWA 1EWXA 3VLNA 3DD3A 3Q74A 5IMDA 3C7MA 2MBSA 1GUHA 2FD3A 3G7YA 4MF5A 3CSHA 3ZITA 4MA9A 5ECMB 5G1LA 2HSYA 1JZOA 2TRCP 2VCZA 4NMUA 2TIRA 5LD0A 1TP9A 4MPFA 4ZILA 2HE3A 4GTUA 7GSSA 4J56E 2GQMA 2HFDA 2VLUA 4TR1A 4N10A 2JZRA 2GDRA 5J3RA 5D8IA 4WBRD 1SJIA 2C0DA 3RHBA 1GUKA 2LRNA 5G2ZA 5CRWA 3OR5A 4FIWA 4K2DA 4JR4A 2VUPA 3FZ4A 2RUEA 5F06A 2R6KA 3HJMA 4K7IA 3EMXA 2HLSA 4GSNA 4G19A 2V6KA 3TRQA 4ECIA 2DC5A 3UBKA 4FYBA 2CT6A 1HQOA 2JACA 2B1KA 3CSJA 3KIJA 2JU5A 5FT3A 20GSA 5JCUA 3RDWA 2CZ3A 3GTUA 2VM2A 5AISA 2H71A 4ML1A 5E4WA 1WWJA 2MMZA 4EC0A 18GSA 2I81A 2X8CA 1T7PB 2L6CA 4O32A 4K9ZA 2RLIA 2GZYA 5IMFA 4MF7A 5ID2A 4KB3A 1W89A 2AAWA 5DALB 2H0GA 5D9XA 4D73A 2NPBA 1AXDA 3D4MA 1FOVA 5DBQA 4GSSA 1ABAA 3KP8A 5ECIB 2YWNA 3J7Yb 2A2RA 2CX3A 2O89A 5FHIA 4WEYA 3TCOA 2GTUA 4EUYA 1DE1A 1Q4JA 2CV4A 4GXZA 2FWHA 1X0RA 3QAVA 4PQ1A 5ECOB 1MD3A 2HI7A 4F0BA 4MF6A 3F0IA 1QQ2A 2LQOA 3IPZA
chains in the Genus database with same CATH superfamily
4PXOA 2CVKA 2C80A 1K0NA 1XWGA 3WGXA 2KP2A 1XZOA 3CBUA 1X9SB 2XHFA 1NHYA 4OCFA 2RM6A 5H5QA 5EL8A 4ECJA 3HCZA 2DJ3A 1QUWA 3TJJA 5IPGA 5FWGA 5KOXA 3U5RE 1BG5A 4MCUA 1VF3A 3I69A 4HZ2A 3TOUA 1FVJA 2PUKC 4KDXA 3DIEA 2LJRA 4GF0A 4V2MA 2H01A 2LUSA 3G9BA 2AUVA 2K8SA 4TXOA 5DCHA 1F3BA 5IMAA 3GRXA 4XS4A 5F8BA 5CRDA 2ZUPA 2GSSA 2GLRA 3G7JA 1GP1A 4HUAA 4ZB6A 2AB6A 3DVXA 2MMNA 3CTFA 4KSMA 5HQPA 3GUSA 3PH9A 4OMVA 1TDIA 4KDYA 5G5EA 5HFIA 1PD21 2YV9A 5CP1A 2PN8A 4HQZA 1B9YC 4WR4A 1TI3A 2VCWA 3UVHA 1BYEA 2H6ZA 3C71A 2PBJA 1SK0A 1ZYNA 4WKWA 4PTSA 4TW5A 1SD9A 1BX9A 3GSTA 4PURA 1B4QA 4O5RA 3IDVA 5IMVA 1U6TA 1M99A 1OKDA 2C3NA 4Q5QA 2V1MA 1T4ZA 1XWAA 4V1Ag 3MWHA 1VGLA 2EC4A 1QFNA 1Z5YE 4KGIA 3QCPA 4ZL8A 2O8VB 2K6VA 3WGEA 4NHZA 2X8GA 2C0FA 1I9DA 3DMLA 1R5PA 3DRNA 4RUVA 1Y6EA 1SJZA 3GH6A 1MEKA 1O73A 3KMNA 1M7TA 1ZYPA 3EVIA 4MZCA 2LRTA 1YY7A 1T4YA 3GFKA 2F8FA 2GT6A 4EIQA 3VPQA 3F8UA 1SL2B 5GSTA 5D9TA 1IYIA 3UVTA 4DSSA 4Q5FA 4KCEA 3GURA 5H5SA 2YPMA 1V9WA 3ZMLA 2OBKA 1K0BA 2CVDA 4GWRA 2M46A 1OE8A 1THXA 1TKDB 3ZIJA 4G0LA 5GAPD 3HYPA 3BJ5A 4BL7A 1TK5B 1LBKA 3A2XA 5CO3A 1PMTA 4ZBDA 4DEJA 1KEBA 2AV4A 3IHGA 1SKSB 1AIUA 5DQSA 2O85A 6GSXA 1M2DA 1AW9A 4Q5NA 4PNGA 2WRTA 3TGZA 4OFNA 1WP0A 3LYPA 1PN0A 4GRFA 2JZTA 1E6BA 3IK7A 2FGXA 1VF4A 3F6DA 3BBYA 1MD4A 5D93A 1X5EA 2G0FA 2VCXA 2CA8A 3L9UA 1PX6A 2GSTA 3IC4A 3ZL5A 4X1UA 2L5LA 4TR4A 1EOHA 1YKCA 3HA9A 5DALA 3VWXA 5ECSA 1SK1A 1K0MA 4NAXA 5IMCA 2HRFA 5ELGA 2N5FA 2OE0A 2IJYA 2MMOA 4HI7A 4QL9A 1XCCA 4MPGA 3P7XA 1FG4A 5JWRB 5A4UA 2YP6A 2H1BA 3SBCA 4ZB9A 1SYXA 3HJOA 1GTAA 3A3TA 1KNGA 4RQRA 2F9SA 3UOMA 3FR6A 1T00A 1EGRA 3AY8A 1EV4A 2VD0A 3DWVA 2QC7A 4NHWA 3G7IA 2VM1A 4ID0A 5ENUA 1GH2A 3F6FA 3F4SA 1O81A 3L0HA 2EIQA 2YZHA 1GTUA 1S3CA 3TKQA 3H4KA 1WE0A 2C0EA 1XW6A 4MABA 5B6MA 2C1YA 5ECPB 3E3EA 1HYUA 5C00A 2A4HA 4IELA 1X5CA 3LXTA 2QSIA 5A4WA 4XS4B 4E8HA 2FHEA 2YCDA 2O7KA 5IPHA 1TJDA 4NXIA 1SKRB 2RIIA 3CSIA 1GSQA 4F9ZA 2L4QA 1OAZA 2HRKA 1G7EA 6GSWA 3GKMA 4MJCA 3A5WA 3C1SA 1NM3A 3TJFA 4IJIA 1A2LA 2M80A 4BVXB 2X64A 4KDUA 4OWYA 3GHAA 1XXUA 1X9WB 4MK3A 1JZWA 2WJUA 1SD8A 4E8EA 5IOXA 3H1NA 1H4OA 4O5QA 1Z7PA 1FAAA 2H76A 1ZOFA 3TJBA 4JRRA 3VWVA 1PQNA 1M0UA 3CYNA 2L59A 2LTKA 5AN1A 2C8UA 3M9JA 3Q19A 4I2UA 2BJXA 3FR9A 4TOPA 5JCGA 1T8EB 2PWJA 3E0UA 1ON4A 1F9MA 5ECNB 3I9V2 1TRUA 1Z3EA 2LS5A 4XS1A 3F63A 3LSZA 5ECHB 4YQUA 3O76A 1ZMAA 1FHEA 2XC2A 1MDJA 1Z9HA 1DBYA 1EV9A 1GNEA 2VL2C 4N30A 5GSSA 1QGVA 3VURA 4K6XA 2LJAA 1G0TA 4MH2A 4CW9A 1EEJA 4K0NA 1RQMA 1ERVA 4DSSB 3DKSA 2KOKA 1NHOA 1BEDA 2IMIA 6GSTA 1A8LA 5B6NA 2L6DA 4POMA 4FH8A 4F82A 4HJ2A 1TXXA 4OCEA 1UA5A 1ZYEA 2C3TA 1ML6A 3DYRA 2GS3A 4RI6A 3US3A 2V41A 3ISOA 1LJRA 4KNDA 3DVWA 2VCVA 3O3TA 1WIKA 4I5QA 2R0CA 5H5RA 4EE0A 5G1KA 4USSA 4POKA 3ERGA 2WZ9A 6GSSA 3ME8A 3R2QA 4TN8A 4P3YB 4IVFA 3NOFA 5CYYA 2RM5A 1XOAA 4EO3A 4EVMA 1XWKA 5AGYA 3L9VA 1WMJA 2LV3A 5A5KA 3F4RA 1S3RA 1XVWA 3IA1A 2CX4A 4MZWA 2HXKA 4Z2UA 2DIZA 4G0IA 2X99A 3ZFBA 3BCIA 4WETA 3APOA 4XCSA 2O87A 1V2AA 4EIPA 4PUAA 1A8YA 2OBIA 1EOGA 5IOWA 3IAM2 5CRHA 4ZIJA 3TRPA 2FCHA 1GL8A 2YWMA 4ZBAA 3ZMKA 4O7HA 1A0RP 3MDKA 3BOAA 4TKYA 4MNNA 3I43A 1ZZYA 2MYGA 3PGTA 4OFTA 4Z2TA 1U3IA 3H93A 1XFLA 3ZREA 1PKWA 4N0VA 4ZL7A 2H75A 1U88A 2YANA 1FO5A 3H79A 4O92A 2XPDA 2DBCA 3EWLA 2KUCA 1WOUA 4V1Ap 1YEXA 4K7NA 3S9FA 3W8SA 4K5RA 1T3BA 1ZGNA 4XS6A 3EC3A 1ZCPA 1BQ7A 5HR0A 2DSAA 4Z2RA 3TKSC 2LEGA 5B8AA 1H75A 1THOA 2PVOC 1YQ1A 5KN3A 6GSYA 2IN3A 4KAEA 4I8BA 1B8XA 1X5DA 4G0KA 4BWSA 3HJPA 4NV5A 1YF0A 3F9UA 2FWFA 5GAND 5J9CA 1PGTA 2IMEA 2C3QA 4JU5A 5AIVA 3A5IA 2HZEB 3BCKA 1YEPA 1OC3A 3HZ8A 1O8WA 3IRAA 2I3YA 4KW6A 2YJ7A 4K7OA 1A2JA 2VL2A 2A4VA 16GSA 3CTGA 2P5QA 3M8NA 4PQIA 3LG6A 1WPIA 1PA3A 5DJLA 3M9KA 1XIYA 3TJGA 1K0AA 2KHPA 4IQAA 5HR2A 1FB0A 2WCIA 14GSA 3TUEA 4BVXA 3D6IA 4YKGA 2R5GA 5DVBA 1PKZA 3ZZXA 3QOUA 1Z6MA 2VL9A 5HR3A 3GKKA 2OKAA 4MZBA 1FB6A 1B48A 4MMMA 5ECLB 1O8XA 2HYXA 3EPTA 4AJ8A 2UZ8A 4IP1A 1S3AA 5AIXA 4FYUA 1MTCA 6GSVA 3KTBA 2XPEA 4KSOA 2RUFA 19GSA 4ULXA 11GSA 3F3RA 2WS2A 2H0IA 5IO0A 2VLVA 10GSA 2GSRA 2X4AA 3UEMA 1NW2A 1F6MC 3VI7A 3WGDA 1ERUA 3UJ1A 4K2XA 2G2QA 5D96A 3FMWA 2DJ2A 1XWCA 2EIOA 2L57A 1GULA 4RQXA 2WDUA 3TJKA 2WGRA 2B5YA 4OO5A 5DQYA 3M1GA 5JWOB 1K3YA 3KJYA 2H19A 2I1UA 4NWYA 2AJQB 2F3MA 2C0GA 3EYTA 2LJKA 1QXHA 1TOFA 4F03A 1WRYA 5IO2A 2R37A 2V2GA 3L9SA 1SKWB 4CHSA 4IP6A 1TRWA 3WD6A 2GQLA 4JBBA 4PNFA 2IL3A 3WYWA 4ZL9A 1YKAA 4L5LA 4LLRA 3LORA 1GSSA 1B4PA 5INYA 1JHBA 1PN9A 2VD1A 5EPFA 3W8JA 1XW9A 1HNBA 5HFGA 1G6YA 1C72A 3HHVA 2E7PA 4FYCA 3CRTA 2IPAA 5ELAA 2F8AA 2IFQB 1S3DA 12GSA 1PRXA 3TKSA 1OC9B 1YZXA 4GCIA 3ZLPA 1U3AA 3HKRA 1B9XC 5BRTA 2K9FA 2IMDA 1AQWA 4K0GA 4RI7A 1M2AA 2LNTA 4Z7XA 4HJMA 4F0CA 3TKSE 3F4TA 3RAZA 1R5AA 4X4JA 5HFKA 3KEBA 4HEA2 4TXVA 3FHKA 3C73A 2R3XA 2L5OA 2M72A 3MNGA 4ZXGA 3VFIA 2R0PA 5F07A 1SENA 2H30A 4L0WA 2BTOT 2DMMA 2REMA 1AQXA 1V98A 3KMOA 2I9HA 4YH2A 1K3OA 4WF4A 4XRAA 1J08A 4NV2A 2B1LA 3TB2A 22GSA 2CZ2A 1A23A 4PUFC 2H1AA 2KLXA 4FO5A 2VLTA 4WF5A 3PPUA 4IBPA 2H8LA 3VWUA 1XG8A 3CQFA 2B6MA 2HRNA 3K8NA 3UBLA 2FY6A 5IIZA 5F0GA 2JSYA 2DJKA 1GWCA 2XBIA 3UARA 1K3LA 3ZVJA 3UAPA 3ZVJD 1FOHA 3IV4A 3KTLA 3W6GA 2HZEA 1EGOA 3TRXA 1RW1A 3J7Yk 2H73A 4XTSA 5L71A 2WB9A 4K1FA 2VOCA 2AYTA 1XOBA 4YKFA 4BPYA 1RK4A 3FZ9A 3HY2A 2NDOA 3A2WA 1FVKA 2OE3A 1URMA 3KD0A 4CDOA 2QA1A 4ZB8A 4TR3A 1ZYQB 2K8VA 2GGTA 3EMPA 2N5BA 2JZSA 1QK8A 4PGTA 4H86A 1A24A 1XW5A 1J9BA 1TRVA 5IMZA 2JSZA 1TU8A 3ZYWA 2R4VA 1IYHA 1ERTA 1XBSA 1R4WA 2TRXA 1M9BA 3FW2A 5GZZB 3MYDA 3RBTA 5DJMA 3GX0A 3GIXA 3CMIA 1OYJA 1USBA 4MH3A 3BD2A 1U87A 3KH9A 5G5FA 2NBSA 2LQQA 3ERWA 3JCML 4HOJA 4KCAA 1GLPA 2YV7A 3FRCA 1V58A 1AC1A 2V6OA 3CRUA 2Z9SA 3GH9A 3TKRA 5D73A 3FZAA 2IMKA 1JFUA 2FLSA 1EEMA 5KEJA 2H6XA 5J5NA 4GQCA 3MAKA 3QFBC 2MZCA 8GSSA 4XIHA 5J9BA 3V1WA 2CAQA 4BVYB 4N11A 2YJHA 4EDYA 5JWQB 2DJ1A 2DJ0A 4TR0A 2ZNMA 1MDIA 2GSQA 3HVSA 4MJBA 2PGTA 3GA4A 1GSEA 4TRXA 2YOIA 1T1VA 1CQHA 1YF1A 3EURA 3HVVA 1K0DA 1PL1A 3KP9A 4ICYA 4OFMA 1A2MA 3VPTA 3DEXA 3IXRA 2J23A 3LQ7A 1JLWA 4LL4B 4FQUA 2PVQA 5ECQB 3VK9A 1SL0B 4WR5A 1SYRA 3FR3A 3UL3A 2JL4A 1GSDA 4EKZA 3IHQA 2FUG2 1LU4A 3NZNA 2PU9C 4LL1B 1NSWA 1O85A 1HNCA 5C04A 1OKTA 4ACSA 4F2IA 2DKIA 2P5RA 2YWOA 4V2NA 2IFQA 3GMFA 1G7OA 1F37A 1UC7A 4HQSA 5IQYA 1KBNA 2NTOA 1OC9A 2N5AA 1OC8A 1AUCA 4EL1A 1V40A 4ECBA 3KCMA 3QFAC 1SK2A 3VWWA 2LKUA 5J41A 3FY7A 4AF2A 4KF9A 1EP8A 4ML6A 1YDKA 3QAWA 2OA7A 1A0FA 1XWBA 5DAKB 4MLYA 2HRAA 5G31A 2LNSA 2GZPA 2KP1A 3A2VA 3Q18A 5HR1A 2QKEA 3H8QA 3LJRA 4EF0A 5CRGA 3LEFA 2E2GA 3DXBA 2BMXA 5B7CA 1VF1A 3GYKA 3F3QA 9GSSA 3M0FA 4AJ6A 1J0FA 3QR6A 2B3SA 2P0GA 2GT5A 2IIYA 3GV1A 1BAYA 1V57A 1K0CA 2F51A 1Z7RA 3TKPA 5ECRB 4HU9A 3RPPA 1HD2A 1M9AA 4Q5RA 3KGKA 1GTIA 4KA0A 2DLXA 4A5PA 5ECKB 2E2MA 1OE7A 3HDCA 3LGCA 2K18A 1TTZA 3HVXA 4L5OA 1JZDA 4GSTA 5COHA 3TDGA 1HNAA 4JR6A 4ISDA 2D2ZA 4L8EA 4TVEA 5DCGA 2H74A 4GQFA 4MDCA 2L4CA 2AHEA 2FNOA 4PQHA 4WXTA 1ILOA 3TOTA 3SWLA 2YN1A 2ALBA 3ZIVA 3E9JB 3ZTLA 4G2EA 2XBQA 4HZ4A 1SU9A 3IAS2 2ES7A 1XPVA 1O6JA 2YZUA 3UIWA 4X43A 4IS0A 2A2SA 2VO4A 5EVOA 1N2AA 2IMFA 2C4JA 1TK0B 1OVNA 17GSA 4MP4A 2DMLA 3IBHA 2R2JA 2PMTA 4DSQA 5LNKe 3HD5A 3IE3A 1AQVA 1ST9A 3D21A 4K8MA 1UN2A 1Y25A 1PSQA 4IJ3A 4I6XA 5KN0A 3FEUA 1BJXA 5BMUA 1VF2A 4QL7A 2H72A 3U6VA 2EIRA 2DJJA 4LMVA 2B7KA 4J2FA 3D22A 3FYGA 2VCTA 3HZ4A 1PX7A 5F05A 3EU4A 4IKHA 4GLTA 1F3AA 3N5OA 2A2PA 4IHUA 2R0GA 2J9HA 3KH7A 3MIXA 4HDEA 3QMXA 5D9VA 5KN2A 1TW9A 1GTBA 4HSCX 4QQ7A 2FA4A 2B7JA 4POBA 3R3EA 4BWQA 4I97A 3LYKA 2MMAA 1GLQA 1W4VA 2H0HA 2HZFA 1ACVA 4LMWA 6GSUA 2HNLA 3VI5A 4YAPA 1R26A 4TR1B 4XRDA 3HXSA 4NPBA 2HT9A 4YAVA 3APSA 3D4TA 2E0QA 3C8EA 3GNJA 4JEDA 4KH7A 1TRSA 2GZZA 4DSRA 5CNWA 1R7HA 3QAGA 2X49A 1K0OA 5LCZA 1TI1A 1EZKA 2IWTA 4ILFA 3IR4A 3L78A 3D0ZA 4N0ZA 13GSA 4IQ1A 4BVYA 3PINA 4CY6A 3QD9A 2VL3A 2OACA 1AAZA 3GX8A 3N9JA 4G9HA 5G30A 1N8JA 4WBJA 1M3JA 5D9WA 4I2TA 1E2YA 3EE2A 3GTUB 3MSZA 4JZQA 4JE1A 2GVPA 1TU7A 2X8HA 5J4UA 1Q98A 1QMVA 1F2EA 1JLVA 2B5XA 3Q6OA 4XHMA 5IM9A 2YWIA 1MDKA 2FWEA 5ID2B 3ED3A 1GNWA 2OADA 3QDNA 3KXOA 4EDZA 1PL2A 3L4NA 4K5SA 5DDLA 4D73B 5JCWA 2OE1A 4YQMA 1FW1A 1DE2A 3GL5A 3EINA 1WJKA 2I4AA 1XVQA 4BA7A 4KX4A 2VCQA 4MJEA 1JZRA 1O7UA 2WULA 1GSYA 1GUMA 1EP7A 2H1GA 4YQVA 2H1DA 4ECCA 3ZRDA 4POLA 3KZQA 3QPMA 2WFCA 4AGSA 2LRCA 5DAKA 4HS1A 3IOSA 4MJAA 2CQ9A 2ON5A 3EU3A 2HSMA 1PFOA 3NIVA 4X0XA 3FK8A 4IW9A 4HU7A 3UMAA 1CQGA 5CREA 3P90A 1SL1B 3WT1A 3GKXA 3M3MA 1DSBA 1TK8B 4PX1A 2VAFA 4LA1A 2YNXA 5EY6A 3GSSA 3RPNA 4IN0A 3O6TA 2FA8A 3P2AA 3ERFA 2B5EA 2LSTA 1VRSD 1ZL9A 2H6YA 1GSUA 2CVBA 5ABRA 4IGJA 2OJLA 2GQKA 3P8WA 1Z6NA 3D5JA 3ZFLA 3ME7A 1DUGA 3FZ5A 3RHCA 3C1RA 3PR8A 2PPTA 5B8BA 4TXOB 3IK9A 4G10A 5A4VA 2QGVA 3CXGA 1GRXA 2H70A 3APQA 4L0UA 5KN1A 1M2BA 4KE3A 1UVZA 2FWGA 5KOWA 2PERA 4ZBBA 2NVLA 2HSHA 2JADA 3WT2A 3I6AA 1YJ6A 1KTEA 2DKHA 3GN3A 3LFLA 4AJ7A 4J57E 2V32A 1GSFA 5E59A 2ZCTA 3KM6A 4KUNA 2ON7A 4V2LA 3LWAA 4OO4A 5CAXA 1I5GA 1G6WA 3DGQA 2P31A 4DVCA 2VIMA 3FKFA 3GKNA 1X9MB 2MBTA 1SJ6A 2DIYA 3LXZA 2H66A 4OD7A 3GL3A 4EXJA 2CAIA 1ERWA 1EWXA 3VLNA 3DD3A 3Q74A 5IMDA 3C7MA 2MBSA 1GUHA 2FD3A 3G7YA 4MF5A 3CSHA 3ZITA 4MA9A 5ECMB 5G1LA 2HSYA 1JZOA 2TRCP 2VCZA 4NMUA 2TIRA 5LD0A 1TP9A 4MPFA 4ZILA 2HE3A 4GTUA 7GSSA 4J56E 2GQMA 2HFDA 2VLUA 4TR1A 4N10A 2JZRA 2GDRA 5J3RA 5D8IA 4WBRD 1SJIA 2C0DA 3RHBA 1GUKA 4CY8A 2LRNA 5G2ZA 5CRWA 3OR5A 4FIWA 4K2DA 4JR4A 2VUPA 4BL7B 1M3IA 3FZ4A 2RUEA 5F06A 2R6KA 3HJMA 4K7IA 3EMXA 2HLSA 4GSNA 4O5UA 4G19A 2V6KA 3TRQA 4ECIA 2DC5A 3UBKA 4FYBA 2CT6A 1HQOA 2JACA 2B1KA 3CSJA 3KIJA 2JU5A 5FT3A 20GSA 5JCUA 3RDWA 2CZ3A 3GTUA 2VM2A 3LW9A 5AISA 2H71A 4ML1A 5E4WA 1WWJA 2MMZA 4EC0A 18GSA 2I81A 2X8CA 1T7PB 2L6CA 4O32A 4K9ZA 2RLIA 2GZYA 5IMFA 4MF7A 5ID2A 4KB3A 1W89A 2AAWA 5DALB 2H0GA 5D9XA 4D73A 2NPBA 1AXDA 3D4MA 1FOVA 5DBQA 3HVNA 4GSSA 1ABAA 2QA2A 3KP8A 5ECIB 2YWNA 3J7Yb 2A2RA 2CX3A 2O89A 5FHIA 4WEYA 3TCOA 2GTUA 4EUYA 4BIKA 1DE1A 3IC8A 1Q4JA 2CV4A 4GXZA 2FWHA 1X0RA 3QAVA 4PQ1A 5ECOB 1MD3A 2HI7A 4F0BA 4MF6A 3F0IA 1QQ2A 2LQOA 3IPZA
chains in the Genus database with same CATH topology
4PXOA 2CVKA 2C80A 1K0NA 1XWGA 3WGXA 2KP2A 1XZOA 3CBUA 1X9SB 2XHFA 1NHYA 4OCFA 2RM6A 5H5QA 5EL8A 4ECJA 3HCZA 2DJ3A 1QUWA 3TJJA 5IPGA 5FWGA 5KOXA 3U5RE 1BG5A 4MCUA 1VF3A 3I69A 4HZ2A 3TOUA 1FVJA 2PUKC 4KDXA 3DIEA 2LJRA 4GF0A 4V2MA 2H01A 2LUSA 3G9BA 2AUVA 2K8SA 4TXOA 5DCHA 1F3BA 5IMAA 3GRXA 4XS4A 5F8BA 5CRDA 2ZUPA 2GSSA 2GLRA 3G7JA 1GP1A 4HUAA 4ZB6A 2AB6A 3DVXA 2MMNA 3CTFA 4KSMA 5HQPA 3GUSA 3PH9A 4OMVA 1TDIA 4KDYA 5G5EA 5HFIA 1PD21 2YV9A 5CP1A 2PN8A 4HQZA 1B9YC 4WR4A 1TI3A 2VCWA 3UVHA 1BYEA 2H6ZA 3C71A 2PBJA 1SK0A 1ZYNA 4WKWA 4PTSA 4TW5A 1SD9A 1BX9A 3GSTA 4PURA 1B4QA 4O5RA 3IDVA 5IMVA 1U6TA 1M99A 1OKDA 2C3NA 4Q5QA 2V1MA 1T4ZA 1XWAA 4V1Ag 3MWHA 1VGLA 2EC4A 1QFNA 1Z5YE 4KGIA 3QCPA 4ZL8A 2O8VB 2K6VA 3WGEA 4NHZA 2X8GA 2C0FA 1I9DA 3DMLA 1R5PA 3DRNA 4RUVA 1Y6EA 1SJZA 3GH6A 1MEKA 1O73A 3KMNA 1M7TA 1ZYPA 3EVIA 4MZCA 2LRTA 1YY7A 1T4YA 3GFKA 2F8FA 2GT6A 4EIQA 3VPQA 3F8UA 1SL2B 5GSTA 5D9TA 1IYIA 3UVTA 4DSSA 4Q5FA 4KCEA 3GURA 5H5SA 2YPMA 1V9WA 3ZMLA 2OBKA 1K0BA 2CVDA 4GWRA 2M46A 1OE8A 1THXA 1TKDB 3ZIJA 4G0LA 5GAPD 3HYPA 3BJ5A 4BL7A 1TK5B 1LBKA 3A2XA 5CO3A 1PMTA 4ZBDA 4DEJA 1KEBA 2AV4A 3IHGA 1SKSB 1AIUA 5DQSA 2O85A 6GSXA 1M2DA 1AW9A 4Q5NA 4PNGA 2WRTA 3TGZA 4OFNA 1WP0A 3LYPA 1PN0A 4GRFA 2JZTA 1E6BA 3IK7A 2FGXA 1VF4A 3F6DA 3BBYA 1MD4A 5D93A 1X5EA 2G0FA 2VCXA 2CA8A 3L9UA 1PX6A 2GSTA 3IC4A 3ZL5A 4X1UA 2L5LA 4TR4A 1EOHA 1YKCA 3HA9A 5DALA 3VWXA 5ECSA 1SK1A 1K0MA 4NAXA 5IMCA 2HRFA 5ELGA 2N5FA 2OE0A 2IJYA 2MMOA 4HI7A 4QL9A 1XCCA 4MPGA 3P7XA 1FG4A 5JWRB 5A4UA 2YP6A 2H1BA 3SBCA 4ZB9A 1SYXA 3HJOA 1GTAA 3A3TA 1KNGA 4RQRA 2F9SA 3UOMA 3FR6A 1T00A 1EGRA 3AY8A 1EV4A 2VD0A 3DWVA 2QC7A 4NHWA 3G7IA 2VM1A 4ID0A 5ENUA 1GH2A 3F6FA 3F4SA 1O81A 3L0HA 2EIQA 2YZHA 1GTUA 1S3CA 3TKQA 3H4KA 1WE0A 2C0EA 1XW6A 4MABA 5B6MA 2C1YA 5ECPB 3E3EA 1HYUA 5C00A 2A4HA 4IELA 1X5CA 3LXTA 2QSIA 5A4WA 4XS4B 4E8HA 2FHEA 2YCDA 2O7KA 5IPHA 1TJDA 4NXIA 1SKRB 2RIIA 3CSIA 1GSQA 4F9ZA 2L4QA 1OAZA 2HRKA 1G7EA 6GSWA 3GKMA 4MJCA 3A5WA 3C1SA 1NM3A 3TJFA 4IJIA 1A2LA 2M80A 4BVXB 2X64A 4KDUA 4OWYA 3GHAA 1XXUA 1X9WB 4MK3A 1JZWA 2WJUA 1SD8A 4E8EA 5IOXA 3H1NA 1H4OA 4O5QA 1Z7PA 1FAAA 2H76A 1ZOFA 3TJBA 4JRRA 3VWVA 1PQNA 1M0UA 3CYNA 2L59A 2LTKA 5AN1A 2C8UA 3M9JA 3Q19A 4I2UA 2BJXA 3FR9A 4TOPA 5JCGA 1T8EB 2PWJA 3E0UA 1ON4A 1F9MA 5ECNB 3I9V2 1TRUA 1Z3EA 2LS5A 4XS1A 3F63A 3LSZA 5ECHB 4YQUA 3O76A 1ZMAA 1FHEA 2XC2A 1MDJA 1Z9HA 1DBYA 1EV9A 1GNEA 2VL2C 4N30A 5GSSA 1QGVA 3VURA 4K6XA 2LJAA 1G0TA 4MH2A 4CW9A 1EEJA 4K0NA 1RQMA 1ERVA 4DSSB 3DKSA 2KOKA 1NHOA 1BEDA 2IMIA 6GSTA 1A8LA 5B6NA 2L6DA 4POMA 4FH8A 4F82A 4HJ2A 1TXXA 4OCEA 1UA5A 1ZYEA 2C3TA 1ML6A 3DYRA 2GS3A 4RI6A 3US3A 2V41A 3ISOA 1LJRA 4KNDA 3DVWA 2VCVA 3O3TA 1WIKA 4I5QA 2R0CA 5H5RA 4EE0A 5G1KA 4USSA 4POKA 3ERGA 2WZ9A 6GSSA 3ME8A 3R2QA 4TN8A 4P3YB 4IVFA 3NOFA 5CYYA 2RM5A 1XOAA 4EO3A 4EVMA 1XWKA 5AGYA 3L9VA 1WMJA 2LV3A 5A5KA 3F4RA 1XVWA 3IA1A 2CX4A 4MZWA 2HXKA 4Z2UA 2DIZA 4G0IA 2X99A 3ZFBA 3BCIA 4WETA 3APOA 4XCSA 2O87A 1V2AA 4EIPA 4PUAA 1A8YA 2OBIA 1EOGA 5IOWA 3IAM2 5CRHA 4ZIJA 3TRPA 2FCHA 1GL8A 2YWMA 4ZBAA 3ZMKA 4O7HA 1A0RP 3MDKA 3BOAA 4TKYA 4MNNA 3I43A 1ZZYA 2MYGA 3PGTA 4OFTA 4Z2TA 1U3IA 3H93A 1XFLA 3ZREA 1PKWA 4N0VA 4ZL7A 2H75A 1U88A 2YANA 1FO5A 3H79A 4O92A 2XPDA 2DBCA 3EWLA 2KUCA 1WOUA 4V1Ap 1YEXA 4K7NA 3S9FA 3W8SA 4K5RA 1T3BA 1ZGNA 4XS6A 3EC3A 1ZCPA 1BQ7A 5HR0A 2DSAA 4Z2RA 3TKSC 2LEGA 5B8AA 1H75A 1THOA 2PVOC 1YQ1A 5KN3A 6GSYA 2IN3A 4KAEA 4I8BA 1B8XA 1X5DA 4G0KA 4BWSA 3HJPA 4NV5A 1YF0A 3F9UA 2FWFA 5GAND 5J9CA 1PGTA 2IMEA 2C3QA 4JU5A 5AIVA 3A5IA 2HZEB 3BCKA 1YEPA 1OC3A 3HZ8A 1O8WA 3IRAA 2I3YA 4KW6A 2YJ7A 4K7OA 1A2JA 2VL2A 2A4VA 16GSA 3CTGA 2P5QA 3M8NA 4PQIA 3LG6A 1WPIA 1PA3A 5DJLA 3M9KA 1XIYA 3TJGA 1K0AA 2KHPA 4IQAA 5HR2A 1FB0A 2WCIA 14GSA 3TUEA 4BVXA 3D6IA 4YKGA 2R5GA 5DVBA 1PKZA 3ZZXA 3QOUA 1Z6MA 2VL9A 5HR3A 3GKKA 2OKAA 4MZBA 1FB6A 1B48A 4MMMA 5ECLB 1O8XA 2HYXA 3EPTA 4AJ8A 2UZ8A 4IP1A 1S3AA 5AIXA 4FYUA 1MTCA 6GSVA 3KTBA 2XPEA 4KSOA 2RUFA 19GSA 4ULXA 11GSA 3F3RA 2WS2A 2H0IA 5IO0A 2VLVA 10GSA 2GSRA 2X4AA 3UEMA 1NW2A 1F6MC 3VI7A 3WGDA 1ERUA 3UJ1A 4K2XA 2G2QA 5D96A 3FMWA 2DJ2A 1XWCA 2EIOA 2L57A 1GULA 4RQXA 2WDUA 3TJKA 2WGRA 2B5YA 4OO5A 5DQYA 3M1GA 5JWOB 1K3YA 3KJYA 2H19A 2I1UA 4NWYA 2AJQB 2F3MA 2C0GA 3EYTA 2LJKA 1QXHA 1TOFA 4F03A 1WRYA 5IO2A 2R37A 2V2GA 3L9SA 1SKWB 4CHSA 4IP6A 1TRWA 3WD6A 2GQLA 4JBBA 4PNFA 2IL3A 3WYWA 4ZL9A 1YKAA 4L5LA 4LLRA 3LORA 1GSSA 1B4PA 5INYA 1JHBA 1PN9A 2VD1A 5EPFA 3W8JA 1XW9A 1HNBA 5HFGA 1G6YA 1C72A 3HHVA 2E7PA 4FYCA 3CRTA 2IPAA 5ELAA 2F8AA 2IFQB 1S3DA 12GSA 1PRXA 3TKSA 1OC9B 1YZXA 4GCIA 3ZLPA 1U3AA 3HKRA 1B9XC 5BRTA 2K9FA 2IMDA 1AQWA 4K0GA 4RI7A 1M2AA 2LNTA 4Z7XA 4HJMA 4F0CA 3TKSE 3F4TA 3RAZA 1R5AA 4X4JA 5HFKA 3KEBA 4HEA2 4TXVA 3FHKA 3C73A 2R3XA 2L5OA 2M72A 3MNGA 4ZXGA 3VFIA 2R0PA 5F07A 1SENA 2H30A 4L0WA 2BTOT 2DMMA 2REMA 1AQXA 1V98A 3KMOA 2I9HA 4YH2A 1K3OA 4WF4A 4XRAA 1J08A 4NV2A 2B1LA 3TB2A 22GSA 2CZ2A 1A23A 4PUFC 2H1AA 2KLXA 4FO5A 2VLTA 4WF5A 3PPUA 4IBPA 2H8LA 3VWUA 2B6MA 2HRNA 3K8NA 3UBLA 2FY6A 5IIZA 5F0GA 2JSYA 2DJKA 1GWCA 2XBIA 3UARA 1K3LA 3ZVJA 3UAPA 3ZVJD 1FOHA 3IV4A 3KTLA 3W6GA 2HZEA 1EGOA 3TRXA 1RW1A 3J7Yk 2H73A 4XTSA 5L71A 2WB9A 4K1FA 2VOCA 2AYTA 1XOBA 4YKFA 4BPYA 1RK4A 3FZ9A 3HY2A 2NDOA 3A2WA 1FVKA 2OE3A 1URMA 3KD0A 4CDOA 2QA1A 4ZB8A 4TR3A 1ZYQB 2K8VA 2GGTA 3EMPA 2N5BA 2JZSA 1QK8A 4PGTA 4H86A 1A24A 1XW5A 1J9BA 1TRVA 5IMZA 2JSZA 1TU8A 3ZYWA 2R4VA 1IYHA 1ERTA 1XBSA 1R4WA 2TRXA 1M9BA 3FW2A 5GZZB 3MYDA 3RBTA 5DJMA 3GX0A 3GIXA 3CMIA 1OYJA 1USBA 4MH3A 3BD2A 1U87A 3KH9A 5G5FA 2NBSA 2LQQA 3ERWA 3JCML 4HOJA 4KCAA 1GLPA 2YV7A 3FRCA 1V58A 1AC1A 2V6OA 3CRUA 2Z9SA 3GH9A 3TKRA 5D73A 3FZAA 2IMKA 1JFUA 2FLSA 1EEMA 5KEJA 2H6XA 5J5NA 4GQCA 3MAKA 3QFBC 2MZCA 8GSSA 4XIHA 5J9BA 3V1WA 2CAQA 4BVYB 4N11A 2YJHA 4EDYA 5JWQB 2DJ1A 2DJ0A 4TR0A 2ZNMA 1MDIA 2GSQA 3HVSA 4MJBA 2PGTA 3GA4A 1GSEA 4TRXA 2YOIA 1T1VA 1CQHA 1YF1A 3EURA 3HVVA 1K0DA 1PL1A 3KP9A 4ICYA 4OFMA 1A2MA 3VPTA 3DEXA 3IXRA 2J23A 3LQ7A 1JLWA 4LL4B 4FQUA 2PVQA 5ECQB 3VK9A 1SL0B 4WR5A 1SYRA 3FR3A 3UL3A 2JL4A 1GSDA 4EKZA 3IHQA 2FUG2 1LU4A 3NZNA 2PU9C 4LL1B 1NSWA 1O85A 1HNCA 5C04A 1OKTA 4ACSA 4F2IA 2DKIA 2P5RA 2YWOA 4V2NA 2IFQA 3GMFA 1G7OA 1F37A 1UC7A 4HQSA 5IQYA 1KBNA 2NTOA 1OC9A 2N5AA 1OC8A 1AUCA 4EL1A 1V40A 4ECBA 3KCMA 3QFAC 1SK2A 3VWWA 2LKUA 5J41A 3FY7A 4AF2A 4KF9A 1EP8A 4ML6A 1YDKA 3QAWA 2OA7A 1A0FA 1XWBA 5DAKB 4MLYA 2HRAA 5G31A 2LNSA 2GZPA 2KP1A 3A2VA 3Q18A 5HR1A 2QKEA 3H8QA 3LJRA 4EF0A 5CRGA 3LEFA 2E2GA 3DXBA 2BMXA 5B7CA 1VF1A 3GYKA 3F3QA 9GSSA 3M0FA 4AJ6A 1J0FA 3QR6A 2B3SA 2P0GA 2GT5A 2IIYA 3GV1A 1BAYA 1V57A 1K0CA 2F51A 1Z7RA 3TKPA 5ECRB 4HU9A 3RPPA 1HD2A 1M9AA 4Q5RA 3KGKA 1GTIA 4KA0A 2DLXA 4A5PA 5ECKB 2E2MA 1OE7A 3HDCA 3LGCA 2K18A 1TTZA 3HVXA 4L5OA 1JZDA 4GSTA 5COHA 3TDGA 1HNAA 4JR6A 4ISDA 2D2ZA 4L8EA 4TVEA 5DCGA 2H74A 4GQFA 4MDCA 2L4CA 2AHEA 2FNOA 4PQHA 4WXTA 1ILOA 3TOTA 3SWLA 2YN1A 2ALBA 3ZIVA 3E9JB 3ZTLA 4G2EA 2XBQA 4HZ4A 1SU9A 3IAS2 2ES7A 1XPVA 1O6JA 2YZUA 3UIWA 4X43A 4IS0A 2A2SA 2VO4A 5EVOA 1N2AA 2IMFA 2C4JA 1TK0B 1OVNA 17GSA 4MP4A 2DMLA 3IBHA 2R2JA 2PMTA 4DSQA 5LNKe 3HD5A 3IE3A 1AQVA 1ST9A 3D21A 4K8MA 1UN2A 1Y25A 1PSQA 4IJ3A 4I6XA 5KN0A 3FEUA 1BJXA 5BMUA 1VF2A 4QL7A 2H72A 3U6VA 2EIRA 2DJJA 4LMVA 2B7KA 4J2FA 3D22A 3FYGA 2VCTA 3HZ4A 1PX7A 5F05A 3EU4A 4IKHA 4GLTA 1F3AA 3N5OA 2A2PA 4IHUA 2R0GA 2J9HA 3KH7A 3MIXA 4HDEA 3QMXA 5D9VA 5KN2A 1TW9A 1GTBA 4QQ7A 2FA4A 2B7JA 4POBA 3R3EA 4BWQA 4I97A 3LYKA 2MMAA 1GLQA 1W4VA 2H0HA 2HZFA 1ACVA 4LMWA 6GSUA 2HNLA 3VI5A 4YAPA 1R26A 4TR1B 4XRDA 3HXSA 4NPBA 2HT9A 4YAVA 3APSA 3D4TA 2E0QA 3C8EA 3GNJA 4JEDA 4KH7A 1TRSA 2GZZA 4DSRA 5CNWA 1R7HA 3QAGA 2X49A 1K0OA 5LCZA 1TI1A 1EZKA 2IWTA 4ILFA 3IR4A 3L78A 3D0ZA 4N0ZA 13GSA 4IQ1A 4BVYA 3PINA 4CY6A 3QD9A 2VL3A 2OACA 1AAZA 3GX8A 3N9JA 4G9HA 5G30A 1N8JA 4WBJA 5D9WA 4I2TA 1E2YA 3EE2A 3GTUB 3MSZA 4JZQA 4JE1A 2GVPA 1TU7A 2X8HA 5J4UA 1Q98A 1QMVA 1F2EA 1JLVA 2B5XA 3Q6OA 4XHMA 5IM9A 2YWIA 1MDKA 2FWEA 5ID2B 3ED3A 1GNWA 2OADA 3QDNA 3KXOA 4EDZA 1PL2A 3L4NA 4K5SA 5DDLA 4D73B 5JCWA 2OE1A 4YQMA 1FW1A 1DE2A 3GL5A 3EINA 1WJKA 2I4AA 1XVQA 4BA7A 4KX4A 2VCQA 4MJEA 1JZRA 1O7UA 2WULA 1GSYA 1GUMA 1EP7A 2H1GA 4YQVA 2H1DA 4ECCA 3ZRDA 4POLA 3KZQA 3QPMA 2WFCA 4AGSA 2LRCA 5DAKA 4HS1A 3IOSA 4MJAA 2CQ9A 2ON5A 3EU3A 2HSMA 3NIVA 4X0XA 3FK8A 4IW9A 4HU7A 3UMAA 1CQGA 5CREA 3P90A 1SL1B 3WT1A 3GKXA 3M3MA 1DSBA 1TK8B 4PX1A 2VAFA 4LA1A 2YNXA 5EY6A 3GSSA 3RPNA 4IN0A 3O6TA 2FA8A 3P2AA 3ERFA 2B5EA 2LSTA 1VRSD 1ZL9A 2H6YA 1GSUA 2CVBA 5ABRA 4IGJA 2OJLA 2GQKA 3P8WA 1Z6NA 3D5JA 3ZFLA 3ME7A 1DUGA 3FZ5A 3RHCA 3C1RA 3PR8A 2PPTA 5B8BA 4TXOB 3IK9A 4G10A 5A4VA 2QGVA 3CXGA 1GRXA 2H70A 3APQA 4L0UA 5KN1A 1M2BA 4KE3A 1UVZA 2FWGA 5KOWA 2PERA 4ZBBA 2NVLA 2HSHA 2JADA 3WT2A 3I6AA 1YJ6A 1KTEA 2DKHA 3GN3A 3LFLA 4AJ7A 4J57E 2V32A 1GSFA 5E59A 2ZCTA 3KM6A 4KUNA 2ON7A 4V2LA 3LWAA 4OO4A 5CAXA 1I5GA 1G6WA 3DGQA 2P31A 4DVCA 2VIMA 3FKFA 3GKNA 1X9MB 2MBTA 1SJ6A 2DIYA 3LXZA 2H66A 4OD7A 3GL3A 4EXJA 2CAIA 1ERWA 1EWXA 3VLNA 3DD3A 3Q74A 5IMDA 3C7MA 2MBSA 1GUHA 2FD3A 3G7YA 4MF5A 3CSHA 3ZITA 4MA9A 5ECMB 5G1LA 2HSYA 1JZOA 2TRCP 2VCZA 4NMUA 2TIRA 5LD0A 1TP9A 4MPFA 4ZILA 2HE3A 4GTUA 7GSSA 4J56E 2GQMA 2HFDA 2VLUA 4TR1A 4N10A 2JZRA 2GDRA 5J3RA 5D8IA 4WBRD 1SJIA 2C0DA 3RHBA 1GUKA 4CY8A 2LRNA 5G2ZA 5CRWA 3OR5A 4FIWA 4K2DA 4JR4A 2VUPA 4BL7B 3FZ4A 2RUEA 5F06A 2R6KA 3HJMA 4K7IA 3EMXA 2HLSA 4GSNA 4O5UA 4G19A 2V6KA 3TRQA 4ECIA 2DC5A 3UBKA 4FYBA 2CT6A 1HQOA 2JACA 2B1KA 3CSJA 3KIJA 2JU5A 5FT3A 20GSA 5JCUA 3RDWA 2CZ3A 3GTUA 2VM2A 3LW9A 5AISA 2H71A 4ML1A 5E4WA 1WWJA 2MMZA 4EC0A 18GSA 2I81A 2X8CA 1T7PB 2L6CA 4O32A 4K9ZA 2RLIA 2GZYA 5IMFA 4MF7A 5ID2A 4KB3A 1W89A 2AAWA 5DALB 2H0GA 5D9XA 4D73A 2NPBA 1AXDA 3D4MA 1FOVA 5DBQA 4GSSA 1ABAA 2QA2A 3KP8A 5ECIB 2YWNA 3J7Yb 2A2RA 2CX3A 2O89A 5FHIA 4WEYA 3TCOA 2GTUA 4EUYA 1DE1A 3IC8A 1Q4JA 2CV4A 4GXZA 2FWHA 1X0RA 3QAVA 4PQ1A 5ECOB 1MD3A 2HI7A 4F0BA 4MF6A 3F0IA 1QQ2A 2LQOA 3IPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PXO A;  2CVK A;  2C80 A;  1K0N A;  1XWG A;  3WGX A;  2KP2 A;  1XZO A;  3CBU A;  1X9S B;  2XHF A;  1NHY A;  4OCF A;  2RM6 A;  5H5Q A;  5EL8 A;  4ECJ A;  3HCZ A;  2DJ3 A;  1QUW A;  3TJJ A;  5IPG A;  5FWG A;  3U5R E;  1BG5 A;  4MCU A;  1VF3 A;  3I69 A;  4HZ2 A;  3TOU A;  1FVJ A;  2PUK C;  4KDX A;  3DIE A;  2LJR A;  4GF0 A;  4V2M A;  2H01 A;  2LUS A;  3G9B A;  2AUV A;  2K8S A;  4TXO A;  5DCH A;  1F3B A;  5IMA A;  3GRX A;  4XS4 A;  5F8B A;  5CRD A;  2ZUP A;  2GSS A;  2GLR A;  3G7J A;  1GP1 A;  4HUA A;  4ZB6 A;  2AB6 A;  3DVX A;  2MMN A;  3CTF A;  4KSM A;  5HQP A;  3GUS A;  3PH9 A;  4OMV A;  1TDI A;  4KDY A;  5G5E A;  5HFI A;  1PD2 1;  2YV9 A;  5CP1 A;  2PN8 A;  4HQZ A;  1B9Y C;  4WR4 A;  1TI3 A;  2VCW A;  3UVH A;  1BYE A;  2H6Z A;  3C71 A;  2PBJ A;  1SK0 A;  4WKW A;  4TW5 A;  1SD9 A;  1BX9 A;  3GST A;  4PUR A;  1B4Q A;  4O5R A;  3IDV A;  5IMV A;  1U6T A;  1M99 A;  1OKD A;  2C3N A;  4Q5Q A;  2V1M A;  1T4Z A;  1XWA A;  4V1A g;  3MWH A;  1VGL A;  2EC4 A;  1QFN A;  1Z5Y E;  4KGI A;  3QCP A;  4ZL8 A;  2O8V B;  2K6V A;  3WGE A;  4NHZ A;  2X8G A;  2C0F A;  1I9D A;  3DML A;  1R5P A;  3DRN A;  4RUV A;  1Y6E A;  1SJZ A;  3GH6 A;  1MEK A;  1O73 A;  3KMN A;  1M7T A;  3EVI A;  4MZC A;  2LRT A;  1YY7 A;  1T4Y A;  3GFK A;  2F8F A;  2GT6 A;  3VPQ A;  3F8U A;  1SL2 B;  5GST A;  5D9T A;  1IYI A;  3UVT A;  4DSS A;  4Q5F A;  4KCE A;  3GUR A;  5H5S A;  2YPM A;  1V9W A;  3ZML A;  2OBK A;  1K0B A;  2CVD A;  4GWR A;  2M46 A;  1OE8 A;  1THX A;  1TKD B;  3ZIJ A;  5GAP D;  3HYP A;  3BJ5 A;  4BL7 A;  1TK5 B;  1LBK A;  3A2X A;  5CO3 A;  1PMT A;  4ZBD A;  4DEJ A;  1KEB A;  2AV4 A;  1SKS B;  1AIU A;  5DQS A;  2O85 A;  6GSX A;  1M2D A;  1AW9 A;  4Q5N A;  4PNG A;  2WRT A;  3TGZ A;  4OFN A;  1WP0 A;  3LYP A;  4GRF A;  2JZT A;  1E6B A;  3IK7 A;  2FGX A;  1VF4 A;  3F6D A;  3BBY A;  1MD4 A;  5D93 A;  1X5E A;  2G0F A;  2VCX A;  2CA8 A;  3L9U A;  1PX6 A;  2GST A;  3IC4 A;  3ZL5 A;  4X1U A;  2L5L A;  4TR4 A;  1EOH A;  1YKC A;  3HA9 A;  5DAL A;  3VWX A;  5ECS A;  1SK1 A;  1K0M A;  4NAX A;  5IMC A;  2HRF A;  5ELG A;  2N5F A;  2OE0 A;  2IJY A;  2MMO A;  4HI7 A;  4QL9 A;  1XCC A;  4MPG A;  3P7X A;  1FG4 A;  5JWR B;  5A4U A;  2YP6 A;  2H1B A;  3SBC A;  4ZB9 A;  1SYX A;  3HJO A;  1GTA A;  3A3T A;  1KNG A;  4RQR A;  2F9S A;  3UOM A;  3FR6 A;  1T00 A;  1EGR A;  3AY8 A;  1EV4 A;  2VD0 A;  3DWV A;  2QC7 A;  4NHW A;  3G7I A;  2VM1 A;  4ID0 A;  5ENU A;  1GH2 A;  3F6F A;  3F4S A;  1O81 A;  3L0H A;  2EIQ A;  2YZH A;  1GTU A;  1S3C A;  3TKQ A;  3H4K A;  1WE0 A;  2C0E A;  1XW6 A;  4MAB A;  5B6M A;  2C1Y A;  5ECP B;  3E3E A;  1HYU A;  5C00 A;  4IEL A;  1X5C A;  3LXT A;  2QSI A;  5A4W A;  4XS4 B;  4E8H A;  2FHE A;  2YCD A;  2O7K A;  5IPH A;  1TJD A;  4NXI A;  1SKR B;  2RII A;  3CSI A;  1GSQ A;  4F9Z A;  2L4Q A;  1OAZ A;  1G7E A;  6GSW A;  3GKM A;  4MJC A;  3A5W A;  3C1S A;  1NM3 A;  3TJF A;  4IJI A;  1A2L A;  2M80 A;  2X64 A;  4KDU A;  4OWY A;  3GHA A;  1XXU A;  1X9W B;  4MK3 A;  1JZW A;  2WJU A;  1SD8 A;  4E8E A;  5IOX A;  3H1N A;  1H4O A;  1Z7P A;  1FAA A;  2H76 A;  1ZOF A;  3TJB A;  4JRR A;  3VWV A;  1PQN A;  1M0U A;  3CYN A;  2L59 A;  2LTK A;  5AN1 A;  2C8U A;  3M9J A;  3Q19 A;  4I2U A;  2BJX A;  3FR9 A;  4TOP A;  5JCG A;  1T8E B;  2PWJ A;  3E0U A;  1ON4 A;  1F9M A;  5ECN B;  3I9V 2;  1TRU A;  1Z3E A;  2LS5 A;  4XS1 A;  3F63 A;  3LSZ A;  5ECH B;  4YQU A;  3O76 A;  1ZMA A;  1FHE A;  2XC2 A;  1MDJ A;  1Z9H A;  1DBY A;  1EV9 A;  1GNE A;  2VL2 C;  4N30 A;  5GSS A;  1QGV A;  3VUR A;  4K6X A;  2LJA A;  1G0T A;  4MH2 A;  4CW9 A;  1EEJ A;  4K0N A;  1RQM A;  1ERV A;  4DSS B;  3DKS A;  2KOK A;  1NHO A;  1BED A;  2IMI A;  6GST A;  1A8L A;  5B6N A;  2L6D A;  4POM A;  4FH8 A;  4F82 A;  4HJ2 A;  1TXX A;  4OCE A;  1UA5 A;  1ZYE A;  2C3T A;  1ML6 A;  3DYR A;  2GS3 A;  4RI6 A;  3US3 A;  2V41 A;  3ISO A;  1LJR A;  4KND A;  3DVW A;  2VCV A;  3O3T A;  1WIK A;  4I5Q A;  5H5R A;  4EE0 A;  5G1K A;  4POK A;  3ERG A;  2WZ9 A;  6GSS A;  3ME8 A;  3R2Q A;  4TN8 A;  4P3Y B;  4IVF A;  3NOF A;  5CYY A;  2RM5 A;  1XOA A;  4EO3 A;  4EVM A;  1XWK A;  5AGY A;  3L9V A;  1WMJ A;  2LV3 A;  5A5K A;  3F4R A;  1XVW A;  3IA1 A;  2CX4 A;  4MZW A;  2HXK A;  2DIZ A;  2X99 A;  3ZFB A;  3BCI A;  4WET A;  3APO A;  4XCS A;  2O87 A;  1V2A A;  4PUA A;  1A8Y A;  2OBI A;  1EOG A;  5IOW A;  3IAM 2;  5CRH A;  4ZIJ A;  3TRP A;  2FCH A;  1GL8 A;  2YWM A;  4ZBA A;  3ZMK A;  4O7H A;  1A0R P;  3MDK A;  3BOA A;  4TKY A;  3I43 A;  1ZZY A;  2MYG A;  3PGT A;  4OFT A;  1U3I A;  3H93 A;  1XFL A;  3ZRE A;  1PKW A;  4N0V A;  4ZL7 A;  2H75 A;  1U88 A;  2YAN A;  1FO5 A;  3H79 A;  4O92 A;  2XPD A;  2DBC A;  3EWL A;  2KUC A;  1WOU A;  4V1A p;  1YEX A;  4K7N A;  3S9F A;  3W8S A;  1T3B A;  1ZGN A;  4XS6 A;  3EC3 A;  1ZCP A;  1BQ7 A;  5HR0 A;  2DSA A;  3TKS C;  2LEG A;  5B8A A;  1H75 A;  1THO A;  2PVO C;  1YQ1 A;  5KN3 A;  6GSY A;  2IN3 A;  4KAE A;  4I8B A;  1B8X A;  1X5D A;  4BWS A;  3HJP A;  4NV5 A;  1YF0 A;  3F9U A;  2FWF A;  5GAN D;  5J9C A;  1PGT A;  2IME A;  2C3Q A;  4JU5 A;  5AIV A;  2HZE B;  3BCK A;  1YEP A;  1OC3 A;  3HZ8 A;  1O8W A;  3IRA A;  2I3Y A;  4KW6 A;  2YJ7 A;  4K7O A;  1A2J A;  2VL2 A;  2A4V A;  16GS A;  3CTG A;  2P5Q A;  3M8N A;  4PQI A;  3LG6 A;  1WPI A;  1PA3 A;  5DJL A;  3M9K A;  1XIY A;  3TJG A;  1K0A A;  2KHP A;  4IQA A;  5HR2 A;  1FB0 A;  2WCI A;  14GS A;  3TUE A;  4BVX A;  3D6I A;  2R5G A;  5DVB A;  1PKZ A;  3ZZX A;  3QOU A;  1Z6M A;  2VL9 A;  5HR3 A;  3GKK A;  2OKA A;  4MZB A;  1FB6 A;  1B48 A;  4MMM A;  5ECL B;  1O8X A;  2HYX A;  4AJ8 A;  4IP1 A;  1S3A A;  5AIX A;  4FYU A;  1MTC A;  6GSV A;  3KTB A;  2XPE A;  4KSO A;  2RUF A;  19GS A;  4ULX A;  11GS A;  3F3R A;  2WS2 A;  2H0I A;  5IO0 A;  2VLV A;  10GS A;  2GSR A;  3UEM A;  1NW2 A;  1F6M C;  3VI7 A;  3WGD A;  1ERU A;  3UJ1 A;  2G2Q A;  5D96 A;  2DJ2 A;  1XWC A;  2EIO A;  2L57 A;  1GUL A;  4RQX A;  2WDU A;  3TJK A;  2WGR A;  2B5Y A;  4OO5 A;  5DQY A;  3M1G A;  5JWO B;  1K3Y A;  3KJY A;  2H19 A;  2I1U A;  4NWY A;  2AJQ B;  2F3M A;  2C0G A;  3EYT A;  2LJK A;  1QXH A;  1TOF A;  4F03 A;  1WRY A;  5IO2 A;  2R37 A;  2V2G A;  3L9S A;  1SKW B;  4CHS A;  4IP6 A;  1TRW A;  3WD6 A;  2GQL A;  4JBB A;  4PNF A;  2IL3 A;  3WYW A;  4ZL9 A;  1YKA A;  4L5L A;  4LLR A;  3LOR A;  1GSS A;  1B4P A;  5INY A;  1JHB A;  1PN9 A;  2VD1 A;  5EPF A;  3W8J A;  1XW9 A;  1HNB A;  5HFG A;  1G6Y A;  1C72 A;  3HHV A;  2E7P A;  4FYC A;  3CRT A;  2IPA A;  5ELA A;  2F8A A;  2IFQ B;  1S3D A;  12GS A;  1PRX A;  3TKS A;  1OC9 B;  1YZX A;  4GCI A;  3ZLP A;  1U3A A;  3HKR A;  1B9X C;  2K9F A;  2IMD A;  1AQW A;  4K0G A;  4RI7 A;  1M2A A;  2LNT A;  4Z7X A;  4HJM A;  4F0C A;  3TKS E;  3F4T A;  3RAZ A;  1R5A A;  5HFK A;  3KEB A;  4HEA 2;  4TXV A;  3FHK A;  3C73 A;  2R3X A;  2L5O A;  2M72 A;  3MNG A;  4ZXG A;  3VFI A;  5F07 A;  1SEN A;  2H30 A;  4L0W A;  2BTO T;  2DMM A;  2REM A;  1AQX A;  1V98 A;  3KMO A;  2I9H A;  4YH2 A;  1K3O A;  4WF4 A;  4XRA A;  1J08 A;  4NV2 A;  2B1L A;  3TB2 A;  22GS A;  2CZ2 A;  1A23 A;  4PUF C;  2H1A A;  2KLX A;  4FO5 A;  2VLT A;  4WF5 A;  4IBP A;  2H8L A;  3VWU A;  2B6M A;  2HRN A;  3K8N A;  3UBL A;  2FY6 A;  5IIZ A;  5F0G A;  2JSY A;  2DJK A;  1GWC A;  2XBI A;  3UAR A;  1K3L A;  3ZVJ A;  3UAP A;  3ZVJ D;  3IV4 A;  3KTL A;  3W6G A;  2HZE A;  1EGO A;  3TRX A;  1RW1 A;  3J7Y k;  2H73 A;  4XTS A;  5L71 A;  2WB9 A;  4K1F A;  2VOC A;  2AYT A;  1XOB A;  4BPY A;  1RK4 A;  3FZ9 A;  3HY2 A;  2NDO A;  3A2W A;  1FVK A;  2OE3 A;  1URM A;  3KD0 A;  4CDO A;  4ZB8 A;  4TR3 A;  1ZYQ B;  2K8V A;  2GGT A;  3EMP A;  2N5B A;  2JZS A;  1QK8 A;  4PGT A;  4H86 A;  1A24 A;  1XW5 A;  1J9B A;  1TRV A;  5IMZ A;  2JSZ A;  1TU8 A;  3ZYW A;  2R4V A;  1IYH A;  1ERT A;  1XBS A;  1R4W A;  2TRX A;  1M9B A;  3FW2 A;  5GZZ B;  3RBT A;  5DJM A;  3GX0 A;  3GIX A;  3CMI A;  1OYJ A;  1USB A;  4MH3 A;  3BD2 A;  1U87 A;  3KH9 A;  5G5F A;  2NBS A;  2LQQ A;  3ERW A;  3JCM L;  4HOJ A;  4KCA A;  1GLP A;  2YV7 A;  3FRC A;  1V58 A;  1AC1 A;  2V6O A;  3CRU A;  2Z9S A;  3GH9 A;  3TKR A;  5D73 A;  3FZA A;  2IMK A;  1JFU A;  2FLS A;  1EEM A;  5KEJ A;  2H6X A;  5J5N A;  4GQC A;  3MAK A;  3QFB C;  2MZC A;  8GSS A;  4XIH A;  5J9B A;  3V1W A;  2CAQ A;  4N11 A;  2YJH A;  4EDY A;  5JWQ B;  2DJ1 A;  2DJ0 A;  4TR0 A;  2ZNM A;  1MDI A;  2GSQ A;  3HVS A;  4MJB A;  2PGT A;  3GA4 A;  1GSE A;  4TRX A;  2YOI A;  1T1V A;  1CQH A;  1YF1 A;  3EUR A;  3HVV A;  1K0D A;  1PL1 A;  3KP9 A;  4OFM A;  1A2M A;  3VPT A;  3DEX A;  3IXR A;  2J23 A;  3LQ7 A;  1JLW A;  4LL4 B;  2PVQ A;  5ECQ B;  3VK9 A;  1SL0 B;  4WR5 A;  1SYR A;  3FR3 A;  3UL3 A;  2JL4 A;  1GSD A;  4EKZ A;  3IHQ A;  2FUG 2;  1LU4 A;  3NZN A;  2PU9 C;  4LL1 B;  1NSW A;  1O85 A;  1HNC A;  5C04 A;  1OKT A;  4ACS A;  4F2I A;  2P5R A;  2YWO A;  4V2N A;  2IFQ A;  3GMF A;  1G7O A;  1F37 A;  1UC7 A;  4HQS A;  5IQY A;  1KBN A;  2NTO A;  1OC9 A;  2N5A A;  1OC8 A;  1AUC A;  4EL1 A;  1V40 A;  4ECB A;  3KCM A;  3QFA C;  1SK2 A;  3VWW A;  2LKU A;  5J41 A;  3FY7 A;  4AF2 A;  1EP8 A;  4ML6 A;  1YDK A;  3QAW A;  2OA7 A;  1A0F A;  1XWB A;  5DAK B;  4MLY A;  5G31 A;  2LNS A;  2GZP A;  2KP1 A;  3A2V A;  3Q18 A;  5HR1 A;  2QKE A;  3H8Q A;  3LJR A;  4EF0 A;  5CRG A;  3LEF A;  2E2G A;  3DXB A;  2BMX A;  5B7C A;  1VF1 A;  3GYK A;  3F3Q A;  9GSS A;  3M0F A;  4AJ6 A;  1J0F A;  3QR6 A;  2B3S A;  2P0G A;  2GT5 A;  2IIY A;  3GV1 A;  1BAY A;  1V57 A;  1K0C A;  2F51 A;  1Z7R A;  3TKP A;  5ECR B;  4HU9 A;  3RPP A;  1HD2 A;  1M9A A;  4Q5R A;  3KGK A;  1GTI A;  4KA0 A;  2DLX A;  5ECK B;  2E2M A;  1OE7 A;  3HDC A;  3LGC A;  2K18 A;  1TTZ A;  3HVX A;  4L5O A;  1JZD A;  4GST A;  5COH A;  3TDG A;  1HNA A;  4JR6 A;  4ISD A;  2D2Z A;  4L8E A;  4TVE A;  5DCG A;  2H74 A;  4GQF A;  4MDC A;  2L4C A;  2AHE A;  2FNO A;  4PQH A;  4WXT A;  1ILO A;  3TOT A;  3SWL A;  2YN1 A;  2ALB A;  3ZIV A;  3E9J B;  3ZTL A;  4G2E A;  2XBQ A;  4HZ4 A;  1SU9 A;  3IAS 2;  2ES7 A;  1XPV A;  1O6J A;  2YZU A;  3UIW A;  4X43 A;  4IS0 A;  2A2S A;  2VO4 A;  5EVO A;  1N2A A;  2IMF A;  2C4J A;  1TK0 B;  1OVN A;  17GS A;  4MP4 A;  2DML A;  3IBH A;  2R2J A;  2PMT A;  4DSQ A;  5LNK e;  3HD5 A;  3IE3 A;  1AQV A;  1ST9 A;  3D21 A;  4K8M A;  1UN2 A;  1Y25 A;  1PSQ A;  4IJ3 A;  4I6X A;  5KN0 A;  3FEU A;  1BJX A;  1VF2 A;  4QL7 A;  2H72 A;  3U6V A;  2EIR A;  2DJJ A;  4LMV A;  2B7K A;  4J2F A;  3D22 A;  3FYG A;  2VCT A;  3HZ4 A;  1PX7 A;  5F05 A;  3EU4 A;  4IKH A;  4GLT A;  1F3A A;  3N5O A;  4IHU A;  2J9H A;  3KH7 A;  4HDE A;  3QMX A;  5D9V A;  5KN2 A;  1TW9 A;  1GTB A;  4QQ7 A;  2FA4 A;  2B7J A;  4POB A;  4BWQ A;  4I97 A;  3LYK A;  2MMA A;  1GLQ A;  1W4V A;  2H0H A;  2HZF A;  1ACV A;  4LMW A;  6GSU A;  2HNL A;  3VI5 A;  4YAP A;  1R26 A;  4TR1 B;  4XRD A;  3HXS A;  4NPB A;  2HT9 A;  4YAV A;  3APS A;  3D4T A;  2E0Q A;  3C8E A;  3GNJ A;  4JED A;  4KH7 A;  1TRS A;  2GZZ A;  4DSR A;  5CNW A;  1R7H A;  3QAG A;  1K0O A;  5LCZ A;  1TI1 A;  1EZK A;  2IWT A;  4ILF A;  3IR4 A;  3L78 A;  3D0Z A;  4N0Z A;  13GS A;  4IQ1 A;  4BVY A;  3PIN A;  3QD9 A;  2VL3 A;  2OAC A;  1AAZ A;  3GX8 A;  3N9J A;  4G9H A;  5G30 A;  1N8J A;  4WBJ A;  5D9W A;  4I2T A;  1E2Y A;  3EE2 A;  3GTU B;  3MSZ A;  4JZQ A;  4JE1 A;  2GVP A;  1TU7 A;  2X8H A;  5J4U A;  1Q98 A;  1QMV A;  1F2E A;  1JLV A;  2B5X A;  3Q6O A;  4XHM A;  5IM9 A;  2YWI A;  1MDK A;  2FWE A;  5ID2 B;  3ED3 A;  1GNW A;  2OAD A;  3QDN A;  3KXO A;  4EDZ A;  1PL2 A;  3L4N A;  5DDL A;  4D73 B;  5JCW A;  2OE1 A;  4YQM A;  1FW1 A;  1DE2 A;  3GL5 A;  3EIN A;  1WJK A;  2I4A A;  1XVQ A;  4BA7 A;  4KX4 A;  2VCQ A;  4MJE A;  1JZR A;  1O7U A;  2WUL A;  1GSY A;  1GUM A;  1EP7 A;  2H1G A;  4YQV A;  2H1D A;  4ECC A;  3ZRD A;  4POL A;  3KZQ A;  3QPM A;  2WFC A;  4AGS A;  2LRC A;  5DAK A;  4HS1 A;  3IOS A;  4MJA A;  2CQ9 A;  2ON5 A;  3EU3 A;  3NIV A;  4X0X A;  3FK8 A;  4IW9 A;  4HU7 A;  3UMA A;  1CQG A;  5CRE A;  3P90 A;  1SL1 B;  3WT1 A;  3GKX A;  3M3M A;  1DSB A;  1TK8 B;  4PX1 A;  2VAF A;  4LA1 A;  2YNX A;  5EY6 A;  3GSS A;  3RPN A;  4IN0 A;  3O6T A;  2FA8 A;  3P2A A;  3ERF A;  2B5E A;  2LST A;  1VRS D;  1ZL9 A;  2H6Y A;  1GSU A;  2CVB A;  5ABR A;  4IGJ A;  2OJL A;  2GQK A;  3P8W A;  1Z6N A;  3D5J A;  3ZFL A;  3ME7 A;  1DUG A;  3FZ5 A;  3RHC A;  3C1R A;  3PR8 A;  2PPT A;  5B8B A;  4TXO B;  3IK9 A;  4G10 A;  5A4V A;  2QGV A;  3CXG A;  1GRX A;  2H70 A;  3APQ A;  4L0U A;  5KN1 A;  1M2B A;  4KE3 A;  1UVZ A;  2FWG A;  2PER A;  4ZBB A;  2NVL A;  2HSH A;  2JAD A;  3WT2 A;  3I6A A;  1YJ6 A;  1KTE A;  3GN3 A;  3LFL A;  4AJ7 A;  4J57 E;  2V32 A;  1GSF A;  5E59 A;  2ZCT A;  3KM6 A;  4KUN A;  2ON7 A;  4V2L A;  3LWA A;  4OO4 A;  5CAX A;  1I5G A;  1G6W A;  3DGQ A;  2P31 A;  4DVC A;  2VIM A;  3FKF A;  3GKN A;  1X9M B;  2MBT A;  1SJ6 A;  2DIY A;  3LXZ A;  2H66 A;  4OD7 A;  3GL3 A;  4EXJ A;  2CAI A;  1ERW A;  1EWX A;  3VLN A;  3DD3 A;  3Q74 A;  5IMD A;  3C7M A;  2MBS A;  1GUH A;  2FD3 A;  3G7Y A;  4MF5 A;  3CSH A;  3ZIT A;  4MA9 A;  5ECM B;  5G1L A;  2HSY A;  1JZO A;  2TRC P;  2VCZ A;  4NMU A;  2TIR A;  5LD0 A;  1TP9 A;  4MPF A;  4ZIL A;  2HE3 A;  4GTU A;  7GSS A;  4J56 E;  2GQM A;  2HFD A;  2VLU A;  4TR1 A;  4N10 A;  2JZR A;  2GDR A;  5J3R A;  5D8I A;  4WBR D;  1SJI A;  2C0D A;  3RHB A;  1GUK A;  2LRN A;  5G2Z A;  5CRW A;  3OR5 A;  4FIW A;  4K2D A;  4JR4 A;  2VUP A;  3FZ4 A;  2RUE A;  5F06 A;  2R6K A;  3HJM A;  4K7I A;  3EMX A;  2HLS A;  4GSN A;  4G19 A;  2V6K A;  3TRQ A;  4ECI A;  2DC5 A;  3UBK A;  4FYB A;  2CT6 A;  1HQO A;  2JAC A;  2B1K A;  3CSJ A;  3KIJ A;  2JU5 A;  5FT3 A;  20GS A;  5JCU A;  3RDW A;  2CZ3 A;  3GTU A;  2VM2 A;  5AIS A;  2H71 A;  4ML1 A;  5E4W A;  1WWJ A;  2MMZ A;  4EC0 A;  18GS A;  2I81 A;  2X8C A;  1T7P B;  2L6C A;  4O32 A;  4K9Z A;  2RLI A;  2GZY A;  5IMF A;  4MF7 A;  5ID2 A;  4KB3 A;  1W89 A;  2AAW A;  5DAL B;  2H0G A;  5D9X A;  4D73 A;  2NPB A;  1AXD A;  3D4M A;  1FOV A;  5DBQ A;  4GSS A;  1ABA A;  3KP8 A;  5ECI B;  2YWN A;  3J7Y b;  2A2R A;  2CX3 A;  2O89 A;  5FHI A;  4WEY A;  3TCO A;  2GTU A;  4EUY A;  1DE1 A;  1Q4J A;  2CV4 A;  4GXZ A;  2FWH A;  1X0R A;  3QAV A;  4PQ1 A;  5ECO B;  1MD3 A;  2HI7 A;  4F0B A;  4MF6 A;  3F0I A;  1QQ2 A;  2LQO A;  3IPZ A; 
#chains in the Genus database with same CATH topology
 4PXO A;  2CVK A;  2C80 A;  1K0N A;  1XWG A;  3WGX A;  2KP2 A;  1XZO A;  3CBU A;  1X9S B;  2XHF A;  1NHY A;  4OCF A;  2RM6 A;  5H5Q A;  5EL8 A;  4ECJ A;  3HCZ A;  2DJ3 A;  1QUW A;  3TJJ A;  5IPG A;  5FWG A;  5KOX A;  3U5R E;  1BG5 A;  4MCU A;  1VF3 A;  3I69 A;  4HZ2 A;  3TOU A;  1FVJ A;  2PUK C;  4KDX A;  3DIE A;  2LJR A;  4GF0 A;  4V2M A;  2H01 A;  2LUS A;  3G9B A;  2AUV A;  2K8S A;  4TXO A;  5DCH A;  1F3B A;  5IMA A;  3GRX A;  4XS4 A;  5F8B A;  5CRD A;  2ZUP A;  2GSS A;  2GLR A;  3G7J A;  1GP1 A;  4HUA A;  4ZB6 A;  2AB6 A;  3DVX A;  2MMN A;  3CTF A;  4KSM A;  5HQP A;  3GUS A;  3PH9 A;  4OMV A;  1TDI A;  4KDY A;  5G5E A;  5HFI A;  1PD2 1;  2YV9 A;  5CP1 A;  2PN8 A;  4HQZ A;  1B9Y C;  4WR4 A;  1TI3 A;  2VCW A;  3UVH A;  1BYE A;  2H6Z A;  3C71 A;  2PBJ A;  1SK0 A;  1ZYN A;  4WKW A;  4PTS A;  4TW5 A;  1SD9 A;  1BX9 A;  3GST A;  4PUR A;  1B4Q A;  4O5R A;  3IDV A;  5IMV A;  1U6T A;  1M99 A;  1OKD A;  2C3N A;  4Q5Q A;  2V1M A;  1T4Z A;  1XWA A;  4V1A g;  3MWH A;  1VGL A;  2EC4 A;  1QFN A;  1Z5Y E;  4KGI A;  3QCP A;  4ZL8 A;  2O8V B;  2K6V A;  3WGE A;  4NHZ A;  2X8G A;  2C0F A;  1I9D A;  3DML A;  1R5P A;  3DRN A;  4RUV A;  1Y6E A;  1SJZ A;  3GH6 A;  1MEK A;  1O73 A;  3KMN A;  1M7T A;  1ZYP A;  3EVI A;  4MZC A;  2LRT A;  1YY7 A;  1T4Y A;  3GFK A;  2F8F A;  2GT6 A;  4EIQ A;  3VPQ A;  3F8U A;  1SL2 B;  5GST A;  5D9T A;  1IYI A;  3UVT A;  4DSS A;  4Q5F A;  4KCE A;  3GUR A;  5H5S A;  2YPM A;  1V9W A;  3ZML A;  2OBK A;  1K0B A;  2CVD A;  4GWR A;  2M46 A;  1OE8 A;  1THX A;  1TKD B;  3ZIJ A;  4G0L A;  5GAP D;  3HYP A;  3BJ5 A;  4BL7 A;  1TK5 B;  1LBK A;  3A2X A;  5CO3 A;  1PMT A;  4ZBD A;  4DEJ A;  1KEB A;  2AV4 A;  3IHG A;  1SKS B;  1AIU A;  5DQS A;  2O85 A;  6GSX A;  1M2D A;  1AW9 A;  4Q5N A;  4PNG A;  2WRT A;  3TGZ A;  4OFN A;  1WP0 A;  3LYP A;  1PN0 A;  4GRF A;  2JZT A;  1E6B A;  3IK7 A;  2FGX A;  1VF4 A;  3F6D A;  3BBY A;  1MD4 A;  5D93 A;  1X5E A;  2G0F A;  2VCX A;  2CA8 A;  3L9U A;  1PX6 A;  2GST A;  3IC4 A;  3ZL5 A;  4X1U A;  2L5L A;  4TR4 A;  1EOH A;  1YKC A;  3HA9 A;  5DAL A;  3VWX A;  5ECS A;  1SK1 A;  1K0M A;  4NAX A;  5IMC A;  2HRF A;  5ELG A;  2N5F A;  2OE0 A;  2IJY A;  2MMO A;  4HI7 A;  4QL9 A;  1XCC A;  4MPG A;  3P7X A;  1FG4 A;  5JWR B;  5A4U A;  2YP6 A;  2H1B A;  3SBC A;  4ZB9 A;  1SYX A;  3HJO A;  1GTA A;  3A3T A;  1KNG A;  4RQR A;  2F9S A;  3UOM A;  3FR6 A;  1T00 A;  1EGR A;  3AY8 A;  1EV4 A;  2VD0 A;  3DWV A;  2QC7 A;  4NHW A;  3G7I A;  2VM1 A;  4ID0 A;  5ENU A;  1GH2 A;  3F6F A;  3F4S A;  1O81 A;  3L0H A;  2EIQ A;  2YZH A;  1GTU A;  1S3C A;  3TKQ A;  3H4K A;  1WE0 A;  2C0E A;  1XW6 A;  4MAB A;  5B6M A;  2C1Y A;  5ECP B;  3E3E A;  1HYU A;  5C00 A;  2A4H A;  4IEL A;  1X5C A;  3LXT A;  2QSI A;  5A4W A;  4XS4 B;  4E8H A;  2FHE A;  2YCD A;  2O7K A;  5IPH A;  1TJD A;  4NXI A;  1SKR B;  2RII A;  3CSI A;  1GSQ A;  4F9Z A;  2L4Q A;  1OAZ A;  2HRK A;  1G7E A;  6GSW A;  3GKM A;  4MJC A;  3A5W A;  3C1S A;  1NM3 A;  3TJF A;  4IJI A;  1A2L A;  2M80 A;  4BVX B;  2X64 A;  4KDU A;  4OWY A;  3GHA A;  1XXU A;  1X9W B;  4MK3 A;  1JZW A;  2WJU A;  1SD8 A;  4E8E A;  5IOX A;  3H1N A;  1H4O A;  4O5Q A;  1Z7P A;  1FAA A;  2H76 A;  1ZOF A;  3TJB A;  4JRR A;  3VWV A;  1PQN A;  1M0U A;  3CYN A;  2L59 A;  2LTK A;  5AN1 A;  2C8U A;  3M9J A;  3Q19 A;  4I2U A;  2BJX A;  3FR9 A;  4TOP A;  5JCG A;  1T8E B;  2PWJ A;  3E0U A;  1ON4 A;  1F9M A;  5ECN B;  3I9V 2;  1TRU A;  1Z3E A;  2LS5 A;  4XS1 A;  3F63 A;  3LSZ A;  5ECH B;  4YQU A;  3O76 A;  1ZMA A;  1FHE A;  2XC2 A;  1MDJ A;  1Z9H A;  1DBY A;  1EV9 A;  1GNE A;  2VL2 C;  4N30 A;  5GSS A;  1QGV A;  3VUR A;  4K6X A;  2LJA A;  1G0T A;  4MH2 A;  4CW9 A;  1EEJ A;  4K0N A;  1RQM A;  1ERV A;  4DSS B;  3DKS A;  2KOK A;  1NHO A;  1BED A;  2IMI A;  6GST A;  1A8L A;  5B6N A;  2L6D A;  4POM A;  4FH8 A;  4F82 A;  4HJ2 A;  1TXX A;  4OCE A;  1UA5 A;  1ZYE A;  2C3T A;  1ML6 A;  3DYR A;  2GS3 A;  4RI6 A;  3US3 A;  2V41 A;  3ISO A;  1LJR A;  4KND A;  3DVW A;  2VCV A;  3O3T A;  1WIK A;  4I5Q A;  2R0C A;  5H5R A;  4EE0 A;  5G1K A;  4USS A;  4POK A;  3ERG A;  2WZ9 A;  6GSS A;  3ME8 A;  3R2Q A;  4TN8 A;  4P3Y B;  4IVF A;  3NOF A;  5CYY A;  2RM5 A;  1XOA A;  4EO3 A;  4EVM A;  1XWK A;  5AGY A;  3L9V A;  1WMJ A;  2LV3 A;  5A5K A;  3F4R A;  1S3R A;  1XVW A;  3IA1 A;  2CX4 A;  4MZW A;  2HXK A;  4Z2U A;  2DIZ A;  4G0I A;  2X99 A;  3ZFB A;  3BCI A;  4WET A;  3APO A;  4XCS A;  2O87 A;  1V2A A;  4EIP A;  4PUA A;  1A8Y A;  2OBI A;  1EOG A;  5IOW A;  3IAM 2;  5CRH A;  4ZIJ A;  3TRP A;  2FCH A;  1GL8 A;  2YWM A;  4ZBA A;  3ZMK A;  4O7H A;  1A0R P;  3MDK A;  3BOA A;  4TKY A;  4MNN A;  3I43 A;  1ZZY A;  2MYG A;  3PGT A;  4OFT A;  4Z2T A;  1U3I A;  3H93 A;  1XFL A;  3ZRE A;  1PKW A;  4N0V A;  4ZL7 A;  2H75 A;  1U88 A;  2YAN A;  1FO5 A;  3H79 A;  4O92 A;  2XPD A;  2DBC A;  3EWL A;  2KUC A;  1WOU A;  4V1A p;  1YEX A;  4K7N A;  3S9F A;  3W8S A;  4K5R A;  1T3B A;  1ZGN A;  4XS6 A;  3EC3 A;  1ZCP A;  1BQ7 A;  5HR0 A;  2DSA A;  4Z2R A;  3TKS C;  2LEG A;  5B8A A;  1H75 A;  1THO A;  2PVO C;  1YQ1 A;  5KN3 A;  6GSY A;  2IN3 A;  4KAE A;  4I8B A;  1B8X A;  1X5D A;  4G0K A;  4BWS A;  3HJP A;  4NV5 A;  1YF0 A;  3F9U A;  2FWF A;  5GAN D;  5J9C A;  1PGT A;  2IME A;  2C3Q A;  4JU5 A;  5AIV A;  3A5I A;  2HZE B;  3BCK A;  1YEP A;  1OC3 A;  3HZ8 A;  1O8W A;  3IRA A;  2I3Y A;  4KW6 A;  2YJ7 A;  4K7O A;  1A2J A;  2VL2 A;  2A4V A;  16GS A;  3CTG A;  2P5Q A;  3M8N A;  4PQI A;  3LG6 A;  1WPI A;  1PA3 A;  5DJL A;  3M9K A;  1XIY A;  3TJG A;  1K0A A;  2KHP A;  4IQA A;  5HR2 A;  1FB0 A;  2WCI A;  14GS A;  3TUE A;  4BVX A;  3D6I A;  4YKG A;  2R5G A;  5DVB A;  1PKZ A;  3ZZX A;  3QOU A;  1Z6M A;  2VL9 A;  5HR3 A;  3GKK A;  2OKA A;  4MZB A;  1FB6 A;  1B48 A;  4MMM A;  5ECL B;  1O8X A;  2HYX A;  3EPT A;  4AJ8 A;  2UZ8 A;  4IP1 A;  1S3A A;  5AIX A;  4FYU A;  1MTC A;  6GSV A;  3KTB A;  2XPE A;  4KSO A;  2RUF A;  19GS A;  4ULX A;  11GS A;  3F3R A;  2WS2 A;  2H0I A;  5IO0 A;  2VLV A;  10GS A;  2GSR A;  2X4A A;  3UEM A;  1NW2 A;  1F6M C;  3VI7 A;  3WGD A;  1ERU A;  3UJ1 A;  4K2X A;  2G2Q A;  5D96 A;  3FMW A;  2DJ2 A;  1XWC A;  2EIO A;  2L57 A;  1GUL A;  4RQX A;  2WDU A;  3TJK A;  2WGR A;  2B5Y A;  4OO5 A;  5DQY A;  3M1G A;  5JWO B;  1K3Y A;  3KJY A;  2H19 A;  2I1U A;  4NWY A;  2AJQ B;  2F3M A;  2C0G A;  3EYT A;  2LJK A;  1QXH A;  1TOF A;  4F03 A;  1WRY A;  5IO2 A;  2R37 A;  2V2G A;  3L9S A;  1SKW B;  4CHS A;  4IP6 A;  1TRW A;  3WD6 A;  2GQL A;  4JBB A;  4PNF A;  2IL3 A;  3WYW A;  4ZL9 A;  1YKA A;  4L5L A;  4LLR A;  3LOR A;  1GSS A;  1B4P A;  5INY A;  1JHB A;  1PN9 A;  2VD1 A;  5EPF A;  3W8J A;  1XW9 A;  1HNB A;  5HFG A;  1G6Y A;  1C72 A;  3HHV A;  2E7P A;  4FYC A;  3CRT A;  2IPA A;  5ELA A;  2F8A A;  2IFQ B;  1S3D A;  12GS A;  1PRX A;  3TKS A;  1OC9 B;  1YZX A;  4GCI A;  3ZLP A;  1U3A A;  3HKR A;  1B9X C;  5BRT A;  2K9F A;  2IMD A;  1AQW A;  4K0G A;  4RI7 A;  1M2A A;  2LNT A;  4Z7X A;  4HJM A;  4F0C A;  3TKS E;  3F4T A;  3RAZ A;  1R5A A;  4X4J A;  5HFK A;  3KEB A;  4HEA 2;  4TXV A;  3FHK A;  3C73 A;  2R3X A;  2L5O A;  2M72 A;  3MNG A;  4ZXG A;  3VFI A;  2R0P A;  5F07 A;  1SEN A;  2H30 A;  4L0W A;  2BTO T;  2DMM A;  2REM A;  1AQX A;  1V98 A;  3KMO A;  2I9H A;  4YH2 A;  1K3O A;  4WF4 A;  4XRA A;  1J08 A;  4NV2 A;  2B1L A;  3TB2 A;  22GS A;  2CZ2 A;  1A23 A;  4PUF C;  2H1A A;  2KLX A;  4FO5 A;  2VLT A;  4WF5 A;  3PPU A;  4IBP A;  2H8L A;  3VWU A;  1XG8 A;  3CQF A;  2B6M A;  2HRN A;  3K8N A;  3UBL A;  2FY6 A;  5IIZ A;  5F0G A;  2JSY A;  2DJK A;  1GWC A;  2XBI A;  3UAR A;  1K3L A;  3ZVJ A;  3UAP A;  3ZVJ D;  1FOH A;  3IV4 A;  3KTL A;  3W6G A;  2HZE A;  1EGO A;  3TRX A;  1RW1 A;  3J7Y k;  2H73 A;  4XTS A;  5L71 A;  2WB9 A;  4K1F A;  2VOC A;  2AYT A;  1XOB A;  4YKF A;  4BPY A;  1RK4 A;  3FZ9 A;  3HY2 A;  2NDO A;  3A2W A;  1FVK A;  2OE3 A;  1URM A;  3KD0 A;  4CDO A;  2QA1 A;  4ZB8 A;  4TR3 A;  1ZYQ B;  2K8V A;  2GGT A;  3EMP A;  2N5B A;  2JZS A;  1QK8 A;  4PGT A;  4H86 A;  1A24 A;  1XW5 A;  1J9B A;  1TRV A;  5IMZ A;  2JSZ A;  1TU8 A;  3ZYW A;  2R4V A;  1IYH A;  1ERT A;  1XBS A;  1R4W A;  2TRX A;  1M9B A;  3FW2 A;  5GZZ B;  3MYD A;  3RBT A;  5DJM A;  3GX0 A;  3GIX A;  3CMI A;  1OYJ A;  1USB A;  4MH3 A;  3BD2 A;  1U87 A;  3KH9 A;  5G5F A;  2NBS A;  2LQQ A;  3ERW A;  3JCM L;  4HOJ A;  4KCA A;  1GLP A;  2YV7 A;  3FRC A;  1V58 A;  1AC1 A;  2V6O A;  3CRU A;  2Z9S A;  3GH9 A;  3TKR A;  5D73 A;  3FZA A;  2IMK A;  1JFU A;  2FLS A;  1EEM A;  5KEJ A;  2H6X A;  5J5N A;  4GQC A;  3MAK A;  3QFB C;  2MZC A;  8GSS A;  4XIH A;  5J9B A;  3V1W A;  2CAQ A;  4BVY B;  4N11 A;  2YJH A;  4EDY A;  5JWQ B;  2DJ1 A;  2DJ0 A;  4TR0 A;  2ZNM A;  1MDI A;  2GSQ A;  3HVS A;  4MJB A;  2PGT A;  3GA4 A;  1GSE A;  4TRX A;  2YOI A;  1T1V A;  1CQH A;  1YF1 A;  3EUR A;  3HVV A;  1K0D A;  1PL1 A;  3KP9 A;  4ICY A;  4OFM A;  1A2M A;  3VPT A;  3DEX A;  3IXR A;  2J23 A;  3LQ7 A;  1JLW A;  4LL4 B;  4FQU A;  2PVQ A;  5ECQ B;  3VK9 A;  1SL0 B;  4WR5 A;  1SYR A;  3FR3 A;  3UL3 A;  2JL4 A;  1GSD A;  4EKZ A;  3IHQ A;  2FUG 2;  1LU4 A;  3NZN A;  2PU9 C;  4LL1 B;  1NSW A;  1O85 A;  1HNC A;  5C04 A;  1OKT A;  4ACS A;  4F2I A;  2DKI A;  2P5R A;  2YWO A;  4V2N A;  2IFQ A;  3GMF A;  1G7O A;  1F37 A;  1UC7 A;  4HQS A;  5IQY A;  1KBN A;  2NTO A;  1OC9 A;  2N5A A;  1OC8 A;  1AUC A;  4EL1 A;  1V40 A;  4ECB A;  3KCM A;  3QFA C;  1SK2 A;  3VWW A;  2LKU A;  5J41 A;  3FY7 A;  4AF2 A;  4KF9 A;  1EP8 A;  4ML6 A;  1YDK A;  3QAW A;  2OA7 A;  1A0F A;  1XWB A;  5DAK B;  4MLY A;  2HRA A;  5G31 A;  2LNS A;  2GZP A;  2KP1 A;  3A2V A;  3Q18 A;  5HR1 A;  2QKE A;  3H8Q A;  3LJR A;  4EF0 A;  5CRG A;  3LEF A;  2E2G A;  3DXB A;  2BMX A;  5B7C A;  1VF1 A;  3GYK A;  3F3Q A;  9GSS A;  3M0F A;  4AJ6 A;  1J0F A;  3QR6 A;  2B3S A;  2P0G A;  2GT5 A;  2IIY A;  3GV1 A;  1BAY A;  1V57 A;  1K0C A;  2F51 A;  1Z7R A;  3TKP A;  5ECR B;  4HU9 A;  3RPP A;  1HD2 A;  1M9A A;  4Q5R A;  3KGK A;  1GTI A;  4KA0 A;  2DLX A;  4A5P A;  5ECK B;  2E2M A;  1OE7 A;  3HDC A;  3LGC A;  2K18 A;  1TTZ A;  3HVX A;  4L5O A;  1JZD A;  4GST A;  5COH A;  3TDG A;  1HNA A;  4JR6 A;  4ISD A;  2D2Z A;  4L8E A;  4TVE A;  5DCG A;  2H74 A;  4GQF A;  4MDC A;  2L4C A;  2AHE A;  2FNO A;  4PQH A;  4WXT A;  1ILO A;  3TOT A;  3SWL A;  2YN1 A;  2ALB A;  3ZIV A;  3E9J B;  3ZTL A;  4G2E A;  2XBQ A;  4HZ4 A;  1SU9 A;  3IAS 2;  2ES7 A;  1XPV A;  1O6J A;  2YZU A;  3UIW A;  4X43 A;  4IS0 A;  2A2S A;  2VO4 A;  5EVO A;  1N2A A;  2IMF A;  2C4J A;  1TK0 B;  1OVN A;  17GS A;  4MP4 A;  2DML A;  3IBH A;  2R2J A;  2PMT A;  4DSQ A;  5LNK e;  3HD5 A;  3IE3 A;  1AQV A;  1ST9 A;  3D21 A;  4K8M A;  1UN2 A;  1Y25 A;  1PSQ A;  4IJ3 A;  4I6X A;  5KN0 A;  3FEU A;  1BJX A;  5BMU A;  1VF2 A;  4QL7 A;  2H72 A;  3U6V A;  2EIR A;  2DJJ A;  4LMV A;  2B7K A;  4J2F A;  3D22 A;  3FYG A;  2VCT A;  3HZ4 A;  1PX7 A;  5F05 A;  3EU4 A;  4IKH A;  4GLT A;  1F3A A;  3N5O A;  2A2P A;  4IHU A;  2R0G A;  2J9H A;  3KH7 A;  3MIX A;  4HDE A;  3QMX A;  5D9V A;  5KN2 A;  1TW9 A;  1GTB A;  4HSC X;  4QQ7 A;  2FA4 A;  2B7J A;  4POB A;  3R3E A;  4BWQ A;  4I97 A;  3LYK A;  2MMA A;  1GLQ A;  1W4V A;  2H0H A;  2HZF A;  1ACV A;  4LMW A;  6GSU A;  2HNL A;  3VI5 A;  4YAP A;  1R26 A;  4TR1 B;  4XRD A;  3HXS A;  4NPB A;  2HT9 A;  4YAV A;  3APS A;  3D4T A;  2E0Q A;  3C8E A;  3GNJ A;  4JED A;  4KH7 A;  1TRS A;  2GZZ A;  4DSR A;  5CNW A;  1R7H A;  3QAG A;  2X49 A;  1K0O A;  5LCZ A;  1TI1 A;  1EZK A;  2IWT A;  4ILF A;  3IR4 A;  3L78 A;  3D0Z A;  4N0Z A;  13GS A;  4IQ1 A;  4BVY A;  3PIN A;  4CY6 A;  3QD9 A;  2VL3 A;  2OAC A;  1AAZ A;  3GX8 A;  3N9J A;  4G9H A;  5G30 A;  1N8J A;  4WBJ A;  1M3J A;  5D9W A;  4I2T A;  1E2Y A;  3EE2 A;  3GTU B;  3MSZ A;  4JZQ A;  4JE1 A;  2GVP A;  1TU7 A;  2X8H A;  5J4U A;  1Q98 A;  1QMV A;  1F2E A;  1JLV A;  2B5X A;  3Q6O A;  4XHM A;  5IM9 A;  2YWI A;  1MDK A;  2FWE A;  5ID2 B;  3ED3 A;  1GNW A;  2OAD A;  3QDN A;  3KXO A;  4EDZ A;  1PL2 A;  3L4N A;  4K5S A;  5DDL A;  4D73 B;  5JCW A;  2OE1 A;  4YQM A;  1FW1 A;  1DE2 A;  3GL5 A;  3EIN A;  1WJK A;  2I4A A;  1XVQ A;  4BA7 A;  4KX4 A;  2VCQ A;  4MJE A;  1JZR A;  1O7U A;  2WUL A;  1GSY A;  1GUM A;  1EP7 A;  2H1G A;  4YQV A;  2H1D A;  4ECC A;  3ZRD A;  4POL A;  3KZQ A;  3QPM A;  2WFC A;  4AGS A;  2LRC A;  5DAK A;  4HS1 A;  3IOS A;  4MJA A;  2CQ9 A;  2ON5 A;  3EU3 A;  2HSM A;  1PFO A;  3NIV A;  4X0X A;  3FK8 A;  4IW9 A;  4HU7 A;  3UMA A;  1CQG A;  5CRE A;  3P90 A;  1SL1 B;  3WT1 A;  3GKX A;  3M3M A;  1DSB A;  1TK8 B;  4PX1 A;  2VAF A;  4LA1 A;  2YNX A;  5EY6 A;  3GSS A;  3RPN A;  4IN0 A;  3O6T A;  2FA8 A;  3P2A A;  3ERF A;  2B5E A;  2LST A;  1VRS D;  1ZL9 A;  2H6Y A;  1GSU A;  2CVB A;  5ABR A;  4IGJ A;  2OJL A;  2GQK A;  3P8W A;  1Z6N A;  3D5J A;  3ZFL A;  3ME7 A;  1DUG A;  3FZ5 A;  3RHC A;  3C1R A;  3PR8 A;  2PPT A;  5B8B A;  4TXO B;  3IK9 A;  4G10 A;  5A4V A;  2QGV A;  3CXG A;  1GRX A;  2H70 A;  3APQ A;  4L0U A;  5KN1 A;  1M2B A;  4KE3 A;  1UVZ A;  2FWG A;  5KOW A;  2PER A;  4ZBB A;  2NVL A;  2HSH A;  2JAD A;  3WT2 A;  3I6A A;  1YJ6 A;  1KTE A;  2DKH A;  3GN3 A;  3LFL A;  4AJ7 A;  4J57 E;  2V32 A;  1GSF A;  5E59 A;  2ZCT A;  3KM6 A;  4KUN A;  2ON7 A;  4V2L A;  3LWA A;  4OO4 A;  5CAX A;  1I5G A;  1G6W A;  3DGQ A;  2P31 A;  4DVC A;  2VIM A;  3FKF A;  3GKN A;  1X9M B;  2MBT A;  1SJ6 A;  2DIY A;  3LXZ A;  2H66 A;  4OD7 A;  3GL3 A;  4EXJ A;  2CAI A;  1ERW A;  1EWX A;  3VLN A;  3DD3 A;  3Q74 A;  5IMD A;  3C7M A;  2MBS A;  1GUH A;  2FD3 A;  3G7Y A;  4MF5 A;  3CSH A;  3ZIT A;  4MA9 A;  5ECM B;  5G1L A;  2HSY A;  1JZO A;  2TRC P;  2VCZ A;  4NMU A;  2TIR A;  5LD0 A;  1TP9 A;  4MPF A;  4ZIL A;  2HE3 A;  4GTU A;  7GSS A;  4J56 E;  2GQM A;  2HFD A;  2VLU A;  4TR1 A;  4N10 A;  2JZR A;  2GDR A;  5J3R A;  5D8I A;  4WBR D;  1SJI A;  2C0D A;  3RHB A;  1GUK A;  4CY8 A;  2LRN A;  5G2Z A;  5CRW A;  3OR5 A;  4FIW A;  4K2D A;  4JR4 A;  2VUP A;  4BL7 B;  1M3I A;  3FZ4 A;  2RUE A;  5F06 A;  2R6K A;  3HJM A;  4K7I A;  3EMX A;  2HLS A;  4GSN A;  4O5U A;  4G19 A;  2V6K A;  3TRQ A;  4ECI A;  2DC5 A;  3UBK A;  4FYB A;  2CT6 A;  1HQO A;  2JAC A;  2B1K A;  3CSJ A;  3KIJ A;  2JU5 A;  5FT3 A;  20GS A;  5JCU A;  3RDW A;  2CZ3 A;  3GTU A;  2VM2 A;  3LW9 A;  5AIS A;  2H71 A;  4ML1 A;  5E4W A;  1WWJ A;  2MMZ A;  4EC0 A;  18GS A;  2I81 A;  2X8C A;  1T7P B;  2L6C A;  4O32 A;  4K9Z A;  2RLI A;  2GZY A;  5IMF A;  4MF7 A;  5ID2 A;  4KB3 A;  1W89 A;  2AAW A;  5DAL B;  2H0G A;  5D9X A;  4D73 A;  2NPB A;  1AXD A;  3D4M A;  1FOV A;  5DBQ A;  3HVN A;  4GSS A;  1ABA A;  2QA2 A;  3KP8 A;  5ECI B;  2YWN A;  3J7Y b;  2A2R A;  2CX3 A;  2O89 A;  5FHI A;  4WEY A;  3TCO A;  2GTU A;  4EUY A;  4BIK A;  1DE1 A;  3IC8 A;  1Q4J A;  2CV4 A;  4GXZ A;  2FWH A;  1X0R A;  3QAV A;  4PQ1 A;  5ECO B;  1MD3 A;  2HI7 A;  4F0B A;  4MF6 A;  3F0I A;  1QQ2 A;  2LQO A;  3IPZ A; 
#chains in the Genus database with same CATH homology
 4PXO A;  2CVK A;  2C80 A;  1K0N A;  1XWG A;  3WGX A;  2KP2 A;  1XZO A;  3CBU A;  1X9S B;  2XHF A;  1NHY A;  4OCF A;  2RM6 A;  5H5Q A;  5EL8 A;  4ECJ A;  3HCZ A;  2DJ3 A;  1QUW A;  3TJJ A;  5IPG A;  5FWG A;  5KOX A;  3U5R E;  1BG5 A;  4MCU A;  1VF3 A;  3I69 A;  4HZ2 A;  3TOU A;  1FVJ A;  2PUK C;  4KDX A;  3DIE A;  2LJR A;  4GF0 A;  4V2M A;  2H01 A;  2LUS A;  3G9B A;  2AUV A;  2K8S A;  4TXO A;  5DCH A;  1F3B A;  5IMA A;  3GRX A;  4XS4 A;  5F8B A;  5CRD A;  2ZUP A;  2GSS A;  2GLR A;  3G7J A;  1GP1 A;  4HUA A;  4ZB6 A;  2AB6 A;  3DVX A;  2MMN A;  3CTF A;  4KSM A;  5HQP A;  3GUS A;  3PH9 A;  4OMV A;  1TDI A;  4KDY A;  5G5E A;  5HFI A;  1PD2 1;  2YV9 A;  5CP1 A;  2PN8 A;  4HQZ A;  1B9Y C;  4WR4 A;  1TI3 A;  2VCW A;  3UVH A;  1BYE A;  2H6Z A;  3C71 A;  2PBJ A;  1SK0 A;  1ZYN A;  4WKW A;  4PTS A;  4TW5 A;  1SD9 A;  1BX9 A;  3GST A;  4PUR A;  1B4Q A;  4O5R A;  3IDV A;  5IMV A;  1U6T A;  1M99 A;  1OKD A;  2C3N A;  4Q5Q A;  2V1M A;  1T4Z A;  1XWA A;  4V1A g;  3MWH A;  1VGL A;  2EC4 A;  1QFN A;  1Z5Y E;  4KGI A;  3QCP A;  4ZL8 A;  2O8V B;  2K6V A;  3WGE A;  4NHZ A;  2X8G A;  2C0F A;  1I9D A;  3DML A;  1R5P A;  3DRN A;  4RUV A;  1Y6E A;  1SJZ A;  3GH6 A;  1MEK A;  1O73 A;  3KMN A;  1M7T A;  1ZYP A;  3EVI A;  4MZC A;  2LRT A;  1YY7 A;  1T4Y A;  3GFK A;  2F8F A;  2GT6 A;  4EIQ A;  3VPQ A;  3F8U A;  1SL2 B;  5GST A;  5D9T A;  1IYI A;  3UVT A;  4DSS A;  4Q5F A;  4KCE A;  3GUR A;  5H5S A;  2YPM A;  1V9W A;  3ZML A;  2OBK A;  1K0B A;  2CVD A;  4GWR A;  2M46 A;  1OE8 A;  1THX A;  1TKD B;  3ZIJ A;  4G0L A;  5GAP D;  3HYP A;  3BJ5 A;  4BL7 A;  1TK5 B;  1LBK A;  3A2X A;  5CO3 A;  1PMT A;  4ZBD A;  4DEJ A;  1KEB A;  2AV4 A;  3IHG A;  1SKS B;  1AIU A;  5DQS A;  2O85 A;  6GSX A;  1M2D A;  1AW9 A;  4Q5N A;  4PNG A;  2WRT A;  3TGZ A;  4OFN A;  1WP0 A;  3LYP A;  1PN0 A;  4GRF A;  2JZT A;  1E6B A;  3IK7 A;  2FGX A;  1VF4 A;  3F6D A;  3BBY A;  1MD4 A;  5D93 A;  1X5E A;  2G0F A;  2VCX A;  2CA8 A;  3L9U A;  1PX6 A;  2GST A;  3IC4 A;  3ZL5 A;  4X1U A;  2L5L A;  4TR4 A;  1EOH A;  1YKC A;  3HA9 A;  5DAL A;  3VWX A;  5ECS A;  1SK1 A;  1K0M A;  4NAX A;  5IMC A;  2HRF A;  5ELG A;  2N5F A;  2OE0 A;  2IJY A;  2MMO A;  4HI7 A;  4QL9 A;  1XCC A;  4MPG A;  3P7X A;  1FG4 A;  5JWR B;  5A4U A;  2YP6 A;  2H1B A;  3SBC A;  4ZB9 A;  1SYX A;  3HJO A;  1GTA A;  3A3T A;  1KNG A;  4RQR A;  2F9S A;  3UOM A;  3FR6 A;  1T00 A;  1EGR A;  3AY8 A;  1EV4 A;  2VD0 A;  3DWV A;  2QC7 A;  4NHW A;  3G7I A;  2VM1 A;  4ID0 A;  5ENU A;  1GH2 A;  3F6F A;  3F4S A;  1O81 A;  3L0H A;  2EIQ A;  2YZH A;  1GTU A;  1S3C A;  3TKQ A;  3H4K A;  1WE0 A;  2C0E A;  1XW6 A;  4MAB A;  5B6M A;  2C1Y A;  5ECP B;  3E3E A;  1HYU A;  5C00 A;  2A4H A;  4IEL A;  1X5C A;  3LXT A;  2QSI A;  5A4W A;  4XS4 B;  4E8H A;  2FHE A;  2YCD A;  2O7K A;  5IPH A;  1TJD A;  4NXI A;  1SKR B;  2RII A;  3CSI A;  1GSQ A;  4F9Z A;  2L4Q A;  1OAZ A;  2HRK A;  1G7E A;  6GSW A;  3GKM A;  4MJC A;  3A5W A;  3C1S A;  1NM3 A;  3TJF A;  4IJI A;  1A2L A;  2M80 A;  4BVX B;  2X64 A;  4KDU A;  4OWY A;  3GHA A;  1XXU A;  1X9W B;  4MK3 A;  1JZW A;  2WJU A;  1SD8 A;  4E8E A;  5IOX A;  3H1N A;  1H4O A;  4O5Q A;  1Z7P A;  1FAA A;  2H76 A;  1ZOF A;  3TJB A;  4JRR A;  3VWV A;  1PQN A;  1M0U A;  3CYN A;  2L59 A;  2LTK A;  5AN1 A;  2C8U A;  3M9J A;  3Q19 A;  4I2U A;  2BJX A;  3FR9 A;  4TOP A;  5JCG A;  1T8E B;  2PWJ A;  3E0U A;  1ON4 A;  1F9M A;  5ECN B;  3I9V 2;  1TRU A;  1Z3E A;  2LS5 A;  4XS1 A;  3F63 A;  3LSZ A;  5ECH B;  4YQU A;  3O76 A;  1ZMA A;  1FHE A;  2XC2 A;  1MDJ A;  1Z9H A;  1DBY A;  1EV9 A;  1GNE A;  2VL2 C;  4N30 A;  5GSS A;  1QGV A;  3VUR A;  4K6X A;  2LJA A;  1G0T A;  4MH2 A;  4CW9 A;  1EEJ A;  4K0N A;  1RQM A;  1ERV A;  4DSS B;  3DKS A;  2KOK A;  1NHO A;  1BED A;  2IMI A;  6GST A;  1A8L A;  5B6N A;  2L6D A;  4POM A;  4FH8 A;  4F82 A;  4HJ2 A;  1TXX A;  4OCE A;  1UA5 A;  1ZYE A;  2C3T A;  1ML6 A;  3DYR A;  2GS3 A;  4RI6 A;  3US3 A;  2V41 A;  3ISO A;  1LJR A;  4KND A;  3DVW A;  2VCV A;  3O3T A;  1WIK A;  4I5Q A;  2R0C A;  5H5R A;  4EE0 A;  5G1K A;  4USS A;  4POK A;  3ERG A;  2WZ9 A;  6GSS A;  3ME8 A;  3R2Q A;  4TN8 A;  4P3Y B;  4IVF A;  3NOF A;  5CYY A;  2RM5 A;  1XOA A;  4EO3 A;  4EVM A;  1XWK A;  5AGY A;  3L9V A;  1WMJ A;  2LV3 A;  5A5K A;  3F4R A;  1XVW A;  3IA1 A;  2CX4 A;  4MZW A;  2HXK A;  4Z2U A;  2DIZ A;  4G0I A;  2X99 A;  3ZFB A;  3BCI A;  4WET A;  3APO A;  4XCS A;  2O87 A;  1V2A A;  4EIP A;  4PUA A;  1A8Y A;  2OBI A;  1EOG A;  5IOW A;  3IAM 2;  5CRH A;  4ZIJ A;  3TRP A;  2FCH A;  1GL8 A;  2YWM A;  4ZBA A;  3ZMK A;  4O7H A;  1A0R P;  3MDK A;  3BOA A;  4TKY A;  4MNN A;  3I43 A;  1ZZY A;  2MYG A;  3PGT A;  4OFT A;  4Z2T A;  1U3I A;  3H93 A;  1XFL A;  3ZRE A;  1PKW A;  4N0V A;  4ZL7 A;  2H75 A;  1U88 A;  2YAN A;  1FO5 A;  3H79 A;  4O92 A;  2XPD A;  2DBC A;  3EWL A;  2KUC A;  1WOU A;  4V1A p;  1YEX A;  4K7N A;  3S9F A;  3W8S A;  4K5R A;  1T3B A;  1ZGN A;  4XS6 A;  3EC3 A;  1ZCP A;  1BQ7 A;  5HR0 A;  2DSA A;  4Z2R A;  3TKS C;  2LEG A;  5B8A A;  1H75 A;  1THO A;  2PVO C;  1YQ1 A;  5KN3 A;  6GSY A;  2IN3 A;  4KAE A;  4I8B A;  1B8X A;  1X5D A;  4G0K A;  4BWS A;  3HJP A;  4NV5 A;  1YF0 A;  3F9U A;  2FWF A;  5GAN D;  5J9C A;  1PGT A;  2IME A;  2C3Q A;  4JU5 A;  5AIV A;  3A5I A;  2HZE B;  3BCK A;  1YEP A;  1OC3 A;  3HZ8 A;  1O8W A;  3IRA A;  2I3Y A;  4KW6 A;  2YJ7 A;  4K7O A;  1A2J A;  2VL2 A;  2A4V A;  16GS A;  3CTG A;  2P5Q A;  3M8N A;  4PQI A;  3LG6 A;  1WPI A;  1PA3 A;  5DJL A;  3M9K A;  1XIY A;  3TJG A;  1K0A A;  2KHP A;  4IQA A;  5HR2 A;  1FB0 A;  2WCI A;  14GS A;  3TUE A;  4BVX A;  3D6I A;  4YKG A;  2R5G A;  5DVB A;  1PKZ A;  3ZZX A;  3QOU A;  1Z6M A;  2VL9 A;  5HR3 A;  3GKK A;  2OKA A;  4MZB A;  1FB6 A;  1B48 A;  4MMM A;  5ECL B;  1O8X A;  2HYX A;  3EPT A;  4AJ8 A;  2UZ8 A;  4IP1 A;  1S3A A;  5AIX A;  4FYU A;  1MTC A;  6GSV A;  3KTB A;  2XPE A;  4KSO A;  2RUF A;  19GS A;  4ULX A;  11GS A;  3F3R A;  2WS2 A;  2H0I A;  5IO0 A;  2VLV A;  10GS A;  2GSR A;  2X4A A;  3UEM A;  1NW2 A;  1F6M C;  3VI7 A;  3WGD A;  1ERU A;  3UJ1 A;  4K2X A;  2G2Q A;  5D96 A;  3FMW A;  2DJ2 A;  1XWC A;  2EIO A;  2L57 A;  1GUL A;  4RQX A;  2WDU A;  3TJK A;  2WGR A;  2B5Y A;  4OO5 A;  5DQY A;  3M1G A;  5JWO B;  1K3Y A;  3KJY A;  2H19 A;  2I1U A;  4NWY A;  2AJQ B;  2F3M A;  2C0G A;  3EYT A;  2LJK A;  1QXH A;  1TOF A;  4F03 A;  1WRY A;  5IO2 A;  2R37 A;  2V2G A;  3L9S A;  1SKW B;  4CHS A;  4IP6 A;  1TRW A;  3WD6 A;  2GQL A;  4JBB A;  4PNF A;  2IL3 A;  3WYW A;  4ZL9 A;  1YKA A;  4L5L A;  4LLR A;  3LOR A;  1GSS A;  1B4P A;  5INY A;  1JHB A;  1PN9 A;  2VD1 A;  5EPF A;  3W8J A;  1XW9 A;  1HNB A;  5HFG A;  1G6Y A;  1C72 A;  3HHV A;  2E7P A;  4FYC A;  3CRT A;  2IPA A;  5ELA A;  2F8A A;  2IFQ B;  1S3D A;  12GS A;  1PRX A;  3TKS A;  1OC9 B;  1YZX A;  4GCI A;  3ZLP A;  1U3A A;  3HKR A;  1B9X C;  5BRT A;  2K9F A;  2IMD A;  1AQW A;  4K0G A;  4RI7 A;  1M2A A;  2LNT A;  4Z7X A;  4HJM A;  4F0C A;  3TKS E;  3F4T A;  3RAZ A;  1R5A A;  4X4J A;  5HFK A;  3KEB A;  4HEA 2;  4TXV A;  3FHK A;  3C73 A;  2R3X A;  2L5O A;  2M72 A;  3MNG A;  4ZXG A;  3VFI A;  2R0P A;  5F07 A;  1SEN A;  2H30 A;  4L0W A;  2BTO T;  2DMM A;  2REM A;  1AQX A;  1V98 A;  3KMO A;  2I9H A;  4YH2 A;  1K3O A;  4WF4 A;  4XRA A;  1J08 A;  4NV2 A;  2B1L A;  3TB2 A;  22GS A;  2CZ2 A;  1A23 A;  4PUF C;  2H1A A;  2KLX A;  4FO5 A;  2VLT A;  4WF5 A;  3PPU A;  4IBP A;  2H8L A;  3VWU A;  2B6M A;  2HRN A;  3K8N A;  3UBL A;  2FY6 A;  5IIZ A;  5F0G A;  2JSY A;  2DJK A;  1GWC A;  2XBI A;  3UAR A;  1K3L A;  3ZVJ A;  3UAP A;  3ZVJ D;  1FOH A;  3IV4 A;  3KTL A;  3W6G A;  2HZE A;  1EGO A;  3TRX A;  1RW1 A;  3J7Y k;  2H73 A;  4XTS A;  5L71 A;  2WB9 A;  4K1F A;  2VOC A;  2AYT A;  1XOB A;  4YKF A;  4BPY A;  1RK4 A;  3FZ9 A;  3HY2 A;  2NDO A;  3A2W A;  1FVK A;  2OE3 A;  1URM A;  3KD0 A;  4CDO A;  2QA1 A;  4ZB8 A;  4TR3 A;  1ZYQ B;  2K8V A;  2GGT A;  3EMP A;  2N5B A;  2JZS A;  1QK8 A;  4PGT A;  4H86 A;  1A24 A;  1XW5 A;  1J9B A;  1TRV A;  5IMZ A;  2JSZ A;  1TU8 A;  3ZYW A;  2R4V A;  1IYH A;  1ERT A;  1XBS A;  1R4W A;  2TRX A;  1M9B A;  3FW2 A;  5GZZ B;  3MYD A;  3RBT A;  5DJM A;  3GX0 A;  3GIX A;  3CMI A;  1OYJ A;  1USB A;  4MH3 A;  3BD2 A;  1U87 A;  3KH9 A;  5G5F A;  2NBS A;  2LQQ A;  3ERW A;  3JCM L;  4HOJ A;  4KCA A;  1GLP A;  2YV7 A;  3FRC A;  1V58 A;  1AC1 A;  2V6O A;  3CRU A;  2Z9S A;  3GH9 A;  3TKR A;  5D73 A;  3FZA A;  2IMK A;  1JFU A;  2FLS A;  1EEM A;  5KEJ A;  2H6X A;  5J5N A;  4GQC A;  3MAK A;  3QFB C;  2MZC A;  8GSS A;  4XIH A;  5J9B A;  3V1W A;  2CAQ A;  4BVY B;  4N11 A;  2YJH A;  4EDY A;  5JWQ B;  2DJ1 A;  2DJ0 A;  4TR0 A;  2ZNM A;  1MDI A;  2GSQ A;  3HVS A;  4MJB A;  2PGT A;  3GA4 A;  1GSE A;  4TRX A;  2YOI A;  1T1V A;  1CQH A;  1YF1 A;  3EUR A;  3HVV A;  1K0D A;  1PL1 A;  3KP9 A;  4ICY A;  4OFM A;  1A2M A;  3VPT A;  3DEX A;  3IXR A;  2J23 A;  3LQ7 A;  1JLW A;  4LL4 B;  4FQU A;  2PVQ A;  5ECQ B;  3VK9 A;  1SL0 B;  4WR5 A;  1SYR A;  3FR3 A;  3UL3 A;  2JL4 A;  1GSD A;  4EKZ A;  3IHQ A;  2FUG 2;  1LU4 A;  3NZN A;  2PU9 C;  4LL1 B;  1NSW A;  1O85 A;  1HNC A;  5C04 A;  1OKT A;  4ACS A;  4F2I A;  2DKI A;  2P5R A;  2YWO A;  4V2N A;  2IFQ A;  3GMF A;  1G7O A;  1F37 A;  1UC7 A;  4HQS A;  5IQY A;  1KBN A;  2NTO A;  1OC9 A;  2N5A A;  1OC8 A;  1AUC A;  4EL1 A;  1V40 A;  4ECB A;  3KCM A;  3QFA C;  1SK2 A;  3VWW A;  2LKU A;  5J41 A;  3FY7 A;  4AF2 A;  4KF9 A;  1EP8 A;  4ML6 A;  1YDK A;  3QAW A;  2OA7 A;  1A0F A;  1XWB A;  5DAK B;  4MLY A;  2HRA A;  5G31 A;  2LNS A;  2GZP A;  2KP1 A;  3A2V A;  3Q18 A;  5HR1 A;  2QKE A;  3H8Q A;  3LJR A;  4EF0 A;  5CRG A;  3LEF A;  2E2G A;  3DXB A;  2BMX A;  5B7C A;  1VF1 A;  3GYK A;  3F3Q A;  9GSS A;  3M0F A;  4AJ6 A;  1J0F A;  3QR6 A;  2B3S A;  2P0G A;  2GT5 A;  2IIY A;  3GV1 A;  1BAY A;  1V57 A;  1K0C A;  2F51 A;  1Z7R A;  3TKP A;  5ECR B;  4HU9 A;  3RPP A;  1HD2 A;  1M9A A;  4Q5R A;  3KGK A;  1GTI A;  4KA0 A;  2DLX A;  4A5P A;  5ECK B;  2E2M A;  1OE7 A;  3HDC A;  3LGC A;  2K18 A;  1TTZ A;  3HVX A;  4L5O A;  1JZD A;  4GST A;  5COH A;  3TDG A;  1HNA A;  4JR6 A;  4ISD A;  2D2Z A;  4L8E A;  4TVE A;  5DCG A;  2H74 A;  4GQF A;  4MDC A;  2L4C A;  2AHE A;  2FNO A;  4PQH A;  4WXT A;  1ILO A;  3TOT A;  3SWL A;  2YN1 A;  2ALB A;  3ZIV A;  3E9J B;  3ZTL A;  4G2E A;  2XBQ A;  4HZ4 A;  1SU9 A;  3IAS 2;  2ES7 A;  1XPV A;  1O6J A;  2YZU A;  3UIW A;  4X43 A;  4IS0 A;  2A2S A;  2VO4 A;  5EVO A;  1N2A A;  2IMF A;  2C4J A;  1TK0 B;  1OVN A;  17GS A;  4MP4 A;  2DML A;  3IBH A;  2R2J A;  2PMT A;  4DSQ A;  5LNK e;  3HD5 A;  3IE3 A;  1AQV A;  1ST9 A;  3D21 A;  4K8M A;  1UN2 A;  1Y25 A;  1PSQ A;  4IJ3 A;  4I6X A;  5KN0 A;  3FEU A;  1BJX A;  5BMU A;  1VF2 A;  4QL7 A;  2H72 A;  3U6V A;  2EIR A;  2DJJ A;  4LMV A;  2B7K A;  4J2F A;  3D22 A;  3FYG A;  2VCT A;  3HZ4 A;  1PX7 A;  5F05 A;  3EU4 A;  4IKH A;  4GLT A;  1F3A A;  3N5O A;  2A2P A;  4IHU A;  2R0G A;  2J9H A;  3KH7 A;  3MIX A;  4HDE A;  3QMX A;  5D9V A;  5KN2 A;  1TW9 A;  1GTB A;  4QQ7 A;  2FA4 A;  2B7J A;  4POB A;  3R3E A;  4BWQ A;  4I97 A;  3LYK A;  2MMA A;  1GLQ A;  1W4V A;  2H0H A;  2HZF A;  1ACV A;  4LMW A;  6GSU A;  2HNL A;  3VI5 A;  4YAP A;  1R26 A;  4TR1 B;  4XRD A;  3HXS A;  4NPB A;  2HT9 A;  4YAV A;  3APS A;  3D4T A;  2E0Q A;  3C8E A;  3GNJ A;  4JED A;  4KH7 A;  1TRS A;  2GZZ A;  4DSR A;  5CNW A;  1R7H A;  3QAG A;  2X49 A;  1K0O A;  5LCZ A;  1TI1 A;  1EZK A;  2IWT A;  4ILF A;  3IR4 A;  3L78 A;  3D0Z A;  4N0Z A;  13GS A;  4IQ1 A;  4BVY A;  3PIN A;  4CY6 A;  3QD9 A;  2VL3 A;  2OAC A;  1AAZ A;  3GX8 A;  3N9J A;  4G9H A;  5G30 A;  1N8J A;  4WBJ A;  5D9W A;  4I2T A;  1E2Y A;  3EE2 A;  3GTU B;  3MSZ A;  4JZQ A;  4JE1 A;  2GVP A;  1TU7 A;  2X8H A;  5J4U A;  1Q98 A;  1QMV A;  1F2E A;  1JLV A;  2B5X A;  3Q6O A;  4XHM A;  5IM9 A;  2YWI A;  1MDK A;  2FWE A;  5ID2 B;  3ED3 A;  1GNW A;  2OAD A;  3QDN A;  3KXO A;  4EDZ A;  1PL2 A;  3L4N A;  4K5S A;  5DDL A;  4D73 B;  5JCW A;  2OE1 A;  4YQM A;  1FW1 A;  1DE2 A;  3GL5 A;  3EIN A;  1WJK A;  2I4A A;  1XVQ A;  4BA7 A;  4KX4 A;  2VCQ A;  4MJE A;  1JZR A;  1O7U A;  2WUL A;  1GSY A;  1GUM A;  1EP7 A;  2H1G A;  4YQV A;  2H1D A;  4ECC A;  3ZRD A;  4POL A;  3KZQ A;  3QPM A;  2WFC A;  4AGS A;  2LRC A;  5DAK A;  4HS1 A;  3IOS A;  4MJA A;  2CQ9 A;  2ON5 A;  3EU3 A;  2HSM A;  3NIV A;  4X0X A;  3FK8 A;  4IW9 A;  4HU7 A;  3UMA A;  1CQG A;  5CRE A;  3P90 A;  1SL1 B;  3WT1 A;  3GKX A;  3M3M A;  1DSB A;  1TK8 B;  4PX1 A;  2VAF A;  4LA1 A;  2YNX A;  5EY6 A;  3GSS A;  3RPN A;  4IN0 A;  3O6T A;  2FA8 A;  3P2A A;  3ERF A;  2B5E A;  2LST A;  1VRS D;  1ZL9 A;  2H6Y A;  1GSU A;  2CVB A;  5ABR A;  4IGJ A;  2OJL A;  2GQK A;  3P8W A;  1Z6N A;  3D5J A;  3ZFL A;  3ME7 A;  1DUG A;  3FZ5 A;  3RHC A;  3C1R A;  3PR8 A;  2PPT A;  5B8B A;  4TXO B;  3IK9 A;  4G10 A;  5A4V A;  2QGV A;  3CXG A;  1GRX A;  2H70 A;  3APQ A;  4L0U A;  5KN1 A;  1M2B A;  4KE3 A;  1UVZ A;  2FWG A;  5KOW A;  2PER A;  4ZBB A;  2NVL A;  2HSH A;  2JAD A;  3WT2 A;  3I6A A;  1YJ6 A;  1KTE A;  2DKH A;  3GN3 A;  3LFL A;  4AJ7 A;  4J57 E;  2V32 A;  1GSF A;  5E59 A;  2ZCT A;  3KM6 A;  4KUN A;  2ON7 A;  4V2L A;  3LWA A;  4OO4 A;  5CAX A;  1I5G A;  1G6W A;  3DGQ A;  2P31 A;  4DVC A;  2VIM A;  3FKF A;  3GKN A;  1X9M B;  2MBT A;  1SJ6 A;  2DIY A;  3LXZ A;  2H66 A;  4OD7 A;  3GL3 A;  4EXJ A;  2CAI A;  1ERW A;  1EWX A;  3VLN A;  3DD3 A;  3Q74 A;  5IMD A;  3C7M A;  2MBS A;  1GUH A;  2FD3 A;  3G7Y A;  4MF5 A;  3CSH A;  3ZIT A;  4MA9 A;  5ECM B;  5G1L A;  2HSY A;  1JZO A;  2TRC P;  2VCZ A;  4NMU A;  2TIR A;  5LD0 A;  1TP9 A;  4MPF A;  4ZIL A;  2HE3 A;  4GTU A;  7GSS A;  4J56 E;  2GQM A;  2HFD A;  2VLU A;  4TR1 A;  4N10 A;  2JZR A;  2GDR A;  5J3R A;  5D8I A;  4WBR D;  1SJI A;  2C0D A;  3RHB A;  1GUK A;  4CY8 A;  2LRN A;  5G2Z A;  5CRW A;  3OR5 A;  4FIW A;  4K2D A;  4JR4 A;  2VUP A;  4BL7 B;  3FZ4 A;  2RUE A;  5F06 A;  2R6K A;  3HJM A;  4K7I A;  3EMX A;  2HLS A;  4GSN A;  4O5U A;  4G19 A;  2V6K A;  3TRQ A;  4ECI A;  2DC5 A;  3UBK A;  4FYB A;  2CT6 A;  1HQO A;  2JAC A;  2B1K A;  3CSJ A;  3KIJ A;  2JU5 A;  5FT3 A;  20GS A;  5JCU A;  3RDW A;  2CZ3 A;  3GTU A;  2VM2 A;  3LW9 A;  5AIS A;  2H71 A;  4ML1 A;  5E4W A;  1WWJ A;  2MMZ A;  4EC0 A;  18GS A;  2I81 A;  2X8C A;  1T7P B;  2L6C A;  4O32 A;  4K9Z A;  2RLI A;  2GZY A;  5IMF A;  4MF7 A;  5ID2 A;  4KB3 A;  1W89 A;  2AAW A;  5DAL B;  2H0G A;  5D9X A;  4D73 A;  2NPB A;  1AXD A;  3D4M A;  1FOV A;  5DBQ A;  4GSS A;  1ABA A;  2QA2 A;  3KP8 A;  5ECI B;  2YWN A;  3J7Y b;  2A2R A;  2CX3 A;  2O89 A;  5FHI A;  4WEY A;  3TCO A;  2GTU A;  4EUY A;  1DE1 A;  3IC8 A;  1Q4J A;  2CV4 A;  4GXZ A;  2FWH A;  1X0R A;  3QAV A;  4PQ1 A;  5ECO B;  1MD3 A;  2HI7 A;  4F0B A;  4MF6 A;  3F0I A;  1QQ2 A;  2LQO A;  3IPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...