3ZTLA

Crystal structure of decameric form of peroxiredoxin i from schistosoma mansoni
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
180
structure length
180
Chain Sequence
LLPNRPAPEFKGQAVINGEFKEICLKDYRGKYVVLFFYPADFTFVCPTEIIAFSDQVEEFNSRNCQVIACSTDSQYSHLAWDNLDRKSGGLGHMKIPLLADRKQEISKAYGVFDEEDGNAFRGLFIIDPNGILRQITINDKPVGRSVDETLRLLDAFQFVEKHGEVCPVNWKRGQHGIKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN PEROXIDASE
publication title Moonlighting by Different Stressors: Crystal Structure of the Chaperone Species of a 2-Cys Peroxiredoxin.
pubmed doi rcsb
source organism Schistosoma mansoni
total genus 56
structure length 180
sequence length 180
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ztlA00
1T7PB 3F6DA 4KW6A 4WEYA 4LL1B 3EWLA 3KMNA 3F0IA 1HNAA 4NXIA 3HY2A 5HR3A 1TRWA 1PA3A 3ZFBA 2J9HA 3KIJA 3GSSA 2ON5A 4EO3A 3ZLPA 3UOMA 3TJBA 3KTBA 1T1VA 3KXOA 3MAKA 2FWHA 2ZUPA 5GSTA 2H0IA 1CQHA 3D0ZA 3APOA 2DIZA 3BCKA 5INYA 2JSYA 5GZZB 3M8NA 5CRHA 5JWRB 5CP1A 1W89A 2E0QA 4PURA 2YNXA 2EC4A 2HYXA 1R4WA 3F9UA 3PR8A 1E6BA 5GAND 1PKZA 2GSTA 1A2JA 2CZ2A 4EE0A 2LJAA 2K18A 1GRXA 4X43A 4E8HA 4KDUA 2LTKA 3ZZXA 1TRUA 5AISA 4XIHA 2N5AA 1BQ7A 1A0FA 5FHIA 5G2ZA 3C8EA 2GSSA 3FR6A 4EXJA 3DKSA 4YQVA 4PNFA 2GSRA 2IFQB 4TR4A 1A8LA 2LV3A 5D9VA 2VL2C 3LYKA 5ID2B 2IFQA 4ZBDA 5D9XA 1A24A 5FT3A 4K0NA 2H1GA 2X99A 5ID2A 4IBPA 3IAS2 4KSOA 1KTEA 3F4TA 4K8MA 4I2TA 3IC4A 3CTGA 1U6TA 4HQZA 4ZXGA 1HNBA 4YH2A 3HZ8A 2FNOA 1YF1A 2XHFA 3KP8A 4OCEA 1BYEA 1H4OA 3WYWA 2H0HA 1PMTA 2DJ0A 4MF7A 4ILFA 4WXTA 2C80A 4HQSA 2LEGA 4D73B 1FB6A 1YQ1A 3IE3A 4N0VA 1TRVA 4POMA 5ECKB 2H76A 5J4UA 4D73A 4TR1B 4IP1A 1SK2A 1Q4JA 3NIVA 3TRXA 1GUHA 2B1KA 4TR1A 2I1UA 1XIYA 5IPGA 3QFAC 2V2GA 4GSTA 4EUYA 4PGTA 4BVYA 5IMDA 2JZTA 4FH8A 4GLTA 2L57A 1OAZA 2GQKA 5J5NA 2YWOA 2OBKA 2R37A 1TK5B 2GT6A 2CVKA 4FYUA 1VF1A 1BG5A 3KP9A 1SENA 3GV1A 4O32A 2RUFA 4OO5A 1UC7A 14GSA 2LSTA 1V9WA 5D9TA 2H73A 3NOFA 2L6DA 4MCUA 4IS0A 1XOAA 2JSZA 3BCIA 1EV9A 3GFKA 1U3AA 3VPTA 3UJ1A 4LMWA 3TKSE 3HJOA 2RM5A 1T00A 1JZRA 1B48A 2LQQA 2MMOA 4JR4A 1AW9A 2VUPA 3VWWA 5IMVA 1HD2A 4RQXA 5IMAA 2WZ9A 11GSA 3GH6A 2GLRA 3I43A 4GCIA 3HJMA 2FGXA 1HNCA 5ECIB 5CRDA 5COHA 1GSEA 3VWXA 5DCHA 2NVLA 1F37A 2NBSA 1O85A 2J23A 1GSDA 2VCTA 3GRXA 1GNWA 4EL1A 4BPYA 5ENUA 4XS4B 4AF2A 1SYRA 3TDGA 2DJ2A 3LWAA 3R2QA 3GNJA 3EYTA 4XS4A 3RPPA 4F82A 2CT6A 3M3MA 2IL3A 2AJQB 3TKSC 4Q5QA 4HOJA 3KGKA 2DC5A 4RUVA 1VF4A 3ZMLA 5DQSA 2H01A 1SU9A 1V98A 2IN3A 1NSWA 2V6KA 1IYHA 1WMJA 1K0MA 3C1SA 4HU9A 2TRXA 3FR3A 4TXVA 3KTLA 1TTZA 1USBA 6GSYA 2AV4A 3A2WA 5JWOB 3CXGA 3WD6A 3HCZA 3HXSA 2K8SA 1O7UA 4F0CA 3FY7A 2KP1A 5HR1A 2IPAA 1ILOA 1SJIA 4BL7A 1J9BA 2EIOA 1Z5YE 2MBTA 1B8XA 4O5RA 1JZOA 1M2AA 3GKMA 1X9WB 4YQUA 2JL4A 2V41A 2O8VB 4N10A 1J0FA 3Q74A 5DBQA 4OCFA 2K9FA 3D4TA 4FIWA 1K0BA 4QL9A 2CQ9A 2ON7A 2LUSA 5EVOA 3P8WA 4TVEA 4NHZA 4ZB8A 2HZEB 2H6YA 3VFIA 3U6VA 4ZBBA 4AGSA 2VLVA 1TJDA 5JCGA 5A4WA 5CREA 4H86A 1RW1A 4GSSA 1AQWA 4WR5A 1G6YA 4IELA 2HZEA 1HQOA 2OADA 3RPNA 4TR3A 3G9BA 2CAQA 2XPDA 3ERGA 12GSA 3IV4A 1EEMA 4KAEA 2H30A 5ELAA 5IPHA 3F4SA 5H5SA 1MTCA 1X5CA 4KA0A 1PD21 2GQLA 1B4QA 4KGIA 5IIZA 3LXZA 2HNLA 19GSA 1T4YA 4CDOA 3LORA 4WBRD 2N5BA 4K7OA 1NHYA 1M9BA 2IMEA 3GN3A 3IBHA 2FHEA 3HKRA 4IGJA 1URMA 1XW5A 3GSTA 2B3SA 1X5DA 3EE2A 3UIWA 4KE3A 1GSUA 3MNGA 3ME7A 1EP8A 2VCZA 6GSSA 4WF5A 2C0DA 2M46A 1WRYA 3ZRDA 2DMLA 5KEJA 4KX4A 1SL0B 4XTSA 1WJKA 5D9WA 3IOSA 5IMZA 3F3RA 2N5FA 2HSHA 4IJIA 3WT2A 3I9V2 5CRGA 1G7OA 1G0TA 2HRFA 1V2AA 2VM2A 5KN1A 1TP9A 2H0GA 2V32A 3LEFA 4GQFA 1AUCA 3LG6A 5IM9A 2OJLA 1A8YA 2VD0A 1DSBA 5F0GA 1R5AA 2B5EA 2TRCP 5ECLB 4ML1A 4MJBA 3GMFA 3GUSA 1WP0A 1MDIA 3KMOA 3D4MA 1PL1A 1TDIA 4K9ZA 1X5EA 2F8AA 4JZQA 3G7YA 2H1BA 1Y25A 5CO3A 2AB6A 2L6CA 1F3AA 3CSJA 1ZL9A 1XWGA 2VL3A 2GGTA 2GZYA 20GSA 4GRFA 3TOUA 1OE7A 2EIRA 2G0FA 5ECQB 1G7EA 3N5OA 3IR4A 4WKWA 4ZB6A 4LA1A 1FW1A 3BD2A 2VL9A 1H75A 2L4CA 3TB2A 4ECBA 1OC3A 1WPIA 1J08A 1PL2A 5ECRB 3KCMA 2RIIA 1WWJA 2XBQA 6GSVA 3E3EA 1YJ6A 3VURA 5DQYA 3LGCA 2VO4A 4K2DA 5DAKB 1O6JA 4LLRA 1S3CA 2NTOA 3DYRA 4WBJA 1SK0A 5DAKA 2HLSA 2C4JA 3BJ5A 2GQMA 4LMVA 5DJMA 1XXUA 2KOKA 2BMXA 4NV5A 4RQRA 2LRTA 4TOPA 1EEJA 4MA9A 5ECNB 2LNSA 5H5RA 4MP4A 1HYUA 2HE3A 6GSTA 5LD0A 6GSXA 3SWLA 3Q18A 3QPMA 1GTIA 2K6VA 8GSSA 3C73A 1VRSD 4IQAA 4MABA 1MDKA 1F6MC 3ZREA 2R4VA 3UAPA 3GL5A 1WE0A 4OD7A 4KDYA 4DSRA 3GKNA 5IOXA 5ECOB 3QD9A 3J7Yb 3VK9A 4KSMA 3IPZA 2C3QA 2M80A 1U3IA 2CAIA 5DVBA 1TKDB 2I4AA 2FCHA 2DMMA 4Q5NA 4OMVA 5KN0A 4KH7A 2F8FA 4GWRA 2DBCA 5HFIA 2YCDA 4Q5FA 3D21A 1VF3A 1F9MA 3LQ7A 3H79A 4XRAA 3P2AA 1RK4A 4OFNA 3QAVA 1SKWB 1B9XC 1WIKA 4HEA2 5FWGA 2HFDA 2HT9A 3FZ9A 1G6WA 4EF0A 2MMNA 3L9UA 2C0FA 1TU8A 4F03A 2A4VA 1NHOA 5B8AA 2YV7A 4KDXA 1Z3EA 3TJJA 3VI5A 3KD0A 4XS6A 1XVQA 1QUWA 3L9VA 2DJ1A 5B8BA 4L0WA 18GSA 2C0EA 4HI7A 2R2JA 4ZB9A 5J9CA 1EOGA 2WGRA 4HUAA 3TGZA 5G5EA 3U5RE 4EDYA 1EP7A 2VAFA 4ECCA 3Q19A 3H4KA 5G30A 4BWSA 4I97A 4RI7A 1R7HA 3CRTA 3D5JA 3QR6A 3F3QA 4CW9A 2WB9A 4V2NA 2KP2A 1B4PA 4KB3A 2G2QA 5GAPD 4EC0A 4OFTA 4LL4B 3GA4A 1NM3A 5HFKA 3W6GA 5D96A 3CSHA 5EL8A 2YV9A 5AIVA 3V1WA 1MD3A 5DALB 4IJ3A 1DBYA 4BWQA 4WR4A 2VCXA 1N2AA 1V58A 4FYBA 3L4NA 3TUEA 1F2EA 4POLA 1S3AA 4EKZA 1XVWA 4MDCA 3M1GA 2AYTA 2D2ZA 4NWYA 2LQOA 1CQGA 6GSUA 3FRCA 2YOIA 1PRXA 1OE8A 1U87A 1EZKA 2RM6A 4ULXA 3TRPA 3UL3A 5J3RA 4PXOA 2GDRA 5AIXA 4MH2A 2DSAA 2WJUA 1GNEA 2LRCA 1JZWA 1TI1A 3LJRA 1JLVA 2OA7A 1TK8B 4KCEA 2HSYA 3C7MA 4BA7A 3HHVA 5ECPB 1AAZA 3QAWA 2CX4A 4TXOB 3AY8A 2DIYA 4TXOA 1SL2B 4NPBA 5B6NA 4NHWA 1FHEA 1PGTA 2HXKA 1XPVA 1YZXA 4L0UA 2VCWA 4DSQA 3UVHA 4JU5A 2JU5A 4J56E 5LNKe 2YWNA 5IQYA 4AJ6A 1THOA 4J57E 4PUAA 3EINA 3HA9A 3MSZA 1EWXA 3RAZA 1AQXA 4IVFA 4MZBA 5A4VA 1E2YA 2X64A 3BBYA 3FKFA 4HJ2A 1R26A 1SL1B 1A23A 2F51A 1JFUA 2H74A 2LRNA 2PU9C 4E8EA 5G31A 5C04A 1ZMAA 4I6XA 2CVBA 1OKTA 4JBBA 4IP6A 4V1Ap 3TJGA 4TKYA 3E9JB 4POBA 1UVZA 1ERUA 4XHMA 2OKAA 1EOHA 2B6MA 3UBLA 1M99A 4MPFA 1GUKA 3CRUA 2QC7A 2QSIA 2VD1A 4DEJA 5KN2A 3CBUA 1T3BA 3EU3A 4ZILA 3JCML 3APSA 2REMA 3ZTLA 2GS3A 3DD3A 1X9SB 1GH2A 2H1DA 1OKDA 1BX9A 1ZYEA 3C71A 1YEPA 3G7JA 4NAXA 1T8EB 4F0BA 2YZHA 2O7KA 1QFNA 2FWEA 3I69A 4QQ7A 4MZCA 3ZITA 4MZWA 1LJRA 2YPMA 1UA5A 4PQHA 3TRQA 5IOWA 5HQPA 1Q98A 2BJXA 4IHUA 3DEXA 2PERA 5IMCA 1YY7A 4MJAA 2B7JA 2V6OA 1SKSB 1O8WA 2OBIA 3IHQA 3QOUA 2OE1A 2C8UA 5E59A 3QCPA 1DUGA 4IQ1A 4O7HA 1ZGNA 1K3YA 2DJKA 3GTUB 1JZDA 5J41A 3L78A 3IK7A 2FA8A 3GTUA 1SK1A 2R5GA 1ZOFA 4JRRA 2MMAA 5DCGA 2B5YA 2KUCA 4G2EA 3IRAA 3CYNA 1XBSA 2RUEA 1FOVA 2H8LA 2O87A 4WF4A 5G1LA 1FB0A 1LBKA 5CNWA 4KNDA 2XBIA 4ZIJA 3TJKA 1TW9A 2C1YA 3VWVA 1QK8A 3I6AA 1MD4A 4K7NA 3EMXA 2B1LA 5JWQB 3BOAA 1EV4A 2MMZA 1ERVA 1F3BA 2FUG2 2YJ7A 3CSIA 1Z7RA 2C0GA 2TIRA 1GUMA 1SJZA 3O6TA 2ZNMA 1GSFA 4GXZA 3IAM2 4OO4A 4KCAA 4ZBAA 1YDKA 2MYGA 2L4QA 2VLUA 4MF5A 2PN8A 3DVXA 1YKCA 2ES7A 3EMPA 1K0CA 4FYCA 4AJ8A 3FHKA 3ZIVA 5CAXA 1QQ2A 3EURA 1XCCA 2ALBA 1O73A 4IW9A 4L8EA 2OE3A 1XWAA 4WETA 2VLTA 4N30A 2LNTA 3E0UA 3ZMKA 4Z7XA 2AAWA 1GTBA 5D93A 2YWMA 4ZL9A 2A2SA 4HDEA 3RHCA 10GSA 1GWCA 4N11A 2H75A 2DJJA 3ZIJA 3W8SA 4PQ1A 2H66A 3DVWA 1GP1A 1Z9HA 2CV4A 4J2FA 4N0ZA 2IMDA 1W4VA 4HU7A 3ISOA 4ID0A 4IKHA 3APQA 1PN9A 2HI7A 3HZ4A 2MZCA 4RI6A 2FA4A 4P3YB 5IMFA 4F2IA 2IWTA 3ME8A 2PWJA 2FY6A 1QGVA 2H1AA 3QAGA 1FAAA 4GQCA 3W8JA 1C72A 4ML6A 1M9AA 5E4WA 5ECHB 7GSSA 3GYKA 4JR6A 1K0AA 2H71A 5A5KA 2FD3A 2O89A 1XZOA 3GKKA 4YQMA 5J9BA 1SYXA 5ABRA 3NZNA 3QDNA 4IN0A 2WRTA 2YZUA 1XOBA 2IMIA 1MDJA 4GSNA 1QXHA 3KEBA 5D8IA 2F3MA 2CX3A 4MJCA 2IIYA 2B7KA 4MMMA 2A2RA 1PX6A 1DE1A 3M9KA 1LU4A 4MLYA 1GLPA 6GSWA 4ACSA 3ZYWA 3IXRA 1YEXA 5HR2A 4ZL8A 5D73A 5F05A 1DE2A 3H1NA 4YAVA 4MPGA 2P5QA 2E2MA 1V57A 1GTAA 1Z6MA 3IK9A 1NW2A 2DLXA 2LJKA 2WFCA 4TR0A 3ZVJD 3RDWA 5F8BA 2YWIA 2JZSA 4L5LA 1K0OA 4YAPA 2L5OA 1K0DA 3HD5A 1Z7PA 4MK3A 1XWKA 1ST9A 4DSSB 3WGEA 4OWYA 1PKWA 5JCWA 1GULA 4DSSA 2GTUA 3IA1A 3VI7A 4O92A 2XC2A 5DJLA 1FVJA 2CA8A 2JACA 1PSQA 3HVVA 5A4UA 3C1RA 3K8NA 4QL7A 4NV2A 1I9DA 3WT1A 4POKA 2YP6A 2FWFA 3A2VA 5F06A 3LYPA 4TRXA 2NPBA 3DMLA 3ZFLA 4I5QA 1SD8A 1FVKA 3QFBC 2H6ZA 3GHAA 4AJ7A 5KN3A 1VF2A 2IMFA 1ERTA 3GL3A 3IDVA 1EGOA 1PX7A 5CYYA 2VL2A 1YF0A 1BJXA 1K3LA 1SKRB 1UN2A 3US3A 2JADA 2AUVA 1ZYQB 2HZFA 4X0XA 3M0FA 4XCSA 2M72A 2CZ3A 2OACA 5CRWA 3DIEA 1V40A 4MH3A 3VPQA 5DALA 4DVCA 4V1Ag 3DRNA 3S9FA 2B5XA 1ABAA 5B7CA 1AC1A 3FW2A 4NMUA 3F4RA 1U88A 2X8GA 4CHSA 3EU4A 3TJFA 1M2BA 1WOUA 3L0HA 3TOTA 1Y6EA 1OYJA 5LCZA 2H6XA 13GSA 4K0GA 2C3NA 3D22A 2MBSA 3L9SA 4BVXA 3UVTA 2P5RA 3FR9A 1GL8A 3ERWA 3ZL5A 3A3TA 3H8QA 1AIUA 1K0NA 1TXXA 2VOCA 2YN1A 2RLIA 2KLXA 3GX0A 3F6FA 2VCQA 2BTOT 3G7IA 2L59A 1AXDA 4F9ZA 2F9SA 3PINA 2PMTA 1B9YC 1KNGA 4V2LA 4XS1A 1JHBA 2PPTA 4L5OA 3LSZA 4K1FA 4EVMA 4Q5RA 1GSQA 4X1UA 3DXBA 2FLSA 5C00A 3WGXA 3UEMA 3FZAA 3RHBA 5GSSA 2X8CA 3UARA 3ERFA 2PVOC 3KJYA 5H5QA 3DGQA 2V1MA 2GVPA 4MJEA 1ML6A 4HJMA 2WULA 3LXTA 2YANA 1XWBA 3EVIA 1KBNA 4OFMA 1M2DA 1QMVA 1IYIA 2R3XA 2R6KA 2Z9SA 1SD9A 3H93A 5ELGA 2DJ3A 3CMIA 2CVDA 1XW6A 1BAYA 3FZ4A 4G19A 4ZL7A 3VWUA 2GZPA 2WDUA 2ZCTA 1SJ6A 3KZQA 1GLQA 5EPFA 2H70A 1ERWA 3MWHA 1OC8A 1S3DA 1M0UA 1I5GA 4G10A 5G1KA 2HRNA 2WCIA 2LJRA 2E2GA 1ON4A 1EGRA 2VIMA 1TI3A 3HVSA 1BEDA 3LFLA 3N9JA 4ECJA 4I2UA 4HZ2A 2FWGA 2NDOA 4PUFC 3UMAA 2QKEA 4HS1A 1ZCPA 3EC3A 2LKUA 1N8JA 3HDCA 4EDZA 5ECSA 5JCUA 2PBJA 2YJHA 1OC9B 3TKSA 3J7Yk 2PGTA 3WGDA 2JZRA 2K8VA 2I9HA 2WS2A 2LS5A 1VGLA 1OC9A 1K3OA 4ISDA 3GX8A 3TKRA 1A0RP 22GSA 2GSQA 2XPEA 4GTUA 1M7TA 17GSA 1GSYA 3DWVA 1XW9A 4XRDA 1PQNA 3PH9A 1ACVA 5HR0A 3UBKA 5DDLA 3KH7A 3PGTA 2OE0A 5B6MA 4MF6A 2QGVA 1THXA 1O8XA 3GURA 1OVNA 3M9JA 5EY6A 1AQVA 2VM1A 4TW5A 5HFGA 5AGYA 2H19A 3FK8A 3O3TA 4GF0A 2EIQA 1X9MB 4PX1A 1TK0B 2GT5A 3A5WA 3P7XA 1FG4A 1T4ZA 5IO0A 3GKXA 3SBCA 2PUKC 1JLWA 1MEKA 2E7PA 16GSA 2P31A 4I8BA 1GTUA 3HVXA 4JEDA 9GSSA 3KM6A 5L71A 4JE1A 3TCOA 4K6XA 5IO2A 3QMXA 3TKPA 1ZZYA 1XWCA 1TU7A 1XFLA 2P0GA 2PVQA 4ECIA 2KHPA 1Z6NA 3KH9A 2AHEA 3MDKA 2I3YA 1O81A 3FZ5A 3OR5A 3FYGA 3CTFA 3F63A 1YKAA 2I81A 3ED3A 3P90A 4FO5A 3FEUA 4K7IA 4TN8A 2X8HA 3Q6OA 2C3TA 2L5LA 1GSSA 5ECMB 3TKQA 1A2LA 3O76A 5AN1A 1TRSA 2IMKA 3HJPA 4PQIA 4KUNA 2GZZA 2IJYA 5G5FA 2VCVA 4PNGA 4G9HA 1TOFA 5F07A 3F8UA 1R5PA 3VLNA 4V2MA 3A2XA 1RQMA 2O85A 1KEBA 3D6IA 3ZVJA 4HZ4A 2H72A 3RBTA 1X0RA 1FO5A 3HYPA 1A2MA 3GH9A 3GIXA
chains in the Genus database with same CATH superfamily
1T7PB 3F6DA 4KW6A 4WEYA 4LL1B 3EWLA 3KMNA 3F0IA 1HNAA 4NXIA 3HY2A 5HR3A 1TRWA 1PA3A 3ZFBA 2J9HA 3KIJA 4Z2TA 3GSSA 2ON5A 4EO3A 3ZLPA 3UOMA 3TJBA 3KTBA 1T1VA 3KXOA 3MAKA 2FWHA 2ZUPA 5GSTA 2H0IA 1CQHA 3D0ZA 3APOA 2DIZA 2HSMA 3BCKA 5INYA 2JSYA 5GZZB 3M8NA 5CRHA 5JWRB 5CP1A 1W89A 2E0QA 4PURA 2YNXA 4FQUA 2EC4A 2HYXA 1R4WA 3F9UA 3PR8A 1E6BA 5GAND 1PKZA 2GSTA 1A2JA 2CZ2A 4EE0A 2LJAA 2K18A 1GRXA 4X43A 4E8HA 4KDUA 2LTKA 3ZZXA 1TRUA 5AISA 2DKHA 4XIHA 2N5AA 1BQ7A 1A0FA 5FHIA 5G2ZA 3C8EA 2GSSA 3FR6A 4EXJA 3DKSA 4YQVA 4PNFA 2GSRA 2IFQB 4TR4A 1A8LA 2LV3A 5D9VA 2VL2C 3LYKA 5ID2B 2IFQA 4ZBDA 5D9XA 1A24A 5FT3A 4K0NA 2H1GA 2UZ8A 2X99A 5ID2A 2R0PA 4IBPA 3IAS2 4KSOA 1KTEA 3F4TA 4K8MA 4I2TA 3IC4A 3CTGA 1U6TA 4HQZA 4ZXGA 1HNBA 4YH2A 3HZ8A 2FNOA 1YF1A 2XHFA 3KP8A 4OCEA 1BYEA 1H4OA 3WYWA 2H0HA 1PMTA 2DJ0A 4MF7A 4ILFA 4WXTA 2C80A 2R0GA 4HQSA 2LEGA 4D73B 1FB6A 1YQ1A 3IE3A 4N0VA 1TRVA 4POMA 1ZYPA 5ECKB 2H76A 5J4UA 4D73A 4TR1B 4IP1A 1SK2A 1Q4JA 3NIVA 4BVYB 3TRXA 1GUHA 2B1KA 4TR1A 2I1UA 1XIYA 5IPGA 3QFAC 2V2GA 4GSTA 4EUYA 4PGTA 4BVYA 5IMDA 2JZTA 4FH8A 4GLTA 2L57A 1OAZA 2GQKA 5J5NA 2YWOA 2OBKA 2R37A 1TK5B 2GT6A 2CVKA 4FYUA 1VF1A 1BG5A 3KP9A 1SENA 3GV1A 4O32A 2RUFA 4OO5A 1UC7A 14GSA 2LSTA 3MIXA 1V9WA 5D9TA 2H73A 3NOFA 2L6DA 4MCUA 4IS0A 1XOAA 2JSZA 3BCIA 1EV9A 3GFKA 1U3AA 3VPTA 3UJ1A 4LMWA 3TKSE 3HJOA 3MYDA 2RM5A 1T00A 1JZRA 1B48A 2LQQA 2MMOA 4JR4A 1AW9A 2VUPA 3VWWA 5IMVA 1HD2A 4RQXA 5IMAA 2WZ9A 11GSA 3GH6A 2GLRA 3I43A 4GCIA 3HJMA 2FGXA 1HNCA 5ECIB 5CRDA 5COHA 1GSEA 3VWXA 5DCHA 2NVLA 1F37A 2NBSA 1O85A 2J23A 1GSDA 2VCTA 3GRXA 1GNWA 1S3RA 4EL1A 4BPYA 5ENUA 4XS4B 4AF2A 1SYRA 3TDGA 2DJ2A 3LWAA 3R2QA 3GNJA 3EYTA 4XS4A 3RPPA 4F82A 2CT6A 3M3MA 2IL3A 2AJQB 3TKSC 4Q5QA 4HOJA 3KGKA 2DC5A 4RUVA 1VF4A 3FMWA 5DQSA 2H01A 3ZMLA 1SU9A 1V98A 5KOXA 2IN3A 1NSWA 2V6KA 1IYHA 1WMJA 1K0MA 3C1SA 4HU9A 2TRXA 3FR3A 4TXVA 3KTLA 1TTZA 1USBA 6GSYA 2AV4A 3A2WA 5JWOB 3CXGA 4BL7B 3WD6A 3HCZA 3HXSA 2K8SA 1O7UA 4F0CA 3FY7A 2KP1A 5HR1A 2IPAA 1ILOA 1SJIA 4BL7A 1J9BA 2EIOA 1Z5YE 2MBTA 1B8XA 4O5RA 1JZOA 1M2AA 3GKMA 1X9WB 4YQUA 2JL4A 2V41A 2O8VB 4N10A 1J0FA 3Q74A 5DBQA 4OCFA 2K9FA 3D4TA 4FIWA 1K0BA 4QL9A 2CQ9A 2ON7A 2LUSA 5EVOA 3P8WA 4TVEA 4NHZA 4ZB8A 2HZEB 2H6YA 3VFIA 3U6VA 4ZBBA 4AGSA 2VLVA 1TJDA 5JCGA 5A4WA 5CREA 4H86A 1RW1A 4GSSA 1AQWA 4WR5A 1G6YA 4IELA 2HZEA 1HQOA 2OADA 3RPNA 4TR3A 3G9BA 2CAQA 2XPDA 3ERGA 12GSA 3IV4A 1EEMA 4KAEA 2H30A 5ELAA 5IPHA 3F4SA 5H5SA 1MTCA 1X5CA 4KA0A 1PD21 1FOHA 2GQLA 1B4QA 4KGIA 5IIZA 3LXZA 2HNLA 19GSA 1T4YA 4CDOA 3LORA 4WBRD 2N5BA 2QA1A 4K7OA 1NHYA 1M9BA 2IMEA 3GN3A 3IBHA 2FHEA 3HKRA 4IGJA 1URMA 1XW5A 3GSTA 2B3SA 1X5DA 3EE2A 3UIWA 4KE3A 1GSUA 3MNGA 3ME7A 1EP8A 2VCZA 6GSSA 4WF5A 2C0DA 2M46A 1WRYA 3ZRDA 2DMLA 5KEJA 4KX4A 1SL0B 4XTSA 1WJKA 5KOWA 5D9WA 3IOSA 3IC8A 5IMZA 3F3RA 2N5FA 2HSHA 4IJIA 3WT2A 3I9V2 5CRGA 2A4HA 1G7OA 1G0TA 2HRFA 1V2AA 2VM2A 5KN1A 1TP9A 2H0GA 2V32A 3LEFA 4K5RA 4GQFA 1AUCA 3LG6A 5IM9A 2OJLA 1A8YA 2VD0A 1DSBA 5F0GA 1R5AA 2B5EA 2TRCP 5ECLB 4ML1A 4MJBA 3GMFA 3GUSA 1WP0A 1MDIA 3KMOA 4X4JA 3D4MA 1PL1A 1TDIA 4K9ZA 1X5EA 2F8AA 4JZQA 3G7YA 2H1BA 1Y25A 5CO3A 2AB6A 2L6CA 1F3AA 3CSJA 1ZL9A 1XWGA 2VL3A 2GGTA 2GZYA 20GSA 4GRFA 3TOUA 1OE7A 2EIRA 2G0FA 5ECQB 1G7EA 3N5OA 3IR4A 4WKWA 4ZB6A 4LA1A 3IHGA 1FW1A 3BD2A 2VL9A 1H75A 2L4CA 3TB2A 4ECBA 1OC3A 1WPIA 1J08A 1PL2A 4PTSA 5ECRB 3KCMA 2RIIA 1WWJA 2XBQA 6GSVA 3E3EA 1YJ6A 3VURA 5DQYA 3LGCA 2VO4A 4K2DA 5DAKB 1O6JA 4LLRA 1S3CA 2NTOA 3DYRA 4WBJA 1SK0A 5DAKA 2HLSA 2C4JA 3BJ5A 2QA2A 2GQMA 4LMVA 5DJMA 1XXUA 2KOKA 1M3IA 2BMXA 4NV5A 4RQRA 4K2XA 2LRTA 4TOPA 1EEJA 4MA9A 5ECNB 2LNSA 5H5RA 4MP4A 1HYUA 2HE3A 6GSTA 5LD0A 6GSXA 3SWLA 3Q18A 3QPMA 1GTIA 2K6VA 8GSSA 3C73A 1VRSD 4IQAA 4MABA 1MDKA 1F6MC 3ZREA 3HVNA 2R4VA 3UAPA 4YKGA 3GL5A 1WE0A 4OD7A 4KDYA 4DSRA 3GKNA 5IOXA 5ECOB 3QD9A 3J7Yb 3VK9A 4KSMA 3IPZA 2C3QA 2M80A 1U3IA 2CAIA 5DVBA 3PPUA 1TKDB 2I4AA 4G0LA 2FCHA 2DMMA 4Q5NA 4OMVA 5KN0A 4KH7A 2F8FA 4GWRA 2DBCA 5HFIA 2YCDA 4Q5FA 3D21A 1VF3A 1F9MA 3LQ7A 3H79A 4XRAA 3P2AA 1RK4A 4OFNA 3QAVA 1SKWB 1B9XC 1WIKA 4HEA2 5FWGA 2HFDA 2HT9A 3FZ9A 1G6WA 4EF0A 2MMNA 3L9UA 2C0FA 1TU8A 4F03A 2A4VA 1NHOA 5B8AA 2YV7A 4KDXA 1Z3EA 3TJJA 3VI5A 3KD0A 2X4AA 4XS6A 1XVQA 5BRTA 1QUWA 3L9VA 2DJ1A 5B8BA 4L0WA 18GSA 2C0EA 4HI7A 2R2JA 4ZB9A 5J9CA 1EOGA 2WGRA 4HUAA 3TGZA 5G5EA 3U5RE 4EDYA 1EP7A 2VAFA 4G0IA 4ECCA 3Q19A 3H4KA 5G30A 4BWSA 4I97A 4RI7A 1R7HA 3CRTA 3D5JA 3QR6A 3F3QA 4CW9A 2WB9A 4V2NA 2KP2A 1B4PA 4KB3A 2G2QA 5GAPD 4EC0A 4OFTA 4LL4B 3GA4A 1NM3A 5HFKA 4CY8A 3W6GA 5D96A 3CSHA 5EL8A 2R0CA 2YV9A 5AIVA 3V1WA 1MD3A 5DALB 4IJ3A 1DBYA 4BWQA 4WR4A 2VCXA 1N2AA 1V58A 4FYBA 3L4NA 3TUEA 1F2EA 4POLA 1S3AA 4EKZA 1XVWA 4MDCA 3M1GA 2AYTA 2D2ZA 4NWYA 2LQOA 1CQGA 6GSUA 3FRCA 2YOIA 1PRXA 1OE8A 1U87A 1EZKA 2RM6A 4ULXA 3TRPA 3UL3A 5J3RA 4PXOA 2GDRA 5AIXA 2A2PA 4MH2A 2DSAA 2WJUA 1GNEA 2LRCA 1JZWA 1TI1A 3LJRA 1JLVA 4O5QA 2OA7A 1TK8B 4KCEA 2HSYA 3C7MA 4BA7A 3HHVA 5ECPB 1AAZA 3QAWA 2CX4A 4TXOB 3AY8A 2DIYA 4TXOA 4O5UA 1SL2B 4NPBA 5B6NA 1XG8A 4NHWA 1FHEA 1PGTA 2HXKA 1XPVA 1YZXA 4L0UA 2VCWA 4DSQA 3UVHA 4JU5A 2JU5A 4J56E 5LNKe 2YWNA 5IQYA 4AJ6A 1THOA 4J57E 4PUAA 3EINA 3HA9A 3MSZA 1EWXA 3RAZA 1AQXA 4G0KA 4IVFA 4MZBA 5A4VA 1E2YA 2X64A 3BBYA 3FKFA 4HJ2A 1R26A 1SL1B 1A23A 2F51A 1JFUA 2H74A 2LRNA 2PU9C 4E8EA 5G31A 5C04A 1ZMAA 4I6XA 2CVBA 1OKTA 4JBBA 4IP6A 4V1Ap 4BIKA 3TJGA 4TKYA 4EIQA 3E9JB 4POBA 1UVZA 1ERUA 4XHMA 2OKAA 1EOHA 2B6MA 3UBLA 1M99A 4MPFA 4USSA 1GUKA 3CRUA 2QC7A 2QSIA 2VD1A 4DEJA 5KN2A 3CBUA 1T3BA 4Z2RA 3EU3A 4ZILA 3JCML 3APSA 2REMA 3ZTLA 2GS3A 3DD3A 1X9SB 1GH2A 2H1DA 1OKDA 1BX9A 1ZYEA 3C71A 1YEPA 3G7JA 4NAXA 1T8EB 4F0BA 2YZHA 2O7KA 1QFNA 2FWEA 3I69A 4QQ7A 4MZCA 3ZITA 4MZWA 1LJRA 2YPMA 1UA5A 4PQHA 3TRQA 5IOWA 5HQPA 1Q98A 2BJXA 4IHUA 3DEXA 2PERA 5IMCA 1YY7A 4MJAA 4KF9A 2B7JA 1M3JA 2V6OA 1SKSB 1O8WA 2OBIA 3IHQA 3QOUA 2OE1A 2C8UA 5E59A 3QCPA 1DUGA 2DKIA 4IQ1A 4O7HA 1ZGNA 1PN0A 1K3YA 2DJKA 3GTUB 1JZDA 5J41A 3L78A 2HRKA 3IK7A 2FA8A 3GTUA 1SK1A 2R5GA 1ZOFA 4JRRA 2MMAA 5DCGA 2B5YA 2KUCA 4G2EA 3IRAA 3CYNA 1XBSA 2RUEA 1FOVA 2H8LA 2O87A 4WF4A 5G1LA 1FB0A 1LBKA 5CNWA 4KNDA 2XBIA 4Z2UA 4ZIJA 3TJKA 1TW9A 2C1YA 3VWVA 1QK8A 3I6AA 1MD4A 4K7NA 3EMXA 2B1LA 5JWQB 3BOAA 3LW9A 1EV4A 2MMZA 1ERVA 1F3BA 2FUG2 2YJ7A 3CSIA 1Z7RA 2C0GA 2TIRA 1GUMA 1SJZA 3O6TA 2ZNMA 1GSFA 4GXZA 3IAM2 4OO4A 4KCAA 4ZBAA 1YDKA 2MYGA 2L4QA 2VLUA 4MF5A 2PN8A 3DVXA 1YKCA 2ES7A 3EMPA 1K0CA 4FYCA 4AJ8A 3FHKA 3ZIVA 5CAXA 1QQ2A 3EURA 1XCCA 2ALBA 1O73A 4IW9A 4L8EA 2OE3A 3A5IA 1XWAA 1ZYNA 4WETA 2VLTA 4N30A 2LNTA 3E0UA 3ZMKA 4Z7XA 2AAWA 1GTBA 5D93A 2YWMA 4ZL9A 2A2SA 4HDEA 3RHCA 10GSA 1GWCA 4N11A 2H75A 2DJJA 3ZIJA 3W8SA 4PQ1A 2HRAA 2H66A 3DVWA 1GP1A 1Z9HA 2CV4A 4J2FA 4N0ZA 2IMDA 1W4VA 4HU7A 3ISOA 4ID0A 4IKHA 3APQA 1PN9A 2HI7A 3HZ4A 2MZCA 4RI6A 2FA4A 4P3YB 5BMUA 5IMFA 4F2IA 2IWTA 4K5SA 3ME8A 2PWJA 2FY6A 3EPTA 1QGVA 2H1AA 3QAGA 1FAAA 1PFOA 4GQCA 3W8JA 1C72A 4ML6A 1M9AA 5E4WA 5ECHB 7GSSA 3GYKA 4JR6A 1K0AA 2H71A 5A5KA 2FD3A 2O89A 1XZOA 3GKKA 4YQMA 5J9BA 1SYXA 5ABRA 3NZNA 3QDNA 4IN0A 2WRTA 2YZUA 1XOBA 2IMIA 1MDJA 4CY6A 4GSNA 1QXHA 3KEBA 5D8IA 2F3MA 2CX3A 4MJCA 2IIYA 2B7KA 4MMMA 2A2RA 1PX6A 1DE1A 3M9KA 1LU4A 4MLYA 1GLPA 6GSWA 4ACSA 3ZYWA 3IXRA 1YEXA 5HR2A 4ZL8A 5D73A 5F05A 4MNNA 1DE2A 3H1NA 4YAVA 4MPGA 2P5QA 2E2MA 1V57A 1GTAA 1Z6MA 3IK9A 1NW2A 2DLXA 2LJKA 2WFCA 4TR0A 3ZVJD 3RDWA 5F8BA 2YWIA 2JZSA 4L5LA 1K0OA 4YAPA 2L5OA 1K0DA 3HD5A 1Z7PA 4MK3A 1XWKA 1ST9A 4DSSB 3WGEA 4OWYA 1PKWA 5JCWA 1GULA 2X49A 4DSSA 2GTUA 3IA1A 3VI7A 4O92A 2XC2A 5DJLA 1FVJA 2CA8A 2JACA 1PSQA 3HVVA 5A4UA 3C1RA 3K8NA 4QL7A 4NV2A 1I9DA 3WT1A 4POKA 2YP6A 2FWFA 3A2VA 5F06A 3LYPA 4TRXA 2NPBA 3DMLA 3ZFLA 4I5QA 1SD8A 1FVKA 3QFBC 2H6ZA 3GHAA 4AJ7A 5KN3A 1VF2A 2IMFA 1ERTA 3GL3A 3IDVA 1EGOA 1PX7A 5CYYA 2VL2A 1YF0A 1BJXA 1K3LA 1SKRB 1UN2A 3US3A 2JADA 2AUVA 1ZYQB 2HZFA 4X0XA 3M0FA 4XCSA 2M72A 2CZ3A 2OACA 5CRWA 3DIEA 1V40A 4MH3A 3VPQA 5DALA 4DVCA 4V1Ag 3DRNA 3S9FA 2B5XA 1ABAA 5B7CA 1AC1A 3FW2A 4NMUA 3F4RA 1U88A 2X8GA 4CHSA 3EU4A 3TJFA 1M2BA 1WOUA 3L0HA 4BVXB 3TOTA 1Y6EA 1OYJA 5LCZA 2H6XA 13GSA 4K0GA 2C3NA 3D22A 2MBSA 3L9SA 4BVXA 3UVTA 2P5RA 3FR9A 1GL8A 3ERWA 3ZL5A 3A3TA 3H8QA 1AIUA 1K0NA 1TXXA 2VOCA 4YKFA 2YN1A 2RLIA 2KLXA 3GX0A 3F6FA 2VCQA 2BTOT 3G7IA 2L59A 1AXDA 4F9ZA 2F9SA 3PINA 2PMTA 1B9YC 1KNGA 4V2LA 4XS1A 1JHBA 2PPTA 4L5OA 3LSZA 4K1FA 4EVMA 4ICYA 4Q5RA 1GSQA 4X1UA 3DXBA 2FLSA 5C00A 3WGXA 3UEMA 3FZAA 3R3EA 3RHBA 5GSSA 2X8CA 3UARA 3ERFA 2PVOC 3KJYA 5H5QA 3DGQA 2V1MA 2GVPA 4MJEA 1ML6A 4HJMA 2WULA 3LXTA 2YANA 1XWBA 3EVIA 1KBNA 4OFMA 3CQFA 1M2DA 1QMVA 1IYIA 2R3XA 2R6KA 2Z9SA 1SD9A 3H93A 5ELGA 2DJ3A 3CMIA 2CVDA 1XW6A 1BAYA 3FZ4A 4G19A 4ZL7A 3VWUA 2GZPA 2WDUA 2ZCTA 1SJ6A 3KZQA 1GLQA 5EPFA 2H70A 1ERWA 3MWHA 1OC8A 1S3DA 1M0UA 1I5GA 4G10A 5G1KA 2HRNA 2WCIA 2LJRA 2E2GA 1ON4A 1EGRA 2VIMA 1TI3A 3HVSA 1BEDA 3LFLA 3N9JA 4ECJA 4I2UA 4HZ2A 2FWGA 2NDOA 4PUFC 3UMAA 2QKEA 4HS1A 1ZCPA 3EC3A 2LKUA 1N8JA 3HDCA 4EDZA 5ECSA 5JCUA 2PBJA 2YJHA 1OC9B 3TKSA 3J7Yk 2PGTA 3WGDA 2JZRA 2K8VA 2I9HA 2WS2A 2LS5A 1VGLA 1OC9A 1K3OA 4ISDA 3GX8A 3TKRA 1A0RP 22GSA 2GSQA 2XPEA 4GTUA 1M7TA 17GSA 1GSYA 3DWVA 1XW9A 4XRDA 1PQNA 3PH9A 1ACVA 5HR0A 3UBKA 5DDLA 3KH7A 3PGTA 2OE0A 5B6MA 4MF6A 2QGVA 1THXA 4EIPA 1O8XA 3GURA 1OVNA 3M9JA 5EY6A 1AQVA 2VM1A 4TW5A 5HFGA 5AGYA 2H19A 3FK8A 3O3TA 4GF0A 2EIQA 1X9MB 4PX1A 1TK0B 2GT5A 3A5WA 3P7XA 1FG4A 1T4ZA 5IO0A 3GKXA 3SBCA 2PUKC 1JLWA 1MEKA 2E7PA 4A5PA 16GSA 2P31A 4I8BA 1GTUA 3HVXA 4JEDA 9GSSA 3KM6A 5L71A 4JE1A 3TCOA 4K6XA 5IO2A 3QMXA 3TKPA 1ZZYA 1XWCA 1TU7A 1XFLA 2P0GA 2PVQA 4ECIA 2KHPA 1Z6NA 3KH9A 2AHEA 3MDKA 2I3YA 1O81A 3FZ5A 3OR5A 3FYGA 3CTFA 3F63A 1YKAA 2I81A 3ED3A 3P90A 4FO5A 3FEUA 4K7IA 4TN8A 2X8HA 3Q6OA 2C3TA 2L5LA 1GSSA 5ECMB 3TKQA 1A2LA 3O76A 5AN1A 1TRSA 2IMKA 3HJPA 4PQIA 4KUNA 2GZZA 2IJYA 5G5FA 2VCVA 4PNGA 4G9HA 1TOFA 5F07A 3F8UA 1R5PA 3VLNA 4V2MA 3A2XA 1RQMA 2O85A 1KEBA 3D6IA 3ZVJA 4HZ4A 2H72A 3RBTA 1X0RA 4HSCX 1FO5A 3HYPA 1A2MA 3GH9A 3GIXA
chains in the Genus database with same CATH topology
1T7PB 3F6DA 4KW6A 4WEYA 4LL1B 3EWLA 3KMNA 3F0IA 1HNAA 4NXIA 3HY2A 5HR3A 1TRWA 1PA3A 3ZFBA 2J9HA 3KIJA 4Z2TA 3GSSA 2ON5A 4EO3A 3ZLPA 3UOMA 3TJBA 3KTBA 1T1VA 3KXOA 3MAKA 2FWHA 2ZUPA 5GSTA 2H0IA 1CQHA 3D0ZA 3APOA 2DIZA 2HSMA 3BCKA 5INYA 2JSYA 5GZZB 3M8NA 5CRHA 5JWRB 5CP1A 1W89A 2E0QA 4PURA 2YNXA 4FQUA 2EC4A 2HYXA 1R4WA 3F9UA 3PR8A 1E6BA 5GAND 1PKZA 2GSTA 1A2JA 2CZ2A 4EE0A 2LJAA 2K18A 1GRXA 4X43A 4E8HA 4KDUA 2LTKA 3ZZXA 1TRUA 5AISA 2DKHA 4XIHA 2N5AA 1BQ7A 1A0FA 5FHIA 5G2ZA 3C8EA 2GSSA 3FR6A 4EXJA 3DKSA 4YQVA 4PNFA 2GSRA 2IFQB 4TR4A 1A8LA 2LV3A 5D9VA 2VL2C 3LYKA 5ID2B 2IFQA 4ZBDA 5D9XA 1A24A 5FT3A 4K0NA 2H1GA 2UZ8A 2X99A 5ID2A 2R0PA 4IBPA 3IAS2 4KSOA 1KTEA 3F4TA 4K8MA 4I2TA 3IC4A 3CTGA 1U6TA 4HQZA 4ZXGA 1HNBA 4YH2A 3HZ8A 2FNOA 1YF1A 2XHFA 3KP8A 4OCEA 1BYEA 1H4OA 3WYWA 2H0HA 1PMTA 2DJ0A 4MF7A 4ILFA 4WXTA 2C80A 2R0GA 4HQSA 2LEGA 4D73B 1FB6A 1YQ1A 3IE3A 4N0VA 1TRVA 4POMA 1ZYPA 5ECKB 2H76A 5J4UA 4D73A 4TR1B 4IP1A 1SK2A 1Q4JA 3NIVA 4BVYB 3TRXA 1GUHA 2B1KA 4TR1A 2I1UA 1XIYA 5IPGA 3QFAC 2V2GA 4GSTA 4EUYA 4PGTA 4BVYA 5IMDA 2JZTA 4FH8A 4GLTA 2L57A 1OAZA 2GQKA 5J5NA 2YWOA 2OBKA 2R37A 1TK5B 2GT6A 2CVKA 4FYUA 1VF1A 1BG5A 3KP9A 1SENA 3GV1A 4O32A 2RUFA 4OO5A 1UC7A 14GSA 2LSTA 3MIXA 1V9WA 5D9TA 2H73A 3NOFA 2L6DA 4MCUA 4IS0A 1XOAA 2JSZA 3BCIA 1EV9A 3GFKA 1U3AA 3VPTA 3UJ1A 4LMWA 3TKSE 3HJOA 3MYDA 2RM5A 1T00A 1JZRA 1B48A 2LQQA 2MMOA 4JR4A 1AW9A 2VUPA 3VWWA 5IMVA 1HD2A 4RQXA 5IMAA 2WZ9A 11GSA 3GH6A 2GLRA 3I43A 4GCIA 3HJMA 2FGXA 1HNCA 5ECIB 5CRDA 5COHA 1GSEA 3VWXA 5DCHA 2NVLA 1F37A 2NBSA 1O85A 2J23A 1GSDA 2VCTA 3GRXA 1GNWA 4EL1A 4BPYA 5ENUA 4XS4B 4AF2A 1SYRA 3TDGA 2DJ2A 3LWAA 3R2QA 3GNJA 3EYTA 4XS4A 3RPPA 4F82A 2CT6A 3M3MA 2IL3A 2AJQB 3TKSC 4Q5QA 4HOJA 3KGKA 2DC5A 4RUVA 1VF4A 3FMWA 5DQSA 2H01A 3ZMLA 1SU9A 1V98A 5KOXA 2IN3A 1NSWA 2V6KA 1IYHA 1WMJA 1K0MA 3C1SA 4HU9A 2TRXA 3FR3A 4TXVA 3KTLA 1TTZA 1USBA 6GSYA 2AV4A 3A2WA 5JWOB 3CXGA 4BL7B 3WD6A 3HCZA 3HXSA 2K8SA 1O7UA 4F0CA 3FY7A 2KP1A 5HR1A 2IPAA 1ILOA 1SJIA 4BL7A 1J9BA 2EIOA 1Z5YE 2MBTA 1B8XA 4O5RA 1JZOA 1M2AA 3GKMA 1X9WB 4YQUA 2JL4A 2V41A 2O8VB 4N10A 1J0FA 3Q74A 5DBQA 4OCFA 2K9FA 3D4TA 4FIWA 1K0BA 4QL9A 2CQ9A 2ON7A 2LUSA 5EVOA 3P8WA 4TVEA 4NHZA 4ZB8A 2HZEB 2H6YA 3VFIA 3U6VA 4ZBBA 4AGSA 2VLVA 1TJDA 5JCGA 5A4WA 5CREA 4H86A 1RW1A 4GSSA 1AQWA 4WR5A 1G6YA 4IELA 2HZEA 1HQOA 2OADA 3RPNA 4TR3A 3G9BA 2CAQA 2XPDA 3ERGA 12GSA 3IV4A 1EEMA 4KAEA 2H30A 5ELAA 5IPHA 3F4SA 5H5SA 1MTCA 1X5CA 4KA0A 1PD21 1FOHA 2GQLA 1B4QA 4KGIA 5IIZA 3LXZA 2HNLA 19GSA 1T4YA 4CDOA 3LORA 4WBRD 2N5BA 2QA1A 4K7OA 1NHYA 1M9BA 2IMEA 3GN3A 3IBHA 2FHEA 3HKRA 4IGJA 1URMA 1XW5A 3GSTA 2B3SA 1X5DA 3EE2A 3UIWA 4KE3A 1GSUA 3MNGA 3ME7A 1EP8A 2VCZA 6GSSA 4WF5A 2C0DA 2M46A 1WRYA 3ZRDA 2DMLA 5KEJA 4KX4A 1SL0B 4XTSA 1WJKA 5KOWA 5D9WA 3IOSA 3IC8A 5IMZA 3F3RA 2N5FA 2HSHA 4IJIA 3WT2A 3I9V2 5CRGA 2A4HA 1G7OA 1G0TA 2HRFA 1V2AA 2VM2A 5KN1A 1TP9A 2H0GA 2V32A 3LEFA 4K5RA 4GQFA 1AUCA 3LG6A 5IM9A 2OJLA 1A8YA 2VD0A 1DSBA 5F0GA 1R5AA 2B5EA 2TRCP 5ECLB 4ML1A 4MJBA 3GMFA 3GUSA 1WP0A 1MDIA 3KMOA 4X4JA 3D4MA 1PL1A 1TDIA 4K9ZA 1X5EA 2F8AA 4JZQA 3G7YA 2H1BA 1Y25A 5CO3A 2AB6A 2L6CA 1F3AA 3CSJA 1ZL9A 1XWGA 2VL3A 2GGTA 2GZYA 20GSA 4GRFA 3TOUA 1OE7A 2EIRA 2G0FA 5ECQB 1G7EA 3N5OA 3IR4A 4WKWA 4ZB6A 4LA1A 3IHGA 1FW1A 3BD2A 2VL9A 1H75A 2L4CA 3TB2A 4ECBA 1OC3A 1WPIA 1J08A 1PL2A 4PTSA 5ECRB 3KCMA 2RIIA 1WWJA 2XBQA 6GSVA 3E3EA 1YJ6A 3VURA 5DQYA 3LGCA 2VO4A 4K2DA 5DAKB 1O6JA 4LLRA 1S3CA 2NTOA 3DYRA 4WBJA 1SK0A 5DAKA 2HLSA 2C4JA 3BJ5A 2QA2A 2GQMA 4LMVA 5DJMA 1XXUA 2KOKA 2BMXA 4NV5A 4RQRA 4K2XA 2LRTA 4TOPA 1EEJA 4MA9A 5ECNB 2LNSA 5H5RA 4MP4A 1HYUA 2HE3A 6GSTA 5LD0A 6GSXA 3SWLA 3Q18A 3QPMA 1GTIA 2K6VA 8GSSA 3C73A 1VRSD 4IQAA 4MABA 1MDKA 1F6MC 3ZREA 2R4VA 3UAPA 4YKGA 3GL5A 1WE0A 4OD7A 4KDYA 4DSRA 3GKNA 5IOXA 5ECOB 3QD9A 3J7Yb 3VK9A 4KSMA 3IPZA 2C3QA 2M80A 1U3IA 2CAIA 5DVBA 3PPUA 1TKDB 2I4AA 4G0LA 2FCHA 2DMMA 4Q5NA 4OMVA 5KN0A 4KH7A 2F8FA 4GWRA 2DBCA 5HFIA 2YCDA 4Q5FA 3D21A 1VF3A 1F9MA 3LQ7A 3H79A 4XRAA 3P2AA 1RK4A 4OFNA 3QAVA 1SKWB 1B9XC 1WIKA 4HEA2 5FWGA 2HFDA 2HT9A 3FZ9A 1G6WA 4EF0A 2MMNA 3L9UA 2C0FA 1TU8A 4F03A 2A4VA 1NHOA 5B8AA 2YV7A 4KDXA 1Z3EA 3TJJA 3VI5A 3KD0A 2X4AA 4XS6A 1XVQA 5BRTA 1QUWA 3L9VA 2DJ1A 5B8BA 4L0WA 18GSA 2C0EA 4HI7A 2R2JA 4ZB9A 5J9CA 1EOGA 2WGRA 4HUAA 3TGZA 5G5EA 3U5RE 4EDYA 1EP7A 2VAFA 4G0IA 4ECCA 3Q19A 3H4KA 5G30A 4BWSA 4I97A 4RI7A 1R7HA 3CRTA 3D5JA 3QR6A 3F3QA 4CW9A 2WB9A 4V2NA 2KP2A 1B4PA 4KB3A 2G2QA 5GAPD 4EC0A 4OFTA 4LL4B 3GA4A 1NM3A 5HFKA 4CY8A 3W6GA 5D96A 3CSHA 5EL8A 2R0CA 2YV9A 5AIVA 3V1WA 1MD3A 5DALB 4IJ3A 1DBYA 4BWQA 4WR4A 2VCXA 1N2AA 1V58A 4FYBA 3L4NA 3TUEA 1F2EA 4POLA 1S3AA 4EKZA 1XVWA 4MDCA 3M1GA 2AYTA 2D2ZA 4NWYA 2LQOA 1CQGA 6GSUA 3FRCA 2YOIA 1PRXA 1OE8A 1U87A 1EZKA 2RM6A 4ULXA 3TRPA 3UL3A 5J3RA 4PXOA 2GDRA 5AIXA 2A2PA 4MH2A 2DSAA 2WJUA 1GNEA 2LRCA 1JZWA 1TI1A 3LJRA 1JLVA 4O5QA 2OA7A 1TK8B 4KCEA 2HSYA 3C7MA 4BA7A 3HHVA 5ECPB 1AAZA 3QAWA 2CX4A 4TXOB 3AY8A 2DIYA 4TXOA 4O5UA 1SL2B 4NPBA 5B6NA 4NHWA 1FHEA 1PGTA 2HXKA 1XPVA 1YZXA 4L0UA 2VCWA 4DSQA 3UVHA 4JU5A 2JU5A 4J56E 5LNKe 2YWNA 5IQYA 4AJ6A 1THOA 4J57E 4PUAA 3EINA 3HA9A 3MSZA 1EWXA 3RAZA 1AQXA 4G0KA 4IVFA 4MZBA 5A4VA 1E2YA 2X64A 3BBYA 3FKFA 4HJ2A 1R26A 1SL1B 1A23A 2F51A 1JFUA 2H74A 2LRNA 2PU9C 4E8EA 5G31A 5C04A 1ZMAA 4I6XA 2CVBA 1OKTA 4JBBA 4IP6A 4V1Ap 3TJGA 4TKYA 4EIQA 3E9JB 4POBA 1UVZA 1ERUA 4XHMA 2OKAA 1EOHA 2B6MA 3UBLA 1M99A 4MPFA 4USSA 1GUKA 3CRUA 2QC7A 2QSIA 2VD1A 4DEJA 5KN2A 3CBUA 1T3BA 4Z2RA 3EU3A 4ZILA 3JCML 3APSA 2REMA 3ZTLA 2GS3A 3DD3A 1X9SB 1GH2A 2H1DA 1OKDA 1BX9A 1ZYEA 3C71A 1YEPA 3G7JA 4NAXA 1T8EB 4F0BA 2YZHA 2O7KA 1QFNA 2FWEA 3I69A 4QQ7A 4MZCA 3ZITA 4MZWA 1LJRA 2YPMA 1UA5A 4PQHA 3TRQA 5IOWA 5HQPA 1Q98A 2BJXA 4IHUA 3DEXA 2PERA 5IMCA 1YY7A 4MJAA 4KF9A 2B7JA 2V6OA 1SKSB 1O8WA 2OBIA 3IHQA 3QOUA 2OE1A 2C8UA 5E59A 3QCPA 1DUGA 2DKIA 4IQ1A 4O7HA 1ZGNA 1PN0A 1K3YA 2DJKA 3GTUB 1JZDA 5J41A 3L78A 2HRKA 3IK7A 2FA8A 3GTUA 1SK1A 2R5GA 1ZOFA 4JRRA 2MMAA 5DCGA 2B5YA 2KUCA 4G2EA 3IRAA 3CYNA 1XBSA 2RUEA 1FOVA 2H8LA 2O87A 4WF4A 5G1LA 1FB0A 1LBKA 5CNWA 4KNDA 2XBIA 4Z2UA 4ZIJA 3TJKA 1TW9A 2C1YA 3VWVA 1QK8A 3I6AA 1MD4A 4K7NA 3EMXA 2B1LA 5JWQB 3BOAA 3LW9A 1EV4A 2MMZA 1ERVA 1F3BA 2FUG2 2YJ7A 3CSIA 1Z7RA 2C0GA 2TIRA 1GUMA 1SJZA 3O6TA 2ZNMA 1GSFA 4GXZA 3IAM2 4OO4A 4KCAA 4ZBAA 1YDKA 2MYGA 2L4QA 2VLUA 4MF5A 2PN8A 3DVXA 1YKCA 2ES7A 3EMPA 1K0CA 4FYCA 4AJ8A 3FHKA 3ZIVA 5CAXA 1QQ2A 3EURA 1XCCA 2ALBA 1O73A 4IW9A 4L8EA 2OE3A 3A5IA 1XWAA 1ZYNA 4WETA 2VLTA 4N30A 2LNTA 3E0UA 3ZMKA 4Z7XA 2AAWA 1GTBA 5D93A 2YWMA 4ZL9A 2A2SA 4HDEA 3RHCA 10GSA 1GWCA 4N11A 2H75A 2DJJA 3ZIJA 3W8SA 4PQ1A 2HRAA 2H66A 3DVWA 1GP1A 1Z9HA 2CV4A 4J2FA 4N0ZA 2IMDA 1W4VA 4HU7A 3ISOA 4ID0A 4IKHA 3APQA 1PN9A 2HI7A 3HZ4A 2MZCA 4RI6A 2FA4A 4P3YB 5BMUA 5IMFA 4F2IA 2IWTA 4K5SA 3ME8A 2PWJA 2FY6A 3EPTA 1QGVA 2H1AA 3QAGA 1FAAA 4GQCA 3W8JA 1C72A 4ML6A 1M9AA 5E4WA 5ECHB 7GSSA 3GYKA 4JR6A 1K0AA 2H71A 5A5KA 2FD3A 2O89A 1XZOA 3GKKA 4YQMA 5J9BA 1SYXA 5ABRA 3NZNA 3QDNA 4IN0A 2WRTA 2YZUA 1XOBA 2IMIA 1MDJA 4CY6A 4GSNA 1QXHA 3KEBA 5D8IA 2F3MA 2CX3A 4MJCA 2IIYA 2B7KA 4MMMA 2A2RA 1PX6A 1DE1A 3M9KA 1LU4A 4MLYA 1GLPA 6GSWA 4ACSA 3ZYWA 3IXRA 1YEXA 5HR2A 4ZL8A 5D73A 5F05A 4MNNA 1DE2A 3H1NA 4YAVA 4MPGA 2P5QA 2E2MA 1V57A 1GTAA 1Z6MA 3IK9A 1NW2A 2DLXA 2LJKA 2WFCA 4TR0A 3ZVJD 3RDWA 5F8BA 2YWIA 2JZSA 4L5LA 1K0OA 4YAPA 2L5OA 1K0DA 3HD5A 1Z7PA 4MK3A 1XWKA 1ST9A 4DSSB 3WGEA 4OWYA 1PKWA 5JCWA 1GULA 2X49A 4DSSA 2GTUA 3IA1A 3VI7A 4O92A 2XC2A 5DJLA 1FVJA 2CA8A 2JACA 1PSQA 3HVVA 5A4UA 3C1RA 3K8NA 4QL7A 4NV2A 1I9DA 3WT1A 4POKA 2YP6A 2FWFA 3A2VA 5F06A 3LYPA 4TRXA 2NPBA 3DMLA 3ZFLA 4I5QA 1SD8A 1FVKA 3QFBC 2H6ZA 3GHAA 4AJ7A 5KN3A 1VF2A 2IMFA 1ERTA 3GL3A 3IDVA 1EGOA 1PX7A 5CYYA 2VL2A 1YF0A 1BJXA 1K3LA 1SKRB 1UN2A 3US3A 2JADA 2AUVA 1ZYQB 2HZFA 4X0XA 3M0FA 4XCSA 2M72A 2CZ3A 2OACA 5CRWA 3DIEA 1V40A 4MH3A 3VPQA 5DALA 4DVCA 4V1Ag 3DRNA 3S9FA 2B5XA 1ABAA 5B7CA 1AC1A 3FW2A 4NMUA 3F4RA 1U88A 2X8GA 4CHSA 3EU4A 3TJFA 1M2BA 1WOUA 3L0HA 4BVXB 3TOTA 1Y6EA 1OYJA 5LCZA 2H6XA 13GSA 4K0GA 2C3NA 3D22A 2MBSA 3L9SA 4BVXA 3UVTA 2P5RA 3FR9A 1GL8A 3ERWA 3ZL5A 3A3TA 3H8QA 1AIUA 1K0NA 1TXXA 2VOCA 4YKFA 2YN1A 2RLIA 2KLXA 3GX0A 3F6FA 2VCQA 2BTOT 3G7IA 2L59A 1AXDA 4F9ZA 2F9SA 3PINA 2PMTA 1B9YC 1KNGA 4V2LA 4XS1A 1JHBA 2PPTA 4L5OA 3LSZA 4K1FA 4EVMA 4ICYA 4Q5RA 1GSQA 4X1UA 3DXBA 2FLSA 5C00A 3WGXA 3UEMA 3FZAA 3R3EA 3RHBA 5GSSA 2X8CA 3UARA 3ERFA 2PVOC 3KJYA 5H5QA 3DGQA 2V1MA 2GVPA 4MJEA 1ML6A 4HJMA 2WULA 3LXTA 2YANA 1XWBA 3EVIA 1KBNA 4OFMA 1M2DA 1QMVA 1IYIA 2R3XA 2R6KA 2Z9SA 1SD9A 3H93A 5ELGA 2DJ3A 3CMIA 2CVDA 1XW6A 1BAYA 3FZ4A 4G19A 4ZL7A 3VWUA 2GZPA 2WDUA 2ZCTA 1SJ6A 3KZQA 1GLQA 5EPFA 2H70A 1ERWA 3MWHA 1OC8A 1S3DA 1M0UA 1I5GA 4G10A 5G1KA 2HRNA 2WCIA 2LJRA 2E2GA 1ON4A 1EGRA 2VIMA 1TI3A 3HVSA 1BEDA 3LFLA 3N9JA 4ECJA 4I2UA 4HZ2A 2FWGA 2NDOA 4PUFC 3UMAA 2QKEA 4HS1A 1ZCPA 3EC3A 2LKUA 1N8JA 3HDCA 4EDZA 5ECSA 5JCUA 2PBJA 2YJHA 1OC9B 3TKSA 3J7Yk 2PGTA 3WGDA 2JZRA 2K8VA 2I9HA 2WS2A 2LS5A 1VGLA 1OC9A 1K3OA 4ISDA 3GX8A 3TKRA 1A0RP 22GSA 2GSQA 2XPEA 4GTUA 1M7TA 17GSA 1GSYA 3DWVA 1XW9A 4XRDA 1PQNA 3PH9A 1ACVA 5HR0A 3UBKA 5DDLA 3KH7A 3PGTA 2OE0A 5B6MA 4MF6A 2QGVA 1THXA 4EIPA 1O8XA 3GURA 1OVNA 3M9JA 5EY6A 1AQVA 2VM1A 4TW5A 5HFGA 5AGYA 2H19A 3FK8A 3O3TA 4GF0A 2EIQA 1X9MB 4PX1A 1TK0B 2GT5A 3A5WA 3P7XA 1FG4A 1T4ZA 5IO0A 3GKXA 3SBCA 2PUKC 1JLWA 1MEKA 2E7PA 4A5PA 16GSA 2P31A 4I8BA 1GTUA 3HVXA 4JEDA 9GSSA 3KM6A 5L71A 4JE1A 3TCOA 4K6XA 5IO2A 3QMXA 3TKPA 1ZZYA 1XWCA 1TU7A 1XFLA 2P0GA 2PVQA 4ECIA 2KHPA 1Z6NA 3KH9A 2AHEA 3MDKA 2I3YA 1O81A 3FZ5A 3OR5A 3FYGA 3CTFA 3F63A 1YKAA 2I81A 3ED3A 3P90A 4FO5A 3FEUA 4K7IA 4TN8A 2X8HA 3Q6OA 2C3TA 2L5LA 1GSSA 5ECMB 3TKQA 1A2LA 3O76A 5AN1A 1TRSA 2IMKA 3HJPA 4PQIA 4KUNA 2GZZA 2IJYA 5G5FA 2VCVA 4PNGA 4G9HA 1TOFA 5F07A 3F8UA 1R5PA 3VLNA 4V2MA 3A2XA 1RQMA 2O85A 1KEBA 3D6IA 3ZVJA 4HZ4A 2H72A 3RBTA 1X0RA 1FO5A 3HYPA 1A2MA 3GH9A 3GIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T7P B;  3F6D A;  4KW6 A;  4WEY A;  4LL1 B;  3EWL A;  3KMN A;  3F0I A;  1HNA A;  4NXI A;  3HY2 A;  5HR3 A;  1TRW A;  1PA3 A;  3ZFB A;  2J9H A;  3KIJ A;  3GSS A;  2ON5 A;  4EO3 A;  3ZLP A;  3UOM A;  3TJB A;  3KTB A;  1T1V A;  3KXO A;  3MAK A;  2FWH A;  2ZUP A;  5GST A;  2H0I A;  1CQH A;  3D0Z A;  3APO A;  2DIZ A;  3BCK A;  5INY A;  2JSY A;  5GZZ B;  3M8N A;  5CRH A;  5JWR B;  5CP1 A;  1W89 A;  2E0Q A;  4PUR A;  2YNX A;  2EC4 A;  2HYX A;  1R4W A;  3F9U A;  3PR8 A;  1E6B A;  5GAN D;  1PKZ A;  2GST A;  1A2J A;  2CZ2 A;  4EE0 A;  2LJA A;  2K18 A;  1GRX A;  4X43 A;  4E8H A;  4KDU A;  2LTK A;  3ZZX A;  1TRU A;  5AIS A;  4XIH A;  2N5A A;  1BQ7 A;  1A0F A;  5FHI A;  5G2Z A;  3C8E A;  2GSS A;  3FR6 A;  4EXJ A;  3DKS A;  4YQV A;  4PNF A;  2GSR A;  2IFQ B;  4TR4 A;  1A8L A;  2LV3 A;  5D9V A;  2VL2 C;  3LYK A;  5ID2 B;  2IFQ A;  4ZBD A;  5D9X A;  1A24 A;  5FT3 A;  4K0N A;  2H1G A;  2X99 A;  5ID2 A;  4IBP A;  3IAS 2;  4KSO A;  1KTE A;  3F4T A;  4K8M A;  4I2T A;  3IC4 A;  3CTG A;  1U6T A;  4HQZ A;  4ZXG A;  1HNB A;  4YH2 A;  3HZ8 A;  2FNO A;  1YF1 A;  2XHF A;  3KP8 A;  4OCE A;  1BYE A;  1H4O A;  3WYW A;  2H0H A;  1PMT A;  2DJ0 A;  4MF7 A;  4ILF A;  4WXT A;  2C80 A;  4HQS A;  2LEG A;  4D73 B;  1FB6 A;  1YQ1 A;  3IE3 A;  4N0V A;  1TRV A;  4POM A;  5ECK B;  2H76 A;  5J4U A;  4D73 A;  4TR1 B;  4IP1 A;  1SK2 A;  1Q4J A;  3NIV A;  3TRX A;  1GUH A;  2B1K A;  4TR1 A;  2I1U A;  1XIY A;  5IPG A;  3QFA C;  2V2G A;  4GST A;  4EUY A;  4PGT A;  4BVY A;  5IMD A;  2JZT A;  4FH8 A;  4GLT A;  2L57 A;  1OAZ A;  2GQK A;  5J5N A;  2YWO A;  2OBK A;  2R37 A;  1TK5 B;  2GT6 A;  2CVK A;  4FYU A;  1VF1 A;  1BG5 A;  3KP9 A;  1SEN A;  3GV1 A;  4O32 A;  2RUF A;  4OO5 A;  1UC7 A;  14GS A;  2LST A;  1V9W A;  5D9T A;  2H73 A;  3NOF A;  2L6D A;  4MCU A;  4IS0 A;  1XOA A;  2JSZ A;  3BCI A;  1EV9 A;  3GFK A;  1U3A A;  3VPT A;  3UJ1 A;  4LMW A;  3TKS E;  3HJO A;  2RM5 A;  1T00 A;  1JZR A;  1B48 A;  2LQQ A;  2MMO A;  4JR4 A;  1AW9 A;  2VUP A;  3VWW A;  5IMV A;  1HD2 A;  4RQX A;  5IMA A;  2WZ9 A;  11GS A;  3GH6 A;  2GLR A;  3I43 A;  4GCI A;  3HJM A;  2FGX A;  1HNC A;  5ECI B;  5CRD A;  5COH A;  1GSE A;  3VWX A;  5DCH A;  2NVL A;  1F37 A;  2NBS A;  1O85 A;  2J23 A;  1GSD A;  2VCT A;  3GRX A;  1GNW A;  4EL1 A;  4BPY A;  5ENU A;  4XS4 B;  4AF2 A;  1SYR A;  3TDG A;  2DJ2 A;  3LWA A;  3R2Q A;  3GNJ A;  3EYT A;  4XS4 A;  3RPP A;  4F82 A;  2CT6 A;  3M3M A;  2IL3 A;  2AJQ B;  3TKS C;  4Q5Q A;  4HOJ A;  3KGK A;  2DC5 A;  4RUV A;  1VF4 A;  3ZML A;  5DQS A;  2H01 A;  1SU9 A;  1V98 A;  2IN3 A;  1NSW A;  2V6K A;  1IYH A;  1WMJ A;  1K0M A;  3C1S A;  4HU9 A;  2TRX A;  3FR3 A;  4TXV A;  3KTL A;  1TTZ A;  1USB A;  6GSY A;  2AV4 A;  3A2W A;  5JWO B;  3CXG A;  3WD6 A;  3HCZ A;  3HXS A;  2K8S A;  1O7U A;  4F0C A;  3FY7 A;  2KP1 A;  5HR1 A;  2IPA A;  1ILO A;  1SJI A;  4BL7 A;  1J9B A;  2EIO A;  1Z5Y E;  2MBT A;  1B8X A;  4O5R A;  1JZO A;  1M2A A;  3GKM A;  1X9W B;  4YQU A;  2JL4 A;  2V41 A;  2O8V B;  4N10 A;  1J0F A;  3Q74 A;  5DBQ A;  4OCF A;  2K9F A;  3D4T A;  4FIW A;  1K0B A;  4QL9 A;  2CQ9 A;  2ON7 A;  2LUS A;  5EVO A;  3P8W A;  4TVE A;  4NHZ A;  4ZB8 A;  2HZE B;  2H6Y A;  3VFI A;  3U6V A;  4ZBB A;  4AGS A;  2VLV A;  1TJD A;  5JCG A;  5A4W A;  5CRE A;  4H86 A;  1RW1 A;  4GSS A;  1AQW A;  4WR5 A;  1G6Y A;  4IEL A;  2HZE A;  1HQO A;  2OAD A;  3RPN A;  4TR3 A;  3G9B A;  2CAQ A;  2XPD A;  3ERG A;  12GS A;  3IV4 A;  1EEM A;  4KAE A;  2H30 A;  5ELA A;  5IPH A;  3F4S A;  5H5S A;  1MTC A;  1X5C A;  4KA0 A;  1PD2 1;  2GQL A;  1B4Q A;  4KGI A;  5IIZ A;  3LXZ A;  2HNL A;  19GS A;  1T4Y A;  4CDO A;  3LOR A;  4WBR D;  2N5B A;  4K7O A;  1NHY A;  1M9B A;  2IME A;  3GN3 A;  3IBH A;  2FHE A;  3HKR A;  4IGJ A;  1URM A;  1XW5 A;  3GST A;  2B3S A;  1X5D A;  3EE2 A;  3UIW A;  4KE3 A;  1GSU A;  3MNG A;  3ME7 A;  1EP8 A;  2VCZ A;  6GSS A;  4WF5 A;  2C0D A;  2M46 A;  1WRY A;  3ZRD A;  2DML A;  5KEJ A;  4KX4 A;  1SL0 B;  4XTS A;  1WJK A;  5D9W A;  3IOS A;  5IMZ A;  3F3R A;  2N5F A;  2HSH A;  4IJI A;  3WT2 A;  3I9V 2;  5CRG A;  1G7O A;  1G0T A;  2HRF A;  1V2A A;  2VM2 A;  5KN1 A;  1TP9 A;  2H0G A;  2V32 A;  3LEF A;  4GQF A;  1AUC A;  3LG6 A;  5IM9 A;  2OJL A;  1A8Y A;  2VD0 A;  1DSB A;  5F0G A;  1R5A A;  2B5E A;  2TRC P;  5ECL B;  4ML1 A;  4MJB A;  3GMF A;  3GUS A;  1WP0 A;  1MDI A;  3KMO A;  3D4M A;  1PL1 A;  1TDI A;  4K9Z A;  1X5E A;  2F8A A;  4JZQ A;  3G7Y A;  2H1B A;  1Y25 A;  5CO3 A;  2AB6 A;  2L6C A;  1F3A A;  3CSJ A;  1ZL9 A;  1XWG A;  2VL3 A;  2GGT A;  2GZY A;  20GS A;  4GRF A;  3TOU A;  1OE7 A;  2EIR A;  2G0F A;  5ECQ B;  1G7E A;  3N5O A;  3IR4 A;  4WKW A;  4ZB6 A;  4LA1 A;  1FW1 A;  3BD2 A;  2VL9 A;  1H75 A;  2L4C A;  3TB2 A;  4ECB A;  1OC3 A;  1WPI A;  1J08 A;  1PL2 A;  5ECR B;  3KCM A;  2RII A;  1WWJ A;  2XBQ A;  6GSV A;  3E3E A;  1YJ6 A;  3VUR A;  5DQY A;  3LGC A;  2VO4 A;  4K2D A;  5DAK B;  1O6J A;  4LLR A;  1S3C A;  2NTO A;  3DYR A;  4WBJ A;  1SK0 A;  5DAK A;  2HLS A;  2C4J A;  3BJ5 A;  2GQM A;  4LMV A;  5DJM A;  1XXU A;  2KOK A;  2BMX A;  4NV5 A;  4RQR A;  2LRT A;  4TOP A;  1EEJ A;  4MA9 A;  5ECN B;  2LNS A;  5H5R A;  4MP4 A;  1HYU A;  2HE3 A;  6GST A;  5LD0 A;  6GSX A;  3SWL A;  3Q18 A;  3QPM A;  1GTI A;  2K6V A;  8GSS A;  3C73 A;  1VRS D;  4IQA A;  4MAB A;  1MDK A;  1F6M C;  3ZRE A;  2R4V A;  3UAP A;  3GL5 A;  1WE0 A;  4OD7 A;  4KDY A;  4DSR A;  3GKN A;  5IOX A;  5ECO B;  3QD9 A;  3J7Y b;  3VK9 A;  4KSM A;  3IPZ A;  2C3Q A;  2M80 A;  1U3I A;  2CAI A;  5DVB A;  1TKD B;  2I4A A;  2FCH A;  2DMM A;  4Q5N A;  4OMV A;  5KN0 A;  4KH7 A;  2F8F A;  4GWR A;  2DBC A;  5HFI A;  2YCD A;  4Q5F A;  3D21 A;  1VF3 A;  1F9M A;  3LQ7 A;  3H79 A;  4XRA A;  3P2A A;  1RK4 A;  4OFN A;  3QAV A;  1SKW B;  1B9X C;  1WIK A;  4HEA 2;  5FWG A;  2HFD A;  2HT9 A;  3FZ9 A;  1G6W A;  4EF0 A;  2MMN A;  3L9U A;  2C0F A;  1TU8 A;  4F03 A;  2A4V A;  1NHO A;  5B8A A;  2YV7 A;  4KDX A;  1Z3E A;  3TJJ A;  3VI5 A;  3KD0 A;  4XS6 A;  1XVQ A;  1QUW A;  3L9V A;  2DJ1 A;  5B8B A;  4L0W A;  18GS A;  2C0E A;  4HI7 A;  2R2J A;  4ZB9 A;  5J9C A;  1EOG A;  2WGR A;  4HUA A;  3TGZ A;  5G5E A;  3U5R E;  4EDY A;  1EP7 A;  2VAF A;  4ECC A;  3Q19 A;  3H4K A;  5G30 A;  4BWS A;  4I97 A;  4RI7 A;  1R7H A;  3CRT A;  3D5J A;  3QR6 A;  3F3Q A;  4CW9 A;  2WB9 A;  4V2N A;  2KP2 A;  1B4P A;  4KB3 A;  2G2Q A;  5GAP D;  4EC0 A;  4OFT A;  4LL4 B;  3GA4 A;  1NM3 A;  5HFK A;  3W6G A;  5D96 A;  3CSH A;  5EL8 A;  2YV9 A;  5AIV A;  3V1W A;  1MD3 A;  5DAL B;  4IJ3 A;  1DBY A;  4BWQ A;  4WR4 A;  2VCX A;  1N2A A;  1V58 A;  4FYB A;  3L4N A;  3TUE A;  1F2E A;  4POL A;  1S3A A;  4EKZ A;  1XVW A;  4MDC A;  3M1G A;  2AYT A;  2D2Z A;  4NWY A;  2LQO A;  1CQG A;  6GSU A;  3FRC A;  2YOI A;  1PRX A;  1OE8 A;  1U87 A;  1EZK A;  2RM6 A;  4ULX A;  3TRP A;  3UL3 A;  5J3R A;  4PXO A;  2GDR A;  5AIX A;  4MH2 A;  2DSA A;  2WJU A;  1GNE A;  2LRC A;  1JZW A;  1TI1 A;  3LJR A;  1JLV A;  2OA7 A;  1TK8 B;  4KCE A;  2HSY A;  3C7M A;  4BA7 A;  3HHV A;  5ECP B;  1AAZ A;  3QAW A;  2CX4 A;  4TXO B;  3AY8 A;  2DIY A;  4TXO A;  1SL2 B;  4NPB A;  5B6N A;  4NHW A;  1FHE A;  1PGT A;  2HXK A;  1XPV A;  1YZX A;  4L0U A;  2VCW A;  4DSQ A;  3UVH A;  4JU5 A;  2JU5 A;  4J56 E;  5LNK e;  2YWN A;  5IQY A;  4AJ6 A;  1THO A;  4J57 E;  4PUA A;  3EIN A;  3HA9 A;  3MSZ A;  1EWX A;  3RAZ A;  1AQX A;  4IVF A;  4MZB A;  5A4V A;  1E2Y A;  2X64 A;  3BBY A;  3FKF A;  4HJ2 A;  1R26 A;  1SL1 B;  1A23 A;  2F51 A;  1JFU A;  2H74 A;  2LRN A;  2PU9 C;  4E8E A;  5G31 A;  5C04 A;  1ZMA A;  4I6X A;  2CVB A;  1OKT A;  4JBB A;  4IP6 A;  4V1A p;  3TJG A;  4TKY A;  3E9J B;  4POB A;  1UVZ A;  1ERU A;  4XHM A;  2OKA A;  1EOH A;  2B6M A;  3UBL A;  1M99 A;  4MPF A;  1GUK A;  3CRU A;  2QC7 A;  2QSI A;  2VD1 A;  4DEJ A;  5KN2 A;  3CBU A;  1T3B A;  3EU3 A;  4ZIL A;  3JCM L;  3APS A;  2REM A;  3ZTL A;  2GS3 A;  3DD3 A;  1X9S B;  1GH2 A;  2H1D A;  1OKD A;  1BX9 A;  1ZYE A;  3C71 A;  1YEP A;  3G7J A;  4NAX A;  1T8E B;  4F0B A;  2YZH A;  2O7K A;  1QFN A;  2FWE A;  3I69 A;  4QQ7 A;  4MZC A;  3ZIT A;  4MZW A;  1LJR A;  2YPM A;  1UA5 A;  4PQH A;  3TRQ A;  5IOW A;  5HQP A;  1Q98 A;  2BJX A;  4IHU A;  3DEX A;  2PER A;  5IMC A;  1YY7 A;  4MJA A;  2B7J A;  2V6O A;  1SKS B;  1O8W A;  2OBI A;  3IHQ A;  3QOU A;  2OE1 A;  2C8U A;  5E59 A;  3QCP A;  1DUG A;  4IQ1 A;  4O7H A;  1ZGN A;  1K3Y A;  2DJK A;  3GTU B;  1JZD A;  5J41 A;  3L78 A;  3IK7 A;  2FA8 A;  3GTU A;  1SK1 A;  2R5G A;  1ZOF A;  4JRR A;  2MMA A;  5DCG A;  2B5Y A;  2KUC A;  4G2E A;  3IRA A;  3CYN A;  1XBS A;  2RUE A;  1FOV A;  2H8L A;  2O87 A;  4WF4 A;  5G1L A;  1FB0 A;  1LBK A;  5CNW A;  4KND A;  2XBI A;  4ZIJ A;  3TJK A;  1TW9 A;  2C1Y A;  3VWV A;  1QK8 A;  3I6A A;  1MD4 A;  4K7N A;  3EMX A;  2B1L A;  5JWQ B;  3BOA A;  1EV4 A;  2MMZ A;  1ERV A;  1F3B A;  2FUG 2;  2YJ7 A;  3CSI A;  1Z7R A;  2C0G A;  2TIR A;  1GUM A;  1SJZ A;  3O6T A;  2ZNM A;  1GSF A;  4GXZ A;  3IAM 2;  4OO4 A;  4KCA A;  4ZBA A;  1YDK A;  2MYG A;  2L4Q A;  2VLU A;  4MF5 A;  2PN8 A;  3DVX A;  1YKC A;  2ES7 A;  3EMP A;  1K0C A;  4FYC A;  4AJ8 A;  3FHK A;  3ZIV A;  5CAX A;  1QQ2 A;  3EUR A;  1XCC A;  2ALB A;  1O73 A;  4IW9 A;  4L8E A;  2OE3 A;  1XWA A;  4WET A;  2VLT A;  4N30 A;  2LNT A;  3E0U A;  3ZMK A;  4Z7X A;  2AAW A;  1GTB A;  5D93 A;  2YWM A;  4ZL9 A;  2A2S A;  4HDE A;  3RHC A;  10GS A;  1GWC A;  4N11 A;  2H75 A;  2DJJ A;  3ZIJ A;  3W8S A;  4PQ1 A;  2H66 A;  3DVW A;  1GP1 A;  1Z9H A;  2CV4 A;  4J2F A;  4N0Z A;  2IMD A;  1W4V A;  4HU7 A;  3ISO A;  4ID0 A;  4IKH A;  3APQ A;  1PN9 A;  2HI7 A;  3HZ4 A;  2MZC A;  4RI6 A;  2FA4 A;  4P3Y B;  5IMF A;  4F2I A;  2IWT A;  3ME8 A;  2PWJ A;  2FY6 A;  1QGV A;  2H1A A;  3QAG A;  1FAA A;  4GQC A;  3W8J A;  1C72 A;  4ML6 A;  1M9A A;  5E4W A;  5ECH B;  7GSS A;  3GYK A;  4JR6 A;  1K0A A;  2H71 A;  5A5K A;  2FD3 A;  2O89 A;  1XZO A;  3GKK A;  4YQM A;  5J9B A;  1SYX A;  5ABR A;  3NZN A;  3QDN A;  4IN0 A;  2WRT A;  2YZU A;  1XOB A;  2IMI A;  1MDJ A;  4GSN A;  1QXH A;  3KEB A;  5D8I A;  2F3M A;  2CX3 A;  4MJC A;  2IIY A;  2B7K A;  4MMM A;  2A2R A;  1PX6 A;  1DE1 A;  3M9K A;  1LU4 A;  4MLY A;  1GLP A;  6GSW A;  4ACS A;  3ZYW A;  3IXR A;  1YEX A;  5HR2 A;  4ZL8 A;  5D73 A;  5F05 A;  1DE2 A;  3H1N A;  4YAV A;  4MPG A;  2P5Q A;  2E2M A;  1V57 A;  1GTA A;  1Z6M A;  3IK9 A;  1NW2 A;  2DLX A;  2LJK A;  2WFC A;  4TR0 A;  3ZVJ D;  3RDW A;  5F8B A;  2YWI A;  2JZS A;  4L5L A;  1K0O A;  4YAP A;  2L5O A;  1K0D A;  3HD5 A;  1Z7P A;  4MK3 A;  1XWK A;  1ST9 A;  4DSS B;  3WGE A;  4OWY A;  1PKW A;  5JCW A;  1GUL A;  4DSS A;  2GTU A;  3IA1 A;  3VI7 A;  4O92 A;  2XC2 A;  5DJL A;  1FVJ A;  2CA8 A;  2JAC A;  1PSQ A;  3HVV A;  5A4U A;  3C1R A;  3K8N A;  4QL7 A;  4NV2 A;  1I9D A;  3WT1 A;  4POK A;  2YP6 A;  2FWF A;  3A2V A;  5F06 A;  3LYP A;  4TRX A;  2NPB A;  3DML A;  3ZFL A;  4I5Q A;  1SD8 A;  1FVK A;  3QFB C;  2H6Z A;  3GHA A;  4AJ7 A;  5KN3 A;  1VF2 A;  2IMF A;  1ERT A;  3GL3 A;  3IDV A;  1EGO A;  1PX7 A;  5CYY A;  2VL2 A;  1YF0 A;  1BJX A;  1K3L A;  1SKR B;  1UN2 A;  3US3 A;  2JAD A;  2AUV A;  1ZYQ B;  2HZF A;  4X0X A;  3M0F A;  4XCS A;  2M72 A;  2CZ3 A;  2OAC A;  5CRW A;  3DIE A;  1V40 A;  4MH3 A;  3VPQ A;  5DAL A;  4DVC A;  4V1A g;  3DRN A;  3S9F A;  2B5X A;  1ABA A;  5B7C A;  1AC1 A;  3FW2 A;  4NMU A;  3F4R A;  1U88 A;  2X8G A;  4CHS A;  3EU4 A;  3TJF A;  1M2B A;  1WOU A;  3L0H A;  3TOT A;  1Y6E A;  1OYJ A;  5LCZ A;  2H6X A;  13GS A;  4K0G A;  2C3N A;  3D22 A;  2MBS A;  3L9S A;  4BVX A;  3UVT A;  2P5R A;  3FR9 A;  1GL8 A;  3ERW A;  3ZL5 A;  3A3T A;  3H8Q A;  1AIU A;  1K0N A;  1TXX A;  2VOC A;  2YN1 A;  2RLI A;  2KLX A;  3GX0 A;  3F6F A;  2VCQ A;  2BTO T;  3G7I A;  2L59 A;  1AXD A;  4F9Z A;  2F9S A;  3PIN A;  2PMT A;  1B9Y C;  1KNG A;  4V2L A;  4XS1 A;  1JHB A;  2PPT A;  4L5O A;  3LSZ A;  4K1F A;  4EVM A;  4Q5R A;  1GSQ A;  4X1U A;  3DXB A;  2FLS A;  5C00 A;  3WGX A;  3UEM A;  3FZA A;  3RHB A;  5GSS A;  2X8C A;  3UAR A;  3ERF A;  2PVO C;  3KJY A;  5H5Q A;  3DGQ A;  2V1M A;  2GVP A;  4MJE A;  1ML6 A;  4HJM A;  2WUL A;  3LXT A;  2YAN A;  1XWB A;  3EVI A;  1KBN A;  4OFM A;  1M2D A;  1QMV A;  1IYI A;  2R3X A;  2R6K A;  2Z9S A;  1SD9 A;  3H93 A;  5ELG A;  2DJ3 A;  3CMI A;  2CVD A;  1XW6 A;  1BAY A;  3FZ4 A;  4G19 A;  4ZL7 A;  3VWU A;  2GZP A;  2WDU A;  2ZCT A;  1SJ6 A;  3KZQ A;  1GLQ A;  5EPF A;  2H70 A;  1ERW A;  3MWH A;  1OC8 A;  1S3D A;  1M0U A;  1I5G A;  4G10 A;  5G1K A;  2HRN A;  2WCI A;  2LJR A;  2E2G A;  1ON4 A;  1EGR A;  2VIM A;  1TI3 A;  3HVS A;  1BED A;  3LFL A;  3N9J A;  4ECJ A;  4I2U A;  4HZ2 A;  2FWG A;  2NDO A;  4PUF C;  3UMA A;  2QKE A;  4HS1 A;  1ZCP A;  3EC3 A;  2LKU A;  1N8J A;  3HDC A;  4EDZ A;  5ECS A;  5JCU A;  2PBJ A;  2YJH A;  1OC9 B;  3TKS A;  3J7Y k;  2PGT A;  3WGD A;  2JZR A;  2K8V A;  2I9H A;  2WS2 A;  2LS5 A;  1VGL A;  1OC9 A;  1K3O A;  4ISD A;  3GX8 A;  3TKR A;  1A0R P;  22GS A;  2GSQ A;  2XPE A;  4GTU A;  1M7T A;  17GS A;  1GSY A;  3DWV A;  1XW9 A;  4XRD A;  1PQN A;  3PH9 A;  1ACV A;  5HR0 A;  3UBK A;  5DDL A;  3KH7 A;  3PGT A;  2OE0 A;  5B6M A;  4MF6 A;  2QGV A;  1THX A;  1O8X A;  3GUR A;  1OVN A;  3M9J A;  5EY6 A;  1AQV A;  2VM1 A;  4TW5 A;  5HFG A;  5AGY A;  2H19 A;  3FK8 A;  3O3T A;  4GF0 A;  2EIQ A;  1X9M B;  4PX1 A;  1TK0 B;  2GT5 A;  3A5W A;  3P7X A;  1FG4 A;  1T4Z A;  5IO0 A;  3GKX A;  3SBC A;  2PUK C;  1JLW A;  1MEK A;  2E7P A;  16GS A;  2P31 A;  4I8B A;  1GTU A;  3HVX A;  4JED A;  9GSS A;  3KM6 A;  5L71 A;  4JE1 A;  3TCO A;  4K6X A;  5IO2 A;  3QMX A;  3TKP A;  1ZZY A;  1XWC A;  1TU7 A;  1XFL A;  2P0G A;  2PVQ A;  4ECI A;  2KHP A;  1Z6N A;  3KH9 A;  2AHE A;  3MDK A;  2I3Y A;  1O81 A;  3FZ5 A;  3OR5 A;  3FYG A;  3CTF A;  3F63 A;  1YKA A;  2I81 A;  3ED3 A;  3P90 A;  4FO5 A;  3FEU A;  4K7I A;  4TN8 A;  2X8H A;  3Q6O A;  2C3T A;  2L5L A;  1GSS A;  5ECM B;  3TKQ A;  1A2L A;  3O76 A;  5AN1 A;  1TRS A;  2IMK A;  3HJP A;  4PQI A;  4KUN A;  2GZZ A;  2IJY A;  5G5F A;  2VCV A;  4PNG A;  4G9H A;  1TOF A;  5F07 A;  3F8U A;  1R5P A;  3VLN A;  4V2M A;  3A2X A;  1RQM A;  2O85 A;  1KEB A;  3D6I A;  3ZVJ A;  4HZ4 A;  2H72 A;  3RBT A;  1X0R A;  1FO5 A;  3HYP A;  1A2M A;  3GH9 A;  3GIX A; 
#chains in the Genus database with same CATH topology
 1T7P B;  3F6D A;  4KW6 A;  4WEY A;  4LL1 B;  3EWL A;  3KMN A;  3F0I A;  1HNA A;  4NXI A;  3HY2 A;  5HR3 A;  1TRW A;  1PA3 A;  3ZFB A;  2J9H A;  3KIJ A;  4Z2T A;  3GSS A;  2ON5 A;  4EO3 A;  3ZLP A;  3UOM A;  3TJB A;  3KTB A;  1T1V A;  3KXO A;  3MAK A;  2FWH A;  2ZUP A;  5GST A;  2H0I A;  1CQH A;  3D0Z A;  3APO A;  2DIZ A;  2HSM A;  3BCK A;  5INY A;  2JSY A;  5GZZ B;  3M8N A;  5CRH A;  5JWR B;  5CP1 A;  1W89 A;  2E0Q A;  4PUR A;  2YNX A;  4FQU A;  2EC4 A;  2HYX A;  1R4W A;  3F9U A;  3PR8 A;  1E6B A;  5GAN D;  1PKZ A;  2GST A;  1A2J A;  2CZ2 A;  4EE0 A;  2LJA A;  2K18 A;  1GRX A;  4X43 A;  4E8H A;  4KDU A;  2LTK A;  3ZZX A;  1TRU A;  5AIS A;  2DKH A;  4XIH A;  2N5A A;  1BQ7 A;  1A0F A;  5FHI A;  5G2Z A;  3C8E A;  2GSS A;  3FR6 A;  4EXJ A;  3DKS A;  4YQV A;  4PNF A;  2GSR A;  2IFQ B;  4TR4 A;  1A8L A;  2LV3 A;  5D9V A;  2VL2 C;  3LYK A;  5ID2 B;  2IFQ A;  4ZBD A;  5D9X A;  1A24 A;  5FT3 A;  4K0N A;  2H1G A;  2UZ8 A;  2X99 A;  5ID2 A;  2R0P A;  4IBP A;  3IAS 2;  4KSO A;  1KTE A;  3F4T A;  4K8M A;  4I2T A;  3IC4 A;  3CTG A;  1U6T A;  4HQZ A;  4ZXG A;  1HNB A;  4YH2 A;  3HZ8 A;  2FNO A;  1YF1 A;  2XHF A;  3KP8 A;  4OCE A;  1BYE A;  1H4O A;  3WYW A;  2H0H A;  1PMT A;  2DJ0 A;  4MF7 A;  4ILF A;  4WXT A;  2C80 A;  2R0G A;  4HQS A;  2LEG A;  4D73 B;  1FB6 A;  1YQ1 A;  3IE3 A;  4N0V A;  1TRV A;  4POM A;  1ZYP A;  5ECK B;  2H76 A;  5J4U A;  4D73 A;  4TR1 B;  4IP1 A;  1SK2 A;  1Q4J A;  3NIV A;  4BVY B;  3TRX A;  1GUH A;  2B1K A;  4TR1 A;  2I1U A;  1XIY A;  5IPG A;  3QFA C;  2V2G A;  4GST A;  4EUY A;  4PGT A;  4BVY A;  5IMD A;  2JZT A;  4FH8 A;  4GLT A;  2L57 A;  1OAZ A;  2GQK A;  5J5N A;  2YWO A;  2OBK A;  2R37 A;  1TK5 B;  2GT6 A;  2CVK A;  4FYU A;  1VF1 A;  1BG5 A;  3KP9 A;  1SEN A;  3GV1 A;  4O32 A;  2RUF A;  4OO5 A;  1UC7 A;  14GS A;  2LST A;  3MIX A;  1V9W A;  5D9T A;  2H73 A;  3NOF A;  2L6D A;  4MCU A;  4IS0 A;  1XOA A;  2JSZ A;  3BCI A;  1EV9 A;  3GFK A;  1U3A A;  3VPT A;  3UJ1 A;  4LMW A;  3TKS E;  3HJO A;  3MYD A;  2RM5 A;  1T00 A;  1JZR A;  1B48 A;  2LQQ A;  2MMO A;  4JR4 A;  1AW9 A;  2VUP A;  3VWW A;  5IMV A;  1HD2 A;  4RQX A;  5IMA A;  2WZ9 A;  11GS A;  3GH6 A;  2GLR A;  3I43 A;  4GCI A;  3HJM A;  2FGX A;  1HNC A;  5ECI B;  5CRD A;  5COH A;  1GSE A;  3VWX A;  5DCH A;  2NVL A;  1F37 A;  2NBS A;  1O85 A;  2J23 A;  1GSD A;  2VCT A;  3GRX A;  1GNW A;  1S3R A;  4EL1 A;  4BPY A;  5ENU A;  4XS4 B;  4AF2 A;  1SYR A;  3TDG A;  2DJ2 A;  3LWA A;  3R2Q A;  3GNJ A;  3EYT A;  4XS4 A;  3RPP A;  4F82 A;  2CT6 A;  3M3M A;  2IL3 A;  2AJQ B;  3TKS C;  4Q5Q A;  4HOJ A;  3KGK A;  2DC5 A;  4RUV A;  1VF4 A;  3FMW A;  5DQS A;  2H01 A;  3ZML A;  1SU9 A;  1V98 A;  5KOX A;  2IN3 A;  1NSW A;  2V6K A;  1IYH A;  1WMJ A;  1K0M A;  3C1S A;  4HU9 A;  2TRX A;  3FR3 A;  4TXV A;  3KTL A;  1TTZ A;  1USB A;  6GSY A;  2AV4 A;  3A2W A;  5JWO B;  3CXG A;  4BL7 B;  3WD6 A;  3HCZ A;  3HXS A;  2K8S A;  1O7U A;  4F0C A;  3FY7 A;  2KP1 A;  5HR1 A;  2IPA A;  1ILO A;  1SJI A;  4BL7 A;  1J9B A;  2EIO A;  1Z5Y E;  2MBT A;  1B8X A;  4O5R A;  1JZO A;  1M2A A;  3GKM A;  1X9W B;  4YQU A;  2JL4 A;  2V41 A;  2O8V B;  4N10 A;  1J0F A;  3Q74 A;  5DBQ A;  4OCF A;  2K9F A;  3D4T A;  4FIW A;  1K0B A;  4QL9 A;  2CQ9 A;  2ON7 A;  2LUS A;  5EVO A;  3P8W A;  4TVE A;  4NHZ A;  4ZB8 A;  2HZE B;  2H6Y A;  3VFI A;  3U6V A;  4ZBB A;  4AGS A;  2VLV A;  1TJD A;  5JCG A;  5A4W A;  5CRE A;  4H86 A;  1RW1 A;  4GSS A;  1AQW A;  4WR5 A;  1G6Y A;  4IEL A;  2HZE A;  1HQO A;  2OAD A;  3RPN A;  4TR3 A;  3G9B A;  2CAQ A;  2XPD A;  3ERG A;  12GS A;  3IV4 A;  1EEM A;  4KAE A;  2H30 A;  5ELA A;  5IPH A;  3F4S A;  5H5S A;  1MTC A;  1X5C A;  4KA0 A;  1PD2 1;  1FOH A;  2GQL A;  1B4Q A;  4KGI A;  5IIZ A;  3LXZ A;  2HNL A;  19GS A;  1T4Y A;  4CDO A;  3LOR A;  4WBR D;  2N5B A;  2QA1 A;  4K7O A;  1NHY A;  1M9B A;  2IME A;  3GN3 A;  3IBH A;  2FHE A;  3HKR A;  4IGJ A;  1URM A;  1XW5 A;  3GST A;  2B3S A;  1X5D A;  3EE2 A;  3UIW A;  4KE3 A;  1GSU A;  3MNG A;  3ME7 A;  1EP8 A;  2VCZ A;  6GSS A;  4WF5 A;  2C0D A;  2M46 A;  1WRY A;  3ZRD A;  2DML A;  5KEJ A;  4KX4 A;  1SL0 B;  4XTS A;  1WJK A;  5KOW A;  5D9W A;  3IOS A;  3IC8 A;  5IMZ A;  3F3R A;  2N5F A;  2HSH A;  4IJI A;  3WT2 A;  3I9V 2;  5CRG A;  2A4H A;  1G7O A;  1G0T A;  2HRF A;  1V2A A;  2VM2 A;  5KN1 A;  1TP9 A;  2H0G A;  2V32 A;  3LEF A;  4K5R A;  4GQF A;  1AUC A;  3LG6 A;  5IM9 A;  2OJL A;  1A8Y A;  2VD0 A;  1DSB A;  5F0G A;  1R5A A;  2B5E A;  2TRC P;  5ECL B;  4ML1 A;  4MJB A;  3GMF A;  3GUS A;  1WP0 A;  1MDI A;  3KMO A;  4X4J A;  3D4M A;  1PL1 A;  1TDI A;  4K9Z A;  1X5E A;  2F8A A;  4JZQ A;  3G7Y A;  2H1B A;  1Y25 A;  5CO3 A;  2AB6 A;  2L6C A;  1F3A A;  3CSJ A;  1ZL9 A;  1XWG A;  2VL3 A;  2GGT A;  2GZY A;  20GS A;  4GRF A;  3TOU A;  1OE7 A;  2EIR A;  2G0F A;  5ECQ B;  1G7E A;  3N5O A;  3IR4 A;  4WKW A;  4ZB6 A;  4LA1 A;  3IHG A;  1FW1 A;  3BD2 A;  2VL9 A;  1H75 A;  2L4C A;  3TB2 A;  4ECB A;  1OC3 A;  1WPI A;  1J08 A;  1PL2 A;  4PTS A;  5ECR B;  3KCM A;  2RII A;  1WWJ A;  2XBQ A;  6GSV A;  3E3E A;  1YJ6 A;  3VUR A;  5DQY A;  3LGC A;  2VO4 A;  4K2D A;  5DAK B;  1O6J A;  4LLR A;  1S3C A;  2NTO A;  3DYR A;  4WBJ A;  1SK0 A;  5DAK A;  2HLS A;  2C4J A;  3BJ5 A;  2QA2 A;  2GQM A;  4LMV A;  5DJM A;  1XXU A;  2KOK A;  1M3I A;  2BMX A;  4NV5 A;  4RQR A;  4K2X A;  2LRT A;  4TOP A;  1EEJ A;  4MA9 A;  5ECN B;  2LNS A;  5H5R A;  4MP4 A;  1HYU A;  2HE3 A;  6GST A;  5LD0 A;  6GSX A;  3SWL A;  3Q18 A;  3QPM A;  1GTI A;  2K6V A;  8GSS A;  3C73 A;  1VRS D;  4IQA A;  4MAB A;  1MDK A;  1F6M C;  3ZRE A;  3HVN A;  2R4V A;  3UAP A;  4YKG A;  3GL5 A;  1WE0 A;  4OD7 A;  4KDY A;  4DSR A;  3GKN A;  5IOX A;  5ECO B;  3QD9 A;  3J7Y b;  3VK9 A;  4KSM A;  3IPZ A;  2C3Q A;  2M80 A;  1U3I A;  2CAI A;  5DVB A;  3PPU A;  1TKD B;  2I4A A;  4G0L A;  2FCH A;  2DMM A;  4Q5N A;  4OMV A;  5KN0 A;  4KH7 A;  2F8F A;  4GWR A;  2DBC A;  5HFI A;  2YCD A;  4Q5F A;  3D21 A;  1VF3 A;  1F9M A;  3LQ7 A;  3H79 A;  4XRA A;  3P2A A;  1RK4 A;  4OFN A;  3QAV A;  1SKW B;  1B9X C;  1WIK A;  4HEA 2;  5FWG A;  2HFD A;  2HT9 A;  3FZ9 A;  1G6W A;  4EF0 A;  2MMN A;  3L9U A;  2C0F A;  1TU8 A;  4F03 A;  2A4V A;  1NHO A;  5B8A A;  2YV7 A;  4KDX A;  1Z3E A;  3TJJ A;  3VI5 A;  3KD0 A;  2X4A A;  4XS6 A;  1XVQ A;  5BRT A;  1QUW A;  3L9V A;  2DJ1 A;  5B8B A;  4L0W A;  18GS A;  2C0E A;  4HI7 A;  2R2J A;  4ZB9 A;  5J9C A;  1EOG A;  2WGR A;  4HUA A;  3TGZ A;  5G5E A;  3U5R E;  4EDY A;  1EP7 A;  2VAF A;  4G0I A;  4ECC A;  3Q19 A;  3H4K A;  5G30 A;  4BWS A;  4I97 A;  4RI7 A;  1R7H A;  3CRT A;  3D5J A;  3QR6 A;  3F3Q A;  4CW9 A;  2WB9 A;  4V2N A;  2KP2 A;  1B4P A;  4KB3 A;  2G2Q A;  5GAP D;  4EC0 A;  4OFT A;  4LL4 B;  3GA4 A;  1NM3 A;  5HFK A;  4CY8 A;  3W6G A;  5D96 A;  3CSH A;  5EL8 A;  2R0C A;  2YV9 A;  5AIV A;  3V1W A;  1MD3 A;  5DAL B;  4IJ3 A;  1DBY A;  4BWQ A;  4WR4 A;  2VCX A;  1N2A A;  1V58 A;  4FYB A;  3L4N A;  3TUE A;  1F2E A;  4POL A;  1S3A A;  4EKZ A;  1XVW A;  4MDC A;  3M1G A;  2AYT A;  2D2Z A;  4NWY A;  2LQO A;  1CQG A;  6GSU A;  3FRC A;  2YOI A;  1PRX A;  1OE8 A;  1U87 A;  1EZK A;  2RM6 A;  4ULX A;  3TRP A;  3UL3 A;  5J3R A;  4PXO A;  2GDR A;  5AIX A;  2A2P A;  4MH2 A;  2DSA A;  2WJU A;  1GNE A;  2LRC A;  1JZW A;  1TI1 A;  3LJR A;  1JLV A;  4O5Q A;  2OA7 A;  1TK8 B;  4KCE A;  2HSY A;  3C7M A;  4BA7 A;  3HHV A;  5ECP B;  1AAZ A;  3QAW A;  2CX4 A;  4TXO B;  3AY8 A;  2DIY A;  4TXO A;  4O5U A;  1SL2 B;  4NPB A;  5B6N A;  1XG8 A;  4NHW A;  1FHE A;  1PGT A;  2HXK A;  1XPV A;  1YZX A;  4L0U A;  2VCW A;  4DSQ A;  3UVH A;  4JU5 A;  2JU5 A;  4J56 E;  5LNK e;  2YWN A;  5IQY A;  4AJ6 A;  1THO A;  4J57 E;  4PUA A;  3EIN A;  3HA9 A;  3MSZ A;  1EWX A;  3RAZ A;  1AQX A;  4G0K A;  4IVF A;  4MZB A;  5A4V A;  1E2Y A;  2X64 A;  3BBY A;  3FKF A;  4HJ2 A;  1R26 A;  1SL1 B;  1A23 A;  2F51 A;  1JFU A;  2H74 A;  2LRN A;  2PU9 C;  4E8E A;  5G31 A;  5C04 A;  1ZMA A;  4I6X A;  2CVB A;  1OKT A;  4JBB A;  4IP6 A;  4V1A p;  4BIK A;  3TJG A;  4TKY A;  4EIQ A;  3E9J B;  4POB A;  1UVZ A;  1ERU A;  4XHM A;  2OKA A;  1EOH A;  2B6M A;  3UBL A;  1M99 A;  4MPF A;  4USS A;  1GUK A;  3CRU A;  2QC7 A;  2QSI A;  2VD1 A;  4DEJ A;  5KN2 A;  3CBU A;  1T3B A;  4Z2R A;  3EU3 A;  4ZIL A;  3JCM L;  3APS A;  2REM A;  3ZTL A;  2GS3 A;  3DD3 A;  1X9S B;  1GH2 A;  2H1D A;  1OKD A;  1BX9 A;  1ZYE A;  3C71 A;  1YEP A;  3G7J A;  4NAX A;  1T8E B;  4F0B A;  2YZH A;  2O7K A;  1QFN A;  2FWE A;  3I69 A;  4QQ7 A;  4MZC A;  3ZIT A;  4MZW A;  1LJR A;  2YPM A;  1UA5 A;  4PQH A;  3TRQ A;  5IOW A;  5HQP A;  1Q98 A;  2BJX A;  4IHU A;  3DEX A;  2PER A;  5IMC A;  1YY7 A;  4MJA A;  4KF9 A;  2B7J A;  1M3J A;  2V6O A;  1SKS B;  1O8W A;  2OBI A;  3IHQ A;  3QOU A;  2OE1 A;  2C8U A;  5E59 A;  3QCP A;  1DUG A;  2DKI A;  4IQ1 A;  4O7H A;  1ZGN A;  1PN0 A;  1K3Y A;  2DJK A;  3GTU B;  1JZD A;  5J41 A;  3L78 A;  2HRK A;  3IK7 A;  2FA8 A;  3GTU A;  1SK1 A;  2R5G A;  1ZOF A;  4JRR A;  2MMA A;  5DCG A;  2B5Y A;  2KUC A;  4G2E A;  3IRA A;  3CYN A;  1XBS A;  2RUE A;  1FOV A;  2H8L A;  2O87 A;  4WF4 A;  5G1L A;  1FB0 A;  1LBK A;  5CNW A;  4KND A;  2XBI A;  4Z2U A;  4ZIJ A;  3TJK A;  1TW9 A;  2C1Y A;  3VWV A;  1QK8 A;  3I6A A;  1MD4 A;  4K7N A;  3EMX A;  2B1L A;  5JWQ B;  3BOA A;  3LW9 A;  1EV4 A;  2MMZ A;  1ERV A;  1F3B A;  2FUG 2;  2YJ7 A;  3CSI A;  1Z7R A;  2C0G A;  2TIR A;  1GUM A;  1SJZ A;  3O6T A;  2ZNM A;  1GSF A;  4GXZ A;  3IAM 2;  4OO4 A;  4KCA A;  4ZBA A;  1YDK A;  2MYG A;  2L4Q A;  2VLU A;  4MF5 A;  2PN8 A;  3DVX A;  1YKC A;  2ES7 A;  3EMP A;  1K0C A;  4FYC A;  4AJ8 A;  3FHK A;  3ZIV A;  5CAX A;  1QQ2 A;  3EUR A;  1XCC A;  2ALB A;  1O73 A;  4IW9 A;  4L8E A;  2OE3 A;  3A5I A;  1XWA A;  1ZYN A;  4WET A;  2VLT A;  4N30 A;  2LNT A;  3E0U A;  3ZMK A;  4Z7X A;  2AAW A;  1GTB A;  5D93 A;  2YWM A;  4ZL9 A;  2A2S A;  4HDE A;  3RHC A;  10GS A;  1GWC A;  4N11 A;  2H75 A;  2DJJ A;  3ZIJ A;  3W8S A;  4PQ1 A;  2HRA A;  2H66 A;  3DVW A;  1GP1 A;  1Z9H A;  2CV4 A;  4J2F A;  4N0Z A;  2IMD A;  1W4V A;  4HU7 A;  3ISO A;  4ID0 A;  4IKH A;  3APQ A;  1PN9 A;  2HI7 A;  3HZ4 A;  2MZC A;  4RI6 A;  2FA4 A;  4P3Y B;  5BMU A;  5IMF A;  4F2I A;  2IWT A;  4K5S A;  3ME8 A;  2PWJ A;  2FY6 A;  3EPT A;  1QGV A;  2H1A A;  3QAG A;  1FAA A;  1PFO A;  4GQC A;  3W8J A;  1C72 A;  4ML6 A;  1M9A A;  5E4W A;  5ECH B;  7GSS A;  3GYK A;  4JR6 A;  1K0A A;  2H71 A;  5A5K A;  2FD3 A;  2O89 A;  1XZO A;  3GKK A;  4YQM A;  5J9B A;  1SYX A;  5ABR A;  3NZN A;  3QDN A;  4IN0 A;  2WRT A;  2YZU A;  1XOB A;  2IMI A;  1MDJ A;  4CY6 A;  4GSN A;  1QXH A;  3KEB A;  5D8I A;  2F3M A;  2CX3 A;  4MJC A;  2IIY A;  2B7K A;  4MMM A;  2A2R A;  1PX6 A;  1DE1 A;  3M9K A;  1LU4 A;  4MLY A;  1GLP A;  6GSW A;  4ACS A;  3ZYW A;  3IXR A;  1YEX A;  5HR2 A;  4ZL8 A;  5D73 A;  5F05 A;  4MNN A;  1DE2 A;  3H1N A;  4YAV A;  4MPG A;  2P5Q A;  2E2M A;  1V57 A;  1GTA A;  1Z6M A;  3IK9 A;  1NW2 A;  2DLX A;  2LJK A;  2WFC A;  4TR0 A;  3ZVJ D;  3RDW A;  5F8B A;  2YWI A;  2JZS A;  4L5L A;  1K0O A;  4YAP A;  2L5O A;  1K0D A;  3HD5 A;  1Z7P A;  4MK3 A;  1XWK A;  1ST9 A;  4DSS B;  3WGE A;  4OWY A;  1PKW A;  5JCW A;  1GUL A;  2X49 A;  4DSS A;  2GTU A;  3IA1 A;  3VI7 A;  4O92 A;  2XC2 A;  5DJL A;  1FVJ A;  2CA8 A;  2JAC A;  1PSQ A;  3HVV A;  5A4U A;  3C1R A;  3K8N A;  4QL7 A;  4NV2 A;  1I9D A;  3WT1 A;  4POK A;  2YP6 A;  2FWF A;  3A2V A;  5F06 A;  3LYP A;  4TRX A;  2NPB A;  3DML A;  3ZFL A;  4I5Q A;  1SD8 A;  1FVK A;  3QFB C;  2H6Z A;  3GHA A;  4AJ7 A;  5KN3 A;  1VF2 A;  2IMF A;  1ERT A;  3GL3 A;  3IDV A;  1EGO A;  1PX7 A;  5CYY A;  2VL2 A;  1YF0 A;  1BJX A;  1K3L A;  1SKR B;  1UN2 A;  3US3 A;  2JAD A;  2AUV A;  1ZYQ B;  2HZF A;  4X0X A;  3M0F A;  4XCS A;  2M72 A;  2CZ3 A;  2OAC A;  5CRW A;  3DIE A;  1V40 A;  4MH3 A;  3VPQ A;  5DAL A;  4DVC A;  4V1A g;  3DRN A;  3S9F A;  2B5X A;  1ABA A;  5B7C A;  1AC1 A;  3FW2 A;  4NMU A;  3F4R A;  1U88 A;  2X8G A;  4CHS A;  3EU4 A;  3TJF A;  1M2B A;  1WOU A;  3L0H A;  4BVX B;  3TOT A;  1Y6E A;  1OYJ A;  5LCZ A;  2H6X A;  13GS A;  4K0G A;  2C3N A;  3D22 A;  2MBS A;  3L9S A;  4BVX A;  3UVT A;  2P5R A;  3FR9 A;  1GL8 A;  3ERW A;  3ZL5 A;  3A3T A;  3H8Q A;  1AIU A;  1K0N A;  1TXX A;  2VOC A;  4YKF A;  2YN1 A;  2RLI A;  2KLX A;  3GX0 A;  3F6F A;  2VCQ A;  2BTO T;  3G7I A;  2L59 A;  1AXD A;  4F9Z A;  2F9S A;  3PIN A;  2PMT A;  1B9Y C;  1KNG A;  4V2L A;  4XS1 A;  1JHB A;  2PPT A;  4L5O A;  3LSZ A;  4K1F A;  4EVM A;  4ICY A;  4Q5R A;  1GSQ A;  4X1U A;  3DXB A;  2FLS A;  5C00 A;  3WGX A;  3UEM A;  3FZA A;  3R3E A;  3RHB A;  5GSS A;  2X8C A;  3UAR A;  3ERF A;  2PVO C;  3KJY A;  5H5Q A;  3DGQ A;  2V1M A;  2GVP A;  4MJE A;  1ML6 A;  4HJM A;  2WUL A;  3LXT A;  2YAN A;  1XWB A;  3EVI A;  1KBN A;  4OFM A;  3CQF A;  1M2D A;  1QMV A;  1IYI A;  2R3X A;  2R6K A;  2Z9S A;  1SD9 A;  3H93 A;  5ELG A;  2DJ3 A;  3CMI A;  2CVD A;  1XW6 A;  1BAY A;  3FZ4 A;  4G19 A;  4ZL7 A;  3VWU A;  2GZP A;  2WDU A;  2ZCT A;  1SJ6 A;  3KZQ A;  1GLQ A;  5EPF A;  2H70 A;  1ERW A;  3MWH A;  1OC8 A;  1S3D A;  1M0U A;  1I5G A;  4G10 A;  5G1K A;  2HRN A;  2WCI A;  2LJR A;  2E2G A;  1ON4 A;  1EGR A;  2VIM A;  1TI3 A;  3HVS A;  1BED A;  3LFL A;  3N9J A;  4ECJ A;  4I2U A;  4HZ2 A;  2FWG A;  2NDO A;  4PUF C;  3UMA A;  2QKE A;  4HS1 A;  1ZCP A;  3EC3 A;  2LKU A;  1N8J A;  3HDC A;  4EDZ A;  5ECS A;  5JCU A;  2PBJ A;  2YJH A;  1OC9 B;  3TKS A;  3J7Y k;  2PGT A;  3WGD A;  2JZR A;  2K8V A;  2I9H A;  2WS2 A;  2LS5 A;  1VGL A;  1OC9 A;  1K3O A;  4ISD A;  3GX8 A;  3TKR A;  1A0R P;  22GS A;  2GSQ A;  2XPE A;  4GTU A;  1M7T A;  17GS A;  1GSY A;  3DWV A;  1XW9 A;  4XRD A;  1PQN A;  3PH9 A;  1ACV A;  5HR0 A;  3UBK A;  5DDL A;  3KH7 A;  3PGT A;  2OE0 A;  5B6M A;  4MF6 A;  2QGV A;  1THX A;  4EIP A;  1O8X A;  3GUR A;  1OVN A;  3M9J A;  5EY6 A;  1AQV A;  2VM1 A;  4TW5 A;  5HFG A;  5AGY A;  2H19 A;  3FK8 A;  3O3T A;  4GF0 A;  2EIQ A;  1X9M B;  4PX1 A;  1TK0 B;  2GT5 A;  3A5W A;  3P7X A;  1FG4 A;  1T4Z A;  5IO0 A;  3GKX A;  3SBC A;  2PUK C;  1JLW A;  1MEK A;  2E7P A;  4A5P A;  16GS A;  2P31 A;  4I8B A;  1GTU A;  3HVX A;  4JED A;  9GSS A;  3KM6 A;  5L71 A;  4JE1 A;  3TCO A;  4K6X A;  5IO2 A;  3QMX A;  3TKP A;  1ZZY A;  1XWC A;  1TU7 A;  1XFL A;  2P0G A;  2PVQ A;  4ECI A;  2KHP A;  1Z6N A;  3KH9 A;  2AHE A;  3MDK A;  2I3Y A;  1O81 A;  3FZ5 A;  3OR5 A;  3FYG A;  3CTF A;  3F63 A;  1YKA A;  2I81 A;  3ED3 A;  3P90 A;  4FO5 A;  3FEU A;  4K7I A;  4TN8 A;  2X8H A;  3Q6O A;  2C3T A;  2L5L A;  1GSS A;  5ECM B;  3TKQ A;  1A2L A;  3O76 A;  5AN1 A;  1TRS A;  2IMK A;  3HJP A;  4PQI A;  4KUN A;  2GZZ A;  2IJY A;  5G5F A;  2VCV A;  4PNG A;  4G9H A;  1TOF A;  5F07 A;  3F8U A;  1R5P A;  3VLN A;  4V2M A;  3A2X A;  1RQM A;  2O85 A;  1KEB A;  3D6I A;  3ZVJ A;  4HZ4 A;  2H72 A;  3RBT A;  1X0R A;  4HSC X;  1FO5 A;  3HYP A;  1A2M A;  3GH9 A;  3GIX A; 
#chains in the Genus database with same CATH homology
 1T7P B;  3F6D A;  4KW6 A;  4WEY A;  4LL1 B;  3EWL A;  3KMN A;  3F0I A;  1HNA A;  4NXI A;  3HY2 A;  5HR3 A;  1TRW A;  1PA3 A;  3ZFB A;  2J9H A;  3KIJ A;  4Z2T A;  3GSS A;  2ON5 A;  4EO3 A;  3ZLP A;  3UOM A;  3TJB A;  3KTB A;  1T1V A;  3KXO A;  3MAK A;  2FWH A;  2ZUP A;  5GST A;  2H0I A;  1CQH A;  3D0Z A;  3APO A;  2DIZ A;  2HSM A;  3BCK A;  5INY A;  2JSY A;  5GZZ B;  3M8N A;  5CRH A;  5JWR B;  5CP1 A;  1W89 A;  2E0Q A;  4PUR A;  2YNX A;  4FQU A;  2EC4 A;  2HYX A;  1R4W A;  3F9U A;  3PR8 A;  1E6B A;  5GAN D;  1PKZ A;  2GST A;  1A2J A;  2CZ2 A;  4EE0 A;  2LJA A;  2K18 A;  1GRX A;  4X43 A;  4E8H A;  4KDU A;  2LTK A;  3ZZX A;  1TRU A;  5AIS A;  2DKH A;  4XIH A;  2N5A A;  1BQ7 A;  1A0F A;  5FHI A;  5G2Z A;  3C8E A;  2GSS A;  3FR6 A;  4EXJ A;  3DKS A;  4YQV A;  4PNF A;  2GSR A;  2IFQ B;  4TR4 A;  1A8L A;  2LV3 A;  5D9V A;  2VL2 C;  3LYK A;  5ID2 B;  2IFQ A;  4ZBD A;  5D9X A;  1A24 A;  5FT3 A;  4K0N A;  2H1G A;  2UZ8 A;  2X99 A;  5ID2 A;  2R0P A;  4IBP A;  3IAS 2;  4KSO A;  1KTE A;  3F4T A;  4K8M A;  4I2T A;  3IC4 A;  3CTG A;  1U6T A;  4HQZ A;  4ZXG A;  1HNB A;  4YH2 A;  3HZ8 A;  2FNO A;  1YF1 A;  2XHF A;  3KP8 A;  4OCE A;  1BYE A;  1H4O A;  3WYW A;  2H0H A;  1PMT A;  2DJ0 A;  4MF7 A;  4ILF A;  4WXT A;  2C80 A;  2R0G A;  4HQS A;  2LEG A;  4D73 B;  1FB6 A;  1YQ1 A;  3IE3 A;  4N0V A;  1TRV A;  4POM A;  1ZYP A;  5ECK B;  2H76 A;  5J4U A;  4D73 A;  4TR1 B;  4IP1 A;  1SK2 A;  1Q4J A;  3NIV A;  4BVY B;  3TRX A;  1GUH A;  2B1K A;  4TR1 A;  2I1U A;  1XIY A;  5IPG A;  3QFA C;  2V2G A;  4GST A;  4EUY A;  4PGT A;  4BVY A;  5IMD A;  2JZT A;  4FH8 A;  4GLT A;  2L57 A;  1OAZ A;  2GQK A;  5J5N A;  2YWO A;  2OBK A;  2R37 A;  1TK5 B;  2GT6 A;  2CVK A;  4FYU A;  1VF1 A;  1BG5 A;  3KP9 A;  1SEN A;  3GV1 A;  4O32 A;  2RUF A;  4OO5 A;  1UC7 A;  14GS A;  2LST A;  3MIX A;  1V9W A;  5D9T A;  2H73 A;  3NOF A;  2L6D A;  4MCU A;  4IS0 A;  1XOA A;  2JSZ A;  3BCI A;  1EV9 A;  3GFK A;  1U3A A;  3VPT A;  3UJ1 A;  4LMW A;  3TKS E;  3HJO A;  3MYD A;  2RM5 A;  1T00 A;  1JZR A;  1B48 A;  2LQQ A;  2MMO A;  4JR4 A;  1AW9 A;  2VUP A;  3VWW A;  5IMV A;  1HD2 A;  4RQX A;  5IMA A;  2WZ9 A;  11GS A;  3GH6 A;  2GLR A;  3I43 A;  4GCI A;  3HJM A;  2FGX A;  1HNC A;  5ECI B;  5CRD A;  5COH A;  1GSE A;  3VWX A;  5DCH A;  2NVL A;  1F37 A;  2NBS A;  1O85 A;  2J23 A;  1GSD A;  2VCT A;  3GRX A;  1GNW A;  4EL1 A;  4BPY A;  5ENU A;  4XS4 B;  4AF2 A;  1SYR A;  3TDG A;  2DJ2 A;  3LWA A;  3R2Q A;  3GNJ A;  3EYT A;  4XS4 A;  3RPP A;  4F82 A;  2CT6 A;  3M3M A;  2IL3 A;  2AJQ B;  3TKS C;  4Q5Q A;  4HOJ A;  3KGK A;  2DC5 A;  4RUV A;  1VF4 A;  3FMW A;  5DQS A;  2H01 A;  3ZML A;  1SU9 A;  1V98 A;  5KOX A;  2IN3 A;  1NSW A;  2V6K A;  1IYH A;  1WMJ A;  1K0M A;  3C1S A;  4HU9 A;  2TRX A;  3FR3 A;  4TXV A;  3KTL A;  1TTZ A;  1USB A;  6GSY A;  2AV4 A;  3A2W A;  5JWO B;  3CXG A;  4BL7 B;  3WD6 A;  3HCZ A;  3HXS A;  2K8S A;  1O7U A;  4F0C A;  3FY7 A;  2KP1 A;  5HR1 A;  2IPA A;  1ILO A;  1SJI A;  4BL7 A;  1J9B A;  2EIO A;  1Z5Y E;  2MBT A;  1B8X A;  4O5R A;  1JZO A;  1M2A A;  3GKM A;  1X9W B;  4YQU A;  2JL4 A;  2V41 A;  2O8V B;  4N10 A;  1J0F A;  3Q74 A;  5DBQ A;  4OCF A;  2K9F A;  3D4T A;  4FIW A;  1K0B A;  4QL9 A;  2CQ9 A;  2ON7 A;  2LUS A;  5EVO A;  3P8W A;  4TVE A;  4NHZ A;  4ZB8 A;  2HZE B;  2H6Y A;  3VFI A;  3U6V A;  4ZBB A;  4AGS A;  2VLV A;  1TJD A;  5JCG A;  5A4W A;  5CRE A;  4H86 A;  1RW1 A;  4GSS A;  1AQW A;  4WR5 A;  1G6Y A;  4IEL A;  2HZE A;  1HQO A;  2OAD A;  3RPN A;  4TR3 A;  3G9B A;  2CAQ A;  2XPD A;  3ERG A;  12GS A;  3IV4 A;  1EEM A;  4KAE A;  2H30 A;  5ELA A;  5IPH A;  3F4S A;  5H5S A;  1MTC A;  1X5C A;  4KA0 A;  1PD2 1;  1FOH A;  2GQL A;  1B4Q A;  4KGI A;  5IIZ A;  3LXZ A;  2HNL A;  19GS A;  1T4Y A;  4CDO A;  3LOR A;  4WBR D;  2N5B A;  2QA1 A;  4K7O A;  1NHY A;  1M9B A;  2IME A;  3GN3 A;  3IBH A;  2FHE A;  3HKR A;  4IGJ A;  1URM A;  1XW5 A;  3GST A;  2B3S A;  1X5D A;  3EE2 A;  3UIW A;  4KE3 A;  1GSU A;  3MNG A;  3ME7 A;  1EP8 A;  2VCZ A;  6GSS A;  4WF5 A;  2C0D A;  2M46 A;  1WRY A;  3ZRD A;  2DML A;  5KEJ A;  4KX4 A;  1SL0 B;  4XTS A;  1WJK A;  5KOW A;  5D9W A;  3IOS A;  3IC8 A;  5IMZ A;  3F3R A;  2N5F A;  2HSH A;  4IJI A;  3WT2 A;  3I9V 2;  5CRG A;  2A4H A;  1G7O A;  1G0T A;  2HRF A;  1V2A A;  2VM2 A;  5KN1 A;  1TP9 A;  2H0G A;  2V32 A;  3LEF A;  4K5R A;  4GQF A;  1AUC A;  3LG6 A;  5IM9 A;  2OJL A;  1A8Y A;  2VD0 A;  1DSB A;  5F0G A;  1R5A A;  2B5E A;  2TRC P;  5ECL B;  4ML1 A;  4MJB A;  3GMF A;  3GUS A;  1WP0 A;  1MDI A;  3KMO A;  4X4J A;  3D4M A;  1PL1 A;  1TDI A;  4K9Z A;  1X5E A;  2F8A A;  4JZQ A;  3G7Y A;  2H1B A;  1Y25 A;  5CO3 A;  2AB6 A;  2L6C A;  1F3A A;  3CSJ A;  1ZL9 A;  1XWG A;  2VL3 A;  2GGT A;  2GZY A;  20GS A;  4GRF A;  3TOU A;  1OE7 A;  2EIR A;  2G0F A;  5ECQ B;  1G7E A;  3N5O A;  3IR4 A;  4WKW A;  4ZB6 A;  4LA1 A;  3IHG A;  1FW1 A;  3BD2 A;  2VL9 A;  1H75 A;  2L4C A;  3TB2 A;  4ECB A;  1OC3 A;  1WPI A;  1J08 A;  1PL2 A;  4PTS A;  5ECR B;  3KCM A;  2RII A;  1WWJ A;  2XBQ A;  6GSV A;  3E3E A;  1YJ6 A;  3VUR A;  5DQY A;  3LGC A;  2VO4 A;  4K2D A;  5DAK B;  1O6J A;  4LLR A;  1S3C A;  2NTO A;  3DYR A;  4WBJ A;  1SK0 A;  5DAK A;  2HLS A;  2C4J A;  3BJ5 A;  2QA2 A;  2GQM A;  4LMV A;  5DJM A;  1XXU A;  2KOK A;  2BMX A;  4NV5 A;  4RQR A;  4K2X A;  2LRT A;  4TOP A;  1EEJ A;  4MA9 A;  5ECN B;  2LNS A;  5H5R A;  4MP4 A;  1HYU A;  2HE3 A;  6GST A;  5LD0 A;  6GSX A;  3SWL A;  3Q18 A;  3QPM A;  1GTI A;  2K6V A;  8GSS A;  3C73 A;  1VRS D;  4IQA A;  4MAB A;  1MDK A;  1F6M C;  3ZRE A;  2R4V A;  3UAP A;  4YKG A;  3GL5 A;  1WE0 A;  4OD7 A;  4KDY A;  4DSR A;  3GKN A;  5IOX A;  5ECO B;  3QD9 A;  3J7Y b;  3VK9 A;  4KSM A;  3IPZ A;  2C3Q A;  2M80 A;  1U3I A;  2CAI A;  5DVB A;  3PPU A;  1TKD B;  2I4A A;  4G0L A;  2FCH A;  2DMM A;  4Q5N A;  4OMV A;  5KN0 A;  4KH7 A;  2F8F A;  4GWR A;  2DBC A;  5HFI A;  2YCD A;  4Q5F A;  3D21 A;  1VF3 A;  1F9M A;  3LQ7 A;  3H79 A;  4XRA A;  3P2A A;  1RK4 A;  4OFN A;  3QAV A;  1SKW B;  1B9X C;  1WIK A;  4HEA 2;  5FWG A;  2HFD A;  2HT9 A;  3FZ9 A;  1G6W A;  4EF0 A;  2MMN A;  3L9U A;  2C0F A;  1TU8 A;  4F03 A;  2A4V A;  1NHO A;  5B8A A;  2YV7 A;  4KDX A;  1Z3E A;  3TJJ A;  3VI5 A;  3KD0 A;  2X4A A;  4XS6 A;  1XVQ A;  5BRT A;  1QUW A;  3L9V A;  2DJ1 A;  5B8B A;  4L0W A;  18GS A;  2C0E A;  4HI7 A;  2R2J A;  4ZB9 A;  5J9C A;  1EOG A;  2WGR A;  4HUA A;  3TGZ A;  5G5E A;  3U5R E;  4EDY A;  1EP7 A;  2VAF A;  4G0I A;  4ECC A;  3Q19 A;  3H4K A;  5G30 A;  4BWS A;  4I97 A;  4RI7 A;  1R7H A;  3CRT A;  3D5J A;  3QR6 A;  3F3Q A;  4CW9 A;  2WB9 A;  4V2N A;  2KP2 A;  1B4P A;  4KB3 A;  2G2Q A;  5GAP D;  4EC0 A;  4OFT A;  4LL4 B;  3GA4 A;  1NM3 A;  5HFK A;  4CY8 A;  3W6G A;  5D96 A;  3CSH A;  5EL8 A;  2R0C A;  2YV9 A;  5AIV A;  3V1W A;  1MD3 A;  5DAL B;  4IJ3 A;  1DBY A;  4BWQ A;  4WR4 A;  2VCX A;  1N2A A;  1V58 A;  4FYB A;  3L4N A;  3TUE A;  1F2E A;  4POL A;  1S3A A;  4EKZ A;  1XVW A;  4MDC A;  3M1G A;  2AYT A;  2D2Z A;  4NWY A;  2LQO A;  1CQG A;  6GSU A;  3FRC A;  2YOI A;  1PRX A;  1OE8 A;  1U87 A;  1EZK A;  2RM6 A;  4ULX A;  3TRP A;  3UL3 A;  5J3R A;  4PXO A;  2GDR A;  5AIX A;  2A2P A;  4MH2 A;  2DSA A;  2WJU A;  1GNE A;  2LRC A;  1JZW A;  1TI1 A;  3LJR A;  1JLV A;  4O5Q A;  2OA7 A;  1TK8 B;  4KCE A;  2HSY A;  3C7M A;  4BA7 A;  3HHV A;  5ECP B;  1AAZ A;  3QAW A;  2CX4 A;  4TXO B;  3AY8 A;  2DIY A;  4TXO A;  4O5U A;  1SL2 B;  4NPB A;  5B6N A;  4NHW A;  1FHE A;  1PGT A;  2HXK A;  1XPV A;  1YZX A;  4L0U A;  2VCW A;  4DSQ A;  3UVH A;  4JU5 A;  2JU5 A;  4J56 E;  5LNK e;  2YWN A;  5IQY A;  4AJ6 A;  1THO A;  4J57 E;  4PUA A;  3EIN A;  3HA9 A;  3MSZ A;  1EWX A;  3RAZ A;  1AQX A;  4G0K A;  4IVF A;  4MZB A;  5A4V A;  1E2Y A;  2X64 A;  3BBY A;  3FKF A;  4HJ2 A;  1R26 A;  1SL1 B;  1A23 A;  2F51 A;  1JFU A;  2H74 A;  2LRN A;  2PU9 C;  4E8E A;  5G31 A;  5C04 A;  1ZMA A;  4I6X A;  2CVB A;  1OKT A;  4JBB A;  4IP6 A;  4V1A p;  3TJG A;  4TKY A;  4EIQ A;  3E9J B;  4POB A;  1UVZ A;  1ERU A;  4XHM A;  2OKA A;  1EOH A;  2B6M A;  3UBL A;  1M99 A;  4MPF A;  4USS A;  1GUK A;  3CRU A;  2QC7 A;  2QSI A;  2VD1 A;  4DEJ A;  5KN2 A;  3CBU A;  1T3B A;  4Z2R A;  3EU3 A;  4ZIL A;  3JCM L;  3APS A;  2REM A;  3ZTL A;  2GS3 A;  3DD3 A;  1X9S B;  1GH2 A;  2H1D A;  1OKD A;  1BX9 A;  1ZYE A;  3C71 A;  1YEP A;  3G7J A;  4NAX A;  1T8E B;  4F0B A;  2YZH A;  2O7K A;  1QFN A;  2FWE A;  3I69 A;  4QQ7 A;  4MZC A;  3ZIT A;  4MZW A;  1LJR A;  2YPM A;  1UA5 A;  4PQH A;  3TRQ A;  5IOW A;  5HQP A;  1Q98 A;  2BJX A;  4IHU A;  3DEX A;  2PER A;  5IMC A;  1YY7 A;  4MJA A;  4KF9 A;  2B7J A;  2V6O A;  1SKS B;  1O8W A;  2OBI A;  3IHQ A;  3QOU A;  2OE1 A;  2C8U A;  5E59 A;  3QCP A;  1DUG A;  2DKI A;  4IQ1 A;  4O7H A;  1ZGN A;  1PN0 A;  1K3Y A;  2DJK A;  3GTU B;  1JZD A;  5J41 A;  3L78 A;  2HRK A;  3IK7 A;  2FA8 A;  3GTU A;  1SK1 A;  2R5G A;  1ZOF A;  4JRR A;  2MMA A;  5DCG A;  2B5Y A;  2KUC A;  4G2E A;  3IRA A;  3CYN A;  1XBS A;  2RUE A;  1FOV A;  2H8L A;  2O87 A;  4WF4 A;  5G1L A;  1FB0 A;  1LBK A;  5CNW A;  4KND A;  2XBI A;  4Z2U A;  4ZIJ A;  3TJK A;  1TW9 A;  2C1Y A;  3VWV A;  1QK8 A;  3I6A A;  1MD4 A;  4K7N A;  3EMX A;  2B1L A;  5JWQ B;  3BOA A;  3LW9 A;  1EV4 A;  2MMZ A;  1ERV A;  1F3B A;  2FUG 2;  2YJ7 A;  3CSI A;  1Z7R A;  2C0G A;  2TIR A;  1GUM A;  1SJZ A;  3O6T A;  2ZNM A;  1GSF A;  4GXZ A;  3IAM 2;  4OO4 A;  4KCA A;  4ZBA A;  1YDK A;  2MYG A;  2L4Q A;  2VLU A;  4MF5 A;  2PN8 A;  3DVX A;  1YKC A;  2ES7 A;  3EMP A;  1K0C A;  4FYC A;  4AJ8 A;  3FHK A;  3ZIV A;  5CAX A;  1QQ2 A;  3EUR A;  1XCC A;  2ALB A;  1O73 A;  4IW9 A;  4L8E A;  2OE3 A;  3A5I A;  1XWA A;  1ZYN A;  4WET A;  2VLT A;  4N30 A;  2LNT A;  3E0U A;  3ZMK A;  4Z7X A;  2AAW A;  1GTB A;  5D93 A;  2YWM A;  4ZL9 A;  2A2S A;  4HDE A;  3RHC A;  10GS A;  1GWC A;  4N11 A;  2H75 A;  2DJJ A;  3ZIJ A;  3W8S A;  4PQ1 A;  2HRA A;  2H66 A;  3DVW A;  1GP1 A;  1Z9H A;  2CV4 A;  4J2F A;  4N0Z A;  2IMD A;  1W4V A;  4HU7 A;  3ISO A;  4ID0 A;  4IKH A;  3APQ A;  1PN9 A;  2HI7 A;  3HZ4 A;  2MZC A;  4RI6 A;  2FA4 A;  4P3Y B;  5BMU A;  5IMF A;  4F2I A;  2IWT A;  4K5S A;  3ME8 A;  2PWJ A;  2FY6 A;  3EPT A;  1QGV A;  2H1A A;  3QAG A;  1FAA A;  4GQC A;  3W8J A;  1C72 A;  4ML6 A;  1M9A A;  5E4W A;  5ECH B;  7GSS A;  3GYK A;  4JR6 A;  1K0A A;  2H71 A;  5A5K A;  2FD3 A;  2O89 A;  1XZO A;  3GKK A;  4YQM A;  5J9B A;  1SYX A;  5ABR A;  3NZN A;  3QDN A;  4IN0 A;  2WRT A;  2YZU A;  1XOB A;  2IMI A;  1MDJ A;  4CY6 A;  4GSN A;  1QXH A;  3KEB A;  5D8I A;  2F3M A;  2CX3 A;  4MJC A;  2IIY A;  2B7K A;  4MMM A;  2A2R A;  1PX6 A;  1DE1 A;  3M9K A;  1LU4 A;  4MLY A;  1GLP A;  6GSW A;  4ACS A;  3ZYW A;  3IXR A;  1YEX A;  5HR2 A;  4ZL8 A;  5D73 A;  5F05 A;  4MNN A;  1DE2 A;  3H1N A;  4YAV A;  4MPG A;  2P5Q A;  2E2M A;  1V57 A;  1GTA A;  1Z6M A;  3IK9 A;  1NW2 A;  2DLX A;  2LJK A;  2WFC A;  4TR0 A;  3ZVJ D;  3RDW A;  5F8B A;  2YWI A;  2JZS A;  4L5L A;  1K0O A;  4YAP A;  2L5O A;  1K0D A;  3HD5 A;  1Z7P A;  4MK3 A;  1XWK A;  1ST9 A;  4DSS B;  3WGE A;  4OWY A;  1PKW A;  5JCW A;  1GUL A;  2X49 A;  4DSS A;  2GTU A;  3IA1 A;  3VI7 A;  4O92 A;  2XC2 A;  5DJL A;  1FVJ A;  2CA8 A;  2JAC A;  1PSQ A;  3HVV A;  5A4U A;  3C1R A;  3K8N A;  4QL7 A;  4NV2 A;  1I9D A;  3WT1 A;  4POK A;  2YP6 A;  2FWF A;  3A2V A;  5F06 A;  3LYP A;  4TRX A;  2NPB A;  3DML A;  3ZFL A;  4I5Q A;  1SD8 A;  1FVK A;  3QFB C;  2H6Z A;  3GHA A;  4AJ7 A;  5KN3 A;  1VF2 A;  2IMF A;  1ERT A;  3GL3 A;  3IDV A;  1EGO A;  1PX7 A;  5CYY A;  2VL2 A;  1YF0 A;  1BJX A;  1K3L A;  1SKR B;  1UN2 A;  3US3 A;  2JAD A;  2AUV A;  1ZYQ B;  2HZF A;  4X0X A;  3M0F A;  4XCS A;  2M72 A;  2CZ3 A;  2OAC A;  5CRW A;  3DIE A;  1V40 A;  4MH3 A;  3VPQ A;  5DAL A;  4DVC A;  4V1A g;  3DRN A;  3S9F A;  2B5X A;  1ABA A;  5B7C A;  1AC1 A;  3FW2 A;  4NMU A;  3F4R A;  1U88 A;  2X8G A;  4CHS A;  3EU4 A;  3TJF A;  1M2B A;  1WOU A;  3L0H A;  4BVX B;  3TOT A;  1Y6E A;  1OYJ A;  5LCZ A;  2H6X A;  13GS A;  4K0G A;  2C3N A;  3D22 A;  2MBS A;  3L9S A;  4BVX A;  3UVT A;  2P5R A;  3FR9 A;  1GL8 A;  3ERW A;  3ZL5 A;  3A3T A;  3H8Q A;  1AIU A;  1K0N A;  1TXX A;  2VOC A;  4YKF A;  2YN1 A;  2RLI A;  2KLX A;  3GX0 A;  3F6F A;  2VCQ A;  2BTO T;  3G7I A;  2L59 A;  1AXD A;  4F9Z A;  2F9S A;  3PIN A;  2PMT A;  1B9Y C;  1KNG A;  4V2L A;  4XS1 A;  1JHB A;  2PPT A;  4L5O A;  3LSZ A;  4K1F A;  4EVM A;  4ICY A;  4Q5R A;  1GSQ A;  4X1U A;  3DXB A;  2FLS A;  5C00 A;  3WGX A;  3UEM A;  3FZA A;  3R3E A;  3RHB A;  5GSS A;  2X8C A;  3UAR A;  3ERF A;  2PVO C;  3KJY A;  5H5Q A;  3DGQ A;  2V1M A;  2GVP A;  4MJE A;  1ML6 A;  4HJM A;  2WUL A;  3LXT A;  2YAN A;  1XWB A;  3EVI A;  1KBN A;  4OFM A;  1M2D A;  1QMV A;  1IYI A;  2R3X A;  2R6K A;  2Z9S A;  1SD9 A;  3H93 A;  5ELG A;  2DJ3 A;  3CMI A;  2CVD A;  1XW6 A;  1BAY A;  3FZ4 A;  4G19 A;  4ZL7 A;  3VWU A;  2GZP A;  2WDU A;  2ZCT A;  1SJ6 A;  3KZQ A;  1GLQ A;  5EPF A;  2H70 A;  1ERW A;  3MWH A;  1OC8 A;  1S3D A;  1M0U A;  1I5G A;  4G10 A;  5G1K A;  2HRN A;  2WCI A;  2LJR A;  2E2G A;  1ON4 A;  1EGR A;  2VIM A;  1TI3 A;  3HVS A;  1BED A;  3LFL A;  3N9J A;  4ECJ A;  4I2U A;  4HZ2 A;  2FWG A;  2NDO A;  4PUF C;  3UMA A;  2QKE A;  4HS1 A;  1ZCP A;  3EC3 A;  2LKU A;  1N8J A;  3HDC A;  4EDZ A;  5ECS A;  5JCU A;  2PBJ A;  2YJH A;  1OC9 B;  3TKS A;  3J7Y k;  2PGT A;  3WGD A;  2JZR A;  2K8V A;  2I9H A;  2WS2 A;  2LS5 A;  1VGL A;  1OC9 A;  1K3O A;  4ISD A;  3GX8 A;  3TKR A;  1A0R P;  22GS A;  2GSQ A;  2XPE A;  4GTU A;  1M7T A;  17GS A;  1GSY A;  3DWV A;  1XW9 A;  4XRD A;  1PQN A;  3PH9 A;  1ACV A;  5HR0 A;  3UBK A;  5DDL A;  3KH7 A;  3PGT A;  2OE0 A;  5B6M A;  4MF6 A;  2QGV A;  1THX A;  4EIP A;  1O8X A;  3GUR A;  1OVN A;  3M9J A;  5EY6 A;  1AQV A;  2VM1 A;  4TW5 A;  5HFG A;  5AGY A;  2H19 A;  3FK8 A;  3O3T A;  4GF0 A;  2EIQ A;  1X9M B;  4PX1 A;  1TK0 B;  2GT5 A;  3A5W A;  3P7X A;  1FG4 A;  1T4Z A;  5IO0 A;  3GKX A;  3SBC A;  2PUK C;  1JLW A;  1MEK A;  2E7P A;  4A5P A;  16GS A;  2P31 A;  4I8B A;  1GTU A;  3HVX A;  4JED A;  9GSS A;  3KM6 A;  5L71 A;  4JE1 A;  3TCO A;  4K6X A;  5IO2 A;  3QMX A;  3TKP A;  1ZZY A;  1XWC A;  1TU7 A;  1XFL A;  2P0G A;  2PVQ A;  4ECI A;  2KHP A;  1Z6N A;  3KH9 A;  2AHE A;  3MDK A;  2I3Y A;  1O81 A;  3FZ5 A;  3OR5 A;  3FYG A;  3CTF A;  3F63 A;  1YKA A;  2I81 A;  3ED3 A;  3P90 A;  4FO5 A;  3FEU A;  4K7I A;  4TN8 A;  2X8H A;  3Q6O A;  2C3T A;  2L5L A;  1GSS A;  5ECM B;  3TKQ A;  1A2L A;  3O76 A;  5AN1 A;  1TRS A;  2IMK A;  3HJP A;  4PQI A;  4KUN A;  2GZZ A;  2IJY A;  5G5F A;  2VCV A;  4PNG A;  4G9H A;  1TOF A;  5F07 A;  3F8U A;  1R5P A;  3VLN A;  4V2M A;  3A2X A;  1RQM A;  2O85 A;  1KEB A;  3D6I A;  3ZVJ A;  4HZ4 A;  2H72 A;  3RBT A;  1X0R A;  1FO5 A;  3HYP A;  1A2M A;  3GH9 A;  3GIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...