2FWEA

Crystal structure of the c-terminal domain of the electron transfer catalyst dsbd (oxidized form)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
122
structure length
122
Chain Sequence
HLNFTQIKTVDELNQALVEAKGKPVMLDLYADWCVACKEFEKYTFSDPQVQKALADTVLLQANVTANDAQDVALLKHLNVLGLPTILFFDGQGQEHPQARVTGFMDAETFSAHLRDRQPHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Thiol:disulfide interchange protein dsbD
publication title High-resolution structures of Escherichia coli cDsbD in different redox states: A combined crystallographic, biochemical and computational study
pubmed doi rcsb
source organism Escherichia coli
total genus 43
structure length 122
sequence length 122
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13899 Thioredoxin_7 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2fweA00
2ALBA 2IJYA 3CXGA 5HR2A 4XTSA 4K0GA 3M3MA 3ZZXA 3U5RE 1X9SB 3LJRA 5EL8A 3UL3A 1TRVA 4EDZA 1EWXA 5C00A 1Z6NA 3CMIA 1S3AA 3M1GA 4N0VA 3HZ8A 4TKYA 5HFIA 2JL4A 2MMZA 4N0ZA 2O87A 3IE3A 4FYBA 4Q5FA 3UVHA 1VRSD 3F8UA 4K8MA 3Q74A 2LJAA 3TKSC 2H0IA 4OO5A 7GSSA 3A2WA 3D21A 4ZL9A 1GSUA 1M2BA 3IA1A 3A3TA 1AXDA 4JRRA 5DQSA 2FUG2 2QGVA 17GSA 1ZZYA 1XOBA 4ZL7A 5DAKA 3IOSA 4MF7A 4K7NA 3WT2A 1URMA 3PINA 2R6KA 1T4ZA 4JE1A 1SENA 5LNKe 1E6BA 2EIRA 3QMXA 3UAPA 5G30A 2K18A 3GIXA 1B48A 1S3DA 2OE0A 2FA4A 4GXZA 4O5RA 3FKFA 2PGTA 1B9YC 3GV1A 2GTUA 3ZLPA 2LRNA 3LGCA 1XFLA 3HVVA 5IMAA 2L6DA 5D9VA 2AV4A 4BWQA 3H93A 5B6MA 2I9HA 3IK7A 1GSSA 2C3NA 3A2XA 4G10A 1F3AA 1PSQA 4Q5NA 2V32A 1G6WA 1NM3A 2B5XA 1SKSB 2L4QA 2YPMA 3JCML 2LJRA 5ECSA 4KA0A 1J9BA 3QFBC 1SKRB 2YZUA 2BMXA 3TOUA 4HDEA 1ABAA 4GSTA 3Q19A 4MA9A 1J0FA 4KX4A 2R2JA 2WRTA 3V1WA 1OC9B 1PQNA 4POKA 1EOGA 2WZ9A 2YJ7A 1Y25A 4ISDA 4JU5A 5ID2A 2M80A 4MZCA 1T00A 3TGZA 4NPBA 4WKWA 3F0IA 1X5EA 1YY7A 1PA3A 3C8EA 3O3TA 2VO4A 4WR4A 4NHWA 1V9WA 4TN8A 2X99A 3QOUA 3UBKA 4P3YB 5HR1A 4WEYA 5DALA 2GSSA 5FHIA 1V2AA 5J9BA 2L57A 2PN8A 4TVEA 1QGVA 5ECPB 3HHVA 4KDYA 1LU4A 1AAZA 4OFNA 3P7XA 2DC5A 2LSTA 1QXHA 4AJ7A 3EINA 2VL9A 1GSEA 1PL1A 1FO5A 1AW9A 3IK9A 5INYA 1M9AA 2A2SA 2GS3A 2MMOA 4OCEA 3PR8A 2X8CA 3QPMA 4GQCA 4ZB8A 2H75A 2I81A 4TOPA 3QAGA 4TXOA 3P90A 2X64A 2FWFA 1K0NA 4O7HA 2VLUA 4MP4A 1KEBA 2CT6A 2JADA 3D5JA 4ILFA 2WULA 4J2FA 4TR1A 3IBHA 1OYJA 3DKSA 1NW2A 1HD2A 1M2AA 3TKPA 2ZCTA 1ERTA 4N11A 2YZHA 4TR3A 1NHYA 1K3YA 5F06A 1QMVA 4WXTA 2JSYA 1K0BA 5D96A 1G0TA 1IYHA 1YKCA 2G2QA 3HJMA 4E8EA 1HQOA 11GSA 4EXJA 1K0AA 4TRXA 3VWWA 1SYRA 6GSSA 3Q18A 2IMDA 3ERGA 1V98A 1UN2A 2P31A 3FZAA 4HU7A 3TRXA 4MZBA 2B5EA 2FLSA 1SYXA 2CAIA 4ID0A 4XIHA 4DEJA 2WCIA 1V57A 1Z7RA 5KEJA 3HJOA 1ACVA 5D9TA 1HNAA 1W89A 4XS4B 1R26A 3AY8A 1XWBA 2IIYA 4KAEA 4HZ4A 1BYEA 2XPDA 3W6GA 2C3TA 4FIWA 4IS0A 4EC0A 3FHKA 3ZREA 2ON5A 2XC2A 3GHAA 1GTIA 1OKDA 1XZOA 3GMFA 1YDKA 2HFDA 1XVWA 5ECLB 2E2MA 2GVPA 5JCGA 2PPTA 3HVSA 2L5LA 1XIYA 4K0NA 5F0GA 2VM2A 1YJ6A 3R2QA 5ABRA 1U87A 2EC4A 2CVKA 1T7PB 3G7JA 3D0ZA 3WGXA 2F51A 4AJ6A 18GSA 4JZQA 5KN3A 4PNGA 3O76A 3UMAA 3KMNA 2FWEA 2A2RA 5EVOA 2CAQA 3IDVA 1DE2A 3GN3A 2PBJA 4D73A 1ERVA 3J7Yk 5ELAA 1HNCA 4EE0A 3VFIA 4IBPA 3IR4A 3ZVJD 2B5YA 2VUPA 2HSYA 2YN1A 3GKMA 2B1KA 4OFTA 3I43A 4HZ2A 2FWHA 2PWJA 3ZL5A 4HJMA 3FK8A 2HLSA 6GSXA 4DVCA 3N9JA 5ECKB 3SWLA 2FHEA 5E4WA 1JZWA 1PX7A 3TDGA 1A23A 3P2AA 19GSA 4V2NA 3MDKA 3ZFLA 4I8BA 4DSSB 5KN1A 4Q5QA 2DMMA 5D73A 1V58A 1PKZA 4EVMA 2C80A 1OE8A 4PGTA 5IMCA 2GT6A 3ZMLA 1WMJA 2YP6A 3ZRDA 1O8XA 3NZNA 2R4VA 3G7YA 3BOAA 4ACSA 3FZ9A 4MDCA 1TK0B 4AJ8A 4PUFC 2AUVA 5A4WA 2KLXA 4ZBBA 5DBQA 4JR6A 2GQKA 5D93A 2VL2C 1ZGNA 1FOVA 1GP1A 4ECIA 1G7EA 4FO5A 3HZ4A 1AQXA 2H01A 1JFUA 4F03A 5DDLA 4WBJA 1MDIA 4AF2A 3K8NA 2DJ2A 4ZIJA 1DE1A 2EIOA 3G7IA 2XBIA 3TJGA 1S3CA 2HYXA 5IMVA 2LNTA 14GSA 3HD5A 4ZB6A 3CSHA 4AGSA 4POBA 3ZIJA 3HYPA 3F3QA 1WRYA 5COHA 1GTAA 2MBTA 1ZYEA 3LXTA 4IP1A 4OFMA 1SD9A 3M0FA 2YWMA 1Q4JA 6GSTA 1GUHA 1MEKA 1Y6EA 2ZUPA 4OO4A 1SU9A 5DCHA 2RIIA 5ECHB 4I2UA 5H5RA 3VWXA 4XHMA 1ZMAA 4PNFA 3ZYWA 2C1YA 2IWTA 2CX3A 3KTBA 4KUNA 1N8JA 2F9SA 1IYIA 1V40A 2HZEB 1X5DA 5DCGA 3GTUA 1R4WA 4K7IA 3HY2A 4WETA 1DBYA 1VGLA 5G5EA 2N5AA 3LG6A 5JCUA 4L5OA 8GSSA 3KZQA 1GSYA 3ISOA 5AN1A 1O81A 3H8QA 2YANA 2HRFA 2IPAA 5DAKB 3QDNA 2H6ZA 2LEGA 4KCEA 4DSQA 1F9MA 1WWJA 3I9V2 2RLIA 3LXZA 2VLVA 4WR5A 3TUEA 4GQFA 3N5OA 2HNLA 4IHUA 4PX1A 4MH3A 3E3EA 2H73A 3DMLA 3WYWA 1ERUA 3KH9A 5IPGA 1THXA 4XCSA 1MDJA 4EF0A 4NV2A 5CRGA 3KIJA 5G1LA 2V6OA 2F8FA 1K0DA 5CAXA 1YKAA 3WT1A 3CTFA 5AGYA 3BCIA 3P8WA 5JWQB 5L71A 2C0EA 3MNGA 1A2JA 4H86A 3QFAC 1EV9A 2R3XA 4TXVA 3QR6A 3KJYA 4HU9A 1E2YA 4O32A 2MZCA 4G19A 2K9FA 1XBSA 5KN0A 1TU8A 2HRNA 2KP2A 3APOA 3KD0A 3KH7A 1SJ6A 1WPIA 2LJKA 2NTOA 3LEFA 2IMIA 3S9FA 2B6MA 4CHSA 2GDRA 5DQYA 4JEDA 2R37A 3A2VA 2H30A 4PXOA 2GQMA 4J56E 4YAVA 2OJLA 2YWOA 2F3MA 4ZB9A 3KMOA 3GSSA 3F6FA 5ENUA 4FH8A 2LRTA 5B6NA 3SBCA 1X5CA 2C4JA 1LBKA 2HI7A 5ID2B 3G9BA 3EWLA 1THOA 1FW1A 2QC7A 4IVFA 2HSHA 2XHFA 3DIEA 4LL4B 1XWGA 3E9JB 4GCIA 1JHBA 1EGOA 4NAXA 1A2MA 4ZBDA 1BQ7A 1QK8A 2AHEA 3LQ7A 2V1MA 2E0QA 3MWHA 1KNGA 1TDIA 2VIMA 5DALB 1JLVA 2H1DA 2TRXA 3DYRA 3QAVA 1TKDB 3TB2A 1XW9A 5J5NA 5LD0A 1TTZA 2H1BA 3LORA 2ON7A 4CDOA 1PKWA 5G5FA 2H72A 2VCZA 4GRFA 5IIZA 3VWVA 2WFCA 1K0OA 2VLTA 4JR4A 5J41A 2FA8A 4RI7A 2DBCA 4BWSA 1VF1A 3OR5A 4MZWA 4IELA 4OMVA 4Q5RA 2GQLA 1M99A 3FEUA 3UOMA 1XCCA 2RUEA 5B8AA 3RPNA 1JZRA 3TJKA 2E7PA 5GAND 3RDWA 1PGTA 3H79A 4TR1B 3VURA 2FY6A 3FY7A 3DVXA 2F8AA 1TP9A 1FVJA 3HCZA 5DJMA 1T4YA 5F07A 1EEMA 3KTLA 1TXXA 3KP8A 1SJZA 2DMLA 1GUMA 1AIUA 4CW9A 4GSSA 3EU4A 1JZDA 2KP1A 1GSFA 3VK9A 1TRSA 1PRXA 4LMWA 3F9UA 1CQGA 3GKXA 2GT5A 4IQ1A 3L78A 4WF4A 13GSA 4OCFA 1A0RP 4F9ZA 2XPEA 3CSIA 4YH2A 2MBSA 1EP7A 3E0UA 2H19A 2H8LA 3TJFA 1WOUA 5AIXA 3EU3A 1Z9HA 2CVDA 3D4TA 3WGEA 2D2ZA 1N2AA 1PD21 2OACA 4RUVA 3LYKA 1C72A 5FWGA 4BVXA 5DJLA 4KW6A 2C3QA 3EURA 3RHCA 4RI6A 2WS2A 3EE2A 1TOFA 1ST9A 1K3LA 4NXIA 1ERWA 3FYGA 4MJBA 2VAFA 3CSJA 1PX6A 1F6MC 4V2LA 4EUYA 3TJBA 5GAPD 1UVZA 4ECJA 5HQPA 3D22A 3F6DA 2R5GA 1O7UA 4E8HA 1WP0A 2KHPA 4MMMA 5ECRB 3TJJA 4EO3A 1GSQA 2YV7A 2HZFA 1ZL9A 2LUSA 3RBTA 2LQOA 2ES7A 2L6CA 1GNEA 1GRXA 2FNOA 4MPFA 1SL1B 5JWOB 1ZYQB 1O6JA 4PURA 4PQ1A 1A8YA 3ED3A 4V1Ag 4Z7XA 3F63A 3HDCA 1M2DA 2CVBA 3TKRA 5J4UA 3GRXA 5EPFA 2P0GA 1YZXA 1GSDA 4PUAA 4NWYA 1UA5A 3FR6A 5CP1A 2X8GA 1ILOA 3CBUA 1TRUA 12GSA 3TKSA 2DJKA 4D73B 1TU7A 5ECIB 2VOCA 4IGJA 1XVQA 4IJIA 1TI3A 2B7KA 3ME8A 3I69A 3GA4A 2HXKA 2PVQA 5IM9A 2P5QA 5A4UA 2CV4A 5IMZA 2LV3A 3O6TA 1OKTA 5KN2A 1U88A 2GZZA 4KCAA 2YV9A 3F4SA 1MD4A 4TW5A 2WB9A 2X8HA 4I2TA 2J23A 3HVXA 1H75A 4FYUA 1AC1A 2I3YA 3I6AA 2H74A 3H1NA 1ZOFA 3UIWA 3TOTA 3RAZA 2DJ1A 1FAAA 1FB6A 2HT9A 1GL8A 4MJAA 2VD0A 4IJ3A 1X0RA 2XBQA 2C0GA 2IMKA 2BTOT 1SK2A 1M0UA 3GUSA 3UEMA 1XW6A 5C04A 2IFQA 4JBBA 4HOJA 2FCHA 2MMNA 3M9KA 3NOFA 4BA7A 2H76A 2H0GA 1F37A 5CRDA 1R5AA 2REMA 4O92A 3US3A 1YQ1A 1K3OA 2V6KA 4HUAA 1OAZA 3Q6OA 4F2IA 1A8LA 3EC3A 4EL1A 1XW5A 4EKZA 5HFKA 4BVYA 2YWNA 1SL2B 4I5QA 3IHQA 2CA8A 5CYYA 4GSNA 2I4AA 5IO0A 4KSOA 2VM1A 4HI7A 3VI7A 3APQA 2VL3A 2K8VA 2KOKA 4MPGA 3BCKA 3IAM2 4YQMA 2OADA 4L0WA 1GULA 2CZ2A 3FW2A 1KBNA 3CRTA 5H5SA 2YWIA 1O85A 3TKSE 3ERWA 2FGXA 1J08A 5A5KA 2JSZA 5GSTA 5ECMB 2H6XA 5IOWA 4HQSA 3MSZA 5B8BA 1USBA 2O8VB 2JZTA 4IW9A 1HNBA 22GSA 3GTUB 1BEDA 4YQVA 1MTCA 2CQ9A 1XWAA 5JCWA 5IPHA 4MK3A 4N30A 4K1FA 2B1LA 3DEXA 3VWUA 1O8WA 1I5GA 3GURA 2WGRA 3M8NA 2HZEA 3IXRA 2H0HA 6GSVA 5IQYA 2IMEA 2L4CA 4X1UA 4KDXA 2H66A 2DSAA 2H1AA 3ZITA 5HR0A 2DIYA 2LQQA 4WF5A 3L9UA 1QUWA 3MAKA 5GZZB 5HFGA 3PH9A 20GSA 4L0UA 3VI5A 2YCDA 1A2LA 1HYUA 5IMDA 4ZL8A 1PL2A 3APSA 1VF3A 1G6YA 2M46A 2AAWA 3UARA 2OBIA 4N10A 2QKEA 2L59A 2KUCA 3GKKA 1AQWA 2N5FA 1SK1A 3FRCA 2JZRA 4XS1A 2AJQB 3EVIA 4LL1B 1A0FA 1XPVA 2OBKA 3H4KA 4ZBAA 6GSYA 3TRQA 5F05A 2GSTA 4TR0A 2RM6A 1SD8A 3D4MA 2P5RA 3L9SA 2VCQA 1B9XC 2LRCA 3GFKA 4ECBA 2K8SA 1EGRA 4QQ7A 3LFLA 5DVBA 4YQUA 1GTBA 2IL3A 2NDOA 3KXOA 5HR3A 4MABA 3FR9A 1DUGA 3W8JA 1TJDA 1TRWA 3QD9A 1RW1A 2Z9SA 5AISA 1U6TA 5CRWA 5IMFA 4BPYA 3F3RA 3HKRA 1W4VA 3TRPA 1GWCA 4MF5A 1QFNA 1VF2A 2N5BA 2EIQA 2G0FA 4FYCA 1YF0A 2B7JA 4MCUA 4QL7A 4MF6A 3ZTLA 2C8UA 2LS5A 9GSSA 3GH9A 2IMFA 2WDUA 4KSMA 1OC9A 4KE3A 1MDKA 3ZVJA 4DSRA 1FHEA 2NVLA 5JWRB 2AB6A 4ML6A 5ECOB 2M72A 3KM6A 2PU9C 3EMXA 2DIZA 1BG5A 3VPQA 3EYTA 2O89A 4LMVA 2GZPA 2MYGA 1RQMA 1FG4A 3CRUA 2PMTA 1EZKA 4GLTA 2HE3A 3QCPA 1WE0A 3C73A 3CTGA 2GSRA 1XWCA 4HQZA 3ZMKA 3BJ5A 5G2ZA 3DVWA 4KH7A 4OD7A 2DLXA 3UJ1A 3UVTA 4F0BA 4EDYA 1CQHA 1X9WB 2VD1A 2OKAA 3GL5A 3GSTA 1MD3A 3VLNA 1GNWA 3TCOA 1Q98A 2BJXA 4NHZA 3FR3A 2WJUA 6GSUA 4LLRA 1PN9A 1Z6MA 3DGQA 2MMAA 1U3IA 1H4OA 4TXOB 4GTUA 4IKHA 2JU5A 3KCMA 4L8EA 4OWYA 2RUFA 4K6XA 4NMUA 3RHBA 1K0MA 5ECQB 1T3BA 5J9CA 1BJXA 1F2EA 1GUKA 3HXSA 1FVKA 1Z5YE 4K2DA 2DJ0A 1XOAA 2O7KA 2YJHA 3LWAA 3GNJA 1SK0A 2OE3A 5G31A 1EEJA 2LKUA 3BBYA 1R5PA 2H70A 3C1SA 1GTUA 1B8XA 1QQ2A 4V2MA 3C71A 4MLYA 4G2EA 4G9HA 3W8SA 5D8IA 2GZYA 1WIKA 2AYTA 1UC7A 4RQRA 4PQHA 5A4VA 1OVNA 2C0DA 2H6YA 3EMPA 4IP6A 3IPZA 4I6XA 2PVOC 2OA7A 4X0XA 1EP8A 6GSWA 5ECNB 2FWGA 3DD3A 1TK5B 3TKQA 2VL2A 1R7HA 3LYPA 4MJEA 2B3SA 2PERA 4X43A 3QAWA 4NV5A 2ZNMA 2GGTA 5B7CA 2I1UA 4IQAA 3F4TA 4XS6A 3GYKA 1X9MB 3KGKA 2QSIA 1GH2A 4XS4A 1TK8B 2IN3A 5H5QA 1M7TA 2J9HA 2VCVA 3GKNA 3J7Yb 4V1Ap 1NHOA 1RK4A 2LNSA 5CRHA 4ZILA 3GX8A 3M9JA 2YNXA 4ML1A 1K0CA 3DXBA 3HJPA 2NPBA 1YEPA 5CNWA 2LTKA 4PQIA 4K9ZA 1Z7PA 3PGTA 1B4QA 2VCTA 2CX4A 2YOIA 1NSWA 3NIVA 1SKWB 2E2GA 4GWRA 2VCXA 1I9DA 2V41A 4XRDA 3C1RA 4TR4A 2PUKC 1GLPA 4GF0A 1XXUA 2RM5A 4QL9A 5AIVA 1M9BA 3IRAA 1ML6A 2JZSA 2JACA 1VF4A 5GSSA 1T8EB 3HA9A 2TRCP 3IV4A 1B4PA 3D6IA 5CO3A 1TI1A 4F0CA 1EOHA 3KEBA 3L0HA 1AQVA 2O85A 1JLWA 1ON4A 5F8BA 3RPPA 2K6VA 16GSA 3ERFA 1XWKA 2CZ3A 4K7OA 1SJIA 1SL0B 5CREA 1OC3A 2VCWA 4ULXA 1YEXA 4KNDA 4J57E 4WBRD 2DJ3A 1TW9A 1F3BA 4HS1A 1O73A 3F4RA 3KP9A 3FZ5A 1KTEA 1U3AA 3L9VA 1GLQA 5FT3A 1YF1A 4KGIA 3IC4A 4MH2A 3IAS2 2GSQA 2IFQB 3C7MA 2C0FA 1ZCPA 4I97A 3A5WA 4DSSA 4KB3A 5LCZA 5D9XA 4KDUA 1A24A 1FB0A 1T1VA 4BL7A 5IOXA 4ECCA 2H1GA 3U6VA 10GSA 5EY6A 2NBSA 1OC8A 4XRAA 4IN0A 5J3RA 4YAPA 3WD6A 3VPTA 3ZFBA 3GH6A 4MJCA 4ZXGA 2H71A 2OE1A 1BAYA 2GLRA 4L5LA 5IO2A 2V2GA 4RQXA 3L4NA 1G7OA 2TIRA 1EV4A 3DWVA 4F82A 3DRNA 5D9WA 2DJJA 3BD2A 1PMTA 2FD3A 3ME7A 1WJKA 5G1KA 1OE7A 1AUCA 3GX0A 3UBLA 5ELGA 1LJRA 3ZIVA 3FZ4A 1BX9A 1Z3EA 4LA1A 2A4VA 4POLA 5E59A 1DSBA 4POMA 4HEA2 2L5OA 4HJ2A 3GL3A 1JZOA 3WGDA 3LSZA 3CYNA
chains in the Genus database with same CATH superfamily
2ALBA 2IJYA 3CXGA 5HR2A 4XTSA 4K0GA 3M3MA 3ZZXA 3U5RE 1X9SB 3LJRA 5EL8A 3UL3A 1TRVA 4EDZA 1EWXA 5C00A 1Z6NA 3CMIA 1S3AA 3M1GA 4N0VA 3HZ8A 4TKYA 5HFIA 2JL4A 2MMZA 4N0ZA 2O87A 3IE3A 4FYBA 4Q5FA 3UVHA 1VRSD 3F8UA 4K8MA 3Q74A 2LJAA 3TKSC 2H0IA 4OO5A 7GSSA 3A2WA 3D21A 4ZL9A 2X4AA 1GSUA 1M2BA 3IA1A 3A3TA 1AXDA 4JRRA 5DQSA 2FUG2 2QGVA 17GSA 1ZZYA 1XOBA 4ZL7A 5DAKA 3IOSA 4MF7A 4K7NA 3WT2A 1URMA 3PINA 2R6KA 1T4ZA 4G0KA 4JE1A 1SENA 5LNKe 1E6BA 2EIRA 3QMXA 3UAPA 5G30A 2K18A 3GIXA 1B48A 1S3DA 2OE0A 1XG8A 2FA4A 4GXZA 4O5RA 3FKFA 2PGTA 1B9YC 2R0CA 3GV1A 2GTUA 3ZLPA 2LRNA 3LGCA 1XFLA 3HVVA 5IMAA 2L6DA 5D9VA 2AV4A 4BWQA 3H93A 5B6MA 2I9HA 3IK7A 3MYDA 1GSSA 2C3NA 3A2XA 4G10A 1F3AA 1PSQA 4Q5NA 2V32A 1G6WA 1NM3A 2B5XA 1SKSB 2L4QA 2YPMA 3JCML 2LJRA 5ECSA 4KA0A 1J9BA 3QFBC 1SKRB 2YZUA 2BMXA 3TOUA 4HDEA 1ABAA 4GSTA 3Q19A 4MA9A 1J0FA 4KX4A 2R2JA 2WRTA 3V1WA 1OC9B 1PQNA 4POKA 1EOGA 2WZ9A 2YJ7A 1Y25A 4ISDA 4JU5A 5ID2A 2M80A 4MZCA 1T00A 3TGZA 4NPBA 4WKWA 3F0IA 1X5EA 1YY7A 1PA3A 3C8EA 3O3TA 2VO4A 4WR4A 4NHWA 1V9WA 4TN8A 2X99A 3QOUA 3UBKA 4P3YB 5HR1A 4WEYA 5DALA 2GSSA 5FHIA 1V2AA 5J9BA 2L57A 2PN8A 4TVEA 1QGVA 5ECPB 3HHVA 4KDYA 1LU4A 1AAZA 4OFNA 3P7XA 2DC5A 2LSTA 1QXHA 4AJ7A 3EINA 2VL9A 1GSEA 1PL1A 1S3RA 1FO5A 3IHGA 1AW9A 3IK9A 5INYA 1M9AA 2A2SA 2GS3A 2MMOA 4OCEA 3PR8A 2X8CA 4PTSA 3QPMA 4GQCA 4ZB8A 2H75A 2I81A 4TOPA 3QAGA 4TXOA 2A2PA 2QA1A 3P90A 2X64A 2FWFA 3IC8A 1K0NA 4O7HA 2VLUA 4MP4A 1KEBA 2CT6A 2JADA 3D5JA 4ILFA 2WULA 4MNNA 4J2FA 4TR1A 3IBHA 2DKHA 4O5QA 1OYJA 3DKSA 1NW2A 2HSMA 1HD2A 1M2AA 3TKPA 4CY6A 2ZCTA 1ERTA 4N11A 2YZHA 4TR3A 1NHYA 1PN0A 1K3YA 5F06A 1QMVA 4WXTA 2JSYA 4FQUA 1K0BA 5D96A 1G0TA 1IYHA 1YKCA 2G2QA 3HJMA 4E8EA 1HQOA 11GSA 4EXJA 2X49A 1K0AA 4TRXA 3VWWA 1SYRA 6GSSA 3Q18A 2IMDA 3ERGA 1V98A 4EIQA 1UN2A 2P31A 3FZAA 4HU7A 3TRXA 4MZBA 4Z2RA 2B5EA 2FLSA 1SYXA 2CAIA 4ID0A 4XIHA 4DEJA 2WCIA 1V57A 1Z7RA 5KEJA 4KF9A 3HJOA 1ACVA 5D9TA 1HNAA 1W89A 4XS4B 1R26A 3AY8A 1XWBA 2IIYA 4KAEA 4HZ4A 1BYEA 2XPDA 3W6GA 2C3TA 4FIWA 4IS0A 4EC0A 3FHKA 3ZREA 2ON5A 2DKIA 2XC2A 3GHAA 1GTIA 1OKDA 1XZOA 3GMFA 1YDKA 2HFDA 1XVWA 5ECLB 2E2MA 2GVPA 5JCGA 2PPTA 3HVSA 2L5LA 1XIYA 4K0NA 5F0GA 2VM2A 1YJ6A 3R2QA 5ABRA 1U87A 2EC4A 2CVKA 1T7PB 3G7JA 3D0ZA 3WGXA 2F51A 4AJ6A 18GSA 4JZQA 5KN3A 4PNGA 3O76A 3UMAA 3KMNA 2FWEA 2A2RA 5EVOA 2CAQA 3IDVA 1DE2A 3GN3A 2PBJA 4D73A 1ERVA 3J7Yk 5ELAA 1HNCA 4EE0A 3VFIA 4IBPA 3IR4A 3ZVJD 2B5YA 2VUPA 2HSYA 2YN1A 3GKMA 2B1KA 4OFTA 3I43A 4HZ2A 2FWHA 2PWJA 3ZL5A 3HVNA 4HJMA 3FK8A 2HLSA 6GSXA 4DVCA 3N9JA 5ECKB 3SWLA 4A5PA 2FHEA 5E4WA 1JZWA 1PX7A 5BMUA 3TDGA 1A23A 3P2AA 19GSA 4V2NA 3MDKA 4O5UA 3ZFLA 4I8BA 4DSSB 5KN1A 4Q5QA 2DMMA 5D73A 1V58A 1PKZA 4EVMA 4BL7B 2C80A 1OE8A 4PGTA 5IMCA 2GT6A 3ZMLA 1WMJA 2YP6A 3ZRDA 1O8XA 3NZNA 2R4VA 3G7YA 3BOAA 4ACSA 3FZ9A 4MDCA 2R0GA 1TK0B 4AJ8A 4PUFC 2AUVA 5A4WA 2KLXA 4ZBBA 5DBQA 4JR6A 2GQKA 5D93A 2VL2C 1ZGNA 1FOVA 1GP1A 4ECIA 1G7EA 4FO5A 3HZ4A 1AQXA 2H01A 1JFUA 4F03A 5DDLA 4WBJA 1MDIA 4AF2A 3K8NA 2DJ2A 4ZIJA 1DE1A 2EIOA 3G7IA 2XBIA 3TJGA 1S3CA 2HYXA 5IMVA 2LNTA 14GSA 3HD5A 4ZB6A 3CSHA 4AGSA 4POBA 3ZIJA 3HYPA 3F3QA 1WRYA 5COHA 1GTAA 2MBTA 1ZYEA 3LXTA 4IP1A 4OFMA 1SD9A 3M0FA 2YWMA 1Q4JA 6GSTA 1GUHA 1MEKA 1Y6EA 2ZUPA 4OO4A 1SU9A 5DCHA 2RIIA 5ECHB 4I2UA 5H5RA 3R3EA 3VWXA 4XHMA 1ZMAA 4PNFA 3ZYWA 2C1YA 2IWTA 2CX3A 3KTBA 2A4HA 4KUNA 1N8JA 2F9SA 1IYIA 1V40A 2HZEB 1X5DA 5DCGA 3GTUA 1R4WA 4K7IA 3HY2A 4WETA 1DBYA 1VGLA 5G5EA 2N5AA 3LG6A 5JCUA 4L5OA 8GSSA 4X4JA 3KZQA 1GSYA 3ISOA 5AN1A 4G0IA 1O81A 3H8QA 2YANA 2HRFA 2IPAA 5DAKB 3QDNA 2H6ZA 2LEGA 4KCEA 4DSQA 1F9MA 1WWJA 3I9V2 2RLIA 3LXZA 2VLVA 4WR5A 3TUEA 4GQFA 3N5OA 2HNLA 4IHUA 4PX1A 4MH3A 3E3EA 2H73A 3DMLA 3WYWA 1ERUA 3KH9A 5IPGA 1THXA 4XCSA 1MDJA 4EF0A 4NV2A 5CRGA 3KIJA 5G1LA 2V6OA 2F8FA 1K0DA 5CAXA 1YKAA 3WT1A 3CTFA 5AGYA 3BCIA 3P8WA 5JWQB 5L71A 2C0EA 3MNGA 1A2JA 4H86A 3QFAC 1EV9A 2R3XA 4TXVA 3QR6A 3KJYA 4HU9A 1E2YA 4O32A 2MZCA 4G19A 2K9FA 1XBSA 5KN0A 1TU8A 2HRNA 2KP2A 3APOA 3KD0A 3KH7A 3A5IA 1SJ6A 1WPIA 2LJKA 2QA2A 2NTOA 3LEFA 2IMIA 3S9FA 2B6MA 4CHSA 2GDRA 5DQYA 4JEDA 2R37A 3A2VA 2H30A 4PXOA 2GQMA 4J56E 4YAVA 4EIPA 2OJLA 2YWOA 2F3MA 4ZB9A 3KMOA 3GSSA 3F6FA 5ENUA 4FH8A 2LRTA 5B6NA 3SBCA 1X5CA 2C4JA 1LBKA 2HI7A 5ID2B 3G9BA 3EWLA 1THOA 1FW1A 2QC7A 4IVFA 2HSHA 2XHFA 3DIEA 4LL4B 1XWGA 3E9JB 4GCIA 1JHBA 1EGOA 4NAXA 1A2MA 4ZBDA 1BQ7A 1QK8A 2AHEA 3LQ7A 2V1MA 2E0QA 3MWHA 1KNGA 1TDIA 2VIMA 5DALB 1JLVA 2H1DA 2TRXA 3DYRA 3QAVA 1TKDB 3TB2A 1XW9A 5J5NA 5LD0A 2HRKA 1TTZA 2H1BA 3LORA 2ON7A 4CDOA 1PKWA 5G5FA 2H72A 2VCZA 4GRFA 5IIZA 3VWVA 2WFCA 1K0OA 2VLTA 4JR4A 5J41A 2FA8A 4RI7A 2DBCA 4BWSA 1VF1A 3OR5A 4MZWA 4IELA 4OMVA 4Q5RA 2GQLA 1M99A 3FEUA 3UOMA 1XCCA 2RUEA 5B8AA 3RPNA 1JZRA 3TJKA 2E7PA 5GAND 3RDWA 1PGTA 3H79A 4TR1B 3VURA 2FY6A 3FY7A 3DVXA 2F8AA 1TP9A 1FVJA 3HCZA 5DJMA 1T4YA 5F07A 1EEMA 3KTLA 1TXXA 3KP8A 1SJZA 2DMLA 1GUMA 1AIUA 4CW9A 4GSSA 3EU4A 1JZDA 2KP1A 1GSFA 3VK9A 1TRSA 1PRXA 4LMWA 3F9UA 1CQGA 3GKXA 2GT5A 4IQ1A 3L78A 4WF4A 13GSA 4OCFA 1A0RP 4F9ZA 2XPEA 3CSIA 4YH2A 2MBSA 1EP7A 4USSA 3E0UA 2H19A 2H8LA 3TJFA 1WOUA 5AIXA 3EU3A 1Z9HA 2CVDA 3D4TA 3WGEA 2D2ZA 1N2AA 1PD21 2OACA 1M3IA 4RUVA 3LYKA 1C72A 5FWGA 4BVXA 5DJLA 4KW6A 2C3QA 3EURA 3RHCA 4RI6A 2WS2A 3EE2A 1TOFA 1ST9A 1K3LA 1PFOA 4NXIA 1ERWA 3FYGA 4MJBA 2VAFA 3CSJA 1PX6A 1F6MC 4YKFA 4V2LA 4EUYA 3TJBA 5GAPD 1UVZA 4ECJA 5HQPA 3D22A 3F6DA 2R5GA 1O7UA 4E8HA 1WP0A 2KHPA 4MMMA 5ECRB 3TJJA 4EO3A 1GSQA 2YV7A 2HZFA 1ZL9A 2LUSA 3RBTA 2LQOA 2ES7A 2L6CA 1GNEA 4K2XA 1GRXA 2FNOA 4MPFA 1SL1B 1M3JA 5JWOB 1ZYQB 1O6JA 4PURA 4PQ1A 1A8YA 3ED3A 4V1Ag 4Z7XA 3F63A 3HDCA 1M2DA 2CVBA 3TKRA 5J4UA 3GRXA 5EPFA 2P0GA 1YZXA 1GSDA 4PUAA 4NWYA 1UA5A 3FR6A 5CP1A 2X8GA 1ILOA 3CBUA 1TRUA 12GSA 3TKSA 2DJKA 4D73B 1TU7A 5ECIB 2VOCA 4IGJA 1XVQA 4IJIA 1TI3A 2B7KA 3ME8A 3I69A 3GA4A 2HXKA 2PVQA 3FMWA 2UZ8A 5IM9A 2P5QA 5A4UA 4Z2TA 2CV4A 5IMZA 2LV3A 3O6TA 1OKTA 5KN2A 1U88A 2GZZA 4KCAA 2YV9A 3F4SA 1MD4A 4TW5A 2WB9A 2X8HA 4I2TA 2J23A 3HVXA 1H75A 4FYUA 1AC1A 2I3YA 3I6AA 2H74A 3H1NA 1ZOFA 2HRAA 3UIWA 3TOTA 3RAZA 2DJ1A 1FAAA 1FB6A 2HT9A 1GL8A 4MJAA 2VD0A 4IJ3A 1X0RA 2XBQA 3CQFA 4YKGA 2C0GA 2IMKA 2BTOT 1SK2A 1M0UA 3GUSA 3UEMA 1XW6A 5C04A 2IFQA 4JBBA 4HOJA 2FCHA 2MMNA 3M9KA 3NOFA 4BA7A 2H76A 2H0GA 1F37A 5CRDA 1R5AA 4K5SA 2REMA 4O92A 3US3A 1YQ1A 1K3OA 2V6KA 2R0PA 3MIXA 4HUAA 1OAZA 3Q6OA 4F2IA 1A8LA 3EC3A 4EL1A 1XW5A 4EKZA 5HFKA 4BVYA 2YWNA 1SL2B 4I5QA 3IHQA 2CA8A 5CYYA 4GSNA 2I4AA 4G0LA 5IO0A 4KSOA 2VM1A 4HI7A 3VI7A 3APQA 2VL3A 2K8VA 2KOKA 4MPGA 3BCKA 3IAM2 4YQMA 2OADA 4L0WA 1GULA 2CZ2A 3FW2A 1KBNA 3CRTA 5H5SA 2YWIA 1O85A 3TKSE 3ERWA 2FGXA 1J08A 5A5KA 2JSZA 5GSTA 5ECMB 2H6XA 5IOWA 4HQSA 3MSZA 5B8BA 1USBA 2O8VB 2JZTA 4IW9A 1HNBA 22GSA 3GTUB 1BEDA 4YQVA 1MTCA 2CQ9A 1XWAA 5JCWA 5IPHA 4MK3A 4N30A 4K1FA 2B1LA 3DEXA 3VWUA 1O8WA 1I5GA 3PPUA 3GURA 2WGRA 3M8NA 2HZEA 3IXRA 2H0HA 6GSVA 5IQYA 2IMEA 2L4CA 4X1UA 4KDXA 2H66A 2DSAA 2H1AA 3ZITA 5HR0A 2DIYA 1ZYPA 2LQQA 4WF5A 3L9UA 1QUWA 3MAKA 5GZZB 5HFGA 3PH9A 20GSA 4L0UA 3VI5A 2YCDA 1A2LA 1HYUA 5IMDA 4ZL8A 1PL2A 3APSA 1VF3A 1G6YA 2M46A 2AAWA 3UARA 2OBIA 4N10A 2QKEA 2L59A 2KUCA 3GKKA 1AQWA 2N5FA 1SK1A 3FRCA 2JZRA 4XS1A 2AJQB 3EVIA 4LL1B 1A0FA 1XPVA 2OBKA 3H4KA 4ZBAA 6GSYA 3TRQA 5F05A 2GSTA 4TR0A 2RM6A 1SD8A 3D4MA 2P5RA 3L9SA 2VCQA 1B9XC 2LRCA 3GFKA 4ECBA 2K8SA 1EGRA 4QQ7A 3LFLA 5DVBA 4YQUA 1GTBA 2IL3A 2NDOA 3KXOA 5HR3A 4MABA 3FR9A 1DUGA 3W8JA 1TJDA 1TRWA 3QD9A 1RW1A 2Z9SA 5AISA 1U6TA 5CRWA 5IMFA 4BPYA 3F3RA 3HKRA 1W4VA 3TRPA 1GWCA 4MF5A 1QFNA 1VF2A 2N5BA 2EIQA 2G0FA 4FYCA 1YF0A 2B7JA 4MCUA 4QL7A 4MF6A 3ZTLA 2C8UA 2LS5A 9GSSA 3GH9A 1FOHA 2IMFA 2WDUA 4KSMA 1OC9A 4KE3A 1MDKA 3ZVJA 4DSRA 1FHEA 2NVLA 5JWRB 2AB6A 4ML6A 5ECOB 2M72A 3KM6A 2PU9C 3EMXA 2DIZA 1BG5A 3VPQA 3EYTA 2O89A 4LMVA 2GZPA 2MYGA 1RQMA 1FG4A 3CRUA 2PMTA 1EZKA 4GLTA 2HE3A 3QCPA 1WE0A 3C73A 3CTGA 2GSRA 1XWCA 4HQZA 3ZMKA 3BJ5A 5G2ZA 3DVWA 4KH7A 4OD7A 2DLXA 3UJ1A 3UVTA 4F0BA 4EDYA 1CQHA 5KOXA 1X9WB 2VD1A 2OKAA 3GL5A 3GSTA 1MD3A 3VLNA 3EPTA 1GNWA 3TCOA 1Q98A 2BJXA 4NHZA 3FR3A 2WJUA 6GSUA 4LLRA 1PN9A 1Z6MA 3DGQA 2MMAA 1U3IA 1H4OA 4TXOB 4HSCX 4GTUA 4IKHA 2JU5A 3KCMA 4L8EA 4OWYA 2RUFA 4K6XA 4NMUA 3RHBA 1K0MA 5ECQB 1T3BA 5J9CA 1BJXA 1F2EA 1GUKA 3HXSA 1FVKA 1Z5YE 4K2DA 2DJ0A 1XOAA 2O7KA 2YJHA 3LWAA 3GNJA 1SK0A 2OE3A 5G31A 1EEJA 2LKUA 3BBYA 1R5PA 2H70A 3C1SA 1GTUA 1B8XA 1QQ2A 4V2MA 3C71A 4MLYA 4G2EA 4G9HA 3W8SA 5D8IA 2GZYA 1WIKA 2AYTA 1UC7A 4RQRA 4PQHA 5A4VA 1OVNA 2C0DA 2H6YA 3EMPA 4IP6A 3IPZA 4I6XA 2PVOC 2OA7A 4X0XA 5KOWA 1EP8A 6GSWA 5ECNB 2FWGA 3DD3A 1TK5B 4BVXB 3TKQA 2VL2A 1R7HA 3LYPA 4MJEA 2B3SA 2PERA 4X43A 3QAWA 4NV5A 2ZNMA 4BIKA 2GGTA 5B7CA 2I1UA 4IQAA 3F4TA 4XS6A 3GYKA 1X9MB 3KGKA 2QSIA 1GH2A 4K5RA 4XS4A 1TK8B 2IN3A 5H5QA 1M7TA 2J9HA 2VCVA 3GKNA 3J7Yb 4V1Ap 1NHOA 1RK4A 2LNSA 5CRHA 4ZILA 3GX8A 3M9JA 2YNXA 4ML1A 1K0CA 3DXBA 3HJPA 2NPBA 1YEPA 5CNWA 2LTKA 4PQIA 4K9ZA 3LW9A 1Z7PA 3PGTA 4ICYA 1B4QA 2VCTA 1ZYNA 2CX4A 2YOIA 1NSWA 3NIVA 1SKWB 2E2GA 4GWRA 2VCXA 1I9DA 2V41A 4XRDA 3C1RA 4TR4A 2PUKC 1GLPA 4GF0A 1XXUA 2RM5A 4QL9A 5AIVA 1M9BA 3IRAA 1ML6A 2JZSA 2JACA 1VF4A 5GSSA 1T8EB 3HA9A 2TRCP 3IV4A 1B4PA 3D6IA 5CO3A 1TI1A 4F0CA 1EOHA 3KEBA 3L0HA 1AQVA 2O85A 1JLWA 1ON4A 5F8BA 3RPPA 2K6VA 16GSA 3ERFA 1XWKA 2CZ3A 4K7OA 1SJIA 1SL0B 5CREA 1OC3A 2VCWA 4ULXA 1YEXA 4KNDA 4J57E 4WBRD 2DJ3A 1TW9A 1F3BA 4HS1A 1O73A 3F4RA 3KP9A 3FZ5A 1KTEA 1U3AA 3L9VA 1GLQA 5FT3A 1YF1A 4KGIA 3IC4A 4MH2A 3IAS2 2GSQA 2IFQB 3C7MA 2C0FA 1ZCPA 4I97A 3A5WA 4DSSA 4KB3A 5LCZA 5D9XA 4KDUA 1A24A 1FB0A 1T1VA 4BL7A 5IOXA 4ECCA 2H1GA 3U6VA 10GSA 5EY6A 2NBSA 1OC8A 4Z2UA 4XRAA 4IN0A 5J3RA 4YAPA 3WD6A 3VPTA 4CY8A 3ZFBA 3GH6A 4MJCA 4ZXGA 2H71A 2OE1A 1BAYA 2GLRA 4L5LA 4BVYB 5IO2A 2V2GA 4RQXA 3L4NA 1G7OA 2TIRA 5BRTA 1EV4A 3DWVA 4F82A 3DRNA 5D9WA 2DJJA 3BD2A 1PMTA 2FD3A 3ME7A 1WJKA 5G1KA 1OE7A 1AUCA 3GX0A 3UBLA 5ELGA 1LJRA 3ZIVA 3FZ4A 1BX9A 1Z3EA 4LA1A 2A4VA 4POLA 1DSBA 4POMA 5E59A 4HEA2 2L5OA 4HJ2A 3GL3A 1JZOA 3WGDA 3LSZA 3CYNA
chains in the Genus database with same CATH topology
2ALBA 2IJYA 3CXGA 5HR2A 4XTSA 4K0GA 3M3MA 3ZZXA 3U5RE 1X9SB 3LJRA 5EL8A 3UL3A 1TRVA 4EDZA 1EWXA 5C00A 1Z6NA 3CMIA 1S3AA 3M1GA 4N0VA 3HZ8A 4TKYA 5HFIA 2JL4A 2MMZA 4N0ZA 2O87A 3IE3A 4FYBA 4Q5FA 3UVHA 1VRSD 3F8UA 4K8MA 3Q74A 2LJAA 3TKSC 2H0IA 4OO5A 7GSSA 3A2WA 3D21A 4ZL9A 2X4AA 1GSUA 1M2BA 3IA1A 3A3TA 1AXDA 4JRRA 5DQSA 2FUG2 2QGVA 17GSA 1ZZYA 1XOBA 4ZL7A 5DAKA 3IOSA 4MF7A 4K7NA 3WT2A 1URMA 3PINA 2R6KA 1T4ZA 4G0KA 4JE1A 1SENA 5LNKe 1E6BA 2EIRA 3QMXA 3UAPA 5G30A 2K18A 3GIXA 1B48A 1S3DA 2OE0A 2FA4A 4GXZA 4O5RA 3FKFA 2PGTA 1B9YC 2R0CA 3GV1A 2GTUA 3ZLPA 2LRNA 3LGCA 1XFLA 3HVVA 5IMAA 2L6DA 5D9VA 2AV4A 4BWQA 3H93A 5B6MA 2I9HA 3IK7A 3MYDA 1GSSA 2C3NA 3A2XA 4G10A 1F3AA 1PSQA 4Q5NA 2V32A 1G6WA 1NM3A 2B5XA 1SKSB 2L4QA 2YPMA 3JCML 2LJRA 5ECSA 4KA0A 1J9BA 3QFBC 1SKRB 2YZUA 2BMXA 3TOUA 4HDEA 1ABAA 4GSTA 3Q19A 4MA9A 1J0FA 4KX4A 2R2JA 2WRTA 3V1WA 1OC9B 1PQNA 4POKA 1EOGA 2WZ9A 2YJ7A 1Y25A 4ISDA 4JU5A 5ID2A 2M80A 4MZCA 1T00A 3TGZA 4NPBA 4WKWA 3F0IA 1X5EA 1YY7A 1PA3A 3C8EA 3O3TA 2VO4A 4WR4A 4NHWA 1V9WA 4TN8A 2X99A 3QOUA 3UBKA 4P3YB 5HR1A 4WEYA 5DALA 2GSSA 5FHIA 1V2AA 5J9BA 2L57A 2PN8A 4TVEA 1QGVA 5ECPB 3HHVA 4KDYA 1LU4A 1AAZA 4OFNA 3P7XA 2DC5A 2LSTA 1QXHA 4AJ7A 3EINA 2VL9A 1GSEA 1PL1A 1FO5A 3IHGA 1AW9A 3IK9A 5INYA 1M9AA 2A2SA 2GS3A 2MMOA 4OCEA 3PR8A 2X8CA 4PTSA 3QPMA 4GQCA 4ZB8A 2H75A 2I81A 4TOPA 3QAGA 4TXOA 2A2PA 2QA1A 3P90A 2X64A 2FWFA 3IC8A 1K0NA 4O7HA 2VLUA 4MP4A 1KEBA 2CT6A 2JADA 3D5JA 4ILFA 2WULA 4MNNA 4J2FA 4TR1A 3IBHA 2DKHA 4O5QA 1OYJA 3DKSA 1NW2A 2HSMA 1HD2A 1M2AA 3TKPA 4CY6A 2ZCTA 1ERTA 4N11A 2YZHA 4TR3A 1NHYA 1PN0A 1K3YA 5F06A 1QMVA 4WXTA 2JSYA 4FQUA 1K0BA 5D96A 1G0TA 1IYHA 1YKCA 2G2QA 3HJMA 4E8EA 1HQOA 11GSA 4EXJA 2X49A 1K0AA 4TRXA 3VWWA 1SYRA 6GSSA 3Q18A 2IMDA 3ERGA 1V98A 4EIQA 1UN2A 2P31A 3FZAA 4HU7A 3TRXA 4MZBA 4Z2RA 2B5EA 2FLSA 1SYXA 2CAIA 4ID0A 4XIHA 4DEJA 2WCIA 1V57A 1Z7RA 5KEJA 4KF9A 3HJOA 1ACVA 5D9TA 1HNAA 1W89A 4XS4B 1R26A 3AY8A 1XWBA 2IIYA 4KAEA 4HZ4A 1BYEA 2XPDA 3W6GA 2C3TA 4FIWA 4IS0A 4EC0A 3FHKA 3ZREA 2ON5A 2DKIA 2XC2A 3GHAA 1GTIA 1OKDA 1XZOA 3GMFA 1YDKA 2HFDA 1XVWA 5ECLB 2E2MA 2GVPA 5JCGA 2PPTA 3HVSA 2L5LA 1XIYA 4K0NA 5F0GA 2VM2A 1YJ6A 3R2QA 5ABRA 1U87A 2EC4A 2CVKA 1T7PB 3G7JA 3D0ZA 3WGXA 2F51A 4AJ6A 18GSA 4JZQA 5KN3A 4PNGA 3O76A 3UMAA 3KMNA 2FWEA 2A2RA 5EVOA 2CAQA 3IDVA 1DE2A 3GN3A 2PBJA 4D73A 1ERVA 3J7Yk 5ELAA 1HNCA 4EE0A 3VFIA 4IBPA 3IR4A 3ZVJD 2B5YA 2VUPA 2HSYA 2YN1A 3GKMA 2B1KA 4OFTA 3I43A 4HZ2A 2FWHA 2PWJA 3ZL5A 4HJMA 3FK8A 2HLSA 6GSXA 4DVCA 3N9JA 5ECKB 3SWLA 4A5PA 2FHEA 5E4WA 1JZWA 1PX7A 5BMUA 3TDGA 1A23A 3P2AA 19GSA 4V2NA 3MDKA 4O5UA 3ZFLA 4I8BA 4DSSB 5KN1A 4Q5QA 2DMMA 5D73A 1V58A 1PKZA 4EVMA 4BL7B 2C80A 1OE8A 4PGTA 5IMCA 2GT6A 3ZMLA 1WMJA 2YP6A 3ZRDA 1O8XA 3NZNA 2R4VA 3G7YA 3BOAA 4ACSA 3FZ9A 4MDCA 2R0GA 1TK0B 4AJ8A 4PUFC 2AUVA 5A4WA 2KLXA 4ZBBA 5DBQA 4JR6A 2GQKA 5D93A 2VL2C 1ZGNA 1FOVA 1GP1A 4ECIA 1G7EA 4FO5A 3HZ4A 1AQXA 2H01A 1JFUA 4F03A 5DDLA 4WBJA 1MDIA 4AF2A 3K8NA 2DJ2A 4ZIJA 1DE1A 2EIOA 3G7IA 2XBIA 3TJGA 1S3CA 2HYXA 5IMVA 2LNTA 14GSA 3HD5A 4ZB6A 3CSHA 4AGSA 4POBA 3ZIJA 3HYPA 3F3QA 1WRYA 5COHA 1GTAA 2MBTA 1ZYEA 3LXTA 4IP1A 4OFMA 1SD9A 3M0FA 2YWMA 1Q4JA 6GSTA 1GUHA 1MEKA 1Y6EA 2ZUPA 4OO4A 1SU9A 5DCHA 2RIIA 5ECHB 4I2UA 5H5RA 3R3EA 3VWXA 4XHMA 1ZMAA 4PNFA 3ZYWA 2C1YA 2IWTA 2CX3A 3KTBA 2A4HA 4KUNA 1N8JA 2F9SA 1IYIA 1V40A 2HZEB 1X5DA 5DCGA 3GTUA 1R4WA 4K7IA 3HY2A 4WETA 1DBYA 1VGLA 5G5EA 2N5AA 3LG6A 5JCUA 4L5OA 8GSSA 4X4JA 3KZQA 1GSYA 3ISOA 5AN1A 4G0IA 1O81A 3H8QA 2YANA 2HRFA 2IPAA 5DAKB 3QDNA 2H6ZA 2LEGA 4KCEA 4DSQA 1F9MA 1WWJA 3I9V2 2RLIA 3LXZA 2VLVA 4WR5A 3TUEA 4GQFA 3N5OA 2HNLA 4IHUA 4PX1A 4MH3A 3E3EA 2H73A 3DMLA 3WYWA 1ERUA 3KH9A 5IPGA 1THXA 4XCSA 1MDJA 4EF0A 4NV2A 5CRGA 3KIJA 5G1LA 2V6OA 2F8FA 1K0DA 5CAXA 1YKAA 3WT1A 3CTFA 5AGYA 3BCIA 3P8WA 5JWQB 5L71A 2C0EA 3MNGA 1A2JA 4H86A 3QFAC 1EV9A 2R3XA 4TXVA 3QR6A 3KJYA 4HU9A 1E2YA 4O32A 2MZCA 4G19A 2K9FA 1XBSA 5KN0A 1TU8A 2HRNA 2KP2A 3APOA 3KD0A 3KH7A 3A5IA 1SJ6A 1WPIA 2LJKA 2QA2A 2NTOA 3LEFA 2IMIA 3S9FA 2B6MA 4CHSA 2GDRA 5DQYA 4JEDA 2R37A 3A2VA 2H30A 4PXOA 2GQMA 4J56E 4YAVA 4EIPA 2OJLA 2YWOA 2F3MA 4ZB9A 3KMOA 3GSSA 3F6FA 5ENUA 4FH8A 2LRTA 5B6NA 3SBCA 1X5CA 2C4JA 1LBKA 2HI7A 5ID2B 3G9BA 3EWLA 1THOA 1FW1A 2QC7A 4IVFA 2HSHA 2XHFA 3DIEA 4LL4B 1XWGA 3E9JB 4GCIA 1JHBA 1EGOA 4NAXA 1A2MA 4ZBDA 1BQ7A 1QK8A 2AHEA 3LQ7A 2V1MA 2E0QA 3MWHA 1KNGA 1TDIA 2VIMA 5DALB 1JLVA 2H1DA 2TRXA 3DYRA 3QAVA 1TKDB 3TB2A 1XW9A 5J5NA 5LD0A 2HRKA 1TTZA 2H1BA 3LORA 2ON7A 4CDOA 1PKWA 5G5FA 2H72A 2VCZA 4GRFA 5IIZA 3VWVA 2WFCA 1K0OA 2VLTA 4JR4A 5J41A 2FA8A 4RI7A 2DBCA 4BWSA 1VF1A 3OR5A 4MZWA 4IELA 4OMVA 4Q5RA 2GQLA 1M99A 3FEUA 3UOMA 1XCCA 2RUEA 5B8AA 3RPNA 1JZRA 3TJKA 2E7PA 5GAND 3RDWA 1PGTA 3H79A 4TR1B 3VURA 2FY6A 3FY7A 3DVXA 2F8AA 1TP9A 1FVJA 3HCZA 5DJMA 1T4YA 5F07A 1EEMA 3KTLA 1TXXA 3KP8A 1SJZA 2DMLA 1GUMA 1AIUA 4CW9A 4GSSA 3EU4A 1JZDA 2KP1A 1GSFA 3VK9A 1TRSA 1PRXA 4LMWA 3F9UA 1CQGA 3GKXA 2GT5A 4IQ1A 3L78A 4WF4A 13GSA 4OCFA 1A0RP 4F9ZA 2XPEA 3CSIA 4YH2A 2MBSA 1EP7A 4USSA 3E0UA 2H19A 2H8LA 3TJFA 1WOUA 5AIXA 3EU3A 1Z9HA 2CVDA 3D4TA 3WGEA 2D2ZA 1N2AA 1PD21 2OACA 4RUVA 3LYKA 1C72A 5FWGA 4BVXA 5DJLA 4KW6A 2C3QA 3EURA 3RHCA 4RI6A 2WS2A 3EE2A 1TOFA 1ST9A 1K3LA 4NXIA 1ERWA 3FYGA 4MJBA 2VAFA 3CSJA 1PX6A 1F6MC 4YKFA 4V2LA 4EUYA 3TJBA 5GAPD 1UVZA 4ECJA 5HQPA 3D22A 3F6DA 2R5GA 1O7UA 4E8HA 1WP0A 2KHPA 4MMMA 5ECRB 3TJJA 4EO3A 1GSQA 2YV7A 2HZFA 1ZL9A 2LUSA 3RBTA 2LQOA 2ES7A 2L6CA 1GNEA 4K2XA 1GRXA 2FNOA 4MPFA 1SL1B 5JWOB 1ZYQB 1O6JA 4PURA 4PQ1A 1A8YA 3ED3A 4V1Ag 4Z7XA 3F63A 3HDCA 1M2DA 2CVBA 3TKRA 5J4UA 3GRXA 5EPFA 2P0GA 1YZXA 1GSDA 4PUAA 4NWYA 1UA5A 3FR6A 5CP1A 2X8GA 1ILOA 3CBUA 1TRUA 12GSA 3TKSA 2DJKA 4D73B 1TU7A 5ECIB 2VOCA 4IGJA 1XVQA 4IJIA 1TI3A 2B7KA 3ME8A 3I69A 3GA4A 2HXKA 2PVQA 3FMWA 2UZ8A 5IM9A 2P5QA 5A4UA 4Z2TA 2CV4A 5IMZA 2LV3A 3O6TA 1OKTA 5KN2A 1U88A 2GZZA 4KCAA 2YV9A 3F4SA 1MD4A 4TW5A 2WB9A 2X8HA 4I2TA 2J23A 3HVXA 1H75A 4FYUA 1AC1A 2I3YA 3I6AA 2H74A 3H1NA 1ZOFA 2HRAA 3UIWA 3TOTA 3RAZA 2DJ1A 1FAAA 1FB6A 2HT9A 1GL8A 4MJAA 2VD0A 4IJ3A 1X0RA 2XBQA 4YKGA 2C0GA 2IMKA 2BTOT 1SK2A 1M0UA 3GUSA 3UEMA 1XW6A 5C04A 2IFQA 4JBBA 4HOJA 2FCHA 2MMNA 3M9KA 3NOFA 4BA7A 2H76A 2H0GA 1F37A 5CRDA 1R5AA 4K5SA 2REMA 4O92A 3US3A 1YQ1A 1K3OA 2V6KA 2R0PA 3MIXA 4HUAA 1OAZA 3Q6OA 4F2IA 1A8LA 3EC3A 4EL1A 1XW5A 4EKZA 5HFKA 4BVYA 2YWNA 1SL2B 4I5QA 3IHQA 2CA8A 5CYYA 4GSNA 2I4AA 4G0LA 5IO0A 4KSOA 2VM1A 4HI7A 3VI7A 3APQA 2VL3A 2K8VA 2KOKA 4MPGA 3BCKA 3IAM2 4YQMA 2OADA 4L0WA 1GULA 2CZ2A 3FW2A 1KBNA 3CRTA 5H5SA 2YWIA 1O85A 3TKSE 3ERWA 2FGXA 1J08A 5A5KA 2JSZA 5GSTA 5ECMB 2H6XA 5IOWA 4HQSA 3MSZA 5B8BA 1USBA 2O8VB 2JZTA 4IW9A 1HNBA 22GSA 3GTUB 1BEDA 4YQVA 1MTCA 2CQ9A 1XWAA 5JCWA 5IPHA 4MK3A 4N30A 4K1FA 2B1LA 3DEXA 3VWUA 1O8WA 1I5GA 3PPUA 3GURA 2WGRA 3M8NA 2HZEA 3IXRA 2H0HA 6GSVA 5IQYA 2IMEA 2L4CA 4X1UA 4KDXA 2H66A 2DSAA 2H1AA 3ZITA 5HR0A 2DIYA 1ZYPA 2LQQA 4WF5A 3L9UA 1QUWA 3MAKA 5GZZB 5HFGA 3PH9A 20GSA 4L0UA 3VI5A 2YCDA 1A2LA 1HYUA 5IMDA 4ZL8A 1PL2A 3APSA 1VF3A 1G6YA 2M46A 2AAWA 3UARA 2OBIA 4N10A 2QKEA 2L59A 2KUCA 3GKKA 1AQWA 2N5FA 1SK1A 3FRCA 2JZRA 4XS1A 2AJQB 3EVIA 4LL1B 1A0FA 1XPVA 2OBKA 3H4KA 4ZBAA 6GSYA 3TRQA 5F05A 2GSTA 4TR0A 2RM6A 1SD8A 3D4MA 2P5RA 3L9SA 2VCQA 1B9XC 2LRCA 3GFKA 4ECBA 2K8SA 1EGRA 4QQ7A 3LFLA 5DVBA 4YQUA 1GTBA 2IL3A 2NDOA 3KXOA 5HR3A 4MABA 3FR9A 1DUGA 3W8JA 1TJDA 1TRWA 3QD9A 1RW1A 2Z9SA 5AISA 1U6TA 5CRWA 5IMFA 4BPYA 3F3RA 3HKRA 1W4VA 3TRPA 1GWCA 4MF5A 1QFNA 1VF2A 2N5BA 2EIQA 2G0FA 4FYCA 1YF0A 2B7JA 4MCUA 4QL7A 4MF6A 3ZTLA 2C8UA 2LS5A 9GSSA 3GH9A 1FOHA 2IMFA 2WDUA 4KSMA 1OC9A 4KE3A 1MDKA 3ZVJA 4DSRA 1FHEA 2NVLA 5JWRB 2AB6A 4ML6A 5ECOB 2M72A 3KM6A 2PU9C 3EMXA 2DIZA 1BG5A 3VPQA 3EYTA 2O89A 4LMVA 2GZPA 2MYGA 1RQMA 1FG4A 3CRUA 2PMTA 1EZKA 4GLTA 2HE3A 3QCPA 1WE0A 3C73A 3CTGA 2GSRA 1XWCA 4HQZA 3ZMKA 3BJ5A 5G2ZA 3DVWA 4KH7A 4OD7A 2DLXA 3UJ1A 3UVTA 4F0BA 4EDYA 1CQHA 5KOXA 1X9WB 2VD1A 2OKAA 3GL5A 3GSTA 1MD3A 3VLNA 3EPTA 1GNWA 3TCOA 1Q98A 2BJXA 4NHZA 3FR3A 2WJUA 6GSUA 4LLRA 1PN9A 1Z6MA 3DGQA 2MMAA 1U3IA 1H4OA 4TXOB 4GTUA 4IKHA 2JU5A 3KCMA 4L8EA 4OWYA 2RUFA 4K6XA 4NMUA 3RHBA 1K0MA 5ECQB 1T3BA 5J9CA 1BJXA 1F2EA 1GUKA 3HXSA 1FVKA 1Z5YE 4K2DA 2DJ0A 1XOAA 2O7KA 2YJHA 3LWAA 3GNJA 1SK0A 2OE3A 5G31A 1EEJA 2LKUA 3BBYA 1R5PA 2H70A 3C1SA 1GTUA 1B8XA 1QQ2A 4V2MA 3C71A 4MLYA 4G2EA 4G9HA 3W8SA 5D8IA 2GZYA 1WIKA 2AYTA 1UC7A 4RQRA 4PQHA 5A4VA 1OVNA 2C0DA 2H6YA 3EMPA 4IP6A 3IPZA 4I6XA 2PVOC 2OA7A 4X0XA 5KOWA 1EP8A 6GSWA 5ECNB 2FWGA 3DD3A 1TK5B 4BVXB 3TKQA 2VL2A 1R7HA 3LYPA 4MJEA 2B3SA 2PERA 4X43A 3QAWA 4NV5A 2ZNMA 2GGTA 5B7CA 2I1UA 4IQAA 3F4TA 4XS6A 3GYKA 1X9MB 3KGKA 2QSIA 1GH2A 4K5RA 4XS4A 1TK8B 2IN3A 5H5QA 1M7TA 2J9HA 2VCVA 3GKNA 3J7Yb 4V1Ap 1NHOA 1RK4A 2LNSA 5CRHA 4ZILA 3GX8A 3M9JA 2YNXA 4ML1A 1K0CA 3DXBA 3HJPA 2NPBA 1YEPA 5CNWA 2LTKA 4PQIA 4K9ZA 3LW9A 1Z7PA 3PGTA 4ICYA 1B4QA 2VCTA 1ZYNA 2CX4A 2YOIA 1NSWA 3NIVA 1SKWB 2E2GA 4GWRA 2VCXA 1I9DA 2V41A 4XRDA 3C1RA 4TR4A 2PUKC 1GLPA 4GF0A 1XXUA 2RM5A 4QL9A 5AIVA 1M9BA 3IRAA 1ML6A 2JZSA 2JACA 1VF4A 5GSSA 1T8EB 3HA9A 2TRCP 3IV4A 1B4PA 3D6IA 5CO3A 1TI1A 4F0CA 1EOHA 3KEBA 3L0HA 1AQVA 2O85A 1JLWA 1ON4A 5F8BA 3RPPA 2K6VA 16GSA 3ERFA 1XWKA 2CZ3A 4K7OA 1SJIA 1SL0B 5CREA 1OC3A 2VCWA 4ULXA 1YEXA 4KNDA 4J57E 4WBRD 2DJ3A 1TW9A 1F3BA 4HS1A 1O73A 3F4RA 3KP9A 3FZ5A 1KTEA 1U3AA 3L9VA 1GLQA 5FT3A 1YF1A 4KGIA 3IC4A 4MH2A 3IAS2 2GSQA 2IFQB 3C7MA 2C0FA 1ZCPA 4I97A 3A5WA 4DSSA 4KB3A 5LCZA 5D9XA 4KDUA 1A24A 1FB0A 1T1VA 4BL7A 5IOXA 4ECCA 2H1GA 3U6VA 10GSA 5EY6A 2NBSA 1OC8A 4Z2UA 4XRAA 4IN0A 5J3RA 4YAPA 3WD6A 3VPTA 4CY8A 3ZFBA 3GH6A 4MJCA 4ZXGA 2H71A 2OE1A 1BAYA 2GLRA 4L5LA 4BVYB 5IO2A 2V2GA 4RQXA 3L4NA 1G7OA 2TIRA 5BRTA 1EV4A 3DWVA 4F82A 3DRNA 5D9WA 2DJJA 3BD2A 1PMTA 2FD3A 3ME7A 1WJKA 5G1KA 1OE7A 1AUCA 3GX0A 3UBLA 5ELGA 1LJRA 3ZIVA 3FZ4A 1BX9A 1Z3EA 4LA1A 2A4VA 4POLA 1DSBA 4POMA 5E59A 4HEA2 2L5OA 4HJ2A 3GL3A 1JZOA 3WGDA 3LSZA 3CYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ALB A;  2IJY A;  3CXG A;  5HR2 A;  4XTS A;  4K0G A;  3M3M A;  3ZZX A;  3U5R E;  1X9S B;  3LJR A;  5EL8 A;  3UL3 A;  1TRV A;  4EDZ A;  1EWX A;  5C00 A;  1Z6N A;  3CMI A;  1S3A A;  3M1G A;  4N0V A;  3HZ8 A;  4TKY A;  5HFI A;  2JL4 A;  2MMZ A;  4N0Z A;  2O87 A;  3IE3 A;  4FYB A;  4Q5F A;  3UVH A;  1VRS D;  3F8U A;  4K8M A;  3Q74 A;  2LJA A;  3TKS C;  2H0I A;  4OO5 A;  7GSS A;  3A2W A;  3D21 A;  4ZL9 A;  1GSU A;  1M2B A;  3IA1 A;  3A3T A;  1AXD A;  4JRR A;  5DQS A;  2FUG 2;  2QGV A;  17GS A;  1ZZY A;  1XOB A;  4ZL7 A;  5DAK A;  3IOS A;  4MF7 A;  4K7N A;  3WT2 A;  1URM A;  3PIN A;  2R6K A;  1T4Z A;  4JE1 A;  1SEN A;  5LNK e;  1E6B A;  2EIR A;  3QMX A;  3UAP A;  5G30 A;  2K18 A;  3GIX A;  1B48 A;  1S3D A;  2OE0 A;  2FA4 A;  4GXZ A;  4O5R A;  3FKF A;  2PGT A;  1B9Y C;  3GV1 A;  2GTU A;  3ZLP A;  2LRN A;  3LGC A;  1XFL A;  3HVV A;  5IMA A;  2L6D A;  5D9V A;  2AV4 A;  4BWQ A;  3H93 A;  5B6M A;  2I9H A;  3IK7 A;  1GSS A;  2C3N A;  3A2X A;  4G10 A;  1F3A A;  1PSQ A;  4Q5N A;  2V32 A;  1G6W A;  1NM3 A;  2B5X A;  1SKS B;  2L4Q A;  2YPM A;  3JCM L;  2LJR A;  5ECS A;  4KA0 A;  1J9B A;  3QFB C;  1SKR B;  2YZU A;  2BMX A;  3TOU A;  4HDE A;  1ABA A;  4GST A;  3Q19 A;  4MA9 A;  1J0F A;  4KX4 A;  2R2J A;  2WRT A;  3V1W A;  1OC9 B;  1PQN A;  4POK A;  1EOG A;  2WZ9 A;  2YJ7 A;  1Y25 A;  4ISD A;  4JU5 A;  5ID2 A;  2M80 A;  4MZC A;  1T00 A;  3TGZ A;  4NPB A;  4WKW A;  3F0I A;  1X5E A;  1YY7 A;  1PA3 A;  3C8E A;  3O3T A;  2VO4 A;  4WR4 A;  4NHW A;  1V9W A;  4TN8 A;  2X99 A;  3QOU A;  3UBK A;  4P3Y B;  5HR1 A;  4WEY A;  5DAL A;  2GSS A;  5FHI A;  1V2A A;  5J9B A;  2L57 A;  2PN8 A;  4TVE A;  1QGV A;  5ECP B;  3HHV A;  4KDY A;  1LU4 A;  1AAZ A;  4OFN A;  3P7X A;  2DC5 A;  2LST A;  1QXH A;  4AJ7 A;  3EIN A;  2VL9 A;  1GSE A;  1PL1 A;  1FO5 A;  1AW9 A;  3IK9 A;  5INY A;  1M9A A;  2A2S A;  2GS3 A;  2MMO A;  4OCE A;  3PR8 A;  2X8C A;  3QPM A;  4GQC A;  4ZB8 A;  2H75 A;  2I81 A;  4TOP A;  3QAG A;  4TXO A;  3P90 A;  2X64 A;  2FWF A;  1K0N A;  4O7H A;  2VLU A;  4MP4 A;  1KEB A;  2CT6 A;  2JAD A;  3D5J A;  4ILF A;  2WUL A;  4J2F A;  4TR1 A;  3IBH A;  1OYJ A;  3DKS A;  1NW2 A;  1HD2 A;  1M2A A;  3TKP A;  2ZCT A;  1ERT A;  4N11 A;  2YZH A;  4TR3 A;  1NHY A;  1K3Y A;  5F06 A;  1QMV A;  4WXT A;  2JSY A;  1K0B A;  5D96 A;  1G0T A;  1IYH A;  1YKC A;  2G2Q A;  3HJM A;  4E8E A;  1HQO A;  11GS A;  4EXJ A;  1K0A A;  4TRX A;  3VWW A;  1SYR A;  6GSS A;  3Q18 A;  2IMD A;  3ERG A;  1V98 A;  1UN2 A;  2P31 A;  3FZA A;  4HU7 A;  3TRX A;  4MZB A;  2B5E A;  2FLS A;  1SYX A;  2CAI A;  4ID0 A;  4XIH A;  4DEJ A;  2WCI A;  1V57 A;  1Z7R A;  5KEJ A;  3HJO A;  1ACV A;  5D9T A;  1HNA A;  1W89 A;  4XS4 B;  1R26 A;  3AY8 A;  1XWB A;  2IIY A;  4KAE A;  4HZ4 A;  1BYE A;  2XPD A;  3W6G A;  2C3T A;  4FIW A;  4IS0 A;  4EC0 A;  3FHK A;  3ZRE A;  2ON5 A;  2XC2 A;  3GHA A;  1GTI A;  1OKD A;  1XZO A;  3GMF A;  1YDK A;  2HFD A;  1XVW A;  5ECL B;  2E2M A;  2GVP A;  5JCG A;  2PPT A;  3HVS A;  2L5L A;  1XIY A;  4K0N A;  5F0G A;  2VM2 A;  1YJ6 A;  3R2Q A;  5ABR A;  1U87 A;  2EC4 A;  2CVK A;  1T7P B;  3G7J A;  3D0Z A;  3WGX A;  2F51 A;  4AJ6 A;  18GS A;  4JZQ A;  5KN3 A;  4PNG A;  3O76 A;  3UMA A;  3KMN A;  2FWE A;  2A2R A;  5EVO A;  2CAQ A;  3IDV A;  1DE2 A;  3GN3 A;  2PBJ A;  4D73 A;  1ERV A;  3J7Y k;  5ELA A;  1HNC A;  4EE0 A;  3VFI A;  4IBP A;  3IR4 A;  3ZVJ D;  2B5Y A;  2VUP A;  2HSY A;  2YN1 A;  3GKM A;  2B1K A;  4OFT A;  3I43 A;  4HZ2 A;  2FWH A;  2PWJ A;  3ZL5 A;  4HJM A;  3FK8 A;  2HLS A;  6GSX A;  4DVC A;  3N9J A;  5ECK B;  3SWL A;  2FHE A;  5E4W A;  1JZW A;  1PX7 A;  3TDG A;  1A23 A;  3P2A A;  19GS A;  4V2N A;  3MDK A;  3ZFL A;  4I8B A;  4DSS B;  5KN1 A;  4Q5Q A;  2DMM A;  5D73 A;  1V58 A;  1PKZ A;  4EVM A;  2C80 A;  1OE8 A;  4PGT A;  5IMC A;  2GT6 A;  3ZML A;  1WMJ A;  2YP6 A;  3ZRD A;  1O8X A;  3NZN A;  2R4V A;  3G7Y A;  3BOA A;  4ACS A;  3FZ9 A;  4MDC A;  1TK0 B;  4AJ8 A;  4PUF C;  2AUV A;  5A4W A;  2KLX A;  4ZBB A;  5DBQ A;  4JR6 A;  2GQK A;  5D93 A;  2VL2 C;  1ZGN A;  1FOV A;  1GP1 A;  4ECI A;  1G7E A;  4FO5 A;  3HZ4 A;  1AQX A;  2H01 A;  1JFU A;  4F03 A;  5DDL A;  4WBJ A;  1MDI A;  4AF2 A;  3K8N A;  2DJ2 A;  4ZIJ A;  1DE1 A;  2EIO A;  3G7I A;  2XBI A;  3TJG A;  1S3C A;  2HYX A;  5IMV A;  2LNT A;  14GS A;  3HD5 A;  4ZB6 A;  3CSH A;  4AGS A;  4POB A;  3ZIJ A;  3HYP A;  3F3Q A;  1WRY A;  5COH A;  1GTA A;  2MBT A;  1ZYE A;  3LXT A;  4IP1 A;  4OFM A;  1SD9 A;  3M0F A;  2YWM A;  1Q4J A;  6GST A;  1GUH A;  1MEK A;  1Y6E A;  2ZUP A;  4OO4 A;  1SU9 A;  5DCH A;  2RII A;  5ECH B;  4I2U A;  5H5R A;  3VWX A;  4XHM A;  1ZMA A;  4PNF A;  3ZYW A;  2C1Y A;  2IWT A;  2CX3 A;  3KTB A;  4KUN A;  1N8J A;  2F9S A;  1IYI A;  1V40 A;  2HZE B;  1X5D A;  5DCG A;  3GTU A;  1R4W A;  4K7I A;  3HY2 A;  4WET A;  1DBY A;  1VGL A;  5G5E A;  2N5A A;  3LG6 A;  5JCU A;  4L5O A;  8GSS A;  3KZQ A;  1GSY A;  3ISO A;  5AN1 A;  1O81 A;  3H8Q A;  2YAN A;  2HRF A;  2IPA A;  5DAK B;  3QDN A;  2H6Z A;  2LEG A;  4KCE A;  4DSQ A;  1F9M A;  1WWJ A;  3I9V 2;  2RLI A;  3LXZ A;  2VLV A;  4WR5 A;  3TUE A;  4GQF A;  3N5O A;  2HNL A;  4IHU A;  4PX1 A;  4MH3 A;  3E3E A;  2H73 A;  3DML A;  3WYW A;  1ERU A;  3KH9 A;  5IPG A;  1THX A;  4XCS A;  1MDJ A;  4EF0 A;  4NV2 A;  5CRG A;  3KIJ A;  5G1L A;  2V6O A;  2F8F A;  1K0D A;  5CAX A;  1YKA A;  3WT1 A;  3CTF A;  5AGY A;  3BCI A;  3P8W A;  5JWQ B;  5L71 A;  2C0E A;  3MNG A;  1A2J A;  4H86 A;  3QFA C;  1EV9 A;  2R3X A;  4TXV A;  3QR6 A;  3KJY A;  4HU9 A;  1E2Y A;  4O32 A;  2MZC A;  4G19 A;  2K9F A;  1XBS A;  5KN0 A;  1TU8 A;  2HRN A;  2KP2 A;  3APO A;  3KD0 A;  3KH7 A;  1SJ6 A;  1WPI A;  2LJK A;  2NTO A;  3LEF A;  2IMI A;  3S9F A;  2B6M A;  4CHS A;  2GDR A;  5DQY A;  4JED A;  2R37 A;  3A2V A;  2H30 A;  4PXO A;  2GQM A;  4J56 E;  4YAV A;  2OJL A;  2YWO A;  2F3M A;  4ZB9 A;  3KMO A;  3GSS A;  3F6F A;  5ENU A;  4FH8 A;  2LRT A;  5B6N A;  3SBC A;  1X5C A;  2C4J A;  1LBK A;  2HI7 A;  5ID2 B;  3G9B A;  3EWL A;  1THO A;  1FW1 A;  2QC7 A;  4IVF A;  2HSH A;  2XHF A;  3DIE A;  4LL4 B;  1XWG A;  3E9J B;  4GCI A;  1JHB A;  1EGO A;  4NAX A;  1A2M A;  4ZBD A;  1BQ7 A;  1QK8 A;  2AHE A;  3LQ7 A;  2V1M A;  2E0Q A;  3MWH A;  1KNG A;  1TDI A;  2VIM A;  5DAL B;  1JLV A;  2H1D A;  2TRX A;  3DYR A;  3QAV A;  1TKD B;  3TB2 A;  1XW9 A;  5J5N A;  5LD0 A;  1TTZ A;  2H1B A;  3LOR A;  2ON7 A;  4CDO A;  1PKW A;  5G5F A;  2H72 A;  2VCZ A;  4GRF A;  5IIZ A;  3VWV A;  2WFC A;  1K0O A;  2VLT A;  4JR4 A;  5J41 A;  2FA8 A;  4RI7 A;  2DBC A;  4BWS A;  1VF1 A;  3OR5 A;  4MZW A;  4IEL A;  4OMV A;  4Q5R A;  2GQL A;  1M99 A;  3FEU A;  3UOM A;  1XCC A;  2RUE A;  5B8A A;  3RPN A;  1JZR A;  3TJK A;  2E7P A;  5GAN D;  3RDW A;  1PGT A;  3H79 A;  4TR1 B;  3VUR A;  2FY6 A;  3FY7 A;  3DVX A;  2F8A A;  1TP9 A;  1FVJ A;  3HCZ A;  5DJM A;  1T4Y A;  5F07 A;  1EEM A;  3KTL A;  1TXX A;  3KP8 A;  1SJZ A;  2DML A;  1GUM A;  1AIU A;  4CW9 A;  4GSS A;  3EU4 A;  1JZD A;  2KP1 A;  1GSF A;  3VK9 A;  1TRS A;  1PRX A;  4LMW A;  3F9U A;  1CQG A;  3GKX A;  2GT5 A;  4IQ1 A;  3L78 A;  4WF4 A;  13GS A;  4OCF A;  1A0R P;  4F9Z A;  2XPE A;  3CSI A;  4YH2 A;  2MBS A;  1EP7 A;  3E0U A;  2H19 A;  2H8L A;  3TJF A;  1WOU A;  5AIX A;  3EU3 A;  1Z9H A;  2CVD A;  3D4T A;  3WGE A;  2D2Z A;  1N2A A;  1PD2 1;  2OAC A;  4RUV A;  3LYK A;  1C72 A;  5FWG A;  4BVX A;  5DJL A;  4KW6 A;  2C3Q A;  3EUR A;  3RHC A;  4RI6 A;  2WS2 A;  3EE2 A;  1TOF A;  1ST9 A;  1K3L A;  4NXI A;  1ERW A;  3FYG A;  4MJB A;  2VAF A;  3CSJ A;  1PX6 A;  1F6M C;  4V2L A;  4EUY A;  3TJB A;  5GAP D;  1UVZ A;  4ECJ A;  5HQP A;  3D22 A;  3F6D A;  2R5G A;  1O7U A;  4E8H A;  1WP0 A;  2KHP A;  4MMM A;  5ECR B;  3TJJ A;  4EO3 A;  1GSQ A;  2YV7 A;  2HZF A;  1ZL9 A;  2LUS A;  3RBT A;  2LQO A;  2ES7 A;  2L6C A;  1GNE A;  1GRX A;  2FNO A;  4MPF A;  1SL1 B;  5JWO B;  1ZYQ B;  1O6J A;  4PUR A;  4PQ1 A;  1A8Y A;  3ED3 A;  4V1A g;  4Z7X A;  3F63 A;  3HDC A;  1M2D A;  2CVB A;  3TKR A;  5J4U A;  3GRX A;  5EPF A;  2P0G A;  1YZX A;  1GSD A;  4PUA A;  4NWY A;  1UA5 A;  3FR6 A;  5CP1 A;  2X8G A;  1ILO A;  3CBU A;  1TRU A;  12GS A;  3TKS A;  2DJK A;  4D73 B;  1TU7 A;  5ECI B;  2VOC A;  4IGJ A;  1XVQ A;  4IJI A;  1TI3 A;  2B7K A;  3ME8 A;  3I69 A;  3GA4 A;  2HXK A;  2PVQ A;  5IM9 A;  2P5Q A;  5A4U A;  2CV4 A;  5IMZ A;  2LV3 A;  3O6T A;  1OKT A;  5KN2 A;  1U88 A;  2GZZ A;  4KCA A;  2YV9 A;  3F4S A;  1MD4 A;  4TW5 A;  2WB9 A;  2X8H A;  4I2T A;  2J23 A;  3HVX A;  1H75 A;  4FYU A;  1AC1 A;  2I3Y A;  3I6A A;  2H74 A;  3H1N A;  1ZOF A;  3UIW A;  3TOT A;  3RAZ A;  2DJ1 A;  1FAA A;  1FB6 A;  2HT9 A;  1GL8 A;  4MJA A;  2VD0 A;  4IJ3 A;  1X0R A;  2XBQ A;  2C0G A;  2IMK A;  2BTO T;  1SK2 A;  1M0U A;  3GUS A;  3UEM A;  1XW6 A;  5C04 A;  2IFQ A;  4JBB A;  4HOJ A;  2FCH A;  2MMN A;  3M9K A;  3NOF A;  4BA7 A;  2H76 A;  2H0G A;  1F37 A;  5CRD A;  1R5A A;  2REM A;  4O92 A;  3US3 A;  1YQ1 A;  1K3O A;  2V6K A;  4HUA A;  1OAZ A;  3Q6O A;  4F2I A;  1A8L A;  3EC3 A;  4EL1 A;  1XW5 A;  4EKZ A;  5HFK A;  4BVY A;  2YWN A;  1SL2 B;  4I5Q A;  3IHQ A;  2CA8 A;  5CYY A;  4GSN A;  2I4A A;  5IO0 A;  4KSO A;  2VM1 A;  4HI7 A;  3VI7 A;  3APQ A;  2VL3 A;  2K8V A;  2KOK A;  4MPG A;  3BCK A;  3IAM 2;  4YQM A;  2OAD A;  4L0W A;  1GUL A;  2CZ2 A;  3FW2 A;  1KBN A;  3CRT A;  5H5S A;  2YWI A;  1O85 A;  3TKS E;  3ERW A;  2FGX A;  1J08 A;  5A5K A;  2JSZ A;  5GST A;  5ECM B;  2H6X A;  5IOW A;  4HQS A;  3MSZ A;  5B8B A;  1USB A;  2O8V B;  2JZT A;  4IW9 A;  1HNB A;  22GS A;  3GTU B;  1BED A;  4YQV A;  1MTC A;  2CQ9 A;  1XWA A;  5JCW A;  5IPH A;  4MK3 A;  4N30 A;  4K1F A;  2B1L A;  3DEX A;  3VWU A;  1O8W A;  1I5G A;  3GUR A;  2WGR A;  3M8N A;  2HZE A;  3IXR A;  2H0H A;  6GSV A;  5IQY A;  2IME A;  2L4C A;  4X1U A;  4KDX A;  2H66 A;  2DSA A;  2H1A A;  3ZIT A;  5HR0 A;  2DIY A;  2LQQ A;  4WF5 A;  3L9U A;  1QUW A;  3MAK A;  5GZZ B;  5HFG A;  3PH9 A;  20GS A;  4L0U A;  3VI5 A;  2YCD A;  1A2L A;  1HYU A;  5IMD A;  4ZL8 A;  1PL2 A;  3APS A;  1VF3 A;  1G6Y A;  2M46 A;  2AAW A;  3UAR A;  2OBI A;  4N10 A;  2QKE A;  2L59 A;  2KUC A;  3GKK A;  1AQW A;  2N5F A;  1SK1 A;  3FRC A;  2JZR A;  4XS1 A;  2AJQ B;  3EVI A;  4LL1 B;  1A0F A;  1XPV A;  2OBK A;  3H4K A;  4ZBA A;  6GSY A;  3TRQ A;  5F05 A;  2GST A;  4TR0 A;  2RM6 A;  1SD8 A;  3D4M A;  2P5R A;  3L9S A;  2VCQ A;  1B9X C;  2LRC A;  3GFK A;  4ECB A;  2K8S A;  1EGR A;  4QQ7 A;  3LFL A;  5DVB A;  4YQU A;  1GTB A;  2IL3 A;  2NDO A;  3KXO A;  5HR3 A;  4MAB A;  3FR9 A;  1DUG A;  3W8J A;  1TJD A;  1TRW A;  3QD9 A;  1RW1 A;  2Z9S A;  5AIS A;  1U6T A;  5CRW A;  5IMF A;  4BPY A;  3F3R A;  3HKR A;  1W4V A;  3TRP A;  1GWC A;  4MF5 A;  1QFN A;  1VF2 A;  2N5B A;  2EIQ A;  2G0F A;  4FYC A;  1YF0 A;  2B7J A;  4MCU A;  4QL7 A;  4MF6 A;  3ZTL A;  2C8U A;  2LS5 A;  9GSS A;  3GH9 A;  2IMF A;  2WDU A;  4KSM A;  1OC9 A;  4KE3 A;  1MDK A;  3ZVJ A;  4DSR A;  1FHE A;  2NVL A;  5JWR B;  2AB6 A;  4ML6 A;  5ECO B;  2M72 A;  3KM6 A;  2PU9 C;  3EMX A;  2DIZ A;  1BG5 A;  3VPQ A;  3EYT A;  2O89 A;  4LMV A;  2GZP A;  2MYG A;  1RQM A;  1FG4 A;  3CRU A;  2PMT A;  1EZK A;  4GLT A;  2HE3 A;  3QCP A;  1WE0 A;  3C73 A;  3CTG A;  2GSR A;  1XWC A;  4HQZ A;  3ZMK A;  3BJ5 A;  5G2Z A;  3DVW A;  4KH7 A;  4OD7 A;  2DLX A;  3UJ1 A;  3UVT A;  4F0B A;  4EDY A;  1CQH A;  1X9W B;  2VD1 A;  2OKA A;  3GL5 A;  3GST A;  1MD3 A;  3VLN A;  1GNW A;  3TCO A;  1Q98 A;  2BJX A;  4NHZ A;  3FR3 A;  2WJU A;  6GSU A;  4LLR A;  1PN9 A;  1Z6M A;  3DGQ A;  2MMA A;  1U3I A;  1H4O A;  4TXO B;  4GTU A;  4IKH A;  2JU5 A;  3KCM A;  4L8E A;  4OWY A;  2RUF A;  4K6X A;  4NMU A;  3RHB A;  1K0M A;  5ECQ B;  1T3B A;  5J9C A;  1BJX A;  1F2E A;  1GUK A;  3HXS A;  1FVK A;  1Z5Y E;  4K2D A;  2DJ0 A;  1XOA A;  2O7K A;  2YJH A;  3LWA A;  3GNJ A;  1SK0 A;  2OE3 A;  5G31 A;  1EEJ A;  2LKU A;  3BBY A;  1R5P A;  2H70 A;  3C1S A;  1GTU A;  1B8X A;  1QQ2 A;  4V2M A;  3C71 A;  4MLY A;  4G2E A;  4G9H A;  3W8S A;  5D8I A;  2GZY A;  1WIK A;  2AYT A;  1UC7 A;  4RQR A;  4PQH A;  5A4V A;  1OVN A;  2C0D A;  2H6Y A;  3EMP A;  4IP6 A;  3IPZ A;  4I6X A;  2PVO C;  2OA7 A;  4X0X A;  1EP8 A;  6GSW A;  5ECN B;  2FWG A;  3DD3 A;  1TK5 B;  3TKQ A;  2VL2 A;  1R7H A;  3LYP A;  4MJE A;  2B3S A;  2PER A;  4X43 A;  3QAW A;  4NV5 A;  2ZNM A;  2GGT A;  5B7C A;  2I1U A;  4IQA A;  3F4T A;  4XS6 A;  3GYK A;  1X9M B;  3KGK A;  2QSI A;  1GH2 A;  4XS4 A;  1TK8 B;  2IN3 A;  5H5Q A;  1M7T A;  2J9H A;  2VCV A;  3GKN A;  3J7Y b;  4V1A p;  1NHO A;  1RK4 A;  2LNS A;  5CRH A;  4ZIL A;  3GX8 A;  3M9J A;  2YNX A;  4ML1 A;  1K0C A;  3DXB A;  3HJP A;  2NPB A;  1YEP A;  5CNW A;  2LTK A;  4PQI A;  4K9Z A;  1Z7P A;  3PGT A;  1B4Q A;  2VCT A;  2CX4 A;  2YOI A;  1NSW A;  3NIV A;  1SKW B;  2E2G A;  4GWR A;  2VCX A;  1I9D A;  2V41 A;  4XRD A;  3C1R A;  4TR4 A;  2PUK C;  1GLP A;  4GF0 A;  1XXU A;  2RM5 A;  4QL9 A;  5AIV A;  1M9B A;  3IRA A;  1ML6 A;  2JZS A;  2JAC A;  1VF4 A;  5GSS A;  1T8E B;  3HA9 A;  2TRC P;  3IV4 A;  1B4P A;  3D6I A;  5CO3 A;  1TI1 A;  4F0C A;  1EOH A;  3KEB A;  3L0H A;  1AQV A;  2O85 A;  1JLW A;  1ON4 A;  5F8B A;  3RPP A;  2K6V A;  16GS A;  3ERF A;  1XWK A;  2CZ3 A;  4K7O A;  1SJI A;  1SL0 B;  5CRE A;  1OC3 A;  2VCW A;  4ULX A;  1YEX A;  4KND A;  4J57 E;  4WBR D;  2DJ3 A;  1TW9 A;  1F3B A;  4HS1 A;  1O73 A;  3F4R A;  3KP9 A;  3FZ5 A;  1KTE A;  1U3A A;  3L9V A;  1GLQ A;  5FT3 A;  1YF1 A;  4KGI A;  3IC4 A;  4MH2 A;  3IAS 2;  2GSQ A;  2IFQ B;  3C7M A;  2C0F A;  1ZCP A;  4I97 A;  3A5W A;  4DSS A;  4KB3 A;  5LCZ A;  5D9X A;  4KDU A;  1A24 A;  1FB0 A;  1T1V A;  4BL7 A;  5IOX A;  4ECC A;  2H1G A;  3U6V A;  10GS A;  5EY6 A;  2NBS A;  1OC8 A;  4XRA A;  4IN0 A;  5J3R A;  4YAP A;  3WD6 A;  3VPT A;  3ZFB A;  3GH6 A;  4MJC A;  4ZXG A;  2H71 A;  2OE1 A;  1BAY A;  2GLR A;  4L5L A;  5IO2 A;  2V2G A;  4RQX A;  3L4N A;  1G7O A;  2TIR A;  1EV4 A;  3DWV A;  4F82 A;  3DRN A;  5D9W A;  2DJJ A;  3BD2 A;  1PMT A;  2FD3 A;  3ME7 A;  1WJK A;  5G1K A;  1OE7 A;  1AUC A;  3GX0 A;  3UBL A;  5ELG A;  1LJR A;  3ZIV A;  3FZ4 A;  1BX9 A;  1Z3E A;  4LA1 A;  2A4V A;  4POL A;  5E59 A;  1DSB A;  4POM A;  4HEA 2;  2L5O A;  4HJ2 A;  3GL3 A;  1JZO A;  3WGD A;  3LSZ A;  3CYN A; 
#chains in the Genus database with same CATH topology
 2ALB A;  2IJY A;  3CXG A;  5HR2 A;  4XTS A;  4K0G A;  3M3M A;  3ZZX A;  3U5R E;  1X9S B;  3LJR A;  5EL8 A;  3UL3 A;  1TRV A;  4EDZ A;  1EWX A;  5C00 A;  1Z6N A;  3CMI A;  1S3A A;  3M1G A;  4N0V A;  3HZ8 A;  4TKY A;  5HFI A;  2JL4 A;  2MMZ A;  4N0Z A;  2O87 A;  3IE3 A;  4FYB A;  4Q5F A;  3UVH A;  1VRS D;  3F8U A;  4K8M A;  3Q74 A;  2LJA A;  3TKS C;  2H0I A;  4OO5 A;  7GSS A;  3A2W A;  3D21 A;  4ZL9 A;  2X4A A;  1GSU A;  1M2B A;  3IA1 A;  3A3T A;  1AXD A;  4JRR A;  5DQS A;  2FUG 2;  2QGV A;  17GS A;  1ZZY A;  1XOB A;  4ZL7 A;  5DAK A;  3IOS A;  4MF7 A;  4K7N A;  3WT2 A;  1URM A;  3PIN A;  2R6K A;  1T4Z A;  4G0K A;  4JE1 A;  1SEN A;  5LNK e;  1E6B A;  2EIR A;  3QMX A;  3UAP A;  5G30 A;  2K18 A;  3GIX A;  1B48 A;  1S3D A;  2OE0 A;  1XG8 A;  2FA4 A;  4GXZ A;  4O5R A;  3FKF A;  2PGT A;  1B9Y C;  2R0C A;  3GV1 A;  2GTU A;  3ZLP A;  2LRN A;  3LGC A;  1XFL A;  3HVV A;  5IMA A;  2L6D A;  5D9V A;  2AV4 A;  4BWQ A;  3H93 A;  5B6M A;  2I9H A;  3IK7 A;  3MYD A;  1GSS A;  2C3N A;  3A2X A;  4G10 A;  1F3A A;  1PSQ A;  4Q5N A;  2V32 A;  1G6W A;  1NM3 A;  2B5X A;  1SKS B;  2L4Q A;  2YPM A;  3JCM L;  2LJR A;  5ECS A;  4KA0 A;  1J9B A;  3QFB C;  1SKR B;  2YZU A;  2BMX A;  3TOU A;  4HDE A;  1ABA A;  4GST A;  3Q19 A;  4MA9 A;  1J0F A;  4KX4 A;  2R2J A;  2WRT A;  3V1W A;  1OC9 B;  1PQN A;  4POK A;  1EOG A;  2WZ9 A;  2YJ7 A;  1Y25 A;  4ISD A;  4JU5 A;  5ID2 A;  2M80 A;  4MZC A;  1T00 A;  3TGZ A;  4NPB A;  4WKW A;  3F0I A;  1X5E A;  1YY7 A;  1PA3 A;  3C8E A;  3O3T A;  2VO4 A;  4WR4 A;  4NHW A;  1V9W A;  4TN8 A;  2X99 A;  3QOU A;  3UBK A;  4P3Y B;  5HR1 A;  4WEY A;  5DAL A;  2GSS A;  5FHI A;  1V2A A;  5J9B A;  2L57 A;  2PN8 A;  4TVE A;  1QGV A;  5ECP B;  3HHV A;  4KDY A;  1LU4 A;  1AAZ A;  4OFN A;  3P7X A;  2DC5 A;  2LST A;  1QXH A;  4AJ7 A;  3EIN A;  2VL9 A;  1GSE A;  1PL1 A;  1S3R A;  1FO5 A;  3IHG A;  1AW9 A;  3IK9 A;  5INY A;  1M9A A;  2A2S A;  2GS3 A;  2MMO A;  4OCE A;  3PR8 A;  2X8C A;  4PTS A;  3QPM A;  4GQC A;  4ZB8 A;  2H75 A;  2I81 A;  4TOP A;  3QAG A;  4TXO A;  2A2P A;  2QA1 A;  3P90 A;  2X64 A;  2FWF A;  3IC8 A;  1K0N A;  4O7H A;  2VLU A;  4MP4 A;  1KEB A;  2CT6 A;  2JAD A;  3D5J A;  4ILF A;  2WUL A;  4MNN A;  4J2F A;  4TR1 A;  3IBH A;  2DKH A;  4O5Q A;  1OYJ A;  3DKS A;  1NW2 A;  2HSM A;  1HD2 A;  1M2A A;  3TKP A;  4CY6 A;  2ZCT A;  1ERT A;  4N11 A;  2YZH A;  4TR3 A;  1NHY A;  1PN0 A;  1K3Y A;  5F06 A;  1QMV A;  4WXT A;  2JSY A;  4FQU A;  1K0B A;  5D96 A;  1G0T A;  1IYH A;  1YKC A;  2G2Q A;  3HJM A;  4E8E A;  1HQO A;  11GS A;  4EXJ A;  2X49 A;  1K0A A;  4TRX A;  3VWW A;  1SYR A;  6GSS A;  3Q18 A;  2IMD A;  3ERG A;  1V98 A;  4EIQ A;  1UN2 A;  2P31 A;  3FZA A;  4HU7 A;  3TRX A;  4MZB A;  4Z2R A;  2B5E A;  2FLS A;  1SYX A;  2CAI A;  4ID0 A;  4XIH A;  4DEJ A;  2WCI A;  1V57 A;  1Z7R A;  5KEJ A;  4KF9 A;  3HJO A;  1ACV A;  5D9T A;  1HNA A;  1W89 A;  4XS4 B;  1R26 A;  3AY8 A;  1XWB A;  2IIY A;  4KAE A;  4HZ4 A;  1BYE A;  2XPD A;  3W6G A;  2C3T A;  4FIW A;  4IS0 A;  4EC0 A;  3FHK A;  3ZRE A;  2ON5 A;  2DKI A;  2XC2 A;  3GHA A;  1GTI A;  1OKD A;  1XZO A;  3GMF A;  1YDK A;  2HFD A;  1XVW A;  5ECL B;  2E2M A;  2GVP A;  5JCG A;  2PPT A;  3HVS A;  2L5L A;  1XIY A;  4K0N A;  5F0G A;  2VM2 A;  1YJ6 A;  3R2Q A;  5ABR A;  1U87 A;  2EC4 A;  2CVK A;  1T7P B;  3G7J A;  3D0Z A;  3WGX A;  2F51 A;  4AJ6 A;  18GS A;  4JZQ A;  5KN3 A;  4PNG A;  3O76 A;  3UMA A;  3KMN A;  2FWE A;  2A2R A;  5EVO A;  2CAQ A;  3IDV A;  1DE2 A;  3GN3 A;  2PBJ A;  4D73 A;  1ERV A;  3J7Y k;  5ELA A;  1HNC A;  4EE0 A;  3VFI A;  4IBP A;  3IR4 A;  3ZVJ D;  2B5Y A;  2VUP A;  2HSY A;  2YN1 A;  3GKM A;  2B1K A;  4OFT A;  3I43 A;  4HZ2 A;  2FWH A;  2PWJ A;  3ZL5 A;  3HVN A;  4HJM A;  3FK8 A;  2HLS A;  6GSX A;  4DVC A;  3N9J A;  5ECK B;  3SWL A;  4A5P A;  2FHE A;  5E4W A;  1JZW A;  1PX7 A;  5BMU A;  3TDG A;  1A23 A;  3P2A A;  19GS A;  4V2N A;  3MDK A;  4O5U A;  3ZFL A;  4I8B A;  4DSS B;  5KN1 A;  4Q5Q A;  2DMM A;  5D73 A;  1V58 A;  1PKZ A;  4EVM A;  4BL7 B;  2C80 A;  1OE8 A;  4PGT A;  5IMC A;  2GT6 A;  3ZML A;  1WMJ A;  2YP6 A;  3ZRD A;  1O8X A;  3NZN A;  2R4V A;  3G7Y A;  3BOA A;  4ACS A;  3FZ9 A;  4MDC A;  2R0G A;  1TK0 B;  4AJ8 A;  4PUF C;  2AUV A;  5A4W A;  2KLX A;  4ZBB A;  5DBQ A;  4JR6 A;  2GQK A;  5D93 A;  2VL2 C;  1ZGN A;  1FOV A;  1GP1 A;  4ECI A;  1G7E A;  4FO5 A;  3HZ4 A;  1AQX A;  2H01 A;  1JFU A;  4F03 A;  5DDL A;  4WBJ A;  1MDI A;  4AF2 A;  3K8N A;  2DJ2 A;  4ZIJ A;  1DE1 A;  2EIO A;  3G7I A;  2XBI A;  3TJG A;  1S3C A;  2HYX A;  5IMV A;  2LNT A;  14GS A;  3HD5 A;  4ZB6 A;  3CSH A;  4AGS A;  4POB A;  3ZIJ A;  3HYP A;  3F3Q A;  1WRY A;  5COH A;  1GTA A;  2MBT A;  1ZYE A;  3LXT A;  4IP1 A;  4OFM A;  1SD9 A;  3M0F A;  2YWM A;  1Q4J A;  6GST A;  1GUH A;  1MEK A;  1Y6E A;  2ZUP A;  4OO4 A;  1SU9 A;  5DCH A;  2RII A;  5ECH B;  4I2U A;  5H5R A;  3R3E A;  3VWX A;  4XHM A;  1ZMA A;  4PNF A;  3ZYW A;  2C1Y A;  2IWT A;  2CX3 A;  3KTB A;  2A4H A;  4KUN A;  1N8J A;  2F9S A;  1IYI A;  1V40 A;  2HZE B;  1X5D A;  5DCG A;  3GTU A;  1R4W A;  4K7I A;  3HY2 A;  4WET A;  1DBY A;  1VGL A;  5G5E A;  2N5A A;  3LG6 A;  5JCU A;  4L5O A;  8GSS A;  4X4J A;  3KZQ A;  1GSY A;  3ISO A;  5AN1 A;  4G0I A;  1O81 A;  3H8Q A;  2YAN A;  2HRF A;  2IPA A;  5DAK B;  3QDN A;  2H6Z A;  2LEG A;  4KCE A;  4DSQ A;  1F9M A;  1WWJ A;  3I9V 2;  2RLI A;  3LXZ A;  2VLV A;  4WR5 A;  3TUE A;  4GQF A;  3N5O A;  2HNL A;  4IHU A;  4PX1 A;  4MH3 A;  3E3E A;  2H73 A;  3DML A;  3WYW A;  1ERU A;  3KH9 A;  5IPG A;  1THX A;  4XCS A;  1MDJ A;  4EF0 A;  4NV2 A;  5CRG A;  3KIJ A;  5G1L A;  2V6O A;  2F8F A;  1K0D A;  5CAX A;  1YKA A;  3WT1 A;  3CTF A;  5AGY A;  3BCI A;  3P8W A;  5JWQ B;  5L71 A;  2C0E A;  3MNG A;  1A2J A;  4H86 A;  3QFA C;  1EV9 A;  2R3X A;  4TXV A;  3QR6 A;  3KJY A;  4HU9 A;  1E2Y A;  4O32 A;  2MZC A;  4G19 A;  2K9F A;  1XBS A;  5KN0 A;  1TU8 A;  2HRN A;  2KP2 A;  3APO A;  3KD0 A;  3KH7 A;  3A5I A;  1SJ6 A;  1WPI A;  2LJK A;  2QA2 A;  2NTO A;  3LEF A;  2IMI A;  3S9F A;  2B6M A;  4CHS A;  2GDR A;  5DQY A;  4JED A;  2R37 A;  3A2V A;  2H30 A;  4PXO A;  2GQM A;  4J56 E;  4YAV A;  4EIP A;  2OJL A;  2YWO A;  2F3M A;  4ZB9 A;  3KMO A;  3GSS A;  3F6F A;  5ENU A;  4FH8 A;  2LRT A;  5B6N A;  3SBC A;  1X5C A;  2C4J A;  1LBK A;  2HI7 A;  5ID2 B;  3G9B A;  3EWL A;  1THO A;  1FW1 A;  2QC7 A;  4IVF A;  2HSH A;  2XHF A;  3DIE A;  4LL4 B;  1XWG A;  3E9J B;  4GCI A;  1JHB A;  1EGO A;  4NAX A;  1A2M A;  4ZBD A;  1BQ7 A;  1QK8 A;  2AHE A;  3LQ7 A;  2V1M A;  2E0Q A;  3MWH A;  1KNG A;  1TDI A;  2VIM A;  5DAL B;  1JLV A;  2H1D A;  2TRX A;  3DYR A;  3QAV A;  1TKD B;  3TB2 A;  1XW9 A;  5J5N A;  5LD0 A;  2HRK A;  1TTZ A;  2H1B A;  3LOR A;  2ON7 A;  4CDO A;  1PKW A;  5G5F A;  2H72 A;  2VCZ A;  4GRF A;  5IIZ A;  3VWV A;  2WFC A;  1K0O A;  2VLT A;  4JR4 A;  5J41 A;  2FA8 A;  4RI7 A;  2DBC A;  4BWS A;  1VF1 A;  3OR5 A;  4MZW A;  4IEL A;  4OMV A;  4Q5R A;  2GQL A;  1M99 A;  3FEU A;  3UOM A;  1XCC A;  2RUE A;  5B8A A;  3RPN A;  1JZR A;  3TJK A;  2E7P A;  5GAN D;  3RDW A;  1PGT A;  3H79 A;  4TR1 B;  3VUR A;  2FY6 A;  3FY7 A;  3DVX A;  2F8A A;  1TP9 A;  1FVJ A;  3HCZ A;  5DJM A;  1T4Y A;  5F07 A;  1EEM A;  3KTL A;  1TXX A;  3KP8 A;  1SJZ A;  2DML A;  1GUM A;  1AIU A;  4CW9 A;  4GSS A;  3EU4 A;  1JZD A;  2KP1 A;  1GSF A;  3VK9 A;  1TRS A;  1PRX A;  4LMW A;  3F9U A;  1CQG A;  3GKX A;  2GT5 A;  4IQ1 A;  3L78 A;  4WF4 A;  13GS A;  4OCF A;  1A0R P;  4F9Z A;  2XPE A;  3CSI A;  4YH2 A;  2MBS A;  1EP7 A;  4USS A;  3E0U A;  2H19 A;  2H8L A;  3TJF A;  1WOU A;  5AIX A;  3EU3 A;  1Z9H A;  2CVD A;  3D4T A;  3WGE A;  2D2Z A;  1N2A A;  1PD2 1;  2OAC A;  1M3I A;  4RUV A;  3LYK A;  1C72 A;  5FWG A;  4BVX A;  5DJL A;  4KW6 A;  2C3Q A;  3EUR A;  3RHC A;  4RI6 A;  2WS2 A;  3EE2 A;  1TOF A;  1ST9 A;  1K3L A;  1PFO A;  4NXI A;  1ERW A;  3FYG A;  4MJB A;  2VAF A;  3CSJ A;  1PX6 A;  1F6M C;  4YKF A;  4V2L A;  4EUY A;  3TJB A;  5GAP D;  1UVZ A;  4ECJ A;  5HQP A;  3D22 A;  3F6D A;  2R5G A;  1O7U A;  4E8H A;  1WP0 A;  2KHP A;  4MMM A;  5ECR B;  3TJJ A;  4EO3 A;  1GSQ A;  2YV7 A;  2HZF A;  1ZL9 A;  2LUS A;  3RBT A;  2LQO A;  2ES7 A;  2L6C A;  1GNE A;  4K2X A;  1GRX A;  2FNO A;  4MPF A;  1SL1 B;  1M3J A;  5JWO B;  1ZYQ B;  1O6J A;  4PUR A;  4PQ1 A;  1A8Y A;  3ED3 A;  4V1A g;  4Z7X A;  3F63 A;  3HDC A;  1M2D A;  2CVB A;  3TKR A;  5J4U A;  3GRX A;  5EPF A;  2P0G A;  1YZX A;  1GSD A;  4PUA A;  4NWY A;  1UA5 A;  3FR6 A;  5CP1 A;  2X8G A;  1ILO A;  3CBU A;  1TRU A;  12GS A;  3TKS A;  2DJK A;  4D73 B;  1TU7 A;  5ECI B;  2VOC A;  4IGJ A;  1XVQ A;  4IJI A;  1TI3 A;  2B7K A;  3ME8 A;  3I69 A;  3GA4 A;  2HXK A;  2PVQ A;  3FMW A;  2UZ8 A;  5IM9 A;  2P5Q A;  5A4U A;  4Z2T A;  2CV4 A;  5IMZ A;  2LV3 A;  3O6T A;  1OKT A;  5KN2 A;  1U88 A;  2GZZ A;  4KCA A;  2YV9 A;  3F4S A;  1MD4 A;  4TW5 A;  2WB9 A;  2X8H A;  4I2T A;  2J23 A;  3HVX A;  1H75 A;  4FYU A;  1AC1 A;  2I3Y A;  3I6A A;  2H74 A;  3H1N A;  1ZOF A;  2HRA A;  3UIW A;  3TOT A;  3RAZ A;  2DJ1 A;  1FAA A;  1FB6 A;  2HT9 A;  1GL8 A;  4MJA A;  2VD0 A;  4IJ3 A;  1X0R A;  2XBQ A;  3CQF A;  4YKG A;  2C0G A;  2IMK A;  2BTO T;  1SK2 A;  1M0U A;  3GUS A;  3UEM A;  1XW6 A;  5C04 A;  2IFQ A;  4JBB A;  4HOJ A;  2FCH A;  2MMN A;  3M9K A;  3NOF A;  4BA7 A;  2H76 A;  2H0G A;  1F37 A;  5CRD A;  1R5A A;  4K5S A;  2REM A;  4O92 A;  3US3 A;  1YQ1 A;  1K3O A;  2V6K A;  2R0P A;  3MIX A;  4HUA A;  1OAZ A;  3Q6O A;  4F2I A;  1A8L A;  3EC3 A;  4EL1 A;  1XW5 A;  4EKZ A;  5HFK A;  4BVY A;  2YWN A;  1SL2 B;  4I5Q A;  3IHQ A;  2CA8 A;  5CYY A;  4GSN A;  2I4A A;  4G0L A;  5IO0 A;  4KSO A;  2VM1 A;  4HI7 A;  3VI7 A;  3APQ A;  2VL3 A;  2K8V A;  2KOK A;  4MPG A;  3BCK A;  3IAM 2;  4YQM A;  2OAD A;  4L0W A;  1GUL A;  2CZ2 A;  3FW2 A;  1KBN A;  3CRT A;  5H5S A;  2YWI A;  1O85 A;  3TKS E;  3ERW A;  2FGX A;  1J08 A;  5A5K A;  2JSZ A;  5GST A;  5ECM B;  2H6X A;  5IOW A;  4HQS A;  3MSZ A;  5B8B A;  1USB A;  2O8V B;  2JZT A;  4IW9 A;  1HNB A;  22GS A;  3GTU B;  1BED A;  4YQV A;  1MTC A;  2CQ9 A;  1XWA A;  5JCW A;  5IPH A;  4MK3 A;  4N30 A;  4K1F A;  2B1L A;  3DEX A;  3VWU A;  1O8W A;  1I5G A;  3PPU A;  3GUR A;  2WGR A;  3M8N A;  2HZE A;  3IXR A;  2H0H A;  6GSV A;  5IQY A;  2IME A;  2L4C A;  4X1U A;  4KDX A;  2H66 A;  2DSA A;  2H1A A;  3ZIT A;  5HR0 A;  2DIY A;  1ZYP A;  2LQQ A;  4WF5 A;  3L9U A;  1QUW A;  3MAK A;  5GZZ B;  5HFG A;  3PH9 A;  20GS A;  4L0U A;  3VI5 A;  2YCD A;  1A2L A;  1HYU A;  5IMD A;  4ZL8 A;  1PL2 A;  3APS A;  1VF3 A;  1G6Y A;  2M46 A;  2AAW A;  3UAR A;  2OBI A;  4N10 A;  2QKE A;  2L59 A;  2KUC A;  3GKK A;  1AQW A;  2N5F A;  1SK1 A;  3FRC A;  2JZR A;  4XS1 A;  2AJQ B;  3EVI A;  4LL1 B;  1A0F A;  1XPV A;  2OBK A;  3H4K A;  4ZBA A;  6GSY A;  3TRQ A;  5F05 A;  2GST A;  4TR0 A;  2RM6 A;  1SD8 A;  3D4M A;  2P5R A;  3L9S A;  2VCQ A;  1B9X C;  2LRC A;  3GFK A;  4ECB A;  2K8S A;  1EGR A;  4QQ7 A;  3LFL A;  5DVB A;  4YQU A;  1GTB A;  2IL3 A;  2NDO A;  3KXO A;  5HR3 A;  4MAB A;  3FR9 A;  1DUG A;  3W8J A;  1TJD A;  1TRW A;  3QD9 A;  1RW1 A;  2Z9S A;  5AIS A;  1U6T A;  5CRW A;  5IMF A;  4BPY A;  3F3R A;  3HKR A;  1W4V A;  3TRP A;  1GWC A;  4MF5 A;  1QFN A;  1VF2 A;  2N5B A;  2EIQ A;  2G0F A;  4FYC A;  1YF0 A;  2B7J A;  4MCU A;  4QL7 A;  4MF6 A;  3ZTL A;  2C8U A;  2LS5 A;  9GSS A;  3GH9 A;  1FOH A;  2IMF A;  2WDU A;  4KSM A;  1OC9 A;  4KE3 A;  1MDK A;  3ZVJ A;  4DSR A;  1FHE A;  2NVL A;  5JWR B;  2AB6 A;  4ML6 A;  5ECO B;  2M72 A;  3KM6 A;  2PU9 C;  3EMX A;  2DIZ A;  1BG5 A;  3VPQ A;  3EYT A;  2O89 A;  4LMV A;  2GZP A;  2MYG A;  1RQM A;  1FG4 A;  3CRU A;  2PMT A;  1EZK A;  4GLT A;  2HE3 A;  3QCP A;  1WE0 A;  3C73 A;  3CTG A;  2GSR A;  1XWC A;  4HQZ A;  3ZMK A;  3BJ5 A;  5G2Z A;  3DVW A;  4KH7 A;  4OD7 A;  2DLX A;  3UJ1 A;  3UVT A;  4F0B A;  4EDY A;  1CQH A;  5KOX A;  1X9W B;  2VD1 A;  2OKA A;  3GL5 A;  3GST A;  1MD3 A;  3VLN A;  3EPT A;  1GNW A;  3TCO A;  1Q98 A;  2BJX A;  4NHZ A;  3FR3 A;  2WJU A;  6GSU A;  4LLR A;  1PN9 A;  1Z6M A;  3DGQ A;  2MMA A;  1U3I A;  1H4O A;  4TXO B;  4HSC X;  4GTU A;  4IKH A;  2JU5 A;  3KCM A;  4L8E A;  4OWY A;  2RUF A;  4K6X A;  4NMU A;  3RHB A;  1K0M A;  5ECQ B;  1T3B A;  5J9C A;  1BJX A;  1F2E A;  1GUK A;  3HXS A;  1FVK A;  1Z5Y E;  4K2D A;  2DJ0 A;  1XOA A;  2O7K A;  2YJH A;  3LWA A;  3GNJ A;  1SK0 A;  2OE3 A;  5G31 A;  1EEJ A;  2LKU A;  3BBY A;  1R5P A;  2H70 A;  3C1S A;  1GTU A;  1B8X A;  1QQ2 A;  4V2M A;  3C71 A;  4MLY A;  4G2E A;  4G9H A;  3W8S A;  5D8I A;  2GZY A;  1WIK A;  2AYT A;  1UC7 A;  4RQR A;  4PQH A;  5A4V A;  1OVN A;  2C0D A;  2H6Y A;  3EMP A;  4IP6 A;  3IPZ A;  4I6X A;  2PVO C;  2OA7 A;  4X0X A;  5KOW A;  1EP8 A;  6GSW A;  5ECN B;  2FWG A;  3DD3 A;  1TK5 B;  4BVX B;  3TKQ A;  2VL2 A;  1R7H A;  3LYP A;  4MJE A;  2B3S A;  2PER A;  4X43 A;  3QAW A;  4NV5 A;  2ZNM A;  4BIK A;  2GGT A;  5B7C A;  2I1U A;  4IQA A;  3F4T A;  4XS6 A;  3GYK A;  1X9M B;  3KGK A;  2QSI A;  1GH2 A;  4K5R A;  4XS4 A;  1TK8 B;  2IN3 A;  5H5Q A;  1M7T A;  2J9H A;  2VCV A;  3GKN A;  3J7Y b;  4V1A p;  1NHO A;  1RK4 A;  2LNS A;  5CRH A;  4ZIL A;  3GX8 A;  3M9J A;  2YNX A;  4ML1 A;  1K0C A;  3DXB A;  3HJP A;  2NPB A;  1YEP A;  5CNW A;  2LTK A;  4PQI A;  4K9Z A;  3LW9 A;  1Z7P A;  3PGT A;  4ICY A;  1B4Q A;  2VCT A;  1ZYN A;  2CX4 A;  2YOI A;  1NSW A;  3NIV A;  1SKW B;  2E2G A;  4GWR A;  2VCX A;  1I9D A;  2V41 A;  4XRD A;  3C1R A;  4TR4 A;  2PUK C;  1GLP A;  4GF0 A;  1XXU A;  2RM5 A;  4QL9 A;  5AIV A;  1M9B A;  3IRA A;  1ML6 A;  2JZS A;  2JAC A;  1VF4 A;  5GSS A;  1T8E B;  3HA9 A;  2TRC P;  3IV4 A;  1B4P A;  3D6I A;  5CO3 A;  1TI1 A;  4F0C A;  1EOH A;  3KEB A;  3L0H A;  1AQV A;  2O85 A;  1JLW A;  1ON4 A;  5F8B A;  3RPP A;  2K6V A;  16GS A;  3ERF A;  1XWK A;  2CZ3 A;  4K7O A;  1SJI A;  1SL0 B;  5CRE A;  1OC3 A;  2VCW A;  4ULX A;  1YEX A;  4KND A;  4J57 E;  4WBR D;  2DJ3 A;  1TW9 A;  1F3B A;  4HS1 A;  1O73 A;  3F4R A;  3KP9 A;  3FZ5 A;  1KTE A;  1U3A A;  3L9V A;  1GLQ A;  5FT3 A;  1YF1 A;  4KGI A;  3IC4 A;  4MH2 A;  3IAS 2;  2GSQ A;  2IFQ B;  3C7M A;  2C0F A;  1ZCP A;  4I97 A;  3A5W A;  4DSS A;  4KB3 A;  5LCZ A;  5D9X A;  4KDU A;  1A24 A;  1FB0 A;  1T1V A;  4BL7 A;  5IOX A;  4ECC A;  2H1G A;  3U6V A;  10GS A;  5EY6 A;  2NBS A;  1OC8 A;  4Z2U A;  4XRA A;  4IN0 A;  5J3R A;  4YAP A;  3WD6 A;  3VPT A;  4CY8 A;  3ZFB A;  3GH6 A;  4MJC A;  4ZXG A;  2H71 A;  2OE1 A;  1BAY A;  2GLR A;  4L5L A;  4BVY B;  5IO2 A;  2V2G A;  4RQX A;  3L4N A;  1G7O A;  2TIR A;  5BRT A;  1EV4 A;  3DWV A;  4F82 A;  3DRN A;  5D9W A;  2DJJ A;  3BD2 A;  1PMT A;  2FD3 A;  3ME7 A;  1WJK A;  5G1K A;  1OE7 A;  1AUC A;  3GX0 A;  3UBL A;  5ELG A;  1LJR A;  3ZIV A;  3FZ4 A;  1BX9 A;  1Z3E A;  4LA1 A;  2A4V A;  4POL A;  1DSB A;  4POM A;  5E59 A;  4HEA 2;  2L5O A;  4HJ2 A;  3GL3 A;  1JZO A;  3WGD A;  3LSZ A;  3CYN A; 
#chains in the Genus database with same CATH homology
 2ALB A;  2IJY A;  3CXG A;  5HR2 A;  4XTS A;  4K0G A;  3M3M A;  3ZZX A;  3U5R E;  1X9S B;  3LJR A;  5EL8 A;  3UL3 A;  1TRV A;  4EDZ A;  1EWX A;  5C00 A;  1Z6N A;  3CMI A;  1S3A A;  3M1G A;  4N0V A;  3HZ8 A;  4TKY A;  5HFI A;  2JL4 A;  2MMZ A;  4N0Z A;  2O87 A;  3IE3 A;  4FYB A;  4Q5F A;  3UVH A;  1VRS D;  3F8U A;  4K8M A;  3Q74 A;  2LJA A;  3TKS C;  2H0I A;  4OO5 A;  7GSS A;  3A2W A;  3D21 A;  4ZL9 A;  2X4A A;  1GSU A;  1M2B A;  3IA1 A;  3A3T A;  1AXD A;  4JRR A;  5DQS A;  2FUG 2;  2QGV A;  17GS A;  1ZZY A;  1XOB A;  4ZL7 A;  5DAK A;  3IOS A;  4MF7 A;  4K7N A;  3WT2 A;  1URM A;  3PIN A;  2R6K A;  1T4Z A;  4G0K A;  4JE1 A;  1SEN A;  5LNK e;  1E6B A;  2EIR A;  3QMX A;  3UAP A;  5G30 A;  2K18 A;  3GIX A;  1B48 A;  1S3D A;  2OE0 A;  2FA4 A;  4GXZ A;  4O5R A;  3FKF A;  2PGT A;  1B9Y C;  2R0C A;  3GV1 A;  2GTU A;  3ZLP A;  2LRN A;  3LGC A;  1XFL A;  3HVV A;  5IMA A;  2L6D A;  5D9V A;  2AV4 A;  4BWQ A;  3H93 A;  5B6M A;  2I9H A;  3IK7 A;  3MYD A;  1GSS A;  2C3N A;  3A2X A;  4G10 A;  1F3A A;  1PSQ A;  4Q5N A;  2V32 A;  1G6W A;  1NM3 A;  2B5X A;  1SKS B;  2L4Q A;  2YPM A;  3JCM L;  2LJR A;  5ECS A;  4KA0 A;  1J9B A;  3QFB C;  1SKR B;  2YZU A;  2BMX A;  3TOU A;  4HDE A;  1ABA A;  4GST A;  3Q19 A;  4MA9 A;  1J0F A;  4KX4 A;  2R2J A;  2WRT A;  3V1W A;  1OC9 B;  1PQN A;  4POK A;  1EOG A;  2WZ9 A;  2YJ7 A;  1Y25 A;  4ISD A;  4JU5 A;  5ID2 A;  2M80 A;  4MZC A;  1T00 A;  3TGZ A;  4NPB A;  4WKW A;  3F0I A;  1X5E A;  1YY7 A;  1PA3 A;  3C8E A;  3O3T A;  2VO4 A;  4WR4 A;  4NHW A;  1V9W A;  4TN8 A;  2X99 A;  3QOU A;  3UBK A;  4P3Y B;  5HR1 A;  4WEY A;  5DAL A;  2GSS A;  5FHI A;  1V2A A;  5J9B A;  2L57 A;  2PN8 A;  4TVE A;  1QGV A;  5ECP B;  3HHV A;  4KDY A;  1LU4 A;  1AAZ A;  4OFN A;  3P7X A;  2DC5 A;  2LST A;  1QXH A;  4AJ7 A;  3EIN A;  2VL9 A;  1GSE A;  1PL1 A;  1FO5 A;  3IHG A;  1AW9 A;  3IK9 A;  5INY A;  1M9A A;  2A2S A;  2GS3 A;  2MMO A;  4OCE A;  3PR8 A;  2X8C A;  4PTS A;  3QPM A;  4GQC A;  4ZB8 A;  2H75 A;  2I81 A;  4TOP A;  3QAG A;  4TXO A;  2A2P A;  2QA1 A;  3P90 A;  2X64 A;  2FWF A;  3IC8 A;  1K0N A;  4O7H A;  2VLU A;  4MP4 A;  1KEB A;  2CT6 A;  2JAD A;  3D5J A;  4ILF A;  2WUL A;  4MNN A;  4J2F A;  4TR1 A;  3IBH A;  2DKH A;  4O5Q A;  1OYJ A;  3DKS A;  1NW2 A;  2HSM A;  1HD2 A;  1M2A A;  3TKP A;  4CY6 A;  2ZCT A;  1ERT A;  4N11 A;  2YZH A;  4TR3 A;  1NHY A;  1PN0 A;  1K3Y A;  5F06 A;  1QMV A;  4WXT A;  2JSY A;  4FQU A;  1K0B A;  5D96 A;  1G0T A;  1IYH A;  1YKC A;  2G2Q A;  3HJM A;  4E8E A;  1HQO A;  11GS A;  4EXJ A;  2X49 A;  1K0A A;  4TRX A;  3VWW A;  1SYR A;  6GSS A;  3Q18 A;  2IMD A;  3ERG A;  1V98 A;  4EIQ A;  1UN2 A;  2P31 A;  3FZA A;  4HU7 A;  3TRX A;  4MZB A;  4Z2R A;  2B5E A;  2FLS A;  1SYX A;  2CAI A;  4ID0 A;  4XIH A;  4DEJ A;  2WCI A;  1V57 A;  1Z7R A;  5KEJ A;  4KF9 A;  3HJO A;  1ACV A;  5D9T A;  1HNA A;  1W89 A;  4XS4 B;  1R26 A;  3AY8 A;  1XWB A;  2IIY A;  4KAE A;  4HZ4 A;  1BYE A;  2XPD A;  3W6G A;  2C3T A;  4FIW A;  4IS0 A;  4EC0 A;  3FHK A;  3ZRE A;  2ON5 A;  2DKI A;  2XC2 A;  3GHA A;  1GTI A;  1OKD A;  1XZO A;  3GMF A;  1YDK A;  2HFD A;  1XVW A;  5ECL B;  2E2M A;  2GVP A;  5JCG A;  2PPT A;  3HVS A;  2L5L A;  1XIY A;  4K0N A;  5F0G A;  2VM2 A;  1YJ6 A;  3R2Q A;  5ABR A;  1U87 A;  2EC4 A;  2CVK A;  1T7P B;  3G7J A;  3D0Z A;  3WGX A;  2F51 A;  4AJ6 A;  18GS A;  4JZQ A;  5KN3 A;  4PNG A;  3O76 A;  3UMA A;  3KMN A;  2FWE A;  2A2R A;  5EVO A;  2CAQ A;  3IDV A;  1DE2 A;  3GN3 A;  2PBJ A;  4D73 A;  1ERV A;  3J7Y k;  5ELA A;  1HNC A;  4EE0 A;  3VFI A;  4IBP A;  3IR4 A;  3ZVJ D;  2B5Y A;  2VUP A;  2HSY A;  2YN1 A;  3GKM A;  2B1K A;  4OFT A;  3I43 A;  4HZ2 A;  2FWH A;  2PWJ A;  3ZL5 A;  4HJM A;  3FK8 A;  2HLS A;  6GSX A;  4DVC A;  3N9J A;  5ECK B;  3SWL A;  4A5P A;  2FHE A;  5E4W A;  1JZW A;  1PX7 A;  5BMU A;  3TDG A;  1A23 A;  3P2A A;  19GS A;  4V2N A;  3MDK A;  4O5U A;  3ZFL A;  4I8B A;  4DSS B;  5KN1 A;  4Q5Q A;  2DMM A;  5D73 A;  1V58 A;  1PKZ A;  4EVM A;  4BL7 B;  2C80 A;  1OE8 A;  4PGT A;  5IMC A;  2GT6 A;  3ZML A;  1WMJ A;  2YP6 A;  3ZRD A;  1O8X A;  3NZN A;  2R4V A;  3G7Y A;  3BOA A;  4ACS A;  3FZ9 A;  4MDC A;  2R0G A;  1TK0 B;  4AJ8 A;  4PUF C;  2AUV A;  5A4W A;  2KLX A;  4ZBB A;  5DBQ A;  4JR6 A;  2GQK A;  5D93 A;  2VL2 C;  1ZGN A;  1FOV A;  1GP1 A;  4ECI A;  1G7E A;  4FO5 A;  3HZ4 A;  1AQX A;  2H01 A;  1JFU A;  4F03 A;  5DDL A;  4WBJ A;  1MDI A;  4AF2 A;  3K8N A;  2DJ2 A;  4ZIJ A;  1DE1 A;  2EIO A;  3G7I A;  2XBI A;  3TJG A;  1S3C A;  2HYX A;  5IMV A;  2LNT A;  14GS A;  3HD5 A;  4ZB6 A;  3CSH A;  4AGS A;  4POB A;  3ZIJ A;  3HYP A;  3F3Q A;  1WRY A;  5COH A;  1GTA A;  2MBT A;  1ZYE A;  3LXT A;  4IP1 A;  4OFM A;  1SD9 A;  3M0F A;  2YWM A;  1Q4J A;  6GST A;  1GUH A;  1MEK A;  1Y6E A;  2ZUP A;  4OO4 A;  1SU9 A;  5DCH A;  2RII A;  5ECH B;  4I2U A;  5H5R A;  3R3E A;  3VWX A;  4XHM A;  1ZMA A;  4PNF A;  3ZYW A;  2C1Y A;  2IWT A;  2CX3 A;  3KTB A;  2A4H A;  4KUN A;  1N8J A;  2F9S A;  1IYI A;  1V40 A;  2HZE B;  1X5D A;  5DCG A;  3GTU A;  1R4W A;  4K7I A;  3HY2 A;  4WET A;  1DBY A;  1VGL A;  5G5E A;  2N5A A;  3LG6 A;  5JCU A;  4L5O A;  8GSS A;  4X4J A;  3KZQ A;  1GSY A;  3ISO A;  5AN1 A;  4G0I A;  1O81 A;  3H8Q A;  2YAN A;  2HRF A;  2IPA A;  5DAK B;  3QDN A;  2H6Z A;  2LEG A;  4KCE A;  4DSQ A;  1F9M A;  1WWJ A;  3I9V 2;  2RLI A;  3LXZ A;  2VLV A;  4WR5 A;  3TUE A;  4GQF A;  3N5O A;  2HNL A;  4IHU A;  4PX1 A;  4MH3 A;  3E3E A;  2H73 A;  3DML A;  3WYW A;  1ERU A;  3KH9 A;  5IPG A;  1THX A;  4XCS A;  1MDJ A;  4EF0 A;  4NV2 A;  5CRG A;  3KIJ A;  5G1L A;  2V6O A;  2F8F A;  1K0D A;  5CAX A;  1YKA A;  3WT1 A;  3CTF A;  5AGY A;  3BCI A;  3P8W A;  5JWQ B;  5L71 A;  2C0E A;  3MNG A;  1A2J A;  4H86 A;  3QFA C;  1EV9 A;  2R3X A;  4TXV A;  3QR6 A;  3KJY A;  4HU9 A;  1E2Y A;  4O32 A;  2MZC A;  4G19 A;  2K9F A;  1XBS A;  5KN0 A;  1TU8 A;  2HRN A;  2KP2 A;  3APO A;  3KD0 A;  3KH7 A;  3A5I A;  1SJ6 A;  1WPI A;  2LJK A;  2QA2 A;  2NTO A;  3LEF A;  2IMI A;  3S9F A;  2B6M A;  4CHS A;  2GDR A;  5DQY A;  4JED A;  2R37 A;  3A2V A;  2H30 A;  4PXO A;  2GQM A;  4J56 E;  4YAV A;  4EIP A;  2OJL A;  2YWO A;  2F3M A;  4ZB9 A;  3KMO A;  3GSS A;  3F6F A;  5ENU A;  4FH8 A;  2LRT A;  5B6N A;  3SBC A;  1X5C A;  2C4J A;  1LBK A;  2HI7 A;  5ID2 B;  3G9B A;  3EWL A;  1THO A;  1FW1 A;  2QC7 A;  4IVF A;  2HSH A;  2XHF A;  3DIE A;  4LL4 B;  1XWG A;  3E9J B;  4GCI A;  1JHB A;  1EGO A;  4NAX A;  1A2M A;  4ZBD A;  1BQ7 A;  1QK8 A;  2AHE A;  3LQ7 A;  2V1M A;  2E0Q A;  3MWH A;  1KNG A;  1TDI A;  2VIM A;  5DAL B;  1JLV A;  2H1D A;  2TRX A;  3DYR A;  3QAV A;  1TKD B;  3TB2 A;  1XW9 A;  5J5N A;  5LD0 A;  2HRK A;  1TTZ A;  2H1B A;  3LOR A;  2ON7 A;  4CDO A;  1PKW A;  5G5F A;  2H72 A;  2VCZ A;  4GRF A;  5IIZ A;  3VWV A;  2WFC A;  1K0O A;  2VLT A;  4JR4 A;  5J41 A;  2FA8 A;  4RI7 A;  2DBC A;  4BWS A;  1VF1 A;  3OR5 A;  4MZW A;  4IEL A;  4OMV A;  4Q5R A;  2GQL A;  1M99 A;  3FEU A;  3UOM A;  1XCC A;  2RUE A;  5B8A A;  3RPN A;  1JZR A;  3TJK A;  2E7P A;  5GAN D;  3RDW A;  1PGT A;  3H79 A;  4TR1 B;  3VUR A;  2FY6 A;  3FY7 A;  3DVX A;  2F8A A;  1TP9 A;  1FVJ A;  3HCZ A;  5DJM A;  1T4Y A;  5F07 A;  1EEM A;  3KTL A;  1TXX A;  3KP8 A;  1SJZ A;  2DML A;  1GUM A;  1AIU A;  4CW9 A;  4GSS A;  3EU4 A;  1JZD A;  2KP1 A;  1GSF A;  3VK9 A;  1TRS A;  1PRX A;  4LMW A;  3F9U A;  1CQG A;  3GKX A;  2GT5 A;  4IQ1 A;  3L78 A;  4WF4 A;  13GS A;  4OCF A;  1A0R P;  4F9Z A;  2XPE A;  3CSI A;  4YH2 A;  2MBS A;  1EP7 A;  4USS A;  3E0U A;  2H19 A;  2H8L A;  3TJF A;  1WOU A;  5AIX A;  3EU3 A;  1Z9H A;  2CVD A;  3D4T A;  3WGE A;  2D2Z A;  1N2A A;  1PD2 1;  2OAC A;  4RUV A;  3LYK A;  1C72 A;  5FWG A;  4BVX A;  5DJL A;  4KW6 A;  2C3Q A;  3EUR A;  3RHC A;  4RI6 A;  2WS2 A;  3EE2 A;  1TOF A;  1ST9 A;  1K3L A;  4NXI A;  1ERW A;  3FYG A;  4MJB A;  2VAF A;  3CSJ A;  1PX6 A;  1F6M C;  4YKF A;  4V2L A;  4EUY A;  3TJB A;  5GAP D;  1UVZ A;  4ECJ A;  5HQP A;  3D22 A;  3F6D A;  2R5G A;  1O7U A;  4E8H A;  1WP0 A;  2KHP A;  4MMM A;  5ECR B;  3TJJ A;  4EO3 A;  1GSQ A;  2YV7 A;  2HZF A;  1ZL9 A;  2LUS A;  3RBT A;  2LQO A;  2ES7 A;  2L6C A;  1GNE A;  4K2X A;  1GRX A;  2FNO A;  4MPF A;  1SL1 B;  5JWO B;  1ZYQ B;  1O6J A;  4PUR A;  4PQ1 A;  1A8Y A;  3ED3 A;  4V1A g;  4Z7X A;  3F63 A;  3HDC A;  1M2D A;  2CVB A;  3TKR A;  5J4U A;  3GRX A;  5EPF A;  2P0G A;  1YZX A;  1GSD A;  4PUA A;  4NWY A;  1UA5 A;  3FR6 A;  5CP1 A;  2X8G A;  1ILO A;  3CBU A;  1TRU A;  12GS A;  3TKS A;  2DJK A;  4D73 B;  1TU7 A;  5ECI B;  2VOC A;  4IGJ A;  1XVQ A;  4IJI A;  1TI3 A;  2B7K A;  3ME8 A;  3I69 A;  3GA4 A;  2HXK A;  2PVQ A;  3FMW A;  2UZ8 A;  5IM9 A;  2P5Q A;  5A4U A;  4Z2T A;  2CV4 A;  5IMZ A;  2LV3 A;  3O6T A;  1OKT A;  5KN2 A;  1U88 A;  2GZZ A;  4KCA A;  2YV9 A;  3F4S A;  1MD4 A;  4TW5 A;  2WB9 A;  2X8H A;  4I2T A;  2J23 A;  3HVX A;  1H75 A;  4FYU A;  1AC1 A;  2I3Y A;  3I6A A;  2H74 A;  3H1N A;  1ZOF A;  2HRA A;  3UIW A;  3TOT A;  3RAZ A;  2DJ1 A;  1FAA A;  1FB6 A;  2HT9 A;  1GL8 A;  4MJA A;  2VD0 A;  4IJ3 A;  1X0R A;  2XBQ A;  4YKG A;  2C0G A;  2IMK A;  2BTO T;  1SK2 A;  1M0U A;  3GUS A;  3UEM A;  1XW6 A;  5C04 A;  2IFQ A;  4JBB A;  4HOJ A;  2FCH A;  2MMN A;  3M9K A;  3NOF A;  4BA7 A;  2H76 A;  2H0G A;  1F37 A;  5CRD A;  1R5A A;  4K5S A;  2REM A;  4O92 A;  3US3 A;  1YQ1 A;  1K3O A;  2V6K A;  2R0P A;  3MIX A;  4HUA A;  1OAZ A;  3Q6O A;  4F2I A;  1A8L A;  3EC3 A;  4EL1 A;  1XW5 A;  4EKZ A;  5HFK A;  4BVY A;  2YWN A;  1SL2 B;  4I5Q A;  3IHQ A;  2CA8 A;  5CYY A;  4GSN A;  2I4A A;  4G0L A;  5IO0 A;  4KSO A;  2VM1 A;  4HI7 A;  3VI7 A;  3APQ A;  2VL3 A;  2K8V A;  2KOK A;  4MPG A;  3BCK A;  3IAM 2;  4YQM A;  2OAD A;  4L0W A;  1GUL A;  2CZ2 A;  3FW2 A;  1KBN A;  3CRT A;  5H5S A;  2YWI A;  1O85 A;  3TKS E;  3ERW A;  2FGX A;  1J08 A;  5A5K A;  2JSZ A;  5GST A;  5ECM B;  2H6X A;  5IOW A;  4HQS A;  3MSZ A;  5B8B A;  1USB A;  2O8V B;  2JZT A;  4IW9 A;  1HNB A;  22GS A;  3GTU B;  1BED A;  4YQV A;  1MTC A;  2CQ9 A;  1XWA A;  5JCW A;  5IPH A;  4MK3 A;  4N30 A;  4K1F A;  2B1L A;  3DEX A;  3VWU A;  1O8W A;  1I5G A;  3PPU A;  3GUR A;  2WGR A;  3M8N A;  2HZE A;  3IXR A;  2H0H A;  6GSV A;  5IQY A;  2IME A;  2L4C A;  4X1U A;  4KDX A;  2H66 A;  2DSA A;  2H1A A;  3ZIT A;  5HR0 A;  2DIY A;  1ZYP A;  2LQQ A;  4WF5 A;  3L9U A;  1QUW A;  3MAK A;  5GZZ B;  5HFG A;  3PH9 A;  20GS A;  4L0U A;  3VI5 A;  2YCD A;  1A2L A;  1HYU A;  5IMD A;  4ZL8 A;  1PL2 A;  3APS A;  1VF3 A;  1G6Y A;  2M46 A;  2AAW A;  3UAR A;  2OBI A;  4N10 A;  2QKE A;  2L59 A;  2KUC A;  3GKK A;  1AQW A;  2N5F A;  1SK1 A;  3FRC A;  2JZR A;  4XS1 A;  2AJQ B;  3EVI A;  4LL1 B;  1A0F A;  1XPV A;  2OBK A;  3H4K A;  4ZBA A;  6GSY A;  3TRQ A;  5F05 A;  2GST A;  4TR0 A;  2RM6 A;  1SD8 A;  3D4M A;  2P5R A;  3L9S A;  2VCQ A;  1B9X C;  2LRC A;  3GFK A;  4ECB A;  2K8S A;  1EGR A;  4QQ7 A;  3LFL A;  5DVB A;  4YQU A;  1GTB A;  2IL3 A;  2NDO A;  3KXO A;  5HR3 A;  4MAB A;  3FR9 A;  1DUG A;  3W8J A;  1TJD A;  1TRW A;  3QD9 A;  1RW1 A;  2Z9S A;  5AIS A;  1U6T A;  5CRW A;  5IMF A;  4BPY A;  3F3R A;  3HKR A;  1W4V A;  3TRP A;  1GWC A;  4MF5 A;  1QFN A;  1VF2 A;  2N5B A;  2EIQ A;  2G0F A;  4FYC A;  1YF0 A;  2B7J A;  4MCU A;  4QL7 A;  4MF6 A;  3ZTL A;  2C8U A;  2LS5 A;  9GSS A;  3GH9 A;  1FOH A;  2IMF A;  2WDU A;  4KSM A;  1OC9 A;  4KE3 A;  1MDK A;  3ZVJ A;  4DSR A;  1FHE A;  2NVL A;  5JWR B;  2AB6 A;  4ML6 A;  5ECO B;  2M72 A;  3KM6 A;  2PU9 C;  3EMX A;  2DIZ A;  1BG5 A;  3VPQ A;  3EYT A;  2O89 A;  4LMV A;  2GZP A;  2MYG A;  1RQM A;  1FG4 A;  3CRU A;  2PMT A;  1EZK A;  4GLT A;  2HE3 A;  3QCP A;  1WE0 A;  3C73 A;  3CTG A;  2GSR A;  1XWC A;  4HQZ A;  3ZMK A;  3BJ5 A;  5G2Z A;  3DVW A;  4KH7 A;  4OD7 A;  2DLX A;  3UJ1 A;  3UVT A;  4F0B A;  4EDY A;  1CQH A;  5KOX A;  1X9W B;  2VD1 A;  2OKA A;  3GL5 A;  3GST A;  1MD3 A;  3VLN A;  3EPT A;  1GNW A;  3TCO A;  1Q98 A;  2BJX A;  4NHZ A;  3FR3 A;  2WJU A;  6GSU A;  4LLR A;  1PN9 A;  1Z6M A;  3DGQ A;  2MMA A;  1U3I A;  1H4O A;  4TXO B;  4GTU A;  4IKH A;  2JU5 A;  3KCM A;  4L8E A;  4OWY A;  2RUF A;  4K6X A;  4NMU A;  3RHB A;  1K0M A;  5ECQ B;  1T3B A;  5J9C A;  1BJX A;  1F2E A;  1GUK A;  3HXS A;  1FVK A;  1Z5Y E;  4K2D A;  2DJ0 A;  1XOA A;  2O7K A;  2YJH A;  3LWA A;  3GNJ A;  1SK0 A;  2OE3 A;  5G31 A;  1EEJ A;  2LKU A;  3BBY A;  1R5P A;  2H70 A;  3C1S A;  1GTU A;  1B8X A;  1QQ2 A;  4V2M A;  3C71 A;  4MLY A;  4G2E A;  4G9H A;  3W8S A;  5D8I A;  2GZY A;  1WIK A;  2AYT A;  1UC7 A;  4RQR A;  4PQH A;  5A4V A;  1OVN A;  2C0D A;  2H6Y A;  3EMP A;  4IP6 A;  3IPZ A;  4I6X A;  2PVO C;  2OA7 A;  4X0X A;  5KOW A;  1EP8 A;  6GSW A;  5ECN B;  2FWG A;  3DD3 A;  1TK5 B;  4BVX B;  3TKQ A;  2VL2 A;  1R7H A;  3LYP A;  4MJE A;  2B3S A;  2PER A;  4X43 A;  3QAW A;  4NV5 A;  2ZNM A;  2GGT A;  5B7C A;  2I1U A;  4IQA A;  3F4T A;  4XS6 A;  3GYK A;  1X9M B;  3KGK A;  2QSI A;  1GH2 A;  4K5R A;  4XS4 A;  1TK8 B;  2IN3 A;  5H5Q A;  1M7T A;  2J9H A;  2VCV A;  3GKN A;  3J7Y b;  4V1A p;  1NHO A;  1RK4 A;  2LNS A;  5CRH A;  4ZIL A;  3GX8 A;  3M9J A;  2YNX A;  4ML1 A;  1K0C A;  3DXB A;  3HJP A;  2NPB A;  1YEP A;  5CNW A;  2LTK A;  4PQI A;  4K9Z A;  3LW9 A;  1Z7P A;  3PGT A;  4ICY A;  1B4Q A;  2VCT A;  1ZYN A;  2CX4 A;  2YOI A;  1NSW A;  3NIV A;  1SKW B;  2E2G A;  4GWR A;  2VCX A;  1I9D A;  2V41 A;  4XRD A;  3C1R A;  4TR4 A;  2PUK C;  1GLP A;  4GF0 A;  1XXU A;  2RM5 A;  4QL9 A;  5AIV A;  1M9B A;  3IRA A;  1ML6 A;  2JZS A;  2JAC A;  1VF4 A;  5GSS A;  1T8E B;  3HA9 A;  2TRC P;  3IV4 A;  1B4P A;  3D6I A;  5CO3 A;  1TI1 A;  4F0C A;  1EOH A;  3KEB A;  3L0H A;  1AQV A;  2O85 A;  1JLW A;  1ON4 A;  5F8B A;  3RPP A;  2K6V A;  16GS A;  3ERF A;  1XWK A;  2CZ3 A;  4K7O A;  1SJI A;  1SL0 B;  5CRE A;  1OC3 A;  2VCW A;  4ULX A;  1YEX A;  4KND A;  4J57 E;  4WBR D;  2DJ3 A;  1TW9 A;  1F3B A;  4HS1 A;  1O73 A;  3F4R A;  3KP9 A;  3FZ5 A;  1KTE A;  1U3A A;  3L9V A;  1GLQ A;  5FT3 A;  1YF1 A;  4KGI A;  3IC4 A;  4MH2 A;  3IAS 2;  2GSQ A;  2IFQ B;  3C7M A;  2C0F A;  1ZCP A;  4I97 A;  3A5W A;  4DSS A;  4KB3 A;  5LCZ A;  5D9X A;  4KDU A;  1A24 A;  1FB0 A;  1T1V A;  4BL7 A;  5IOX A;  4ECC A;  2H1G A;  3U6V A;  10GS A;  5EY6 A;  2NBS A;  1OC8 A;  4Z2U A;  4XRA A;  4IN0 A;  5J3R A;  4YAP A;  3WD6 A;  3VPT A;  4CY8 A;  3ZFB A;  3GH6 A;  4MJC A;  4ZXG A;  2H71 A;  2OE1 A;  1BAY A;  2GLR A;  4L5L A;  4BVY B;  5IO2 A;  2V2G A;  4RQX A;  3L4N A;  1G7O A;  2TIR A;  5BRT A;  1EV4 A;  3DWV A;  4F82 A;  3DRN A;  5D9W A;  2DJJ A;  3BD2 A;  1PMT A;  2FD3 A;  3ME7 A;  1WJK A;  5G1K A;  1OE7 A;  1AUC A;  3GX0 A;  3UBL A;  5ELG A;  1LJR A;  3ZIV A;  3FZ4 A;  1BX9 A;  1Z3E A;  4LA1 A;  2A4V A;  4POL A;  1DSB A;  4POM A;  5E59 A;  4HEA 2;  2L5O A;  4HJ2 A;  3GL3 A;  1JZO A;  3WGD A;  3LSZ A;  3CYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...