2DBCA

Solution structure of the thioredoxin-like domain of phosducin-like protein 2(pdcl2)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
135
structure length
135
Chain Sequence
GSSGSSGKFGELREISGNQYVNEVTNAEKDLWVVIHLYRSSVPMCLVVNQHLSVLARKFPETKFVKAIVNSCIEHYHDNCLPTIFVYKNGQIEGKFIGIIECGGINLKLEELEWKLSEVGAIQSDLEENSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unnamed protein product
publication title Solution structure of the Thioredoxin-like domain of Phosducin-like protein 2(PDCL2)
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 19
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2005-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2dbcA00
1YKAA 4XIHA 3M8NA 3N5OA 3ZZXA 4POBA 2CV4A 4WR5A 2JZTA 1TK5B 1J08A 1JZWA 1CQHA 2PPTA 3QAVA 3HZ8A 1IYHA 4ZB9A 3LYKA 3KCMA 2L57A 4G19A 5C00A 3Q6OA 1Y6EA 4OO5A 3J7Yb 2JADA 1QXHA 3EWLA 4ZBAA 3DVXA 1DUGA 4MPGA 1EP7A 1FHEA 3VWVA 3L0HA 3I9V2 2XBQA 4HOJA 3TJKA 1T3BA 5ECKB 3F0IA 3S9FA 4BWQA 2R2JA 3KP8A 4PX1A 3KTLA 2C3QA 3GNJA 5IMVA 4POMA 4KCEA 4EL1A 1EOHA 1OYJA 1PA3A 2P5RA 3HCZA 1BYEA 3UVHA 5D73A 1GSFA 1XFLA 3W8SA 5ECQB 4BL7A 2R6KA 3DD3A 1X9SB 4K1FA 18GSA 3KMOA 2LRCA 3P8WA 4TR4A 3F4RA 3DYRA 2YNXA 5HR2A 5F0GA 2N5AA 4WF4A 1VF4A 4TW5A 5B7CA 3NOFA 3BBYA 1I5GA 2HYXA 2WB9A 1GUKA 4I97A 6GSYA 3CSJA 3WT1A 3CMIA 1Z9HA 5G1LA 3ZITA 2VCQA 3DWVA 1A0FA 3GH9A 5GZZB 2FUG2 3H93A 3IAS2 1HD2A 2H75A 1K0NA 4MK3A 2X8HA 2HXKA 1J0FA 1E6BA 5ECLB 3KH7A 4HU7A 4JR4A 3F63A 2H66A 1X9MB 2WFCA 3CBUA 4IKHA 4OMVA 1GUHA 3ERFA 2O89A 4JU5A 1THOA 3M0FA 3C71A 3KIJA 3DRNA 2J9HA 2QSIA 4ML6A 3GKNA 4OO4A 1N8JA 2AV4A 4KDXA 1V9WA 5J9CA 4YQUA 3UOMA 1OE7A 2X8CA 3QFBC 4WF5A 3GV1A 1PX7A 3OR5A 1FB6A 2CAQA 3LFLA 2C3TA 4WBJA 3ME7A 1B9YC 1MDJA 3TJGA 3LQ7A 4QQ7A 3QAGA 1A0RP 4TXOB 5EVOA 1Z6NA 2OBIA 4O7HA 3N9JA 1ST9A 2H1DA 5CYYA 3IA1A 5IPGA 2IMEA 4EDZA 13GSA 2JL4A 3DVWA 4TKYA 1ZZYA 4X0XA 2GGTA 5ECRB 3TCOA 5KN1A 4OFTA 1HNAA 4POLA 1FAAA 1T7PB 2GSRA 1WWJA 10GSA 1QK8A 4EKZA 3FY7A 3TKRA 1SENA 4DSRA 1TRVA 2R5GA 3ERGA 2DJ1A 4K8MA 5JCUA 5CO3A 4ECCA 5G5FA 4L5OA 1GTAA 1Z7PA 3GA4A 3FZ9A 2CVBA 1O81A 4HZ4A 2YJHA 3ZYWA 4HJ2A 2VCZA 2PUKC 5G1KA 6GSWA 2LQQA 3FKFA 4EF0A 5EPFA 3HY2A 6GSUA 4AGSA 1XW6A 3KTBA 3P90A 5CRHA 2KP1A 3KZQA 1PX6A 1AUCA 2CX3A 2FWEA 4Z7XA 1F6MC 2GSQA 2FHEA 2CA8A 14GSA 3CTFA 3BJ5A 3CSIA 4F9ZA 4HDEA 3QCPA 1Z3EA 2GZZA 2M46A 2OE0A 3GN3A 2P5QA 2HRFA 4TN8A 1ERWA 1GTBA 3HJOA 3I69A 1ZYQB 1YEXA 2YWMA 4PXOA 1TP9A 1URMA 1LJRA 4OWYA 2X64A 4XCSA 3VWWA 1V40A 2BJXA 1BG5A 1GSUA 3F6FA 3KEBA 5IMCA 1OKDA 3TOTA 5D96A 5GAND 3TRPA 1EWXA 3WT2A 2F8AA 3IBHA 1M0UA 4MF7A 1XBSA 4WR4A 2C0GA 2I81A 5LCZA 3P7XA 1NHYA 5AIVA 4FYUA 3HVVA 2B5YA 2M80A 3TGZA 2CAIA 2H74A 3DMLA 1PL2A 3TDGA 1N2AA 1MTCA 2DJ0A 1NM3A 3UJ1A 4IJIA 2B6MA 3M3MA 3FYGA 4K0GA 1KTEA 4RQRA 1O73A 1M99A 4NHWA 2FA8A 2DJJA 2C0FA 1TI3A 3FHKA 1SK0A 4I5QA 2H0IA 1V58A 4I8BA 4MLYA 1FOVA 1X5CA 2HI7A 5KN2A 4IGJA 1X5EA 1W4VA 2LNSA 2YV7A 2GSSA 4ECIA 2L6DA 2C1YA 2DMMA 1Z5YE 1ACVA 1F2EA 3GTUB 5DDLA 5IMZA 2ON7A 2GQLA 3VPQA 5J5NA 2R37A 1SJZA 4TXOA 1Q98A 4XRAA 2RUFA 4PQHA 4MH3A 4XS4B 2OJLA 4LL1B 4MABA 2IMKA 5E59A 4TVEA 1HQOA 4ZB6A 3UVTA 2MYGA 2GQMA 4IHUA 2WCIA 4P3YB 4OCFA 4FYBA 4GSNA 5A4VA 1NW2A 1JZRA 1ILOA 1S3CA 2DLXA 4DVCA 5IOWA 1WMJA 3GYKA 3RAZA 1AW9A 4GWRA 4O92A 5KEJA 1FB0A 4K9ZA 3DXBA 5H5SA 3MNGA 4POKA 2B1KA 1ZGNA 4NHZA 3TUEA 1A2MA 3TJFA 5DALB 4LLRA 2V41A 1K0AA 2VLTA 4G9HA 20GSA 3D22A 2VAFA 3EU3A 3DKSA 1XOBA 2EIRA 3GKXA 6GSVA 5J3RA 2I3YA 5JCWA 2FWHA 3LEFA 3ZRDA 2AB6A 4J56E 1OC9B 1JLWA 4HEA2 1TTZA 2V32A 2GQKA 2RM5A 3GURA 3IE3A 3LG6A 4GCIA 1SJIA 4EXJA 1PSQA 1F3BA 1ML6A 5B8BA 2E0QA 4OFNA 2HSYA 1XOAA 1M9BA 1XIYA 2G2QA 3IPZA 2YJ7A 3F8UA 4V1Ap 1TRSA 1AQWA 4Q5RA 3CRTA 2FD3A 1YDKA 3W8JA 3AY8A 3MDKA 5B8AA 5G31A 3PH9A 4TR1B 4LA1A 3TKSA 3GHAA 5ECMB 3HDCA 2H01A 3WGXA 1WRYA 2ALBA 3FZAA 2O8VB 5ECSA 2LJKA 2B3SA 1TOFA 2TIRA 4MCUA 2OE1A 3GSTA 1WIKA 3VURA 3FZ5A 1ON4A 2IFQB 5IMDA 1WE0A 1UC7A 1WOUA 1SK1A 2H6ZA 3U5RE 5A5KA 5FWGA 1M9AA 1A8YA 2K8VA 4HQSA 4I2TA 3TB2A 3SBCA 3IRAA 2YANA 2HT9A 1G7EA 2A2RA 2YPMA 3UL3A 3IR4A 6GSSA 1DE2A 3ED3A 4MJEA 5HR0A 3CTGA 5G2ZA 4O32A 2H30A 2IMFA 4N0VA 4GQFA 1XWGA 2LRTA 1B8XA 1SYXA 1GLPA 3TRXA 4F03A 2VIMA 4ZILA 1O6JA 1SL1B 2OADA 3D21A 4ZBDA 5G30A 1VF2A 3QOUA 5J41A 4ZBBA 1AIUA 4HS1A 1GWCA 2RM6A 3LXZA 1EV9A 1GNEA 2YWNA 4MMMA 3A2WA 4V2LA 2LQOA 3GTUA 5ID2B 3PINA 3K8NA 4IS0A 1F9MA 2L5LA 3EINA 3ZVJD 3QR6A 4AJ6A 3HYPA 3EMXA 2R3XA 3A2VA 3UMAA 4AF2A 1MD4A 3C1RA 4XS4A 1SYRA 2FNOA 4L8EA 1M2BA 1I9DA 4PURA 4PNFA 1ZOFA 2GVPA 4YAVA 4MZWA 4NPBA 2H76A 1K3OA 1T00A 4FYCA 2ES7A 3BCKA 3C73A 2F51A 4BPYA 3FW2A 1SKRB 3IV4A 3GIXA 5DVBA 2LEGA 3L9SA 4K7NA 4JEDA 3PGTA 4ZB8A 3GMFA 3TOUA 5HR3A 5F8BA 2F9SA 2CX4A 5GAPD 4FIWA 1YY7A 4Q5FA 3QFAC 4ML1A 3QPMA 1XWAA 1BQ7A 3O76A 2LV3A 3FK8A 2ON5A 1Z6MA 3UIWA 4JBBA 4TOPA 4KNDA 1SJ6A 6GSTA 5HFGA 3FRCA 2X99A 1DE1A 4KX4A 4K7IA 5D8IA 2CZ3A 1GULA 1GSSA 2VL2C 4IELA 1GH2A 2H0GA 5AIXA 1BAYA 3MSZA 1FO5A 2DC5A 3C1SA 1SK2A 3F4TA 4KSOA 5F05A 1XVQA 1DBYA 4MA9A 2LNTA 1OC9A 1CQGA 4E8HA 1ZMAA 2V6OA 4E8EA 12GSA 1U3IA 5J4UA 4MZCA 5G5EA 3KMNA 1QGVA 2VL2A 1OC3A 4LMWA 1UA5A 4J57E 1VF3A 3P2AA 3TRQA 5DJMA 2ZUPA 4NWYA 1GUMA 1V2AA 6GSXA 5ABRA 3GUSA 1XWKA 3BOAA 3WGDA 2B5EA 1K0BA 2LRNA 2NDOA 2BTOT 2I9HA 2K18A 1W89A 3A5WA 2KOKA 5J9BA 1TK0B 4G2EA 2FY6A 1K0OA 4GRFA 3F6DA 2RUEA 1TRUA 1YEPA 2VO4A 3KH9A 1B4PA 3TKQA 3H8QA 1C72A 2LUSA 7GSSA 1QQ2A 4LL4B 4F2IA 4JZQA 3LSZA 1YF1A 3ZIVA 2IFQA 3TJBA 3VLNA 2B7KA 3TJJA 2EC4A 1PN9A 2DJ2A 1O7UA 2FWGA 2GZPA 5A4UA 2YOIA 3ERWA 3IC4A 1TRWA 1EOGA 2JSYA 5DCGA 2DMLA 3U6VA 1VRSD 4MJAA 1HNBA 1XCCA 2MMOA 5IIZA 3IK7A 1WPIA 4OCEA 5D9WA 4XTSA 3VWUA 4RUVA 1GSQA 2A2SA 2HLSA 2IMIA 1NSWA 5GSSA 2H0HA 2ZNMA 4JE1A 1KEBA 3ZMKA 3ZMLA 3FR9A 5D9TA 4KH7A 3HZ4A 2A4VA 1RK4A 3CXGA 4IP6A 3ZVJA 2WGRA 4OD7A 3LXTA 8GSSA 2RLIA 2O85A 3HJMA 4GXZA 2HRNA 5F06A 2MBTA 2HZFA 3D6IA 3HJPA 3H79A 2I1UA 3US3A 1U87A 3F3QA 5HQPA 1TU8A 3D4MA 5ID2A 1BEDA 3LWAA 1AXDA 1TJDA 2L4CA 1UVZA 4J2FA 2FLSA 4WKWA 5D9XA 1X9WB 2C0EA 3F9UA 5DQYA 1ERUA 2NVLA 2YZUA 2HNLA 2B7JA 3GH6A 2WRTA 2C3NA 3KM6A 1OC8A 5HR1A 2GT6A 3GL3A 3GX0A 4NXIA 17GSA 5EL8A 1XPVA 3CRUA 2LJAA 1OKTA 2QC7A 2BMXA 3L9VA 2JZSA 1A24A 2QKEA 3D5JA 3RPNA 4MZBA 5HFKA 2DIZA 2PU9C 4CDOA 4ZL9A 4IP1A 2KLXA 2REMA 3FZ4A 4HUAA 1SD9A 11GSA 2L5OA 2H71A 1OVNA 4HZ2A 1USBA 2LS5A 1KBNA 5IO0A 4YQVA 2H6YA 3A3TA 5DCHA 1LU4A 3VPTA 3VI7A 3H1NA 1XXUA 3WYWA 2AUVA 3C8EA 3F3RA 2V6KA 4IQAA 5IO2A 2GTUA 5IOXA 3DGQA 3E0UA 4G10A 2GDRA 2C80A 2JSZA 1A23A 4RI6A 4XHMA 1FVJA 4IVFA 2MMNA 4ULXA 2NPBA 1PGTA 3JCML 4IQ1A 2H19A 1TK8B 1PL1A 2RIIA 2JZRA 1K3LA 5H5QA 4N11A 3NZNA 1BX9A 3LYPA 3HVSA 1JFUA 3WD6A 2CZ2A 4LMVA 1Q4JA 4AJ7A 1MDIA 2HZEB 1AQVA 2VLVA 2F3MA 4EVMA 1GL8A 3APSA 4L0WA 1V98A 2H70A 3GSSA 2XBIA 2PVQA 3MWHA 3HA9A 1E2YA 4MP4A 1O8XA 3KJYA 3QDNA 4NMUA 1EGOA 5A4WA 3QAWA 2DBCA 1O8WA 1B48A 2E7PA 5D9VA 3TKSC 4NV5A 1R7HA 3UBKA 4TR0A 1PKWA 3HHVA 3UARA 3KGKA 3NIVA 3GX8A 2IWTA 3IHQA 2L6CA 2DSAA 4TRXA 1G6YA 2N5BA 3RHCA 3KD0A 4YH2A 3EVIA 4Q5NA 2B1LA 4NV2A 3EE2A 4X43A 1FG4A 1H75A 2JU5A 1VF1A 2H1BA 1GTIA 4TXVA 3CYNA 3ZFLA 1YQ1A 1GSDA 1HYUA 1XW9A 3PR8A 1BJXA 1A8LA 2V1MA 2N5FA 1EV4A 2VD0A 4ZL7A 3L4NA 3RHBA 4JRRA 3EU4A 2WULA 3IXRA 2C0DA 5AGYA 1ZCPA 2CQ9A 2MZCA 2O87A 1PQNA 1YZXA 5ECHB 4I6XA 2I4AA 4V1Ag 4MJCA 4XS1A 2HSHA 2GZYA 3LORA 4GF0A 4O5RA 2MBSA 4N0ZA 1H4OA 1TKDB 3CSHA 2VCTA 1GNWA 2O7KA 4L0UA 1JLVA 1QFNA 3WGEA 1A2LA 2GLRA 2ZCTA 1JZOA 3GL5A 2PMTA 4CW9A 4NAXA 1M2AA 1U88A 1TDIA 16GSA 1RW1A 1R5PA 2FWFA 3RPPA 5DAKB 4KA0A 2YWOA 1IYIA 1T8EB 4XS6A 4BVXA 2GS3A 5CNWA 5DJLA 3SWLA 3ISOA 1FW1A 5CRGA 2VUPA 1T1VA 1SD8A 2E2MA 4F0CA 4F0BA 4N10A 3GFKA 2WJUA 1V57A 2VCVA 1EP8A 1S3DA 2TRXA 4OFMA 5ENUA 3VI5A 1U3AA 5B6NA 2JACA 3M9KA 1G6WA 3G7YA 3Q18A 4ECBA 4IBPA 2K8SA 1U6TA 3RDWA 1G0TA 3FR3A 2KUCA 4KAEA 5CRWA 4QL9A 4K0NA 5H5RA 5JWQB 1R5AA 3VWXA 4F82A 4KCAA 4H86A 5AISA 5CAXA 2H1AA 4MF5A 5IQYA 4I2UA 1A2JA 2OKAA 2IMDA 5CP1A 3D0ZA 3VK9A 1K0MA 1EEJA 2VOCA 3IK9A 1XVWA 1T4YA 2YN1A 2AYTA 2C8UA 5DALA 2CT6A 4BVYA 1KNGA 3QMXA 4D73B 4IN0A 4WBRD 2X8GA 2HZEA 2FCHA 2AJQB 3Q19A 3HKRA 3M1GA 5LNKe 3APQA 3TKSE 4DEJA 4BWSA 1FVKA 3O3TA 4WETA 3G9BA 5B6MA 1WJKA 2LSTA 5AN1A 2FA4A 1G7OA 2VL9A 3KXOA 2C4JA 1SKSB 2VD1A 1M7TA 4HI7A 1EGRA 5IMAA 1PD21 1GP1A 4YAPA 4DSQA 3EC3A 1SKWB 2LKUA 4GQCA 1ERVA 4Q5QA 3ZL5A 2EIQA 5F07A 4JR6A 2TRCP 3ZLPA 4PGTA 1X0RA 1YKCA 4MJBA 1ZL9A 1B4QA 3QD9A 1YJ6A 5E4WA 4HQZA 4TR1A 2H72A 1MDKA 5ECPB 1LBKA 1AC1A 2WDUA 1WP0A 3GKKA 4DSSB 5FT3A 4RQXA 3DEXA 1SU9A 4X1UA 1QUWA 2AHEA 1TW9A 3BD2A 4V2NA 1QMVA 2PGTA 4K2DA 2XPDA 3KP9A 1M2DA 1XW5A 1EEMA 2J23A 3V1WA 1GTUA 1T4ZA 4L5LA 5IMFA 4AJ8A 4K6XA 1J9BA 3IAM2 2PERA 3R2QA 3LJRA 1HNCA 1GRXA 3Q74A 3IOSA 4IW9A 1OE8A 3APOA 3RBTA 4ZIJA 4RI7A 4ZXGA 4KE3A 2B5XA 3H4KA 1GSEA 4MF6A 5ECIB 5ELGA 4N30A 2DIYA 2EIOA 2H73A 1XWBA 1GSYA 1K0CA 3J7Yk 1YF0A 5C04A 1UN2A 1MD3A 2H8LA 1PRXA 3GKMA 5ECOB 5DAKA 4HJMA 4BA7A 4YQMA 3ME8A 5L71A 4PUAA 3BCIA 2VCWA 4MH2A 4MDCA 2DJKA 4EUYA 2XC2A 2PWJA 1SL0B 5INYA 2YWIA 2P0GA 2CVDA 1R26A 4ID0A 3EMPA 2VL3A 3G7JA 5ECNB 2YCDA 5JCGA 2GSTA 4GSTA 1ZYEA 3ZTLA 4GLTA 4KB3A 2VLUA 3F4SA 4XRDA 4EDYA 4PQ1A 3ZREA 1K0DA 5DQSA 3UBLA 1EZKA 3A2XA 2WZ9A 4PNGA 3ZFBA 2VM2A 4TR3A 3VFIA 2G0FA 2MMZA 4MPFA 2OBKA 2DJ3A 2YZHA 4ISDA 1AAZA 2IJYA 2OA7A 3HD5A 4EC0A 3M9JA 1PMTA 2LTKA 2E2GA 4ILFA 1Y25A 3FEUA 3GRXA 3EURA 4PUFC 2MMAA 4PQIA 2OE3A 3FR6A 3L78A 3C7MA 2KP2A 2AAWA 2D2ZA 3W6GA 2PN8A 1K3YA 9GSSA 1DSBA 1NHOA 5DBQA 2XPEA 4ECJA 4D73A 1XZOA 4CHSA 5KN0A 1PKZA 1R4WA 3MAKA 1TU7A 2IPAA 2GT5A 2QGVA 4V2MA 1MEKA 3HVXA 1JZDA 3I6AA 2H1GA 2Z9SA 1TI1A 3IDVA 2K6VA 4GTUA 3ZIJA 1TXXA 4ZL8A 1GLQA 2HE3A 5KN3A 2WS2A 2K9FA 22GSA 1ABAA 5HFIA 1VGLA 1O85A 5CREA 2L4QA 2L59A 2VM1A 4ACSA 5CRDA 1THXA 5EY6A 3UAPA 4FH8A 4KUNA 2LJRA 3O6TA 2V2GA 5IM9A 5JWOB 5JWRB 3EYTA 2PVOC 4KW6A 2IN3A 2IL3A 2YP6A 1RQMA 1Z7RA 4FO5A 4KDYA 2YV9A 4DSSA 2NTOA 1ERTA 4GSSA 4WEYA 3E9JB 2IIYA 2VCXA 5FHIA 1S3AA 1JHBA 5LD0A 2PBJA 2XHFA 3LGCA 4WXTA 1F3AA 2KHPA 3E3EA 2FGXA 2P31A 3HXSA 1XWCA 4QL7A 1X5DA 5COHA 4HU9A 3D4TA 2OACA 1F37A 4KGIA 3DIEA 2H6XA 2R4VA 1AQXA 4EO3A 3L9UA 2HFDA 4KDUA 5D93A 2M72A 1SL2B 5ELAA 4K7OA 3G7IA 5GSTA 2CVKA 2NBSA 4IJ3A 3UEMA 2F8FA 4KSMA 5IPHA 3I43A 3TKPA 1B9XC 19GSA 4EE0A 1OAZA
chains in the Genus database with same CATH superfamily
1YKAA 4XIHA 3M8NA 3N5OA 2HRAA 3ZZXA 4POBA 2CV4A 4WR5A 2JZTA 1TK5B 1J08A 1JZWA 1CQHA 2PPTA 3QAVA 3HZ8A 1IYHA 4ZB9A 2HRKA 3LYKA 2X4AA 3KCMA 2L57A 4G19A 5C00A 3Q6OA 1Y6EA 4OO5A 3J7Yb 2JADA 1QXHA 4YKFA 3EWLA 4ZBAA 3DVXA 1DUGA 4MPGA 1EP7A 1FHEA 3VWVA 3L0HA 3I9V2 2XBQA 4HOJA 3TJKA 1T3BA 5ECKB 3F0IA 3S9FA 4BWQA 2R2JA 3KP8A 4PX1A 3KTLA 2C3QA 3GNJA 5IMVA 4POMA 4KCEA 4EL1A 1EOHA 1OYJA 1PA3A 2P5RA 3HCZA 1BYEA 3UVHA 5D73A 1GSFA 1XFLA 3W8SA 5ECQB 4BL7A 2R6KA 3DD3A 1X9SB 4K1FA 1PFOA 18GSA 3KMOA 2LRCA 3P8WA 4TR4A 3F4RA 3DYRA 2YNXA 5HR2A 5F0GA 2N5AA 4WF4A 1VF4A 4TW5A 5B7CA 3NOFA 3BBYA 1I5GA 2HYXA 2WB9A 1GUKA 4I97A 6GSYA 3CSJA 3WT1A 3CMIA 1Z9HA 5G1LA 3ZITA 2VCQA 3DWVA 1A0FA 3GH9A 5GZZB 2FUG2 3H93A 3IAS2 1HD2A 2H75A 1K0NA 4MK3A 2X8HA 2HXKA 4A5PA 1J0FA 1E6BA 5ECLB 3KH7A 4HU7A 4JR4A 3F63A 2H66A 1X9MB 2WFCA 3CBUA 4IKHA 4OMVA 1GUHA 3ERFA 2O89A 4JU5A 1THOA 3M0FA 3C71A 3KIJA 3DRNA 2J9HA 2QSIA 4ML6A 3GKNA 4OO4A 1N8JA 2AV4A 4KDXA 1V9WA 5J9CA 4YQUA 3UOMA 1OE7A 2X8CA 3QFBC 4WF5A 3GV1A 1PX7A 3OR5A 4CY8A 1FB6A 2CAQA 3LFLA 2C3TA 4WBJA 3ME7A 1B9YC 1MDJA 3TJGA 3LQ7A 4QQ7A 3QAGA 1A0RP 4TXOB 5EVOA 1Z6NA 2R0GA 2OBIA 4O7HA 3N9JA 1ST9A 2H1DA 5CYYA 3IA1A 5IPGA 2IMEA 4EDZA 13GSA 2JL4A 3DVWA 4TKYA 1ZZYA 4X0XA 2GGTA 5ECRB 3TCOA 5KN1A 4OFTA 1HNAA 4POLA 1FAAA 1T7PB 2GSRA 1WWJA 10GSA 1QK8A 4EKZA 3FY7A 3TKRA 1SENA 4DSRA 1TRVA 2R5GA 3ERGA 2DJ1A 4K8MA 5JCUA 5CO3A 4ECCA 5G5FA 4L5OA 1GTAA 1Z7PA 3GA4A 3FZ9A 2CVBA 3FMWA 1O81A 4HZ4A 2YJHA 3ZYWA 4HJ2A 2VCZA 2PUKC 5G1KA 6GSWA 2LQQA 3FKFA 4EF0A 5EPFA 3HY2A 6GSUA 1FOHA 4AGSA 1XW6A 3KTBA 3P90A 5CRHA 2KP1A 3KZQA 1PX6A 1AUCA 2DKHA 2CX3A 2FWEA 4Z7XA 1F6MC 2GSQA 2FHEA 2CA8A 14GSA 3CTFA 3BJ5A 3CSIA 4F9ZA 4HDEA 3QCPA 1Z3EA 2GZZA 2M46A 2OE0A 3GN3A 2P5QA 2HRFA 4TN8A 1ERWA 1GTBA 3HJOA 1S3RA 3I69A 1ZYQB 1YEXA 2YWMA 4PXOA 1TP9A 1URMA 1LJRA 4OWYA 2X64A 4XCSA 3VWWA 4KF9A 2A4HA 1V40A 2BJXA 1BG5A 1GSUA 3F6FA 3KEBA 5IMCA 1OKDA 3TOTA 5D96A 5GAND 3TRPA 1EWXA 3WT2A 2F8AA 3IBHA 1M0UA 4MF7A 1XBSA 4WR4A 2C0GA 2I81A 5LCZA 3P7XA 1NHYA 1M3IA 5AIVA 4FYUA 3HVVA 2B5YA 2M80A 3TGZA 2CAIA 4CY6A 2H74A 3DMLA 1PL2A 3TDGA 1N2AA 1MTCA 2DJ0A 1NM3A 3UJ1A 4IJIA 2B6MA 3M3MA 3FYGA 4K0GA 1KTEA 4RQRA 1O73A 1M99A 4NHWA 2FA8A 2DJJA 2C0FA 4Z2TA 1TI3A 3FHKA 1SK0A 4I5QA 2H0IA 1V58A 4I8BA 4MLYA 1FOVA 1X5CA 2HI7A 5KN2A 4IGJA 1X5EA 1W4VA 2LNSA 2YV7A 3R3EA 2GSSA 4ECIA 2L6DA 2C1YA 2DMMA 1Z5YE 1ACVA 1F2EA 3GTUB 2A2PA 5DDLA 4USSA 5IMZA 2ON7A 2GQLA 3VPQA 5J5NA 2R37A 1SJZA 4TXOA 1Q98A 4XRAA 2RUFA 3PPUA 4MH3A 4PQHA 4XS4B 2OJLA 4LL1B 4MABA 2IMKA 5E59A 4TVEA 1HQOA 4ZB6A 3UVTA 4G0KA 2MYGA 2GQMA 4IHUA 2WCIA 4P3YB 4OCFA 4FYBA 4GSNA 5A4VA 1NW2A 1JZRA 1ILOA 1S3CA 2DLXA 4DVCA 5IOWA 1WMJA 3GYKA 3RAZA 1AW9A 4GWRA 4O92A 5KEJA 1FB0A 4K9ZA 3DXBA 5H5SA 3MNGA 4POKA 2B1KA 1ZGNA 4NHZA 3TUEA 1A2MA 3TJFA 5DALB 4LLRA 2V41A 1K0AA 2VLTA 4G9HA 20GSA 3D22A 2VAFA 3EU3A 3DKSA 1XOBA 1ZYPA 2EIRA 3GKXA 6GSVA 5J3RA 2I3YA 5KOWA 5JCWA 2FWHA 3LEFA 3ZRDA 2AB6A 4ICYA 4J56E 1OC9B 1JLWA 4HEA2 1TTZA 2V32A 2GQKA 2RM5A 3GURA 3IE3A 3LG6A 4GCIA 1SJIA 4EXJA 1PSQA 1F3BA 1ML6A 2R0CA 5B8BA 2E0QA 4OFNA 4K2XA 2HSYA 1XOAA 4FQUA 1M9BA 1XIYA 2G2QA 3IPZA 2YJ7A 3F8UA 4V1Ap 1TRSA 1AQWA 4Q5RA 3CRTA 2FD3A 1YDKA 3W8JA 3AY8A 3MDKA 5BRTA 5B8AA 5G31A 3PH9A 4TR1B 4LA1A 3TKSA 3GHAA 5ECMB 3HDCA 2H01A 3WGXA 1WRYA 4EIPA 2ALBA 3FZAA 2O8VB 5ECSA 2LJKA 2B3SA 1TOFA 2TIRA 4MCUA 2OE1A 3GSTA 1WIKA 3VURA 3FZ5A 1ON4A 2IFQB 5IMDA 2R0PA 1WE0A 1UC7A 1WOUA 1SK1A 2H6ZA 3U5RE 5A5KA 5FWGA 1M9AA 1A8YA 2K8VA 4HQSA 4I2TA 3TB2A 3SBCA 3IRAA 2YANA 2HT9A 1G7EA 2A2RA 2YPMA 3UL3A 3IR4A 6GSSA 1DE2A 3ED3A 4O5QA 4MJEA 5HR0A 3CTGA 5G2ZA 4O32A 2H30A 2IMFA 4N0VA 4GQFA 1XWGA 2LRTA 1B8XA 1SYXA 1GLPA 3TRXA 4F03A 2VIMA 4ZILA 1O6JA 1SL1B 2OADA 3D21A 4ZBDA 5G30A 1VF2A 3QOUA 5J41A 2UZ8A 4ZBBA 1AIUA 4HS1A 1GWCA 2RM6A 3LXZA 1EV9A 1GNEA 2YWNA 4MMMA 3A2WA 4V2LA 2LQOA 3GTUA 5ID2B 3PINA 3K8NA 4IS0A 1F9MA 2L5LA 3EINA 3ZVJD 3QR6A 4AJ6A 3HYPA 3EMXA 2R3XA 3A2VA 3UMAA 4AF2A 1MD4A 3C1RA 4XS4A 1SYRA 2FNOA 4L8EA 1M2BA 4PURA 1I9DA 4PNFA 1ZOFA 2GVPA 4YAVA 4MZWA 4NPBA 2H76A 1K3OA 1T00A 4FYCA 2ES7A 3BCKA 3C73A 2F51A 4BPYA 3FW2A 1SKRB 3IV4A 3GIXA 5DVBA 2LEGA 3L9SA 4K7NA 4JEDA 3PGTA 4ZB8A 3GMFA 3TOUA 5HR3A 5F8BA 2F9SA 2CX4A 5GAPD 4FIWA 1YY7A 4Q5FA 3QFAC 4ML1A 3QPMA 1XWAA 1BQ7A 3O76A 2LV3A 5KOXA 3FK8A 2ON5A 1Z6MA 3UIWA 4JBBA 4TOPA 4KNDA 1SJ6A 6GSTA 5HFGA 3FRCA 2X99A 1DE1A 4KX4A 4K7IA 2CZ3A 5D8IA 1GULA 5BMUA 1GSSA 2VL2C 4IELA 1GH2A 2H0GA 5AIXA 1BAYA 3MSZA 1FO5A 2DC5A 3C1SA 1SK2A 3F4TA 4KSOA 5F05A 1XVQA 1DBYA 4MA9A 2LNTA 1OC9A 1CQGA 4E8HA 1ZMAA 2V6OA 4E8EA 12GSA 1U3IA 5J4UA 4MZCA 5G5EA 3KMNA 1QGVA 2VL2A 1OC3A 4LMWA 1UA5A 4J57E 1VF3A 3P2AA 3TRQA 5DJMA 2ZUPA 4NWYA 1GUMA 1V2AA 6GSXA 5ABRA 3GUSA 1XWKA 3BOAA 3WGDA 2B5EA 1K0BA 2LRNA 2NDOA 2BTOT 2I9HA 2K18A 1W89A 3A5WA 2KOKA 5J9BA 1TK0B 4G2EA 2FY6A 1K0OA 4GRFA 3F6DA 2RUEA 1TRUA 1YEPA 2VO4A 3KH9A 1B4PA 3TKQA 3H8QA 1C72A 2LUSA 7GSSA 1QQ2A 4LL4B 4F2IA 4JZQA 3LSZA 3MIXA 1YF1A 3ZIVA 2IFQA 3TJBA 3VLNA 2B7KA 3TJJA 2EC4A 1PN9A 2DJ2A 1O7UA 2FWGA 2GZPA 5A4UA 2YOIA 3ERWA 3IC4A 1TRWA 1EOGA 2JSYA 5DCGA 2DMLA 3U6VA 1VRSD 4MJAA 1HNBA 1XCCA 2MMOA 5IIZA 3IK7A 1WPIA 4OCEA 5D9WA 3A5IA 4XTSA 3VWUA 4RUVA 1GSQA 2A2SA 2HLSA 2IMIA 1NSWA 5GSSA 2H0HA 2ZNMA 4JE1A 1KEBA 3ZMKA 3ZMLA 3FR9A 5D9TA 4KH7A 3HZ4A 2A4VA 1RK4A 3CXGA 4IP6A 3ZVJA 2WGRA 4OD7A 3LXTA 8GSSA 2RLIA 2O85A 3HJMA 4GXZA 2HRNA 5F06A 2MBTA 2HZFA 3D6IA 3HJPA 3H79A 2I1UA 3US3A 1U87A 3F3QA 5HQPA 1TU8A 3D4MA 5ID2A 1BEDA 3LWAA 1AXDA 1TJDA 2L4CA 1UVZA 4J2FA 2FLSA 4WKWA 5D9XA 1X9WB 2C0EA 3F9UA 5DQYA 1ERUA 2NVLA 2YZUA 2HNLA 2B7JA 3GH6A 2WRTA 2C3NA 3KM6A 1OC8A 5HR1A 2GT6A 3GL3A 3GX0A 4NXIA 17GSA 5EL8A 1XPVA 3CRUA 2LJAA 1OKTA 2QC7A 2BMXA 3L9VA 2JZSA 4BVXB 1A24A 3MYDA 2QKEA 3D5JA 3RPNA 4MZBA 5HFKA 3IC8A 2DKIA 2DIZA 2PU9C 4CDOA 4ZL9A 4IP1A 2KLXA 2REMA 3FZ4A 4HUAA 1SD9A 11GSA 2L5OA 2H71A 1OVNA 4HZ2A 1USBA 2LS5A 1KBNA 5IO0A 4YQVA 2H6YA 3A3TA 5DCHA 1LU4A 3VPTA 3VI7A 3H1NA 1XXUA 3WYWA 2AUVA 3C8EA 3F3RA 2V6KA 4IQAA 5IO2A 2GTUA 5IOXA 3DGQA 3E0UA 4G10A 2GDRA 2C80A 2JSZA 1A23A 4RI6A 4XHMA 1FVJA 4IVFA 2MMNA 4ULXA 2NPBA 1PGTA 3JCML 4IQ1A 2H19A 1TK8B 1PL1A 2RIIA 2JZRA 4Z2UA 1K3LA 5H5QA 4N11A 3NZNA 1BX9A 3LYPA 3HVSA 1JFUA 3WD6A 2CZ2A 4BVYB 4LMVA 1Q4JA 4AJ7A 1MDIA 2HZEB 1AQVA 2VLVA 2F3MA 4EVMA 1GL8A 3APSA 4L0WA 1V98A 2H70A 3GSSA 2XBIA 2PVQA 3MWHA 3HA9A 1E2YA 4MP4A 1O8XA 3KJYA 3QDNA 4NMUA 1EGOA 5A4WA 3QAWA 2HSMA 2DBCA 1O8WA 1ZYNA 1B48A 2E7PA 5D9VA 3TKSC 4NV5A 1R7HA 3UBKA 4TR0A 1PKWA 3HHVA 3UARA 3KGKA 3NIVA 3GX8A 2IWTA 3IHQA 2L6CA 2DSAA 4TRXA 1G6YA 2N5BA 3RHCA 3KD0A 4YH2A 3EVIA 4Q5NA 2B1LA 1XG8A 4NV2A 3EE2A 4X43A 1FG4A 1H75A 2JU5A 1VF1A 2H1BA 1GTIA 4TXVA 3CYNA 3ZFLA 1YQ1A 1GSDA 1HYUA 1XW9A 3PR8A 1BJXA 1A8LA 2V1MA 2N5FA 1EV4A 2VD0A 4ZL7A 3L4NA 3RHBA 4JRRA 3EU4A 2WULA 3IXRA 4YKGA 2C0DA 5AGYA 1ZCPA 2CQ9A 2MZCA 2O87A 1PQNA 1YZXA 5ECHB 4I6XA 2I4AA 4V1Ag 4MJCA 4XS1A 2HSHA 2GZYA 3LORA 4GF0A 4O5RA 2MBSA 4N0ZA 1H4OA 1TKDB 3CSHA 2VCTA 1GNWA 4G0LA 2O7KA 4L0UA 1JLVA 1QFNA 3WGEA 1A2LA 2GLRA 2ZCTA 1JZOA 3GL5A 2PMTA 4CW9A 4NAXA 1M2AA 1U88A 1TDIA 16GSA 1RW1A 4X4JA 1R5PA 2FWFA 3RPPA 5DAKB 4KA0A 2YWOA 1IYIA 1T8EB 4XS6A 4BVXA 2GS3A 5CNWA 5DJLA 3SWLA 3ISOA 1FW1A 4K5RA 5CRGA 2VUPA 1T1VA 1SD8A 2E2MA 4F0CA 4F0BA 4N10A 3GFKA 2WJUA 1V57A 2VCVA 1EP8A 1S3DA 2TRXA 4OFMA 5ENUA 3VI5A 1U3AA 5B6NA 2JACA 3M9KA 1G6WA 3G7YA 3Q18A 4ECBA 4IBPA 2K8SA 1U6TA 3RDWA 4Z2RA 1G0TA 3FR3A 2KUCA 4KAEA 5CRWA 4QL9A 4K0NA 4EIQA 4PTSA 5H5RA 2QA1A 5JWQB 1R5AA 3VWXA 4F82A 4HSCX 4KCAA 4H86A 5AISA 5CAXA 2H1AA 4MF5A 5IQYA 4I2UA 1A2JA 2OKAA 2IMDA 5CP1A 3D0ZA 3VK9A 1K0MA 1EEJA 2VOCA 3IK9A 1XVWA 1T4YA 2YN1A 2AYTA 2C8UA 5DALA 2CT6A 4BVYA 1KNGA 3QMXA 4D73B 4IN0A 4WBRD 2X8GA 2HZEA 2FCHA 2AJQB 3Q19A 3HKRA 3M1GA 5LNKe 3APQA 3TKSE 4DEJA 4BWSA 1FVKA 3O3TA 4WETA 3G9BA 5B6MA 1WJKA 2LSTA 5AN1A 3EPTA 2FA4A 1G7OA 2VL9A 3KXOA 2C4JA 1SKSB 2VD1A 1M7TA 4HI7A 1EGRA 5IMAA 1PD21 1GP1A 2QA2A 4YAPA 4DSQA 3EC3A 1SKWB 2LKUA 4GQCA 1ERVA 4Q5QA 3ZL5A 2EIQA 5F07A 4JR6A 2TRCP 3ZLPA 4PGTA 1X0RA 3HVNA 1YKCA 4MJBA 1ZL9A 1B4QA 3QD9A 1YJ6A 5E4WA 4HQZA 4TR1A 2H72A 1MDKA 5ECPB 2X49A 1LBKA 1AC1A 3IHGA 2WDUA 1WP0A 3GKKA 4DSSB 5FT3A 4RQXA 3DEXA 1SU9A 4X1UA 1QUWA 2AHEA 1TW9A 3BD2A 4V2NA 1QMVA 2PGTA 4K2DA 2XPDA 3KP9A 1M2DA 1XW5A 1EEMA 2J23A 3V1WA 1GTUA 1T4ZA 4L5LA 5IMFA 4O5UA 4AJ8A 4K6XA 1J9BA 3IAM2 2PERA 3R2QA 3LJRA 1HNCA 1GRXA 3Q74A 3IOSA 4IW9A 1OE8A 3APOA 3RBTA 4ZIJA 4RI7A 4ZXGA 4KE3A 2B5XA 3H4KA 1GSEA 4MF6A 5ECIB 5ELGA 4N30A 2DIYA 2EIOA 2H73A 1XWBA 1GSYA 1K0CA 4MNNA 3J7Yk 1YF0A 5C04A 1UN2A 1MD3A 2H8LA 1PRXA 3GKMA 5ECOB 5DAKA 4HJMA 4BA7A 4YQMA 3ME8A 5L71A 4PUAA 3BCIA 2VCWA 4MH2A 4MDCA 2DJKA 4EUYA 2XC2A 2PWJA 1SL0B 5INYA 2YWIA 2P0GA 2CVDA 1R26A 4ID0A 3EMPA 2VL3A 3G7JA 5ECNB 2YCDA 5JCGA 2GSTA 4GSTA 1ZYEA 3ZTLA 4GLTA 4KB3A 2VLUA 3F4SA 4XRDA 4EDYA 4PQ1A 3ZREA 1K0DA 5DQSA 3UBLA 1EZKA 3A2XA 2WZ9A 4PNGA 3ZFBA 2VM2A 3LW9A 4TR3A 3VFIA 2G0FA 2MMZA 4MPFA 2OBKA 2DJ3A 4K5SA 2YZHA 4ISDA 1AAZA 2IJYA 2OA7A 3HD5A 4EC0A 3M9JA 1PMTA 2LTKA 2E2GA 4ILFA 1Y25A 3FEUA 3GRXA 3EURA 4PUFC 2MMAA 4PQIA 2OE3A 3FR6A 3L78A 3C7MA 2KP2A 2AAWA 2D2ZA 4BL7B 3W6GA 2PN8A 1K3YA 9GSSA 1DSBA 1NHOA 5DBQA 1M3JA 2XPEA 4ECJA 4D73A 1XZOA 4CHSA 5KN0A 1PKZA 1R4WA 3MAKA 1TU7A 2IPAA 2GT5A 2QGVA 4V2MA 1MEKA 3HVXA 1JZDA 3I6AA 2H1GA 2Z9SA 3CQFA 1TI1A 4BIKA 3IDVA 2K6VA 4GTUA 3ZIJA 1TXXA 4ZL8A 1GLQA 2HE3A 5KN3A 4G0IA 2WS2A 2K9FA 22GSA 1ABAA 5HFIA 1VGLA 1O85A 5CREA 2L4QA 2L59A 2VM1A 4ACSA 5CRDA 1THXA 5EY6A 3UAPA 4FH8A 4KUNA 2LJRA 3O6TA 2V2GA 5IM9A 5JWOB 5JWRB 3EYTA 2PVOC 4KW6A 2IN3A 2IL3A 2YP6A 1RQMA 1Z7RA 4FO5A 4KDYA 2YV9A 4DSSA 2NTOA 1ERTA 4GSSA 4WEYA 3E9JB 2IIYA 2VCXA 5FHIA 1S3AA 1JHBA 5LD0A 2PBJA 2XHFA 3LGCA 4WXTA 1F3AA 2KHPA 3E3EA 2FGXA 2P31A 3HXSA 1XWCA 4QL7A 1X5DA 5COHA 4HU9A 3D4TA 2OACA 1F37A 4KGIA 3DIEA 2H6XA 2R4VA 1AQXA 4EO3A 3L9UA 2HFDA 4KDUA 5D93A 2M72A 1SL2B 5ELAA 4K7OA 3G7IA 5GSTA 2CVKA 2NBSA 1PN0A 4IJ3A 3UEMA 2F8FA 4KSMA 5IPHA 3I43A 3TKPA 1B9XC 19GSA 4EE0A 1OAZA
chains in the Genus database with same CATH topology
1YKAA 4XIHA 3M8NA 3N5OA 2HRAA 3ZZXA 4POBA 2CV4A 4WR5A 2JZTA 1TK5B 1J08A 1JZWA 1CQHA 2PPTA 3QAVA 3HZ8A 1IYHA 4ZB9A 2HRKA 3LYKA 2X4AA 3KCMA 2L57A 4G19A 5C00A 3Q6OA 1Y6EA 4OO5A 3J7Yb 2JADA 1QXHA 4YKFA 3EWLA 4ZBAA 3DVXA 1DUGA 4MPGA 1EP7A 1FHEA 3VWVA 3L0HA 3I9V2 2XBQA 4HOJA 3TJKA 1T3BA 5ECKB 3F0IA 3S9FA 4BWQA 2R2JA 3KP8A 4PX1A 3KTLA 2C3QA 3GNJA 5IMVA 4POMA 4KCEA 4EL1A 1EOHA 1OYJA 1PA3A 2P5RA 3HCZA 1BYEA 3UVHA 5D73A 1GSFA 1XFLA 3W8SA 5ECQB 4BL7A 2R6KA 3DD3A 1X9SB 4K1FA 18GSA 3KMOA 2LRCA 3P8WA 4TR4A 3F4RA 3DYRA 2YNXA 5HR2A 5F0GA 2N5AA 4WF4A 1VF4A 4TW5A 5B7CA 3NOFA 3BBYA 1I5GA 2HYXA 2WB9A 1GUKA 4I97A 6GSYA 3CSJA 3WT1A 3CMIA 1Z9HA 5G1LA 3ZITA 2VCQA 3DWVA 1A0FA 3GH9A 5GZZB 2FUG2 3H93A 3IAS2 1HD2A 2H75A 1K0NA 4MK3A 2X8HA 2HXKA 4A5PA 1J0FA 1E6BA 5ECLB 3KH7A 4HU7A 4JR4A 3F63A 2H66A 1X9MB 2WFCA 3CBUA 4IKHA 4OMVA 1GUHA 3ERFA 2O89A 4JU5A 1THOA 3M0FA 3C71A 3KIJA 3DRNA 2J9HA 2QSIA 4ML6A 3GKNA 4OO4A 1N8JA 2AV4A 4KDXA 1V9WA 5J9CA 4YQUA 3UOMA 1OE7A 2X8CA 3QFBC 4WF5A 3GV1A 1PX7A 3OR5A 4CY8A 1FB6A 2CAQA 3LFLA 2C3TA 4WBJA 3ME7A 1B9YC 1MDJA 3TJGA 3LQ7A 4QQ7A 3QAGA 1A0RP 4TXOB 5EVOA 1Z6NA 2R0GA 2OBIA 4O7HA 3N9JA 1ST9A 2H1DA 5CYYA 3IA1A 5IPGA 2IMEA 4EDZA 13GSA 2JL4A 3DVWA 4TKYA 1ZZYA 4X0XA 2GGTA 5ECRB 3TCOA 5KN1A 4OFTA 1HNAA 4POLA 1FAAA 1T7PB 2GSRA 1WWJA 10GSA 1QK8A 4EKZA 3FY7A 3TKRA 1SENA 4DSRA 1TRVA 2R5GA 3ERGA 2DJ1A 4K8MA 5JCUA 5CO3A 4ECCA 5G5FA 4L5OA 1GTAA 1Z7PA 3GA4A 3FZ9A 2CVBA 3FMWA 1O81A 4HZ4A 2YJHA 3ZYWA 4HJ2A 2VCZA 2PUKC 5G1KA 6GSWA 2LQQA 3FKFA 4EF0A 5EPFA 3HY2A 6GSUA 1FOHA 4AGSA 1XW6A 3KTBA 3P90A 5CRHA 2KP1A 3KZQA 1PX6A 1AUCA 2DKHA 2CX3A 2FWEA 4Z7XA 1F6MC 2GSQA 2FHEA 2CA8A 14GSA 3CTFA 3BJ5A 3CSIA 4F9ZA 4HDEA 3QCPA 1Z3EA 2GZZA 2M46A 2OE0A 3GN3A 2P5QA 2HRFA 4TN8A 1ERWA 1GTBA 3HJOA 3I69A 1ZYQB 1YEXA 2YWMA 4PXOA 1TP9A 1URMA 1LJRA 4OWYA 2X64A 4XCSA 3VWWA 4KF9A 2A4HA 1V40A 2BJXA 1BG5A 1GSUA 3F6FA 3KEBA 5IMCA 1OKDA 3TOTA 5D96A 5GAND 3TRPA 1EWXA 3WT2A 2F8AA 3IBHA 1M0UA 4MF7A 1XBSA 4WR4A 2C0GA 2I81A 5LCZA 3P7XA 1NHYA 5AIVA 4FYUA 3HVVA 2B5YA 2M80A 3TGZA 2CAIA 4CY6A 2H74A 3DMLA 1PL2A 3TDGA 1N2AA 1MTCA 2DJ0A 1NM3A 3UJ1A 4IJIA 2B6MA 3M3MA 3FYGA 4K0GA 1KTEA 4RQRA 1O73A 1M99A 4NHWA 2FA8A 2DJJA 2C0FA 4Z2TA 1TI3A 3FHKA 1SK0A 4I5QA 2H0IA 1V58A 4I8BA 4MLYA 1FOVA 1X5CA 2HI7A 5KN2A 4IGJA 1X5EA 1W4VA 2LNSA 2YV7A 3R3EA 2GSSA 4ECIA 2L6DA 2C1YA 2DMMA 1Z5YE 1ACVA 1F2EA 3GTUB 2A2PA 5DDLA 4USSA 5IMZA 2ON7A 2GQLA 3VPQA 5J5NA 2R37A 1SJZA 4TXOA 1Q98A 4XRAA 2RUFA 3PPUA 4MH3A 4PQHA 4XS4B 2OJLA 4LL1B 4MABA 2IMKA 5E59A 4TVEA 1HQOA 4ZB6A 3UVTA 4G0KA 2MYGA 2GQMA 4IHUA 2WCIA 4P3YB 4OCFA 4FYBA 4GSNA 5A4VA 1NW2A 1JZRA 1ILOA 1S3CA 2DLXA 4DVCA 5IOWA 1WMJA 3GYKA 3RAZA 1AW9A 4GWRA 4O92A 5KEJA 1FB0A 4K9ZA 3DXBA 5H5SA 3MNGA 4POKA 2B1KA 1ZGNA 4NHZA 3TUEA 1A2MA 3TJFA 5DALB 4LLRA 2V41A 1K0AA 2VLTA 4G9HA 20GSA 3D22A 2VAFA 3EU3A 3DKSA 1XOBA 1ZYPA 2EIRA 3GKXA 6GSVA 5J3RA 2I3YA 5KOWA 5JCWA 2FWHA 3LEFA 3ZRDA 2AB6A 4ICYA 4J56E 1OC9B 1JLWA 4HEA2 1TTZA 2V32A 2GQKA 2RM5A 3GURA 3IE3A 3LG6A 4GCIA 1SJIA 4EXJA 1PSQA 1F3BA 1ML6A 2R0CA 5B8BA 2E0QA 4OFNA 4K2XA 2HSYA 1XOAA 4FQUA 1M9BA 1XIYA 2G2QA 3IPZA 2YJ7A 3F8UA 4V1Ap 1TRSA 1AQWA 4Q5RA 3CRTA 2FD3A 1YDKA 3W8JA 3AY8A 3MDKA 5BRTA 5B8AA 5G31A 3PH9A 4TR1B 4LA1A 3TKSA 3GHAA 5ECMB 3HDCA 2H01A 3WGXA 1WRYA 4EIPA 2ALBA 3FZAA 2O8VB 5ECSA 2LJKA 2B3SA 1TOFA 2TIRA 4MCUA 2OE1A 3GSTA 1WIKA 3VURA 3FZ5A 1ON4A 2IFQB 5IMDA 2R0PA 1WE0A 1UC7A 1WOUA 1SK1A 2H6ZA 3U5RE 5A5KA 5FWGA 1M9AA 1A8YA 2K8VA 4HQSA 4I2TA 3TB2A 3SBCA 3IRAA 2YANA 2HT9A 1G7EA 2A2RA 2YPMA 3UL3A 3IR4A 6GSSA 1DE2A 3ED3A 4O5QA 4MJEA 5HR0A 3CTGA 5G2ZA 4O32A 2H30A 2IMFA 4N0VA 4GQFA 1XWGA 2LRTA 1B8XA 1SYXA 1GLPA 3TRXA 4F03A 2VIMA 4ZILA 1O6JA 1SL1B 2OADA 3D21A 4ZBDA 5G30A 1VF2A 3QOUA 5J41A 2UZ8A 4ZBBA 1AIUA 4HS1A 1GWCA 2RM6A 3LXZA 1EV9A 1GNEA 2YWNA 4MMMA 3A2WA 4V2LA 2LQOA 3GTUA 5ID2B 3PINA 3K8NA 4IS0A 1F9MA 2L5LA 3EINA 3ZVJD 3QR6A 4AJ6A 3HYPA 3EMXA 2R3XA 3A2VA 3UMAA 4AF2A 1MD4A 3C1RA 4XS4A 1SYRA 2FNOA 4L8EA 1M2BA 4PURA 1I9DA 4PNFA 1ZOFA 2GVPA 4YAVA 4MZWA 4NPBA 2H76A 1K3OA 1T00A 4FYCA 2ES7A 3BCKA 3C73A 2F51A 4BPYA 3FW2A 1SKRB 3IV4A 3GIXA 5DVBA 2LEGA 3L9SA 4K7NA 4JEDA 3PGTA 4ZB8A 3GMFA 3TOUA 5HR3A 5F8BA 2F9SA 2CX4A 5GAPD 4FIWA 1YY7A 4Q5FA 3QFAC 4ML1A 3QPMA 1XWAA 1BQ7A 3O76A 2LV3A 5KOXA 3FK8A 2ON5A 1Z6MA 3UIWA 4JBBA 4TOPA 4KNDA 1SJ6A 6GSTA 5HFGA 3FRCA 2X99A 1DE1A 4KX4A 4K7IA 2CZ3A 5D8IA 1GULA 5BMUA 1GSSA 2VL2C 4IELA 1GH2A 2H0GA 5AIXA 1BAYA 3MSZA 1FO5A 2DC5A 3C1SA 1SK2A 3F4TA 4KSOA 5F05A 1XVQA 1DBYA 4MA9A 2LNTA 1OC9A 1CQGA 4E8HA 1ZMAA 2V6OA 4E8EA 12GSA 1U3IA 5J4UA 4MZCA 5G5EA 3KMNA 1QGVA 2VL2A 1OC3A 4LMWA 1UA5A 4J57E 1VF3A 3P2AA 3TRQA 5DJMA 2ZUPA 4NWYA 1GUMA 1V2AA 6GSXA 5ABRA 3GUSA 1XWKA 3BOAA 3WGDA 2B5EA 1K0BA 2LRNA 2NDOA 2BTOT 2I9HA 2K18A 1W89A 3A5WA 2KOKA 5J9BA 1TK0B 4G2EA 2FY6A 1K0OA 4GRFA 3F6DA 2RUEA 1TRUA 1YEPA 2VO4A 3KH9A 1B4PA 3TKQA 3H8QA 1C72A 2LUSA 7GSSA 1QQ2A 4LL4B 4F2IA 4JZQA 3LSZA 3MIXA 1YF1A 3ZIVA 2IFQA 3TJBA 3VLNA 2B7KA 3TJJA 2EC4A 1PN9A 2DJ2A 1O7UA 2FWGA 2GZPA 5A4UA 2YOIA 3ERWA 3IC4A 1TRWA 1EOGA 2JSYA 5DCGA 2DMLA 3U6VA 1VRSD 4MJAA 1HNBA 1XCCA 2MMOA 5IIZA 3IK7A 1WPIA 4OCEA 5D9WA 3A5IA 4XTSA 3VWUA 4RUVA 1GSQA 2A2SA 2HLSA 2IMIA 1NSWA 5GSSA 2H0HA 2ZNMA 4JE1A 1KEBA 3ZMKA 3ZMLA 3FR9A 5D9TA 4KH7A 3HZ4A 2A4VA 1RK4A 3CXGA 4IP6A 3ZVJA 2WGRA 4OD7A 3LXTA 8GSSA 2RLIA 2O85A 3HJMA 4GXZA 2HRNA 5F06A 2MBTA 2HZFA 3D6IA 3HJPA 3H79A 2I1UA 3US3A 1U87A 3F3QA 5HQPA 1TU8A 3D4MA 5ID2A 1BEDA 3LWAA 1AXDA 1TJDA 2L4CA 1UVZA 4J2FA 2FLSA 4WKWA 5D9XA 1X9WB 2C0EA 3F9UA 5DQYA 1ERUA 2NVLA 2YZUA 2HNLA 2B7JA 3GH6A 2WRTA 2C3NA 3KM6A 1OC8A 5HR1A 2GT6A 3GL3A 3GX0A 4NXIA 17GSA 5EL8A 1XPVA 3CRUA 2LJAA 1OKTA 2QC7A 2BMXA 3L9VA 2JZSA 4BVXB 1A24A 3MYDA 2QKEA 3D5JA 3RPNA 4MZBA 5HFKA 3IC8A 2DKIA 2DIZA 2PU9C 4CDOA 4ZL9A 4IP1A 2KLXA 2REMA 3FZ4A 4HUAA 1SD9A 11GSA 2L5OA 2H71A 1OVNA 4HZ2A 1USBA 2LS5A 1KBNA 5IO0A 4YQVA 2H6YA 3A3TA 5DCHA 1LU4A 3VPTA 3VI7A 3H1NA 1XXUA 3WYWA 2AUVA 3C8EA 3F3RA 2V6KA 4IQAA 5IO2A 2GTUA 5IOXA 3DGQA 3E0UA 4G10A 2GDRA 2C80A 2JSZA 1A23A 4RI6A 4XHMA 1FVJA 4IVFA 2MMNA 4ULXA 2NPBA 1PGTA 3JCML 4IQ1A 2H19A 1TK8B 1PL1A 2RIIA 2JZRA 4Z2UA 1K3LA 5H5QA 4N11A 3NZNA 1BX9A 3LYPA 3HVSA 1JFUA 3WD6A 2CZ2A 4BVYB 4LMVA 1Q4JA 4AJ7A 1MDIA 2HZEB 1AQVA 2VLVA 2F3MA 4EVMA 1GL8A 3APSA 4L0WA 1V98A 2H70A 3GSSA 2XBIA 2PVQA 3MWHA 3HA9A 1E2YA 4MP4A 1O8XA 3KJYA 3QDNA 4NMUA 1EGOA 5A4WA 3QAWA 2HSMA 2DBCA 1O8WA 1ZYNA 1B48A 2E7PA 5D9VA 3TKSC 4NV5A 1R7HA 3UBKA 4TR0A 1PKWA 3HHVA 3UARA 3KGKA 3NIVA 3GX8A 2IWTA 3IHQA 2L6CA 2DSAA 4TRXA 1G6YA 2N5BA 3RHCA 3KD0A 4YH2A 3EVIA 4Q5NA 2B1LA 4NV2A 3EE2A 4X43A 1FG4A 1H75A 2JU5A 1VF1A 2H1BA 1GTIA 4TXVA 3CYNA 3ZFLA 1YQ1A 1GSDA 1HYUA 1XW9A 3PR8A 1BJXA 1A8LA 2V1MA 2N5FA 1EV4A 2VD0A 4ZL7A 3L4NA 3RHBA 4JRRA 3EU4A 2WULA 3IXRA 4YKGA 2C0DA 5AGYA 1ZCPA 2CQ9A 2MZCA 2O87A 1PQNA 1YZXA 5ECHB 4I6XA 2I4AA 4V1Ag 4MJCA 4XS1A 2HSHA 2GZYA 3LORA 4GF0A 4O5RA 2MBSA 4N0ZA 1H4OA 1TKDB 3CSHA 2VCTA 1GNWA 4G0LA 2O7KA 4L0UA 1JLVA 1QFNA 3WGEA 1A2LA 2GLRA 2ZCTA 1JZOA 3GL5A 2PMTA 4CW9A 4NAXA 1M2AA 1U88A 1TDIA 16GSA 1RW1A 4X4JA 1R5PA 2FWFA 3RPPA 5DAKB 4KA0A 2YWOA 1IYIA 1T8EB 4XS6A 4BVXA 2GS3A 5CNWA 5DJLA 3SWLA 3ISOA 1FW1A 4K5RA 5CRGA 2VUPA 1T1VA 1SD8A 2E2MA 4F0CA 4F0BA 4N10A 3GFKA 2WJUA 1V57A 2VCVA 1EP8A 1S3DA 2TRXA 4OFMA 5ENUA 3VI5A 1U3AA 5B6NA 2JACA 3M9KA 1G6WA 3G7YA 3Q18A 4ECBA 4IBPA 2K8SA 1U6TA 3RDWA 4Z2RA 1G0TA 3FR3A 2KUCA 4KAEA 5CRWA 4QL9A 4K0NA 4EIQA 4PTSA 5H5RA 2QA1A 5JWQB 1R5AA 3VWXA 4F82A 4KCAA 4H86A 5AISA 5CAXA 2H1AA 4MF5A 5IQYA 4I2UA 1A2JA 2OKAA 2IMDA 5CP1A 3D0ZA 3VK9A 1K0MA 1EEJA 2VOCA 3IK9A 1XVWA 1T4YA 2YN1A 2AYTA 2C8UA 5DALA 2CT6A 4BVYA 1KNGA 3QMXA 4D73B 4IN0A 4WBRD 2X8GA 2HZEA 2FCHA 2AJQB 3Q19A 3HKRA 3M1GA 5LNKe 3APQA 3TKSE 4DEJA 4BWSA 1FVKA 3O3TA 4WETA 3G9BA 5B6MA 1WJKA 2LSTA 5AN1A 3EPTA 2FA4A 1G7OA 2VL9A 3KXOA 2C4JA 1SKSB 2VD1A 1M7TA 4HI7A 1EGRA 5IMAA 1PD21 1GP1A 2QA2A 4YAPA 4DSQA 3EC3A 1SKWB 2LKUA 4GQCA 1ERVA 4Q5QA 3ZL5A 2EIQA 5F07A 4JR6A 2TRCP 3ZLPA 4PGTA 1X0RA 1YKCA 4MJBA 1ZL9A 1B4QA 3QD9A 1YJ6A 5E4WA 4HQZA 4TR1A 2H72A 1MDKA 5ECPB 2X49A 1LBKA 1AC1A 3IHGA 2WDUA 1WP0A 3GKKA 4DSSB 5FT3A 4RQXA 3DEXA 1SU9A 4X1UA 1QUWA 2AHEA 1TW9A 3BD2A 4V2NA 1QMVA 2PGTA 4K2DA 2XPDA 3KP9A 1M2DA 1XW5A 1EEMA 2J23A 3V1WA 1GTUA 1T4ZA 4L5LA 5IMFA 4O5UA 4AJ8A 4K6XA 1J9BA 3IAM2 2PERA 3R2QA 3LJRA 1HNCA 1GRXA 3Q74A 3IOSA 4IW9A 1OE8A 3APOA 3RBTA 4ZIJA 4RI7A 4ZXGA 4KE3A 2B5XA 3H4KA 1GSEA 4MF6A 5ECIB 5ELGA 4N30A 2DIYA 2EIOA 2H73A 1XWBA 1GSYA 1K0CA 4MNNA 3J7Yk 1YF0A 5C04A 1UN2A 1MD3A 2H8LA 1PRXA 3GKMA 5ECOB 5DAKA 4HJMA 4BA7A 4YQMA 3ME8A 5L71A 4PUAA 3BCIA 2VCWA 4MH2A 4MDCA 2DJKA 4EUYA 2XC2A 2PWJA 1SL0B 5INYA 2YWIA 2P0GA 2CVDA 1R26A 4ID0A 3EMPA 2VL3A 3G7JA 5ECNB 2YCDA 5JCGA 2GSTA 4GSTA 1ZYEA 3ZTLA 4GLTA 4KB3A 2VLUA 3F4SA 4XRDA 4EDYA 4PQ1A 3ZREA 1K0DA 5DQSA 3UBLA 1EZKA 3A2XA 2WZ9A 4PNGA 3ZFBA 2VM2A 3LW9A 4TR3A 3VFIA 2G0FA 2MMZA 4MPFA 2OBKA 2DJ3A 4K5SA 2YZHA 4ISDA 1AAZA 2IJYA 2OA7A 3HD5A 4EC0A 3M9JA 1PMTA 2LTKA 2E2GA 4ILFA 1Y25A 3FEUA 3GRXA 3EURA 4PUFC 2MMAA 4PQIA 2OE3A 3FR6A 3L78A 3C7MA 2KP2A 2AAWA 2D2ZA 4BL7B 3W6GA 2PN8A 1K3YA 9GSSA 1DSBA 1NHOA 5DBQA 2XPEA 4ECJA 4D73A 1XZOA 4CHSA 5KN0A 1PKZA 1R4WA 3MAKA 1TU7A 2IPAA 2GT5A 2QGVA 4V2MA 1MEKA 3HVXA 1JZDA 3I6AA 2H1GA 2Z9SA 1TI1A 3IDVA 2K6VA 4GTUA 3ZIJA 1TXXA 4ZL8A 1GLQA 2HE3A 5KN3A 4G0IA 2WS2A 2K9FA 22GSA 1ABAA 5HFIA 1VGLA 1O85A 5CREA 2L4QA 2L59A 2VM1A 4ACSA 5CRDA 1THXA 5EY6A 3UAPA 4FH8A 4KUNA 2LJRA 3O6TA 2V2GA 5IM9A 5JWOB 5JWRB 3EYTA 2PVOC 4KW6A 2IN3A 2IL3A 2YP6A 1RQMA 1Z7RA 4FO5A 4KDYA 2YV9A 4DSSA 2NTOA 1ERTA 4GSSA 4WEYA 3E9JB 2IIYA 2VCXA 5FHIA 1S3AA 1JHBA 5LD0A 2PBJA 2XHFA 3LGCA 4WXTA 1F3AA 2KHPA 3E3EA 2FGXA 2P31A 3HXSA 1XWCA 4QL7A 1X5DA 5COHA 4HU9A 3D4TA 2OACA 1F37A 4KGIA 3DIEA 2H6XA 2R4VA 1AQXA 4EO3A 3L9UA 2HFDA 4KDUA 5D93A 2M72A 1SL2B 5ELAA 4K7OA 3G7IA 5GSTA 2CVKA 2NBSA 1PN0A 4IJ3A 3UEMA 2F8FA 4KSMA 5IPHA 3I43A 3TKPA 1B9XC 19GSA 4EE0A 1OAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YKA A;  4XIH A;  3M8N A;  3N5O A;  3ZZX A;  4POB A;  2CV4 A;  4WR5 A;  2JZT A;  1TK5 B;  1J08 A;  1JZW A;  1CQH A;  2PPT A;  3QAV A;  3HZ8 A;  1IYH A;  4ZB9 A;  3LYK A;  3KCM A;  2L57 A;  4G19 A;  5C00 A;  3Q6O A;  1Y6E A;  4OO5 A;  3J7Y b;  2JAD A;  1QXH A;  3EWL A;  4ZBA A;  3DVX A;  1DUG A;  4MPG A;  1EP7 A;  1FHE A;  3VWV A;  3L0H A;  3I9V 2;  2XBQ A;  4HOJ A;  3TJK A;  1T3B A;  5ECK B;  3F0I A;  3S9F A;  4BWQ A;  2R2J A;  3KP8 A;  4PX1 A;  3KTL A;  2C3Q A;  3GNJ A;  5IMV A;  4POM A;  4KCE A;  4EL1 A;  1EOH A;  1OYJ A;  1PA3 A;  2P5R A;  3HCZ A;  1BYE A;  3UVH A;  5D73 A;  1GSF A;  1XFL A;  3W8S A;  5ECQ B;  4BL7 A;  2R6K A;  3DD3 A;  1X9S B;  4K1F A;  18GS A;  3KMO A;  2LRC A;  3P8W A;  4TR4 A;  3F4R A;  3DYR A;  2YNX A;  5HR2 A;  5F0G A;  2N5A A;  4WF4 A;  1VF4 A;  4TW5 A;  5B7C A;  3NOF A;  3BBY A;  1I5G A;  2HYX A;  2WB9 A;  1GUK A;  4I97 A;  6GSY A;  3CSJ A;  3WT1 A;  3CMI A;  1Z9H A;  5G1L A;  3ZIT A;  2VCQ A;  3DWV A;  1A0F A;  3GH9 A;  5GZZ B;  2FUG 2;  3H93 A;  3IAS 2;  1HD2 A;  2H75 A;  1K0N A;  4MK3 A;  2X8H A;  2HXK A;  1J0F A;  1E6B A;  5ECL B;  3KH7 A;  4HU7 A;  4JR4 A;  3F63 A;  2H66 A;  1X9M B;  2WFC A;  3CBU A;  4IKH A;  4OMV A;  1GUH A;  3ERF A;  2O89 A;  4JU5 A;  1THO A;  3M0F A;  3C71 A;  3KIJ A;  3DRN A;  2J9H A;  2QSI A;  4ML6 A;  3GKN A;  4OO4 A;  1N8J A;  2AV4 A;  4KDX A;  1V9W A;  5J9C A;  4YQU A;  3UOM A;  1OE7 A;  2X8C A;  3QFB C;  4WF5 A;  3GV1 A;  1PX7 A;  3OR5 A;  1FB6 A;  2CAQ A;  3LFL A;  2C3T A;  4WBJ A;  3ME7 A;  1B9Y C;  1MDJ A;  3TJG A;  3LQ7 A;  4QQ7 A;  3QAG A;  1A0R P;  4TXO B;  5EVO A;  1Z6N A;  2OBI A;  4O7H A;  3N9J A;  1ST9 A;  2H1D A;  5CYY A;  3IA1 A;  5IPG A;  2IME A;  4EDZ A;  13GS A;  2JL4 A;  3DVW A;  4TKY A;  1ZZY A;  4X0X A;  2GGT A;  5ECR B;  3TCO A;  5KN1 A;  4OFT A;  1HNA A;  4POL A;  1FAA A;  1T7P B;  2GSR A;  1WWJ A;  10GS A;  1QK8 A;  4EKZ A;  3FY7 A;  3TKR A;  1SEN A;  4DSR A;  1TRV A;  2R5G A;  3ERG A;  2DJ1 A;  4K8M A;  5JCU A;  5CO3 A;  4ECC A;  5G5F A;  4L5O A;  1GTA A;  1Z7P A;  3GA4 A;  3FZ9 A;  2CVB A;  1O81 A;  4HZ4 A;  2YJH A;  3ZYW A;  4HJ2 A;  2VCZ A;  2PUK C;  5G1K A;  6GSW A;  2LQQ A;  3FKF A;  4EF0 A;  5EPF A;  3HY2 A;  6GSU A;  4AGS A;  1XW6 A;  3KTB A;  3P90 A;  5CRH A;  2KP1 A;  3KZQ A;  1PX6 A;  1AUC A;  2CX3 A;  2FWE A;  4Z7X A;  1F6M C;  2GSQ A;  2FHE A;  2CA8 A;  14GS A;  3CTF A;  3BJ5 A;  3CSI A;  4F9Z A;  4HDE A;  3QCP A;  1Z3E A;  2GZZ A;  2M46 A;  2OE0 A;  3GN3 A;  2P5Q A;  2HRF A;  4TN8 A;  1ERW A;  1GTB A;  3HJO A;  3I69 A;  1ZYQ B;  1YEX A;  2YWM A;  4PXO A;  1TP9 A;  1URM A;  1LJR A;  4OWY A;  2X64 A;  4XCS A;  3VWW A;  1V40 A;  2BJX A;  1BG5 A;  1GSU A;  3F6F A;  3KEB A;  5IMC A;  1OKD A;  3TOT A;  5D96 A;  5GAN D;  3TRP A;  1EWX A;  3WT2 A;  2F8A A;  3IBH A;  1M0U A;  4MF7 A;  1XBS A;  4WR4 A;  2C0G A;  2I81 A;  5LCZ A;  3P7X A;  1NHY A;  5AIV A;  4FYU A;  3HVV A;  2B5Y A;  2M80 A;  3TGZ A;  2CAI A;  2H74 A;  3DML A;  1PL2 A;  3TDG A;  1N2A A;  1MTC A;  2DJ0 A;  1NM3 A;  3UJ1 A;  4IJI A;  2B6M A;  3M3M A;  3FYG A;  4K0G A;  1KTE A;  4RQR A;  1O73 A;  1M99 A;  4NHW A;  2FA8 A;  2DJJ A;  2C0F A;  1TI3 A;  3FHK A;  1SK0 A;  4I5Q A;  2H0I A;  1V58 A;  4I8B A;  4MLY A;  1FOV A;  1X5C A;  2HI7 A;  5KN2 A;  4IGJ A;  1X5E A;  1W4V A;  2LNS A;  2YV7 A;  2GSS A;  4ECI A;  2L6D A;  2C1Y A;  2DMM A;  1Z5Y E;  1ACV A;  1F2E A;  3GTU B;  5DDL A;  5IMZ A;  2ON7 A;  2GQL A;  3VPQ A;  5J5N A;  2R37 A;  1SJZ A;  4TXO A;  1Q98 A;  4XRA A;  2RUF A;  4PQH A;  4MH3 A;  4XS4 B;  2OJL A;  4LL1 B;  4MAB A;  2IMK A;  5E59 A;  4TVE A;  1HQO A;  4ZB6 A;  3UVT A;  2MYG A;  2GQM A;  4IHU A;  2WCI A;  4P3Y B;  4OCF A;  4FYB A;  4GSN A;  5A4V A;  1NW2 A;  1JZR A;  1ILO A;  1S3C A;  2DLX A;  4DVC A;  5IOW A;  1WMJ A;  3GYK A;  3RAZ A;  1AW9 A;  4GWR A;  4O92 A;  5KEJ A;  1FB0 A;  4K9Z A;  3DXB A;  5H5S A;  3MNG A;  4POK A;  2B1K A;  1ZGN A;  4NHZ A;  3TUE A;  1A2M A;  3TJF A;  5DAL B;  4LLR A;  2V41 A;  1K0A A;  2VLT A;  4G9H A;  20GS A;  3D22 A;  2VAF A;  3EU3 A;  3DKS A;  1XOB A;  2EIR A;  3GKX A;  6GSV A;  5J3R A;  2I3Y A;  5JCW A;  2FWH A;  3LEF A;  3ZRD A;  2AB6 A;  4J56 E;  1OC9 B;  1JLW A;  4HEA 2;  1TTZ A;  2V32 A;  2GQK A;  2RM5 A;  3GUR A;  3IE3 A;  3LG6 A;  4GCI A;  1SJI A;  4EXJ A;  1PSQ A;  1F3B A;  1ML6 A;  5B8B A;  2E0Q A;  4OFN A;  2HSY A;  1XOA A;  1M9B A;  1XIY A;  2G2Q A;  3IPZ A;  2YJ7 A;  3F8U A;  4V1A p;  1TRS A;  1AQW A;  4Q5R A;  3CRT A;  2FD3 A;  1YDK A;  3W8J A;  3AY8 A;  3MDK A;  5B8A A;  5G31 A;  3PH9 A;  4TR1 B;  4LA1 A;  3TKS A;  3GHA A;  5ECM B;  3HDC A;  2H01 A;  3WGX A;  1WRY A;  2ALB A;  3FZA A;  2O8V B;  5ECS A;  2LJK A;  2B3S A;  1TOF A;  2TIR A;  4MCU A;  2OE1 A;  3GST A;  1WIK A;  3VUR A;  3FZ5 A;  1ON4 A;  2IFQ B;  5IMD A;  1WE0 A;  1UC7 A;  1WOU A;  1SK1 A;  2H6Z A;  3U5R E;  5A5K A;  5FWG A;  1M9A A;  1A8Y A;  2K8V A;  4HQS A;  4I2T A;  3TB2 A;  3SBC A;  3IRA A;  2YAN A;  2HT9 A;  1G7E A;  2A2R A;  2YPM A;  3UL3 A;  3IR4 A;  6GSS A;  1DE2 A;  3ED3 A;  4MJE A;  5HR0 A;  3CTG A;  5G2Z A;  4O32 A;  2H30 A;  2IMF A;  4N0V A;  4GQF A;  1XWG A;  2LRT A;  1B8X A;  1SYX A;  1GLP A;  3TRX A;  4F03 A;  2VIM A;  4ZIL A;  1O6J A;  1SL1 B;  2OAD A;  3D21 A;  4ZBD A;  5G30 A;  1VF2 A;  3QOU A;  5J41 A;  4ZBB A;  1AIU A;  4HS1 A;  1GWC A;  2RM6 A;  3LXZ A;  1EV9 A;  1GNE A;  2YWN A;  4MMM A;  3A2W A;  4V2L A;  2LQO A;  3GTU A;  5ID2 B;  3PIN A;  3K8N A;  4IS0 A;  1F9M A;  2L5L A;  3EIN A;  3ZVJ D;  3QR6 A;  4AJ6 A;  3HYP A;  3EMX A;  2R3X A;  3A2V A;  3UMA A;  4AF2 A;  1MD4 A;  3C1R A;  4XS4 A;  1SYR A;  2FNO A;  4L8E A;  1M2B A;  1I9D A;  4PUR A;  4PNF A;  1ZOF A;  2GVP A;  4YAV A;  4MZW A;  4NPB A;  2H76 A;  1K3O A;  1T00 A;  4FYC A;  2ES7 A;  3BCK A;  3C73 A;  2F51 A;  4BPY A;  3FW2 A;  1SKR B;  3IV4 A;  3GIX A;  5DVB A;  2LEG A;  3L9S A;  4K7N A;  4JED A;  3PGT A;  4ZB8 A;  3GMF A;  3TOU A;  5HR3 A;  5F8B A;  2F9S A;  2CX4 A;  5GAP D;  4FIW A;  1YY7 A;  4Q5F A;  3QFA C;  4ML1 A;  3QPM A;  1XWA A;  1BQ7 A;  3O76 A;  2LV3 A;  3FK8 A;  2ON5 A;  1Z6M A;  3UIW A;  4JBB A;  4TOP A;  4KND A;  1SJ6 A;  6GST A;  5HFG A;  3FRC A;  2X99 A;  1DE1 A;  4KX4 A;  4K7I A;  5D8I A;  2CZ3 A;  1GUL A;  1GSS A;  2VL2 C;  4IEL A;  1GH2 A;  2H0G A;  5AIX A;  1BAY A;  3MSZ A;  1FO5 A;  2DC5 A;  3C1S A;  1SK2 A;  3F4T A;  4KSO A;  5F05 A;  1XVQ A;  1DBY A;  4MA9 A;  2LNT A;  1OC9 A;  1CQG A;  4E8H A;  1ZMA A;  2V6O A;  4E8E A;  12GS A;  1U3I A;  5J4U A;  4MZC A;  5G5E A;  3KMN A;  1QGV A;  2VL2 A;  1OC3 A;  4LMW A;  1UA5 A;  4J57 E;  1VF3 A;  3P2A A;  3TRQ A;  5DJM A;  2ZUP A;  4NWY A;  1GUM A;  1V2A A;  6GSX A;  5ABR A;  3GUS A;  1XWK A;  3BOA A;  3WGD A;  2B5E A;  1K0B A;  2LRN A;  2NDO A;  2BTO T;  2I9H A;  2K18 A;  1W89 A;  3A5W A;  2KOK A;  5J9B A;  1TK0 B;  4G2E A;  2FY6 A;  1K0O A;  4GRF A;  3F6D A;  2RUE A;  1TRU A;  1YEP A;  2VO4 A;  3KH9 A;  1B4P A;  3TKQ A;  3H8Q A;  1C72 A;  2LUS A;  7GSS A;  1QQ2 A;  4LL4 B;  4F2I A;  4JZQ A;  3LSZ A;  1YF1 A;  3ZIV A;  2IFQ A;  3TJB A;  3VLN A;  2B7K A;  3TJJ A;  2EC4 A;  1PN9 A;  2DJ2 A;  1O7U A;  2FWG A;  2GZP A;  5A4U A;  2YOI A;  3ERW A;  3IC4 A;  1TRW A;  1EOG A;  2JSY A;  5DCG A;  2DML A;  3U6V A;  1VRS D;  4MJA A;  1HNB A;  1XCC A;  2MMO A;  5IIZ A;  3IK7 A;  1WPI A;  4OCE A;  5D9W A;  4XTS A;  3VWU A;  4RUV A;  1GSQ A;  2A2S A;  2HLS A;  2IMI A;  1NSW A;  5GSS A;  2H0H A;  2ZNM A;  4JE1 A;  1KEB A;  3ZMK A;  3ZML A;  3FR9 A;  5D9T A;  4KH7 A;  3HZ4 A;  2A4V A;  1RK4 A;  3CXG A;  4IP6 A;  3ZVJ A;  2WGR A;  4OD7 A;  3LXT A;  8GSS A;  2RLI A;  2O85 A;  3HJM A;  4GXZ A;  2HRN A;  5F06 A;  2MBT A;  2HZF A;  3D6I A;  3HJP A;  3H79 A;  2I1U A;  3US3 A;  1U87 A;  3F3Q A;  5HQP A;  1TU8 A;  3D4M A;  5ID2 A;  1BED A;  3LWA A;  1AXD A;  1TJD A;  2L4C A;  1UVZ A;  4J2F A;  2FLS A;  4WKW A;  5D9X A;  1X9W B;  2C0E A;  3F9U A;  5DQY A;  1ERU A;  2NVL A;  2YZU A;  2HNL A;  2B7J A;  3GH6 A;  2WRT A;  2C3N A;  3KM6 A;  1OC8 A;  5HR1 A;  2GT6 A;  3GL3 A;  3GX0 A;  4NXI A;  17GS A;  5EL8 A;  1XPV A;  3CRU A;  2LJA A;  1OKT A;  2QC7 A;  2BMX A;  3L9V A;  2JZS A;  1A24 A;  2QKE A;  3D5J A;  3RPN A;  4MZB A;  5HFK A;  2DIZ A;  2PU9 C;  4CDO A;  4ZL9 A;  4IP1 A;  2KLX A;  2REM A;  3FZ4 A;  4HUA A;  1SD9 A;  11GS A;  2L5O A;  2H71 A;  1OVN A;  4HZ2 A;  1USB A;  2LS5 A;  1KBN A;  5IO0 A;  4YQV A;  2H6Y A;  3A3T A;  5DCH A;  1LU4 A;  3VPT A;  3VI7 A;  3H1N A;  1XXU A;  3WYW A;  2AUV A;  3C8E A;  3F3R A;  2V6K A;  4IQA A;  5IO2 A;  2GTU A;  5IOX A;  3DGQ A;  3E0U A;  4G10 A;  2GDR A;  2C80 A;  2JSZ A;  1A23 A;  4RI6 A;  4XHM A;  1FVJ A;  4IVF A;  2MMN A;  4ULX A;  2NPB A;  1PGT A;  3JCM L;  4IQ1 A;  2H19 A;  1TK8 B;  1PL1 A;  2RII A;  2JZR A;  1K3L A;  5H5Q A;  4N11 A;  3NZN A;  1BX9 A;  3LYP A;  3HVS A;  1JFU A;  3WD6 A;  2CZ2 A;  4LMV A;  1Q4J A;  4AJ7 A;  1MDI A;  2HZE B;  1AQV A;  2VLV A;  2F3M A;  4EVM A;  1GL8 A;  3APS A;  4L0W A;  1V98 A;  2H70 A;  3GSS A;  2XBI A;  2PVQ A;  3MWH A;  3HA9 A;  1E2Y A;  4MP4 A;  1O8X A;  3KJY A;  3QDN A;  4NMU A;  1EGO A;  5A4W A;  3QAW A;  2DBC A;  1O8W A;  1B48 A;  2E7P A;  5D9V A;  3TKS C;  4NV5 A;  1R7H A;  3UBK A;  4TR0 A;  1PKW A;  3HHV A;  3UAR A;  3KGK A;  3NIV A;  3GX8 A;  2IWT A;  3IHQ A;  2L6C A;  2DSA A;  4TRX A;  1G6Y A;  2N5B A;  3RHC A;  3KD0 A;  4YH2 A;  3EVI A;  4Q5N A;  2B1L A;  4NV2 A;  3EE2 A;  4X43 A;  1FG4 A;  1H75 A;  2JU5 A;  1VF1 A;  2H1B A;  1GTI A;  4TXV A;  3CYN A;  3ZFL A;  1YQ1 A;  1GSD A;  1HYU A;  1XW9 A;  3PR8 A;  1BJX A;  1A8L A;  2V1M A;  2N5F A;  1EV4 A;  2VD0 A;  4ZL7 A;  3L4N A;  3RHB A;  4JRR A;  3EU4 A;  2WUL A;  3IXR A;  2C0D A;  5AGY A;  1ZCP A;  2CQ9 A;  2MZC A;  2O87 A;  1PQN A;  1YZX A;  5ECH B;  4I6X A;  2I4A A;  4V1A g;  4MJC A;  4XS1 A;  2HSH A;  2GZY A;  3LOR A;  4GF0 A;  4O5R A;  2MBS A;  4N0Z A;  1H4O A;  1TKD B;  3CSH A;  2VCT A;  1GNW A;  2O7K A;  4L0U A;  1JLV A;  1QFN A;  3WGE A;  1A2L A;  2GLR A;  2ZCT A;  1JZO A;  3GL5 A;  2PMT A;  4CW9 A;  4NAX A;  1M2A A;  1U88 A;  1TDI A;  16GS A;  1RW1 A;  1R5P A;  2FWF A;  3RPP A;  5DAK B;  4KA0 A;  2YWO A;  1IYI A;  1T8E B;  4XS6 A;  4BVX A;  2GS3 A;  5CNW A;  5DJL A;  3SWL A;  3ISO A;  1FW1 A;  5CRG A;  2VUP A;  1T1V A;  1SD8 A;  2E2M A;  4F0C A;  4F0B A;  4N10 A;  3GFK A;  2WJU A;  1V57 A;  2VCV A;  1EP8 A;  1S3D A;  2TRX A;  4OFM A;  5ENU A;  3VI5 A;  1U3A A;  5B6N A;  2JAC A;  3M9K A;  1G6W A;  3G7Y A;  3Q18 A;  4ECB A;  4IBP A;  2K8S A;  1U6T A;  3RDW A;  1G0T A;  3FR3 A;  2KUC A;  4KAE A;  5CRW A;  4QL9 A;  4K0N A;  5H5R A;  5JWQ B;  1R5A A;  3VWX A;  4F82 A;  4KCA A;  4H86 A;  5AIS A;  5CAX A;  2H1A A;  4MF5 A;  5IQY A;  4I2U A;  1A2J A;  2OKA A;  2IMD A;  5CP1 A;  3D0Z A;  3VK9 A;  1K0M A;  1EEJ A;  2VOC A;  3IK9 A;  1XVW A;  1T4Y A;  2YN1 A;  2AYT A;  2C8U A;  5DAL A;  2CT6 A;  4BVY A;  1KNG A;  3QMX A;  4D73 B;  4IN0 A;  4WBR D;  2X8G A;  2HZE A;  2FCH A;  2AJQ B;  3Q19 A;  3HKR A;  3M1G A;  5LNK e;  3APQ A;  3TKS E;  4DEJ A;  4BWS A;  1FVK A;  3O3T A;  4WET A;  3G9B A;  5B6M A;  1WJK A;  2LST A;  5AN1 A;  2FA4 A;  1G7O A;  2VL9 A;  3KXO A;  2C4J A;  1SKS B;  2VD1 A;  1M7T A;  4HI7 A;  1EGR A;  5IMA A;  1PD2 1;  1GP1 A;  4YAP A;  4DSQ A;  3EC3 A;  1SKW B;  2LKU A;  4GQC A;  1ERV A;  4Q5Q A;  3ZL5 A;  2EIQ A;  5F07 A;  4JR6 A;  2TRC P;  3ZLP A;  4PGT A;  1X0R A;  1YKC A;  4MJB A;  1ZL9 A;  1B4Q A;  3QD9 A;  1YJ6 A;  5E4W A;  4HQZ A;  4TR1 A;  2H72 A;  1MDK A;  5ECP B;  1LBK A;  1AC1 A;  2WDU A;  1WP0 A;  3GKK A;  4DSS B;  5FT3 A;  4RQX A;  3DEX A;  1SU9 A;  4X1U A;  1QUW A;  2AHE A;  1TW9 A;  3BD2 A;  4V2N A;  1QMV A;  2PGT A;  4K2D A;  2XPD A;  3KP9 A;  1M2D A;  1XW5 A;  1EEM A;  2J23 A;  3V1W A;  1GTU A;  1T4Z A;  4L5L A;  5IMF A;  4AJ8 A;  4K6X A;  1J9B A;  3IAM 2;  2PER A;  3R2Q A;  3LJR A;  1HNC A;  1GRX A;  3Q74 A;  3IOS A;  4IW9 A;  1OE8 A;  3APO A;  3RBT A;  4ZIJ A;  4RI7 A;  4ZXG A;  4KE3 A;  2B5X A;  3H4K A;  1GSE A;  4MF6 A;  5ECI B;  5ELG A;  4N30 A;  2DIY A;  2EIO A;  2H73 A;  1XWB A;  1GSY A;  1K0C A;  3J7Y k;  1YF0 A;  5C04 A;  1UN2 A;  1MD3 A;  2H8L A;  1PRX A;  3GKM A;  5ECO B;  5DAK A;  4HJM A;  4BA7 A;  4YQM A;  3ME8 A;  5L71 A;  4PUA A;  3BCI A;  2VCW A;  4MH2 A;  4MDC A;  2DJK A;  4EUY A;  2XC2 A;  2PWJ A;  1SL0 B;  5INY A;  2YWI A;  2P0G A;  2CVD A;  1R26 A;  4ID0 A;  3EMP A;  2VL3 A;  3G7J A;  5ECN B;  2YCD A;  5JCG A;  2GST A;  4GST A;  1ZYE A;  3ZTL A;  4GLT A;  4KB3 A;  2VLU A;  3F4S A;  4XRD A;  4EDY A;  4PQ1 A;  3ZRE A;  1K0D A;  5DQS A;  3UBL A;  1EZK A;  3A2X A;  2WZ9 A;  4PNG A;  3ZFB A;  2VM2 A;  4TR3 A;  3VFI A;  2G0F A;  2MMZ A;  4MPF A;  2OBK A;  2DJ3 A;  2YZH A;  4ISD A;  1AAZ A;  2IJY A;  2OA7 A;  3HD5 A;  4EC0 A;  3M9J A;  1PMT A;  2LTK A;  2E2G A;  4ILF A;  1Y25 A;  3FEU A;  3GRX A;  3EUR A;  4PUF C;  2MMA A;  4PQI A;  2OE3 A;  3FR6 A;  3L78 A;  3C7M A;  2KP2 A;  2AAW A;  2D2Z A;  3W6G A;  2PN8 A;  1K3Y A;  9GSS A;  1DSB A;  1NHO A;  5DBQ A;  2XPE A;  4ECJ A;  4D73 A;  1XZO A;  4CHS A;  5KN0 A;  1PKZ A;  1R4W A;  3MAK A;  1TU7 A;  2IPA A;  2GT5 A;  2QGV A;  4V2M A;  1MEK A;  3HVX A;  1JZD A;  3I6A A;  2H1G A;  2Z9S A;  1TI1 A;  3IDV A;  2K6V A;  4GTU A;  3ZIJ A;  1TXX A;  4ZL8 A;  1GLQ A;  2HE3 A;  5KN3 A;  2WS2 A;  2K9F A;  22GS A;  1ABA A;  5HFI A;  1VGL A;  1O85 A;  5CRE A;  2L4Q A;  2L59 A;  2VM1 A;  4ACS A;  5CRD A;  1THX A;  5EY6 A;  3UAP A;  4FH8 A;  4KUN A;  2LJR A;  3O6T A;  2V2G A;  5IM9 A;  5JWO B;  5JWR B;  3EYT A;  2PVO C;  4KW6 A;  2IN3 A;  2IL3 A;  2YP6 A;  1RQM A;  1Z7R A;  4FO5 A;  4KDY A;  2YV9 A;  4DSS A;  2NTO A;  1ERT A;  4GSS A;  4WEY A;  3E9J B;  2IIY A;  2VCX A;  5FHI A;  1S3A A;  1JHB A;  5LD0 A;  2PBJ A;  2XHF A;  3LGC A;  4WXT A;  1F3A A;  2KHP A;  3E3E A;  2FGX A;  2P31 A;  3HXS A;  1XWC A;  4QL7 A;  1X5D A;  5COH A;  4HU9 A;  3D4T A;  2OAC A;  1F37 A;  4KGI A;  3DIE A;  2H6X A;  2R4V A;  1AQX A;  4EO3 A;  3L9U A;  2HFD A;  4KDU A;  5D93 A;  2M72 A;  1SL2 B;  5ELA A;  4K7O A;  3G7I A;  5GST A;  2CVK A;  2NBS A;  4IJ3 A;  3UEM A;  2F8F A;  4KSM A;  5IPH A;  3I43 A;  3TKP A;  1B9X C;  19GS A;  4EE0 A;  1OAZ A; 
#chains in the Genus database with same CATH topology
 1YKA A;  4XIH A;  3M8N A;  3N5O A;  2HRA A;  3ZZX A;  4POB A;  2CV4 A;  4WR5 A;  2JZT A;  1TK5 B;  1J08 A;  1JZW A;  1CQH A;  2PPT A;  3QAV A;  3HZ8 A;  1IYH A;  4ZB9 A;  2HRK A;  3LYK A;  2X4A A;  3KCM A;  2L57 A;  4G19 A;  5C00 A;  3Q6O A;  1Y6E A;  4OO5 A;  3J7Y b;  2JAD A;  1QXH A;  4YKF A;  3EWL A;  4ZBA A;  3DVX A;  1DUG A;  4MPG A;  1EP7 A;  1FHE A;  3VWV A;  3L0H A;  3I9V 2;  2XBQ A;  4HOJ A;  3TJK A;  1T3B A;  5ECK B;  3F0I A;  3S9F A;  4BWQ A;  2R2J A;  3KP8 A;  4PX1 A;  3KTL A;  2C3Q A;  3GNJ A;  5IMV A;  4POM A;  4KCE A;  4EL1 A;  1EOH A;  1OYJ A;  1PA3 A;  2P5R A;  3HCZ A;  1BYE A;  3UVH A;  5D73 A;  1GSF A;  1XFL A;  3W8S A;  5ECQ B;  4BL7 A;  2R6K A;  3DD3 A;  1X9S B;  4K1F A;  1PFO A;  18GS A;  3KMO A;  2LRC A;  3P8W A;  4TR4 A;  3F4R A;  3DYR A;  2YNX A;  5HR2 A;  5F0G A;  2N5A A;  4WF4 A;  1VF4 A;  4TW5 A;  5B7C A;  3NOF A;  3BBY A;  1I5G A;  2HYX A;  2WB9 A;  1GUK A;  4I97 A;  6GSY A;  3CSJ A;  3WT1 A;  3CMI A;  1Z9H A;  5G1L A;  3ZIT A;  2VCQ A;  3DWV A;  1A0F A;  3GH9 A;  5GZZ B;  2FUG 2;  3H93 A;  3IAS 2;  1HD2 A;  2H75 A;  1K0N A;  4MK3 A;  2X8H A;  2HXK A;  4A5P A;  1J0F A;  1E6B A;  5ECL B;  3KH7 A;  4HU7 A;  4JR4 A;  3F63 A;  2H66 A;  1X9M B;  2WFC A;  3CBU A;  4IKH A;  4OMV A;  1GUH A;  3ERF A;  2O89 A;  4JU5 A;  1THO A;  3M0F A;  3C71 A;  3KIJ A;  3DRN A;  2J9H A;  2QSI A;  4ML6 A;  3GKN A;  4OO4 A;  1N8J A;  2AV4 A;  4KDX A;  1V9W A;  5J9C A;  4YQU A;  3UOM A;  1OE7 A;  2X8C A;  3QFB C;  4WF5 A;  3GV1 A;  1PX7 A;  3OR5 A;  4CY8 A;  1FB6 A;  2CAQ A;  3LFL A;  2C3T A;  4WBJ A;  3ME7 A;  1B9Y C;  1MDJ A;  3TJG A;  3LQ7 A;  4QQ7 A;  3QAG A;  1A0R P;  4TXO B;  5EVO A;  1Z6N A;  2R0G A;  2OBI A;  4O7H A;  3N9J A;  1ST9 A;  2H1D A;  5CYY A;  3IA1 A;  5IPG A;  2IME A;  4EDZ A;  13GS A;  2JL4 A;  3DVW A;  4TKY A;  1ZZY A;  4X0X A;  2GGT A;  5ECR B;  3TCO A;  5KN1 A;  4OFT A;  1HNA A;  4POL A;  1FAA A;  1T7P B;  2GSR A;  1WWJ A;  10GS A;  1QK8 A;  4EKZ A;  3FY7 A;  3TKR A;  1SEN A;  4DSR A;  1TRV A;  2R5G A;  3ERG A;  2DJ1 A;  4K8M A;  5JCU A;  5CO3 A;  4ECC A;  5G5F A;  4L5O A;  1GTA A;  1Z7P A;  3GA4 A;  3FZ9 A;  2CVB A;  3FMW A;  1O81 A;  4HZ4 A;  2YJH A;  3ZYW A;  4HJ2 A;  2VCZ A;  2PUK C;  5G1K A;  6GSW A;  2LQQ A;  3FKF A;  4EF0 A;  5EPF A;  3HY2 A;  6GSU A;  1FOH A;  4AGS A;  1XW6 A;  3KTB A;  3P90 A;  5CRH A;  2KP1 A;  3KZQ A;  1PX6 A;  1AUC A;  2DKH A;  2CX3 A;  2FWE A;  4Z7X A;  1F6M C;  2GSQ A;  2FHE A;  2CA8 A;  14GS A;  3CTF A;  3BJ5 A;  3CSI A;  4F9Z A;  4HDE A;  3QCP A;  1Z3E A;  2GZZ A;  2M46 A;  2OE0 A;  3GN3 A;  2P5Q A;  2HRF A;  4TN8 A;  1ERW A;  1GTB A;  3HJO A;  1S3R A;  3I69 A;  1ZYQ B;  1YEX A;  2YWM A;  4PXO A;  1TP9 A;  1URM A;  1LJR A;  4OWY A;  2X64 A;  4XCS A;  3VWW A;  4KF9 A;  2A4H A;  1V40 A;  2BJX A;  1BG5 A;  1GSU A;  3F6F A;  3KEB A;  5IMC A;  1OKD A;  3TOT A;  5D96 A;  5GAN D;  3TRP A;  1EWX A;  3WT2 A;  2F8A A;  3IBH A;  1M0U A;  4MF7 A;  1XBS A;  4WR4 A;  2C0G A;  2I81 A;  5LCZ A;  3P7X A;  1NHY A;  1M3I A;  5AIV A;  4FYU A;  3HVV A;  2B5Y A;  2M80 A;  3TGZ A;  2CAI A;  4CY6 A;  2H74 A;  3DML A;  1PL2 A;  3TDG A;  1N2A A;  1MTC A;  2DJ0 A;  1NM3 A;  3UJ1 A;  4IJI A;  2B6M A;  3M3M A;  3FYG A;  4K0G A;  1KTE A;  4RQR A;  1O73 A;  1M99 A;  4NHW A;  2FA8 A;  2DJJ A;  2C0F A;  4Z2T A;  1TI3 A;  3FHK A;  1SK0 A;  4I5Q A;  2H0I A;  1V58 A;  4I8B A;  4MLY A;  1FOV A;  1X5C A;  2HI7 A;  5KN2 A;  4IGJ A;  1X5E A;  1W4V A;  2LNS A;  2YV7 A;  3R3E A;  2GSS A;  4ECI A;  2L6D A;  2C1Y A;  2DMM A;  1Z5Y E;  1ACV A;  1F2E A;  3GTU B;  2A2P A;  5DDL A;  4USS A;  5IMZ A;  2ON7 A;  2GQL A;  3VPQ A;  5J5N A;  2R37 A;  1SJZ A;  4TXO A;  1Q98 A;  4XRA A;  2RUF A;  3PPU A;  4MH3 A;  4PQH A;  4XS4 B;  2OJL A;  4LL1 B;  4MAB A;  2IMK A;  5E59 A;  4TVE A;  1HQO A;  4ZB6 A;  3UVT A;  4G0K A;  2MYG A;  2GQM A;  4IHU A;  2WCI A;  4P3Y B;  4OCF A;  4FYB A;  4GSN A;  5A4V A;  1NW2 A;  1JZR A;  1ILO A;  1S3C A;  2DLX A;  4DVC A;  5IOW A;  1WMJ A;  3GYK A;  3RAZ A;  1AW9 A;  4GWR A;  4O92 A;  5KEJ A;  1FB0 A;  4K9Z A;  3DXB A;  5H5S A;  3MNG A;  4POK A;  2B1K A;  1ZGN A;  4NHZ A;  3TUE A;  1A2M A;  3TJF A;  5DAL B;  4LLR A;  2V41 A;  1K0A A;  2VLT A;  4G9H A;  20GS A;  3D22 A;  2VAF A;  3EU3 A;  3DKS A;  1XOB A;  1ZYP A;  2EIR A;  3GKX A;  6GSV A;  5J3R A;  2I3Y A;  5KOW A;  5JCW A;  2FWH A;  3LEF A;  3ZRD A;  2AB6 A;  4ICY A;  4J56 E;  1OC9 B;  1JLW A;  4HEA 2;  1TTZ A;  2V32 A;  2GQK A;  2RM5 A;  3GUR A;  3IE3 A;  3LG6 A;  4GCI A;  1SJI A;  4EXJ A;  1PSQ A;  1F3B A;  1ML6 A;  2R0C A;  5B8B A;  2E0Q A;  4OFN A;  4K2X A;  2HSY A;  1XOA A;  4FQU A;  1M9B A;  1XIY A;  2G2Q A;  3IPZ A;  2YJ7 A;  3F8U A;  4V1A p;  1TRS A;  1AQW A;  4Q5R A;  3CRT A;  2FD3 A;  1YDK A;  3W8J A;  3AY8 A;  3MDK A;  5BRT A;  5B8A A;  5G31 A;  3PH9 A;  4TR1 B;  4LA1 A;  3TKS A;  3GHA A;  5ECM B;  3HDC A;  2H01 A;  3WGX A;  1WRY A;  4EIP A;  2ALB A;  3FZA A;  2O8V B;  5ECS A;  2LJK A;  2B3S A;  1TOF A;  2TIR A;  4MCU A;  2OE1 A;  3GST A;  1WIK A;  3VUR A;  3FZ5 A;  1ON4 A;  2IFQ B;  5IMD A;  2R0P A;  1WE0 A;  1UC7 A;  1WOU A;  1SK1 A;  2H6Z A;  3U5R E;  5A5K A;  5FWG A;  1M9A A;  1A8Y A;  2K8V A;  4HQS A;  4I2T A;  3TB2 A;  3SBC A;  3IRA A;  2YAN A;  2HT9 A;  1G7E A;  2A2R A;  2YPM A;  3UL3 A;  3IR4 A;  6GSS A;  1DE2 A;  3ED3 A;  4O5Q A;  4MJE A;  5HR0 A;  3CTG A;  5G2Z A;  4O32 A;  2H30 A;  2IMF A;  4N0V A;  4GQF A;  1XWG A;  2LRT A;  1B8X A;  1SYX A;  1GLP A;  3TRX A;  4F03 A;  2VIM A;  4ZIL A;  1O6J A;  1SL1 B;  2OAD A;  3D21 A;  4ZBD A;  5G30 A;  1VF2 A;  3QOU A;  5J41 A;  2UZ8 A;  4ZBB A;  1AIU A;  4HS1 A;  1GWC A;  2RM6 A;  3LXZ A;  1EV9 A;  1GNE A;  2YWN A;  4MMM A;  3A2W A;  4V2L A;  2LQO A;  3GTU A;  5ID2 B;  3PIN A;  3K8N A;  4IS0 A;  1F9M A;  2L5L A;  3EIN A;  3ZVJ D;  3QR6 A;  4AJ6 A;  3HYP A;  3EMX A;  2R3X A;  3A2V A;  3UMA A;  4AF2 A;  1MD4 A;  3C1R A;  4XS4 A;  1SYR A;  2FNO A;  4L8E A;  1M2B A;  4PUR A;  1I9D A;  4PNF A;  1ZOF A;  2GVP A;  4YAV A;  4MZW A;  4NPB A;  2H76 A;  1K3O A;  1T00 A;  4FYC A;  2ES7 A;  3BCK A;  3C73 A;  2F51 A;  4BPY A;  3FW2 A;  1SKR B;  3IV4 A;  3GIX A;  5DVB A;  2LEG A;  3L9S A;  4K7N A;  4JED A;  3PGT A;  4ZB8 A;  3GMF A;  3TOU A;  5HR3 A;  5F8B A;  2F9S A;  2CX4 A;  5GAP D;  4FIW A;  1YY7 A;  4Q5F A;  3QFA C;  4ML1 A;  3QPM A;  1XWA A;  1BQ7 A;  3O76 A;  2LV3 A;  5KOX A;  3FK8 A;  2ON5 A;  1Z6M A;  3UIW A;  4JBB A;  4TOP A;  4KND A;  1SJ6 A;  6GST A;  5HFG A;  3FRC A;  2X99 A;  1DE1 A;  4KX4 A;  4K7I A;  2CZ3 A;  5D8I A;  1GUL A;  5BMU A;  1GSS A;  2VL2 C;  4IEL A;  1GH2 A;  2H0G A;  5AIX A;  1BAY A;  3MSZ A;  1FO5 A;  2DC5 A;  3C1S A;  1SK2 A;  3F4T A;  4KSO A;  5F05 A;  1XVQ A;  1DBY A;  4MA9 A;  2LNT A;  1OC9 A;  1CQG A;  4E8H A;  1ZMA A;  2V6O A;  4E8E A;  12GS A;  1U3I A;  5J4U A;  4MZC A;  5G5E A;  3KMN A;  1QGV A;  2VL2 A;  1OC3 A;  4LMW A;  1UA5 A;  4J57 E;  1VF3 A;  3P2A A;  3TRQ A;  5DJM A;  2ZUP A;  4NWY A;  1GUM A;  1V2A A;  6GSX A;  5ABR A;  3GUS A;  1XWK A;  3BOA A;  3WGD A;  2B5E A;  1K0B A;  2LRN A;  2NDO A;  2BTO T;  2I9H A;  2K18 A;  1W89 A;  3A5W A;  2KOK A;  5J9B A;  1TK0 B;  4G2E A;  2FY6 A;  1K0O A;  4GRF A;  3F6D A;  2RUE A;  1TRU A;  1YEP A;  2VO4 A;  3KH9 A;  1B4P A;  3TKQ A;  3H8Q A;  1C72 A;  2LUS A;  7GSS A;  1QQ2 A;  4LL4 B;  4F2I A;  4JZQ A;  3LSZ A;  3MIX A;  1YF1 A;  3ZIV A;  2IFQ A;  3TJB A;  3VLN A;  2B7K A;  3TJJ A;  2EC4 A;  1PN9 A;  2DJ2 A;  1O7U A;  2FWG A;  2GZP A;  5A4U A;  2YOI A;  3ERW A;  3IC4 A;  1TRW A;  1EOG A;  2JSY A;  5DCG A;  2DML A;  3U6V A;  1VRS D;  4MJA A;  1HNB A;  1XCC A;  2MMO A;  5IIZ A;  3IK7 A;  1WPI A;  4OCE A;  5D9W A;  3A5I A;  4XTS A;  3VWU A;  4RUV A;  1GSQ A;  2A2S A;  2HLS A;  2IMI A;  1NSW A;  5GSS A;  2H0H A;  2ZNM A;  4JE1 A;  1KEB A;  3ZMK A;  3ZML A;  3FR9 A;  5D9T A;  4KH7 A;  3HZ4 A;  2A4V A;  1RK4 A;  3CXG A;  4IP6 A;  3ZVJ A;  2WGR A;  4OD7 A;  3LXT A;  8GSS A;  2RLI A;  2O85 A;  3HJM A;  4GXZ A;  2HRN A;  5F06 A;  2MBT A;  2HZF A;  3D6I A;  3HJP A;  3H79 A;  2I1U A;  3US3 A;  1U87 A;  3F3Q A;  5HQP A;  1TU8 A;  3D4M A;  5ID2 A;  1BED A;  3LWA A;  1AXD A;  1TJD A;  2L4C A;  1UVZ A;  4J2F A;  2FLS A;  4WKW A;  5D9X A;  1X9W B;  2C0E A;  3F9U A;  5DQY A;  1ERU A;  2NVL A;  2YZU A;  2HNL A;  2B7J A;  3GH6 A;  2WRT A;  2C3N A;  3KM6 A;  1OC8 A;  5HR1 A;  2GT6 A;  3GL3 A;  3GX0 A;  4NXI A;  17GS A;  5EL8 A;  1XPV A;  3CRU A;  2LJA A;  1OKT A;  2QC7 A;  2BMX A;  3L9V A;  2JZS A;  4BVX B;  1A24 A;  3MYD A;  2QKE A;  3D5J A;  3RPN A;  4MZB A;  5HFK A;  3IC8 A;  2DKI A;  2DIZ A;  2PU9 C;  4CDO A;  4ZL9 A;  4IP1 A;  2KLX A;  2REM A;  3FZ4 A;  4HUA A;  1SD9 A;  11GS A;  2L5O A;  2H71 A;  1OVN A;  4HZ2 A;  1USB A;  2LS5 A;  1KBN A;  5IO0 A;  4YQV A;  2H6Y A;  3A3T A;  5DCH A;  1LU4 A;  3VPT A;  3VI7 A;  3H1N A;  1XXU A;  3WYW A;  2AUV A;  3C8E A;  3F3R A;  2V6K A;  4IQA A;  5IO2 A;  2GTU A;  5IOX A;  3DGQ A;  3E0U A;  4G10 A;  2GDR A;  2C80 A;  2JSZ A;  1A23 A;  4RI6 A;  4XHM A;  1FVJ A;  4IVF A;  2MMN A;  4ULX A;  2NPB A;  1PGT A;  3JCM L;  4IQ1 A;  2H19 A;  1TK8 B;  1PL1 A;  2RII A;  2JZR A;  4Z2U A;  1K3L A;  5H5Q A;  4N11 A;  3NZN A;  1BX9 A;  3LYP A;  3HVS A;  1JFU A;  3WD6 A;  2CZ2 A;  4BVY B;  4LMV A;  1Q4J A;  4AJ7 A;  1MDI A;  2HZE B;  1AQV A;  2VLV A;  2F3M A;  4EVM A;  1GL8 A;  3APS A;  4L0W A;  1V98 A;  2H70 A;  3GSS A;  2XBI A;  2PVQ A;  3MWH A;  3HA9 A;  1E2Y A;  4MP4 A;  1O8X A;  3KJY A;  3QDN A;  4NMU A;  1EGO A;  5A4W A;  3QAW A;  2HSM A;  2DBC A;  1O8W A;  1ZYN A;  1B48 A;  2E7P A;  5D9V A;  3TKS C;  4NV5 A;  1R7H A;  3UBK A;  4TR0 A;  1PKW A;  3HHV A;  3UAR A;  3KGK A;  3NIV A;  3GX8 A;  2IWT A;  3IHQ A;  2L6C A;  2DSA A;  4TRX A;  1G6Y A;  2N5B A;  3RHC A;  3KD0 A;  4YH2 A;  3EVI A;  4Q5N A;  2B1L A;  1XG8 A;  4NV2 A;  3EE2 A;  4X43 A;  1FG4 A;  1H75 A;  2JU5 A;  1VF1 A;  2H1B A;  1GTI A;  4TXV A;  3CYN A;  3ZFL A;  1YQ1 A;  1GSD A;  1HYU A;  1XW9 A;  3PR8 A;  1BJX A;  1A8L A;  2V1M A;  2N5F A;  1EV4 A;  2VD0 A;  4ZL7 A;  3L4N A;  3RHB A;  4JRR A;  3EU4 A;  2WUL A;  3IXR A;  4YKG A;  2C0D A;  5AGY A;  1ZCP A;  2CQ9 A;  2MZC A;  2O87 A;  1PQN A;  1YZX A;  5ECH B;  4I6X A;  2I4A A;  4V1A g;  4MJC A;  4XS1 A;  2HSH A;  2GZY A;  3LOR A;  4GF0 A;  4O5R A;  2MBS A;  4N0Z A;  1H4O A;  1TKD B;  3CSH A;  2VCT A;  1GNW A;  4G0L A;  2O7K A;  4L0U A;  1JLV A;  1QFN A;  3WGE A;  1A2L A;  2GLR A;  2ZCT A;  1JZO A;  3GL5 A;  2PMT A;  4CW9 A;  4NAX A;  1M2A A;  1U88 A;  1TDI A;  16GS A;  1RW1 A;  4X4J A;  1R5P A;  2FWF A;  3RPP A;  5DAK B;  4KA0 A;  2YWO A;  1IYI A;  1T8E B;  4XS6 A;  4BVX A;  2GS3 A;  5CNW A;  5DJL A;  3SWL A;  3ISO A;  1FW1 A;  4K5R A;  5CRG A;  2VUP A;  1T1V A;  1SD8 A;  2E2M A;  4F0C A;  4F0B A;  4N10 A;  3GFK A;  2WJU A;  1V57 A;  2VCV A;  1EP8 A;  1S3D A;  2TRX A;  4OFM A;  5ENU A;  3VI5 A;  1U3A A;  5B6N A;  2JAC A;  3M9K A;  1G6W A;  3G7Y A;  3Q18 A;  4ECB A;  4IBP A;  2K8S A;  1U6T A;  3RDW A;  4Z2R A;  1G0T A;  3FR3 A;  2KUC A;  4KAE A;  5CRW A;  4QL9 A;  4K0N A;  4EIQ A;  4PTS A;  5H5R A;  2QA1 A;  5JWQ B;  1R5A A;  3VWX A;  4F82 A;  4HSC X;  4KCA A;  4H86 A;  5AIS A;  5CAX A;  2H1A A;  4MF5 A;  5IQY A;  4I2U A;  1A2J A;  2OKA A;  2IMD A;  5CP1 A;  3D0Z A;  3VK9 A;  1K0M A;  1EEJ A;  2VOC A;  3IK9 A;  1XVW A;  1T4Y A;  2YN1 A;  2AYT A;  2C8U A;  5DAL A;  2CT6 A;  4BVY A;  1KNG A;  3QMX A;  4D73 B;  4IN0 A;  4WBR D;  2X8G A;  2HZE A;  2FCH A;  2AJQ B;  3Q19 A;  3HKR A;  3M1G A;  5LNK e;  3APQ A;  3TKS E;  4DEJ A;  4BWS A;  1FVK A;  3O3T A;  4WET A;  3G9B A;  5B6M A;  1WJK A;  2LST A;  5AN1 A;  3EPT A;  2FA4 A;  1G7O A;  2VL9 A;  3KXO A;  2C4J A;  1SKS B;  2VD1 A;  1M7T A;  4HI7 A;  1EGR A;  5IMA A;  1PD2 1;  1GP1 A;  2QA2 A;  4YAP A;  4DSQ A;  3EC3 A;  1SKW B;  2LKU A;  4GQC A;  1ERV A;  4Q5Q A;  3ZL5 A;  2EIQ A;  5F07 A;  4JR6 A;  2TRC P;  3ZLP A;  4PGT A;  1X0R A;  3HVN A;  1YKC A;  4MJB A;  1ZL9 A;  1B4Q A;  3QD9 A;  1YJ6 A;  5E4W A;  4HQZ A;  4TR1 A;  2H72 A;  1MDK A;  5ECP B;  2X49 A;  1LBK A;  1AC1 A;  3IHG A;  2WDU A;  1WP0 A;  3GKK A;  4DSS B;  5FT3 A;  4RQX A;  3DEX A;  1SU9 A;  4X1U A;  1QUW A;  2AHE A;  1TW9 A;  3BD2 A;  4V2N A;  1QMV A;  2PGT A;  4K2D A;  2XPD A;  3KP9 A;  1M2D A;  1XW5 A;  1EEM A;  2J23 A;  3V1W A;  1GTU A;  1T4Z A;  4L5L A;  5IMF A;  4O5U A;  4AJ8 A;  4K6X A;  1J9B A;  3IAM 2;  2PER A;  3R2Q A;  3LJR A;  1HNC A;  1GRX A;  3Q74 A;  3IOS A;  4IW9 A;  1OE8 A;  3APO A;  3RBT A;  4ZIJ A;  4RI7 A;  4ZXG A;  4KE3 A;  2B5X A;  3H4K A;  1GSE A;  4MF6 A;  5ECI B;  5ELG A;  4N30 A;  2DIY A;  2EIO A;  2H73 A;  1XWB A;  1GSY A;  1K0C A;  4MNN A;  3J7Y k;  1YF0 A;  5C04 A;  1UN2 A;  1MD3 A;  2H8L A;  1PRX A;  3GKM A;  5ECO B;  5DAK A;  4HJM A;  4BA7 A;  4YQM A;  3ME8 A;  5L71 A;  4PUA A;  3BCI A;  2VCW A;  4MH2 A;  4MDC A;  2DJK A;  4EUY A;  2XC2 A;  2PWJ A;  1SL0 B;  5INY A;  2YWI A;  2P0G A;  2CVD A;  1R26 A;  4ID0 A;  3EMP A;  2VL3 A;  3G7J A;  5ECN B;  2YCD A;  5JCG A;  2GST A;  4GST A;  1ZYE A;  3ZTL A;  4GLT A;  4KB3 A;  2VLU A;  3F4S A;  4XRD A;  4EDY A;  4PQ1 A;  3ZRE A;  1K0D A;  5DQS A;  3UBL A;  1EZK A;  3A2X A;  2WZ9 A;  4PNG A;  3ZFB A;  2VM2 A;  3LW9 A;  4TR3 A;  3VFI A;  2G0F A;  2MMZ A;  4MPF A;  2OBK A;  2DJ3 A;  4K5S A;  2YZH A;  4ISD A;  1AAZ A;  2IJY A;  2OA7 A;  3HD5 A;  4EC0 A;  3M9J A;  1PMT A;  2LTK A;  2E2G A;  4ILF A;  1Y25 A;  3FEU A;  3GRX A;  3EUR A;  4PUF C;  2MMA A;  4PQI A;  2OE3 A;  3FR6 A;  3L78 A;  3C7M A;  2KP2 A;  2AAW A;  2D2Z A;  4BL7 B;  3W6G A;  2PN8 A;  1K3Y A;  9GSS A;  1DSB A;  1NHO A;  5DBQ A;  1M3J A;  2XPE A;  4ECJ A;  4D73 A;  1XZO A;  4CHS A;  5KN0 A;  1PKZ A;  1R4W A;  3MAK A;  1TU7 A;  2IPA A;  2GT5 A;  2QGV A;  4V2M A;  1MEK A;  3HVX A;  1JZD A;  3I6A A;  2H1G A;  2Z9S A;  3CQF A;  1TI1 A;  4BIK A;  3IDV A;  2K6V A;  4GTU A;  3ZIJ A;  1TXX A;  4ZL8 A;  1GLQ A;  2HE3 A;  5KN3 A;  4G0I A;  2WS2 A;  2K9F A;  22GS A;  1ABA A;  5HFI A;  1VGL A;  1O85 A;  5CRE A;  2L4Q A;  2L59 A;  2VM1 A;  4ACS A;  5CRD A;  1THX A;  5EY6 A;  3UAP A;  4FH8 A;  4KUN A;  2LJR A;  3O6T A;  2V2G A;  5IM9 A;  5JWO B;  5JWR B;  3EYT A;  2PVO C;  4KW6 A;  2IN3 A;  2IL3 A;  2YP6 A;  1RQM A;  1Z7R A;  4FO5 A;  4KDY A;  2YV9 A;  4DSS A;  2NTO A;  1ERT A;  4GSS A;  4WEY A;  3E9J B;  2IIY A;  2VCX A;  5FHI A;  1S3A A;  1JHB A;  5LD0 A;  2PBJ A;  2XHF A;  3LGC A;  4WXT A;  1F3A A;  2KHP A;  3E3E A;  2FGX A;  2P31 A;  3HXS A;  1XWC A;  4QL7 A;  1X5D A;  5COH A;  4HU9 A;  3D4T A;  2OAC A;  1F37 A;  4KGI A;  3DIE A;  2H6X A;  2R4V A;  1AQX A;  4EO3 A;  3L9U A;  2HFD A;  4KDU A;  5D93 A;  2M72 A;  1SL2 B;  5ELA A;  4K7O A;  3G7I A;  5GST A;  2CVK A;  2NBS A;  1PN0 A;  4IJ3 A;  3UEM A;  2F8F A;  4KSM A;  5IPH A;  3I43 A;  3TKP A;  1B9X C;  19GS A;  4EE0 A;  1OAZ A; 
#chains in the Genus database with same CATH homology
 1YKA A;  4XIH A;  3M8N A;  3N5O A;  2HRA A;  3ZZX A;  4POB A;  2CV4 A;  4WR5 A;  2JZT A;  1TK5 B;  1J08 A;  1JZW A;  1CQH A;  2PPT A;  3QAV A;  3HZ8 A;  1IYH A;  4ZB9 A;  2HRK A;  3LYK A;  2X4A A;  3KCM A;  2L57 A;  4G19 A;  5C00 A;  3Q6O A;  1Y6E A;  4OO5 A;  3J7Y b;  2JAD A;  1QXH A;  4YKF A;  3EWL A;  4ZBA A;  3DVX A;  1DUG A;  4MPG A;  1EP7 A;  1FHE A;  3VWV A;  3L0H A;  3I9V 2;  2XBQ A;  4HOJ A;  3TJK A;  1T3B A;  5ECK B;  3F0I A;  3S9F A;  4BWQ A;  2R2J A;  3KP8 A;  4PX1 A;  3KTL A;  2C3Q A;  3GNJ A;  5IMV A;  4POM A;  4KCE A;  4EL1 A;  1EOH A;  1OYJ A;  1PA3 A;  2P5R A;  3HCZ A;  1BYE A;  3UVH A;  5D73 A;  1GSF A;  1XFL A;  3W8S A;  5ECQ B;  4BL7 A;  2R6K A;  3DD3 A;  1X9S B;  4K1F A;  18GS A;  3KMO A;  2LRC A;  3P8W A;  4TR4 A;  3F4R A;  3DYR A;  2YNX A;  5HR2 A;  5F0G A;  2N5A A;  4WF4 A;  1VF4 A;  4TW5 A;  5B7C A;  3NOF A;  3BBY A;  1I5G A;  2HYX A;  2WB9 A;  1GUK A;  4I97 A;  6GSY A;  3CSJ A;  3WT1 A;  3CMI A;  1Z9H A;  5G1L A;  3ZIT A;  2VCQ A;  3DWV A;  1A0F A;  3GH9 A;  5GZZ B;  2FUG 2;  3H93 A;  3IAS 2;  1HD2 A;  2H75 A;  1K0N A;  4MK3 A;  2X8H A;  2HXK A;  4A5P A;  1J0F A;  1E6B A;  5ECL B;  3KH7 A;  4HU7 A;  4JR4 A;  3F63 A;  2H66 A;  1X9M B;  2WFC A;  3CBU A;  4IKH A;  4OMV A;  1GUH A;  3ERF A;  2O89 A;  4JU5 A;  1THO A;  3M0F A;  3C71 A;  3KIJ A;  3DRN A;  2J9H A;  2QSI A;  4ML6 A;  3GKN A;  4OO4 A;  1N8J A;  2AV4 A;  4KDX A;  1V9W A;  5J9C A;  4YQU A;  3UOM A;  1OE7 A;  2X8C A;  3QFB C;  4WF5 A;  3GV1 A;  1PX7 A;  3OR5 A;  4CY8 A;  1FB6 A;  2CAQ A;  3LFL A;  2C3T A;  4WBJ A;  3ME7 A;  1B9Y C;  1MDJ A;  3TJG A;  3LQ7 A;  4QQ7 A;  3QAG A;  1A0R P;  4TXO B;  5EVO A;  1Z6N A;  2R0G A;  2OBI A;  4O7H A;  3N9J A;  1ST9 A;  2H1D A;  5CYY A;  3IA1 A;  5IPG A;  2IME A;  4EDZ A;  13GS A;  2JL4 A;  3DVW A;  4TKY A;  1ZZY A;  4X0X A;  2GGT A;  5ECR B;  3TCO A;  5KN1 A;  4OFT A;  1HNA A;  4POL A;  1FAA A;  1T7P B;  2GSR A;  1WWJ A;  10GS A;  1QK8 A;  4EKZ A;  3FY7 A;  3TKR A;  1SEN A;  4DSR A;  1TRV A;  2R5G A;  3ERG A;  2DJ1 A;  4K8M A;  5JCU A;  5CO3 A;  4ECC A;  5G5F A;  4L5O A;  1GTA A;  1Z7P A;  3GA4 A;  3FZ9 A;  2CVB A;  3FMW A;  1O81 A;  4HZ4 A;  2YJH A;  3ZYW A;  4HJ2 A;  2VCZ A;  2PUK C;  5G1K A;  6GSW A;  2LQQ A;  3FKF A;  4EF0 A;  5EPF A;  3HY2 A;  6GSU A;  1FOH A;  4AGS A;  1XW6 A;  3KTB A;  3P90 A;  5CRH A;  2KP1 A;  3KZQ A;  1PX6 A;  1AUC A;  2DKH A;  2CX3 A;  2FWE A;  4Z7X A;  1F6M C;  2GSQ A;  2FHE A;  2CA8 A;  14GS A;  3CTF A;  3BJ5 A;  3CSI A;  4F9Z A;  4HDE A;  3QCP A;  1Z3E A;  2GZZ A;  2M46 A;  2OE0 A;  3GN3 A;  2P5Q A;  2HRF A;  4TN8 A;  1ERW A;  1GTB A;  3HJO A;  3I69 A;  1ZYQ B;  1YEX A;  2YWM A;  4PXO A;  1TP9 A;  1URM A;  1LJR A;  4OWY A;  2X64 A;  4XCS A;  3VWW A;  4KF9 A;  2A4H A;  1V40 A;  2BJX A;  1BG5 A;  1GSU A;  3F6F A;  3KEB A;  5IMC A;  1OKD A;  3TOT A;  5D96 A;  5GAN D;  3TRP A;  1EWX A;  3WT2 A;  2F8A A;  3IBH A;  1M0U A;  4MF7 A;  1XBS A;  4WR4 A;  2C0G A;  2I81 A;  5LCZ A;  3P7X A;  1NHY A;  5AIV A;  4FYU A;  3HVV A;  2B5Y A;  2M80 A;  3TGZ A;  2CAI A;  4CY6 A;  2H74 A;  3DML A;  1PL2 A;  3TDG A;  1N2A A;  1MTC A;  2DJ0 A;  1NM3 A;  3UJ1 A;  4IJI A;  2B6M A;  3M3M A;  3FYG A;  4K0G A;  1KTE A;  4RQR A;  1O73 A;  1M99 A;  4NHW A;  2FA8 A;  2DJJ A;  2C0F A;  4Z2T A;  1TI3 A;  3FHK A;  1SK0 A;  4I5Q A;  2H0I A;  1V58 A;  4I8B A;  4MLY A;  1FOV A;  1X5C A;  2HI7 A;  5KN2 A;  4IGJ A;  1X5E A;  1W4V A;  2LNS A;  2YV7 A;  3R3E A;  2GSS A;  4ECI A;  2L6D A;  2C1Y A;  2DMM A;  1Z5Y E;  1ACV A;  1F2E A;  3GTU B;  2A2P A;  5DDL A;  4USS A;  5IMZ A;  2ON7 A;  2GQL A;  3VPQ A;  5J5N A;  2R37 A;  1SJZ A;  4TXO A;  1Q98 A;  4XRA A;  2RUF A;  3PPU A;  4MH3 A;  4PQH A;  4XS4 B;  2OJL A;  4LL1 B;  4MAB A;  2IMK A;  5E59 A;  4TVE A;  1HQO A;  4ZB6 A;  3UVT A;  4G0K A;  2MYG A;  2GQM A;  4IHU A;  2WCI A;  4P3Y B;  4OCF A;  4FYB A;  4GSN A;  5A4V A;  1NW2 A;  1JZR A;  1ILO A;  1S3C A;  2DLX A;  4DVC A;  5IOW A;  1WMJ A;  3GYK A;  3RAZ A;  1AW9 A;  4GWR A;  4O92 A;  5KEJ A;  1FB0 A;  4K9Z A;  3DXB A;  5H5S A;  3MNG A;  4POK A;  2B1K A;  1ZGN A;  4NHZ A;  3TUE A;  1A2M A;  3TJF A;  5DAL B;  4LLR A;  2V41 A;  1K0A A;  2VLT A;  4G9H A;  20GS A;  3D22 A;  2VAF A;  3EU3 A;  3DKS A;  1XOB A;  1ZYP A;  2EIR A;  3GKX A;  6GSV A;  5J3R A;  2I3Y A;  5KOW A;  5JCW A;  2FWH A;  3LEF A;  3ZRD A;  2AB6 A;  4ICY A;  4J56 E;  1OC9 B;  1JLW A;  4HEA 2;  1TTZ A;  2V32 A;  2GQK A;  2RM5 A;  3GUR A;  3IE3 A;  3LG6 A;  4GCI A;  1SJI A;  4EXJ A;  1PSQ A;  1F3B A;  1ML6 A;  2R0C A;  5B8B A;  2E0Q A;  4OFN A;  4K2X A;  2HSY A;  1XOA A;  4FQU A;  1M9B A;  1XIY A;  2G2Q A;  3IPZ A;  2YJ7 A;  3F8U A;  4V1A p;  1TRS A;  1AQW A;  4Q5R A;  3CRT A;  2FD3 A;  1YDK A;  3W8J A;  3AY8 A;  3MDK A;  5BRT A;  5B8A A;  5G31 A;  3PH9 A;  4TR1 B;  4LA1 A;  3TKS A;  3GHA A;  5ECM B;  3HDC A;  2H01 A;  3WGX A;  1WRY A;  4EIP A;  2ALB A;  3FZA A;  2O8V B;  5ECS A;  2LJK A;  2B3S A;  1TOF A;  2TIR A;  4MCU A;  2OE1 A;  3GST A;  1WIK A;  3VUR A;  3FZ5 A;  1ON4 A;  2IFQ B;  5IMD A;  2R0P A;  1WE0 A;  1UC7 A;  1WOU A;  1SK1 A;  2H6Z A;  3U5R E;  5A5K A;  5FWG A;  1M9A A;  1A8Y A;  2K8V A;  4HQS A;  4I2T A;  3TB2 A;  3SBC A;  3IRA A;  2YAN A;  2HT9 A;  1G7E A;  2A2R A;  2YPM A;  3UL3 A;  3IR4 A;  6GSS A;  1DE2 A;  3ED3 A;  4O5Q A;  4MJE A;  5HR0 A;  3CTG A;  5G2Z A;  4O32 A;  2H30 A;  2IMF A;  4N0V A;  4GQF A;  1XWG A;  2LRT A;  1B8X A;  1SYX A;  1GLP A;  3TRX A;  4F03 A;  2VIM A;  4ZIL A;  1O6J A;  1SL1 B;  2OAD A;  3D21 A;  4ZBD A;  5G30 A;  1VF2 A;  3QOU A;  5J41 A;  2UZ8 A;  4ZBB A;  1AIU A;  4HS1 A;  1GWC A;  2RM6 A;  3LXZ A;  1EV9 A;  1GNE A;  2YWN A;  4MMM A;  3A2W A;  4V2L A;  2LQO A;  3GTU A;  5ID2 B;  3PIN A;  3K8N A;  4IS0 A;  1F9M A;  2L5L A;  3EIN A;  3ZVJ D;  3QR6 A;  4AJ6 A;  3HYP A;  3EMX A;  2R3X A;  3A2V A;  3UMA A;  4AF2 A;  1MD4 A;  3C1R A;  4XS4 A;  1SYR A;  2FNO A;  4L8E A;  1M2B A;  4PUR A;  1I9D A;  4PNF A;  1ZOF A;  2GVP A;  4YAV A;  4MZW A;  4NPB A;  2H76 A;  1K3O A;  1T00 A;  4FYC A;  2ES7 A;  3BCK A;  3C73 A;  2F51 A;  4BPY A;  3FW2 A;  1SKR B;  3IV4 A;  3GIX A;  5DVB A;  2LEG A;  3L9S A;  4K7N A;  4JED A;  3PGT A;  4ZB8 A;  3GMF A;  3TOU A;  5HR3 A;  5F8B A;  2F9S A;  2CX4 A;  5GAP D;  4FIW A;  1YY7 A;  4Q5F A;  3QFA C;  4ML1 A;  3QPM A;  1XWA A;  1BQ7 A;  3O76 A;  2LV3 A;  5KOX A;  3FK8 A;  2ON5 A;  1Z6M A;  3UIW A;  4JBB A;  4TOP A;  4KND A;  1SJ6 A;  6GST A;  5HFG A;  3FRC A;  2X99 A;  1DE1 A;  4KX4 A;  4K7I A;  2CZ3 A;  5D8I A;  1GUL A;  5BMU A;  1GSS A;  2VL2 C;  4IEL A;  1GH2 A;  2H0G A;  5AIX A;  1BAY A;  3MSZ A;  1FO5 A;  2DC5 A;  3C1S A;  1SK2 A;  3F4T A;  4KSO A;  5F05 A;  1XVQ A;  1DBY A;  4MA9 A;  2LNT A;  1OC9 A;  1CQG A;  4E8H A;  1ZMA A;  2V6O A;  4E8E A;  12GS A;  1U3I A;  5J4U A;  4MZC A;  5G5E A;  3KMN A;  1QGV A;  2VL2 A;  1OC3 A;  4LMW A;  1UA5 A;  4J57 E;  1VF3 A;  3P2A A;  3TRQ A;  5DJM A;  2ZUP A;  4NWY A;  1GUM A;  1V2A A;  6GSX A;  5ABR A;  3GUS A;  1XWK A;  3BOA A;  3WGD A;  2B5E A;  1K0B A;  2LRN A;  2NDO A;  2BTO T;  2I9H A;  2K18 A;  1W89 A;  3A5W A;  2KOK A;  5J9B A;  1TK0 B;  4G2E A;  2FY6 A;  1K0O A;  4GRF A;  3F6D A;  2RUE A;  1TRU A;  1YEP A;  2VO4 A;  3KH9 A;  1B4P A;  3TKQ A;  3H8Q A;  1C72 A;  2LUS A;  7GSS A;  1QQ2 A;  4LL4 B;  4F2I A;  4JZQ A;  3LSZ A;  3MIX A;  1YF1 A;  3ZIV A;  2IFQ A;  3TJB A;  3VLN A;  2B7K A;  3TJJ A;  2EC4 A;  1PN9 A;  2DJ2 A;  1O7U A;  2FWG A;  2GZP A;  5A4U A;  2YOI A;  3ERW A;  3IC4 A;  1TRW A;  1EOG A;  2JSY A;  5DCG A;  2DML A;  3U6V A;  1VRS D;  4MJA A;  1HNB A;  1XCC A;  2MMO A;  5IIZ A;  3IK7 A;  1WPI A;  4OCE A;  5D9W A;  3A5I A;  4XTS A;  3VWU A;  4RUV A;  1GSQ A;  2A2S A;  2HLS A;  2IMI A;  1NSW A;  5GSS A;  2H0H A;  2ZNM A;  4JE1 A;  1KEB A;  3ZMK A;  3ZML A;  3FR9 A;  5D9T A;  4KH7 A;  3HZ4 A;  2A4V A;  1RK4 A;  3CXG A;  4IP6 A;  3ZVJ A;  2WGR A;  4OD7 A;  3LXT A;  8GSS A;  2RLI A;  2O85 A;  3HJM A;  4GXZ A;  2HRN A;  5F06 A;  2MBT A;  2HZF A;  3D6I A;  3HJP A;  3H79 A;  2I1U A;  3US3 A;  1U87 A;  3F3Q A;  5HQP A;  1TU8 A;  3D4M A;  5ID2 A;  1BED A;  3LWA A;  1AXD A;  1TJD A;  2L4C A;  1UVZ A;  4J2F A;  2FLS A;  4WKW A;  5D9X A;  1X9W B;  2C0E A;  3F9U A;  5DQY A;  1ERU A;  2NVL A;  2YZU A;  2HNL A;  2B7J A;  3GH6 A;  2WRT A;  2C3N A;  3KM6 A;  1OC8 A;  5HR1 A;  2GT6 A;  3GL3 A;  3GX0 A;  4NXI A;  17GS A;  5EL8 A;  1XPV A;  3CRU A;  2LJA A;  1OKT A;  2QC7 A;  2BMX A;  3L9V A;  2JZS A;  4BVX B;  1A24 A;  3MYD A;  2QKE A;  3D5J A;  3RPN A;  4MZB A;  5HFK A;  3IC8 A;  2DKI A;  2DIZ A;  2PU9 C;  4CDO A;  4ZL9 A;  4IP1 A;  2KLX A;  2REM A;  3FZ4 A;  4HUA A;  1SD9 A;  11GS A;  2L5O A;  2H71 A;  1OVN A;  4HZ2 A;  1USB A;  2LS5 A;  1KBN A;  5IO0 A;  4YQV A;  2H6Y A;  3A3T A;  5DCH A;  1LU4 A;  3VPT A;  3VI7 A;  3H1N A;  1XXU A;  3WYW A;  2AUV A;  3C8E A;  3F3R A;  2V6K A;  4IQA A;  5IO2 A;  2GTU A;  5IOX A;  3DGQ A;  3E0U A;  4G10 A;  2GDR A;  2C80 A;  2JSZ A;  1A23 A;  4RI6 A;  4XHM A;  1FVJ A;  4IVF A;  2MMN A;  4ULX A;  2NPB A;  1PGT A;  3JCM L;  4IQ1 A;  2H19 A;  1TK8 B;  1PL1 A;  2RII A;  2JZR A;  4Z2U A;  1K3L A;  5H5Q A;  4N11 A;  3NZN A;  1BX9 A;  3LYP A;  3HVS A;  1JFU A;  3WD6 A;  2CZ2 A;  4BVY B;  4LMV A;  1Q4J A;  4AJ7 A;  1MDI A;  2HZE B;  1AQV A;  2VLV A;  2F3M A;  4EVM A;  1GL8 A;  3APS A;  4L0W A;  1V98 A;  2H70 A;  3GSS A;  2XBI A;  2PVQ A;  3MWH A;  3HA9 A;  1E2Y A;  4MP4 A;  1O8X A;  3KJY A;  3QDN A;  4NMU A;  1EGO A;  5A4W A;  3QAW A;  2HSM A;  2DBC A;  1O8W A;  1ZYN A;  1B48 A;  2E7P A;  5D9V A;  3TKS C;  4NV5 A;  1R7H A;  3UBK A;  4TR0 A;  1PKW A;  3HHV A;  3UAR A;  3KGK A;  3NIV A;  3GX8 A;  2IWT A;  3IHQ A;  2L6C A;  2DSA A;  4TRX A;  1G6Y A;  2N5B A;  3RHC A;  3KD0 A;  4YH2 A;  3EVI A;  4Q5N A;  2B1L A;  4NV2 A;  3EE2 A;  4X43 A;  1FG4 A;  1H75 A;  2JU5 A;  1VF1 A;  2H1B A;  1GTI A;  4TXV A;  3CYN A;  3ZFL A;  1YQ1 A;  1GSD A;  1HYU A;  1XW9 A;  3PR8 A;  1BJX A;  1A8L A;  2V1M A;  2N5F A;  1EV4 A;  2VD0 A;  4ZL7 A;  3L4N A;  3RHB A;  4JRR A;  3EU4 A;  2WUL A;  3IXR A;  4YKG A;  2C0D A;  5AGY A;  1ZCP A;  2CQ9 A;  2MZC A;  2O87 A;  1PQN A;  1YZX A;  5ECH B;  4I6X A;  2I4A A;  4V1A g;  4MJC A;  4XS1 A;  2HSH A;  2GZY A;  3LOR A;  4GF0 A;  4O5R A;  2MBS A;  4N0Z A;  1H4O A;  1TKD B;  3CSH A;  2VCT A;  1GNW A;  4G0L A;  2O7K A;  4L0U A;  1JLV A;  1QFN A;  3WGE A;  1A2L A;  2GLR A;  2ZCT A;  1JZO A;  3GL5 A;  2PMT A;  4CW9 A;  4NAX A;  1M2A A;  1U88 A;  1TDI A;  16GS A;  1RW1 A;  4X4J A;  1R5P A;  2FWF A;  3RPP A;  5DAK B;  4KA0 A;  2YWO A;  1IYI A;  1T8E B;  4XS6 A;  4BVX A;  2GS3 A;  5CNW A;  5DJL A;  3SWL A;  3ISO A;  1FW1 A;  4K5R A;  5CRG A;  2VUP A;  1T1V A;  1SD8 A;  2E2M A;  4F0C A;  4F0B A;  4N10 A;  3GFK A;  2WJU A;  1V57 A;  2VCV A;  1EP8 A;  1S3D A;  2TRX A;  4OFM A;  5ENU A;  3VI5 A;  1U3A A;  5B6N A;  2JAC A;  3M9K A;  1G6W A;  3G7Y A;  3Q18 A;  4ECB A;  4IBP A;  2K8S A;  1U6T A;  3RDW A;  4Z2R A;  1G0T A;  3FR3 A;  2KUC A;  4KAE A;  5CRW A;  4QL9 A;  4K0N A;  4EIQ A;  4PTS A;  5H5R A;  2QA1 A;  5JWQ B;  1R5A A;  3VWX A;  4F82 A;  4KCA A;  4H86 A;  5AIS A;  5CAX A;  2H1A A;  4MF5 A;  5IQY A;  4I2U A;  1A2J A;  2OKA A;  2IMD A;  5CP1 A;  3D0Z A;  3VK9 A;  1K0M A;  1EEJ A;  2VOC A;  3IK9 A;  1XVW A;  1T4Y A;  2YN1 A;  2AYT A;  2C8U A;  5DAL A;  2CT6 A;  4BVY A;  1KNG A;  3QMX A;  4D73 B;  4IN0 A;  4WBR D;  2X8G A;  2HZE A;  2FCH A;  2AJQ B;  3Q19 A;  3HKR A;  3M1G A;  5LNK e;  3APQ A;  3TKS E;  4DEJ A;  4BWS A;  1FVK A;  3O3T A;  4WET A;  3G9B A;  5B6M A;  1WJK A;  2LST A;  5AN1 A;  3EPT A;  2FA4 A;  1G7O A;  2VL9 A;  3KXO A;  2C4J A;  1SKS B;  2VD1 A;  1M7T A;  4HI7 A;  1EGR A;  5IMA A;  1PD2 1;  1GP1 A;  2QA2 A;  4YAP A;  4DSQ A;  3EC3 A;  1SKW B;  2LKU A;  4GQC A;  1ERV A;  4Q5Q A;  3ZL5 A;  2EIQ A;  5F07 A;  4JR6 A;  2TRC P;  3ZLP A;  4PGT A;  1X0R A;  1YKC A;  4MJB A;  1ZL9 A;  1B4Q A;  3QD9 A;  1YJ6 A;  5E4W A;  4HQZ A;  4TR1 A;  2H72 A;  1MDK A;  5ECP B;  2X49 A;  1LBK A;  1AC1 A;  3IHG A;  2WDU A;  1WP0 A;  3GKK A;  4DSS B;  5FT3 A;  4RQX A;  3DEX A;  1SU9 A;  4X1U A;  1QUW A;  2AHE A;  1TW9 A;  3BD2 A;  4V2N A;  1QMV A;  2PGT A;  4K2D A;  2XPD A;  3KP9 A;  1M2D A;  1XW5 A;  1EEM A;  2J23 A;  3V1W A;  1GTU A;  1T4Z A;  4L5L A;  5IMF A;  4O5U A;  4AJ8 A;  4K6X A;  1J9B A;  3IAM 2;  2PER A;  3R2Q A;  3LJR A;  1HNC A;  1GRX A;  3Q74 A;  3IOS A;  4IW9 A;  1OE8 A;  3APO A;  3RBT A;  4ZIJ A;  4RI7 A;  4ZXG A;  4KE3 A;  2B5X A;  3H4K A;  1GSE A;  4MF6 A;  5ECI B;  5ELG A;  4N30 A;  2DIY A;  2EIO A;  2H73 A;  1XWB A;  1GSY A;  1K0C A;  4MNN A;  3J7Y k;  1YF0 A;  5C04 A;  1UN2 A;  1MD3 A;  2H8L A;  1PRX A;  3GKM A;  5ECO B;  5DAK A;  4HJM A;  4BA7 A;  4YQM A;  3ME8 A;  5L71 A;  4PUA A;  3BCI A;  2VCW A;  4MH2 A;  4MDC A;  2DJK A;  4EUY A;  2XC2 A;  2PWJ A;  1SL0 B;  5INY A;  2YWI A;  2P0G A;  2CVD A;  1R26 A;  4ID0 A;  3EMP A;  2VL3 A;  3G7J A;  5ECN B;  2YCD A;  5JCG A;  2GST A;  4GST A;  1ZYE A;  3ZTL A;  4GLT A;  4KB3 A;  2VLU A;  3F4S A;  4XRD A;  4EDY A;  4PQ1 A;  3ZRE A;  1K0D A;  5DQS A;  3UBL A;  1EZK A;  3A2X A;  2WZ9 A;  4PNG A;  3ZFB A;  2VM2 A;  3LW9 A;  4TR3 A;  3VFI A;  2G0F A;  2MMZ A;  4MPF A;  2OBK A;  2DJ3 A;  4K5S A;  2YZH A;  4ISD A;  1AAZ A;  2IJY A;  2OA7 A;  3HD5 A;  4EC0 A;  3M9J A;  1PMT A;  2LTK A;  2E2G A;  4ILF A;  1Y25 A;  3FEU A;  3GRX A;  3EUR A;  4PUF C;  2MMA A;  4PQI A;  2OE3 A;  3FR6 A;  3L78 A;  3C7M A;  2KP2 A;  2AAW A;  2D2Z A;  4BL7 B;  3W6G A;  2PN8 A;  1K3Y A;  9GSS A;  1DSB A;  1NHO A;  5DBQ A;  2XPE A;  4ECJ A;  4D73 A;  1XZO A;  4CHS A;  5KN0 A;  1PKZ A;  1R4W A;  3MAK A;  1TU7 A;  2IPA A;  2GT5 A;  2QGV A;  4V2M A;  1MEK A;  3HVX A;  1JZD A;  3I6A A;  2H1G A;  2Z9S A;  1TI1 A;  3IDV A;  2K6V A;  4GTU A;  3ZIJ A;  1TXX A;  4ZL8 A;  1GLQ A;  2HE3 A;  5KN3 A;  4G0I A;  2WS2 A;  2K9F A;  22GS A;  1ABA A;  5HFI A;  1VGL A;  1O85 A;  5CRE A;  2L4Q A;  2L59 A;  2VM1 A;  4ACS A;  5CRD A;  1THX A;  5EY6 A;  3UAP A;  4FH8 A;  4KUN A;  2LJR A;  3O6T A;  2V2G A;  5IM9 A;  5JWO B;  5JWR B;  3EYT A;  2PVO C;  4KW6 A;  2IN3 A;  2IL3 A;  2YP6 A;  1RQM A;  1Z7R A;  4FO5 A;  4KDY A;  2YV9 A;  4DSS A;  2NTO A;  1ERT A;  4GSS A;  4WEY A;  3E9J B;  2IIY A;  2VCX A;  5FHI A;  1S3A A;  1JHB A;  5LD0 A;  2PBJ A;  2XHF A;  3LGC A;  4WXT A;  1F3A A;  2KHP A;  3E3E A;  2FGX A;  2P31 A;  3HXS A;  1XWC A;  4QL7 A;  1X5D A;  5COH A;  4HU9 A;  3D4T A;  2OAC A;  1F37 A;  4KGI A;  3DIE A;  2H6X A;  2R4V A;  1AQX A;  4EO3 A;  3L9U A;  2HFD A;  4KDU A;  5D93 A;  2M72 A;  1SL2 B;  5ELA A;  4K7O A;  3G7I A;  5GST A;  2CVK A;  2NBS A;  1PN0 A;  4IJ3 A;  3UEM A;  2F8F A;  4KSM A;  5IPH A;  3I43 A;  3TKP A;  1B9X C;  19GS A;  4EE0 A;  1OAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...