3C71A

Structure of a resa variant with a dsba-like active site motif (cphc)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
140
structure length
140
Chain Sequence
SDAPNFVLEDTNGKRIELSDLKGKGVFLNFWGTWCPHCKKEFPYMANQYKHFKSQGVEIVAVNVGESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLINPEGKVVKVVTGTMTESMIHDYMNLIKPGETSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol-disulfide oxidoreductase resA
publication title Effects of substitutions in the CXXC active-site motif of the extracytoplasmic thioredoxin ResA.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 44
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3c71A00
2EC4A 1XZOA 3W8SA 2OE1A 3SBCA 2PMTA 2BMXA 1T7PB 3FZAA 4PNGA 4O5RA 1Z5YE 3CBUA 3H1NA 4YQUA 2C80A 3ZLPA 1GSUA 2RLIA 1PGTA 4GQCA 3HJPA 2DIZA 4KE3A 4ZILA 2B5YA 5B6MA 1AC1A 2HYXA 4FYBA 5DQSA 1A2JA 4GRFA 4JEDA 5J9BA 3LXTA 3VWWA 2R37A 3LG6A 5HFKA 5ECHB 2V2GA 2FUG2 5E4WA 2DSAA 1C72A 4G9HA 1K0NA 4NHWA 1X5DA 1GH2A 1ZL9A 4KSOA 3R2QA 4RI6A 5B8AA 3HJMA 1WPIA 3ME7A 5J9CA 3LYKA 2HZEA 2C8UA 5KN0A 3HXSA 1MDIA 4O32A 2GQKA 2F9SA 1G7OA 4BPYA 1WRYA 4NAXA 3ED3A 1MD3A 1NHYA 4MDCA 2FWHA 3KP9A 4L0UA 1X0RA 3APOA 3GTUB 3EU4A 1R5PA 1BQ7A 3MDKA 1H75A 1RK4A 3C7MA 3CSIA 5L71A 3QFBC 3TJFA 4GSSA 4MJEA 5HR3A 3MAKA 3ISOA 3GUSA 1TU7A 3GNJA 4PX1A 3A3TA 3C71A 5DVBA 2C0DA 1TRSA 3HZ4A 1TW9A 3WT2A 1K0DA 3ZVJA 3P7XA 3GL5A 2I4AA 3DD3A 3GA4A 2CAQA 2YNXA 2HXKA 1K0OA 5F0GA 4I2UA 3CSJA 1SKWB 2YJ7A 3C8EA 3GHAA 1GUKA 3A2WA 5A4WA 5EPFA 4MP4A 4D73B 1YZXA 2E7PA 2GSRA 4AGSA 3J7Yb 5D9TA 3ZRDA 3P8WA 1XOBA 4F82A 3M9KA 2EIQA 3HY2A 1M99A 1IYIA 5DCHA 2V6KA 3TOUA 3HVVA 2P5RA 1THOA 4IN0A 1BG5A 2K9FA 2IMKA 4WETA 3EINA 2HSHA 1Q98A 3GFKA 2FHEA 2IWTA 3IK9A 1NSWA 1SL2B 2VO4A 2CZ2A 2PVOC 2OA7A 5GSTA 2H6YA 2ALBA 5JCUA 5LCZA 1OYJA 2LJAA 1THXA 2H8LA 4EXJA 2WULA 1XWBA 2GZYA 3A2VA 3TCOA 5CAXA 3QOUA 1RW1A 5J4UA 2CAIA 5CO3A 5EY6A 1K0AA 2NTOA 3US3A 1EZKA 3HDCA 4DSSA 3W8JA 5IIZA 2K6VA 2MBSA 3ZZXA 1TRWA 4XTSA 4NV5A 2B7JA 4HQZA 1A23A 5AIXA 3VLNA 3UOMA 3CTFA 4KCEA 3BD2A 2OACA 4WXTA 2ES7A 3UBKA 1YJ6A 3TOTA 2CA8A 4V2LA 2M72A 5CREA 1OC8A 4K0NA 1TDIA 1ZZYA 5HQPA 3DWVA 1ERVA 4XHMA 2O87A 3KXOA 2C1YA 1EEJA 9GSSA 5G30A 4WR5A 3QFAC 1FAAA 1Y6EA 4TW5A 1OVNA 1W4VA 1EV9A 4IELA 4XRDA 4LL4B 2WCIA 2H75A 3DGQA 2CQ9A 4PQIA 2ON5A 2VD0A 2IJYA 2KLXA 2TIRA 5ENUA 1EWXA 3BOAA 4ZBBA 1TJDA 1M2BA 3I43A 3IE3A 3CSHA 1PKWA 3OR5A 5LNKe 2V6OA 1AAZA 2XPDA 4K7NA 3VURA 3GH6A 3PH9A 4ZB8A 4ML6A 3SWLA 1QQ2A 4HQSA 5EL8A 4HJ2A 4EC0A 3L78A 1Z7RA 1AQVA 2H74A 3RDWA 3DKSA 1ZCPA 1GLQA 4FYCA 1LJRA 2HFDA 5ECSA 2K8VA 5ECPB 1QFNA 3A2XA 2YWNA 1TKDB 4RQRA 2LSTA 4OCEA 2E2MA 3ZMLA 2O7KA 1USBA 2HZEB 5ID2A 4DSQA 3UL3A 3EC3A 4WBRD 2WS2A 2HI7A 3QD9A 2V41A 2B6MA 4NPBA 1SKRB 1NHOA 2H71A 2VOCA 3GKXA 4F2IA 1V2AA 3W6GA 1U87A 3EE2A 2FY6A 2OADA 1F3AA 3FKFA 2J9HA 3BBYA 3TGZA 4MMMA 2LUSA 4IQAA 5AIVA 2YWMA 1W89A 1ABAA 4F9ZA 2LNTA 1Z9HA 2PBJA 4WBJA 3NZNA 3ME8A 4IJ3A 1GNWA 1WOUA 3EYTA 3ZVJD 3KIJA 4Q5NA 4HZ4A 2H0IA 2G0FA 1HD2A 3GX0A 3FYGA 3LGCA 1U3AA 1HQOA 4GXZA 2I1UA 3M1GA 3F4SA 1TRUA 1VRSD 5JCGA 2I3YA 5CRGA 2VIMA 4FYUA 1JLWA 1CQHA 2ZCTA 3VWVA 3ZREA 5GAND 1XOAA 2OE0A 2H73A 3L9SA 4AF2A 3KD0A 1WE0A 1XCCA 1OC9B 2VL2A 3EMPA 3ZITA 2OBKA 2VCWA 3WGXA 2NDOA 1FOVA 2QSIA 3BCKA 1MDJA 1G6WA 4X0XA 2X8HA 1OC3A 5G31A 1K0CA 4GSNA 3D4TA 4ECJA 2FWFA 1AW9A 4I8BA 3DRNA 2L5OA 3FW2A 1UN2A 4ILFA 2YJHA 2YZHA 1VF4A 3ZFLA 4LL1B 1URMA 2EIOA 4K7IA 3H4KA 4XS4B 4MF5A 2MMNA 3TJKA 1K3YA 5DAKB 1S3CA 5D9XA 1QMVA 2B1LA 3KTLA 3LSZA 4MCUA 3QAWA 5B7CA 6GSWA 2DJ1A 5F07A 3G7JA 1GP1A 5IMVA 2V32A 5DJMA 3TB2A 1CQGA 4PNFA 2WFCA 2AAWA 2VCQA 2CX4A 4KNDA 1ZMAA 2GT5A 5D96A 5IPGA 3QAVA 3LFLA 3TKSA 1X9WB 3IR4A 4BA7A 2VL3A 4MZCA 2LQQA 5C00A 1DSBA 3P90A 3S9FA 2L6DA 2PGTA 3TJJA 1SD9A 2YWIA 3GKNA 4BVXA 4J56E 2H0HA 3GV1A 4EKZA 1SU9A 4K2DA 4OO4A 4IVFA 3HA9A 3ZIVA 5KEJA 2G2QA 2IN3A 5IQYA 5KN3A 1U88A 3APQA 4QL7A 1LU4A 4DVCA 5INYA 2R5GA 1TTZA 4OWYA 2XC2A 3AY8A 6GSSA 18GSA 3IC4A 4I2TA 3KH7A 4TN8A 1PKZA 5DDLA 12GSA 1F6MC 2H1AA 3VI5A 1TK5B 2L4CA 4XCSA 2PU9C 4YAVA 4O92A 1Z6MA 4ISDA 4MLYA 4Q5RA 4TR1A 2H19A 5A5KA 2GVPA 1MD4A 4ID0A 2GSSA 4Q5QA 2LV3A 2FNOA 2VL9A 3F6FA 2C0GA 1O85A 2P0GA 3WGEA 4NXIA 1WIKA 3F4RA 3KCMA 1ZYEA 2GGTA 3ERFA 4PQHA 1HYUA 2DJ0A 3HCZA 5FT3A 1UC7A 3GKKA 4ZL9A 1X5EA 3FR9A 2YV9A 2LJKA 2R3XA 3ZFBA 1SL1B 4ZBAA 2VAFA 3GRXA 5ID2B 3DYRA 2PUKC 1GWCA 1XWCA 2VD1A 3KZQA 2L5LA 2YANA 2IFQA 3UAPA 13GSA 2A2RA 4I6XA 2F8FA 1NM3A 1G0TA 5ECLB 4HOJA 1T8EB 1YY7A 1ZGNA 2CT6A 5IPHA 2LNSA 2H1GA 5IMDA 2C0EA 1VF1A 1UVZA 1PA3A 2AYTA 3IXRA 4PURA 4XS1A 3FR3A 1JZWA 2XBQA 5G2ZA 5HR0A 3GX8A 2OBIA 2OKAA 1ERTA 2RUEA 2H6ZA 4E8EA 1PL2A 3PR8A 2B5EA 5F8BA 1AQWA 1VGLA 2FA8A 4F0BA 2NVLA 4RI7A 4F03A 4ECIA 1WMJA 1FG4A 3FZ5A 1F37A 5CRWA 2AB6A 5C04A 3GH9A 1B9YC 1DUGA 1K0BA 5HFGA 2PWJA 1GSDA 1YEPA 1TU8A 3RHBA 3U6VA 5D9WA 1Z7PA 1EGRA 2YZUA 1OAZA 1EV4A 1LBKA 3TKQA 1J0FA 5ELGA 1GSQA 4KUNA 2A2SA 2HSYA 5F06A 4ZL7A 4TVEA 5ECIB 4TOPA 3RBTA 5G5FA 5HR1A 1GSYA 3PGTA 2IMDA 4OFTA 1XIYA 4OFMA 2E2GA 3QAGA 5JCWA 2REMA 4IKHA 5D9VA 1WP0A 3ZYWA 2GQLA 2TRCP 5CYYA 1G7EA 4WF5A 3TKPA 4KGIA 5H5RA 2JU5A 2WGRA 4WR4A 1IYHA 4V2MA 3IOSA 2JSYA 3TRXA 3CYNA 1YEXA 2MMAA 4K1FA 2AJQB 1O73A 1R7HA 2JACA 1MEKA 1FVJA 2C3NA 4EUYA 3F0IA 4J57E 4KA0A 3QMXA 3E3EA 2H76A 3E9JB 2XHFA 4LMWA 1TP9A 2GLRA 2VLTA 3M0FA 4DEJA 4MJCA 1M0UA 4HUAA 3Q74A 4IGJA 3FY7A 4V1Ag 2GZZA 3KMOA 2RM5A 4XIHA 4YQMA 3FRCA 1ML6A 1SK1A 3O6TA 5JWRB 2R2JA 3IBHA 4KX4A 3TDGA 4IP1A 4HI7A 3F8UA 2VLUA 2I9HA 4AJ6A 3HJOA 1GL8A 2KP1A 4ZIJA 4NMUA 4IBPA 2L6CA 1BEDA 4ML1A 1MDKA 3D21A 2L57A 4JU5A 1GSEA 1YQ1A 3IRAA 4HJMA 4GSTA 3UBLA 4O7HA 3KH9A 4QL9A 4K8MA 5E59A 3UMAA 4POMA 2R4VA 2FCHA 1N8JA 3G7IA 2CZ3A 1T1VA 3TKRA 1XWGA 1SYXA 4PUAA 2FGXA 1I5GA 3IV4A 2LRNA 3DIEA 3U5RE 4WF4A 3V1WA 1M2AA 1JLVA 4CHSA 1EOGA 3MWHA 3LXZA 2FLSA 1QUWA 2YCDA 4WKWA 5ECKB 2IPAA 4RQXA 3PINA 2VUPA 1MTCA 1K0MA 1B9XC 22GSA 4N10A 4I97A 3HKRA 2VM2A 3QPMA 1JZOA 4EF0A 2MBTA 2XBIA 3HVSA 17GSA 2GSTA 1V58A 3LORA 4JBBA 4JRRA 3DVWA 2J23A 5HR2A 5H5SA 1PN9A 4BWQA 1AQXA 2WDUA 1EP7A 2CVKA 2V1MA 3BJ5A 3VWXA 4F0CA 5IOXA 5IMCA 5GSSA 1T4YA 4EO3A 3LQ7A 1DE1A 4POLA 1Q4JA 2C3QA 3CRUA 4HZ2A 3WGDA 2LJRA 4WEYA 1BYEA 4D73A 1FVKA 5IOWA 1ERWA 4RUVA 4POKA 4TR4A 1OKDA 1J08A 3CRTA 1WJKA 4XS6A 1UA5A 3EURA 3A5WA 1E6BA 3VI7A 5IO2A 3I6AA 2YWOA 4JE1A 2LRCA 5CNWA 3O76A 3D4MA 4OMVA 2DLXA 6GSXA 1A0FA 4KAEA 3UIWA 5CRDA 3G9BA 4GLTA 2JZTA 4G2EA 3EWLA 1NW2A 5IMAA 4ZXGA 2CV4A 2NBSA 3RPPA 2PPTA 3I69A 6GSYA 1SK0A 3IDVA 3N5OA 4K0GA 3D0ZA 1TI1A 1OKTA 5CP1A 1OE7A 1OE8A 1X9MB 2IMFA 2HRNA 5ECMB 11GSA 4IS0A 4CDOA 4P3YB 3FZ9A 4GCIA 2I81A 2X64A 1J9BA 4ZL8A 4K6XA 4POBA 3F63A 1PL1A 2ZNMA 4V2NA 2YOIA 4MPGA 2VCVA 4DSSB 2GT6A 2VL2C 3CTGA 3L9UA 1ST9A 3GL3A 2GQMA 4MK3A 4MABA 2WZ9A 1FO5A 3GSSA 4N30A 2ON7A 2KUCA 3GN3A 2C3TA 2DJ2A 4IJIA 1M9BA 5EVOA 2GTUA 2YN1A 5AGYA 1G6YA 4KB3A 2B1KA 3UVHA 16GSA 1XPVA 2IIYA 3TJGA 3I9V2 4HDEA 4L5LA 2C0FA 4Q5FA 3ZTLA 4YH2A 3GMFA 3GKMA 4AJ7A 5J5NA 1K3OA 1FHEA 2KOKA 4BL7A 5G1KA 2JZRA 5COHA 1SJZA 4ULXA 1FB0A 2O85A 1B48A 4MZWA 3L4NA 4L0WA 1XW5A 2EIRA 2K18A 2JADA 1SD8A 3QCPA 1XWKA 3IPZA 2DC5A 4HS1A 3TUEA 1GTBA 4MJAA 3D5JA 5J3RA 3UEMA 1SENA 1M9AA 4IP6A 3TKSC 3APSA 1HNAA 2LS5A 2H1DA 5GZZB 7GSSA 1M2DA 5FHIA 2B7KA 4KDYA 1VF2A 1SYRA 1T3BA 1VF3A 4JR6A 2N5AA 2IL3A 4KH7A 2H0GA 2BTOT 4N11A 2CX3A 2IMEA 1B4QA 1T4ZA 4AJ8A 3C1RA 1A8LA 4V1Ap 4TXOA 3IK7A 2AUVA 2JSZA 3VPTA 3N9JA 1ZOFA 2QGVA 2C4JA 6GSUA 1GSSA 4KDXA 1KTEA 4GQFA 4DSRA 3TRQA 1ERUA 2DMMA 1Z6NA 3UJ1A 3VK9A 1ILOA 1TOFA 2MYGA 3H93A 3TRPA 2MZCA 3RAZA 4NV2A 3WT1A 2PN8A 2VCZA 4XRAA 3RPNA 3LWAA 2N5FA 5DALA 4KSMA 3QR6A 1JZRA 4PUFC 3VWUA 2X8CA 2NPBA 2E0QA 3JCML 3GIXA 4GWRA 1A24A 1HNCA 4LLRA 3H79A 1EEMA 1TXXA 5G5EA 4QQ7A 1ACVA 2VM1A 2FD3A 1SJIA 1AIUA 1XW9A 2LEGA 1TK0B 1X5CA 3K8NA 4J2FA 2QC7A 2DJKA 5JWQB 2YP6A 4ECCA 3Q6OA 3J7Yk 2AV4A 4K7OA 1H4OA 3RHCA 3VFIA 3LEFA 5F05A 1RQMA 2VCXA 5H5QA 1OC9A 3BCIA 5ABRA 1SJ6A 1GTIA 2D2ZA 1TRVA 3E0UA 4H86A 4MPFA 5IMZA 1U6TA 3M9JA 2PVQA 1O8WA 1XFLA 5DBQA 6GSTA 3Q19A 1ON4A 5G1LA 3DXBA 3FHKA 10GSA 1JHBA 1FB6A 1GLPA 1QXHA 2X99A 4Z7XA 1S3AA 4TXVA 3HVXA 5ELAA 2FWEA 2H72A 2HRFA 4OFNA 4LA1A 3F3RA 1PRXA 3GSTA 2P31A 2A4VA 1BAYA 2B5XA 4IW9A 1PMTA 1K3LA 4XS4A 3ERGA 1A8YA 3G7YA 3LJRA 5DCGA 5DAKA 1V57A 4BVYA 2YPMA 5A4VA 3FZ4A 2DJ3A 1X9SB 1GNEA 5KN2A 1TI3A 5DJLA 1BJXA 1QGVA 2H30A 3CMIA 3M8NA 5D93A 4OCFA 3EU3A 3GURA 2GDRA 4GTUA 4G19A 1O7UA 4FIWA 2TRXA 2DBCA 5IO0A 2ZUPA 3KTBA 3DEXA 3MNGA 2KHPA 3HYPA 4GF0A 4HU9A 1XVQA 3GYKA 2QKEA 4I5QA 2H70A 4G10A 4MH2A 2RM6A 3WD6A 1SL0B 3L9VA 3EVIA 3L0HA 2Z9SA 3F4TA 3IAS2 3DVXA 1QK8A 5D8IA 1V98A 1YF1A 1B8XA 4KDUA 4ZB9A 2KP2A 4L8EA 1KBNA 3KM6A 1KNGA 5B8BA 1Z3EA 2O89A 3UARA 1E2YA 2DMLA 4PGTA 3LYPA 2L59A 2JZSA 2MMZA 1F9MA 4E8HA 3M3MA 20GSA 5HFIA 1FW1A 3C1SA 4KW6A 3HZ8A 1XW6A 3ZL5A 4MH3A 4EE0A 1V9WA 1A2LA 2H1BA 3NOFA 1DBYA 4TR1B 5J41A 1U3IA 2LKUA 1PX7A 5IMFA 1JFUA 1GUMA 4TRXA 1EP8A 3KP8A 4ZBDA 4NWYA 4PXOA 4JZQA 2HNLA 4X1UA 1Y25A 1XWAA 3D6IA 1AXDA 2B3SA 5ECQB 1SKSB 2L4QA 3VPQA 1HNBA 1JZDA 2CVBA 14GSA 3GTUA 4TXOB 5LD0A 1O8XA 4MJBA 4MF7A 1R26A 2O8VB 3DMLA 4TKYA 5IM9A 1R5AA 5AN1A 4ECBA 5JWOB 1BX9A 5ECOB 5B6NA 1YF0A 3NIVA 3EMXA 1PSQA 4EL1A 2M80A 5AISA 2OE3A 2IFQB 1N2AA 1PX6A 3FEUA 2HLSA 3F6DA 2F3MA 3Q18A 1R4WA 3TKSE 1GTUA 4L5OA 5DALB 4TR0A 1M7TA 3KGKA 2PERA 4NHZA 3WYWA 4ACSA 2XPEA 1XVWA 2GZPA 2H01A 1GUHA 2BJXA 2HT9A 2X8GA 5CRHA 3P2AA 1S3DA 2WB9A 4TR3A 4CW9A 1I9DA 3MSZA 3F9UA 2OJLA 3D22A 2LRTA 4IQ1A 1T00A 3TJBA 1GULA 3F3QA 2DJJA 1YDKA 1GSFA 2FWGA 8GSSA 4HU7A 4ZB6A 3QDNA 4LMVA 2HZFA 4FH8A 3C73A 3CXGA 1F2EA 19GSA 3FK8A 1GTAA 3IHQA 3KMNA 3ZIJA 2M46A 5DQYA 4K9ZA 4OO5A 4N0VA 2YV7A 1EGOA 1WWJA 4MZBA 4YQVA 4FO5A 6GSVA 2GS3A 1B4PA 1KEBA 1V40A 1SK2A 4KCAA 4HEA2 2K8SA 5GAPD 4MF6A 1ZYQB 5KN1A 2JL4A 4YAPA 4MA9A 5D73A 2IMIA 2RUFA 1F3BA 2LQOA 1O6JA 1XXUA 1YKAA 4EDYA 4EDZA 5FWGA 5ECRB 2WRTA 4JR4A 2P5QA 3UVTA 1AUCA 2RIIA 1A0RP 4EVMA 2F8AA 2H66A 4N0ZA 1O81A 2CVDA 1TK8B 2MMOA 2H6XA 1GRXA 2DIYA 2F51A 3IA1A 4IHUA 1YKCA 2WJUA 1PD21 2LTKA 3ZMKA 3KJYA 4PQ1A 2N5BA 1PQNA 2VCTA 3IAM2 4BWSA 4OD7A 3H8QA 2GSQA 2AHEA 1A2MA 3HHVA 3ERWA 3KEBA 1EOHA 2R6KA 4X43A 1DE2A 3FR6A 2FA4A 2VLVA 1XBSA 3O3TA 2HE3A 5ECNB 5A4UA 3HD5A
chains in the Genus database with same CATH superfamily
2EC4A 1XZOA 3W8SA 2OE1A 3SBCA 2PMTA 2BMXA 1T7PB 3FZAA 4PNGA 4O5RA 1Z5YE 3CBUA 3H1NA 4YQUA 2C80A 3ZLPA 1GSUA 2RLIA 1PGTA 4GQCA 3HJPA 2DIZA 4KE3A 4ZILA 2B5YA 5B6MA 1AC1A 2HYXA 4FYBA 5DQSA 1A2JA 4GRFA 4JEDA 5J9BA 3LXTA 3VWWA 2R37A 3LG6A 5HFKA 5ECHB 2V2GA 2FUG2 5E4WA 2DSAA 1C72A 4G9HA 1K0NA 4NHWA 1X5DA 1GH2A 1ZL9A 4KSOA 3R2QA 4RI6A 5B8AA 3HJMA 1WPIA 3ME7A 5J9CA 3LYKA 2HZEA 2C8UA 5KN0A 3HXSA 1MDIA 4O32A 2GQKA 2F9SA 1G7OA 4BPYA 1WRYA 4NAXA 3ED3A 1MD3A 1NHYA 4MDCA 2FWHA 3KP9A 4L0UA 1X0RA 3APOA 3GTUB 3EU4A 1R5PA 1BQ7A 3MDKA 1H75A 1RK4A 3C7MA 3CSIA 5L71A 3QFBC 3TJFA 4GSSA 4MJEA 5HR3A 3MAKA 3ISOA 3GUSA 1TU7A 3GNJA 4PX1A 3A3TA 3C71A 5DVBA 2C0DA 1TRSA 3HZ4A 1TW9A 3WT2A 1K0DA 3ZVJA 3P7XA 3GL5A 2I4AA 3DD3A 3GA4A 2CAQA 2YNXA 4PTSA 2HXKA 1K0OA 5F0GA 4I2UA 3CSJA 1SKWB 2YJ7A 3C8EA 3GHAA 1GUKA 3A2WA 5A4WA 5EPFA 4MP4A 4D73B 1YZXA 2E7PA 2GSRA 4AGSA 3J7Yb 5D9TA 3ZRDA 3P8WA 1XOBA 4F82A 3M9KA 2EIQA 3HY2A 1M99A 1IYIA 5DCHA 2V6KA 3TOUA 3HVVA 2P5RA 1THOA 4IN0A 1BG5A 2K9FA 2IMKA 4WETA 3EINA 2HSHA 1Q98A 3GFKA 2FHEA 2IWTA 3IK9A 1NSWA 4Z2UA 1SL2B 2VO4A 2CZ2A 2PVOC 2OA7A 5GSTA 2H6YA 2ALBA 5JCUA 5LCZA 1OYJA 2LJAA 1THXA 2H8LA 4EXJA 2WULA 1XWBA 2GZYA 3A2VA 3TCOA 5CAXA 3QOUA 1RW1A 5J4UA 2CAIA 5CO3A 5EY6A 1K0AA 2HSMA 2NTOA 3US3A 1EZKA 3HDCA 4DSSA 3W8JA 5IIZA 2K6VA 2MBSA 3ZZXA 1TRWA 2R0CA 4XTSA 4NV5A 2B7JA 4HQZA 1A23A 3LW9A 5AIXA 3VLNA 3UOMA 3CTFA 4KCEA 3A5IA 3BD2A 2OACA 4WXTA 2ES7A 3UBKA 1YJ6A 3TOTA 2CA8A 4V2LA 2M72A 5CREA 1OC8A 4K0NA 1TDIA 1ZZYA 5HQPA 2HRKA 3DWVA 1ERVA 4XHMA 2O87A 3KXOA 2C1YA 1EEJA 9GSSA 5G30A 4WR5A 3QFAC 1FAAA 1Y6EA 4TW5A 1OVNA 1W4VA 1EV9A 4IELA 4XRDA 4LL4B 2WCIA 2H75A 3DGQA 2CQ9A 4PQIA 2ON5A 2QA1A 2VD0A 2IJYA 2KLXA 2TIRA 5ENUA 1EWXA 3BOAA 4ZBBA 1TJDA 1M2BA 3I43A 3IE3A 3CSHA 1PKWA 3OR5A 5LNKe 2V6OA 1AAZA 2XPDA 4K7NA 3VURA 3GH6A 3PH9A 4ZB8A 4ML6A 3SWLA 1QQ2A 4HQSA 5EL8A 4HJ2A 3PPUA 4EC0A 3L78A 1Z7RA 1AQVA 2H74A 3RDWA 3DKSA 1ZCPA 1GLQA 4EIQA 4FYCA 1LJRA 2HFDA 5ECSA 2K8VA 5ECPB 1QFNA 4HSCX 3A2XA 2YWNA 1TKDB 4RQRA 2LSTA 4OCEA 2E2MA 3ZMLA 2O7KA 1USBA 2HZEB 5ID2A 4DSQA 3UL3A 3EC3A 4WBRD 2WS2A 2HI7A 3FMWA 3QD9A 2V41A 2B6MA 4NPBA 1SKRB 1NHOA 2H71A 2VOCA 3GKXA 4F2IA 1V2AA 3W6GA 1U87A 3EE2A 2FY6A 2OADA 1F3AA 3FKFA 2J9HA 3BBYA 3TGZA 4MMMA 2LUSA 4IQAA 5AIVA 2YWMA 1W89A 1ABAA 4F9ZA 2LNTA 1Z9HA 2PBJA 4WBJA 3NZNA 3ME8A 4YKGA 4IJ3A 1GNWA 1WOUA 3EYTA 3ZVJD 3KIJA 4Q5NA 4HZ4A 2H0IA 2G0FA 1HD2A 3GX0A 3FYGA 3LGCA 1U3AA 1HQOA 4GXZA 2I1UA 3M1GA 3F4SA 1TRUA 1VRSD 5JCGA 2I3YA 5CRGA 2VIMA 4FYUA 1JLWA 1CQHA 2ZCTA 3VWVA 3ZREA 5GAND 1XOAA 2OE0A 2H73A 3L9SA 4AF2A 3KD0A 1WE0A 1XCCA 1OC9B 2VL2A 3EMPA 3ZITA 2OBKA 2VCWA 3WGXA 2NDOA 1FOVA 4G0IA 2QSIA 3BCKA 1MDJA 1G6WA 4X0XA 2X8HA 1OC3A 5G31A 1K0CA 4GSNA 3D4TA 2HRAA 4ECJA 2FWFA 1AW9A 4I8BA 3DRNA 2L5OA 3FW2A 1UN2A 4ILFA 2YJHA 2YZHA 1VF4A 3ZFLA 4LL1B 1URMA 2EIOA 4K7IA 3H4KA 4XS4B 4MF5A 2MMNA 3TJKA 1K3YA 5DAKB 4BVYB 1S3CA 5D9XA 1QMVA 2B1LA 3KTLA 3LSZA 4MCUA 3QAWA 5B7CA 4MNNA 6GSWA 2DJ1A 5F07A 3G7JA 1GP1A 2A2PA 2V32A 5IMVA 5DJMA 3TB2A 1CQGA 4PNFA 2WFCA 2AAWA 2VCQA 2CX4A 4KNDA 1ZMAA 2GT5A 5D96A 5IPGA 3QAVA 3LFLA 4Z2RA 2DKHA 3TKSA 1X9WB 3IR4A 4BA7A 2VL3A 4MZCA 2LQQA 5C00A 1DSBA 3P90A 3S9FA 2L6DA 2A4HA 2PGTA 3TJJA 1SD9A 2YWIA 3GKNA 4BVXA 4J56E 2H0HA 3GV1A 4EKZA 1SU9A 4K2DA 4OO4A 2R0GA 4IVFA 3HA9A 3ZIVA 5KEJA 2G2QA 2IN3A 5IQYA 5KN3A 1U88A 3APQA 4QL7A 1LU4A 4DVCA 5INYA 2R5GA 1TTZA 4OWYA 2XC2A 3AY8A 6GSSA 18GSA 3IC4A 4I2TA 3KH7A 4TN8A 1PKZA 5DDLA 12GSA 1F6MC 2H1AA 3VI5A 1TK5B 2L4CA 4XCSA 2PU9C 4YAVA 4O92A 1Z6MA 4ISDA 4MLYA 4Q5RA 4TR1A 2H19A 5A5KA 2GVPA 1MD4A 4ID0A 2GSSA 4Q5QA 2LV3A 2FNOA 2VL9A 3F6FA 2C0GA 1O85A 2P0GA 3WGEA 4NXIA 1WIKA 3F4RA 3KCMA 1ZYEA 2GGTA 3ERFA 3HVNA 4PQHA 1HYUA 2DJ0A 3HCZA 5FT3A 1UC7A 3GKKA 4ZL9A 1X5EA 3FR9A 2YV9A 2LJKA 2R3XA 3ZFBA 1SL1B 4ZBAA 2VAFA 3GRXA 5ID2B 3DYRA 2PUKC 1GWCA 1XWCA 2VD1A 3KZQA 2L5LA 2YANA 2IFQA 3UAPA 13GSA 2A2RA 4I6XA 2F8FA 1NM3A 1G0TA 5ECLB 4HOJA 1T8EB 1YY7A 1ZGNA 2CT6A 5IPHA 2LNSA 2H1GA 5IMDA 2C0EA 1VF1A 1UVZA 1PA3A 2AYTA 3IXRA 4PURA 4XS1A 3FR3A 4USSA 1JZWA 2XBQA 5G2ZA 5HR0A 3GX8A 2OBIA 2OKAA 1ERTA 2RUEA 2H6ZA 4E8EA 1PL2A 3PR8A 2B5EA 1XG8A 5F8BA 1AQWA 1VGLA 2FA8A 4F0BA 2NVLA 4RI7A 4F03A 4ECIA 1WMJA 1FG4A 3FZ5A 1F37A 5CRWA 2AB6A 5C04A 3GH9A 1B9YC 1DUGA 1K0BA 5HFGA 2PWJA 1GSDA 1YEPA 1TU8A 3RHBA 3U6VA 5D9WA 1Z7PA 1EGRA 2YZUA 1OAZA 4G0LA 1EV4A 1LBKA 3TKQA 1J0FA 5ELGA 1GSQA 4KUNA 2A2SA 1ZYPA 2HSYA 5F06A 4ZL7A 4TVEA 5ECIB 4TOPA 3RBTA 5G5FA 5HR1A 1GSYA 3PGTA 2UZ8A 2IMDA 4OFTA 1XIYA 4OFMA 2E2GA 3QAGA 5JCWA 2REMA 4IKHA 5D9VA 1WP0A 3ZYWA 2GQLA 2TRCP 5CYYA 1G7EA 4WF5A 3TKPA 4KGIA 5H5RA 2JU5A 2WGRA 4WR4A 1IYHA 4V2MA 3IOSA 2JSYA 3TRXA 3CYNA 1YEXA 2MMAA 4K1FA 2AJQB 3R3EA 1O73A 1R7HA 2JACA 1PFOA 1MEKA 1FVJA 2C3NA 4EUYA 3F0IA 4J57E 4KA0A 3QMXA 3E3EA 2H76A 2X49A 3E9JB 3EPTA 2XHFA 4LMWA 1TP9A 2GLRA 2VLTA 3M0FA 4DEJA 4MJCA 1M0UA 4HUAA 3Q74A 4IGJA 3FY7A 4V1Ag 2GZZA 3KMOA 2RM5A 4XIHA 4YQMA 3FRCA 1ML6A 1SK1A 3O6TA 5JWRB 2R2JA 3IBHA 4KX4A 3TDGA 4IP1A 4HI7A 3F8UA 2VLUA 2I9HA 4AJ6A 3HJOA 1GL8A 2KP1A 4ZIJA 1S3RA 4NMUA 4IBPA 2L6CA 1BEDA 4ML1A 1MDKA 3D21A 2L57A 4JU5A 1GSEA 1YQ1A 3IRAA 4HJMA 4GSTA 3UBLA 4O7HA 3KH9A 4QL9A 4K8MA 5E59A 3UMAA 4POMA 2R4VA 2FCHA 1N8JA 3G7IA 3MYDA 2CZ3A 1T1VA 3TKRA 4BIKA 1XWGA 1SYXA 4PUAA 2FGXA 1I5GA 3IV4A 2LRNA 3DIEA 3U5RE 5KOXA 4WF4A 3V1WA 1M2AA 1JLVA 4CHSA 1EOGA 3MWHA 3LXZA 2FLSA 1QUWA 2YCDA 4WKWA 5ECKB 2IPAA 4RQXA 3PINA 2VUPA 1MTCA 1K0MA 1B9XC 22GSA 4N10A 4I97A 3HKRA 2VM2A 3QPMA 1JZOA 4EF0A 2MBTA 2XBIA 3HVSA 17GSA 2GSTA 1V58A 3LORA 4JBBA 4JRRA 3DVWA 2J23A 5HR2A 5H5SA 1PN9A 4BWQA 1AQXA 2WDUA 1EP7A 2CVKA 1PN0A 2V1MA 3BJ5A 3VWXA 4F0CA 5IOXA 5IMCA 5GSSA 1T4YA 4EO3A 3LQ7A 1DE1A 4POLA 1Q4JA 2C3QA 3CRUA 4HZ2A 3WGDA 2LJRA 4WEYA 1ZYNA 1BYEA 4D73A 1FVKA 5IOWA 1ERWA 4RUVA 4POKA 4TR4A 1OKDA 1J08A 3CRTA 1WJKA 4XS6A 1UA5A 3EURA 3A5WA 1E6BA 3VI7A 5IO2A 3I6AA 2YWOA 4JE1A 2LRCA 4X4JA 5CNWA 3O76A 3D4MA 4OMVA 2DLXA 6GSXA 2R0PA 1A0FA 4KAEA 3UIWA 5CRDA 3G9BA 4GLTA 2JZTA 4G2EA 3EWLA 1NW2A 5IMAA 4ZXGA 2CV4A 2NBSA 3RPPA 2PPTA 3I69A 6GSYA 1SK0A 3IDVA 3N5OA 4K0GA 3D0ZA 1TI1A 1OKTA 5CP1A 1OE7A 1OE8A 1X9MB 2IMFA 2HRNA 5ECMB 11GSA 4IS0A 4CDOA 4P3YB 1M3JA 3FZ9A 4GCIA 2I81A 2X64A 1J9BA 4ZL8A 4K6XA 4POBA 3F63A 1PL1A 2ZNMA 4V2NA 2YOIA 3IC8A 4MPGA 2VCVA 4DSSB 2GT6A 2VL2C 3CTGA 3L9UA 1ST9A 3GL3A 2GQMA 4MK3A 4MABA 2WZ9A 1FO5A 3GSSA 4N30A 1FOHA 2ON7A 2KUCA 4O5QA 3GN3A 2C3TA 2DJ2A 4IJIA 1M9BA 5EVOA 2GTUA 2YN1A 5AGYA 1G6YA 4KB3A 2B1KA 3UVHA 3IHGA 16GSA 1XPVA 2IIYA 3TJGA 3I9V2 4HDEA 4K5RA 4L5LA 2C0FA 4Q5FA 3ZTLA 4YH2A 3GMFA 3GKMA 4AJ7A 5J5NA 4Z2TA 1K3OA 1FHEA 2KOKA 4BL7A 5G1KA 2JZRA 5COHA 1SJZA 4ULXA 1FB0A 4EIPA 2O85A 1B48A 4MZWA 3L4NA 4L0WA 1XW5A 2EIRA 2K18A 2JADA 1SD8A 3QCPA 1XWKA 3IPZA 2DC5A 4HS1A 3TUEA 1GTBA 4MJAA 3D5JA 5J3RA 3UEMA 1SENA 1M9AA 4IP6A 3TKSC 3APSA 1HNAA 2LS5A 2H1DA 5GZZB 7GSSA 1M2DA 5FHIA 2B7KA 4KDYA 1VF2A 1SYRA 1T3BA 1VF3A 4JR6A 2N5AA 2IL3A 4KH7A 5BMUA 2H0GA 2BTOT 2DKIA 4N11A 2CX3A 2IMEA 1B4QA 1T4ZA 4AJ8A 3C1RA 1A8LA 4V1Ap 2X4AA 4TXOA 3IK7A 2AUVA 2JSZA 3VPTA 3N9JA 1ZOFA 2QGVA 2C4JA 6GSUA 1GSSA 4KDXA 1KTEA 4GQFA 4DSRA 3TRQA 1ERUA 2DMMA 1Z6NA 3UJ1A 3VK9A 1ILOA 1TOFA 2MYGA 3H93A 3TRPA 2MZCA 3RAZA 4NV2A 3WT1A 2PN8A 2VCZA 4XRAA 3RPNA 3LWAA 2N5FA 5DALA 4KSMA 3QR6A 1JZRA 4PUFC 3VWUA 2X8CA 2NPBA 2E0QA 3JCML 3GIXA 4GWRA 1A24A 1HNCA 4LLRA 3H79A 1EEMA 1TXXA 5G5EA 4QQ7A 1ACVA 2VM1A 2FD3A 4CY6A 1SJIA 1AIUA 4K5SA 1XW9A 2LEGA 1TK0B 1X5CA 3K8NA 4J2FA 2QC7A 2DJKA 5JWQB 2YP6A 4ECCA 3Q6OA 3J7Yk 2AV4A 4K7OA 1H4OA 3RHCA 3VFIA 3LEFA 5F05A 1RQMA 2VCXA 5H5QA 1OC9A 3BCIA 5ABRA 1SJ6A 1GTIA 2D2ZA 1TRVA 3E0UA 4H86A 4MPFA 5IMZA 1U6TA 3M9JA 2PVQA 1O8WA 1XFLA 5DBQA 6GSTA 3Q19A 1ON4A 5G1LA 3DXBA 3FHKA 10GSA 1JHBA 1FB6A 1GLPA 1QXHA 2X99A 4Z7XA 1S3AA 4TXVA 3HVXA 5ELAA 2FWEA 2H72A 2HRFA 4OFNA 4LA1A 3F3RA 1PRXA 3GSTA 2P31A 2A4VA 1BAYA 2B5XA 4IW9A 1PMTA 1K3LA 4XS4A 3ERGA 1A8YA 3G7YA 3LJRA 5DCGA 5DAKA 1V57A 4BVYA 2YPMA 5A4VA 3FZ4A 5KOWA 2DJ3A 1X9SB 1GNEA 5KN2A 1TI3A 5DJLA 1BJXA 1QGVA 2H30A 3CMIA 3M8NA 5D93A 4OCFA 3EU3A 3GURA 2GDRA 4GTUA 4G19A 1O7UA 5BRTA 4FIWA 2TRXA 2DBCA 4ICYA 5IO0A 2ZUPA 3KTBA 3DEXA 3MIXA 3MNGA 2KHPA 3HYPA 4GF0A 4HU9A 1XVQA 3GYKA 2QKEA 4I5QA 2H70A 4G10A 4MH2A 2RM6A 3WD6A 1SL0B 3L9VA 4CY8A 3EVIA 3L0HA 2Z9SA 3F4TA 3IAS2 4BVXB 3DVXA 1QK8A 5D8IA 1V98A 1YF1A 1B8XA 4KDUA 4K2XA 4YKFA 4ZB9A 4BL7B 2KP2A 4L8EA 1KBNA 3KM6A 1KNGA 5B8BA 1Z3EA 2O89A 3UARA 1E2YA 2DMLA 4PGTA 3LYPA 2L59A 4FQUA 2JZSA 2MMZA 1F9MA 4E8HA 3M3MA 20GSA 5HFIA 1FW1A 3C1SA 4KW6A 3HZ8A 1XW6A 3ZL5A 4MH3A 4EE0A 1V9WA 1A2LA 2H1BA 3NOFA 1DBYA 4TR1B 5J41A 1U3IA 2LKUA 1PX7A 5IMFA 3CQFA 1JFUA 1GUMA 4TRXA 1EP8A 3KP8A 4ZBDA 4NWYA 4PXOA 4JZQA 2HNLA 4X1UA 1Y25A 1XWAA 3D6IA 1AXDA 2B3SA 5ECQB 1SKSB 2L4QA 3VPQA 1HNBA 1JZDA 2CVBA 14GSA 3GTUA 4TXOB 5LD0A 1O8XA 4MJBA 4MF7A 1R26A 2O8VB 4O5UA 3DMLA 4TKYA 5IM9A 1R5AA 5AN1A 1M3IA 4ECBA 5JWOB 1BX9A 5ECOB 5B6NA 1YF0A 3NIVA 3EMXA 1PSQA 4EL1A 2M80A 5AISA 2OE3A 2IFQB 1N2AA 1PX6A 3FEUA 2HLSA 3F6DA 2F3MA 3Q18A 1R4WA 3TKSE 1GTUA 4L5OA 5DALB 4TR0A 1M7TA 3KGKA 2PERA 4NHZA 3WYWA 4ACSA 2XPEA 1XVWA 4A5PA 2GZPA 2H01A 1GUHA 2BJXA 2HT9A 2X8GA 5CRHA 3P2AA 1S3DA 2WB9A 4TR3A 4CW9A 1I9DA 3MSZA 3F9UA 2OJLA 3D22A 2LRTA 4IQ1A 1T00A 3TJBA 1GULA 3F3QA 2DJJA 1YDKA 1GSFA 4KF9A 2FWGA 8GSSA 4HU7A 4ZB6A 3QDNA 4LMVA 2HZFA 4FH8A 3C73A 3CXGA 1F2EA 19GSA 3FK8A 1GTAA 3IHQA 3KMNA 3ZIJA 2M46A 5DQYA 4K9ZA 4OO5A 4N0VA 2YV7A 1EGOA 1WWJA 4MZBA 4YQVA 4FO5A 6GSVA 2GS3A 1B4PA 1KEBA 1V40A 1SK2A 4KCAA 4HEA2 2K8SA 5GAPD 4MF6A 1ZYQB 5KN1A 2JL4A 4YAPA 4MA9A 5D73A 2IMIA 2RUFA 1F3BA 2LQOA 1O6JA 1XXUA 1YKAA 4EDYA 4EDZA 5FWGA 5ECRB 2WRTA 4JR4A 2P5QA 3UVTA 1AUCA 2RIIA 1A0RP 4EVMA 2F8AA 2H66A 4N0ZA 4G0KA 1O81A 2CVDA 1TK8B 2MMOA 2H6XA 1GRXA 2DIYA 2F51A 3IA1A 4IHUA 1YKCA 2WJUA 1PD21 2LTKA 3ZMKA 3KJYA 4PQ1A 2N5BA 1PQNA 2VCTA 3IAM2 4BWSA 4OD7A 3H8QA 2GSQA 2AHEA 1A2MA 3HHVA 3ERWA 3KEBA 1EOHA 2R6KA 4X43A 1DE2A 3FR6A 2FA4A 2VLVA 1XBSA 3O3TA 2HE3A 5ECNB 5A4UA 3HD5A 2QA2A
chains in the Genus database with same CATH topology
2EC4A 1XZOA 3W8SA 2OE1A 3SBCA 2PMTA 2BMXA 1T7PB 3FZAA 4PNGA 4O5RA 1Z5YE 3CBUA 3H1NA 4YQUA 2C80A 3ZLPA 1GSUA 2RLIA 1PGTA 4GQCA 3HJPA 2DIZA 4KE3A 4ZILA 2B5YA 5B6MA 1AC1A 2HYXA 4FYBA 5DQSA 1A2JA 4GRFA 4JEDA 5J9BA 3LXTA 3VWWA 2R37A 3LG6A 5HFKA 5ECHB 2V2GA 2FUG2 5E4WA 2DSAA 1C72A 4G9HA 1K0NA 4NHWA 1X5DA 1GH2A 1ZL9A 4KSOA 3R2QA 4RI6A 5B8AA 3HJMA 1WPIA 3ME7A 5J9CA 3LYKA 2HZEA 2C8UA 5KN0A 3HXSA 1MDIA 4O32A 2GQKA 2F9SA 1G7OA 4BPYA 1WRYA 4NAXA 3ED3A 1MD3A 1NHYA 4MDCA 2FWHA 3KP9A 4L0UA 1X0RA 3APOA 3GTUB 3EU4A 1R5PA 1BQ7A 3MDKA 1H75A 1RK4A 3C7MA 3CSIA 5L71A 3QFBC 3TJFA 4GSSA 4MJEA 5HR3A 3MAKA 3ISOA 3GUSA 1TU7A 3GNJA 4PX1A 3A3TA 3C71A 5DVBA 2C0DA 1TRSA 3HZ4A 1TW9A 3WT2A 1K0DA 3ZVJA 3P7XA 3GL5A 2I4AA 3DD3A 3GA4A 2CAQA 2YNXA 4PTSA 2HXKA 1K0OA 5F0GA 4I2UA 3CSJA 1SKWB 2YJ7A 3C8EA 3GHAA 1GUKA 3A2WA 5A4WA 5EPFA 4MP4A 4D73B 1YZXA 2E7PA 2GSRA 4AGSA 3J7Yb 5D9TA 3ZRDA 3P8WA 1XOBA 4F82A 3M9KA 2EIQA 3HY2A 1M99A 1IYIA 5DCHA 2V6KA 3TOUA 3HVVA 2P5RA 1THOA 4IN0A 1BG5A 2K9FA 2IMKA 4WETA 3EINA 2HSHA 1Q98A 3GFKA 2FHEA 2IWTA 3IK9A 1NSWA 4Z2UA 1SL2B 2VO4A 2CZ2A 2PVOC 2OA7A 5GSTA 2H6YA 2ALBA 5JCUA 5LCZA 1OYJA 2LJAA 1THXA 2H8LA 4EXJA 2WULA 1XWBA 2GZYA 3A2VA 3TCOA 5CAXA 3QOUA 1RW1A 5J4UA 2CAIA 5CO3A 5EY6A 1K0AA 2HSMA 2NTOA 3US3A 1EZKA 3HDCA 4DSSA 3W8JA 5IIZA 2K6VA 2MBSA 3ZZXA 1TRWA 2R0CA 4XTSA 4NV5A 2B7JA 4HQZA 1A23A 3LW9A 5AIXA 3VLNA 3UOMA 3CTFA 4KCEA 3A5IA 3BD2A 2OACA 4WXTA 2ES7A 3UBKA 1YJ6A 3TOTA 2CA8A 4V2LA 2M72A 5CREA 1OC8A 4K0NA 1TDIA 1ZZYA 5HQPA 2HRKA 3DWVA 1ERVA 4XHMA 2O87A 3KXOA 2C1YA 1EEJA 9GSSA 5G30A 4WR5A 3QFAC 1FAAA 1Y6EA 4TW5A 1OVNA 1W4VA 1EV9A 4IELA 4XRDA 4LL4B 2WCIA 2H75A 3DGQA 2CQ9A 4PQIA 2ON5A 2QA1A 2VD0A 2IJYA 2KLXA 2TIRA 5ENUA 1EWXA 3BOAA 4ZBBA 1TJDA 1M2BA 3I43A 3IE3A 3CSHA 1PKWA 3OR5A 5LNKe 2V6OA 1AAZA 2XPDA 4K7NA 3VURA 3GH6A 3PH9A 4ZB8A 4ML6A 3SWLA 1QQ2A 4HQSA 5EL8A 4HJ2A 3PPUA 4EC0A 3L78A 1Z7RA 1AQVA 2H74A 3RDWA 3DKSA 1ZCPA 1GLQA 4EIQA 4FYCA 1LJRA 2HFDA 5ECSA 2K8VA 5ECPB 1QFNA 3A2XA 2YWNA 1TKDB 4RQRA 2LSTA 4OCEA 2E2MA 3ZMLA 2O7KA 1USBA 2HZEB 5ID2A 4DSQA 3UL3A 3EC3A 4WBRD 2WS2A 2HI7A 3FMWA 3QD9A 2V41A 2B6MA 4NPBA 1SKRB 1NHOA 2H71A 2VOCA 3GKXA 4F2IA 1V2AA 3W6GA 1U87A 3EE2A 2FY6A 2OADA 1F3AA 3FKFA 2J9HA 3BBYA 3TGZA 4MMMA 2LUSA 4IQAA 5AIVA 2YWMA 1W89A 1ABAA 4F9ZA 2LNTA 1Z9HA 2PBJA 4WBJA 3NZNA 3ME8A 4YKGA 4IJ3A 1GNWA 1WOUA 3EYTA 3ZVJD 3KIJA 4Q5NA 4HZ4A 2H0IA 2G0FA 1HD2A 3GX0A 3FYGA 3LGCA 1U3AA 1HQOA 4GXZA 2I1UA 3M1GA 3F4SA 1TRUA 1VRSD 5JCGA 2I3YA 5CRGA 2VIMA 4FYUA 1JLWA 1CQHA 2ZCTA 3VWVA 3ZREA 5GAND 1XOAA 2OE0A 2H73A 3L9SA 4AF2A 3KD0A 1WE0A 1XCCA 1OC9B 2VL2A 3EMPA 3ZITA 2OBKA 2VCWA 3WGXA 2NDOA 1FOVA 4G0IA 2QSIA 3BCKA 1MDJA 1G6WA 4X0XA 2X8HA 1OC3A 5G31A 1K0CA 4GSNA 3D4TA 2HRAA 4ECJA 2FWFA 1AW9A 4I8BA 3DRNA 2L5OA 3FW2A 1UN2A 4ILFA 2YJHA 2YZHA 1VF4A 3ZFLA 4LL1B 1URMA 2EIOA 4K7IA 3H4KA 4XS4B 4MF5A 2MMNA 3TJKA 1K3YA 5DAKB 4BVYB 1S3CA 5D9XA 1QMVA 2B1LA 3KTLA 3LSZA 4MCUA 3QAWA 5B7CA 4MNNA 6GSWA 2DJ1A 5F07A 3G7JA 1GP1A 2A2PA 2V32A 5IMVA 5DJMA 3TB2A 1CQGA 4PNFA 2WFCA 2AAWA 2VCQA 2CX4A 4KNDA 1ZMAA 2GT5A 5D96A 5IPGA 3QAVA 3LFLA 4Z2RA 2DKHA 3TKSA 1X9WB 3IR4A 4BA7A 2VL3A 4MZCA 2LQQA 5C00A 1DSBA 3P90A 3S9FA 2L6DA 2A4HA 2PGTA 3TJJA 1SD9A 2YWIA 3GKNA 4BVXA 4J56E 2H0HA 3GV1A 4EKZA 1SU9A 4K2DA 4OO4A 2R0GA 4IVFA 3HA9A 3ZIVA 5KEJA 2G2QA 2IN3A 5IQYA 5KN3A 1U88A 3APQA 4QL7A 1LU4A 4DVCA 5INYA 2R5GA 1TTZA 4OWYA 2XC2A 3AY8A 6GSSA 18GSA 3IC4A 4I2TA 3KH7A 4TN8A 1PKZA 5DDLA 12GSA 1F6MC 2H1AA 3VI5A 1TK5B 2L4CA 4XCSA 2PU9C 4YAVA 4O92A 1Z6MA 4ISDA 4MLYA 4Q5RA 4TR1A 2H19A 5A5KA 2GVPA 1MD4A 4ID0A 2GSSA 4Q5QA 2LV3A 2FNOA 2VL9A 3F6FA 2C0GA 1O85A 2P0GA 3WGEA 4NXIA 1WIKA 3F4RA 3KCMA 1ZYEA 2GGTA 3ERFA 4PQHA 1HYUA 2DJ0A 3HCZA 5FT3A 1UC7A 3GKKA 4ZL9A 1X5EA 3FR9A 2YV9A 2LJKA 2R3XA 3ZFBA 1SL1B 4ZBAA 2VAFA 3GRXA 5ID2B 3DYRA 2PUKC 1GWCA 1XWCA 2VD1A 3KZQA 2L5LA 2YANA 2IFQA 3UAPA 13GSA 2A2RA 4I6XA 2F8FA 1NM3A 1G0TA 5ECLB 4HOJA 1T8EB 1YY7A 1ZGNA 2CT6A 5IPHA 2LNSA 2H1GA 5IMDA 2C0EA 1VF1A 1UVZA 1PA3A 2AYTA 3IXRA 4PURA 4XS1A 3FR3A 4USSA 1JZWA 2XBQA 5G2ZA 5HR0A 3GX8A 2OBIA 2OKAA 1ERTA 2RUEA 2H6ZA 4E8EA 1PL2A 3PR8A 2B5EA 5F8BA 1AQWA 1VGLA 2FA8A 4F0BA 2NVLA 4RI7A 4F03A 4ECIA 1WMJA 1FG4A 3FZ5A 1F37A 5CRWA 2AB6A 5C04A 3GH9A 1B9YC 1DUGA 1K0BA 5HFGA 2PWJA 1GSDA 1YEPA 1TU8A 3RHBA 3U6VA 5D9WA 1Z7PA 1EGRA 2YZUA 1OAZA 4G0LA 1EV4A 1LBKA 3TKQA 1J0FA 5ELGA 1GSQA 4KUNA 2A2SA 1ZYPA 2HSYA 5F06A 4ZL7A 4TVEA 5ECIB 4TOPA 3RBTA 5G5FA 5HR1A 1GSYA 3PGTA 2UZ8A 2IMDA 4OFTA 1XIYA 4OFMA 2E2GA 3QAGA 5JCWA 2REMA 4IKHA 5D9VA 1WP0A 3ZYWA 2GQLA 2TRCP 5CYYA 1G7EA 4WF5A 3TKPA 4KGIA 5H5RA 2JU5A 2WGRA 4WR4A 1IYHA 4V2MA 3IOSA 2JSYA 3TRXA 3CYNA 1YEXA 2MMAA 4K1FA 2AJQB 3R3EA 1O73A 1R7HA 2JACA 1MEKA 1FVJA 2C3NA 4EUYA 3F0IA 4J57E 4KA0A 3QMXA 3E3EA 2H76A 2X49A 3E9JB 3EPTA 2XHFA 4LMWA 1TP9A 2GLRA 2VLTA 3M0FA 4DEJA 4MJCA 1M0UA 4HUAA 3Q74A 4IGJA 3FY7A 4V1Ag 2GZZA 3KMOA 2RM5A 4XIHA 4YQMA 3FRCA 1ML6A 1SK1A 3O6TA 5JWRB 2R2JA 3IBHA 4KX4A 3TDGA 4IP1A 4HI7A 3F8UA 2VLUA 2I9HA 4AJ6A 3HJOA 1GL8A 2KP1A 4ZIJA 4NMUA 4IBPA 2L6CA 1BEDA 4ML1A 1MDKA 3D21A 2L57A 4JU5A 1GSEA 1YQ1A 3IRAA 4HJMA 4GSTA 3UBLA 4O7HA 3KH9A 4QL9A 4K8MA 5E59A 3UMAA 4POMA 2R4VA 2FCHA 1N8JA 3G7IA 3MYDA 2CZ3A 1T1VA 3TKRA 1XWGA 1SYXA 4PUAA 2FGXA 1I5GA 3IV4A 2LRNA 3DIEA 3U5RE 5KOXA 4WF4A 3V1WA 1M2AA 1JLVA 4CHSA 1EOGA 3MWHA 3LXZA 2FLSA 1QUWA 2YCDA 4WKWA 5ECKB 2IPAA 4RQXA 3PINA 2VUPA 1MTCA 1K0MA 1B9XC 22GSA 4N10A 4I97A 3HKRA 2VM2A 3QPMA 1JZOA 4EF0A 2MBTA 2XBIA 3HVSA 17GSA 2GSTA 1V58A 3LORA 4JBBA 4JRRA 3DVWA 2J23A 5HR2A 5H5SA 1PN9A 4BWQA 1AQXA 2WDUA 1EP7A 2CVKA 1PN0A 2V1MA 3BJ5A 3VWXA 4F0CA 5IOXA 5IMCA 5GSSA 1T4YA 4EO3A 3LQ7A 1DE1A 4POLA 1Q4JA 2C3QA 3CRUA 4HZ2A 3WGDA 2LJRA 4WEYA 1ZYNA 1BYEA 4D73A 1FVKA 5IOWA 1ERWA 4RUVA 4POKA 4TR4A 1OKDA 1J08A 3CRTA 1WJKA 4XS6A 1UA5A 3EURA 3A5WA 1E6BA 3VI7A 5IO2A 3I6AA 2YWOA 4JE1A 2LRCA 4X4JA 5CNWA 3O76A 3D4MA 4OMVA 2DLXA 6GSXA 2R0PA 1A0FA 4KAEA 3UIWA 5CRDA 3G9BA 4GLTA 2JZTA 4G2EA 3EWLA 1NW2A 5IMAA 4ZXGA 2CV4A 2NBSA 3RPPA 2PPTA 3I69A 6GSYA 1SK0A 3IDVA 3N5OA 4K0GA 3D0ZA 1TI1A 1OKTA 5CP1A 1OE7A 1OE8A 1X9MB 2IMFA 2HRNA 5ECMB 11GSA 4IS0A 4CDOA 4P3YB 3FZ9A 4GCIA 2I81A 2X64A 1J9BA 4ZL8A 4K6XA 4POBA 3F63A 1PL1A 2ZNMA 4V2NA 2YOIA 3IC8A 4MPGA 2VCVA 4DSSB 2GT6A 2VL2C 3CTGA 3L9UA 1ST9A 3GL3A 2GQMA 4MK3A 4MABA 2WZ9A 1FO5A 3GSSA 4N30A 1FOHA 2ON7A 2KUCA 4O5QA 3GN3A 2C3TA 2DJ2A 4IJIA 1M9BA 5EVOA 2GTUA 2YN1A 5AGYA 1G6YA 4KB3A 2B1KA 3UVHA 3IHGA 16GSA 1XPVA 2IIYA 3TJGA 3I9V2 4HDEA 4K5RA 4L5LA 2C0FA 4Q5FA 3ZTLA 4YH2A 3GMFA 3GKMA 4AJ7A 5J5NA 4Z2TA 1K3OA 1FHEA 2KOKA 4BL7A 5G1KA 2JZRA 5COHA 1SJZA 4ULXA 1FB0A 4EIPA 2O85A 1B48A 4MZWA 3L4NA 4L0WA 1XW5A 2EIRA 2K18A 2JADA 1SD8A 3QCPA 1XWKA 3IPZA 2DC5A 4HS1A 3TUEA 1GTBA 4MJAA 3D5JA 5J3RA 3UEMA 1SENA 1M9AA 4IP6A 3TKSC 3APSA 1HNAA 2LS5A 2H1DA 5GZZB 7GSSA 1M2DA 5FHIA 2B7KA 4KDYA 1VF2A 1SYRA 1T3BA 1VF3A 4JR6A 2N5AA 2IL3A 4KH7A 5BMUA 2H0GA 2BTOT 2DKIA 4N11A 2CX3A 2IMEA 1B4QA 1T4ZA 4AJ8A 3C1RA 1A8LA 4V1Ap 2X4AA 4TXOA 3IK7A 2AUVA 2JSZA 3VPTA 3N9JA 1ZOFA 2QGVA 2C4JA 6GSUA 1GSSA 4KDXA 1KTEA 4GQFA 4DSRA 3TRQA 1ERUA 2DMMA 1Z6NA 3UJ1A 3VK9A 1ILOA 1TOFA 2MYGA 3H93A 3TRPA 2MZCA 3RAZA 4NV2A 3WT1A 2PN8A 2VCZA 4XRAA 3RPNA 3LWAA 2N5FA 5DALA 4KSMA 3QR6A 1JZRA 4PUFC 3VWUA 2X8CA 2NPBA 2E0QA 3JCML 3GIXA 4GWRA 1A24A 1HNCA 4LLRA 3H79A 1EEMA 1TXXA 5G5EA 4QQ7A 1ACVA 2VM1A 2FD3A 4CY6A 1SJIA 1AIUA 4K5SA 1XW9A 2LEGA 1TK0B 1X5CA 3K8NA 4J2FA 2QC7A 2DJKA 5JWQB 2YP6A 4ECCA 3Q6OA 3J7Yk 2AV4A 4K7OA 1H4OA 3RHCA 3VFIA 3LEFA 5F05A 1RQMA 2VCXA 5H5QA 1OC9A 3BCIA 5ABRA 1SJ6A 1GTIA 2D2ZA 1TRVA 3E0UA 4H86A 4MPFA 5IMZA 1U6TA 3M9JA 2PVQA 1O8WA 1XFLA 5DBQA 6GSTA 3Q19A 1ON4A 5G1LA 3DXBA 3FHKA 10GSA 1JHBA 1FB6A 1GLPA 1QXHA 2X99A 4Z7XA 1S3AA 4TXVA 3HVXA 5ELAA 2FWEA 2H72A 2HRFA 4OFNA 4LA1A 3F3RA 1PRXA 3GSTA 2P31A 2A4VA 1BAYA 2B5XA 4IW9A 1PMTA 1K3LA 4XS4A 3ERGA 1A8YA 3G7YA 3LJRA 5DCGA 5DAKA 1V57A 4BVYA 2YPMA 5A4VA 3FZ4A 5KOWA 2DJ3A 1X9SB 1GNEA 5KN2A 1TI3A 5DJLA 1BJXA 1QGVA 2H30A 3CMIA 3M8NA 5D93A 4OCFA 3EU3A 3GURA 2GDRA 4GTUA 4G19A 1O7UA 5BRTA 4FIWA 2TRXA 2DBCA 4ICYA 5IO0A 2ZUPA 3KTBA 3DEXA 3MIXA 3MNGA 2KHPA 3HYPA 4GF0A 4HU9A 1XVQA 3GYKA 2QKEA 4I5QA 2H70A 4G10A 4MH2A 2RM6A 3WD6A 1SL0B 3L9VA 4CY8A 3EVIA 3L0HA 2Z9SA 3F4TA 3IAS2 4BVXB 3DVXA 1QK8A 5D8IA 1V98A 1YF1A 1B8XA 4KDUA 4K2XA 4YKFA 4ZB9A 4BL7B 2KP2A 4L8EA 1KBNA 3KM6A 1KNGA 5B8BA 1Z3EA 2O89A 3UARA 1E2YA 2DMLA 4PGTA 3LYPA 2L59A 4FQUA 2JZSA 2MMZA 1F9MA 4E8HA 3M3MA 20GSA 5HFIA 1FW1A 3C1SA 4KW6A 3HZ8A 1XW6A 3ZL5A 4MH3A 4EE0A 1V9WA 1A2LA 2H1BA 3NOFA 1DBYA 4TR1B 5J41A 1U3IA 2LKUA 1PX7A 5IMFA 1JFUA 1GUMA 4TRXA 1EP8A 3KP8A 4ZBDA 4NWYA 4PXOA 4JZQA 2HNLA 4X1UA 1Y25A 1XWAA 3D6IA 1AXDA 2B3SA 5ECQB 1SKSB 2L4QA 3VPQA 1HNBA 1JZDA 2CVBA 14GSA 3GTUA 4TXOB 5LD0A 1O8XA 4MJBA 4MF7A 1R26A 2O8VB 4O5UA 3DMLA 4TKYA 5IM9A 1R5AA 5AN1A 4ECBA 5JWOB 1BX9A 5ECOB 5B6NA 1YF0A 3NIVA 3EMXA 1PSQA 4EL1A 2M80A 5AISA 2OE3A 2IFQB 1N2AA 1PX6A 3FEUA 2HLSA 3F6DA 2F3MA 3Q18A 1R4WA 3TKSE 1GTUA 4L5OA 5DALB 4TR0A 1M7TA 3KGKA 2PERA 4NHZA 3WYWA 4ACSA 2XPEA 1XVWA 4A5PA 2GZPA 2H01A 1GUHA 2BJXA 2HT9A 2X8GA 5CRHA 3P2AA 1S3DA 2WB9A 4TR3A 4CW9A 1I9DA 3MSZA 3F9UA 2OJLA 3D22A 2LRTA 4IQ1A 1T00A 3TJBA 1GULA 3F3QA 2DJJA 1YDKA 1GSFA 4KF9A 2FWGA 8GSSA 4HU7A 4ZB6A 3QDNA 4LMVA 2HZFA 4FH8A 3C73A 3CXGA 1F2EA 19GSA 3FK8A 1GTAA 3IHQA 3KMNA 3ZIJA 2M46A 5DQYA 4K9ZA 4OO5A 4N0VA 2YV7A 1EGOA 1WWJA 4MZBA 4YQVA 4FO5A 6GSVA 2GS3A 1B4PA 1KEBA 1V40A 1SK2A 4KCAA 4HEA2 2K8SA 5GAPD 4MF6A 1ZYQB 5KN1A 2JL4A 4YAPA 4MA9A 5D73A 2IMIA 2RUFA 1F3BA 2LQOA 1O6JA 1XXUA 1YKAA 4EDYA 4EDZA 5FWGA 5ECRB 2WRTA 4JR4A 2P5QA 3UVTA 1AUCA 2RIIA 1A0RP 4EVMA 2F8AA 2H66A 4N0ZA 4G0KA 1O81A 2CVDA 1TK8B 2MMOA 2H6XA 1GRXA 2DIYA 2F51A 3IA1A 4IHUA 1YKCA 2WJUA 1PD21 2LTKA 3ZMKA 3KJYA 4PQ1A 2N5BA 1PQNA 2VCTA 3IAM2 4BWSA 4OD7A 3H8QA 2GSQA 2AHEA 1A2MA 3HHVA 3ERWA 3KEBA 1EOHA 2R6KA 4X43A 1DE2A 3FR6A 2FA4A 2VLVA 1XBSA 3O3TA 2HE3A 5ECNB 5A4UA 3HD5A 2QA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EC4 A;  1XZO A;  3W8S A;  2OE1 A;  3SBC A;  2PMT A;  2BMX A;  1T7P B;  3FZA A;  4PNG A;  4O5R A;  1Z5Y E;  3CBU A;  3H1N A;  4YQU A;  2C80 A;  3ZLP A;  1GSU A;  2RLI A;  1PGT A;  4GQC A;  3HJP A;  2DIZ A;  4KE3 A;  4ZIL A;  2B5Y A;  5B6M A;  1AC1 A;  2HYX A;  4FYB A;  5DQS A;  1A2J A;  4GRF A;  4JED A;  5J9B A;  3LXT A;  3VWW A;  2R37 A;  3LG6 A;  5HFK A;  5ECH B;  2V2G A;  2FUG 2;  5E4W A;  2DSA A;  1C72 A;  4G9H A;  1K0N A;  4NHW A;  1X5D A;  1GH2 A;  1ZL9 A;  4KSO A;  3R2Q A;  4RI6 A;  5B8A A;  3HJM A;  1WPI A;  3ME7 A;  5J9C A;  3LYK A;  2HZE A;  2C8U A;  5KN0 A;  3HXS A;  1MDI A;  4O32 A;  2GQK A;  2F9S A;  1G7O A;  4BPY A;  1WRY A;  4NAX A;  3ED3 A;  1MD3 A;  1NHY A;  4MDC A;  2FWH A;  3KP9 A;  4L0U A;  1X0R A;  3APO A;  3GTU B;  3EU4 A;  1R5P A;  1BQ7 A;  3MDK A;  1H75 A;  1RK4 A;  3C7M A;  3CSI A;  5L71 A;  3QFB C;  3TJF A;  4GSS A;  4MJE A;  5HR3 A;  3MAK A;  3ISO A;  3GUS A;  1TU7 A;  3GNJ A;  4PX1 A;  3A3T A;  3C71 A;  5DVB A;  2C0D A;  1TRS A;  3HZ4 A;  1TW9 A;  3WT2 A;  1K0D A;  3ZVJ A;  3P7X A;  3GL5 A;  2I4A A;  3DD3 A;  3GA4 A;  2CAQ A;  2YNX A;  2HXK A;  1K0O A;  5F0G A;  4I2U A;  3CSJ A;  1SKW B;  2YJ7 A;  3C8E A;  3GHA A;  1GUK A;  3A2W A;  5A4W A;  5EPF A;  4MP4 A;  4D73 B;  1YZX A;  2E7P A;  2GSR A;  4AGS A;  3J7Y b;  5D9T A;  3ZRD A;  3P8W A;  1XOB A;  4F82 A;  3M9K A;  2EIQ A;  3HY2 A;  1M99 A;  1IYI A;  5DCH A;  2V6K A;  3TOU A;  3HVV A;  2P5R A;  1THO A;  4IN0 A;  1BG5 A;  2K9F A;  2IMK A;  4WET A;  3EIN A;  2HSH A;  1Q98 A;  3GFK A;  2FHE A;  2IWT A;  3IK9 A;  1NSW A;  1SL2 B;  2VO4 A;  2CZ2 A;  2PVO C;  2OA7 A;  5GST A;  2H6Y A;  2ALB A;  5JCU A;  5LCZ A;  1OYJ A;  2LJA A;  1THX A;  2H8L A;  4EXJ A;  2WUL A;  1XWB A;  2GZY A;  3A2V A;  3TCO A;  5CAX A;  3QOU A;  1RW1 A;  5J4U A;  2CAI A;  5CO3 A;  5EY6 A;  1K0A A;  2NTO A;  3US3 A;  1EZK A;  3HDC A;  4DSS A;  3W8J A;  5IIZ A;  2K6V A;  2MBS A;  3ZZX A;  1TRW A;  4XTS A;  4NV5 A;  2B7J A;  4HQZ A;  1A23 A;  5AIX A;  3VLN A;  3UOM A;  3CTF A;  4KCE A;  3BD2 A;  2OAC A;  4WXT A;  2ES7 A;  3UBK A;  1YJ6 A;  3TOT A;  2CA8 A;  4V2L A;  2M72 A;  5CRE A;  1OC8 A;  4K0N A;  1TDI A;  1ZZY A;  5HQP A;  3DWV A;  1ERV A;  4XHM A;  2O87 A;  3KXO A;  2C1Y A;  1EEJ A;  9GSS A;  5G30 A;  4WR5 A;  3QFA C;  1FAA A;  1Y6E A;  4TW5 A;  1OVN A;  1W4V A;  1EV9 A;  4IEL A;  4XRD A;  4LL4 B;  2WCI A;  2H75 A;  3DGQ A;  2CQ9 A;  4PQI A;  2ON5 A;  2VD0 A;  2IJY A;  2KLX A;  2TIR A;  5ENU A;  1EWX A;  3BOA A;  4ZBB A;  1TJD A;  1M2B A;  3I43 A;  3IE3 A;  3CSH A;  1PKW A;  3OR5 A;  5LNK e;  2V6O A;  1AAZ A;  2XPD A;  4K7N A;  3VUR A;  3GH6 A;  3PH9 A;  4ZB8 A;  4ML6 A;  3SWL A;  1QQ2 A;  4HQS A;  5EL8 A;  4HJ2 A;  4EC0 A;  3L78 A;  1Z7R A;  1AQV A;  2H74 A;  3RDW A;  3DKS A;  1ZCP A;  1GLQ A;  4FYC A;  1LJR A;  2HFD A;  5ECS A;  2K8V A;  5ECP B;  1QFN A;  3A2X A;  2YWN A;  1TKD B;  4RQR A;  2LST A;  4OCE A;  2E2M A;  3ZML A;  2O7K A;  1USB A;  2HZE B;  5ID2 A;  4DSQ A;  3UL3 A;  3EC3 A;  4WBR D;  2WS2 A;  2HI7 A;  3QD9 A;  2V41 A;  2B6M A;  4NPB A;  1SKR B;  1NHO A;  2H71 A;  2VOC A;  3GKX A;  4F2I A;  1V2A A;  3W6G A;  1U87 A;  3EE2 A;  2FY6 A;  2OAD A;  1F3A A;  3FKF A;  2J9H A;  3BBY A;  3TGZ A;  4MMM A;  2LUS A;  4IQA A;  5AIV A;  2YWM A;  1W89 A;  1ABA A;  4F9Z A;  2LNT A;  1Z9H A;  2PBJ A;  4WBJ A;  3NZN A;  3ME8 A;  4IJ3 A;  1GNW A;  1WOU A;  3EYT A;  3ZVJ D;  3KIJ A;  4Q5N A;  4HZ4 A;  2H0I A;  2G0F A;  1HD2 A;  3GX0 A;  3FYG A;  3LGC A;  1U3A A;  1HQO A;  4GXZ A;  2I1U A;  3M1G A;  3F4S A;  1TRU A;  1VRS D;  5JCG A;  2I3Y A;  5CRG A;  2VIM A;  4FYU A;  1JLW A;  1CQH A;  2ZCT A;  3VWV A;  3ZRE A;  5GAN D;  1XOA A;  2OE0 A;  2H73 A;  3L9S A;  4AF2 A;  3KD0 A;  1WE0 A;  1XCC A;  1OC9 B;  2VL2 A;  3EMP A;  3ZIT A;  2OBK A;  2VCW A;  3WGX A;  2NDO A;  1FOV A;  2QSI A;  3BCK A;  1MDJ A;  1G6W A;  4X0X A;  2X8H A;  1OC3 A;  5G31 A;  1K0C A;  4GSN A;  3D4T A;  4ECJ A;  2FWF A;  1AW9 A;  4I8B A;  3DRN A;  2L5O A;  3FW2 A;  1UN2 A;  4ILF A;  2YJH A;  2YZH A;  1VF4 A;  3ZFL A;  4LL1 B;  1URM A;  2EIO A;  4K7I A;  3H4K A;  4XS4 B;  4MF5 A;  2MMN A;  3TJK A;  1K3Y A;  5DAK B;  1S3C A;  5D9X A;  1QMV A;  2B1L A;  3KTL A;  3LSZ A;  4MCU A;  3QAW A;  5B7C A;  6GSW A;  2DJ1 A;  5F07 A;  3G7J A;  1GP1 A;  5IMV A;  2V32 A;  5DJM A;  3TB2 A;  1CQG A;  4PNF A;  2WFC A;  2AAW A;  2VCQ A;  2CX4 A;  4KND A;  1ZMA A;  2GT5 A;  5D96 A;  5IPG A;  3QAV A;  3LFL A;  3TKS A;  1X9W B;  3IR4 A;  4BA7 A;  2VL3 A;  4MZC A;  2LQQ A;  5C00 A;  1DSB A;  3P90 A;  3S9F A;  2L6D A;  2PGT A;  3TJJ A;  1SD9 A;  2YWI A;  3GKN A;  4BVX A;  4J56 E;  2H0H A;  3GV1 A;  4EKZ A;  1SU9 A;  4K2D A;  4OO4 A;  4IVF A;  3HA9 A;  3ZIV A;  5KEJ A;  2G2Q A;  2IN3 A;  5IQY A;  5KN3 A;  1U88 A;  3APQ A;  4QL7 A;  1LU4 A;  4DVC A;  5INY A;  2R5G A;  1TTZ A;  4OWY A;  2XC2 A;  3AY8 A;  6GSS A;  18GS A;  3IC4 A;  4I2T A;  3KH7 A;  4TN8 A;  1PKZ A;  5DDL A;  12GS A;  1F6M C;  2H1A A;  3VI5 A;  1TK5 B;  2L4C A;  4XCS A;  2PU9 C;  4YAV A;  4O92 A;  1Z6M A;  4ISD A;  4MLY A;  4Q5R A;  4TR1 A;  2H19 A;  5A5K A;  2GVP A;  1MD4 A;  4ID0 A;  2GSS A;  4Q5Q A;  2LV3 A;  2FNO A;  2VL9 A;  3F6F A;  2C0G A;  1O85 A;  2P0G A;  3WGE A;  4NXI A;  1WIK A;  3F4R A;  3KCM A;  1ZYE A;  2GGT A;  3ERF A;  4PQH A;  1HYU A;  2DJ0 A;  3HCZ A;  5FT3 A;  1UC7 A;  3GKK A;  4ZL9 A;  1X5E A;  3FR9 A;  2YV9 A;  2LJK A;  2R3X A;  3ZFB A;  1SL1 B;  4ZBA A;  2VAF A;  3GRX A;  5ID2 B;  3DYR A;  2PUK C;  1GWC A;  1XWC A;  2VD1 A;  3KZQ A;  2L5L A;  2YAN A;  2IFQ A;  3UAP A;  13GS A;  2A2R A;  4I6X A;  2F8F A;  1NM3 A;  1G0T A;  5ECL B;  4HOJ A;  1T8E B;  1YY7 A;  1ZGN A;  2CT6 A;  5IPH A;  2LNS A;  2H1G A;  5IMD A;  2C0E A;  1VF1 A;  1UVZ A;  1PA3 A;  2AYT A;  3IXR A;  4PUR A;  4XS1 A;  3FR3 A;  1JZW A;  2XBQ A;  5G2Z A;  5HR0 A;  3GX8 A;  2OBI A;  2OKA A;  1ERT A;  2RUE A;  2H6Z A;  4E8E A;  1PL2 A;  3PR8 A;  2B5E A;  5F8B A;  1AQW A;  1VGL A;  2FA8 A;  4F0B A;  2NVL A;  4RI7 A;  4F03 A;  4ECI A;  1WMJ A;  1FG4 A;  3FZ5 A;  1F37 A;  5CRW A;  2AB6 A;  5C04 A;  3GH9 A;  1B9Y C;  1DUG A;  1K0B A;  5HFG A;  2PWJ A;  1GSD A;  1YEP A;  1TU8 A;  3RHB A;  3U6V A;  5D9W A;  1Z7P A;  1EGR A;  2YZU A;  1OAZ A;  1EV4 A;  1LBK A;  3TKQ A;  1J0F A;  5ELG A;  1GSQ A;  4KUN A;  2A2S A;  2HSY A;  5F06 A;  4ZL7 A;  4TVE A;  5ECI B;  4TOP A;  3RBT A;  5G5F A;  5HR1 A;  1GSY A;  3PGT A;  2IMD A;  4OFT A;  1XIY A;  4OFM A;  2E2G A;  3QAG A;  5JCW A;  2REM A;  4IKH A;  5D9V A;  1WP0 A;  3ZYW A;  2GQL A;  2TRC P;  5CYY A;  1G7E A;  4WF5 A;  3TKP A;  4KGI A;  5H5R A;  2JU5 A;  2WGR A;  4WR4 A;  1IYH A;  4V2M A;  3IOS A;  2JSY A;  3TRX A;  3CYN A;  1YEX A;  2MMA A;  4K1F A;  2AJQ B;  1O73 A;  1R7H A;  2JAC A;  1MEK A;  1FVJ A;  2C3N A;  4EUY A;  3F0I A;  4J57 E;  4KA0 A;  3QMX A;  3E3E A;  2H76 A;  3E9J B;  2XHF A;  4LMW A;  1TP9 A;  2GLR A;  2VLT A;  3M0F A;  4DEJ A;  4MJC A;  1M0U A;  4HUA A;  3Q74 A;  4IGJ A;  3FY7 A;  4V1A g;  2GZZ A;  3KMO A;  2RM5 A;  4XIH A;  4YQM A;  3FRC A;  1ML6 A;  1SK1 A;  3O6T A;  5JWR B;  2R2J A;  3IBH A;  4KX4 A;  3TDG A;  4IP1 A;  4HI7 A;  3F8U A;  2VLU A;  2I9H A;  4AJ6 A;  3HJO A;  1GL8 A;  2KP1 A;  4ZIJ A;  4NMU A;  4IBP A;  2L6C A;  1BED A;  4ML1 A;  1MDK A;  3D21 A;  2L57 A;  4JU5 A;  1GSE A;  1YQ1 A;  3IRA A;  4HJM A;  4GST A;  3UBL A;  4O7H A;  3KH9 A;  4QL9 A;  4K8M A;  5E59 A;  3UMA A;  4POM A;  2R4V A;  2FCH A;  1N8J A;  3G7I A;  2CZ3 A;  1T1V A;  3TKR A;  1XWG A;  1SYX A;  4PUA A;  2FGX A;  1I5G A;  3IV4 A;  2LRN A;  3DIE A;  3U5R E;  4WF4 A;  3V1W A;  1M2A A;  1JLV A;  4CHS A;  1EOG A;  3MWH A;  3LXZ A;  2FLS A;  1QUW A;  2YCD A;  4WKW A;  5ECK B;  2IPA A;  4RQX A;  3PIN A;  2VUP A;  1MTC A;  1K0M A;  1B9X C;  22GS A;  4N10 A;  4I97 A;  3HKR A;  2VM2 A;  3QPM A;  1JZO A;  4EF0 A;  2MBT A;  2XBI A;  3HVS A;  17GS A;  2GST A;  1V58 A;  3LOR A;  4JBB A;  4JRR A;  3DVW A;  2J23 A;  5HR2 A;  5H5S A;  1PN9 A;  4BWQ A;  1AQX A;  2WDU A;  1EP7 A;  2CVK A;  2V1M A;  3BJ5 A;  3VWX A;  4F0C A;  5IOX A;  5IMC A;  5GSS A;  1T4Y A;  4EO3 A;  3LQ7 A;  1DE1 A;  4POL A;  1Q4J A;  2C3Q A;  3CRU A;  4HZ2 A;  3WGD A;  2LJR A;  4WEY A;  1BYE A;  4D73 A;  1FVK A;  5IOW A;  1ERW A;  4RUV A;  4POK A;  4TR4 A;  1OKD A;  1J08 A;  3CRT A;  1WJK A;  4XS6 A;  1UA5 A;  3EUR A;  3A5W A;  1E6B A;  3VI7 A;  5IO2 A;  3I6A A;  2YWO A;  4JE1 A;  2LRC A;  5CNW A;  3O76 A;  3D4M A;  4OMV A;  2DLX A;  6GSX A;  1A0F A;  4KAE A;  3UIW A;  5CRD A;  3G9B A;  4GLT A;  2JZT A;  4G2E A;  3EWL A;  1NW2 A;  5IMA A;  4ZXG A;  2CV4 A;  2NBS A;  3RPP A;  2PPT A;  3I69 A;  6GSY A;  1SK0 A;  3IDV A;  3N5O A;  4K0G A;  3D0Z A;  1TI1 A;  1OKT A;  5CP1 A;  1OE7 A;  1OE8 A;  1X9M B;  2IMF A;  2HRN A;  5ECM B;  11GS A;  4IS0 A;  4CDO A;  4P3Y B;  3FZ9 A;  4GCI A;  2I81 A;  2X64 A;  1J9B A;  4ZL8 A;  4K6X A;  4POB A;  3F63 A;  1PL1 A;  2ZNM A;  4V2N A;  2YOI A;  4MPG A;  2VCV A;  4DSS B;  2GT6 A;  2VL2 C;  3CTG A;  3L9U A;  1ST9 A;  3GL3 A;  2GQM A;  4MK3 A;  4MAB A;  2WZ9 A;  1FO5 A;  3GSS A;  4N30 A;  2ON7 A;  2KUC A;  3GN3 A;  2C3T A;  2DJ2 A;  4IJI A;  1M9B A;  5EVO A;  2GTU A;  2YN1 A;  5AGY A;  1G6Y A;  4KB3 A;  2B1K A;  3UVH A;  16GS A;  1XPV A;  2IIY A;  3TJG A;  3I9V 2;  4HDE A;  4L5L A;  2C0F A;  4Q5F A;  3ZTL A;  4YH2 A;  3GMF A;  3GKM A;  4AJ7 A;  5J5N A;  1K3O A;  1FHE A;  2KOK A;  4BL7 A;  5G1K A;  2JZR A;  5COH A;  1SJZ A;  4ULX A;  1FB0 A;  2O85 A;  1B48 A;  4MZW A;  3L4N A;  4L0W A;  1XW5 A;  2EIR A;  2K18 A;  2JAD A;  1SD8 A;  3QCP A;  1XWK A;  3IPZ A;  2DC5 A;  4HS1 A;  3TUE A;  1GTB A;  4MJA A;  3D5J A;  5J3R A;  3UEM A;  1SEN A;  1M9A A;  4IP6 A;  3TKS C;  3APS A;  1HNA A;  2LS5 A;  2H1D A;  5GZZ B;  7GSS A;  1M2D A;  5FHI A;  2B7K A;  4KDY A;  1VF2 A;  1SYR A;  1T3B A;  1VF3 A;  4JR6 A;  2N5A A;  2IL3 A;  4KH7 A;  2H0G A;  2BTO T;  4N11 A;  2CX3 A;  2IME A;  1B4Q A;  1T4Z A;  4AJ8 A;  3C1R A;  1A8L A;  4V1A p;  4TXO A;  3IK7 A;  2AUV A;  2JSZ A;  3VPT A;  3N9J A;  1ZOF A;  2QGV A;  2C4J A;  6GSU A;  1GSS A;  4KDX A;  1KTE A;  4GQF A;  4DSR A;  3TRQ A;  1ERU A;  2DMM A;  1Z6N A;  3UJ1 A;  3VK9 A;  1ILO A;  1TOF A;  2MYG A;  3H93 A;  3TRP A;  2MZC A;  3RAZ A;  4NV2 A;  3WT1 A;  2PN8 A;  2VCZ A;  4XRA A;  3RPN A;  3LWA A;  2N5F A;  5DAL A;  4KSM A;  3QR6 A;  1JZR A;  4PUF C;  3VWU A;  2X8C A;  2NPB A;  2E0Q A;  3JCM L;  3GIX A;  4GWR A;  1A24 A;  1HNC A;  4LLR A;  3H79 A;  1EEM A;  1TXX A;  5G5E A;  4QQ7 A;  1ACV A;  2VM1 A;  2FD3 A;  1SJI A;  1AIU A;  1XW9 A;  2LEG A;  1TK0 B;  1X5C A;  3K8N A;  4J2F A;  2QC7 A;  2DJK A;  5JWQ B;  2YP6 A;  4ECC A;  3Q6O A;  3J7Y k;  2AV4 A;  4K7O A;  1H4O A;  3RHC A;  3VFI A;  3LEF A;  5F05 A;  1RQM A;  2VCX A;  5H5Q A;  1OC9 A;  3BCI A;  5ABR A;  1SJ6 A;  1GTI A;  2D2Z A;  1TRV A;  3E0U A;  4H86 A;  4MPF A;  5IMZ A;  1U6T A;  3M9J A;  2PVQ A;  1O8W A;  1XFL A;  5DBQ A;  6GST A;  3Q19 A;  1ON4 A;  5G1L A;  3DXB A;  3FHK A;  10GS A;  1JHB A;  1FB6 A;  1GLP A;  1QXH A;  2X99 A;  4Z7X A;  1S3A A;  4TXV A;  3HVX A;  5ELA A;  2FWE A;  2H72 A;  2HRF A;  4OFN A;  4LA1 A;  3F3R A;  1PRX A;  3GST A;  2P31 A;  2A4V A;  1BAY A;  2B5X A;  4IW9 A;  1PMT A;  1K3L A;  4XS4 A;  3ERG A;  1A8Y A;  3G7Y A;  3LJR A;  5DCG A;  5DAK A;  1V57 A;  4BVY A;  2YPM A;  5A4V A;  3FZ4 A;  2DJ3 A;  1X9S B;  1GNE A;  5KN2 A;  1TI3 A;  5DJL A;  1BJX A;  1QGV A;  2H30 A;  3CMI A;  3M8N A;  5D93 A;  4OCF A;  3EU3 A;  3GUR A;  2GDR A;  4GTU A;  4G19 A;  1O7U A;  4FIW A;  2TRX A;  2DBC A;  5IO0 A;  2ZUP A;  3KTB A;  3DEX A;  3MNG A;  2KHP A;  3HYP A;  4GF0 A;  4HU9 A;  1XVQ A;  3GYK A;  2QKE A;  4I5Q A;  2H70 A;  4G10 A;  4MH2 A;  2RM6 A;  3WD6 A;  1SL0 B;  3L9V A;  3EVI A;  3L0H A;  2Z9S A;  3F4T A;  3IAS 2;  3DVX A;  1QK8 A;  5D8I A;  1V98 A;  1YF1 A;  1B8X A;  4KDU A;  4ZB9 A;  2KP2 A;  4L8E A;  1KBN A;  3KM6 A;  1KNG A;  5B8B A;  1Z3E A;  2O89 A;  3UAR A;  1E2Y A;  2DML A;  4PGT A;  3LYP A;  2L59 A;  2JZS A;  2MMZ A;  1F9M A;  4E8H A;  3M3M A;  20GS A;  5HFI A;  1FW1 A;  3C1S A;  4KW6 A;  3HZ8 A;  1XW6 A;  3ZL5 A;  4MH3 A;  4EE0 A;  1V9W A;  1A2L A;  2H1B A;  3NOF A;  1DBY A;  4TR1 B;  5J41 A;  1U3I A;  2LKU A;  1PX7 A;  5IMF A;  1JFU A;  1GUM A;  4TRX A;  1EP8 A;  3KP8 A;  4ZBD A;  4NWY A;  4PXO A;  4JZQ A;  2HNL A;  4X1U A;  1Y25 A;  1XWA A;  3D6I A;  1AXD A;  2B3S A;  5ECQ B;  1SKS B;  2L4Q A;  3VPQ A;  1HNB A;  1JZD A;  2CVB A;  14GS A;  3GTU A;  4TXO B;  5LD0 A;  1O8X A;  4MJB A;  4MF7 A;  1R26 A;  2O8V B;  3DML A;  4TKY A;  5IM9 A;  1R5A A;  5AN1 A;  4ECB A;  5JWO B;  1BX9 A;  5ECO B;  5B6N A;  1YF0 A;  3NIV A;  3EMX A;  1PSQ A;  4EL1 A;  2M80 A;  5AIS A;  2OE3 A;  2IFQ B;  1N2A A;  1PX6 A;  3FEU A;  2HLS A;  3F6D A;  2F3M A;  3Q18 A;  1R4W A;  3TKS E;  1GTU A;  4L5O A;  5DAL B;  4TR0 A;  1M7T A;  3KGK A;  2PER A;  4NHZ A;  3WYW A;  4ACS A;  2XPE A;  1XVW A;  2GZP A;  2H01 A;  1GUH A;  2BJX A;  2HT9 A;  2X8G A;  5CRH A;  3P2A A;  1S3D A;  2WB9 A;  4TR3 A;  4CW9 A;  1I9D A;  3MSZ A;  3F9U A;  2OJL A;  3D22 A;  2LRT A;  4IQ1 A;  1T00 A;  3TJB A;  1GUL A;  3F3Q A;  2DJJ A;  1YDK A;  1GSF A;  2FWG A;  8GSS A;  4HU7 A;  4ZB6 A;  3QDN A;  4LMV A;  2HZF A;  4FH8 A;  3C73 A;  3CXG A;  1F2E A;  19GS A;  3FK8 A;  1GTA A;  3IHQ A;  3KMN A;  3ZIJ A;  2M46 A;  5DQY A;  4K9Z A;  4OO5 A;  4N0V A;  2YV7 A;  1EGO A;  1WWJ A;  4MZB A;  4YQV A;  4FO5 A;  6GSV A;  2GS3 A;  1B4P A;  1KEB A;  1V40 A;  1SK2 A;  4KCA A;  4HEA 2;  2K8S A;  5GAP D;  4MF6 A;  1ZYQ B;  5KN1 A;  2JL4 A;  4YAP A;  4MA9 A;  5D73 A;  2IMI A;  2RUF A;  1F3B A;  2LQO A;  1O6J A;  1XXU A;  1YKA A;  4EDY A;  4EDZ A;  5FWG A;  5ECR B;  2WRT A;  4JR4 A;  2P5Q A;  3UVT A;  1AUC A;  2RII A;  1A0R P;  4EVM A;  2F8A A;  2H66 A;  4N0Z A;  1O81 A;  2CVD A;  1TK8 B;  2MMO A;  2H6X A;  1GRX A;  2DIY A;  2F51 A;  3IA1 A;  4IHU A;  1YKC A;  2WJU A;  1PD2 1;  2LTK A;  3ZMK A;  3KJY A;  4PQ1 A;  2N5B A;  1PQN A;  2VCT A;  3IAM 2;  4BWS A;  4OD7 A;  3H8Q A;  2GSQ A;  2AHE A;  1A2M A;  3HHV A;  3ERW A;  3KEB A;  1EOH A;  2R6K A;  4X43 A;  1DE2 A;  3FR6 A;  2FA4 A;  2VLV A;  1XBS A;  3O3T A;  2HE3 A;  5ECN B;  5A4U A;  3HD5 A; 
#chains in the Genus database with same CATH topology
 2EC4 A;  1XZO A;  3W8S A;  2OE1 A;  3SBC A;  2PMT A;  2BMX A;  1T7P B;  3FZA A;  4PNG A;  4O5R A;  1Z5Y E;  3CBU A;  3H1N A;  4YQU A;  2C80 A;  3ZLP A;  1GSU A;  2RLI A;  1PGT A;  4GQC A;  3HJP A;  2DIZ A;  4KE3 A;  4ZIL A;  2B5Y A;  5B6M A;  1AC1 A;  2HYX A;  4FYB A;  5DQS A;  1A2J A;  4GRF A;  4JED A;  5J9B A;  3LXT A;  3VWW A;  2R37 A;  3LG6 A;  5HFK A;  5ECH B;  2V2G A;  2FUG 2;  5E4W A;  2DSA A;  1C72 A;  4G9H A;  1K0N A;  4NHW A;  1X5D A;  1GH2 A;  1ZL9 A;  4KSO A;  3R2Q A;  4RI6 A;  5B8A A;  3HJM A;  1WPI A;  3ME7 A;  5J9C A;  3LYK A;  2HZE A;  2C8U A;  5KN0 A;  3HXS A;  1MDI A;  4O32 A;  2GQK A;  2F9S A;  1G7O A;  4BPY A;  1WRY A;  4NAX A;  3ED3 A;  1MD3 A;  1NHY A;  4MDC A;  2FWH A;  3KP9 A;  4L0U A;  1X0R A;  3APO A;  3GTU B;  3EU4 A;  1R5P A;  1BQ7 A;  3MDK A;  1H75 A;  1RK4 A;  3C7M A;  3CSI A;  5L71 A;  3QFB C;  3TJF A;  4GSS A;  4MJE A;  5HR3 A;  3MAK A;  3ISO A;  3GUS A;  1TU7 A;  3GNJ A;  4PX1 A;  3A3T A;  3C71 A;  5DVB A;  2C0D A;  1TRS A;  3HZ4 A;  1TW9 A;  3WT2 A;  1K0D A;  3ZVJ A;  3P7X A;  3GL5 A;  2I4A A;  3DD3 A;  3GA4 A;  2CAQ A;  2YNX A;  4PTS A;  2HXK A;  1K0O A;  5F0G A;  4I2U A;  3CSJ A;  1SKW B;  2YJ7 A;  3C8E A;  3GHA A;  1GUK A;  3A2W A;  5A4W A;  5EPF A;  4MP4 A;  4D73 B;  1YZX A;  2E7P A;  2GSR A;  4AGS A;  3J7Y b;  5D9T A;  3ZRD A;  3P8W A;  1XOB A;  4F82 A;  3M9K A;  2EIQ A;  3HY2 A;  1M99 A;  1IYI A;  5DCH A;  2V6K A;  3TOU A;  3HVV A;  2P5R A;  1THO A;  4IN0 A;  1BG5 A;  2K9F A;  2IMK A;  4WET A;  3EIN A;  2HSH A;  1Q98 A;  3GFK A;  2FHE A;  2IWT A;  3IK9 A;  1NSW A;  4Z2U A;  1SL2 B;  2VO4 A;  2CZ2 A;  2PVO C;  2OA7 A;  5GST A;  2H6Y A;  2ALB A;  5JCU A;  5LCZ A;  1OYJ A;  2LJA A;  1THX A;  2H8L A;  4EXJ A;  2WUL A;  1XWB A;  2GZY A;  3A2V A;  3TCO A;  5CAX A;  3QOU A;  1RW1 A;  5J4U A;  2CAI A;  5CO3 A;  5EY6 A;  1K0A A;  2HSM A;  2NTO A;  3US3 A;  1EZK A;  3HDC A;  4DSS A;  3W8J A;  5IIZ A;  2K6V A;  2MBS A;  3ZZX A;  1TRW A;  2R0C A;  4XTS A;  4NV5 A;  2B7J A;  4HQZ A;  1A23 A;  3LW9 A;  5AIX A;  3VLN A;  3UOM A;  3CTF A;  4KCE A;  3A5I A;  3BD2 A;  2OAC A;  4WXT A;  2ES7 A;  3UBK A;  1YJ6 A;  3TOT A;  2CA8 A;  4V2L A;  2M72 A;  5CRE A;  1OC8 A;  4K0N A;  1TDI A;  1ZZY A;  5HQP A;  2HRK A;  3DWV A;  1ERV A;  4XHM A;  2O87 A;  3KXO A;  2C1Y A;  1EEJ A;  9GSS A;  5G30 A;  4WR5 A;  3QFA C;  1FAA A;  1Y6E A;  4TW5 A;  1OVN A;  1W4V A;  1EV9 A;  4IEL A;  4XRD A;  4LL4 B;  2WCI A;  2H75 A;  3DGQ A;  2CQ9 A;  4PQI A;  2ON5 A;  2QA1 A;  2VD0 A;  2IJY A;  2KLX A;  2TIR A;  5ENU A;  1EWX A;  3BOA A;  4ZBB A;  1TJD A;  1M2B A;  3I43 A;  3IE3 A;  3CSH A;  1PKW A;  3OR5 A;  5LNK e;  2V6O A;  1AAZ A;  2XPD A;  4K7N A;  3VUR A;  3GH6 A;  3PH9 A;  4ZB8 A;  4ML6 A;  3SWL A;  1QQ2 A;  4HQS A;  5EL8 A;  4HJ2 A;  3PPU A;  4EC0 A;  3L78 A;  1Z7R A;  1AQV A;  2H74 A;  3RDW A;  3DKS A;  1ZCP A;  1GLQ A;  4EIQ A;  4FYC A;  1LJR A;  2HFD A;  5ECS A;  2K8V A;  5ECP B;  1QFN A;  4HSC X;  3A2X A;  2YWN A;  1TKD B;  4RQR A;  2LST A;  4OCE A;  2E2M A;  3ZML A;  2O7K A;  1USB A;  2HZE B;  5ID2 A;  4DSQ A;  3UL3 A;  3EC3 A;  4WBR D;  2WS2 A;  2HI7 A;  3FMW A;  3QD9 A;  2V41 A;  2B6M A;  4NPB A;  1SKR B;  1NHO A;  2H71 A;  2VOC A;  3GKX A;  4F2I A;  1V2A A;  3W6G A;  1U87 A;  3EE2 A;  2FY6 A;  2OAD A;  1F3A A;  3FKF A;  2J9H A;  3BBY A;  3TGZ A;  4MMM A;  2LUS A;  4IQA A;  5AIV A;  2YWM A;  1W89 A;  1ABA A;  4F9Z A;  2LNT A;  1Z9H A;  2PBJ A;  4WBJ A;  3NZN A;  3ME8 A;  4YKG A;  4IJ3 A;  1GNW A;  1WOU A;  3EYT A;  3ZVJ D;  3KIJ A;  4Q5N A;  4HZ4 A;  2H0I A;  2G0F A;  1HD2 A;  3GX0 A;  3FYG A;  3LGC A;  1U3A A;  1HQO A;  4GXZ A;  2I1U A;  3M1G A;  3F4S A;  1TRU A;  1VRS D;  5JCG A;  2I3Y A;  5CRG A;  2VIM A;  4FYU A;  1JLW A;  1CQH A;  2ZCT A;  3VWV A;  3ZRE A;  5GAN D;  1XOA A;  2OE0 A;  2H73 A;  3L9S A;  4AF2 A;  3KD0 A;  1WE0 A;  1XCC A;  1OC9 B;  2VL2 A;  3EMP A;  3ZIT A;  2OBK A;  2VCW A;  3WGX A;  2NDO A;  1FOV A;  4G0I A;  2QSI A;  3BCK A;  1MDJ A;  1G6W A;  4X0X A;  2X8H A;  1OC3 A;  5G31 A;  1K0C A;  4GSN A;  3D4T A;  2HRA A;  4ECJ A;  2FWF A;  1AW9 A;  4I8B A;  3DRN A;  2L5O A;  3FW2 A;  1UN2 A;  4ILF A;  2YJH A;  2YZH A;  1VF4 A;  3ZFL A;  4LL1 B;  1URM A;  2EIO A;  4K7I A;  3H4K A;  4XS4 B;  4MF5 A;  2MMN A;  3TJK A;  1K3Y A;  5DAK B;  4BVY B;  1S3C A;  5D9X A;  1QMV A;  2B1L A;  3KTL A;  3LSZ A;  4MCU A;  3QAW A;  5B7C A;  4MNN A;  6GSW A;  2DJ1 A;  5F07 A;  3G7J A;  1GP1 A;  2A2P A;  2V32 A;  5IMV A;  5DJM A;  3TB2 A;  1CQG A;  4PNF A;  2WFC A;  2AAW A;  2VCQ A;  2CX4 A;  4KND A;  1ZMA A;  2GT5 A;  5D96 A;  5IPG A;  3QAV A;  3LFL A;  4Z2R A;  2DKH A;  3TKS A;  1X9W B;  3IR4 A;  4BA7 A;  2VL3 A;  4MZC A;  2LQQ A;  5C00 A;  1DSB A;  3P90 A;  3S9F A;  2L6D A;  2A4H A;  2PGT A;  3TJJ A;  1SD9 A;  2YWI A;  3GKN A;  4BVX A;  4J56 E;  2H0H A;  3GV1 A;  4EKZ A;  1SU9 A;  4K2D A;  4OO4 A;  2R0G A;  4IVF A;  3HA9 A;  3ZIV A;  5KEJ A;  2G2Q A;  2IN3 A;  5IQY A;  5KN3 A;  1U88 A;  3APQ A;  4QL7 A;  1LU4 A;  4DVC A;  5INY A;  2R5G A;  1TTZ A;  4OWY A;  2XC2 A;  3AY8 A;  6GSS A;  18GS A;  3IC4 A;  4I2T A;  3KH7 A;  4TN8 A;  1PKZ A;  5DDL A;  12GS A;  1F6M C;  2H1A A;  3VI5 A;  1TK5 B;  2L4C A;  4XCS A;  2PU9 C;  4YAV A;  4O92 A;  1Z6M A;  4ISD A;  4MLY A;  4Q5R A;  4TR1 A;  2H19 A;  5A5K A;  2GVP A;  1MD4 A;  4ID0 A;  2GSS A;  4Q5Q A;  2LV3 A;  2FNO A;  2VL9 A;  3F6F A;  2C0G A;  1O85 A;  2P0G A;  3WGE A;  4NXI A;  1WIK A;  3F4R A;  3KCM A;  1ZYE A;  2GGT A;  3ERF A;  3HVN A;  4PQH A;  1HYU A;  2DJ0 A;  3HCZ A;  5FT3 A;  1UC7 A;  3GKK A;  4ZL9 A;  1X5E A;  3FR9 A;  2YV9 A;  2LJK A;  2R3X A;  3ZFB A;  1SL1 B;  4ZBA A;  2VAF A;  3GRX A;  5ID2 B;  3DYR A;  2PUK C;  1GWC A;  1XWC A;  2VD1 A;  3KZQ A;  2L5L A;  2YAN A;  2IFQ A;  3UAP A;  13GS A;  2A2R A;  4I6X A;  2F8F A;  1NM3 A;  1G0T A;  5ECL B;  4HOJ A;  1T8E B;  1YY7 A;  1ZGN A;  2CT6 A;  5IPH A;  2LNS A;  2H1G A;  5IMD A;  2C0E A;  1VF1 A;  1UVZ A;  1PA3 A;  2AYT A;  3IXR A;  4PUR A;  4XS1 A;  3FR3 A;  4USS A;  1JZW A;  2XBQ A;  5G2Z A;  5HR0 A;  3GX8 A;  2OBI A;  2OKA A;  1ERT A;  2RUE A;  2H6Z A;  4E8E A;  1PL2 A;  3PR8 A;  2B5E A;  1XG8 A;  5F8B A;  1AQW A;  1VGL A;  2FA8 A;  4F0B A;  2NVL A;  4RI7 A;  4F03 A;  4ECI A;  1WMJ A;  1FG4 A;  3FZ5 A;  1F37 A;  5CRW A;  2AB6 A;  5C04 A;  3GH9 A;  1B9Y C;  1DUG A;  1K0B A;  5HFG A;  2PWJ A;  1GSD A;  1YEP A;  1TU8 A;  3RHB A;  3U6V A;  5D9W A;  1Z7P A;  1EGR A;  2YZU A;  1OAZ A;  4G0L A;  1EV4 A;  1LBK A;  3TKQ A;  1J0F A;  5ELG A;  1GSQ A;  4KUN A;  2A2S A;  1ZYP A;  2HSY A;  5F06 A;  4ZL7 A;  4TVE A;  5ECI B;  4TOP A;  3RBT A;  5G5F A;  5HR1 A;  1GSY A;  3PGT A;  2UZ8 A;  2IMD A;  4OFT A;  1XIY A;  4OFM A;  2E2G A;  3QAG A;  5JCW A;  2REM A;  4IKH A;  5D9V A;  1WP0 A;  3ZYW A;  2GQL A;  2TRC P;  5CYY A;  1G7E A;  4WF5 A;  3TKP A;  4KGI A;  5H5R A;  2JU5 A;  2WGR A;  4WR4 A;  1IYH A;  4V2M A;  3IOS A;  2JSY A;  3TRX A;  3CYN A;  1YEX A;  2MMA A;  4K1F A;  2AJQ B;  3R3E A;  1O73 A;  1R7H A;  2JAC A;  1PFO A;  1MEK A;  1FVJ A;  2C3N A;  4EUY A;  3F0I A;  4J57 E;  4KA0 A;  3QMX A;  3E3E A;  2H76 A;  2X49 A;  3E9J B;  3EPT A;  2XHF A;  4LMW A;  1TP9 A;  2GLR A;  2VLT A;  3M0F A;  4DEJ A;  4MJC A;  1M0U A;  4HUA A;  3Q74 A;  4IGJ A;  3FY7 A;  4V1A g;  2GZZ A;  3KMO A;  2RM5 A;  4XIH A;  4YQM A;  3FRC A;  1ML6 A;  1SK1 A;  3O6T A;  5JWR B;  2R2J A;  3IBH A;  4KX4 A;  3TDG A;  4IP1 A;  4HI7 A;  3F8U A;  2VLU A;  2I9H A;  4AJ6 A;  3HJO A;  1GL8 A;  2KP1 A;  4ZIJ A;  1S3R A;  4NMU A;  4IBP A;  2L6C A;  1BED A;  4ML1 A;  1MDK A;  3D21 A;  2L57 A;  4JU5 A;  1GSE A;  1YQ1 A;  3IRA A;  4HJM A;  4GST A;  3UBL A;  4O7H A;  3KH9 A;  4QL9 A;  4K8M A;  5E59 A;  3UMA A;  4POM A;  2R4V A;  2FCH A;  1N8J A;  3G7I A;  3MYD A;  2CZ3 A;  1T1V A;  3TKR A;  4BIK A;  1XWG A;  1SYX A;  4PUA A;  2FGX A;  1I5G A;  3IV4 A;  2LRN A;  3DIE A;  3U5R E;  5KOX A;  4WF4 A;  3V1W A;  1M2A A;  1JLV A;  4CHS A;  1EOG A;  3MWH A;  3LXZ A;  2FLS A;  1QUW A;  2YCD A;  4WKW A;  5ECK B;  2IPA A;  4RQX A;  3PIN A;  2VUP A;  1MTC A;  1K0M A;  1B9X C;  22GS A;  4N10 A;  4I97 A;  3HKR A;  2VM2 A;  3QPM A;  1JZO A;  4EF0 A;  2MBT A;  2XBI A;  3HVS A;  17GS A;  2GST A;  1V58 A;  3LOR A;  4JBB A;  4JRR A;  3DVW A;  2J23 A;  5HR2 A;  5H5S A;  1PN9 A;  4BWQ A;  1AQX A;  2WDU A;  1EP7 A;  2CVK A;  1PN0 A;  2V1M A;  3BJ5 A;  3VWX A;  4F0C A;  5IOX A;  5IMC A;  5GSS A;  1T4Y A;  4EO3 A;  3LQ7 A;  1DE1 A;  4POL A;  1Q4J A;  2C3Q A;  3CRU A;  4HZ2 A;  3WGD A;  2LJR A;  4WEY A;  1ZYN A;  1BYE A;  4D73 A;  1FVK A;  5IOW A;  1ERW A;  4RUV A;  4POK A;  4TR4 A;  1OKD A;  1J08 A;  3CRT A;  1WJK A;  4XS6 A;  1UA5 A;  3EUR A;  3A5W A;  1E6B A;  3VI7 A;  5IO2 A;  3I6A A;  2YWO A;  4JE1 A;  2LRC A;  4X4J A;  5CNW A;  3O76 A;  3D4M A;  4OMV A;  2DLX A;  6GSX A;  2R0P A;  1A0F A;  4KAE A;  3UIW A;  5CRD A;  3G9B A;  4GLT A;  2JZT A;  4G2E A;  3EWL A;  1NW2 A;  5IMA A;  4ZXG A;  2CV4 A;  2NBS A;  3RPP A;  2PPT A;  3I69 A;  6GSY A;  1SK0 A;  3IDV A;  3N5O A;  4K0G A;  3D0Z A;  1TI1 A;  1OKT A;  5CP1 A;  1OE7 A;  1OE8 A;  1X9M B;  2IMF A;  2HRN A;  5ECM B;  11GS A;  4IS0 A;  4CDO A;  4P3Y B;  1M3J A;  3FZ9 A;  4GCI A;  2I81 A;  2X64 A;  1J9B A;  4ZL8 A;  4K6X A;  4POB A;  3F63 A;  1PL1 A;  2ZNM A;  4V2N A;  2YOI A;  3IC8 A;  4MPG A;  2VCV A;  4DSS B;  2GT6 A;  2VL2 C;  3CTG A;  3L9U A;  1ST9 A;  3GL3 A;  2GQM A;  4MK3 A;  4MAB A;  2WZ9 A;  1FO5 A;  3GSS A;  4N30 A;  1FOH A;  2ON7 A;  2KUC A;  4O5Q A;  3GN3 A;  2C3T A;  2DJ2 A;  4IJI A;  1M9B A;  5EVO A;  2GTU A;  2YN1 A;  5AGY A;  1G6Y A;  4KB3 A;  2B1K A;  3UVH A;  3IHG A;  16GS A;  1XPV A;  2IIY A;  3TJG A;  3I9V 2;  4HDE A;  4K5R A;  4L5L A;  2C0F A;  4Q5F A;  3ZTL A;  4YH2 A;  3GMF A;  3GKM A;  4AJ7 A;  5J5N A;  4Z2T A;  1K3O A;  1FHE A;  2KOK A;  4BL7 A;  5G1K A;  2JZR A;  5COH A;  1SJZ A;  4ULX A;  1FB0 A;  4EIP A;  2O85 A;  1B48 A;  4MZW A;  3L4N A;  4L0W A;  1XW5 A;  2EIR A;  2K18 A;  2JAD A;  1SD8 A;  3QCP A;  1XWK A;  3IPZ A;  2DC5 A;  4HS1 A;  3TUE A;  1GTB A;  4MJA A;  3D5J A;  5J3R A;  3UEM A;  1SEN A;  1M9A A;  4IP6 A;  3TKS C;  3APS A;  1HNA A;  2LS5 A;  2H1D A;  5GZZ B;  7GSS A;  1M2D A;  5FHI A;  2B7K A;  4KDY A;  1VF2 A;  1SYR A;  1T3B A;  1VF3 A;  4JR6 A;  2N5A A;  2IL3 A;  4KH7 A;  5BMU A;  2H0G A;  2BTO T;  2DKI A;  4N11 A;  2CX3 A;  2IME A;  1B4Q A;  1T4Z A;  4AJ8 A;  3C1R A;  1A8L A;  4V1A p;  2X4A A;  4TXO A;  3IK7 A;  2AUV A;  2JSZ A;  3VPT A;  3N9J A;  1ZOF A;  2QGV A;  2C4J A;  6GSU A;  1GSS A;  4KDX A;  1KTE A;  4GQF A;  4DSR A;  3TRQ A;  1ERU A;  2DMM A;  1Z6N A;  3UJ1 A;  3VK9 A;  1ILO A;  1TOF A;  2MYG A;  3H93 A;  3TRP A;  2MZC A;  3RAZ A;  4NV2 A;  3WT1 A;  2PN8 A;  2VCZ A;  4XRA A;  3RPN A;  3LWA A;  2N5F A;  5DAL A;  4KSM A;  3QR6 A;  1JZR A;  4PUF C;  3VWU A;  2X8C A;  2NPB A;  2E0Q A;  3JCM L;  3GIX A;  4GWR A;  1A24 A;  1HNC A;  4LLR A;  3H79 A;  1EEM A;  1TXX A;  5G5E A;  4QQ7 A;  1ACV A;  2VM1 A;  2FD3 A;  4CY6 A;  1SJI A;  1AIU A;  4K5S A;  1XW9 A;  2LEG A;  1TK0 B;  1X5C A;  3K8N A;  4J2F A;  2QC7 A;  2DJK A;  5JWQ B;  2YP6 A;  4ECC A;  3Q6O A;  3J7Y k;  2AV4 A;  4K7O A;  1H4O A;  3RHC A;  3VFI A;  3LEF A;  5F05 A;  1RQM A;  2VCX A;  5H5Q A;  1OC9 A;  3BCI A;  5ABR A;  1SJ6 A;  1GTI A;  2D2Z A;  1TRV A;  3E0U A;  4H86 A;  4MPF A;  5IMZ A;  1U6T A;  3M9J A;  2PVQ A;  1O8W A;  1XFL A;  5DBQ A;  6GST A;  3Q19 A;  1ON4 A;  5G1L A;  3DXB A;  3FHK A;  10GS A;  1JHB A;  1FB6 A;  1GLP A;  1QXH A;  2X99 A;  4Z7X A;  1S3A A;  4TXV A;  3HVX A;  5ELA A;  2FWE A;  2H72 A;  2HRF A;  4OFN A;  4LA1 A;  3F3R A;  1PRX A;  3GST A;  2P31 A;  2A4V A;  1BAY A;  2B5X A;  4IW9 A;  1PMT A;  1K3L A;  4XS4 A;  3ERG A;  1A8Y A;  3G7Y A;  3LJR A;  5DCG A;  5DAK A;  1V57 A;  4BVY A;  2YPM A;  5A4V A;  3FZ4 A;  5KOW A;  2DJ3 A;  1X9S B;  1GNE A;  5KN2 A;  1TI3 A;  5DJL A;  1BJX A;  1QGV A;  2H30 A;  3CMI A;  3M8N A;  5D93 A;  4OCF A;  3EU3 A;  3GUR A;  2GDR A;  4GTU A;  4G19 A;  1O7U A;  5BRT A;  4FIW A;  2TRX A;  2DBC A;  4ICY A;  5IO0 A;  2ZUP A;  3KTB A;  3DEX A;  3MIX A;  3MNG A;  2KHP A;  3HYP A;  4GF0 A;  4HU9 A;  1XVQ A;  3GYK A;  2QKE A;  4I5Q A;  2H70 A;  4G10 A;  4MH2 A;  2RM6 A;  3WD6 A;  1SL0 B;  3L9V A;  4CY8 A;  3EVI A;  3L0H A;  2Z9S A;  3F4T A;  3IAS 2;  4BVX B;  3DVX A;  1QK8 A;  5D8I A;  1V98 A;  1YF1 A;  1B8X A;  4KDU A;  4K2X A;  4YKF A;  4ZB9 A;  4BL7 B;  2KP2 A;  4L8E A;  1KBN A;  3KM6 A;  1KNG A;  5B8B A;  1Z3E A;  2O89 A;  3UAR A;  1E2Y A;  2DML A;  4PGT A;  3LYP A;  2L59 A;  4FQU A;  2JZS A;  2MMZ A;  1F9M A;  4E8H A;  3M3M A;  20GS A;  5HFI A;  1FW1 A;  3C1S A;  4KW6 A;  3HZ8 A;  1XW6 A;  3ZL5 A;  4MH3 A;  4EE0 A;  1V9W A;  1A2L A;  2H1B A;  3NOF A;  1DBY A;  4TR1 B;  5J41 A;  1U3I A;  2LKU A;  1PX7 A;  5IMF A;  3CQF A;  1JFU A;  1GUM A;  4TRX A;  1EP8 A;  3KP8 A;  4ZBD A;  4NWY A;  4PXO A;  4JZQ A;  2HNL A;  4X1U A;  1Y25 A;  1XWA A;  3D6I A;  1AXD A;  2B3S A;  5ECQ B;  1SKS B;  2L4Q A;  3VPQ A;  1HNB A;  1JZD A;  2CVB A;  14GS A;  3GTU A;  4TXO B;  5LD0 A;  1O8X A;  4MJB A;  4MF7 A;  1R26 A;  2O8V B;  4O5U A;  3DML A;  4TKY A;  5IM9 A;  1R5A A;  5AN1 A;  1M3I A;  4ECB A;  5JWO B;  1BX9 A;  5ECO B;  5B6N A;  1YF0 A;  3NIV A;  3EMX A;  1PSQ A;  4EL1 A;  2M80 A;  5AIS A;  2OE3 A;  2IFQ B;  1N2A A;  1PX6 A;  3FEU A;  2HLS A;  3F6D A;  2F3M A;  3Q18 A;  1R4W A;  3TKS E;  1GTU A;  4L5O A;  5DAL B;  4TR0 A;  1M7T A;  3KGK A;  2PER A;  4NHZ A;  3WYW A;  4ACS A;  2XPE A;  1XVW A;  4A5P A;  2GZP A;  2H01 A;  1GUH A;  2BJX A;  2HT9 A;  2X8G A;  5CRH A;  3P2A A;  1S3D A;  2WB9 A;  4TR3 A;  4CW9 A;  1I9D A;  3MSZ A;  3F9U A;  2OJL A;  3D22 A;  2LRT A;  4IQ1 A;  1T00 A;  3TJB A;  1GUL A;  3F3Q A;  2DJJ A;  1YDK A;  1GSF A;  4KF9 A;  2FWG A;  8GSS A;  4HU7 A;  4ZB6 A;  3QDN A;  4LMV A;  2HZF A;  4FH8 A;  3C73 A;  3CXG A;  1F2E A;  19GS A;  3FK8 A;  1GTA A;  3IHQ A;  3KMN A;  3ZIJ A;  2M46 A;  5DQY A;  4K9Z A;  4OO5 A;  4N0V A;  2YV7 A;  1EGO A;  1WWJ A;  4MZB A;  4YQV A;  4FO5 A;  6GSV A;  2GS3 A;  1B4P A;  1KEB A;  1V40 A;  1SK2 A;  4KCA A;  4HEA 2;  2K8S A;  5GAP D;  4MF6 A;  1ZYQ B;  5KN1 A;  2JL4 A;  4YAP A;  4MA9 A;  5D73 A;  2IMI A;  2RUF A;  1F3B A;  2LQO A;  1O6J A;  1XXU A;  1YKA A;  4EDY A;  4EDZ A;  5FWG A;  5ECR B;  2WRT A;  4JR4 A;  2P5Q A;  3UVT A;  1AUC A;  2RII A;  1A0R P;  4EVM A;  2F8A A;  2H66 A;  4N0Z A;  4G0K A;  1O81 A;  2CVD A;  1TK8 B;  2MMO A;  2H6X A;  1GRX A;  2DIY A;  2F51 A;  3IA1 A;  4IHU A;  1YKC A;  2WJU A;  1PD2 1;  2LTK A;  3ZMK A;  3KJY A;  4PQ1 A;  2N5B A;  1PQN A;  2VCT A;  3IAM 2;  4BWS A;  4OD7 A;  3H8Q A;  2GSQ A;  2AHE A;  1A2M A;  3HHV A;  3ERW A;  3KEB A;  1EOH A;  2R6K A;  4X43 A;  1DE2 A;  3FR6 A;  2FA4 A;  2VLV A;  1XBS A;  3O3T A;  2HE3 A;  5ECN B;  5A4U A;  3HD5 A;  2QA2 A; 
#chains in the Genus database with same CATH homology
 2EC4 A;  1XZO A;  3W8S A;  2OE1 A;  3SBC A;  2PMT A;  2BMX A;  1T7P B;  3FZA A;  4PNG A;  4O5R A;  1Z5Y E;  3CBU A;  3H1N A;  4YQU A;  2C80 A;  3ZLP A;  1GSU A;  2RLI A;  1PGT A;  4GQC A;  3HJP A;  2DIZ A;  4KE3 A;  4ZIL A;  2B5Y A;  5B6M A;  1AC1 A;  2HYX A;  4FYB A;  5DQS A;  1A2J A;  4GRF A;  4JED A;  5J9B A;  3LXT A;  3VWW A;  2R37 A;  3LG6 A;  5HFK A;  5ECH B;  2V2G A;  2FUG 2;  5E4W A;  2DSA A;  1C72 A;  4G9H A;  1K0N A;  4NHW A;  1X5D A;  1GH2 A;  1ZL9 A;  4KSO A;  3R2Q A;  4RI6 A;  5B8A A;  3HJM A;  1WPI A;  3ME7 A;  5J9C A;  3LYK A;  2HZE A;  2C8U A;  5KN0 A;  3HXS A;  1MDI A;  4O32 A;  2GQK A;  2F9S A;  1G7O A;  4BPY A;  1WRY A;  4NAX A;  3ED3 A;  1MD3 A;  1NHY A;  4MDC A;  2FWH A;  3KP9 A;  4L0U A;  1X0R A;  3APO A;  3GTU B;  3EU4 A;  1R5P A;  1BQ7 A;  3MDK A;  1H75 A;  1RK4 A;  3C7M A;  3CSI A;  5L71 A;  3QFB C;  3TJF A;  4GSS A;  4MJE A;  5HR3 A;  3MAK A;  3ISO A;  3GUS A;  1TU7 A;  3GNJ A;  4PX1 A;  3A3T A;  3C71 A;  5DVB A;  2C0D A;  1TRS A;  3HZ4 A;  1TW9 A;  3WT2 A;  1K0D A;  3ZVJ A;  3P7X A;  3GL5 A;  2I4A A;  3DD3 A;  3GA4 A;  2CAQ A;  2YNX A;  4PTS A;  2HXK A;  1K0O A;  5F0G A;  4I2U A;  3CSJ A;  1SKW B;  2YJ7 A;  3C8E A;  3GHA A;  1GUK A;  3A2W A;  5A4W A;  5EPF A;  4MP4 A;  4D73 B;  1YZX A;  2E7P A;  2GSR A;  4AGS A;  3J7Y b;  5D9T A;  3ZRD A;  3P8W A;  1XOB A;  4F82 A;  3M9K A;  2EIQ A;  3HY2 A;  1M99 A;  1IYI A;  5DCH A;  2V6K A;  3TOU A;  3HVV A;  2P5R A;  1THO A;  4IN0 A;  1BG5 A;  2K9F A;  2IMK A;  4WET A;  3EIN A;  2HSH A;  1Q98 A;  3GFK A;  2FHE A;  2IWT A;  3IK9 A;  1NSW A;  4Z2U A;  1SL2 B;  2VO4 A;  2CZ2 A;  2PVO C;  2OA7 A;  5GST A;  2H6Y A;  2ALB A;  5JCU A;  5LCZ A;  1OYJ A;  2LJA A;  1THX A;  2H8L A;  4EXJ A;  2WUL A;  1XWB A;  2GZY A;  3A2V A;  3TCO A;  5CAX A;  3QOU A;  1RW1 A;  5J4U A;  2CAI A;  5CO3 A;  5EY6 A;  1K0A A;  2HSM A;  2NTO A;  3US3 A;  1EZK A;  3HDC A;  4DSS A;  3W8J A;  5IIZ A;  2K6V A;  2MBS A;  3ZZX A;  1TRW A;  2R0C A;  4XTS A;  4NV5 A;  2B7J A;  4HQZ A;  1A23 A;  3LW9 A;  5AIX A;  3VLN A;  3UOM A;  3CTF A;  4KCE A;  3A5I A;  3BD2 A;  2OAC A;  4WXT A;  2ES7 A;  3UBK A;  1YJ6 A;  3TOT A;  2CA8 A;  4V2L A;  2M72 A;  5CRE A;  1OC8 A;  4K0N A;  1TDI A;  1ZZY A;  5HQP A;  2HRK A;  3DWV A;  1ERV A;  4XHM A;  2O87 A;  3KXO A;  2C1Y A;  1EEJ A;  9GSS A;  5G30 A;  4WR5 A;  3QFA C;  1FAA A;  1Y6E A;  4TW5 A;  1OVN A;  1W4V A;  1EV9 A;  4IEL A;  4XRD A;  4LL4 B;  2WCI A;  2H75 A;  3DGQ A;  2CQ9 A;  4PQI A;  2ON5 A;  2QA1 A;  2VD0 A;  2IJY A;  2KLX A;  2TIR A;  5ENU A;  1EWX A;  3BOA A;  4ZBB A;  1TJD A;  1M2B A;  3I43 A;  3IE3 A;  3CSH A;  1PKW A;  3OR5 A;  5LNK e;  2V6O A;  1AAZ A;  2XPD A;  4K7N A;  3VUR A;  3GH6 A;  3PH9 A;  4ZB8 A;  4ML6 A;  3SWL A;  1QQ2 A;  4HQS A;  5EL8 A;  4HJ2 A;  3PPU A;  4EC0 A;  3L78 A;  1Z7R A;  1AQV A;  2H74 A;  3RDW A;  3DKS A;  1ZCP A;  1GLQ A;  4EIQ A;  4FYC A;  1LJR A;  2HFD A;  5ECS A;  2K8V A;  5ECP B;  1QFN A;  3A2X A;  2YWN A;  1TKD B;  4RQR A;  2LST A;  4OCE A;  2E2M A;  3ZML A;  2O7K A;  1USB A;  2HZE B;  5ID2 A;  4DSQ A;  3UL3 A;  3EC3 A;  4WBR D;  2WS2 A;  2HI7 A;  3FMW A;  3QD9 A;  2V41 A;  2B6M A;  4NPB A;  1SKR B;  1NHO A;  2H71 A;  2VOC A;  3GKX A;  4F2I A;  1V2A A;  3W6G A;  1U87 A;  3EE2 A;  2FY6 A;  2OAD A;  1F3A A;  3FKF A;  2J9H A;  3BBY A;  3TGZ A;  4MMM A;  2LUS A;  4IQA A;  5AIV A;  2YWM A;  1W89 A;  1ABA A;  4F9Z A;  2LNT A;  1Z9H A;  2PBJ A;  4WBJ A;  3NZN A;  3ME8 A;  4YKG A;  4IJ3 A;  1GNW A;  1WOU A;  3EYT A;  3ZVJ D;  3KIJ A;  4Q5N A;  4HZ4 A;  2H0I A;  2G0F A;  1HD2 A;  3GX0 A;  3FYG A;  3LGC A;  1U3A A;  1HQO A;  4GXZ A;  2I1U A;  3M1G A;  3F4S A;  1TRU A;  1VRS D;  5JCG A;  2I3Y A;  5CRG A;  2VIM A;  4FYU A;  1JLW A;  1CQH A;  2ZCT A;  3VWV A;  3ZRE A;  5GAN D;  1XOA A;  2OE0 A;  2H73 A;  3L9S A;  4AF2 A;  3KD0 A;  1WE0 A;  1XCC A;  1OC9 B;  2VL2 A;  3EMP A;  3ZIT A;  2OBK A;  2VCW A;  3WGX A;  2NDO A;  1FOV A;  4G0I A;  2QSI A;  3BCK A;  1MDJ A;  1G6W A;  4X0X A;  2X8H A;  1OC3 A;  5G31 A;  1K0C A;  4GSN A;  3D4T A;  2HRA A;  4ECJ A;  2FWF A;  1AW9 A;  4I8B A;  3DRN A;  2L5O A;  3FW2 A;  1UN2 A;  4ILF A;  2YJH A;  2YZH A;  1VF4 A;  3ZFL A;  4LL1 B;  1URM A;  2EIO A;  4K7I A;  3H4K A;  4XS4 B;  4MF5 A;  2MMN A;  3TJK A;  1K3Y A;  5DAK B;  4BVY B;  1S3C A;  5D9X A;  1QMV A;  2B1L A;  3KTL A;  3LSZ A;  4MCU A;  3QAW A;  5B7C A;  4MNN A;  6GSW A;  2DJ1 A;  5F07 A;  3G7J A;  1GP1 A;  2A2P A;  2V32 A;  5IMV A;  5DJM A;  3TB2 A;  1CQG A;  4PNF A;  2WFC A;  2AAW A;  2VCQ A;  2CX4 A;  4KND A;  1ZMA A;  2GT5 A;  5D96 A;  5IPG A;  3QAV A;  3LFL A;  4Z2R A;  2DKH A;  3TKS A;  1X9W B;  3IR4 A;  4BA7 A;  2VL3 A;  4MZC A;  2LQQ A;  5C00 A;  1DSB A;  3P90 A;  3S9F A;  2L6D A;  2A4H A;  2PGT A;  3TJJ A;  1SD9 A;  2YWI A;  3GKN A;  4BVX A;  4J56 E;  2H0H A;  3GV1 A;  4EKZ A;  1SU9 A;  4K2D A;  4OO4 A;  2R0G A;  4IVF A;  3HA9 A;  3ZIV A;  5KEJ A;  2G2Q A;  2IN3 A;  5IQY A;  5KN3 A;  1U88 A;  3APQ A;  4QL7 A;  1LU4 A;  4DVC A;  5INY A;  2R5G A;  1TTZ A;  4OWY A;  2XC2 A;  3AY8 A;  6GSS A;  18GS A;  3IC4 A;  4I2T A;  3KH7 A;  4TN8 A;  1PKZ A;  5DDL A;  12GS A;  1F6M C;  2H1A A;  3VI5 A;  1TK5 B;  2L4C A;  4XCS A;  2PU9 C;  4YAV A;  4O92 A;  1Z6M A;  4ISD A;  4MLY A;  4Q5R A;  4TR1 A;  2H19 A;  5A5K A;  2GVP A;  1MD4 A;  4ID0 A;  2GSS A;  4Q5Q A;  2LV3 A;  2FNO A;  2VL9 A;  3F6F A;  2C0G A;  1O85 A;  2P0G A;  3WGE A;  4NXI A;  1WIK A;  3F4R A;  3KCM A;  1ZYE A;  2GGT A;  3ERF A;  4PQH A;  1HYU A;  2DJ0 A;  3HCZ A;  5FT3 A;  1UC7 A;  3GKK A;  4ZL9 A;  1X5E A;  3FR9 A;  2YV9 A;  2LJK A;  2R3X A;  3ZFB A;  1SL1 B;  4ZBA A;  2VAF A;  3GRX A;  5ID2 B;  3DYR A;  2PUK C;  1GWC A;  1XWC A;  2VD1 A;  3KZQ A;  2L5L A;  2YAN A;  2IFQ A;  3UAP A;  13GS A;  2A2R A;  4I6X A;  2F8F A;  1NM3 A;  1G0T A;  5ECL B;  4HOJ A;  1T8E B;  1YY7 A;  1ZGN A;  2CT6 A;  5IPH A;  2LNS A;  2H1G A;  5IMD A;  2C0E A;  1VF1 A;  1UVZ A;  1PA3 A;  2AYT A;  3IXR A;  4PUR A;  4XS1 A;  3FR3 A;  4USS A;  1JZW A;  2XBQ A;  5G2Z A;  5HR0 A;  3GX8 A;  2OBI A;  2OKA A;  1ERT A;  2RUE A;  2H6Z A;  4E8E A;  1PL2 A;  3PR8 A;  2B5E A;  5F8B A;  1AQW A;  1VGL A;  2FA8 A;  4F0B A;  2NVL A;  4RI7 A;  4F03 A;  4ECI A;  1WMJ A;  1FG4 A;  3FZ5 A;  1F37 A;  5CRW A;  2AB6 A;  5C04 A;  3GH9 A;  1B9Y C;  1DUG A;  1K0B A;  5HFG A;  2PWJ A;  1GSD A;  1YEP A;  1TU8 A;  3RHB A;  3U6V A;  5D9W A;  1Z7P A;  1EGR A;  2YZU A;  1OAZ A;  4G0L A;  1EV4 A;  1LBK A;  3TKQ A;  1J0F A;  5ELG A;  1GSQ A;  4KUN A;  2A2S A;  1ZYP A;  2HSY A;  5F06 A;  4ZL7 A;  4TVE A;  5ECI B;  4TOP A;  3RBT A;  5G5F A;  5HR1 A;  1GSY A;  3PGT A;  2UZ8 A;  2IMD A;  4OFT A;  1XIY A;  4OFM A;  2E2G A;  3QAG A;  5JCW A;  2REM A;  4IKH A;  5D9V A;  1WP0 A;  3ZYW A;  2GQL A;  2TRC P;  5CYY A;  1G7E A;  4WF5 A;  3TKP A;  4KGI A;  5H5R A;  2JU5 A;  2WGR A;  4WR4 A;  1IYH A;  4V2M A;  3IOS A;  2JSY A;  3TRX A;  3CYN A;  1YEX A;  2MMA A;  4K1F A;  2AJQ B;  3R3E A;  1O73 A;  1R7H A;  2JAC A;  1MEK A;  1FVJ A;  2C3N A;  4EUY A;  3F0I A;  4J57 E;  4KA0 A;  3QMX A;  3E3E A;  2H76 A;  2X49 A;  3E9J B;  3EPT A;  2XHF A;  4LMW A;  1TP9 A;  2GLR A;  2VLT A;  3M0F A;  4DEJ A;  4MJC A;  1M0U A;  4HUA A;  3Q74 A;  4IGJ A;  3FY7 A;  4V1A g;  2GZZ A;  3KMO A;  2RM5 A;  4XIH A;  4YQM A;  3FRC A;  1ML6 A;  1SK1 A;  3O6T A;  5JWR B;  2R2J A;  3IBH A;  4KX4 A;  3TDG A;  4IP1 A;  4HI7 A;  3F8U A;  2VLU A;  2I9H A;  4AJ6 A;  3HJO A;  1GL8 A;  2KP1 A;  4ZIJ A;  4NMU A;  4IBP A;  2L6C A;  1BED A;  4ML1 A;  1MDK A;  3D21 A;  2L57 A;  4JU5 A;  1GSE A;  1YQ1 A;  3IRA A;  4HJM A;  4GST A;  3UBL A;  4O7H A;  3KH9 A;  4QL9 A;  4K8M A;  5E59 A;  3UMA A;  4POM A;  2R4V A;  2FCH A;  1N8J A;  3G7I A;  3MYD A;  2CZ3 A;  1T1V A;  3TKR A;  1XWG A;  1SYX A;  4PUA A;  2FGX A;  1I5G A;  3IV4 A;  2LRN A;  3DIE A;  3U5R E;  5KOX A;  4WF4 A;  3V1W A;  1M2A A;  1JLV A;  4CHS A;  1EOG A;  3MWH A;  3LXZ A;  2FLS A;  1QUW A;  2YCD A;  4WKW A;  5ECK B;  2IPA A;  4RQX A;  3PIN A;  2VUP A;  1MTC A;  1K0M A;  1B9X C;  22GS A;  4N10 A;  4I97 A;  3HKR A;  2VM2 A;  3QPM A;  1JZO A;  4EF0 A;  2MBT A;  2XBI A;  3HVS A;  17GS A;  2GST A;  1V58 A;  3LOR A;  4JBB A;  4JRR A;  3DVW A;  2J23 A;  5HR2 A;  5H5S A;  1PN9 A;  4BWQ A;  1AQX A;  2WDU A;  1EP7 A;  2CVK A;  1PN0 A;  2V1M A;  3BJ5 A;  3VWX A;  4F0C A;  5IOX A;  5IMC A;  5GSS A;  1T4Y A;  4EO3 A;  3LQ7 A;  1DE1 A;  4POL A;  1Q4J A;  2C3Q A;  3CRU A;  4HZ2 A;  3WGD A;  2LJR A;  4WEY A;  1ZYN A;  1BYE A;  4D73 A;  1FVK A;  5IOW A;  1ERW A;  4RUV A;  4POK A;  4TR4 A;  1OKD A;  1J08 A;  3CRT A;  1WJK A;  4XS6 A;  1UA5 A;  3EUR A;  3A5W A;  1E6B A;  3VI7 A;  5IO2 A;  3I6A A;  2YWO A;  4JE1 A;  2LRC A;  4X4J A;  5CNW A;  3O76 A;  3D4M A;  4OMV A;  2DLX A;  6GSX A;  2R0P A;  1A0F A;  4KAE A;  3UIW A;  5CRD A;  3G9B A;  4GLT A;  2JZT A;  4G2E A;  3EWL A;  1NW2 A;  5IMA A;  4ZXG A;  2CV4 A;  2NBS A;  3RPP A;  2PPT A;  3I69 A;  6GSY A;  1SK0 A;  3IDV A;  3N5O A;  4K0G A;  3D0Z A;  1TI1 A;  1OKT A;  5CP1 A;  1OE7 A;  1OE8 A;  1X9M B;  2IMF A;  2HRN A;  5ECM B;  11GS A;  4IS0 A;  4CDO A;  4P3Y B;  3FZ9 A;  4GCI A;  2I81 A;  2X64 A;  1J9B A;  4ZL8 A;  4K6X A;  4POB A;  3F63 A;  1PL1 A;  2ZNM A;  4V2N A;  2YOI A;  3IC8 A;  4MPG A;  2VCV A;  4DSS B;  2GT6 A;  2VL2 C;  3CTG A;  3L9U A;  1ST9 A;  3GL3 A;  2GQM A;  4MK3 A;  4MAB A;  2WZ9 A;  1FO5 A;  3GSS A;  4N30 A;  1FOH A;  2ON7 A;  2KUC A;  4O5Q A;  3GN3 A;  2C3T A;  2DJ2 A;  4IJI A;  1M9B A;  5EVO A;  2GTU A;  2YN1 A;  5AGY A;  1G6Y A;  4KB3 A;  2B1K A;  3UVH A;  3IHG A;  16GS A;  1XPV A;  2IIY A;  3TJG A;  3I9V 2;  4HDE A;  4K5R A;  4L5L A;  2C0F A;  4Q5F A;  3ZTL A;  4YH2 A;  3GMF A;  3GKM A;  4AJ7 A;  5J5N A;  4Z2T A;  1K3O A;  1FHE A;  2KOK A;  4BL7 A;  5G1K A;  2JZR A;  5COH A;  1SJZ A;  4ULX A;  1FB0 A;  4EIP A;  2O85 A;  1B48 A;  4MZW A;  3L4N A;  4L0W A;  1XW5 A;  2EIR A;  2K18 A;  2JAD A;  1SD8 A;  3QCP A;  1XWK A;  3IPZ A;  2DC5 A;  4HS1 A;  3TUE A;  1GTB A;  4MJA A;  3D5J A;  5J3R A;  3UEM A;  1SEN A;  1M9A A;  4IP6 A;  3TKS C;  3APS A;  1HNA A;  2LS5 A;  2H1D A;  5GZZ B;  7GSS A;  1M2D A;  5FHI A;  2B7K A;  4KDY A;  1VF2 A;  1SYR A;  1T3B A;  1VF3 A;  4JR6 A;  2N5A A;  2IL3 A;  4KH7 A;  5BMU A;  2H0G A;  2BTO T;  2DKI A;  4N11 A;  2CX3 A;  2IME A;  1B4Q A;  1T4Z A;  4AJ8 A;  3C1R A;  1A8L A;  4V1A p;  2X4A A;  4TXO A;  3IK7 A;  2AUV A;  2JSZ A;  3VPT A;  3N9J A;  1ZOF A;  2QGV A;  2C4J A;  6GSU A;  1GSS A;  4KDX A;  1KTE A;  4GQF A;  4DSR A;  3TRQ A;  1ERU A;  2DMM A;  1Z6N A;  3UJ1 A;  3VK9 A;  1ILO A;  1TOF A;  2MYG A;  3H93 A;  3TRP A;  2MZC A;  3RAZ A;  4NV2 A;  3WT1 A;  2PN8 A;  2VCZ A;  4XRA A;  3RPN A;  3LWA A;  2N5F A;  5DAL A;  4KSM A;  3QR6 A;  1JZR A;  4PUF C;  3VWU A;  2X8C A;  2NPB A;  2E0Q A;  3JCM L;  3GIX A;  4GWR A;  1A24 A;  1HNC A;  4LLR A;  3H79 A;  1EEM A;  1TXX A;  5G5E A;  4QQ7 A;  1ACV A;  2VM1 A;  2FD3 A;  4CY6 A;  1SJI A;  1AIU A;  4K5S A;  1XW9 A;  2LEG A;  1TK0 B;  1X5C A;  3K8N A;  4J2F A;  2QC7 A;  2DJK A;  5JWQ B;  2YP6 A;  4ECC A;  3Q6O A;  3J7Y k;  2AV4 A;  4K7O A;  1H4O A;  3RHC A;  3VFI A;  3LEF A;  5F05 A;  1RQM A;  2VCX A;  5H5Q A;  1OC9 A;  3BCI A;  5ABR A;  1SJ6 A;  1GTI A;  2D2Z A;  1TRV A;  3E0U A;  4H86 A;  4MPF A;  5IMZ A;  1U6T A;  3M9J A;  2PVQ A;  1O8W A;  1XFL A;  5DBQ A;  6GST A;  3Q19 A;  1ON4 A;  5G1L A;  3DXB A;  3FHK A;  10GS A;  1JHB A;  1FB6 A;  1GLP A;  1QXH A;  2X99 A;  4Z7X A;  1S3A A;  4TXV A;  3HVX A;  5ELA A;  2FWE A;  2H72 A;  2HRF A;  4OFN A;  4LA1 A;  3F3R A;  1PRX A;  3GST A;  2P31 A;  2A4V A;  1BAY A;  2B5X A;  4IW9 A;  1PMT A;  1K3L A;  4XS4 A;  3ERG A;  1A8Y A;  3G7Y A;  3LJR A;  5DCG A;  5DAK A;  1V57 A;  4BVY A;  2YPM A;  5A4V A;  3FZ4 A;  5KOW A;  2DJ3 A;  1X9S B;  1GNE A;  5KN2 A;  1TI3 A;  5DJL A;  1BJX A;  1QGV A;  2H30 A;  3CMI A;  3M8N A;  5D93 A;  4OCF A;  3EU3 A;  3GUR A;  2GDR A;  4GTU A;  4G19 A;  1O7U A;  5BRT A;  4FIW A;  2TRX A;  2DBC A;  4ICY A;  5IO0 A;  2ZUP A;  3KTB A;  3DEX A;  3MIX A;  3MNG A;  2KHP A;  3HYP A;  4GF0 A;  4HU9 A;  1XVQ A;  3GYK A;  2QKE A;  4I5Q A;  2H70 A;  4G10 A;  4MH2 A;  2RM6 A;  3WD6 A;  1SL0 B;  3L9V A;  4CY8 A;  3EVI A;  3L0H A;  2Z9S A;  3F4T A;  3IAS 2;  4BVX B;  3DVX A;  1QK8 A;  5D8I A;  1V98 A;  1YF1 A;  1B8X A;  4KDU A;  4K2X A;  4YKF A;  4ZB9 A;  4BL7 B;  2KP2 A;  4L8E A;  1KBN A;  3KM6 A;  1KNG A;  5B8B A;  1Z3E A;  2O89 A;  3UAR A;  1E2Y A;  2DML A;  4PGT A;  3LYP A;  2L59 A;  4FQU A;  2JZS A;  2MMZ A;  1F9M A;  4E8H A;  3M3M A;  20GS A;  5HFI A;  1FW1 A;  3C1S A;  4KW6 A;  3HZ8 A;  1XW6 A;  3ZL5 A;  4MH3 A;  4EE0 A;  1V9W A;  1A2L A;  2H1B A;  3NOF A;  1DBY A;  4TR1 B;  5J41 A;  1U3I A;  2LKU A;  1PX7 A;  5IMF A;  1JFU A;  1GUM A;  4TRX A;  1EP8 A;  3KP8 A;  4ZBD A;  4NWY A;  4PXO A;  4JZQ A;  2HNL A;  4X1U A;  1Y25 A;  1XWA A;  3D6I A;  1AXD A;  2B3S A;  5ECQ B;  1SKS B;  2L4Q A;  3VPQ A;  1HNB A;  1JZD A;  2CVB A;  14GS A;  3GTU A;  4TXO B;  5LD0 A;  1O8X A;  4MJB A;  4MF7 A;  1R26 A;  2O8V B;  4O5U A;  3DML A;  4TKY A;  5IM9 A;  1R5A A;  5AN1 A;  4ECB A;  5JWO B;  1BX9 A;  5ECO B;  5B6N A;  1YF0 A;  3NIV A;  3EMX A;  1PSQ A;  4EL1 A;  2M80 A;  5AIS A;  2OE3 A;  2IFQ B;  1N2A A;  1PX6 A;  3FEU A;  2HLS A;  3F6D A;  2F3M A;  3Q18 A;  1R4W A;  3TKS E;  1GTU A;  4L5O A;  5DAL B;  4TR0 A;  1M7T A;  3KGK A;  2PER A;  4NHZ A;  3WYW A;  4ACS A;  2XPE A;  1XVW A;  4A5P A;  2GZP A;  2H01 A;  1GUH A;  2BJX A;  2HT9 A;  2X8G A;  5CRH A;  3P2A A;  1S3D A;  2WB9 A;  4TR3 A;  4CW9 A;  1I9D A;  3MSZ A;  3F9U A;  2OJL A;  3D22 A;  2LRT A;  4IQ1 A;  1T00 A;  3TJB A;  1GUL A;  3F3Q A;  2DJJ A;  1YDK A;  1GSF A;  4KF9 A;  2FWG A;  8GSS A;  4HU7 A;  4ZB6 A;  3QDN A;  4LMV A;  2HZF A;  4FH8 A;  3C73 A;  3CXG A;  1F2E A;  19GS A;  3FK8 A;  1GTA A;  3IHQ A;  3KMN A;  3ZIJ A;  2M46 A;  5DQY A;  4K9Z A;  4OO5 A;  4N0V A;  2YV7 A;  1EGO A;  1WWJ A;  4MZB A;  4YQV A;  4FO5 A;  6GSV A;  2GS3 A;  1B4P A;  1KEB A;  1V40 A;  1SK2 A;  4KCA A;  4HEA 2;  2K8S A;  5GAP D;  4MF6 A;  1ZYQ B;  5KN1 A;  2JL4 A;  4YAP A;  4MA9 A;  5D73 A;  2IMI A;  2RUF A;  1F3B A;  2LQO A;  1O6J A;  1XXU A;  1YKA A;  4EDY A;  4EDZ A;  5FWG A;  5ECR B;  2WRT A;  4JR4 A;  2P5Q A;  3UVT A;  1AUC A;  2RII A;  1A0R P;  4EVM A;  2F8A A;  2H66 A;  4N0Z A;  4G0K A;  1O81 A;  2CVD A;  1TK8 B;  2MMO A;  2H6X A;  1GRX A;  2DIY A;  2F51 A;  3IA1 A;  4IHU A;  1YKC A;  2WJU A;  1PD2 1;  2LTK A;  3ZMK A;  3KJY A;  4PQ1 A;  2N5B A;  1PQN A;  2VCT A;  3IAM 2;  4BWS A;  4OD7 A;  3H8Q A;  2GSQ A;  2AHE A;  1A2M A;  3HHV A;  3ERW A;  3KEB A;  1EOH A;  2R6K A;  4X43 A;  1DE2 A;  3FR6 A;  2FA4 A;  2VLV A;  1XBS A;  3O3T A;  2HE3 A;  5ECN B;  5A4U A;  3HD5 A;  2QA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...