2DBCA

Solution structure of the thioredoxin-like domain of phosducin-like protein 2(pdcl2)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
135
structure length
135
Chain Sequence
GSSGSSGKFGELREISGNQYVNEVTNAEKDLWVVIHLYRSSVPMCLVVNQHLSVLARKFPETKFVKAIVNSCIEHYHDNCLPTIFVYKNGQIEGKFIGIIECGGINLKLEELEWKLSEVGAIQSDLEENSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords unnamed protein product
publication title Solution structure of the Thioredoxin-like domain of Phosducin-like protein 2(PDCL2)
rcsb
source organism Mus musculus
total genus 19
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2005-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2dbcA00
4DSSB 5ECMB 2KHPA 5F07A 3JCML 1BYEA 4F0CA 1GNEA 1GLPA 1Z5YE 3D6IA 3F3RA 4V2MA 3Q18A 1GSEA 4PNFA 3LYPA 4GWRA 2R6KA 4WXTA 4BWQA 4EVMA 1OC3A 2VOCA 1T00A 1E6BA 2KOKA 2QSIA 3L0HA 4NV2A 2RM6A 2JADA 4KH7A 3FK8A 3L9VA 1UC7A 2JZRA 4Q5FA 1XWGA 1TK8B 3LJRA 1SK0A 4NHWA 4FO5A 5ECOB 1WP0A 4V2LA 3F4SA 3P2AA 1M0UA 2DJJA 5J41A 4RQXA 1B8XA 3HHVA 3TKQA 3H79A 3DKSA 4DSSA 3MNGA 1USBA 5H5RA 1F6MC 4ML6A 5JCGA 3HCZA 1FOVA 1AXDA 1XOBA 3BCKA 1TRUA 4OFTA 1Z3EA 1R7HA 2EIOA 3KH9A 2IMFA 4KE3A 4L0WA 1VF4A 2I81A 2V6KA 1H4OA 1BEDA 4KA0A 5GAPD 2VUPA 3ERWA 2H1BA 2C0FA 4TN8A 5HFIA 1K0MA 1RQMA 3E0UA 1OKDA 3LFLA 5E4WA 1XWKA 2VCXA 4KX4A 3DWVA 4ZL7A 1U3AA 2HXKA 1SL2B 3ZITA 3VWWA 3CSIA 5HQPA 3GYKA 1R5AA 1HNCA 4WBJA 2YWMA 2NVLA 1NHYA 5F05A 3HA9A 2PERA 5J4UA 3PINA 4DSQA 1ZOFA 3HZ8A 1V40A 4WEYA 3UVTA 3M1GA 5IO2A 4GSNA 1G7EA 1YKCA 1U6TA 2CZ2A 1PMTA 1EOGA 2C0DA 3UL3A 1JFUA 3CSJA 2VCVA 2FWHA 1T8EB 2IMKA 2CVDA 3QAGA 3Q6OA 4KSOA 2QKEA 1ML6A 5J5NA 1XBSA 2OE3A 1TU7A 4YQVA 1Z7PA 3UOMA 1FVKA 5D9WA 3TKSE 4D73A 1GL8A 2RIIA 2GSQA 2EIRA 1W89A 1EGRA 2VM1A 1FB0A 1F37A 1QFNA 4OFMA 5F0GA 2K8VA 1X9SB 2WULA 4GTUA 2VL3A 3F4RA 5KN2A 4O32A 5EVOA 3DMLA 2DJ3A 3TJFA 2X8GA 5D93A 1FB6A 4PQIA 3EE2A 3QAVA 5IO0A 1BQ7A 2XPDA 3C73A 1TP9A 5KEJA 1EV4A 3CYNA 5CP1A 3KH7A 1WRYA 4IJIA 3EYTA 1ZCPA 1WJKA 2IMDA 3TOUA 6GSUA 1R26A 2HNLA 2R37A 5ECPB 1B48A 4N11A 3WT1A 3O76A 3DVXA 3DRNA 3TRQA 3GRXA 4EO3A 3TKSA 4N0ZA 5A4WA 3A2VA 13GSA 2DIZA 2FLSA 2RLIA 5KN1A 3KGKA 4CDOA 1M9BA 1K0DA 4WETA 2YV7A 3PR8A 4IGJA 3D4MA 3VWUA 4LMVA 3N9JA 1GTIA 1FO5A 3W6GA 5IMVA 2R2JA 1XWCA 1GNWA 5L71A 3OR5A 4PUFC 3KIJA 1KNGA 2WRTA 4HU9A 1ERUA 2H70A 3ME7A 4O5RA 1V9WA 2IL3A 2LEGA 3GKKA 3TJBA 3M8NA 3TKPA 1KEBA 1O7UA 2I4AA 2REMA 3E3EA 2VO4A 3US3A 4FH8A 3BOAA 1EEJA 3MSZA 5ELGA 2H0IA 3VI7A 22GSA 3M3MA 2JU5A 4JU5A 3ZVJA 2GSSA 5HR0A 4JZQA 1OC9B 6GSXA 2CV4A 1JZWA 1B9YC 1DBYA 2VCWA 3G7IA 4CHSA 3EC3A 1SENA 3KD0A 3CMIA 3NZNA 4IKHA 4RI6A 2YPMA 3FR6A 4GQFA 5FHIA 4IS0A 4WF4A 3UARA 5IOWA 2LRTA 2H76A 1X9WB 1PA3A 4MJEA 4TKYA 4F2IA 3FEUA 2C1YA 3TCOA 1J9BA 3EURA 1RW1A 2HRFA 3QMXA 4PURA 1EEMA 3APQA 2VD0A 1RK4A 2VCTA 3DGQA 4EDYA 4MJAA 3EMXA 1OC9A 2B3SA 1SJ6A 2H74A 1K0CA 2OADA 1QQ2A 1OYJA 1TKDB 2GQLA 1K0AA 2LJAA 2LQOA 1DUGA 1OVNA 2H1AA 1AIUA 5IMDA 3U6VA 1GSQA 3ZZXA 1FG4A 1QUWA 1GSYA 1A24A 1F3AA 3QFAC 2FA4A 4WR5A 3RHCA 4YH2A 5D8IA 2HSHA 2JACA 2VAFA 2WGRA 3EWLA 1B4QA 2JL4A 1BJXA 1GP1A 2FD3A 1A8YA 4K7NA 1OC8A 2K18A 2H0HA 2H1GA 3KTBA 4POMA 3O3TA 1GTBA 2M46A 3GFKA 1XWBA 3HXSA 1AW9A 2LTKA 3D0ZA 2P5QA 3ZFLA 1NHOA 4EXJA 2C0EA 4ML1A 3GHAA 4KUNA 3LXTA 3GTUB 1F2EA 1SD8A 4P3YB 1ILOA 4TOPA 3QDNA 1JZRA 3ZIJA 3VI5A 2DJ0A 3KCMA 3O6TA 1X5DA 5DALB 4JRRA 1ERWA 2P0GA 2L59A 4G19A 1HNBA 2YJ7A 4NV5A 2NPBA 3ZLPA 2BMXA 4MJCA 2O85A 2I9HA 2MMZA 1WE0A 3TRPA 3C1SA 1GWCA 3TOTA 1X5CA 1EV9A 1F9MA 1KTEA 3IDVA 3QD9A 3NOFA 3LYKA 4YQMA 1EOHA 3KP8A 3H4KA 4MPFA 4MPGA 2IMEA 3CTFA 5H5QA 2HT9A 2WDUA 3GTUA 2GT6A 1YQ1A 1WPIA 3I43A 5DALA 3TGZA 1YZXA 4ZB8A 5IMAA 3I69A 2LJRA 4GSSA 2AJQB 3VWXA 2YZHA 2LRCA 1M9AA 2YWOA 3CTGA 1ZYEA 3ISOA 4HUAA 4EC0A 2QGVA 1VF1A 4G2EA 2HLSA 2FWFA 2C4JA 4K6XA 3F6DA 5CRGA 17GSA 2CQ9A 2GT5A 3H8QA 2WS2A 1ZMAA 3QR6A 1MD3A 4YAPA 3FKFA 3UAPA 4DVCA 2H19A 2H1DA 1ZL9A 1PSQA 1XW9A 1SL1B 3H1NA 1GLQA 2FGXA 2RM5A 2P31A 2DJ1A 2CZ3A 4IQ1A 1XCCA 2IPAA 1M2DA 3DIEA 1A0FA 2F8AA 2ALBA 2N5FA 1T1VA 1UN2A 4MP4A 3UBLA 4XS1A 2PMTA 3ME8A 5ECRB 2FCHA 4V2NA 4BPYA 5AIXA 1DSBA 1BX9A 2B1LA 1VGLA 2B5EA 5H5SA 1YDKA 5HR3A 4XRDA 1GUHA 2YP6A 4ULXA 3J7Yb 1ST9A 2GTUA 3IE3A 5JWOB 4MLYA 2J9HA 2OJLA 3CSHA 2K8SA 2H6YA 3UMAA 3QPMA 2CVBA 1MDJA 4K0NA 5GZZB 2IWTA 5CYYA 2CVKA 4PGTA 5IM9A 2OE1A 4PX1A 2WCIA 3EMPA 1O6JA 3HVVA 3VURA 5ECQB 3I6AA 5DCHA 4G10A 2A2RA 3TKRA 4POLA 4TR4A 1TW9A 4GSTA 2O89A 2I1UA 4ZB6A 2F8FA 4D73B 4DEJA 1S3AA 2G0FA 1SKRB 2EIQA 2IN3A 3F9UA 1URMA 3CRUA 2V41A 2VLUA 3HKRA 3HVSA 3C7MA 5A4UA 3IXRA 4TR1A 2VL2C 2RUFA 4X43A 5HFKA 4RQRA 1WIKA 4WKWA 2BTOT 1MTCA 18GSA 2YOIA 2J23A 4YQUA 4EF0A 1FHEA 3Q74A 2KLXA 1TOFA 3R2QA 4ID0A 2LRNA 1XZOA 2X99A 1VRSD 2HYXA 2HZFA 1I5GA 2CAIA 4IHUA 1K0OA 3IV4A 4V1Ap 5ELAA 3E9JB 3APOA 3GX8A 1TK5B 5CAXA 2ON7A 3IOSA 2HE3A 4ZL9A 1J08A 3PH9A 2YCDA 4LLRA 5DDLA 2H0GA 3M9JA 8GSSA 2A4VA 4HEA2 4NHZA 2OACA 5EPFA 2H6XA 3TJGA 1K0BA 4IP6A 3GKXA 3G7JA 3ERGA 1XW5A 4I2TA 1M2BA 2MMAA 2FA8A 5IOXA 3TDGA 4I8BA 1J0FA 1V57A 4GRFA 2OE0A 5J9CA 5JWRB 4CW9A 2VD1A 5ID2A 2EC4A 2YV9A 1O85A 3GL3A 1SKWB 1S3DA 4HDEA 2GSTA 1K3LA 5IMFA 1OE7A 2E0QA 3TJKA 1X9MB 4XRAA 3DVWA 4OMVA 4GXZA 4HZ2A 3MDKA 3FZ9A 4F82A 1M7TA 3BJ5A 4I2UA 3RDWA 3RPNA 2N5BA 2C80A 3WYWA 2FUG2 1PD21 3GSTA 3HZ4A 2PUKC 1QGVA 3A2XA 2DJ2A 1IYHA 2V32A 4N30A 5D96A 1TTZA 3VPTA 4F9ZA 3LORA 2DMMA 3LQ7A 4PUAA 5A4VA 4H86A 3ZVJD 3UVHA 4PNGA 3HDCA 5B6MA 12GSA 4TRXA 4WR4A 5G5FA 1NW2A 2GZPA 4TR3A 2PWJA 2MBTA 3ZMKA 5ENUA 1GSFA 4LL4B 3ZMLA 1ERTA 4ECIA 1AQXA 3IA1A 5COHA 2IFQA 4MJBA 1MD4A 5D9XA 1EGOA 2C8UA 2LNSA 3EU4A 2JZSA 2JSYA 4KNDA 1NSWA 5ECLB 1JZDA 3FYGA 4J56E 4MK3A 4TW5A 2X8CA 4Q5NA 5HR1A 3GL5A 3GURA 3DXBA 5CRDA 2LJKA 4L5OA 2TRCP 6GSSA 4LMWA 2FY6A 3W8SA 2WFCA 3F3QA 4HJ2A 2O8VB 5DVBA 2GZYA 1E2YA 1Z9HA 1AQVA 4IJ3A 1EZKA 4QQ7A 5CRWA 3KM6A 3A5WA 2GQKA 3BBYA 2DIYA 3KP9A 1HD2A 1Z7RA 2HZEA 2L57A 2K6VA 2GZZA 3I9V2 3J7Yk 1Q98A 5DJLA 2FWEA 1YKAA 2H8LA 2RUEA 2B5XA 2V1MA 2OKAA 4HI7A 3WGDA 3BCIA 1TU8A 2OA7A 1DE2A 5IIZA 2MMOA 2PGTA 2TRXA 2R3XA 3GN3A 3IK9A 3TRXA 1TI3A 2L6CA 5AISA 1ZZYA 2V2GA 2YANA 4WF5A 1AC1A 4MZWA 3P8WA 3LWAA 4TR0A 1V2AA 3IBHA 2C3QA 2R5GA 2B6MA 3IAS2 4ZILA 4EL1A 1LBKA 2ES7A 4G9HA 5ECSA 2KP2A 1M2AA 1GRXA 1JZOA 4IELA 4K9ZA 1ZYQB 1YEXA 3IC4A 4XTSA 4TVEA 2YNXA 1M99A 5GSTA 3U5RE 2YWNA 2MMNA 1BAYA 5B8AA 2PVOC 2H72A 3EVIA 3RHBA 5IPGA 1SJZA 1H75A 2H66A 2N5AA 2H01A 5FWGA 3RPPA 1GH2A 4WBRD 2JZTA 2XC2A 4IBPA 3A2WA 1K3YA 4K1FA 3HJOA 5KN0A 4JEDA 3ZREA 3ZTLA 3W8JA 5LNKe 3MWHA 2AB6A 4AJ6A 20GSA 3UEMA 2H71A 3GSSA 3NIVA 2AYTA 2NBSA 3HJMA 4HQZA 4J57E 4J2FA 3KZQA 1PQNA 4Q5QA 2LSTA 1TJDA 4HJMA 3TUEA 4OCEA 1O8WA 3F63A 3SBCA 1A23A 5GAND 1UVZA 4ZBDA 2A2SA 3EINA 2MBSA 4Z7XA 4OO5A 4JR4A 2AV4A 5CO3A 4JBBA 2B1KA 4EUYA 3KMOA 4Q5RA 3G9BA 1V98A 3GH6A 1S3CA 3D22A 3FR3A 1XIYA 2O7KA 1XFLA 4MZBA 5CRHA 1CQGA 1PX6A 9GSSA 4ILFA 4OD7A 4QL9A 10GSA 3QCPA 5G30A 3GH9A 4AJ8A 3C71A 1HYUA 4E8EA 4F0BA 4EE0A 2L6DA 4L5LA 4MDCA 3HVXA 5F8BA 3DEXA 5C00A 3UJ1A 4ECJA 2F3MA 2HRNA 4O7HA 4MF6A 1YF1A 3ED3A 4OCFA 3FZ5A 3GMFA 2L5OA 1PX7A 3ZIVA 3L78A 4MABA 4MF7A 3G7YA 4PQHA 1A2JA 3ZYWA 1WMJA 1VF3A 2VL9A 4XS6A 1MDIA 2TIRA 4XCSA 3ZL5A 4RUVA 3FW2A 2C3TA 2GLRA 2H73A 4IW9A 4KAEA 2LNTA 3GKNA 3TJJA 1F3BA 2WB9A 5AN1A 1PKZA 3M0FA 3WT2A 1W4VA 4NMUA 1YY7A 6GSVA 1SYRA 1QXHA 1Y6EA 1THXA 4BVXA 4E8HA 2HSYA 2DLXA 6GSWA 5IMZA 5EY6A 2B7KA 1ACVA 5ECIB 2CX3A 5JCWA 2M72A 1Z6NA 2CX4A 2MZCA 2GDRA 1K0NA 1TRSA 4L0UA 1ABAA 5C04A 2DMLA 1A2LA 4TR1B 4HZ4A 4QL7A 5IQYA 4FIWA 3AY8A 3DYRA 1PKWA 1O81A 5FT3A 3CRTA 2XBIA 4POKA 2ZCTA 4K8MA 4K0GA 5B7CA 1X5EA 4ZIJA 1B9XC 1LU4A 3HYPA 2V6OA 1A0RP 1TI1A 2FNOA 4TXVA 4IQAA 4N10A 3KXOA 3VLNA 2HI7A 3LGCA 1JLWA 4FYBA 2D2ZA 2VLTA 2Z9SA 3KJYA 1FW1A 1FVJA 4HQSA 4X1UA 2H30A 4FYUA 4POBA 4XIHA 3S9FA 3IK7A 1PL1A 5J3RA 4XS4B 2VCQA 5G5EA 5D9VA 5ID2B 4IVFA 4NXIA 3FZ4A 4BVYA 2XBQA 4TXOB 7GSSA 2H6ZA 4ECBA 3C8EA 2CAQA 3QOUA 1K3OA 4ZBAA 2GGTA 3APSA 2OBIA 3PGTA 1O8XA 4MH3A 1T4ZA 1YEPA 4ZXGA 1PN9A 1N8JA 3TKSC 4GLTA 3CBUA 3ZFBA 1XW6A 1VF2A 3HD5A 4JR6A 4RI7A 1CQHA 2DC5A 2XPEA 1HQOA 1XVWA 2LV3A 3Q19A 3L9SA 4KB3A 4ISDA 3GA4A 3TB2A 4L8EA 4XS4A 5F06A 1GUKA 1G7OA 2I3YA 1SD9A 5DBQA 2LS5A 1I9DA 1T3BA 2IJYA 2LKUA 5ECKB 4TXOA 1QMVA 5CNWA 2L4CA 1SL0B 2PU9C 2FWGA 3GIXA 2VL2A 4I6XA 5J9BA 4BWSA 2IFQB 1GSDA 5DAKB 1GSUA 4ZBBA 4AGSA 1THOA 5B8BA 3KTLA 1UA5A 1EWXA 1T7PB 5GSSA 1IYIA 5INYA 1SKSB 2X8HA 4IN0A 5AGYA 4EDZA 3IAM2 4KDXA 3RBTA 4LA1A 4AF2A 2KP1A 4MA9A 5E59A 1AUCA 1JLVA 2AUVA 3D4TA 2X64A 1G6YA 5JWQB 1ON4A 5DQSA 3V1WA 2AAWA 5EL8A 5G1KA 3DD3A 3MAKA 3IPZA 2OBKA 5HFGA 2KUCA 2PN8A 1KBNA 5DAKA 2HZEB 4HS1A 1O73A 3C1RA 4K2DA 4K7OA 1TXXA 4GCIA 1YJ6A 2H75A 4KCAA 3F8UA 5D9TA 5JCUA 2GVPA 4I97A 3VWVA 3FY7A 5G2ZA 2F9SA 2GQMA 2JSZA 2HFDA 3ERFA 1PL2A 3LXZA 2WJUA 4O92A 4KDUA 3H93A 4DSRA 3A3TA 4KGIA 3D5JA 1YF0A 2PBJA 3D21A 1N2AA 5CREA 2CT6A 3P90A 5DJMA 1Y25A 5A5KA 2BJXA 3L4NA 4KSMA 2P5RA 2XHFA 4HOJA 2GSRA 1XOAA 2ZNMA 1TRWA 3GX0A 3GNJA 4NWYA 3SWLA 1MEKA 3IHQA 3KEBA 4ACSA 5KN3A 19GSA 3VPQA 1TK0B 1WOUA 6GSTA 2VIMA 4N0VA 3VK9A 2CA8A 3QFBC 3EU3A 1EP8A 3FRCA 1GTAA 2VLVA 1HNAA 3RAZA 2AHEA 2L5LA 4NAXA 2K9FA 3LSZA 1DE1A 2YN1A 1A2MA 5DCGA 1SK2A 2G2QA 1ZGNA 2ON5A 3UBKA 4ZB9A 2FHEA 1XVQA 1AQWA 3F4TA 2PVQA 4KW6A 2WZ9A 5HR2A 3CXGA 1LJRA 3LG6A 5AIVA 1R4WA 3GUSA 4BL7A 1NM3A 4LL1B 5LCZA 1WWJA 1TRVA 4EKZA 3M9KA 1U87A 3FHKA 3VFIA 1PGTA 3HY2A 5G31A 4V1Ag 5ECHB 1AAZA 1OKTA 2E2GA 2F51A 4ECCA 1A8LA 2LUSA 3K8NA 3WGEA 1U88A 4NPBA 4IP1A 4GF0A 16GSA 4MF5A 1T4YA 5IMCA 2DJKA 1JHBA 2GS3A 1MDKA 2LQQA 3UIWA 1SU9A 4OO4A 3BD2A 1OAZA 2IIYA 2E7PA 4HU7A 2VCZA 1ERVA 4JE1A 1U3IA 5D73A 1TDIA 3HJPA 2YJHA 4MH2A 1FAAA 1Q4JA 4OWYA 1V58A 3KMNA 1X0RA 1Z6MA 2YZUA 4KDYA 1G0TA 2PPTA 5ABRA 1BG5A 1C72A 3GKMA 4PQ1A 3QAWA 2L4QA 5LD0A 1XXUA 1XPVA 1SK1A 4KCEA 2B5YA 2R4VA 14GSA 4BA7A 4K7IA 3WD6A 2IMIA 5DQYA 2E2MA 4XHMA 3LEFA 1GULA 2VM2A 4AJ7A 2MYGA 1SJIA 2QC7A 2ZUPA 1OE8A 2B7JA 1R5PA 2C0GA 2M80A 2O87A 2DSAA 4ZL8A 3P7XA 1EP7A 1GSSA 4I5QA 2NTOA 4X0XA 4FYCA 5ECNB 1G6WA 4MZCA 5IPHA 1GTUA 11GSA 1B4PA 2DBCA 2NDOA 4PXOA 1SYXA 3IRAA 1GUMA 4F03A 2YWIA 5G1LA 3ZRDA 3IR4A 4MCUA 5B6NA 3F0IA 2C3NA 4GQCA 6GSYA 4OFNA 3L9UA 1XWAA 4MMMA 4YAVA 3GV1A 3F6FA 3WGXA 1PRXA 3N5OA 3FZAA 3FR9A 1QK8A
chains in the Genus database with same CATH superfamily
4DSSB 5ECMB 2KHPA 5F07A 3JCML 1BYEA 4Z2RA 4F0CA 1GNEA 5BMUA 1GLPA 2R0PA 1Z5YE 3D6IA 3F3RA 4V2MA 3Q18A 1GSEA 4PNFA 3LYPA 4GWRA 2R6KA 4WXTA 4BWQA 4EVMA 1OC3A 2VOCA 1T00A 1E6BA 2KOKA 2QSIA 3L0HA 2HSMA 4NV2A 2RM6A 2JADA 4KH7A 3FK8A 3L9VA 1UC7A 2JZRA 4Q5FA 1XWGA 1TK8B 3LJRA 1SK0A 4NHWA 4FO5A 5ECOB 4K5RA 1WP0A 4V2LA 3F4SA 3P2AA 1M0UA 2DJJA 4BVYB 5J41A 4RQXA 1B8XA 3HHVA 3TKQA 2R0CA 3H79A 3DKSA 4DSSA 3MNGA 1USBA 5H5RA 1F6MC 4ML6A 5JCGA 3HCZA 1FOVA 1AXDA 1XOBA 3BCKA 1TRUA 4OFTA 1Z3EA 1R7HA 2EIOA 3KH9A 2IMFA 4KE3A 4L0WA 1VF4A 2I81A 2V6KA 1H4OA 1BEDA 4KA0A 5GAPD 2VUPA 3ERWA 2H1BA 2C0FA 4TN8A 5HFIA 1K0MA 1RQMA 3E0UA 1OKDA 3LFLA 5E4WA 1XWKA 2VCXA 4KX4A 3DWVA 4ZL7A 1U3AA 2HXKA 1SL2B 3ZITA 3VWWA 3CSIA 5HQPA 3GYKA 1R5AA 1HNCA 4WBJA 2YWMA 2NVLA 1NHYA 5F05A 5KOWA 3HA9A 2PERA 5J4UA 4Z2UA 3PINA 4DSQA 1ZOFA 3HZ8A 4CY8A 1V40A 4WEYA 3UVTA 3M1GA 5IO2A 4GSNA 1G7EA 1YKCA 1U6TA 2CZ2A 1PMTA 1EOGA 2C0DA 3UL3A 1JFUA 3CSJA 2VCVA 2FWHA 1T8EB 2IMKA 2CVDA 3QAGA 4BIKA 3Q6OA 4KSOA 2QKEA 1ML6A 5J5NA 1XBSA 2OE3A 1TU7A 4YQVA 1Z7PA 3UOMA 1FVKA 5D9WA 3TKSE 4D73A 1GL8A 2RIIA 2HRAA 2GSQA 2EIRA 1W89A 1EGRA 2VM1A 1FB0A 1F37A 1QFNA 4OFMA 5F0GA 2K8VA 1X9SB 2WULA 4GTUA 2VL3A 3F4RA 5KN2A 4O32A 4K5SA 5EVOA 3DMLA 2DJ3A 3TJFA 2X8GA 5D93A 1FB6A 4PQIA 3EE2A 3QAVA 5IO0A 1BQ7A 2XPDA 3C73A 1TP9A 5KEJA 1EV4A 3CYNA 5CP1A 3KH7A 1WRYA 4IJIA 3EYTA 1ZCPA 1WJKA 2IMDA 3TOUA 6GSUA 1R26A 2HNLA 2R37A 5ECPB 1B48A 4N11A 3WT1A 3O76A 3DVXA 3DRNA 3TRQA 3GRXA 4EO3A 3TKSA 4N0ZA 5A4WA 3A2VA 1ZYNA 13GSA 2DIZA 2FLSA 2RLIA 5KN1A 3KGKA 4CDOA 1M9BA 1FOHA 1K0DA 4WETA 2YV7A 3PR8A 4IGJA 3D4MA 3VWUA 4LMVA 3N9JA 1GTIA 1FO5A 3W6GA 5IMVA 2R2JA 1XWCA 1GNWA 5L71A 3OR5A 4PUFC 3KIJA 1KNGA 2WRTA 4HU9A 1ERUA 2H70A 3ME7A 4O5RA 1V9WA 2IL3A 2LEGA 3GKKA 3TJBA 3M8NA 3TKPA 1KEBA 1O7UA 2I4AA 2REMA 3E3EA 2VO4A 3US3A 4FH8A 3BOAA 1EEJA 3MSZA 5ELGA 2H0IA 4FQUA 3VI7A 22GSA 3M3MA 2JU5A 4JU5A 3ZVJA 2GSSA 5HR0A 4JZQA 1OC9B 6GSXA 2CV4A 1JZWA 1B9YC 1DBYA 2VCWA 3G7IA 4CHSA 3EC3A 1SENA 3KD0A 3CMIA 3NZNA 4IKHA 3HVNA 4RI6A 4YKGA 4Z2TA 2YPMA 3FR6A 4GQFA 4BL7B 5FHIA 4IS0A 4WF4A 3UARA 4HSCX 5IOWA 2LRTA 2H76A 2A4HA 1X9WB 1PA3A 4MJEA 4TKYA 4F2IA 3FEUA 2C1YA 3TCOA 1J9BA 3EURA 3IC8A 1RW1A 2HRFA 3QMXA 4PURA 1EEMA 3APQA 2VD0A 1RK4A 2VCTA 3DGQA 4EDYA 4MJAA 3EMXA 1OC9A 2B3SA 1SJ6A 2H74A 1K0CA 2OADA 1QQ2A 1OYJA 1TKDB 2GQLA 1K0AA 2LJAA 2LQOA 1DUGA 1OVNA 2H1AA 1AIUA 5IMDA 3U6VA 1GSQA 3ZZXA 1FG4A 1QUWA 4O5UA 1GSYA 1A24A 1F3AA 3QFAC 2FA4A 4WR5A 3RHCA 4YH2A 5D8IA 2HSHA 2JACA 4G0LA 2VAFA 2WGRA 3EWLA 1B4QA 2JL4A 1BJXA 1GP1A 2FD3A 1A8YA 4K7NA 1OC8A 2K18A 2H0HA 2H1GA 3KTBA 4POMA 3O3TA 1GTBA 2M46A 3GFKA 1XWBA 3HXSA 1AW9A 2LTKA 3D0ZA 2P5QA 3ZFLA 1NHOA 4EXJA 2C0EA 4ML1A 3GHAA 4KUNA 3LXTA 3GTUB 1F2EA 1SD8A 4P3YB 1ILOA 4TOPA 3QDNA 1JZRA 3ZIJA 3VI5A 2DJ0A 3KCMA 3O6TA 1X5DA 5DALB 4JRRA 1ERWA 3A5IA 2P0GA 2L59A 4G19A 1HNBA 2YJ7A 4NV5A 2NPBA 3ZLPA 2BMXA 4MJCA 2O85A 2I9HA 2MMZA 1WE0A 3TRPA 3C1SA 1GWCA 3TOTA 1X5CA 1EV9A 1F9MA 1KTEA 3IDVA 3QD9A 3NOFA 3LYKA 4YQMA 1EOHA 3KP8A 3H4KA 4MPFA 4MPGA 2QA1A 2IMEA 3CTFA 5H5QA 2HT9A 2WDUA 3GTUA 2GT6A 1YQ1A 1WPIA 3I43A 5DALA 3TGZA 1YZXA 4ZB8A 5IMAA 3I69A 2LJRA 4GSSA 2AJQB 3VWXA 2YZHA 2LRCA 1M9AA 2YWOA 3CTGA 1ZYEA 3ISOA 4HUAA 4EC0A 2QGVA 1VF1A 4G2EA 2HLSA 2R0GA 2FWFA 2C4JA 4K6XA 3F6DA 5BRTA 5CRGA 17GSA 2CQ9A 2GT5A 3H8QA 2WS2A 1ZMAA 3QR6A 1MD3A 4YAPA 3FKFA 3UAPA 4DVCA 2H19A 2H1DA 1ZL9A 1PSQA 1XW9A 1SL1B 1XG8A 3H1NA 1GLQA 2FGXA 2RM5A 2P31A 2DJ1A 2CZ3A 4IQ1A 1XCCA 2IPAA 1M2DA 3DIEA 1A0FA 2F8AA 2ALBA 2N5FA 1T1VA 1UN2A 4MP4A 3UBLA 4XS1A 2PMTA 3ME8A 5ECRB 2FCHA 4V2NA 4BPYA 5AIXA 1DSBA 1BX9A 2B1LA 1VGLA 2B5EA 5H5SA 1YDKA 5HR3A 4XRDA 1GUHA 2YP6A 4ULXA 3J7Yb 1ST9A 2GTUA 3IE3A 5JWOB 4MLYA 2J9HA 2OJLA 3CSHA 2K8SA 2H6YA 3UMAA 3QPMA 3LW9A 2CVBA 1MDJA 4K0NA 5GZZB 2IWTA 5CYYA 2CVKA 4PGTA 4YKFA 5IM9A 2OE1A 4PX1A 2A2PA 2WCIA 3EMPA 1O6JA 4EIQA 3HVVA 3VURA 5ECQB 3I6AA 5DCHA 4G10A 2A2RA 3TKRA 4POLA 4TR4A 1TW9A 4GSTA 2O89A 2I1UA 4ZB6A 2F8FA 4D73B 4DEJA 1S3AA 2G0FA 1SKRB 2EIQA 2IN3A 3F9UA 1URMA 3CRUA 2V41A 2VLUA 3HKRA 3HVSA 3C7MA 5A4UA 3IXRA 4TR1A 2VL2C 2RUFA 4X43A 5HFKA 4RQRA 1WIKA 4WKWA 2DKHA 2BTOT 1MTCA 18GSA 2YOIA 2J23A 4YQUA 4EF0A 1FHEA 3Q74A 2KLXA 1TOFA 3R2QA 4ID0A 2LRNA 1XZOA 2X99A 1VRSD 2HYXA 2HZFA 1I5GA 2CAIA 4IHUA 1K0OA 3IV4A 4V1Ap 5ELAA 3E9JB 3APOA 3GX8A 1TK5B 5CAXA 2ON7A 3IOSA 2HE3A 4ZL9A 1J08A 3PH9A 2YCDA 4LLRA 5DDLA 2H0GA 3M9JA 8GSSA 2A4VA 4HEA2 4NHZA 2OACA 5EPFA 2H6XA 3TJGA 1K0BA 4IP6A 3GKXA 3G7JA 3ERGA 1XW5A 4I2TA 1M2BA 2MMAA 2FA8A 5IOXA 3TDGA 4I8BA 1J0FA 1V57A 4GRFA 2OE0A 5J9CA 5JWRB 4CW9A 2VD1A 5ID2A 2EC4A 2YV9A 1O85A 3GL3A 1SKWB 1S3DA 4HDEA 2GSTA 1K3LA 5IMFA 1OE7A 2E0QA 3TJKA 1X9MB 4XRAA 3DVWA 4OMVA 4GXZA 4HZ2A 4PTSA 3MDKA 3FZ9A 5KOXA 4F82A 2UZ8A 1M7TA 3BJ5A 4X4JA 4I2UA 3RDWA 3RPNA 2N5BA 2C80A 3WYWA 2FUG2 1PD21 3GSTA 3HZ4A 2PUKC 1QGVA 3A2XA 2DJ2A 1IYHA 2V32A 4N30A 5D96A 1TTZA 3VPTA 4F9ZA 3LORA 2DMMA 3LQ7A 4PUAA 5A4VA 4H86A 3ZVJD 3UVHA 4PNGA 3HDCA 5B6MA 12GSA 4TRXA 4WR4A 5G5FA 1NW2A 2GZPA 4TR3A 2PWJA 2MBTA 3ZMKA 5ENUA 1GSFA 4LL4B 3MIXA 3ZMLA 1ERTA 4ECIA 1AQXA 3IA1A 5COHA 2IFQA 4MJBA 1MD4A 5D9XA 1EGOA 2C8UA 2LNSA 3EU4A 2JZSA 2JSYA 4KNDA 1NSWA 5ECLB 1JZDA 3FYGA 4J56E 4MK3A 4TW5A 2X8CA 4Q5NA 5HR1A 3GL5A 3GURA 3DXBA 5CRDA 1M3JA 2LJKA 4L5OA 2TRCP 6GSSA 4LMWA 2FY6A 3W8SA 2WFCA 3F3QA 4HJ2A 2O8VB 5DVBA 2GZYA 1S3RA 1E2YA 1Z9HA 1AQVA 4IJ3A 1EZKA 4QQ7A 5CRWA 3KM6A 3A5WA 2GQKA 3BBYA 2DIYA 3KP9A 1HD2A 1Z7RA 2HZEA 2L57A 2K6VA 2GZZA 3I9V2 3J7Yk 1Q98A 5DJLA 1PN0A 2FWEA 1YKAA 2H8LA 2RUEA 2B5XA 2V1MA 2OKAA 4HI7A 3WGDA 3BCIA 1TU8A 2OA7A 4K2XA 5IIZA 2MMOA 1DE2A 2PGTA 2TRXA 2R3XA 3GN3A 3IK9A 3TRXA 1TI3A 2L6CA 5AISA 1ZZYA 2V2GA 2YANA 4WF5A 1AC1A 4MZWA 3P8WA 3LWAA 4TR0A 1V2AA 3IBHA 2C3QA 2R5GA 2B6MA 3IAS2 4ZILA 4EL1A 1LBKA 2ES7A 4G9HA 5ECSA 2KP2A 1M2AA 1GRXA 1JZOA 4IELA 4K9ZA 1ZYQB 1YEXA 3IC4A 4XTSA 4TVEA 2YNXA 1M99A 5GSTA 3R3EA 3U5RE 2YWNA 2MMNA 1BAYA 5B8AA 2PVOC 2H72A 3EVIA 3RHBA 5IPGA 1SJZA 1H75A 2H66A 2N5AA 2H01A 5FWGA 3RPPA 1GH2A 2HRKA 4WBRD 2JZTA 2XC2A 4IBPA 3A2WA 1K3YA 4K1FA 3HJOA 5KN0A 4JEDA 3ZREA 3ZTLA 3W8JA 5LNKe 3MWHA 2AB6A 4AJ6A 20GSA 3UEMA 2H71A 3GSSA 3NIVA 2AYTA 2NBSA 3HJMA 4HQZA 4J57E 4J2FA 3KZQA 1PQNA 4Q5QA 2LSTA 1TJDA 4HJMA 3TUEA 4OCEA 1O8WA 3F63A 3SBCA 2X49A 1A23A 5GAND 1UVZA 4ZBDA 2A2SA 3EINA 2MBSA 4Z7XA 4OO5A 4JR4A 2AV4A 5CO3A 4JBBA 2B1KA 4EUYA 3KMOA 4Q5RA 4O5QA 3G9BA 1V98A 3GH6A 1S3CA 3D22A 3FR3A 1XIYA 2O7KA 1XFLA 4MZBA 5CRHA 1CQGA 1PX6A 9GSSA 4ILFA 4OD7A 4QL9A 10GSA 3QCPA 5G30A 3GH9A 4AJ8A 3C71A 1HYUA 4E8EA 4F0BA 4EE0A 2L6DA 4L5LA 4MDCA 3HVXA 5F8BA 3DEXA 5C00A 3UJ1A 4ECJA 2F3MA 4BVXB 2HRNA 4O7HA 4MF6A 1YF1A 3ED3A 4OCFA 3FZ5A 3GMFA 2L5OA 1PX7A 3ZIVA 3L78A 4MABA 4MF7A 3G7YA 4PQHA 1A2JA 3FMWA 3ZYWA 1WMJA 1VF3A 2VL9A 4XS6A 1MDIA 2TIRA 4XCSA 3ZL5A 4RUVA 3FW2A 2C3TA 2GLRA 2H73A 4IW9A 3EPTA 4KAEA 2LNTA 3GKNA 3TJJA 1F3BA 2DKIA 3CQFA 2WB9A 5AN1A 1PKZA 3M0FA 3WT2A 1W4VA 4NMUA 1YY7A 6GSVA 1SYRA 1QXHA 1Y6EA 1THXA 4BVXA 4E8HA 2HSYA 2DLXA 6GSWA 5IMZA 5EY6A 2B7KA 1ACVA 5ECIB 2CX3A 5JCWA 2M72A 1Z6NA 2CX4A 2MZCA 2GDRA 1K0NA 1TRSA 4L0UA 1ABAA 5C04A 2DMLA 1A2LA 4TR1B 4HZ4A 4QL7A 5IQYA 4FIWA 3AY8A 3DYRA 1PKWA 1O81A 5FT3A 3CRTA 2XBIA 4POKA 2ZCTA 4K8MA 4K0GA 5B7CA 1X5EA 4ZIJA 1B9XC 1LU4A 3HYPA 2V6OA 1A0RP 1TI1A 2FNOA 4TXVA 4IQAA 4N10A 3KXOA 3VLNA 2HI7A 3LGCA 1JLWA 4FYBA 2D2ZA 2VLTA 2Z9SA 3KJYA 1FW1A 1FVJA 4HQSA 4X1UA 2H30A 4FYUA 4POBA 4XIHA 3S9FA 3IK7A 1PL1A 5J3RA 4XS4B 2VCQA 5G5EA 5D9VA 5ID2B 1PFOA 4IVFA 4NXIA 3FZ4A 4BVYA 2XBQA 4TXOB 7GSSA 2H6ZA 4ECBA 3C8EA 2CAQA 3QOUA 1K3OA 4ZBAA 4EIPA 2GGTA 3APSA 2OBIA 3PGTA 1O8XA 4MH3A 1T4ZA 1YEPA 4ZXGA 2QA2A 1PN9A 1N8JA 3TKSC 4GLTA 4MNNA 3CBUA 3ZFBA 1XW6A 1VF2A 3HD5A 4JR6A 4RI7A 1CQHA 2DC5A 1ZYPA 2XPEA 1HQOA 1XVWA 4G0KA 2LV3A 3Q19A 3L9SA 4KB3A 4ISDA 3GA4A 3TB2A 4L8EA 4XS4A 5F06A 1GUKA 1G7OA 2I3YA 1SD9A 5DBQA 2LS5A 1I9DA 1T3BA 2IJYA 2LKUA 5ECKB 4TXOA 1QMVA 5CNWA 2L4CA 1SL0B 2PU9C 2FWGA 3GIXA 1M3IA 2VL2A 4I6XA 5J9BA 4BWSA 2IFQB 4ICYA 1GSDA 5DAKB 1GSUA 4ZBBA 4AGSA 1THOA 5B8BA 3KTLA 1UA5A 1EWXA 1T7PB 5GSSA 1IYIA 5INYA 1SKSB 2X8HA 4IN0A 5AGYA 4EDZA 3IAM2 4KDXA 3RBTA 4LA1A 4AF2A 2KP1A 4MA9A 5E59A 1AUCA 1JLVA 2AUVA 3D4TA 2X64A 1G6YA 5JWQB 1ON4A 5DQSA 3V1WA 2AAWA 5EL8A 5G1KA 3DD3A 3MAKA 3IPZA 2OBKA 5HFGA 2KUCA 2PN8A 1KBNA 5DAKA 2HZEB 4HS1A 1O73A 3C1RA 4K2DA 4K7OA 1TXXA 4GCIA 4A5PA 1YJ6A 2H75A 4KCAA 3F8UA 5D9TA 5JCUA 2GVPA 3PPUA 4I97A 3VWVA 3FY7A 5G2ZA 2F9SA 2GQMA 2JSZA 2HFDA 3ERFA 1PL2A 3LXZA 2WJUA 4O92A 4KDUA 3H93A 4DSRA 3A3TA 4KGIA 3D5JA 1YF0A 2PBJA 3D21A 1N2AA 5CREA 2CT6A 3P90A 5DJMA 1Y25A 5A5KA 2BJXA 3L4NA 4KSMA 2P5RA 2XHFA 4HOJA 2GSRA 1XOAA 2ZNMA 1TRWA 3GX0A 3GNJA 4NWYA 3SWLA 1MEKA 3IHQA 3KEBA 4ACSA 5KN3A 19GSA 3VPQA 1TK0B 1WOUA 6GSTA 2VIMA 4N0VA 3VK9A 2CA8A 3QFBC 3EU3A 1EP8A 3FRCA 1GTAA 2VLVA 1HNAA 3RAZA 2AHEA 2L5LA 4NAXA 2K9FA 4USSA 3LSZA 1DE1A 2YN1A 1A2MA 5DCGA 1SK2A 2G2QA 1ZGNA 2ON5A 3UBKA 4ZB9A 2FHEA 1XVQA 1AQWA 3F4TA 2PVQA 4KW6A 2WZ9A 5HR2A 3CXGA 1LJRA 3LG6A 5AIVA 1R4WA 3GUSA 4BL7A 1NM3A 4G0IA 4LL1B 5LCZA 1WWJA 1TRVA 2X4AA 4EKZA 3M9KA 1U87A 3FHKA 3VFIA 1PGTA 3HY2A 5G31A 4V1Ag 4KF9A 5ECHB 1AAZA 1OKTA 2E2GA 2F51A 4ECCA 1A8LA 2LUSA 3K8NA 3WGEA 1U88A 4NPBA 4IP1A 4GF0A 16GSA 4MF5A 1T4YA 5IMCA 2DJKA 3MYDA 1JHBA 2GS3A 1MDKA 2LQQA 3UIWA 1SU9A 4OO4A 3BD2A 1OAZA 3IHGA 2IIYA 2E7PA 4HU7A 2VCZA 1ERVA 4JE1A 1U3IA 5D73A 1TDIA 3HJPA 2YJHA 4MH2A 1FAAA 1Q4JA 4OWYA 1V58A 3KMNA 1X0RA 1Z6MA 2YZUA 4KDYA 1G0TA 2PPTA 5ABRA 1BG5A 1C72A 3GKMA 4CY6A 4PQ1A 3QAWA 2L4QA 5LD0A 1XXUA 1XPVA 1SK1A 4KCEA 2B5YA 2R4VA 14GSA 4BA7A 4K7IA 3WD6A 2IMIA 5DQYA 2E2MA 4XHMA 3LEFA 1GULA 2VM2A 4AJ7A 2MYGA 1SJIA 2QC7A 2ZUPA 1OE8A 2B7JA 1R5PA 2C0GA 2M80A 2O87A 2DSAA 4ZL8A 3P7XA 1EP7A 1GSSA 4I5QA 2NTOA 4X0XA 4FYCA 5ECNB 1G6WA 4MZCA 5IPHA 1GTUA 11GSA 1B4PA 2DBCA 2NDOA 4PXOA 1SYXA 3IRAA 1GUMA 4F03A 2YWIA 5G1LA 3ZRDA 3IR4A 4MCUA 5B6NA 3F0IA 2C3NA 4GQCA 6GSYA 4OFNA 3L9UA 1XWAA 4MMMA 4YAVA 3GV1A 3F6FA 3WGXA 1PRXA 3N5OA 3FZAA 3FR9A 1QK8A
chains in the Genus database with same CATH topology
4DSSB 5ECMB 2KHPA 5F07A 3JCML 1BYEA 4Z2RA 4F0CA 1GNEA 5BMUA 1GLPA 2R0PA 1Z5YE 3D6IA 3F3RA 4V2MA 3Q18A 1GSEA 4PNFA 3LYPA 4GWRA 2R6KA 4WXTA 4BWQA 4EVMA 1OC3A 2VOCA 1T00A 1E6BA 2KOKA 2QSIA 3L0HA 2HSMA 4NV2A 2RM6A 2JADA 4KH7A 3FK8A 3L9VA 1UC7A 2JZRA 4Q5FA 1XWGA 1TK8B 3LJRA 1SK0A 4NHWA 4FO5A 5ECOB 4K5RA 1WP0A 4V2LA 3F4SA 3P2AA 1M0UA 2DJJA 4BVYB 5J41A 4RQXA 1B8XA 3HHVA 3TKQA 2R0CA 3H79A 3DKSA 4DSSA 3MNGA 1USBA 5H5RA 1F6MC 4ML6A 5JCGA 3HCZA 1FOVA 1AXDA 1XOBA 3BCKA 1TRUA 4OFTA 1Z3EA 1R7HA 2EIOA 3KH9A 2IMFA 4KE3A 4L0WA 1VF4A 2I81A 2V6KA 1H4OA 1BEDA 4KA0A 5GAPD 2VUPA 3ERWA 2H1BA 2C0FA 4TN8A 5HFIA 1K0MA 1RQMA 3E0UA 1OKDA 3LFLA 5E4WA 1XWKA 2VCXA 4KX4A 3DWVA 4ZL7A 1U3AA 2HXKA 1SL2B 3ZITA 3VWWA 3CSIA 5HQPA 3GYKA 1R5AA 1HNCA 4WBJA 2YWMA 2NVLA 1NHYA 5F05A 5KOWA 3HA9A 2PERA 5J4UA 4Z2UA 3PINA 4DSQA 1ZOFA 3HZ8A 4CY8A 1V40A 4WEYA 3UVTA 3M1GA 5IO2A 4GSNA 1G7EA 1YKCA 1U6TA 2CZ2A 1PMTA 1EOGA 2C0DA 3UL3A 1JFUA 3CSJA 2VCVA 2FWHA 1T8EB 2IMKA 2CVDA 3QAGA 3Q6OA 4KSOA 2QKEA 1ML6A 5J5NA 1XBSA 2OE3A 1TU7A 4YQVA 1Z7PA 3UOMA 1FVKA 5D9WA 3TKSE 4D73A 1GL8A 2RIIA 2HRAA 2GSQA 2EIRA 1W89A 1EGRA 2VM1A 1FB0A 1F37A 1QFNA 4OFMA 5F0GA 2K8VA 1X9SB 2WULA 4GTUA 2VL3A 3F4RA 5KN2A 4O32A 4K5SA 5EVOA 3DMLA 2DJ3A 3TJFA 2X8GA 5D93A 1FB6A 4PQIA 3EE2A 3QAVA 5IO0A 1BQ7A 2XPDA 3C73A 1TP9A 5KEJA 1EV4A 3CYNA 5CP1A 3KH7A 1WRYA 4IJIA 3EYTA 1ZCPA 1WJKA 2IMDA 3TOUA 6GSUA 1R26A 2HNLA 2R37A 5ECPB 1B48A 4N11A 3WT1A 3O76A 3DVXA 3DRNA 3TRQA 3GRXA 4EO3A 3TKSA 4N0ZA 5A4WA 3A2VA 1ZYNA 13GSA 2DIZA 2FLSA 2RLIA 5KN1A 3KGKA 4CDOA 1M9BA 1FOHA 1K0DA 4WETA 2YV7A 3PR8A 4IGJA 3D4MA 3VWUA 4LMVA 3N9JA 1GTIA 1FO5A 3W6GA 5IMVA 2R2JA 1XWCA 1GNWA 5L71A 3OR5A 4PUFC 3KIJA 1KNGA 2WRTA 4HU9A 1ERUA 2H70A 3ME7A 4O5RA 1V9WA 2IL3A 2LEGA 3GKKA 3TJBA 3M8NA 3TKPA 1KEBA 1O7UA 2I4AA 2REMA 3E3EA 2VO4A 3US3A 4FH8A 3BOAA 1EEJA 3MSZA 5ELGA 2H0IA 4FQUA 3VI7A 22GSA 3M3MA 2JU5A 4JU5A 3ZVJA 2GSSA 5HR0A 4JZQA 1OC9B 6GSXA 2CV4A 1JZWA 1B9YC 1DBYA 2VCWA 3G7IA 4CHSA 3EC3A 1SENA 3KD0A 3CMIA 3NZNA 4IKHA 4RI6A 4YKGA 4Z2TA 2YPMA 3FR6A 4GQFA 4BL7B 5FHIA 4IS0A 4WF4A 3UARA 5IOWA 2LRTA 2H76A 2A4HA 1X9WB 1PA3A 4MJEA 4TKYA 4F2IA 3FEUA 2C1YA 3TCOA 1J9BA 3EURA 3IC8A 1RW1A 2HRFA 3QMXA 4PURA 1EEMA 3APQA 2VD0A 1RK4A 2VCTA 3DGQA 4EDYA 4MJAA 3EMXA 1OC9A 2B3SA 1SJ6A 2H74A 1K0CA 2OADA 1QQ2A 1OYJA 1TKDB 2GQLA 1K0AA 2LJAA 2LQOA 1DUGA 1OVNA 2H1AA 1AIUA 5IMDA 3U6VA 1GSQA 3ZZXA 1FG4A 1QUWA 4O5UA 1GSYA 1A24A 1F3AA 3QFAC 2FA4A 4WR5A 3RHCA 4YH2A 5D8IA 2HSHA 2JACA 4G0LA 2VAFA 2WGRA 3EWLA 1B4QA 2JL4A 1BJXA 1GP1A 2FD3A 1A8YA 4K7NA 1OC8A 2K18A 2H0HA 2H1GA 3KTBA 4POMA 3O3TA 1GTBA 2M46A 3GFKA 1XWBA 3HXSA 1AW9A 2LTKA 3D0ZA 2P5QA 3ZFLA 1NHOA 4EXJA 2C0EA 4ML1A 3GHAA 4KUNA 3LXTA 3GTUB 1F2EA 1SD8A 4P3YB 1ILOA 4TOPA 3QDNA 1JZRA 3ZIJA 3VI5A 2DJ0A 3KCMA 3O6TA 1X5DA 5DALB 4JRRA 1ERWA 3A5IA 2P0GA 2L59A 4G19A 1HNBA 2YJ7A 4NV5A 2NPBA 3ZLPA 2BMXA 4MJCA 2O85A 2I9HA 2MMZA 1WE0A 3TRPA 3C1SA 1GWCA 3TOTA 1X5CA 1EV9A 1F9MA 1KTEA 3IDVA 3QD9A 3NOFA 3LYKA 4YQMA 1EOHA 3KP8A 3H4KA 4MPFA 4MPGA 2QA1A 2IMEA 3CTFA 5H5QA 2HT9A 2WDUA 3GTUA 2GT6A 1YQ1A 1WPIA 3I43A 5DALA 3TGZA 1YZXA 4ZB8A 5IMAA 3I69A 2LJRA 4GSSA 2AJQB 3VWXA 2YZHA 2LRCA 1M9AA 2YWOA 3CTGA 1ZYEA 3ISOA 4HUAA 4EC0A 2QGVA 1VF1A 4G2EA 2HLSA 2R0GA 2FWFA 2C4JA 4K6XA 3F6DA 5BRTA 5CRGA 17GSA 2CQ9A 2GT5A 3H8QA 2WS2A 1ZMAA 3QR6A 1MD3A 4YAPA 3FKFA 3UAPA 4DVCA 2H19A 2H1DA 1ZL9A 1PSQA 1XW9A 1SL1B 3H1NA 1GLQA 2FGXA 2RM5A 2P31A 2DJ1A 2CZ3A 4IQ1A 1XCCA 2IPAA 1M2DA 3DIEA 1A0FA 2F8AA 2ALBA 2N5FA 1T1VA 1UN2A 4MP4A 3UBLA 4XS1A 2PMTA 3ME8A 5ECRB 2FCHA 4V2NA 4BPYA 5AIXA 1DSBA 1BX9A 2B1LA 1VGLA 2B5EA 5H5SA 1YDKA 5HR3A 4XRDA 1GUHA 2YP6A 4ULXA 3J7Yb 1ST9A 2GTUA 3IE3A 5JWOB 4MLYA 2J9HA 2OJLA 3CSHA 2K8SA 2H6YA 3UMAA 3QPMA 3LW9A 2CVBA 1MDJA 4K0NA 5GZZB 2IWTA 5CYYA 2CVKA 4PGTA 4YKFA 5IM9A 2OE1A 4PX1A 2A2PA 2WCIA 3EMPA 1O6JA 4EIQA 3HVVA 3VURA 5ECQB 3I6AA 5DCHA 4G10A 2A2RA 3TKRA 4POLA 4TR4A 1TW9A 4GSTA 2O89A 2I1UA 4ZB6A 2F8FA 4D73B 4DEJA 1S3AA 2G0FA 1SKRB 2EIQA 2IN3A 3F9UA 1URMA 3CRUA 2V41A 2VLUA 3HKRA 3HVSA 3C7MA 5A4UA 3IXRA 4TR1A 2VL2C 2RUFA 4X43A 5HFKA 4RQRA 1WIKA 4WKWA 2DKHA 2BTOT 1MTCA 18GSA 2YOIA 2J23A 4YQUA 4EF0A 1FHEA 3Q74A 2KLXA 1TOFA 3R2QA 4ID0A 2LRNA 1XZOA 2X99A 1VRSD 2HYXA 2HZFA 1I5GA 2CAIA 4IHUA 1K0OA 3IV4A 4V1Ap 5ELAA 3E9JB 3APOA 3GX8A 1TK5B 5CAXA 2ON7A 3IOSA 2HE3A 4ZL9A 1J08A 3PH9A 2YCDA 4LLRA 5DDLA 2H0GA 3M9JA 8GSSA 2A4VA 4HEA2 4NHZA 2OACA 5EPFA 2H6XA 3TJGA 1K0BA 4IP6A 3GKXA 3G7JA 3ERGA 1XW5A 4I2TA 1M2BA 2MMAA 2FA8A 5IOXA 3TDGA 4I8BA 1J0FA 1V57A 4GRFA 2OE0A 5J9CA 5JWRB 4CW9A 2VD1A 5ID2A 2EC4A 2YV9A 1O85A 3GL3A 1SKWB 1S3DA 4HDEA 2GSTA 1K3LA 5IMFA 1OE7A 2E0QA 3TJKA 1X9MB 4XRAA 3DVWA 4OMVA 4GXZA 4HZ2A 4PTSA 3MDKA 3FZ9A 5KOXA 4F82A 2UZ8A 1M7TA 3BJ5A 4X4JA 4I2UA 3RDWA 3RPNA 2N5BA 2C80A 3WYWA 2FUG2 1PD21 3GSTA 3HZ4A 2PUKC 1QGVA 3A2XA 2DJ2A 1IYHA 2V32A 4N30A 5D96A 1TTZA 3VPTA 4F9ZA 3LORA 2DMMA 3LQ7A 4PUAA 5A4VA 4H86A 3ZVJD 3UVHA 4PNGA 3HDCA 5B6MA 12GSA 4TRXA 4WR4A 5G5FA 1NW2A 2GZPA 4TR3A 2PWJA 2MBTA 3ZMKA 5ENUA 1GSFA 4LL4B 3MIXA 3ZMLA 1ERTA 4ECIA 1AQXA 3IA1A 5COHA 2IFQA 4MJBA 1MD4A 5D9XA 1EGOA 2C8UA 2LNSA 3EU4A 2JZSA 2JSYA 4KNDA 1NSWA 5ECLB 1JZDA 3FYGA 4J56E 4MK3A 4TW5A 2X8CA 4Q5NA 5HR1A 3GL5A 3GURA 3DXBA 5CRDA 2LJKA 4L5OA 2TRCP 6GSSA 4LMWA 2FY6A 3W8SA 2WFCA 3F3QA 4HJ2A 2O8VB 5DVBA 2GZYA 1E2YA 1Z9HA 1AQVA 4IJ3A 1EZKA 4QQ7A 5CRWA 3KM6A 3A5WA 2GQKA 3BBYA 2DIYA 3KP9A 1HD2A 1Z7RA 2HZEA 2L57A 2K6VA 2GZZA 3I9V2 3J7Yk 1Q98A 5DJLA 1PN0A 2FWEA 1YKAA 2H8LA 2RUEA 2B5XA 2V1MA 2OKAA 4HI7A 3WGDA 3BCIA 1TU8A 2OA7A 4K2XA 5IIZA 2MMOA 1DE2A 2PGTA 2TRXA 2R3XA 3GN3A 3IK9A 3TRXA 1TI3A 2L6CA 5AISA 1ZZYA 2V2GA 2YANA 4WF5A 1AC1A 4MZWA 3P8WA 3LWAA 4TR0A 1V2AA 3IBHA 2C3QA 2R5GA 2B6MA 3IAS2 4ZILA 4EL1A 1LBKA 2ES7A 4G9HA 5ECSA 2KP2A 1M2AA 1GRXA 1JZOA 4IELA 4K9ZA 1ZYQB 1YEXA 3IC4A 4XTSA 4TVEA 2YNXA 1M99A 5GSTA 3R3EA 3U5RE 2YWNA 2MMNA 1BAYA 5B8AA 2PVOC 2H72A 3EVIA 3RHBA 5IPGA 1SJZA 1H75A 2H66A 2N5AA 2H01A 5FWGA 3RPPA 1GH2A 2HRKA 4WBRD 2JZTA 2XC2A 4IBPA 3A2WA 1K3YA 4K1FA 3HJOA 5KN0A 4JEDA 3ZREA 3ZTLA 3W8JA 5LNKe 3MWHA 2AB6A 4AJ6A 20GSA 3UEMA 2H71A 3GSSA 3NIVA 2AYTA 2NBSA 3HJMA 4HQZA 4J57E 4J2FA 3KZQA 1PQNA 4Q5QA 2LSTA 1TJDA 4HJMA 3TUEA 4OCEA 1O8WA 3F63A 3SBCA 2X49A 1A23A 5GAND 1UVZA 4ZBDA 2A2SA 3EINA 2MBSA 4Z7XA 4OO5A 4JR4A 2AV4A 5CO3A 4JBBA 2B1KA 4EUYA 3KMOA 4Q5RA 4O5QA 3G9BA 1V98A 3GH6A 1S3CA 3D22A 3FR3A 1XIYA 2O7KA 1XFLA 4MZBA 5CRHA 1CQGA 1PX6A 9GSSA 4ILFA 4OD7A 4QL9A 10GSA 3QCPA 5G30A 3GH9A 4AJ8A 3C71A 1HYUA 4E8EA 4F0BA 4EE0A 2L6DA 4L5LA 4MDCA 3HVXA 5F8BA 3DEXA 5C00A 3UJ1A 4ECJA 2F3MA 4BVXB 2HRNA 4O7HA 4MF6A 1YF1A 3ED3A 4OCFA 3FZ5A 3GMFA 2L5OA 1PX7A 3ZIVA 3L78A 4MABA 4MF7A 3G7YA 4PQHA 1A2JA 3FMWA 3ZYWA 1WMJA 1VF3A 2VL9A 4XS6A 1MDIA 2TIRA 4XCSA 3ZL5A 4RUVA 3FW2A 2C3TA 2GLRA 2H73A 4IW9A 3EPTA 4KAEA 2LNTA 3GKNA 3TJJA 1F3BA 2DKIA 2WB9A 5AN1A 1PKZA 3M0FA 3WT2A 1W4VA 4NMUA 1YY7A 6GSVA 1SYRA 1QXHA 1Y6EA 1THXA 4BVXA 4E8HA 2HSYA 2DLXA 6GSWA 5IMZA 5EY6A 2B7KA 1ACVA 5ECIB 2CX3A 5JCWA 2M72A 1Z6NA 2CX4A 2MZCA 2GDRA 1K0NA 1TRSA 4L0UA 1ABAA 5C04A 2DMLA 1A2LA 4TR1B 4HZ4A 4QL7A 5IQYA 4FIWA 3AY8A 3DYRA 1PKWA 1O81A 5FT3A 3CRTA 2XBIA 4POKA 2ZCTA 4K8MA 4K0GA 5B7CA 1X5EA 4ZIJA 1B9XC 1LU4A 3HYPA 2V6OA 1A0RP 1TI1A 2FNOA 4TXVA 4IQAA 4N10A 3KXOA 3VLNA 2HI7A 3LGCA 1JLWA 4FYBA 2D2ZA 2VLTA 2Z9SA 3KJYA 1FW1A 1FVJA 4HQSA 4X1UA 2H30A 4FYUA 4POBA 4XIHA 3S9FA 3IK7A 1PL1A 5J3RA 4XS4B 2VCQA 5G5EA 5D9VA 5ID2B 4IVFA 4NXIA 3FZ4A 4BVYA 2XBQA 4TXOB 7GSSA 2H6ZA 4ECBA 3C8EA 2CAQA 3QOUA 1K3OA 4ZBAA 4EIPA 2GGTA 3APSA 2OBIA 3PGTA 1O8XA 4MH3A 1T4ZA 1YEPA 4ZXGA 2QA2A 1PN9A 1N8JA 3TKSC 4GLTA 4MNNA 3CBUA 3ZFBA 1XW6A 1VF2A 3HD5A 4JR6A 4RI7A 1CQHA 2DC5A 1ZYPA 2XPEA 1HQOA 1XVWA 4G0KA 2LV3A 3Q19A 3L9SA 4KB3A 4ISDA 3GA4A 3TB2A 4L8EA 4XS4A 5F06A 1GUKA 1G7OA 2I3YA 1SD9A 5DBQA 2LS5A 1I9DA 1T3BA 2IJYA 2LKUA 5ECKB 4TXOA 1QMVA 5CNWA 2L4CA 1SL0B 2PU9C 2FWGA 3GIXA 2VL2A 4I6XA 5J9BA 4BWSA 2IFQB 4ICYA 1GSDA 5DAKB 1GSUA 4ZBBA 4AGSA 1THOA 5B8BA 3KTLA 1UA5A 1EWXA 1T7PB 5GSSA 1IYIA 5INYA 1SKSB 2X8HA 4IN0A 5AGYA 4EDZA 3IAM2 4KDXA 3RBTA 4LA1A 4AF2A 2KP1A 4MA9A 5E59A 1AUCA 1JLVA 2AUVA 3D4TA 2X64A 1G6YA 5JWQB 1ON4A 5DQSA 3V1WA 2AAWA 5EL8A 5G1KA 3DD3A 3MAKA 3IPZA 2OBKA 5HFGA 2KUCA 2PN8A 1KBNA 5DAKA 2HZEB 4HS1A 1O73A 3C1RA 4K2DA 4K7OA 1TXXA 4GCIA 4A5PA 1YJ6A 2H75A 4KCAA 3F8UA 5D9TA 5JCUA 2GVPA 3PPUA 4I97A 3VWVA 3FY7A 5G2ZA 2F9SA 2GQMA 2JSZA 2HFDA 3ERFA 1PL2A 3LXZA 2WJUA 4O92A 4KDUA 3H93A 4DSRA 3A3TA 4KGIA 3D5JA 1YF0A 2PBJA 3D21A 1N2AA 5CREA 2CT6A 3P90A 5DJMA 1Y25A 5A5KA 2BJXA 3L4NA 4KSMA 2P5RA 2XHFA 4HOJA 2GSRA 1XOAA 2ZNMA 1TRWA 3GX0A 3GNJA 4NWYA 3SWLA 1MEKA 3IHQA 3KEBA 4ACSA 5KN3A 19GSA 3VPQA 1TK0B 1WOUA 6GSTA 2VIMA 4N0VA 3VK9A 2CA8A 3QFBC 3EU3A 1EP8A 3FRCA 1GTAA 2VLVA 1HNAA 3RAZA 2AHEA 2L5LA 4NAXA 2K9FA 4USSA 3LSZA 1DE1A 2YN1A 1A2MA 5DCGA 1SK2A 2G2QA 1ZGNA 2ON5A 3UBKA 4ZB9A 2FHEA 1XVQA 1AQWA 3F4TA 2PVQA 4KW6A 2WZ9A 5HR2A 3CXGA 1LJRA 3LG6A 5AIVA 1R4WA 3GUSA 4BL7A 1NM3A 4G0IA 4LL1B 5LCZA 1WWJA 1TRVA 2X4AA 4EKZA 3M9KA 1U87A 3FHKA 3VFIA 1PGTA 3HY2A 5G31A 4V1Ag 4KF9A 5ECHB 1AAZA 1OKTA 2E2GA 2F51A 4ECCA 1A8LA 2LUSA 3K8NA 3WGEA 1U88A 4NPBA 4IP1A 4GF0A 16GSA 4MF5A 1T4YA 5IMCA 2DJKA 3MYDA 1JHBA 2GS3A 1MDKA 2LQQA 3UIWA 1SU9A 4OO4A 3BD2A 1OAZA 3IHGA 2IIYA 2E7PA 4HU7A 2VCZA 1ERVA 4JE1A 1U3IA 5D73A 1TDIA 3HJPA 2YJHA 4MH2A 1FAAA 1Q4JA 4OWYA 1V58A 3KMNA 1X0RA 1Z6MA 2YZUA 4KDYA 1G0TA 2PPTA 5ABRA 1BG5A 1C72A 3GKMA 4CY6A 4PQ1A 3QAWA 2L4QA 5LD0A 1XXUA 1XPVA 1SK1A 4KCEA 2B5YA 2R4VA 14GSA 4BA7A 4K7IA 3WD6A 2IMIA 5DQYA 2E2MA 4XHMA 3LEFA 1GULA 2VM2A 4AJ7A 2MYGA 1SJIA 2QC7A 2ZUPA 1OE8A 2B7JA 1R5PA 2C0GA 2M80A 2O87A 2DSAA 4ZL8A 3P7XA 1EP7A 1GSSA 4I5QA 2NTOA 4X0XA 4FYCA 5ECNB 1G6WA 4MZCA 5IPHA 1GTUA 11GSA 1B4PA 2DBCA 2NDOA 4PXOA 1SYXA 3IRAA 1GUMA 4F03A 2YWIA 5G1LA 3ZRDA 3IR4A 4MCUA 5B6NA 3F0IA 2C3NA 4GQCA 6GSYA 4OFNA 3L9UA 1XWAA 4MMMA 4YAVA 3GV1A 3F6FA 3WGXA 1PRXA 3N5OA 3FZAA 3FR9A 1QK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DSS B;  5ECM B;  2KHP A;  5F07 A;  3JCM L;  1BYE A;  4F0C A;  1GNE A;  1GLP A;  1Z5Y E;  3D6I A;  3F3R A;  4V2M A;  3Q18 A;  1GSE A;  4PNF A;  3LYP A;  4GWR A;  2R6K A;  4WXT A;  4BWQ A;  4EVM A;  1OC3 A;  2VOC A;  1T00 A;  1E6B A;  2KOK A;  2QSI A;  3L0H A;  4NV2 A;  2RM6 A;  2JAD A;  4KH7 A;  3FK8 A;  3L9V A;  1UC7 A;  2JZR A;  4Q5F A;  1XWG A;  1TK8 B;  3LJR A;  1SK0 A;  4NHW A;  4FO5 A;  5ECO B;  1WP0 A;  4V2L A;  3F4S A;  3P2A A;  1M0U A;  2DJJ A;  5J41 A;  4RQX A;  1B8X A;  3HHV A;  3TKQ A;  3H79 A;  3DKS A;  4DSS A;  3MNG A;  1USB A;  5H5R A;  1F6M C;  4ML6 A;  5JCG A;  3HCZ A;  1FOV A;  1AXD A;  1XOB A;  3BCK A;  1TRU A;  4OFT A;  1Z3E A;  1R7H A;  2EIO A;  3KH9 A;  2IMF A;  4KE3 A;  4L0W A;  1VF4 A;  2I81 A;  2V6K A;  1H4O A;  1BED A;  4KA0 A;  5GAP D;  2VUP A;  3ERW A;  2H1B A;  2C0F A;  4TN8 A;  5HFI A;  1K0M A;  1RQM A;  3E0U A;  1OKD A;  3LFL A;  5E4W A;  1XWK A;  2VCX A;  4KX4 A;  3DWV A;  4ZL7 A;  1U3A A;  2HXK A;  1SL2 B;  3ZIT A;  3VWW A;  3CSI A;  5HQP A;  3GYK A;  1R5A A;  1HNC A;  4WBJ A;  2YWM A;  2NVL A;  1NHY A;  5F05 A;  3HA9 A;  2PER A;  5J4U A;  3PIN A;  4DSQ A;  1ZOF A;  3HZ8 A;  1V40 A;  4WEY A;  3UVT A;  3M1G A;  5IO2 A;  4GSN A;  1G7E A;  1YKC A;  1U6T A;  2CZ2 A;  1PMT A;  1EOG A;  2C0D A;  3UL3 A;  1JFU A;  3CSJ A;  2VCV A;  2FWH A;  1T8E B;  2IMK A;  2CVD A;  3QAG A;  3Q6O A;  4KSO A;  2QKE A;  1ML6 A;  5J5N A;  1XBS A;  2OE3 A;  1TU7 A;  4YQV A;  1Z7P A;  3UOM A;  1FVK A;  5D9W A;  3TKS E;  4D73 A;  1GL8 A;  2RII A;  2GSQ A;  2EIR A;  1W89 A;  1EGR A;  2VM1 A;  1FB0 A;  1F37 A;  1QFN A;  4OFM A;  5F0G A;  2K8V A;  1X9S B;  2WUL A;  4GTU A;  2VL3 A;  3F4R A;  5KN2 A;  4O32 A;  5EVO A;  3DML A;  2DJ3 A;  3TJF A;  2X8G A;  5D93 A;  1FB6 A;  4PQI A;  3EE2 A;  3QAV A;  5IO0 A;  1BQ7 A;  2XPD A;  3C73 A;  1TP9 A;  5KEJ A;  1EV4 A;  3CYN A;  5CP1 A;  3KH7 A;  1WRY A;  4IJI A;  3EYT A;  1ZCP A;  1WJK A;  2IMD A;  3TOU A;  6GSU A;  1R26 A;  2HNL A;  2R37 A;  5ECP B;  1B48 A;  4N11 A;  3WT1 A;  3O76 A;  3DVX A;  3DRN A;  3TRQ A;  3GRX A;  4EO3 A;  3TKS A;  4N0Z A;  5A4W A;  3A2V A;  13GS A;  2DIZ A;  2FLS A;  2RLI A;  5KN1 A;  3KGK A;  4CDO A;  1M9B A;  1K0D A;  4WET A;  2YV7 A;  3PR8 A;  4IGJ A;  3D4M A;  3VWU A;  4LMV A;  3N9J A;  1GTI A;  1FO5 A;  3W6G A;  5IMV A;  2R2J A;  1XWC A;  1GNW A;  5L71 A;  3OR5 A;  4PUF C;  3KIJ A;  1KNG A;  2WRT A;  4HU9 A;  1ERU A;  2H70 A;  3ME7 A;  4O5R A;  1V9W A;  2IL3 A;  2LEG A;  3GKK A;  3TJB A;  3M8N A;  3TKP A;  1KEB A;  1O7U A;  2I4A A;  2REM A;  3E3E A;  2VO4 A;  3US3 A;  4FH8 A;  3BOA A;  1EEJ A;  3MSZ A;  5ELG A;  2H0I A;  3VI7 A;  22GS A;  3M3M A;  2JU5 A;  4JU5 A;  3ZVJ A;  2GSS A;  5HR0 A;  4JZQ A;  1OC9 B;  6GSX A;  2CV4 A;  1JZW A;  1B9Y C;  1DBY A;  2VCW A;  3G7I A;  4CHS A;  3EC3 A;  1SEN A;  3KD0 A;  3CMI A;  3NZN A;  4IKH A;  4RI6 A;  2YPM A;  3FR6 A;  4GQF A;  5FHI A;  4IS0 A;  4WF4 A;  3UAR A;  5IOW A;  2LRT A;  2H76 A;  1X9W B;  1PA3 A;  4MJE A;  4TKY A;  4F2I A;  3FEU A;  2C1Y A;  3TCO A;  1J9B A;  3EUR A;  1RW1 A;  2HRF A;  3QMX A;  4PUR A;  1EEM A;  3APQ A;  2VD0 A;  1RK4 A;  2VCT A;  3DGQ A;  4EDY A;  4MJA A;  3EMX A;  1OC9 A;  2B3S A;  1SJ6 A;  2H74 A;  1K0C A;  2OAD A;  1QQ2 A;  1OYJ A;  1TKD B;  2GQL A;  1K0A A;  2LJA A;  2LQO A;  1DUG A;  1OVN A;  2H1A A;  1AIU A;  5IMD A;  3U6V A;  1GSQ A;  3ZZX A;  1FG4 A;  1QUW A;  1GSY A;  1A24 A;  1F3A A;  3QFA C;  2FA4 A;  4WR5 A;  3RHC A;  4YH2 A;  5D8I A;  2HSH A;  2JAC A;  2VAF A;  2WGR A;  3EWL A;  1B4Q A;  2JL4 A;  1BJX A;  1GP1 A;  2FD3 A;  1A8Y A;  4K7N A;  1OC8 A;  2K18 A;  2H0H A;  2H1G A;  3KTB A;  4POM A;  3O3T A;  1GTB A;  2M46 A;  3GFK A;  1XWB A;  3HXS A;  1AW9 A;  2LTK A;  3D0Z A;  2P5Q A;  3ZFL A;  1NHO A;  4EXJ A;  2C0E A;  4ML1 A;  3GHA A;  4KUN A;  3LXT A;  3GTU B;  1F2E A;  1SD8 A;  4P3Y B;  1ILO A;  4TOP A;  3QDN A;  1JZR A;  3ZIJ A;  3VI5 A;  2DJ0 A;  3KCM A;  3O6T A;  1X5D A;  5DAL B;  4JRR A;  1ERW A;  2P0G A;  2L59 A;  4G19 A;  1HNB A;  2YJ7 A;  4NV5 A;  2NPB A;  3ZLP A;  2BMX A;  4MJC A;  2O85 A;  2I9H A;  2MMZ A;  1WE0 A;  3TRP A;  3C1S A;  1GWC A;  3TOT A;  1X5C A;  1EV9 A;  1F9M A;  1KTE A;  3IDV A;  3QD9 A;  3NOF A;  3LYK A;  4YQM A;  1EOH A;  3KP8 A;  3H4K A;  4MPF A;  4MPG A;  2IME A;  3CTF A;  5H5Q A;  2HT9 A;  2WDU A;  3GTU A;  2GT6 A;  1YQ1 A;  1WPI A;  3I43 A;  5DAL A;  3TGZ A;  1YZX A;  4ZB8 A;  5IMA A;  3I69 A;  2LJR A;  4GSS A;  2AJQ B;  3VWX A;  2YZH A;  2LRC A;  1M9A A;  2YWO A;  3CTG A;  1ZYE A;  3ISO A;  4HUA A;  4EC0 A;  2QGV A;  1VF1 A;  4G2E A;  2HLS A;  2FWF A;  2C4J A;  4K6X A;  3F6D A;  5CRG A;  17GS A;  2CQ9 A;  2GT5 A;  3H8Q A;  2WS2 A;  1ZMA A;  3QR6 A;  1MD3 A;  4YAP A;  3FKF A;  3UAP A;  4DVC A;  2H19 A;  2H1D A;  1ZL9 A;  1PSQ A;  1XW9 A;  1SL1 B;  3H1N A;  1GLQ A;  2FGX A;  2RM5 A;  2P31 A;  2DJ1 A;  2CZ3 A;  4IQ1 A;  1XCC A;  2IPA A;  1M2D A;  3DIE A;  1A0F A;  2F8A A;  2ALB A;  2N5F A;  1T1V A;  1UN2 A;  4MP4 A;  3UBL A;  4XS1 A;  2PMT A;  3ME8 A;  5ECR B;  2FCH A;  4V2N A;  4BPY A;  5AIX A;  1DSB A;  1BX9 A;  2B1L A;  1VGL A;  2B5E A;  5H5S A;  1YDK A;  5HR3 A;  4XRD A;  1GUH A;  2YP6 A;  4ULX A;  3J7Y b;  1ST9 A;  2GTU A;  3IE3 A;  5JWO B;  4MLY A;  2J9H A;  2OJL A;  3CSH A;  2K8S A;  2H6Y A;  3UMA A;  3QPM A;  2CVB A;  1MDJ A;  4K0N A;  5GZZ B;  2IWT A;  5CYY A;  2CVK A;  4PGT A;  5IM9 A;  2OE1 A;  4PX1 A;  2WCI A;  3EMP A;  1O6J A;  3HVV A;  3VUR A;  5ECQ B;  3I6A A;  5DCH A;  4G10 A;  2A2R A;  3TKR A;  4POL A;  4TR4 A;  1TW9 A;  4GST A;  2O89 A;  2I1U A;  4ZB6 A;  2F8F A;  4D73 B;  4DEJ A;  1S3A A;  2G0F A;  1SKR B;  2EIQ A;  2IN3 A;  3F9U A;  1URM A;  3CRU A;  2V41 A;  2VLU A;  3HKR A;  3HVS A;  3C7M A;  5A4U A;  3IXR A;  4TR1 A;  2VL2 C;  2RUF A;  4X43 A;  5HFK A;  4RQR A;  1WIK A;  4WKW A;  2BTO T;  1MTC A;  18GS A;  2YOI A;  2J23 A;  4YQU A;  4EF0 A;  1FHE A;  3Q74 A;  2KLX A;  1TOF A;  3R2Q A;  4ID0 A;  2LRN A;  1XZO A;  2X99 A;  1VRS D;  2HYX A;  2HZF A;  1I5G A;  2CAI A;  4IHU A;  1K0O A;  3IV4 A;  4V1A p;  5ELA A;  3E9J B;  3APO A;  3GX8 A;  1TK5 B;  5CAX A;  2ON7 A;  3IOS A;  2HE3 A;  4ZL9 A;  1J08 A;  3PH9 A;  2YCD A;  4LLR A;  5DDL A;  2H0G A;  3M9J A;  8GSS A;  2A4V A;  4HEA 2;  4NHZ A;  2OAC A;  5EPF A;  2H6X A;  3TJG A;  1K0B A;  4IP6 A;  3GKX A;  3G7J A;  3ERG A;  1XW5 A;  4I2T A;  1M2B A;  2MMA A;  2FA8 A;  5IOX A;  3TDG A;  4I8B A;  1J0F A;  1V57 A;  4GRF A;  2OE0 A;  5J9C A;  5JWR B;  4CW9 A;  2VD1 A;  5ID2 A;  2EC4 A;  2YV9 A;  1O85 A;  3GL3 A;  1SKW B;  1S3D A;  4HDE A;  2GST A;  1K3L A;  5IMF A;  1OE7 A;  2E0Q A;  3TJK A;  1X9M B;  4XRA A;  3DVW A;  4OMV A;  4GXZ A;  4HZ2 A;  3MDK A;  3FZ9 A;  4F82 A;  1M7T A;  3BJ5 A;  4I2U A;  3RDW A;  3RPN A;  2N5B A;  2C80 A;  3WYW A;  2FUG 2;  1PD2 1;  3GST A;  3HZ4 A;  2PUK C;  1QGV A;  3A2X A;  2DJ2 A;  1IYH A;  2V32 A;  4N30 A;  5D96 A;  1TTZ A;  3VPT A;  4F9Z A;  3LOR A;  2DMM A;  3LQ7 A;  4PUA A;  5A4V A;  4H86 A;  3ZVJ D;  3UVH A;  4PNG A;  3HDC A;  5B6M A;  12GS A;  4TRX A;  4WR4 A;  5G5F A;  1NW2 A;  2GZP A;  4TR3 A;  2PWJ A;  2MBT A;  3ZMK A;  5ENU A;  1GSF A;  4LL4 B;  3ZML A;  1ERT A;  4ECI A;  1AQX A;  3IA1 A;  5COH A;  2IFQ A;  4MJB A;  1MD4 A;  5D9X A;  1EGO A;  2C8U A;  2LNS A;  3EU4 A;  2JZS A;  2JSY A;  4KND A;  1NSW A;  5ECL B;  1JZD A;  3FYG A;  4J56 E;  4MK3 A;  4TW5 A;  2X8C A;  4Q5N A;  5HR1 A;  3GL5 A;  3GUR A;  3DXB A;  5CRD A;  2LJK A;  4L5O A;  2TRC P;  6GSS A;  4LMW A;  2FY6 A;  3W8S A;  2WFC A;  3F3Q A;  4HJ2 A;  2O8V B;  5DVB A;  2GZY A;  1E2Y A;  1Z9H A;  1AQV A;  4IJ3 A;  1EZK A;  4QQ7 A;  5CRW A;  3KM6 A;  3A5W A;  2GQK A;  3BBY A;  2DIY A;  3KP9 A;  1HD2 A;  1Z7R A;  2HZE A;  2L57 A;  2K6V A;  2GZZ A;  3I9V 2;  3J7Y k;  1Q98 A;  5DJL A;  2FWE A;  1YKA A;  2H8L A;  2RUE A;  2B5X A;  2V1M A;  2OKA A;  4HI7 A;  3WGD A;  3BCI A;  1TU8 A;  2OA7 A;  1DE2 A;  5IIZ A;  2MMO A;  2PGT A;  2TRX A;  2R3X A;  3GN3 A;  3IK9 A;  3TRX A;  1TI3 A;  2L6C A;  5AIS A;  1ZZY A;  2V2G A;  2YAN A;  4WF5 A;  1AC1 A;  4MZW A;  3P8W A;  3LWA A;  4TR0 A;  1V2A A;  3IBH A;  2C3Q A;  2R5G A;  2B6M A;  3IAS 2;  4ZIL A;  4EL1 A;  1LBK A;  2ES7 A;  4G9H A;  5ECS A;  2KP2 A;  1M2A A;  1GRX A;  1JZO A;  4IEL A;  4K9Z A;  1ZYQ B;  1YEX A;  3IC4 A;  4XTS A;  4TVE A;  2YNX A;  1M99 A;  5GST A;  3U5R E;  2YWN A;  2MMN A;  1BAY A;  5B8A A;  2PVO C;  2H72 A;  3EVI A;  3RHB A;  5IPG A;  1SJZ A;  1H75 A;  2H66 A;  2N5A A;  2H01 A;  5FWG A;  3RPP A;  1GH2 A;  4WBR D;  2JZT A;  2XC2 A;  4IBP A;  3A2W A;  1K3Y A;  4K1F A;  3HJO A;  5KN0 A;  4JED A;  3ZRE A;  3ZTL A;  3W8J A;  5LNK e;  3MWH A;  2AB6 A;  4AJ6 A;  20GS A;  3UEM A;  2H71 A;  3GSS A;  3NIV A;  2AYT A;  2NBS A;  3HJM A;  4HQZ A;  4J57 E;  4J2F A;  3KZQ A;  1PQN A;  4Q5Q A;  2LST A;  1TJD A;  4HJM A;  3TUE A;  4OCE A;  1O8W A;  3F63 A;  3SBC A;  1A23 A;  5GAN D;  1UVZ A;  4ZBD A;  2A2S A;  3EIN A;  2MBS A;  4Z7X A;  4OO5 A;  4JR4 A;  2AV4 A;  5CO3 A;  4JBB A;  2B1K A;  4EUY A;  3KMO A;  4Q5R A;  3G9B A;  1V98 A;  3GH6 A;  1S3C A;  3D22 A;  3FR3 A;  1XIY A;  2O7K A;  1XFL A;  4MZB A;  5CRH A;  1CQG A;  1PX6 A;  9GSS A;  4ILF A;  4OD7 A;  4QL9 A;  10GS A;  3QCP A;  5G30 A;  3GH9 A;  4AJ8 A;  3C71 A;  1HYU A;  4E8E A;  4F0B A;  4EE0 A;  2L6D A;  4L5L A;  4MDC A;  3HVX A;  5F8B A;  3DEX A;  5C00 A;  3UJ1 A;  4ECJ A;  2F3M A;  2HRN A;  4O7H A;  4MF6 A;  1YF1 A;  3ED3 A;  4OCF A;  3FZ5 A;  3GMF A;  2L5O A;  1PX7 A;  3ZIV A;  3L78 A;  4MAB A;  4MF7 A;  3G7Y A;  4PQH A;  1A2J A;  3ZYW A;  1WMJ A;  1VF3 A;  2VL9 A;  4XS6 A;  1MDI A;  2TIR A;  4XCS A;  3ZL5 A;  4RUV A;  3FW2 A;  2C3T A;  2GLR A;  2H73 A;  4IW9 A;  4KAE A;  2LNT A;  3GKN A;  3TJJ A;  1F3B A;  2WB9 A;  5AN1 A;  1PKZ A;  3M0F A;  3WT2 A;  1W4V A;  4NMU A;  1YY7 A;  6GSV A;  1SYR A;  1QXH A;  1Y6E A;  1THX A;  4BVX A;  4E8H A;  2HSY A;  2DLX A;  6GSW A;  5IMZ A;  5EY6 A;  2B7K A;  1ACV A;  5ECI B;  2CX3 A;  5JCW A;  2M72 A;  1Z6N A;  2CX4 A;  2MZC A;  2GDR A;  1K0N A;  1TRS A;  4L0U A;  1ABA A;  5C04 A;  2DML A;  1A2L A;  4TR1 B;  4HZ4 A;  4QL7 A;  5IQY A;  4FIW A;  3AY8 A;  3DYR A;  1PKW A;  1O81 A;  5FT3 A;  3CRT A;  2XBI A;  4POK A;  2ZCT A;  4K8M A;  4K0G A;  5B7C A;  1X5E A;  4ZIJ A;  1B9X C;  1LU4 A;  3HYP A;  2V6O A;  1A0R P;  1TI1 A;  2FNO A;  4TXV A;  4IQA A;  4N10 A;  3KXO A;  3VLN A;  2HI7 A;  3LGC A;  1JLW A;  4FYB A;  2D2Z A;  2VLT A;  2Z9S A;  3KJY A;  1FW1 A;  1FVJ A;  4HQS A;  4X1U A;  2H30 A;  4FYU A;  4POB A;  4XIH A;  3S9F A;  3IK7 A;  1PL1 A;  5J3R A;  4XS4 B;  2VCQ A;  5G5E A;  5D9V A;  5ID2 B;  4IVF A;  4NXI A;  3FZ4 A;  4BVY A;  2XBQ A;  4TXO B;  7GSS A;  2H6Z A;  4ECB A;  3C8E A;  2CAQ A;  3QOU A;  1K3O A;  4ZBA A;  2GGT A;  3APS A;  2OBI A;  3PGT A;  1O8X A;  4MH3 A;  1T4Z A;  1YEP A;  4ZXG A;  1PN9 A;  1N8J A;  3TKS C;  4GLT A;  3CBU A;  3ZFB A;  1XW6 A;  1VF2 A;  3HD5 A;  4JR6 A;  4RI7 A;  1CQH A;  2DC5 A;  2XPE A;  1HQO A;  1XVW A;  2LV3 A;  3Q19 A;  3L9S A;  4KB3 A;  4ISD A;  3GA4 A;  3TB2 A;  4L8E A;  4XS4 A;  5F06 A;  1GUK A;  1G7O A;  2I3Y A;  1SD9 A;  5DBQ A;  2LS5 A;  1I9D A;  1T3B A;  2IJY A;  2LKU A;  5ECK B;  4TXO A;  1QMV A;  5CNW A;  2L4C A;  1SL0 B;  2PU9 C;  2FWG A;  3GIX A;  2VL2 A;  4I6X A;  5J9B A;  4BWS A;  2IFQ B;  1GSD A;  5DAK B;  1GSU A;  4ZBB A;  4AGS A;  1THO A;  5B8B A;  3KTL A;  1UA5 A;  1EWX A;  1T7P B;  5GSS A;  1IYI A;  5INY A;  1SKS B;  2X8H A;  4IN0 A;  5AGY A;  4EDZ A;  3IAM 2;  4KDX A;  3RBT A;  4LA1 A;  4AF2 A;  2KP1 A;  4MA9 A;  5E59 A;  1AUC A;  1JLV A;  2AUV A;  3D4T A;  2X64 A;  1G6Y A;  5JWQ B;  1ON4 A;  5DQS A;  3V1W A;  2AAW A;  5EL8 A;  5G1K A;  3DD3 A;  3MAK A;  3IPZ A;  2OBK A;  5HFG A;  2KUC A;  2PN8 A;  1KBN A;  5DAK A;  2HZE B;  4HS1 A;  1O73 A;  3C1R A;  4K2D A;  4K7O A;  1TXX A;  4GCI A;  1YJ6 A;  2H75 A;  4KCA A;  3F8U A;  5D9T A;  5JCU A;  2GVP A;  4I97 A;  3VWV A;  3FY7 A;  5G2Z A;  2F9S A;  2GQM A;  2JSZ A;  2HFD A;  3ERF A;  1PL2 A;  3LXZ A;  2WJU A;  4O92 A;  4KDU A;  3H93 A;  4DSR A;  3A3T A;  4KGI A;  3D5J A;  1YF0 A;  2PBJ A;  3D21 A;  1N2A A;  5CRE A;  2CT6 A;  3P90 A;  5DJM A;  1Y25 A;  5A5K A;  2BJX A;  3L4N A;  4KSM A;  2P5R A;  2XHF A;  4HOJ A;  2GSR A;  1XOA A;  2ZNM A;  1TRW A;  3GX0 A;  3GNJ A;  4NWY A;  3SWL A;  1MEK A;  3IHQ A;  3KEB A;  4ACS A;  5KN3 A;  19GS A;  3VPQ A;  1TK0 B;  1WOU A;  6GST A;  2VIM A;  4N0V A;  3VK9 A;  2CA8 A;  3QFB C;  3EU3 A;  1EP8 A;  3FRC A;  1GTA A;  2VLV A;  1HNA A;  3RAZ A;  2AHE A;  2L5L A;  4NAX A;  2K9F A;  3LSZ A;  1DE1 A;  2YN1 A;  1A2M A;  5DCG A;  1SK2 A;  2G2Q A;  1ZGN A;  2ON5 A;  3UBK A;  4ZB9 A;  2FHE A;  1XVQ A;  1AQW A;  3F4T A;  2PVQ A;  4KW6 A;  2WZ9 A;  5HR2 A;  3CXG A;  1LJR A;  3LG6 A;  5AIV A;  1R4W A;  3GUS A;  4BL7 A;  1NM3 A;  4LL1 B;  5LCZ A;  1WWJ A;  1TRV A;  4EKZ A;  3M9K A;  1U87 A;  3FHK A;  3VFI A;  1PGT A;  3HY2 A;  5G31 A;  4V1A g;  5ECH B;  1AAZ A;  1OKT A;  2E2G A;  2F51 A;  4ECC A;  1A8L A;  2LUS A;  3K8N A;  3WGE A;  1U88 A;  4NPB A;  4IP1 A;  4GF0 A;  16GS A;  4MF5 A;  1T4Y A;  5IMC A;  2DJK A;  1JHB A;  2GS3 A;  1MDK A;  2LQQ A;  3UIW A;  1SU9 A;  4OO4 A;  3BD2 A;  1OAZ A;  2IIY A;  2E7P A;  4HU7 A;  2VCZ A;  1ERV A;  4JE1 A;  1U3I A;  5D73 A;  1TDI A;  3HJP A;  2YJH A;  4MH2 A;  1FAA A;  1Q4J A;  4OWY A;  1V58 A;  3KMN A;  1X0R A;  1Z6M A;  2YZU A;  4KDY A;  1G0T A;  2PPT A;  5ABR A;  1BG5 A;  1C72 A;  3GKM A;  4PQ1 A;  3QAW A;  2L4Q A;  5LD0 A;  1XXU A;  1XPV A;  1SK1 A;  4KCE A;  2B5Y A;  2R4V A;  14GS A;  4BA7 A;  4K7I A;  3WD6 A;  2IMI A;  5DQY A;  2E2M A;  4XHM A;  3LEF A;  1GUL A;  2VM2 A;  4AJ7 A;  2MYG A;  1SJI A;  2QC7 A;  2ZUP A;  1OE8 A;  2B7J A;  1R5P A;  2C0G A;  2M80 A;  2O87 A;  2DSA A;  4ZL8 A;  3P7X A;  1EP7 A;  1GSS A;  4I5Q A;  2NTO A;  4X0X A;  4FYC A;  5ECN B;  1G6W A;  4MZC A;  5IPH A;  1GTU A;  11GS A;  1B4P A;  2DBC A;  2NDO A;  4PXO A;  1SYX A;  3IRA A;  1GUM A;  4F03 A;  2YWI A;  5G1L A;  3ZRD A;  3IR4 A;  4MCU A;  5B6N A;  3F0I A;  2C3N A;  4GQC A;  6GSY A;  4OFN A;  3L9U A;  1XWA A;  4MMM A;  4YAV A;  3GV1 A;  3F6F A;  3WGX A;  1PRX A;  3N5O A;  3FZA A;  3FR9 A;  1QK8 A; 
#chains in the Genus database with same CATH topology
 4DSS B;  5ECM B;  2KHP A;  5F07 A;  3JCM L;  1BYE A;  4Z2R A;  4F0C A;  1GNE A;  5BMU A;  1GLP A;  2R0P A;  1Z5Y E;  3D6I A;  3F3R A;  4V2M A;  3Q18 A;  1GSE A;  4PNF A;  3LYP A;  4GWR A;  2R6K A;  4WXT A;  4BWQ A;  4EVM A;  1OC3 A;  2VOC A;  1T00 A;  1E6B A;  2KOK A;  2QSI A;  3L0H A;  2HSM A;  4NV2 A;  2RM6 A;  2JAD A;  4KH7 A;  3FK8 A;  3L9V A;  1UC7 A;  2JZR A;  4Q5F A;  1XWG A;  1TK8 B;  3LJR A;  1SK0 A;  4NHW A;  4FO5 A;  5ECO B;  4K5R A;  1WP0 A;  4V2L A;  3F4S A;  3P2A A;  1M0U A;  2DJJ A;  4BVY B;  5J41 A;  4RQX A;  1B8X A;  3HHV A;  3TKQ A;  2R0C A;  3H79 A;  3DKS A;  4DSS A;  3MNG A;  1USB A;  5H5R A;  1F6M C;  4ML6 A;  5JCG A;  3HCZ A;  1FOV A;  1AXD A;  1XOB A;  3BCK A;  1TRU A;  4OFT A;  1Z3E A;  1R7H A;  2EIO A;  3KH9 A;  2IMF A;  4KE3 A;  4L0W A;  1VF4 A;  2I81 A;  2V6K A;  1H4O A;  1BED A;  4KA0 A;  5GAP D;  2VUP A;  3ERW A;  2H1B A;  2C0F A;  4TN8 A;  5HFI A;  1K0M A;  1RQM A;  3E0U A;  1OKD A;  3LFL A;  5E4W A;  1XWK A;  2VCX A;  4KX4 A;  3DWV A;  4ZL7 A;  1U3A A;  2HXK A;  1SL2 B;  3ZIT A;  3VWW A;  3CSI A;  5HQP A;  3GYK A;  1R5A A;  1HNC A;  4WBJ A;  2YWM A;  2NVL A;  1NHY A;  5F05 A;  5KOW A;  3HA9 A;  2PER A;  5J4U A;  4Z2U A;  3PIN A;  4DSQ A;  1ZOF A;  3HZ8 A;  4CY8 A;  1V40 A;  4WEY A;  3UVT A;  3M1G A;  5IO2 A;  4GSN A;  1G7E A;  1YKC A;  1U6T A;  2CZ2 A;  1PMT A;  1EOG A;  2C0D A;  3UL3 A;  1JFU A;  3CSJ A;  2VCV A;  2FWH A;  1T8E B;  2IMK A;  2CVD A;  3QAG A;  4BIK A;  3Q6O A;  4KSO A;  2QKE A;  1ML6 A;  5J5N A;  1XBS A;  2OE3 A;  1TU7 A;  4YQV A;  1Z7P A;  3UOM A;  1FVK A;  5D9W A;  3TKS E;  4D73 A;  1GL8 A;  2RII A;  2HRA A;  2GSQ A;  2EIR A;  1W89 A;  1EGR A;  2VM1 A;  1FB0 A;  1F37 A;  1QFN A;  4OFM A;  5F0G A;  2K8V A;  1X9S B;  2WUL A;  4GTU A;  2VL3 A;  3F4R A;  5KN2 A;  4O32 A;  4K5S A;  5EVO A;  3DML A;  2DJ3 A;  3TJF A;  2X8G A;  5D93 A;  1FB6 A;  4PQI A;  3EE2 A;  3QAV A;  5IO0 A;  1BQ7 A;  2XPD A;  3C73 A;  1TP9 A;  5KEJ A;  1EV4 A;  3CYN A;  5CP1 A;  3KH7 A;  1WRY A;  4IJI A;  3EYT A;  1ZCP A;  1WJK A;  2IMD A;  3TOU A;  6GSU A;  1R26 A;  2HNL A;  2R37 A;  5ECP B;  1B48 A;  4N11 A;  3WT1 A;  3O76 A;  3DVX A;  3DRN A;  3TRQ A;  3GRX A;  4EO3 A;  3TKS A;  4N0Z A;  5A4W A;  3A2V A;  1ZYN A;  13GS A;  2DIZ A;  2FLS A;  2RLI A;  5KN1 A;  3KGK A;  4CDO A;  1M9B A;  1FOH A;  1K0D A;  4WET A;  2YV7 A;  3PR8 A;  4IGJ A;  3D4M A;  3VWU A;  4LMV A;  3N9J A;  1GTI A;  1FO5 A;  3W6G A;  5IMV A;  2R2J A;  1XWC A;  1GNW A;  5L71 A;  3OR5 A;  4PUF C;  3KIJ A;  1KNG A;  2WRT A;  4HU9 A;  1ERU A;  2H70 A;  3ME7 A;  4O5R A;  1V9W A;  2IL3 A;  2LEG A;  3GKK A;  3TJB A;  3M8N A;  3TKP A;  1KEB A;  1O7U A;  2I4A A;  2REM A;  3E3E A;  2VO4 A;  3US3 A;  4FH8 A;  3BOA A;  1EEJ A;  3MSZ A;  5ELG A;  2H0I A;  4FQU A;  3VI7 A;  22GS A;  3M3M A;  2JU5 A;  4JU5 A;  3ZVJ A;  2GSS A;  5HR0 A;  4JZQ A;  1OC9 B;  6GSX A;  2CV4 A;  1JZW A;  1B9Y C;  1DBY A;  2VCW A;  3G7I A;  4CHS A;  3EC3 A;  1SEN A;  3KD0 A;  3CMI A;  3NZN A;  4IKH A;  3HVN A;  4RI6 A;  4YKG A;  4Z2T A;  2YPM A;  3FR6 A;  4GQF A;  4BL7 B;  5FHI A;  4IS0 A;  4WF4 A;  3UAR A;  4HSC X;  5IOW A;  2LRT A;  2H76 A;  2A4H A;  1X9W B;  1PA3 A;  4MJE A;  4TKY A;  4F2I A;  3FEU A;  2C1Y A;  3TCO A;  1J9B A;  3EUR A;  3IC8 A;  1RW1 A;  2HRF A;  3QMX A;  4PUR A;  1EEM A;  3APQ A;  2VD0 A;  1RK4 A;  2VCT A;  3DGQ A;  4EDY A;  4MJA A;  3EMX A;  1OC9 A;  2B3S A;  1SJ6 A;  2H74 A;  1K0C A;  2OAD A;  1QQ2 A;  1OYJ A;  1TKD B;  2GQL A;  1K0A A;  2LJA A;  2LQO A;  1DUG A;  1OVN A;  2H1A A;  1AIU A;  5IMD A;  3U6V A;  1GSQ A;  3ZZX A;  1FG4 A;  1QUW A;  4O5U A;  1GSY A;  1A24 A;  1F3A A;  3QFA C;  2FA4 A;  4WR5 A;  3RHC A;  4YH2 A;  5D8I A;  2HSH A;  2JAC A;  4G0L A;  2VAF A;  2WGR A;  3EWL A;  1B4Q A;  2JL4 A;  1BJX A;  1GP1 A;  2FD3 A;  1A8Y A;  4K7N A;  1OC8 A;  2K18 A;  2H0H A;  2H1G A;  3KTB A;  4POM A;  3O3T A;  1GTB A;  2M46 A;  3GFK A;  1XWB A;  3HXS A;  1AW9 A;  2LTK A;  3D0Z A;  2P5Q A;  3ZFL A;  1NHO A;  4EXJ A;  2C0E A;  4ML1 A;  3GHA A;  4KUN A;  3LXT A;  3GTU B;  1F2E A;  1SD8 A;  4P3Y B;  1ILO A;  4TOP A;  3QDN A;  1JZR A;  3ZIJ A;  3VI5 A;  2DJ0 A;  3KCM A;  3O6T A;  1X5D A;  5DAL B;  4JRR A;  1ERW A;  3A5I A;  2P0G A;  2L59 A;  4G19 A;  1HNB A;  2YJ7 A;  4NV5 A;  2NPB A;  3ZLP A;  2BMX A;  4MJC A;  2O85 A;  2I9H A;  2MMZ A;  1WE0 A;  3TRP A;  3C1S A;  1GWC A;  3TOT A;  1X5C A;  1EV9 A;  1F9M A;  1KTE A;  3IDV A;  3QD9 A;  3NOF A;  3LYK A;  4YQM A;  1EOH A;  3KP8 A;  3H4K A;  4MPF A;  4MPG A;  2QA1 A;  2IME A;  3CTF A;  5H5Q A;  2HT9 A;  2WDU A;  3GTU A;  2GT6 A;  1YQ1 A;  1WPI A;  3I43 A;  5DAL A;  3TGZ A;  1YZX A;  4ZB8 A;  5IMA A;  3I69 A;  2LJR A;  4GSS A;  2AJQ B;  3VWX A;  2YZH A;  2LRC A;  1M9A A;  2YWO A;  3CTG A;  1ZYE A;  3ISO A;  4HUA A;  4EC0 A;  2QGV A;  1VF1 A;  4G2E A;  2HLS A;  2R0G A;  2FWF A;  2C4J A;  4K6X A;  3F6D A;  5BRT A;  5CRG A;  17GS A;  2CQ9 A;  2GT5 A;  3H8Q A;  2WS2 A;  1ZMA A;  3QR6 A;  1MD3 A;  4YAP A;  3FKF A;  3UAP A;  4DVC A;  2H19 A;  2H1D A;  1ZL9 A;  1PSQ A;  1XW9 A;  1SL1 B;  1XG8 A;  3H1N A;  1GLQ A;  2FGX A;  2RM5 A;  2P31 A;  2DJ1 A;  2CZ3 A;  4IQ1 A;  1XCC A;  2IPA A;  1M2D A;  3DIE A;  1A0F A;  2F8A A;  2ALB A;  2N5F A;  1T1V A;  1UN2 A;  4MP4 A;  3UBL A;  4XS1 A;  2PMT A;  3ME8 A;  5ECR B;  2FCH A;  4V2N A;  4BPY A;  5AIX A;  1DSB A;  1BX9 A;  2B1L A;  1VGL A;  2B5E A;  5H5S A;  1YDK A;  5HR3 A;  4XRD A;  1GUH A;  2YP6 A;  4ULX A;  3J7Y b;  1ST9 A;  2GTU A;  3IE3 A;  5JWO B;  4MLY A;  2J9H A;  2OJL A;  3CSH A;  2K8S A;  2H6Y A;  3UMA A;  3QPM A;  3LW9 A;  2CVB A;  1MDJ A;  4K0N A;  5GZZ B;  2IWT A;  5CYY A;  2CVK A;  4PGT A;  4YKF A;  5IM9 A;  2OE1 A;  4PX1 A;  2A2P A;  2WCI A;  3EMP A;  1O6J A;  4EIQ A;  3HVV A;  3VUR A;  5ECQ B;  3I6A A;  5DCH A;  4G10 A;  2A2R A;  3TKR A;  4POL A;  4TR4 A;  1TW9 A;  4GST A;  2O89 A;  2I1U A;  4ZB6 A;  2F8F A;  4D73 B;  4DEJ A;  1S3A A;  2G0F A;  1SKR B;  2EIQ A;  2IN3 A;  3F9U A;  1URM A;  3CRU A;  2V41 A;  2VLU A;  3HKR A;  3HVS A;  3C7M A;  5A4U A;  3IXR A;  4TR1 A;  2VL2 C;  2RUF A;  4X43 A;  5HFK A;  4RQR A;  1WIK A;  4WKW A;  2DKH A;  2BTO T;  1MTC A;  18GS A;  2YOI A;  2J23 A;  4YQU A;  4EF0 A;  1FHE A;  3Q74 A;  2KLX A;  1TOF A;  3R2Q A;  4ID0 A;  2LRN A;  1XZO A;  2X99 A;  1VRS D;  2HYX A;  2HZF A;  1I5G A;  2CAI A;  4IHU A;  1K0O A;  3IV4 A;  4V1A p;  5ELA A;  3E9J B;  3APO A;  3GX8 A;  1TK5 B;  5CAX A;  2ON7 A;  3IOS A;  2HE3 A;  4ZL9 A;  1J08 A;  3PH9 A;  2YCD A;  4LLR A;  5DDL A;  2H0G A;  3M9J A;  8GSS A;  2A4V A;  4HEA 2;  4NHZ A;  2OAC A;  5EPF A;  2H6X A;  3TJG A;  1K0B A;  4IP6 A;  3GKX A;  3G7J A;  3ERG A;  1XW5 A;  4I2T A;  1M2B A;  2MMA A;  2FA8 A;  5IOX A;  3TDG A;  4I8B A;  1J0F A;  1V57 A;  4GRF A;  2OE0 A;  5J9C A;  5JWR B;  4CW9 A;  2VD1 A;  5ID2 A;  2EC4 A;  2YV9 A;  1O85 A;  3GL3 A;  1SKW B;  1S3D A;  4HDE A;  2GST A;  1K3L A;  5IMF A;  1OE7 A;  2E0Q A;  3TJK A;  1X9M B;  4XRA A;  3DVW A;  4OMV A;  4GXZ A;  4HZ2 A;  4PTS A;  3MDK A;  3FZ9 A;  5KOX A;  4F82 A;  2UZ8 A;  1M7T A;  3BJ5 A;  4X4J A;  4I2U A;  3RDW A;  3RPN A;  2N5B A;  2C80 A;  3WYW A;  2FUG 2;  1PD2 1;  3GST A;  3HZ4 A;  2PUK C;  1QGV A;  3A2X A;  2DJ2 A;  1IYH A;  2V32 A;  4N30 A;  5D96 A;  1TTZ A;  3VPT A;  4F9Z A;  3LOR A;  2DMM A;  3LQ7 A;  4PUA A;  5A4V A;  4H86 A;  3ZVJ D;  3UVH A;  4PNG A;  3HDC A;  5B6M A;  12GS A;  4TRX A;  4WR4 A;  5G5F A;  1NW2 A;  2GZP A;  4TR3 A;  2PWJ A;  2MBT A;  3ZMK A;  5ENU A;  1GSF A;  4LL4 B;  3MIX A;  3ZML A;  1ERT A;  4ECI A;  1AQX A;  3IA1 A;  5COH A;  2IFQ A;  4MJB A;  1MD4 A;  5D9X A;  1EGO A;  2C8U A;  2LNS A;  3EU4 A;  2JZS A;  2JSY A;  4KND A;  1NSW A;  5ECL B;  1JZD A;  3FYG A;  4J56 E;  4MK3 A;  4TW5 A;  2X8C A;  4Q5N A;  5HR1 A;  3GL5 A;  3GUR A;  3DXB A;  5CRD A;  1M3J A;  2LJK A;  4L5O A;  2TRC P;  6GSS A;  4LMW A;  2FY6 A;  3W8S A;  2WFC A;  3F3Q A;  4HJ2 A;  2O8V B;  5DVB A;  2GZY A;  1S3R A;  1E2Y A;  1Z9H A;  1AQV A;  4IJ3 A;  1EZK A;  4QQ7 A;  5CRW A;  3KM6 A;  3A5W A;  2GQK A;  3BBY A;  2DIY A;  3KP9 A;  1HD2 A;  1Z7R A;  2HZE A;  2L57 A;  2K6V A;  2GZZ A;  3I9V 2;  3J7Y k;  1Q98 A;  5DJL A;  1PN0 A;  2FWE A;  1YKA A;  2H8L A;  2RUE A;  2B5X A;  2V1M A;  2OKA A;  4HI7 A;  3WGD A;  3BCI A;  1TU8 A;  2OA7 A;  4K2X A;  5IIZ A;  2MMO A;  1DE2 A;  2PGT A;  2TRX A;  2R3X A;  3GN3 A;  3IK9 A;  3TRX A;  1TI3 A;  2L6C A;  5AIS A;  1ZZY A;  2V2G A;  2YAN A;  4WF5 A;  1AC1 A;  4MZW A;  3P8W A;  3LWA A;  4TR0 A;  1V2A A;  3IBH A;  2C3Q A;  2R5G A;  2B6M A;  3IAS 2;  4ZIL A;  4EL1 A;  1LBK A;  2ES7 A;  4G9H A;  5ECS A;  2KP2 A;  1M2A A;  1GRX A;  1JZO A;  4IEL A;  4K9Z A;  1ZYQ B;  1YEX A;  3IC4 A;  4XTS A;  4TVE A;  2YNX A;  1M99 A;  5GST A;  3R3E A;  3U5R E;  2YWN A;  2MMN A;  1BAY A;  5B8A A;  2PVO C;  2H72 A;  3EVI A;  3RHB A;  5IPG A;  1SJZ A;  1H75 A;  2H66 A;  2N5A A;  2H01 A;  5FWG A;  3RPP A;  1GH2 A;  2HRK A;  4WBR D;  2JZT A;  2XC2 A;  4IBP A;  3A2W A;  1K3Y A;  4K1F A;  3HJO A;  5KN0 A;  4JED A;  3ZRE A;  3ZTL A;  3W8J A;  5LNK e;  3MWH A;  2AB6 A;  4AJ6 A;  20GS A;  3UEM A;  2H71 A;  3GSS A;  3NIV A;  2AYT A;  2NBS A;  3HJM A;  4HQZ A;  4J57 E;  4J2F A;  3KZQ A;  1PQN A;  4Q5Q A;  2LST A;  1TJD A;  4HJM A;  3TUE A;  4OCE A;  1O8W A;  3F63 A;  3SBC A;  2X49 A;  1A23 A;  5GAN D;  1UVZ A;  4ZBD A;  2A2S A;  3EIN A;  2MBS A;  4Z7X A;  4OO5 A;  4JR4 A;  2AV4 A;  5CO3 A;  4JBB A;  2B1K A;  4EUY A;  3KMO A;  4Q5R A;  4O5Q A;  3G9B A;  1V98 A;  3GH6 A;  1S3C A;  3D22 A;  3FR3 A;  1XIY A;  2O7K A;  1XFL A;  4MZB A;  5CRH A;  1CQG A;  1PX6 A;  9GSS A;  4ILF A;  4OD7 A;  4QL9 A;  10GS A;  3QCP A;  5G30 A;  3GH9 A;  4AJ8 A;  3C71 A;  1HYU A;  4E8E A;  4F0B A;  4EE0 A;  2L6D A;  4L5L A;  4MDC A;  3HVX A;  5F8B A;  3DEX A;  5C00 A;  3UJ1 A;  4ECJ A;  2F3M A;  4BVX B;  2HRN A;  4O7H A;  4MF6 A;  1YF1 A;  3ED3 A;  4OCF A;  3FZ5 A;  3GMF A;  2L5O A;  1PX7 A;  3ZIV A;  3L78 A;  4MAB A;  4MF7 A;  3G7Y A;  4PQH A;  1A2J A;  3FMW A;  3ZYW A;  1WMJ A;  1VF3 A;  2VL9 A;  4XS6 A;  1MDI A;  2TIR A;  4XCS A;  3ZL5 A;  4RUV A;  3FW2 A;  2C3T A;  2GLR A;  2H73 A;  4IW9 A;  3EPT A;  4KAE A;  2LNT A;  3GKN A;  3TJJ A;  1F3B A;  2DKI A;  3CQF A;  2WB9 A;  5AN1 A;  1PKZ A;  3M0F A;  3WT2 A;  1W4V A;  4NMU A;  1YY7 A;  6GSV A;  1SYR A;  1QXH A;  1Y6E A;  1THX A;  4BVX A;  4E8H A;  2HSY A;  2DLX A;  6GSW A;  5IMZ A;  5EY6 A;  2B7K A;  1ACV A;  5ECI B;  2CX3 A;  5JCW A;  2M72 A;  1Z6N A;  2CX4 A;  2MZC A;  2GDR A;  1K0N A;  1TRS A;  4L0U A;  1ABA A;  5C04 A;  2DML A;  1A2L A;  4TR1 B;  4HZ4 A;  4QL7 A;  5IQY A;  4FIW A;  3AY8 A;  3DYR A;  1PKW A;  1O81 A;  5FT3 A;  3CRT A;  2XBI A;  4POK A;  2ZCT A;  4K8M A;  4K0G A;  5B7C A;  1X5E A;  4ZIJ A;  1B9X C;  1LU4 A;  3HYP A;  2V6O A;  1A0R P;  1TI1 A;  2FNO A;  4TXV A;  4IQA A;  4N10 A;  3KXO A;  3VLN A;  2HI7 A;  3LGC A;  1JLW A;  4FYB A;  2D2Z A;  2VLT A;  2Z9S A;  3KJY A;  1FW1 A;  1FVJ A;  4HQS A;  4X1U A;  2H30 A;  4FYU A;  4POB A;  4XIH A;  3S9F A;  3IK7 A;  1PL1 A;  5J3R A;  4XS4 B;  2VCQ A;  5G5E A;  5D9V A;  5ID2 B;  1PFO A;  4IVF A;  4NXI A;  3FZ4 A;  4BVY A;  2XBQ A;  4TXO B;  7GSS A;  2H6Z A;  4ECB A;  3C8E A;  2CAQ A;  3QOU A;  1K3O A;  4ZBA A;  4EIP A;  2GGT A;  3APS A;  2OBI A;  3PGT A;  1O8X A;  4MH3 A;  1T4Z A;  1YEP A;  4ZXG A;  2QA2 A;  1PN9 A;  1N8J A;  3TKS C;  4GLT A;  4MNN A;  3CBU A;  3ZFB A;  1XW6 A;  1VF2 A;  3HD5 A;  4JR6 A;  4RI7 A;  1CQH A;  2DC5 A;  1ZYP A;  2XPE A;  1HQO A;  1XVW A;  4G0K A;  2LV3 A;  3Q19 A;  3L9S A;  4KB3 A;  4ISD A;  3GA4 A;  3TB2 A;  4L8E A;  4XS4 A;  5F06 A;  1GUK A;  1G7O A;  2I3Y A;  1SD9 A;  5DBQ A;  2LS5 A;  1I9D A;  1T3B A;  2IJY A;  2LKU A;  5ECK B;  4TXO A;  1QMV A;  5CNW A;  2L4C A;  1SL0 B;  2PU9 C;  2FWG A;  3GIX A;  1M3I A;  2VL2 A;  4I6X A;  5J9B A;  4BWS A;  2IFQ B;  4ICY A;  1GSD A;  5DAK B;  1GSU A;  4ZBB A;  4AGS A;  1THO A;  5B8B A;  3KTL A;  1UA5 A;  1EWX A;  1T7P B;  5GSS A;  1IYI A;  5INY A;  1SKS B;  2X8H A;  4IN0 A;  5AGY A;  4EDZ A;  3IAM 2;  4KDX A;  3RBT A;  4LA1 A;  4AF2 A;  2KP1 A;  4MA9 A;  5E59 A;  1AUC A;  1JLV A;  2AUV A;  3D4T A;  2X64 A;  1G6Y A;  5JWQ B;  1ON4 A;  5DQS A;  3V1W A;  2AAW A;  5EL8 A;  5G1K A;  3DD3 A;  3MAK A;  3IPZ A;  2OBK A;  5HFG A;  2KUC A;  2PN8 A;  1KBN A;  5DAK A;  2HZE B;  4HS1 A;  1O73 A;  3C1R A;  4K2D A;  4K7O A;  1TXX A;  4GCI A;  4A5P A;  1YJ6 A;  2H75 A;  4KCA A;  3F8U A;  5D9T A;  5JCU A;  2GVP A;  3PPU A;  4I97 A;  3VWV A;  3FY7 A;  5G2Z A;  2F9S A;  2GQM A;  2JSZ A;  2HFD A;  3ERF A;  1PL2 A;  3LXZ A;  2WJU A;  4O92 A;  4KDU A;  3H93 A;  4DSR A;  3A3T A;  4KGI A;  3D5J A;  1YF0 A;  2PBJ A;  3D21 A;  1N2A A;  5CRE A;  2CT6 A;  3P90 A;  5DJM A;  1Y25 A;  5A5K A;  2BJX A;  3L4N A;  4KSM A;  2P5R A;  2XHF A;  4HOJ A;  2GSR A;  1XOA A;  2ZNM A;  1TRW A;  3GX0 A;  3GNJ A;  4NWY A;  3SWL A;  1MEK A;  3IHQ A;  3KEB A;  4ACS A;  5KN3 A;  19GS A;  3VPQ A;  1TK0 B;  1WOU A;  6GST A;  2VIM A;  4N0V A;  3VK9 A;  2CA8 A;  3QFB C;  3EU3 A;  1EP8 A;  3FRC A;  1GTA A;  2VLV A;  1HNA A;  3RAZ A;  2AHE A;  2L5L A;  4NAX A;  2K9F A;  4USS A;  3LSZ A;  1DE1 A;  2YN1 A;  1A2M A;  5DCG A;  1SK2 A;  2G2Q A;  1ZGN A;  2ON5 A;  3UBK A;  4ZB9 A;  2FHE A;  1XVQ A;  1AQW A;  3F4T A;  2PVQ A;  4KW6 A;  2WZ9 A;  5HR2 A;  3CXG A;  1LJR A;  3LG6 A;  5AIV A;  1R4W A;  3GUS A;  4BL7 A;  1NM3 A;  4G0I A;  4LL1 B;  5LCZ A;  1WWJ A;  1TRV A;  2X4A A;  4EKZ A;  3M9K A;  1U87 A;  3FHK A;  3VFI A;  1PGT A;  3HY2 A;  5G31 A;  4V1A g;  4KF9 A;  5ECH B;  1AAZ A;  1OKT A;  2E2G A;  2F51 A;  4ECC A;  1A8L A;  2LUS A;  3K8N A;  3WGE A;  1U88 A;  4NPB A;  4IP1 A;  4GF0 A;  16GS A;  4MF5 A;  1T4Y A;  5IMC A;  2DJK A;  3MYD A;  1JHB A;  2GS3 A;  1MDK A;  2LQQ A;  3UIW A;  1SU9 A;  4OO4 A;  3BD2 A;  1OAZ A;  3IHG A;  2IIY A;  2E7P A;  4HU7 A;  2VCZ A;  1ERV A;  4JE1 A;  1U3I A;  5D73 A;  1TDI A;  3HJP A;  2YJH A;  4MH2 A;  1FAA A;  1Q4J A;  4OWY A;  1V58 A;  3KMN A;  1X0R A;  1Z6M A;  2YZU A;  4KDY A;  1G0T A;  2PPT A;  5ABR A;  1BG5 A;  1C72 A;  3GKM A;  4CY6 A;  4PQ1 A;  3QAW A;  2L4Q A;  5LD0 A;  1XXU A;  1XPV A;  1SK1 A;  4KCE A;  2B5Y A;  2R4V A;  14GS A;  4BA7 A;  4K7I A;  3WD6 A;  2IMI A;  5DQY A;  2E2M A;  4XHM A;  3LEF A;  1GUL A;  2VM2 A;  4AJ7 A;  2MYG A;  1SJI A;  2QC7 A;  2ZUP A;  1OE8 A;  2B7J A;  1R5P A;  2C0G A;  2M80 A;  2O87 A;  2DSA A;  4ZL8 A;  3P7X A;  1EP7 A;  1GSS A;  4I5Q A;  2NTO A;  4X0X A;  4FYC A;  5ECN B;  1G6W A;  4MZC A;  5IPH A;  1GTU A;  11GS A;  1B4P A;  2DBC A;  2NDO A;  4PXO A;  1SYX A;  3IRA A;  1GUM A;  4F03 A;  2YWI A;  5G1L A;  3ZRD A;  3IR4 A;  4MCU A;  5B6N A;  3F0I A;  2C3N A;  4GQC A;  6GSY A;  4OFN A;  3L9U A;  1XWA A;  4MMM A;  4YAV A;  3GV1 A;  3F6F A;  3WGX A;  1PRX A;  3N5O A;  3FZA A;  3FR9 A;  1QK8 A; 
#chains in the Genus database with same CATH homology
 4DSS B;  5ECM B;  2KHP A;  5F07 A;  3JCM L;  1BYE A;  4Z2R A;  4F0C A;  1GNE A;  5BMU A;  1GLP A;  2R0P A;  1Z5Y E;  3D6I A;  3F3R A;  4V2M A;  3Q18 A;  1GSE A;  4PNF A;  3LYP A;  4GWR A;  2R6K A;  4WXT A;  4BWQ A;  4EVM A;  1OC3 A;  2VOC A;  1T00 A;  1E6B A;  2KOK A;  2QSI A;  3L0H A;  2HSM A;  4NV2 A;  2RM6 A;  2JAD A;  4KH7 A;  3FK8 A;  3L9V A;  1UC7 A;  2JZR A;  4Q5F A;  1XWG A;  1TK8 B;  3LJR A;  1SK0 A;  4NHW A;  4FO5 A;  5ECO B;  4K5R A;  1WP0 A;  4V2L A;  3F4S A;  3P2A A;  1M0U A;  2DJJ A;  4BVY B;  5J41 A;  4RQX A;  1B8X A;  3HHV A;  3TKQ A;  2R0C A;  3H79 A;  3DKS A;  4DSS A;  3MNG A;  1USB A;  5H5R A;  1F6M C;  4ML6 A;  5JCG A;  3HCZ A;  1FOV A;  1AXD A;  1XOB A;  3BCK A;  1TRU A;  4OFT A;  1Z3E A;  1R7H A;  2EIO A;  3KH9 A;  2IMF A;  4KE3 A;  4L0W A;  1VF4 A;  2I81 A;  2V6K A;  1H4O A;  1BED A;  4KA0 A;  5GAP D;  2VUP A;  3ERW A;  2H1B A;  2C0F A;  4TN8 A;  5HFI A;  1K0M A;  1RQM A;  3E0U A;  1OKD A;  3LFL A;  5E4W A;  1XWK A;  2VCX A;  4KX4 A;  3DWV A;  4ZL7 A;  1U3A A;  2HXK A;  1SL2 B;  3ZIT A;  3VWW A;  3CSI A;  5HQP A;  3GYK A;  1R5A A;  1HNC A;  4WBJ A;  2YWM A;  2NVL A;  1NHY A;  5F05 A;  5KOW A;  3HA9 A;  2PER A;  5J4U A;  4Z2U A;  3PIN A;  4DSQ A;  1ZOF A;  3HZ8 A;  4CY8 A;  1V40 A;  4WEY A;  3UVT A;  3M1G A;  5IO2 A;  4GSN A;  1G7E A;  1YKC A;  1U6T A;  2CZ2 A;  1PMT A;  1EOG A;  2C0D A;  3UL3 A;  1JFU A;  3CSJ A;  2VCV A;  2FWH A;  1T8E B;  2IMK A;  2CVD A;  3QAG A;  3Q6O A;  4KSO A;  2QKE A;  1ML6 A;  5J5N A;  1XBS A;  2OE3 A;  1TU7 A;  4YQV A;  1Z7P A;  3UOM A;  1FVK A;  5D9W A;  3TKS E;  4D73 A;  1GL8 A;  2RII A;  2HRA A;  2GSQ A;  2EIR A;  1W89 A;  1EGR A;  2VM1 A;  1FB0 A;  1F37 A;  1QFN A;  4OFM A;  5F0G A;  2K8V A;  1X9S B;  2WUL A;  4GTU A;  2VL3 A;  3F4R A;  5KN2 A;  4O32 A;  4K5S A;  5EVO A;  3DML A;  2DJ3 A;  3TJF A;  2X8G A;  5D93 A;  1FB6 A;  4PQI A;  3EE2 A;  3QAV A;  5IO0 A;  1BQ7 A;  2XPD A;  3C73 A;  1TP9 A;  5KEJ A;  1EV4 A;  3CYN A;  5CP1 A;  3KH7 A;  1WRY A;  4IJI A;  3EYT A;  1ZCP A;  1WJK A;  2IMD A;  3TOU A;  6GSU A;  1R26 A;  2HNL A;  2R37 A;  5ECP B;  1B48 A;  4N11 A;  3WT1 A;  3O76 A;  3DVX A;  3DRN A;  3TRQ A;  3GRX A;  4EO3 A;  3TKS A;  4N0Z A;  5A4W A;  3A2V A;  1ZYN A;  13GS A;  2DIZ A;  2FLS A;  2RLI A;  5KN1 A;  3KGK A;  4CDO A;  1M9B A;  1FOH A;  1K0D A;  4WET A;  2YV7 A;  3PR8 A;  4IGJ A;  3D4M A;  3VWU A;  4LMV A;  3N9J A;  1GTI A;  1FO5 A;  3W6G A;  5IMV A;  2R2J A;  1XWC A;  1GNW A;  5L71 A;  3OR5 A;  4PUF C;  3KIJ A;  1KNG A;  2WRT A;  4HU9 A;  1ERU A;  2H70 A;  3ME7 A;  4O5R A;  1V9W A;  2IL3 A;  2LEG A;  3GKK A;  3TJB A;  3M8N A;  3TKP A;  1KEB A;  1O7U A;  2I4A A;  2REM A;  3E3E A;  2VO4 A;  3US3 A;  4FH8 A;  3BOA A;  1EEJ A;  3MSZ A;  5ELG A;  2H0I A;  4FQU A;  3VI7 A;  22GS A;  3M3M A;  2JU5 A;  4JU5 A;  3ZVJ A;  2GSS A;  5HR0 A;  4JZQ A;  1OC9 B;  6GSX A;  2CV4 A;  1JZW A;  1B9Y C;  1DBY A;  2VCW A;  3G7I A;  4CHS A;  3EC3 A;  1SEN A;  3KD0 A;  3CMI A;  3NZN A;  4IKH A;  4RI6 A;  4YKG A;  4Z2T A;  2YPM A;  3FR6 A;  4GQF A;  4BL7 B;  5FHI A;  4IS0 A;  4WF4 A;  3UAR A;  5IOW A;  2LRT A;  2H76 A;  2A4H A;  1X9W B;  1PA3 A;  4MJE A;  4TKY A;  4F2I A;  3FEU A;  2C1Y A;  3TCO A;  1J9B A;  3EUR A;  3IC8 A;  1RW1 A;  2HRF A;  3QMX A;  4PUR A;  1EEM A;  3APQ A;  2VD0 A;  1RK4 A;  2VCT A;  3DGQ A;  4EDY A;  4MJA A;  3EMX A;  1OC9 A;  2B3S A;  1SJ6 A;  2H74 A;  1K0C A;  2OAD A;  1QQ2 A;  1OYJ A;  1TKD B;  2GQL A;  1K0A A;  2LJA A;  2LQO A;  1DUG A;  1OVN A;  2H1A A;  1AIU A;  5IMD A;  3U6V A;  1GSQ A;  3ZZX A;  1FG4 A;  1QUW A;  4O5U A;  1GSY A;  1A24 A;  1F3A A;  3QFA C;  2FA4 A;  4WR5 A;  3RHC A;  4YH2 A;  5D8I A;  2HSH A;  2JAC A;  4G0L A;  2VAF A;  2WGR A;  3EWL A;  1B4Q A;  2JL4 A;  1BJX A;  1GP1 A;  2FD3 A;  1A8Y A;  4K7N A;  1OC8 A;  2K18 A;  2H0H A;  2H1G A;  3KTB A;  4POM A;  3O3T A;  1GTB A;  2M46 A;  3GFK A;  1XWB A;  3HXS A;  1AW9 A;  2LTK A;  3D0Z A;  2P5Q A;  3ZFL A;  1NHO A;  4EXJ A;  2C0E A;  4ML1 A;  3GHA A;  4KUN A;  3LXT A;  3GTU B;  1F2E A;  1SD8 A;  4P3Y B;  1ILO A;  4TOP A;  3QDN A;  1JZR A;  3ZIJ A;  3VI5 A;  2DJ0 A;  3KCM A;  3O6T A;  1X5D A;  5DAL B;  4JRR A;  1ERW A;  3A5I A;  2P0G A;  2L59 A;  4G19 A;  1HNB A;  2YJ7 A;  4NV5 A;  2NPB A;  3ZLP A;  2BMX A;  4MJC A;  2O85 A;  2I9H A;  2MMZ A;  1WE0 A;  3TRP A;  3C1S A;  1GWC A;  3TOT A;  1X5C A;  1EV9 A;  1F9M A;  1KTE A;  3IDV A;  3QD9 A;  3NOF A;  3LYK A;  4YQM A;  1EOH A;  3KP8 A;  3H4K A;  4MPF A;  4MPG A;  2QA1 A;  2IME A;  3CTF A;  5H5Q A;  2HT9 A;  2WDU A;  3GTU A;  2GT6 A;  1YQ1 A;  1WPI A;  3I43 A;  5DAL A;  3TGZ A;  1YZX A;  4ZB8 A;  5IMA A;  3I69 A;  2LJR A;  4GSS A;  2AJQ B;  3VWX A;  2YZH A;  2LRC A;  1M9A A;  2YWO A;  3CTG A;  1ZYE A;  3ISO A;  4HUA A;  4EC0 A;  2QGV A;  1VF1 A;  4G2E A;  2HLS A;  2R0G A;  2FWF A;  2C4J A;  4K6X A;  3F6D A;  5BRT A;  5CRG A;  17GS A;  2CQ9 A;  2GT5 A;  3H8Q A;  2WS2 A;  1ZMA A;  3QR6 A;  1MD3 A;  4YAP A;  3FKF A;  3UAP A;  4DVC A;  2H19 A;  2H1D A;  1ZL9 A;  1PSQ A;  1XW9 A;  1SL1 B;  3H1N A;  1GLQ A;  2FGX A;  2RM5 A;  2P31 A;  2DJ1 A;  2CZ3 A;  4IQ1 A;  1XCC A;  2IPA A;  1M2D A;  3DIE A;  1A0F A;  2F8A A;  2ALB A;  2N5F A;  1T1V A;  1UN2 A;  4MP4 A;  3UBL A;  4XS1 A;  2PMT A;  3ME8 A;  5ECR B;  2FCH A;  4V2N A;  4BPY A;  5AIX A;  1DSB A;  1BX9 A;  2B1L A;  1VGL A;  2B5E A;  5H5S A;  1YDK A;  5HR3 A;  4XRD A;  1GUH A;  2YP6 A;  4ULX A;  3J7Y b;  1ST9 A;  2GTU A;  3IE3 A;  5JWO B;  4MLY A;  2J9H A;  2OJL A;  3CSH A;  2K8S A;  2H6Y A;  3UMA A;  3QPM A;  3LW9 A;  2CVB A;  1MDJ A;  4K0N A;  5GZZ B;  2IWT A;  5CYY A;  2CVK A;  4PGT A;  4YKF A;  5IM9 A;  2OE1 A;  4PX1 A;  2A2P A;  2WCI A;  3EMP A;  1O6J A;  4EIQ A;  3HVV A;  3VUR A;  5ECQ B;  3I6A A;  5DCH A;  4G10 A;  2A2R A;  3TKR A;  4POL A;  4TR4 A;  1TW9 A;  4GST A;  2O89 A;  2I1U A;  4ZB6 A;  2F8F A;  4D73 B;  4DEJ A;  1S3A A;  2G0F A;  1SKR B;  2EIQ A;  2IN3 A;  3F9U A;  1URM A;  3CRU A;  2V41 A;  2VLU A;  3HKR A;  3HVS A;  3C7M A;  5A4U A;  3IXR A;  4TR1 A;  2VL2 C;  2RUF A;  4X43 A;  5HFK A;  4RQR A;  1WIK A;  4WKW A;  2DKH A;  2BTO T;  1MTC A;  18GS A;  2YOI A;  2J23 A;  4YQU A;  4EF0 A;  1FHE A;  3Q74 A;  2KLX A;  1TOF A;  3R2Q A;  4ID0 A;  2LRN A;  1XZO A;  2X99 A;  1VRS D;  2HYX A;  2HZF A;  1I5G A;  2CAI A;  4IHU A;  1K0O A;  3IV4 A;  4V1A p;  5ELA A;  3E9J B;  3APO A;  3GX8 A;  1TK5 B;  5CAX A;  2ON7 A;  3IOS A;  2HE3 A;  4ZL9 A;  1J08 A;  3PH9 A;  2YCD A;  4LLR A;  5DDL A;  2H0G A;  3M9J A;  8GSS A;  2A4V A;  4HEA 2;  4NHZ A;  2OAC A;  5EPF A;  2H6X A;  3TJG A;  1K0B A;  4IP6 A;  3GKX A;  3G7J A;  3ERG A;  1XW5 A;  4I2T A;  1M2B A;  2MMA A;  2FA8 A;  5IOX A;  3TDG A;  4I8B A;  1J0F A;  1V57 A;  4GRF A;  2OE0 A;  5J9C A;  5JWR B;  4CW9 A;  2VD1 A;  5ID2 A;  2EC4 A;  2YV9 A;  1O85 A;  3GL3 A;  1SKW B;  1S3D A;  4HDE A;  2GST A;  1K3L A;  5IMF A;  1OE7 A;  2E0Q A;  3TJK A;  1X9M B;  4XRA A;  3DVW A;  4OMV A;  4GXZ A;  4HZ2 A;  4PTS A;  3MDK A;  3FZ9 A;  5KOX A;  4F82 A;  2UZ8 A;  1M7T A;  3BJ5 A;  4X4J A;  4I2U A;  3RDW A;  3RPN A;  2N5B A;  2C80 A;  3WYW A;  2FUG 2;  1PD2 1;  3GST A;  3HZ4 A;  2PUK C;  1QGV A;  3A2X A;  2DJ2 A;  1IYH A;  2V32 A;  4N30 A;  5D96 A;  1TTZ A;  3VPT A;  4F9Z A;  3LOR A;  2DMM A;  3LQ7 A;  4PUA A;  5A4V A;  4H86 A;  3ZVJ D;  3UVH A;  4PNG A;  3HDC A;  5B6M A;  12GS A;  4TRX A;  4WR4 A;  5G5F A;  1NW2 A;  2GZP A;  4TR3 A;  2PWJ A;  2MBT A;  3ZMK A;  5ENU A;  1GSF A;  4LL4 B;  3MIX A;  3ZML A;  1ERT A;  4ECI A;  1AQX A;  3IA1 A;  5COH A;  2IFQ A;  4MJB A;  1MD4 A;  5D9X A;  1EGO A;  2C8U A;  2LNS A;  3EU4 A;  2JZS A;  2JSY A;  4KND A;  1NSW A;  5ECL B;  1JZD A;  3FYG A;  4J56 E;  4MK3 A;  4TW5 A;  2X8C A;  4Q5N A;  5HR1 A;  3GL5 A;  3GUR A;  3DXB A;  5CRD A;  2LJK A;  4L5O A;  2TRC P;  6GSS A;  4LMW A;  2FY6 A;  3W8S A;  2WFC A;  3F3Q A;  4HJ2 A;  2O8V B;  5DVB A;  2GZY A;  1E2Y A;  1Z9H A;  1AQV A;  4IJ3 A;  1EZK A;  4QQ7 A;  5CRW A;  3KM6 A;  3A5W A;  2GQK A;  3BBY A;  2DIY A;  3KP9 A;  1HD2 A;  1Z7R A;  2HZE A;  2L57 A;  2K6V A;  2GZZ A;  3I9V 2;  3J7Y k;  1Q98 A;  5DJL A;  1PN0 A;  2FWE A;  1YKA A;  2H8L A;  2RUE A;  2B5X A;  2V1M A;  2OKA A;  4HI7 A;  3WGD A;  3BCI A;  1TU8 A;  2OA7 A;  4K2X A;  5IIZ A;  2MMO A;  1DE2 A;  2PGT A;  2TRX A;  2R3X A;  3GN3 A;  3IK9 A;  3TRX A;  1TI3 A;  2L6C A;  5AIS A;  1ZZY A;  2V2G A;  2YAN A;  4WF5 A;  1AC1 A;  4MZW A;  3P8W A;  3LWA A;  4TR0 A;  1V2A A;  3IBH A;  2C3Q A;  2R5G A;  2B6M A;  3IAS 2;  4ZIL A;  4EL1 A;  1LBK A;  2ES7 A;  4G9H A;  5ECS A;  2KP2 A;  1M2A A;  1GRX A;  1JZO A;  4IEL A;  4K9Z A;  1ZYQ B;  1YEX A;  3IC4 A;  4XTS A;  4TVE A;  2YNX A;  1M99 A;  5GST A;  3R3E A;  3U5R E;  2YWN A;  2MMN A;  1BAY A;  5B8A A;  2PVO C;  2H72 A;  3EVI A;  3RHB A;  5IPG A;  1SJZ A;  1H75 A;  2H66 A;  2N5A A;  2H01 A;  5FWG A;  3RPP A;  1GH2 A;  2HRK A;  4WBR D;  2JZT A;  2XC2 A;  4IBP A;  3A2W A;  1K3Y A;  4K1F A;  3HJO A;  5KN0 A;  4JED A;  3ZRE A;  3ZTL A;  3W8J A;  5LNK e;  3MWH A;  2AB6 A;  4AJ6 A;  20GS A;  3UEM A;  2H71 A;  3GSS A;  3NIV A;  2AYT A;  2NBS A;  3HJM A;  4HQZ A;  4J57 E;  4J2F A;  3KZQ A;  1PQN A;  4Q5Q A;  2LST A;  1TJD A;  4HJM A;  3TUE A;  4OCE A;  1O8W A;  3F63 A;  3SBC A;  2X49 A;  1A23 A;  5GAN D;  1UVZ A;  4ZBD A;  2A2S A;  3EIN A;  2MBS A;  4Z7X A;  4OO5 A;  4JR4 A;  2AV4 A;  5CO3 A;  4JBB A;  2B1K A;  4EUY A;  3KMO A;  4Q5R A;  4O5Q A;  3G9B A;  1V98 A;  3GH6 A;  1S3C A;  3D22 A;  3FR3 A;  1XIY A;  2O7K A;  1XFL A;  4MZB A;  5CRH A;  1CQG A;  1PX6 A;  9GSS A;  4ILF A;  4OD7 A;  4QL9 A;  10GS A;  3QCP A;  5G30 A;  3GH9 A;  4AJ8 A;  3C71 A;  1HYU A;  4E8E A;  4F0B A;  4EE0 A;  2L6D A;  4L5L A;  4MDC A;  3HVX A;  5F8B A;  3DEX A;  5C00 A;  3UJ1 A;  4ECJ A;  2F3M A;  4BVX B;  2HRN A;  4O7H A;  4MF6 A;  1YF1 A;  3ED3 A;  4OCF A;  3FZ5 A;  3GMF A;  2L5O A;  1PX7 A;  3ZIV A;  3L78 A;  4MAB A;  4MF7 A;  3G7Y A;  4PQH A;  1A2J A;  3FMW A;  3ZYW A;  1WMJ A;  1VF3 A;  2VL9 A;  4XS6 A;  1MDI A;  2TIR A;  4XCS A;  3ZL5 A;  4RUV A;  3FW2 A;  2C3T A;  2GLR A;  2H73 A;  4IW9 A;  3EPT A;  4KAE A;  2LNT A;  3GKN A;  3TJJ A;  1F3B A;  2DKI A;  2WB9 A;  5AN1 A;  1PKZ A;  3M0F A;  3WT2 A;  1W4V A;  4NMU A;  1YY7 A;  6GSV A;  1SYR A;  1QXH A;  1Y6E A;  1THX A;  4BVX A;  4E8H A;  2HSY A;  2DLX A;  6GSW A;  5IMZ A;  5EY6 A;  2B7K A;  1ACV A;  5ECI B;  2CX3 A;  5JCW A;  2M72 A;  1Z6N A;  2CX4 A;  2MZC A;  2GDR A;  1K0N A;  1TRS A;  4L0U A;  1ABA A;  5C04 A;  2DML A;  1A2L A;  4TR1 B;  4HZ4 A;  4QL7 A;  5IQY A;  4FIW A;  3AY8 A;  3DYR A;  1PKW A;  1O81 A;  5FT3 A;  3CRT A;  2XBI A;  4POK A;  2ZCT A;  4K8M A;  4K0G A;  5B7C A;  1X5E A;  4ZIJ A;  1B9X C;  1LU4 A;  3HYP A;  2V6O A;  1A0R P;  1TI1 A;  2FNO A;  4TXV A;  4IQA A;  4N10 A;  3KXO A;  3VLN A;  2HI7 A;  3LGC A;  1JLW A;  4FYB A;  2D2Z A;  2VLT A;  2Z9S A;  3KJY A;  1FW1 A;  1FVJ A;  4HQS A;  4X1U A;  2H30 A;  4FYU A;  4POB A;  4XIH A;  3S9F A;  3IK7 A;  1PL1 A;  5J3R A;  4XS4 B;  2VCQ A;  5G5E A;  5D9V A;  5ID2 B;  4IVF A;  4NXI A;  3FZ4 A;  4BVY A;  2XBQ A;  4TXO B;  7GSS A;  2H6Z A;  4ECB A;  3C8E A;  2CAQ A;  3QOU A;  1K3O A;  4ZBA A;  4EIP A;  2GGT A;  3APS A;  2OBI A;  3PGT A;  1O8X A;  4MH3 A;  1T4Z A;  1YEP A;  4ZXG A;  2QA2 A;  1PN9 A;  1N8J A;  3TKS C;  4GLT A;  4MNN A;  3CBU A;  3ZFB A;  1XW6 A;  1VF2 A;  3HD5 A;  4JR6 A;  4RI7 A;  1CQH A;  2DC5 A;  1ZYP A;  2XPE A;  1HQO A;  1XVW A;  4G0K A;  2LV3 A;  3Q19 A;  3L9S A;  4KB3 A;  4ISD A;  3GA4 A;  3TB2 A;  4L8E A;  4XS4 A;  5F06 A;  1GUK A;  1G7O A;  2I3Y A;  1SD9 A;  5DBQ A;  2LS5 A;  1I9D A;  1T3B A;  2IJY A;  2LKU A;  5ECK B;  4TXO A;  1QMV A;  5CNW A;  2L4C A;  1SL0 B;  2PU9 C;  2FWG A;  3GIX A;  2VL2 A;  4I6X A;  5J9B A;  4BWS A;  2IFQ B;  4ICY A;  1GSD A;  5DAK B;  1GSU A;  4ZBB A;  4AGS A;  1THO A;  5B8B A;  3KTL A;  1UA5 A;  1EWX A;  1T7P B;  5GSS A;  1IYI A;  5INY A;  1SKS B;  2X8H A;  4IN0 A;  5AGY A;  4EDZ A;  3IAM 2;  4KDX A;  3RBT A;  4LA1 A;  4AF2 A;  2KP1 A;  4MA9 A;  5E59 A;  1AUC A;  1JLV A;  2AUV A;  3D4T A;  2X64 A;  1G6Y A;  5JWQ B;  1ON4 A;  5DQS A;  3V1W A;  2AAW A;  5EL8 A;  5G1K A;  3DD3 A;  3MAK A;  3IPZ A;  2OBK A;  5HFG A;  2KUC A;  2PN8 A;  1KBN A;  5DAK A;  2HZE B;  4HS1 A;  1O73 A;  3C1R A;  4K2D A;  4K7O A;  1TXX A;  4GCI A;  4A5P A;  1YJ6 A;  2H75 A;  4KCA A;  3F8U A;  5D9T A;  5JCU A;  2GVP A;  3PPU A;  4I97 A;  3VWV A;  3FY7 A;  5G2Z A;  2F9S A;  2GQM A;  2JSZ A;  2HFD A;  3ERF A;  1PL2 A;  3LXZ A;  2WJU A;  4O92 A;  4KDU A;  3H93 A;  4DSR A;  3A3T A;  4KGI A;  3D5J A;  1YF0 A;  2PBJ A;  3D21 A;  1N2A A;  5CRE A;  2CT6 A;  3P90 A;  5DJM A;  1Y25 A;  5A5K A;  2BJX A;  3L4N A;  4KSM A;  2P5R A;  2XHF A;  4HOJ A;  2GSR A;  1XOA A;  2ZNM A;  1TRW A;  3GX0 A;  3GNJ A;  4NWY A;  3SWL A;  1MEK A;  3IHQ A;  3KEB A;  4ACS A;  5KN3 A;  19GS A;  3VPQ A;  1TK0 B;  1WOU A;  6GST A;  2VIM A;  4N0V A;  3VK9 A;  2CA8 A;  3QFB C;  3EU3 A;  1EP8 A;  3FRC A;  1GTA A;  2VLV A;  1HNA A;  3RAZ A;  2AHE A;  2L5L A;  4NAX A;  2K9F A;  4USS A;  3LSZ A;  1DE1 A;  2YN1 A;  1A2M A;  5DCG A;  1SK2 A;  2G2Q A;  1ZGN A;  2ON5 A;  3UBK A;  4ZB9 A;  2FHE A;  1XVQ A;  1AQW A;  3F4T A;  2PVQ A;  4KW6 A;  2WZ9 A;  5HR2 A;  3CXG A;  1LJR A;  3LG6 A;  5AIV A;  1R4W A;  3GUS A;  4BL7 A;  1NM3 A;  4G0I A;  4LL1 B;  5LCZ A;  1WWJ A;  1TRV A;  2X4A A;  4EKZ A;  3M9K A;  1U87 A;  3FHK A;  3VFI A;  1PGT A;  3HY2 A;  5G31 A;  4V1A g;  4KF9 A;  5ECH B;  1AAZ A;  1OKT A;  2E2G A;  2F51 A;  4ECC A;  1A8L A;  2LUS A;  3K8N A;  3WGE A;  1U88 A;  4NPB A;  4IP1 A;  4GF0 A;  16GS A;  4MF5 A;  1T4Y A;  5IMC A;  2DJK A;  3MYD A;  1JHB A;  2GS3 A;  1MDK A;  2LQQ A;  3UIW A;  1SU9 A;  4OO4 A;  3BD2 A;  1OAZ A;  3IHG A;  2IIY A;  2E7P A;  4HU7 A;  2VCZ A;  1ERV A;  4JE1 A;  1U3I A;  5D73 A;  1TDI A;  3HJP A;  2YJH A;  4MH2 A;  1FAA A;  1Q4J A;  4OWY A;  1V58 A;  3KMN A;  1X0R A;  1Z6M A;  2YZU A;  4KDY A;  1G0T A;  2PPT A;  5ABR A;  1BG5 A;  1C72 A;  3GKM A;  4CY6 A;  4PQ1 A;  3QAW A;  2L4Q A;  5LD0 A;  1XXU A;  1XPV A;  1SK1 A;  4KCE A;  2B5Y A;  2R4V A;  14GS A;  4BA7 A;  4K7I A;  3WD6 A;  2IMI A;  5DQY A;  2E2M A;  4XHM A;  3LEF A;  1GUL A;  2VM2 A;  4AJ7 A;  2MYG A;  1SJI A;  2QC7 A;  2ZUP A;  1OE8 A;  2B7J A;  1R5P A;  2C0G A;  2M80 A;  2O87 A;  2DSA A;  4ZL8 A;  3P7X A;  1EP7 A;  1GSS A;  4I5Q A;  2NTO A;  4X0X A;  4FYC A;  5ECN B;  1G6W A;  4MZC A;  5IPH A;  1GTU A;  11GS A;  1B4P A;  2DBC A;  2NDO A;  4PXO A;  1SYX A;  3IRA A;  1GUM A;  4F03 A;  2YWI A;  5G1L A;  3ZRD A;  3IR4 A;  4MCU A;  5B6N A;  3F0I A;  2C3N A;  4GQC A;  6GSY A;  4OFN A;  3L9U A;  1XWA A;  4MMM A;  4YAV A;  3GV1 A;  3F6F A;  3WGX A;  1PRX A;  3N5O A;  3FZA A;  3FR9 A;  1QK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...