4HUAA

E. coli thioredoxin variant with (4r)-fluoropro76 as single proline residue
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
107
Chain Sequence
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGACKMIAAILDEIADEYQGKLTVAKLNIDQNAGTAAKYGIRGITLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin-1
publication title (4R)- and (4S)-Fluoroproline in the Conserved cis-Prolyl Peptide Bond of the Thioredoxin Fold: Tertiary Structure Context Dictates Ring Puckering.
pubmed doi rcsb
source organism Escherichia coli
total genus 33
structure length 107
sequence length 108
ec nomenclature
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4huaA00
2PUKC 1X0RA 1T8EB 2KP2A 3IAM2 2FD3A 1B48A 4EDZA 3L0HA 1IYHA 3AY8A 3P2AA 1HNAA 3UIWA 4OO4A 4NHWA 3TB2A 1TXXA 4Q5FA 2C0GA 2QGVA 3DRNA 4PGTA 2QSIA 4NMUA 1VF1A 1Z6NA 5KN1A 2YP6A 2H6ZA 6GSTA 3ME7A 4XS4A 2HSYA 5FT3A 3ZFLA 3KMOA 3SWLA 3DIEA 2X99A 4TXVA 3A2VA 3GTUA 2H1DA 3KH7A 5D96A 4HS1A 4ZBAA 1GSUA 3DVXA 2D2ZA 1A0RP 2ZNMA 2R5GA 2PN8A 1GRXA 3EE2A 3IA1A 4DSSB 1R7HA 1DSBA 1W89A 2MYGA 2WCIA 1J0FA 3APSA 4OWYA 3EMPA 2C0FA 4OMVA 2AB6A 1THOA 2VUPA 1SJZA 2H75A 1NHOA 5G2ZA 5FWGA 2CA8A 3IRAA 1TRUA 3EMXA 3HZ8A 3TOTA 1SU9A 2AV4A 3VPTA 1SJ6A 3QFBC 4HZ4A 1A8YA 4KGIA 4OFMA 1I5GA 4F03A 1QGVA 3GIXA 1X5DA 4TXOA 5B8AA 4XCSA 3TJGA 4ZL7A 3F63A 3MNGA 1FB6A 3L9VA 1E2YA 1A2LA 2FNOA 1QK8A 2JACA 4POKA 1RQMA 2GS3A 5JCUA 1XVQA 1WPIA 2CZ2A 2CVBA 4V2LA 4XS1A 1AUCA 2JZRA 3C1RA 2TIRA 3FZ4A 3KJYA 5ENUA 1OVNA 1WMJA 3I6AA 4L0WA 2GQKA 1JFUA 2HSHA 2V41A 5F8BA 3WT2A 3FZ9A 2IL3A 2RUEA 2C0DA 3PGTA 3TKQA 3FRCA 2FWFA 1R26A 4IJ3A 3MSZA 5FHIA 4YQVA 10GSA 1H4OA 2EC4A 1FHEA 3CSJA 5J9BA 1X5CA 1Y25A 5HQPA 3KP9A 3KTLA 1CQHA 2YN1A 3GSTA 2LNSA 5ELAA 1YZXA 2YCDA 3VWWA 4EE0A 2BJXA 4TR0A 2OA7A 3ERWA 4F9ZA 5HR3A 3ZZXA 5F0GA 3ZIVA 1WE0A 4FO5A 5DDLA 2H6YA 5DCGA 1A0FA 4PXOA 4TW5A 1BYEA 1T3BA 4K7IA 2N5AA 3DEXA 1LBKA 1A23A 3IK9A 5ELGA 1ERTA 1YQ1A 2Z9SA 4DSSA 5HR2A 1VF3A 4TOPA 1SD9A 4OCFA 1M7TA 4JR6A 3HXSA 1T4YA 1FVKA 3CTFA 2KLXA 1YY7A 2VCZA 3GMFA 2DJ2A 2DJ1A 4FYBA 3GL3A 2KUCA 1SENA 1SJIA 2H0HA 3QAVA 3CMIA 1SYXA 3DMLA 4K6XA 1F6MC 2GDRA 5ECRB 11GSA 1ST9A 2H73A 4I97A 2H19A 2DJ0A 1B8XA 1FB0A 3LFLA 3OR5A 4LLRA 1XW6A 5G31A 3ZRDA 1GL8A 2R4VA 3ERGA 2REMA 1FAAA 5E4WA 2VD1A 1S3CA 2JSZA 2H6XA 2CV4A 3TDGA 3RPNA 8GSSA 2H1GA 2M46A 4YAPA 5ECPB 1ML6A 3GKMA 1XOAA 1NHYA 5CRGA 4RUVA 3N9JA 4FYCA 2FLSA 9GSSA 1V2AA 4IP6A 2GT6A 2PVQA 5IPGA 2B1KA 2AHEA 4FH8A 3M0FA 1B9XC 1B9YC 4O7HA 2B3SA 4HI7A 2DIZA 5E59A 1GUKA 3DGQA 3FYGA 4MP4A 4N0VA 1UA5A 5IOWA 2LUSA 4WR5A 5CRWA 2GTUA 2IMFA 3VLNA 2H8LA 2EIQA 3UL3A 4L8EA 2FA4A 2H74A 3GFKA 4HU9A 4MCUA 5CP1A 2VLUA 4PNGA 6GSUA 1QMVA 2K6VA 3RHBA 2A2RA 3M3MA 2GLRA 2VCTA 3GX8A 1HD2A 1UN2A 1ABAA 2JZTA 4WBJA 2YNXA 3APQA 3TJBA 3D5JA 3E3EA 2VLVA 2XBIA 1GULA 3A2XA 1O73A 5HFKA 4K7OA 2H72A 1SK0A 4WEYA 1HYUA 1JZWA 4K7NA 3W8SA 3CTGA 5CRDA 1W4VA 2C8UA 4OD7A 3LQ7A 1T1VA 5LCZA 4EXJA 1XCCA 3EU3A 1SKRB 3HA9A 4JR4A 3VWVA 3L9UA 4ZL9A 2WZ9A 5IQYA 2KOKA 1GSYA 4J2FA 2L4QA 3PH9A 4KNDA 1N2AA 1U87A 2B7JA 3GA4A 4LL4B 4YQMA 3U5RE 4EO3A 4EC0A 2X8CA 2PGTA 1ERWA 2I9HA 1FG4A 4ECJA 3I43A 3L4NA 3D21A 3H8QA 3LG6A 4Z7XA 4OO5A 1HQOA 1G7OA 4IQ1A 3FHKA 3UVTA 1JZRA 5JCGA 1TRVA 2FHEA 4MABA 3KD0A 3GTUB 4HUAA 2A4VA 1RK4A 5D93A 2E7PA 5IMZA 1BAYA 3IAS2 3HZ4A 4FYUA 1OYJA 2HRFA 1K3YA 3GH9A 2YOIA 1M99A 5AIXA 4K8MA 3H1NA 1URMA 2B5YA 1GTBA 2X8GA 3DWVA 3Q6OA 2CVDA 5DALB 2AJQB 2P0GA 4Q5RA 5ECQB 1EGOA 2H0GA 2TRCP 2L5LA 5ID2B 4NXIA 4I2UA 1Z7RA 1GP1A 3V1WA 4G10A 1GNEA 1GSEA 5HFGA 1S3DA 2MMOA 3H4KA 3HY2A 2HT9A 4POLA 4PNFA 1EP7A 2VLTA 2L5OA 4AJ6A 1XPVA 5CAXA 1TKDB 1ZOFA 3KMNA 2ES7A 4ILFA 2N5FA 3TKPA 3LXZA 1AC1A 2P5QA 1PMTA 3WD6A 2YPMA 3DKSA 2YJHA 3APOA 4KB3A 5B6MA 2YWNA 3VURA 3QAGA 1KBNA 3IDVA 1XW5A 4IHUA 3CRUA 2KP1A 2OE1A 4XRAA 5DVBA 2F8FA 5HR1A 2EIRA 4CW9A 4JU5A 4WF5A 4KW6A 4ZL8A 3O76A 4Q5NA 1OC3A 1VF4A 2X64A 2MBTA 1J08A 1ERUA 5AIVA 2AYTA 5J3RA 3F6FA 3H79A 2BTOT 1GUMA 2VOCA 3FW2A 1O85A 3EWLA 4WKWA 5J5NA 4XRDA 1PL1A 1GSDA 3D4TA 1O6JA 2JU5A 3DD3A 4ZB6A 4MMMA 2MZCA 2PU9C 4JZQA 3R2QA 3BCIA 4RI7A 1V98A 4N11A 4ZILA 3F3QA 5AGYA 2V6OA 2WRTA 5IMVA 2LJAA 3IE3A 2GSQA 2LQOA 2H01A 1K3OA 4IP1A 1OAZA 2YWMA 4MH2A 1AW9A 2ON5A 3F3RA 1PL2A 5ECOB 2I4AA 1B4PA 5INYA 2CX3A 2H30A 1U3AA 5G5EA 1TK0B 4BL7A 2J23A 3TCOA 3F4SA 3QDNA 3O6TA 4ZIJA 3FR3A 5J9CA 1V57A 3EU4A 5DALA 1PD21 3CBUA 4IW9A 1YKCA 2LRTA 3C71A 2RUFA 5ID2A 4MLYA 1F9MA 3K8NA 2GQLA 4PQHA 1FOVA 2N5BA 2O87A 4MJCA 2GZPA 3TRPA 1TU7A 3Q19A 2P31A 1DBYA 4GRFA 4K0GA 1TRWA 4XHMA 4TR4A 3CSHA 3VWXA 4RQXA 3WGDA 4EL1A 5ECSA 2NTOA 19GSA 3GRXA 1ZMAA 2TRXA 1BEDA 1KEBA 2G2QA 4LA1A 1G6YA 4G19A 4IJIA 3ZVJA 1GSFA 2GT5A 4L5LA 3EC3A 2C80A 5G30A 2HFDA 2YWOA 5JWQB 3GKXA 3RBTA 1Z5YE 3IOSA 1OE7A 1OC9B 3HCZA 5COHA 3RAZA 5D9WA 1QXHA 3TGZA 2HZEA 5GAND 3D0ZA 1EOHA 2DMMA 1PSQA 1X9WB 2J9HA 2LKUA 1XFLA 2XHFA 1TK8B 1AAZA 4G2EA 3IBHA 2DSAA 4TVEA 3P90A 3UVHA 2LRCA 5LNKe 1YF1A 4XIHA 2MBSA 4TN8A 2JL4A 1YF0A 3RPPA 3ZIJA 2O89A 5ECKB 1K0CA 2ZUPA 3ZYWA 1EEMA 1MTCA 1FW1A 1OKDA 4GXZA 2OADA 2E2GA 4MJAA 2K8SA 4MF5A 4LMVA 4NV2A 5ECHB 2NDOA 5CRHA 2HI7A 1YEXA 1XWCA 5ECIB 3CYNA 3L9SA 4E8EA 1OC8A 2MMZA 2YV7A 3HVVA 4O92A 4NV5A 5D9VA 1TW9A 1M9AA 3C8EA 3E0UA 4YH2A 5H5RA 2KHPA 1XW9A 2LJRA 2NVLA 1XIYA 1ON4A 4MDCA 2WS2A 3QR6A 1DE1A 3FK8A 3RDWA 2YZHA 4KUNA 1Z6MA 2CAQA 4AJ8A 4DSQA 1FO5A 2K18A 1X5EA 4DSRA 4JE1A 1XWKA 4N30A 1TK5B 3F8UA 3UOMA 2A2SA 4GF0A 5DJLA 3GN3A 3KZQA 1GNWA 4GSSA 4QL7A 4OFNA 1IYIA 4I8BA 20GSA 4X43A 2C1YA 2L6CA 3W8JA 3GKNA 1XWBA 2OBIA 4PQIA 2GSTA 5KN2A 3TKRA 1WP0A 4K9ZA 3WGEA 4PUFC 3G9BA 2H1BA 1PA3A 2C3QA 4PX1A 2RM6A 4J56E 3NOFA 3QMXA 1XOBA 3ED3A 1PRXA 3IC4A 1YKAA 1Z9HA 2MMNA 4V2MA 1KNGA 3TKSE 4BWQA 1AQVA 2IN3A 1K0MA 4MF7A 1T7PB 3S9FA 1OC9A 2GZZA 2IMEA 2PERA 5A4WA 1ERVA 4WETA 5LD0A 4EF0A 3WT1A 1JLVA 3C7MA 2VIMA 2IPAA 5JWOB 3ISOA 2OBKA 2C4JA 4ML1A 4PQ1A 3ERFA 2PPTA 3A3TA 2VCQA 4NHZA 5D73A 2IJYA 1F2EA 1X9SB 4NWYA 6GSSA 1A2JA 2FUG2 2M80A 4P3YB 3UARA 1AXDA 3QD9A 3GV1A 3WYWA 4KSMA 5EVOA 4MF6A 5C04A 2VCWA 3UEMA 3NZNA 14GSA 1EOGA 5A4VA 4HEA2 4K0NA 4LMWA 3F0IA 3M1GA 1U88A 2DMLA 4LL1B 1QUWA 2IMDA 1O7UA 1SL0B 4EKZA 3BD2A 2B5XA 5CREA 1MDKA 1K0OA 1A2MA 1J9BA 3MDKA 1TTZA 5IMAA 1JZOA 3HYPA 4WBRD 4AJ7A 4PURA 4MZBA 3D22A 3MWHA 3ZFBA 4MA9A 2OACA 3ZLPA 5GAPD 4MPFA 2VCVA 4IGJA 1K0NA 4KDYA 2R2JA 1R5PA 1U3IA 1DE2A 3C73A 2WDUA 3G7JA 2DJKA 2HZFA 4D73A 4GCIA 3GL5A 2O8VB 5F07A 3EURA 5F06A 1PQNA 4V1Ag 2PVOC 1PX7A 3IHQA 1R4WA 1ZCPA 4V1Ap 5EPFA 1SK2A 1O81A 4AF2A 5A5KA 3LORA 1B4QA 4KDXA 2DLXA 4MK3A 1VGLA 1NW2A 3GX0A 2VL3A 3GYKA 4KX4A 3KEBA 3LYKA 4KSOA 3UBLA 1XBSA 2NBSA 2LQQA 4HOJA 2FY6A 3W6GA 3EINA 22GSA 2YWIA 4V2NA 5KEJA 3C1SA 2IMIA 1SL1B 4NPBA 3TUEA 1ILOA 1CQGA 3HJMA 2GVPA 3IXRA 3MAKA 1F3BA 5KN3A 3FKFA 1SD8A 2O7KA 2CVKA 1X9MB 2I1UA 2F3MA 5EY6A 4ECBA 12GSA 4AGSA 2JZSA 4TR3A 2HE3A 3IK7A 4TKYA 2WJUA 2F9SA 2NPBA 3J7Yb 16GSA 4GWRA 1QQ2A 1N8JA 3LEFA 4ZBBA 5D9TA 4OCEA 5DBQA 2L6DA 2LSTA 2F51A 5ECNB 3UAPA 3ZMLA 3M8NA 5GSTA 6GSXA 2LV3A 2FWGA 2C3NA 3KH9A 2I81A 1I9DA 4BPYA 1HNBA 1GTUA 1ZGNA 2R3XA 1TDIA 2IWTA 2B1LA 3UMAA 3A2WA 1MDJA 4IVFA 5J41A 2QC7A 2OE3A 1Q98A 3QPMA 2EIOA 5D8IA 3TRXA 5B8BA 1GUHA 1MD4A 4MH3A 1O8XA 3M9KA 1RW1A 4EVMA 1QFNA 4GLTA 2YJ7A 4TRXA 4ZXGA 1Z7PA 2ALBA 3TJKA 2HZEB 1AQWA 2DBCA 1YJ6A 3TJJA 2V1MA 2HLSA 2FCHA 2IFQA 1T4ZA 2G0FA 4ZB9A 2HYXA 1F3AA 3EYTA 3HVXA 5D9XA 2RM5A 5DAKB 3Q74A 4POMA 5AN1A 3FY7A 4ML6A 4ISDA 2I3YA 5DCHA 2MMAA 5G1KA 1M2AA 4GTUA 1PKZA 2FA8A 5H5QA 1M2DA 3G7IA 3E9JB 3CRTA 3VPQA 4K1FA 2JSYA 3O3TA 4I6XA 1TI3A 2P5RA 3ME8A 1TI1A 18GSA 3PR8A 4JEDA 2H71A 3KP8A 3D4MA 2VL9A 1SYRA 5DQSA 1JLWA 1WOUA 7GSSA 3I9V2 2CX4A 1GTIA 4HZ2A 4EUYA 4XTSA 2WFCA 5CYYA 2ON7A 1K0AA 3VFIA 3N5OA 4H86A 3DXBA 3F4TA 2WULA 2YV9A 3FEUA 4GQFA 1WWJA 2XC2A 1EZKA 5EL8A 2GZYA 4HQSA 1BX9A 3A5WA 4FIWA 4EDYA 4N10A 4MJBA 3GURA 1YEPA 3P7XA 1M9BA 1V58A 3D6IA 1SKWB 2FWEA 1K0DA 3ZVJD 2LEGA 1WJKA 1SKSB 3J7Yk 3FZAA 3HKRA 5G5FA 3QFAC 3QAWA 4WR4A 4MPGA 2XPEA 1G7EA 3FZ5A 4GQCA 2C3TA 4IKHA 2DJ3A 1T00A 4BVXA 3CSIA 1XWAA 5IPHA 2XPDA 1PN9A 1JZDA 4HJMA 4IN0A 4MZCA 4G9HA 1S3AA 4F0BA 1Q4JA 3U6VA 5B7CA 1TOFA 5C00A 2K9FA 3GHAA 1JHBA 1XWGA 3M9JA 3JCML 1KTEA 2R37A 1LU4A 1PKWA 2R6KA 4DVCA 4CDOA 5GSSA 2V2GA 2PBJA 3DVWA 3KXOA 5GZZB 1EV4A 4ZBDA 1TJDA 2WB9A 3H93A 4GSNA 3FR9A 5DAKA 4KH7A 3BOAA 3F4RA 1XZOA 1BJXA 1HNCA 2VM1A 2HRNA 1PX6A 2B5EA 4TR1B 1DUGA 5IIZA 4JRRA 3P8WA 2L59A 4HJ2A 1THXA 2H0IA 2JADA 4F2IA 4KAEA 1WRYA 1ZZYA 2H1AA 1SL2B 2VAFA 3TOUA 2YZUA 3G7YA 3NIVA 1MD3A 5DJMA 4JBBA 4F0CA 2RLIA 4HQZA 5HR0A 3LGCA 3PINA 3VI5A 1OKTA 2FWHA 2L57A 4QL9A 3GNJA 4RI6A 1USBA 2VM2A 3UBKA 3BCKA 3HVSA 1F37A 1U6TA 4Q5QA 4ULXA 4IQAA 4O5RA 3KGKA 1Y6EA 5CO3A 5A4UA 3TRQA 3WGXA 4D73B 2PMTA 5IMFA 3GH6A 1Z3EA 2H70A 4N0ZA 2E2MA 3KCMA 6GSYA 2FGXA 3LSZA 5ECMB 4KCAA 2DIYA 2CZ3A 4ACSA 1H75A 2C0EA 3TJFA 3SBCA 3US3A 2QKEA 5ABRA 3F6DA 1NM3A 2GGTA 3VI7A 3LWAA 2GQMA 3ZMKA 3ZL5A 4PUAA 4L5OA 2AUVA 4X0XA 2V32A 4F82A 1AQXA 3QOUA 1BQ7A 1EP8A 1GSSA 4O32A 3FR6A 4BVYA 2GSRA 1UC7A 2IMKA 1TRSA 1VF2A 4ZB8A 2CT6A 3LXTA 4POBA 4K2DA 1K0BA 2BMXA 2LRNA 5G1LA 4IS0A 4TR1A 3L78A 2OKAA 2CQ9A 3I69A 1OE8A 2IIYA 2B6MA 5IMCA 3TKSC 1V9WA 2M72A 1G6WA 5DQYA 1EWXA 2LS5A 1G0TA 3ZITA 1A24A 3TKSA 1NSWA 5IM9A 5H5SA 5L71A 1MEKA 3HJPA 2K8VA 4KA0A 2E0QA 3ZTLA 1GTAA 3Q18A 2VD0A 4WXTA 3HJOA 3GSSA 5IOXA 6GSVA 4DEJA 1EV9A 2ZCTA 1FVJA 3BBYA 4NAXA 5JWRB 1R5AA 4XS6A 1BG5A 2DJJA 4ID0A 3HD5A 1GSQA 2IFQB 1AIUA 1M0UA 2WGRA 2LJKA 1E6BA 3HDCA 3IR4A 1VRSD 5CNWA 2XBQA 5ECLB 4OFTA 1EEJA 2DC5A 4ECIA 2B7KA 2YANA 4IELA 2H76A 4HDEA 3LJRA 2HNLA 4IBPA 2LNTA 3KTBA 4KE3A 4MZWA 2LTKA 1XXUA 1YDKA 2V6KA 1PGTA 4CHSA 5IMDA 4XS4B 1C72A 3RHCA 5F05A 1MDIA 2HXKA 3EVIA 2F8AA 1UVZA 5J4UA 2VO4A 1XVWA 4YQUA 3CXGA 3HHVA 5IO2A 1GH2A 3LYPA 2PWJA 5IO0A 4GSTA 2VCXA 5HFIA 2OJLA 4MJEA 1TU8A 3ZREA 2H66A 4WF4A 1V40A 2GSSA 4QQ7A 1ZYQB 2L4CA 2AAWA 5B6NA 1O8WA 3F9UA 17GSA 3QCPA 1ACVA 3VK9A 4HU7A 4I5QA 3KM6A 1GLPA 4X1UA 3GUSA 5AISA 3KIJA 4BWSA 2RIIA 4KDUA 2CAIA 3UJ1A 2X8HA 4KCEA 4I2TA 3IPZA 4BA7A 4TXOB 1TP9A 3IV4A 1ZYEA 1EGRA 4E8HA 1WIKA 4J57E 2OE0A 2VL2C 3DYRA 1LJRA 1M2BA 1GLQA 3BJ5A 4ECCA 2VL2A 4RQRA 2O85A 5KN0A 4YAVA 1SK1A 6GSWA 5JCWA 4L0UA 3GKKA 1GWCA 1K3LA 1ZL9A 3VWUA 1A8LA 13GSA
chains in the Genus database with same CATH superfamily
2PUKC 1X0RA 1T8EB 2KP2A 3IAM2 2FD3A 1M3JA 1B48A 4EDZA 3L0HA 1IYHA 3AY8A 3P2AA 2R0CA 1HNAA 3UIWA 4OO4A 4NHWA 3TB2A 1TXXA 4Q5FA 2C0GA 2QGVA 3DRNA 4PGTA 4CY6A 2QSIA 4NMUA 1VF1A 1Z6NA 5KN1A 2YP6A 2H6ZA 6GSTA 3ME7A 4XS4A 2HSYA 5FT3A 3ZFLA 3KMOA 3SWLA 3DIEA 2X99A 4TXVA 3A2VA 3A5IA 3GTUA 2H1DA 3KH7A 5D96A 4HS1A 4ZBAA 1GSUA 3DVXA 2D2ZA 1A0RP 2ZNMA 2R5GA 2PN8A 1GRXA 3EE2A 3IA1A 4DSSB 1R7HA 4YKGA 1DSBA 1W89A 2MYGA 2WCIA 1J0FA 3APSA 4OWYA 3EMPA 2C0FA 4OMVA 2AB6A 1THOA 2VUPA 1SJZA 2H75A 1NHOA 5G2ZA 2HSMA 5FWGA 2CA8A 3IRAA 1TRUA 3EMXA 3HZ8A 3TOTA 1SU9A 2AV4A 3VPTA 1SJ6A 3QFBC 4HZ4A 1A8YA 4KGIA 4OFMA 1I5GA 4F03A 1QGVA 3GIXA 1X5DA 4TXOA 5B8AA 4XCSA 3TJGA 4ZL7A 3F63A 3MNGA 1FB6A 3L9VA 1E2YA 1A2LA 2FNOA 1QK8A 2JACA 4POKA 1RQMA 2GS3A 5JCUA 1XVQA 2DKIA 1WPIA 2CZ2A 2CVBA 4V2LA 4XS1A 1AUCA 2JZRA 3C1RA 2TIRA 3FZ4A 3KJYA 5ENUA 1OVNA 1WMJA 3I6AA 4L0WA 3LW9A 2GQKA 1JFUA 2HSHA 2V41A 5F8BA 3WT2A 3FZ9A 2IL3A 2RUEA 2C0DA 3PGTA 3TKQA 3FRCA 2FWFA 1R26A 4IJ3A 3MSZA 5FHIA 4YQVA 10GSA 4G0LA 1H4OA 2EC4A 1FHEA 3CSJA 1S3RA 5J9BA 4USSA 1X5CA 1Y25A 5HQPA 3KP9A 3KTLA 1CQHA 2YN1A 3GSTA 2LNSA 5ELAA 1YZXA 2YCDA 3VWWA 4EE0A 2BJXA 4TR0A 2OA7A 3ERWA 4F9ZA 5HR3A 3ZZXA 5F0GA 3MIXA 3ZIVA 1WE0A 2HRAA 4FO5A 5DDLA 2H6YA 5DCGA 1A0FA 4PXOA 4TW5A 1BYEA 1T3BA 4K7IA 2N5AA 3DEXA 1LBKA 1A23A 3IK9A 5ELGA 1ERTA 1YQ1A 2Z9SA 4DSSA 5HR2A 1VF3A 4TOPA 1SD9A 4OCFA 1M7TA 4JR6A 3HXSA 4YKFA 4BIKA 1T4YA 2A2PA 1FVKA 3CTFA 2KLXA 1YY7A 2VCZA 3GMFA 2DJ2A 2DJ1A 4FYBA 3GL3A 2KUCA 1SENA 1SJIA 2H0HA 3QAVA 3CMIA 1SYXA 3DMLA 4K6XA 1F6MC 2GDRA 5ECRB 11GSA 1ST9A 2H73A 4I97A 2H19A 2DJ0A 1B8XA 1FB0A 3LFLA 3OR5A 4LLRA 1XW6A 5G31A 3ZRDA 1GL8A 2R4VA 3ERGA 2REMA 1FAAA 5E4WA 2VD1A 1S3CA 2JSZA 2H6XA 2CV4A 3TDGA 3RPNA 3IHGA 8GSSA 2H1GA 2M46A 4YAPA 5ECPB 1ML6A 3GKMA 1XOAA 1NHYA 5CRGA 4RUVA 3N9JA 4FYCA 2FLSA 9GSSA 1V2AA 4IP6A 2GT6A 2PVQA 5IPGA 2B1KA 2AHEA 4FH8A 3M0FA 1B9XC 1B9YC 4O7HA 2B3SA 4HI7A 2DIZA 5E59A 1GUKA 3DGQA 3FYGA 4MP4A 4N0VA 1UA5A 5IOWA 2LUSA 4WR5A 5CRWA 2GTUA 2IMFA 3VLNA 2H8LA 2EIQA 3UL3A 4L8EA 2FA4A 2H74A 3GFKA 4HU9A 4MCUA 5CP1A 2VLUA 4PNGA 6GSUA 1QMVA 2K6VA 3RHBA 2A2RA 3M3MA 2GLRA 2VCTA 3GX8A 1HD2A 1UN2A 1ABAA 2JZTA 4WBJA 2YNXA 3APQA 3TJBA 3D5JA 3E3EA 2VLVA 2XBIA 1GULA 3A2XA 1O73A 5HFKA 4K7OA 2H72A 1SK0A 4WEYA 1HYUA 1JZWA 4K7NA 4O5QA 3W8SA 3CTGA 5CRDA 1W4VA 2C8UA 4OD7A 3LQ7A 1T1VA 5LCZA 4EXJA 1XCCA 3EU3A 1SKRB 3HA9A 4JR4A 3VWVA 3L9UA 4ZL9A 2WZ9A 5IQYA 2KOKA 1GSYA 4J2FA 2L4QA 3PH9A 4KNDA 1N2AA 1U87A 2B7JA 3GA4A 4LL4B 4YQMA 3U5RE 4EO3A 4EC0A 2X8CA 2PGTA 1ERWA 2I9HA 1FG4A 4ECJA 3I43A 3L4NA 3D21A 3H8QA 3LG6A 4Z7XA 4OO5A 1HQOA 1G7OA 4IQ1A 3FHKA 3UVTA 1JZRA 5JCGA 1TRVA 2FHEA 4MABA 3KD0A 3GTUB 4HUAA 2A4VA 5BRTA 1RK4A 5D93A 2E7PA 5IMZA 1BAYA 3IAS2 3HZ4A 4FYUA 1OYJA 3IC8A 2HRFA 1K3YA 3GH9A 2YOIA 1M99A 5AIXA 4BL7B 4K8MA 3H1NA 1URMA 2B5YA 1GTBA 2X8GA 3DWVA 3Q6OA 2CVDA 5DALB 2AJQB 2P0GA 4Q5RA 5ECQB 1EGOA 2H0GA 2TRCP 2L5LA 5ID2B 4NXIA 4I2UA 1Z7RA 1GP1A 3V1WA 4G10A 1GNEA 1GSEA 5HFGA 1S3DA 2MMOA 3H4KA 3HY2A 2HT9A 4POLA 4PNFA 1EP7A 2VLTA 2L5OA 4AJ6A 1XPVA 4KF9A 5CAXA 1TKDB 1ZOFA 3KMNA 2ES7A 4ILFA 2N5FA 3TKPA 3LXZA 1AC1A 2P5QA 1PMTA 3WD6A 2YPMA 3DKSA 1ZYNA 2YJHA 3APOA 4KB3A 5B6MA 2YWNA 3VURA 3QAGA 3PPUA 1KBNA 3IDVA 1XW5A 4IHUA 3CRUA 2KP1A 2OE1A 4XRAA 5DVBA 2F8FA 5HR1A 2EIRA 4CW9A 4EIPA 4JU5A 4WF5A 4KW6A 4ZL8A 2A4HA 3O76A 4Q5NA 1OC3A 1VF4A 2X64A 2MBTA 1J08A 1ERUA 5AIVA 2AYTA 5J3RA 3F6FA 3H79A 2BTOT 1GUMA 2VOCA 3FW2A 4X4JA 1O85A 3EWLA 4WKWA 5J5NA 4XRDA 1PL1A 1GSDA 3D4TA 1O6JA 2JU5A 3DD3A 4ZB6A 4MMMA 2MZCA 2PU9C 4JZQA 3R2QA 3BCIA 4RI7A 1V98A 4N11A 4ZILA 3F3QA 5AGYA 2V6OA 2WRTA 5IMVA 2LJAA 3IE3A 2GSQA 2LQOA 2H01A 1K3OA 4IP1A 1OAZA 2YWMA 4MH2A 1AW9A 2ON5A 3F3RA 1PL2A 5ECOB 2I4AA 1B4PA 5INYA 2CX3A 2H30A 1U3AA 5G5EA 1TK0B 4BL7A 2J23A 3TCOA 3F4SA 3QDNA 3O6TA 4ZIJA 3FR3A 5J9CA 1V57A 3EU4A 5DALA 1PD21 3CBUA 4IW9A 1YKCA 2LRTA 3C71A 2RUFA 5ID2A 4MLYA 1F9MA 3K8NA 4K2XA 2GQLA 4PQHA 1FOVA 2N5BA 2O87A 4MJCA 2GZPA 3TRPA 1TU7A 3Q19A 2P31A 1DBYA 4GRFA 4K0GA 1TRWA 4XHMA 4TR4A 3CSHA 3VWXA 4RQXA 3WGDA 4EL1A 5ECSA 2NTOA 19GSA 3GRXA 1ZMAA 2TRXA 1BEDA 1KEBA 2G2QA 4LA1A 1G6YA 4G19A 4PTSA 4IJIA 3ZVJA 1GSFA 2GT5A 4L5LA 4MNNA 3EC3A 2C80A 5G30A 2HFDA 2YWOA 5JWQB 3GKXA 3RBTA 1Z5YE 3IOSA 1OE7A 1OC9B 3HCZA 5COHA 3RAZA 5D9WA 1QXHA 3TGZA 2HZEA 5GAND 3D0ZA 1EOHA 2DMMA 1PSQA 1X9WB 2J9HA 2LKUA 1XFLA 2XHFA 1TK8B 1PN0A 1AAZA 4G2EA 3IBHA 2DSAA 4TVEA 3P90A 3UVHA 2LRCA 5LNKe 1YF1A 4XIHA 2MBSA 4TN8A 2JL4A 1YF0A 2R0PA 3RPPA 3ZIJA 2O89A 5ECKB 1K0CA 2ZUPA 3ZYWA 1EEMA 1MTCA 1FW1A 1OKDA 4GXZA 2OADA 2E2GA 4MJAA 2K8SA 4MF5A 4LMVA 4FQUA 4NV2A 5ECHB 2NDOA 5CRHA 2HI7A 1YEXA 1XWCA 5ECIB 3CYNA 3L9SA 4E8EA 1OC8A 2MMZA 2YV7A 3HVVA 4O92A 4NV5A 5D9VA 1TW9A 1M9AA 3C8EA 3E0UA 4YH2A 5H5RA 2KHPA 1XW9A 2LJRA 2NVLA 1XIYA 1ON4A 4MDCA 2WS2A 3QR6A 1DE1A 3FK8A 3RDWA 2YZHA 4KUNA 1Z6MA 2CAQA 4AJ8A 4DSQA 1FO5A 2K18A 1X5EA 4DSRA 4JE1A 1XWKA 4N30A 1TK5B 3F8UA 3UOMA 2A2SA 4GF0A 5DJLA 3GN3A 3KZQA 1GNWA 4GSSA 4QL7A 4K5SA 4OFNA 1IYIA 4I8BA 20GSA 4X43A 2C1YA 2L6CA 3W8JA 1FOHA 3GKNA 1XWBA 2OBIA 4PQIA 2GSTA 5KN2A 3TKRA 1WP0A 4K9ZA 3WGEA 4PUFC 3G9BA 2H1BA 1PA3A 2C3QA 4PX1A 2RM6A 4J56E 3NOFA 3QMXA 1XOBA 3ED3A 1PRXA 3IC4A 1YKAA 1Z9HA 2MMNA 4V2MA 1KNGA 3TKSE 4BWQA 1AQVA 2IN3A 1K0MA 4MF7A 1T7PB 3S9FA 1OC9A 2GZZA 2IMEA 2PERA 5A4WA 1ERVA 4WETA 5LD0A 4EF0A 3WT1A 1JLVA 3C7MA 2VIMA 2IPAA 5JWOB 3ISOA 2OBKA 2C4JA 4ML1A 4PQ1A 3ERFA 2PPTA 3A3TA 2VCQA 4NHZA 5D73A 2IJYA 1F2EA 1X9SB 4NWYA 6GSSA 1A2JA 2FUG2 2M80A 4P3YB 3UARA 1AXDA 3QD9A 3GV1A 3WYWA 4KSMA 5EVOA 4MF6A 1XG8A 5C04A 2VCWA 3UEMA 3NZNA 14GSA 1EOGA 5A4VA 4HEA2 4K0NA 4LMWA 3F0IA 3M1GA 1U88A 2DMLA 4LL1B 1QUWA 2IMDA 1O7UA 1SL0B 4EKZA 2QA1A 3BD2A 2B5XA 5CREA 1MDKA 1K0OA 1A2MA 1J9BA 3MDKA 1TTZA 5IMAA 1JZOA 3HYPA 4WBRD 4AJ7A 4PURA 4MZBA 3D22A 3MWHA 3ZFBA 4MA9A 2OACA 3ZLPA 5GAPD 4MPFA 2VCVA 4IGJA 1K0NA 4KDYA 2R2JA 1R5PA 1U3IA 1DE2A 4Z2UA 3C73A 3R3EA 2WDUA 3G7JA 2DJKA 2HZFA 4D73A 4GCIA 3GL5A 2O8VB 5F07A 3EURA 5F06A 1PQNA 5BMUA 4V1Ag 2PVOC 1PX7A 3IHQA 1R4WA 1ZCPA 4V1Ap 5EPFA 1SK2A 1O81A 4AF2A 5A5KA 3LORA 1B4QA 4KDXA 2DLXA 4MK3A 1VGLA 1NW2A 3GX0A 2VL3A 3GYKA 4KX4A 3KEBA 1ZYPA 3LYKA 4KSOA 3UBLA 1XBSA 2HRKA 2NBSA 2LQQA 4HOJA 2FY6A 3W6GA 3EINA 22GSA 2YWIA 4V2NA 5KEJA 3C1SA 2X49A 2IMIA 1SL1B 4NPBA 3TUEA 1ILOA 1CQGA 5KOXA 3HJMA 2GVPA 3IXRA 3MAKA 1F3BA 5KN3A 3FKFA 1SD8A 2O7KA 2CVKA 1X9MB 2I1UA 2F3MA 5EY6A 4ECBA 12GSA 4AGSA 2JZSA 2QA2A 4TR3A 2HE3A 3IK7A 4TKYA 2WJUA 2F9SA 2NPBA 3J7Yb 16GSA 4GWRA 1QQ2A 1N8JA 3LEFA 4ZBBA 5D9TA 4OCEA 5DBQA 2L6DA 2LSTA 2F51A 5ECNB 3UAPA 3ZMLA 3M8NA 5GSTA 6GSXA 2LV3A 4O5UA 2FWGA 2C3NA 3KH9A 2I81A 1I9DA 4BPYA 1HNBA 1GTUA 1ZGNA 2R3XA 1TDIA 2IWTA 2B1LA 3UMAA 3A2WA 1MDJA 4IVFA 5J41A 2QC7A 2OE3A 1Q98A 3QPMA 2EIOA 5D8IA 4BVXB 3TRXA 5B8BA 1GUHA 1MD4A 4MH3A 1O8XA 3M9KA 1RW1A 4EVMA 1QFNA 4GLTA 2YJ7A 4TRXA 4ZXGA 1Z7PA 2ALBA 3TJKA 4A5PA 2HZEB 1AQWA 2DBCA 1YJ6A 3TJJA 2V1MA 4Z2TA 2HLSA 2FCHA 2IFQA 1T4ZA 2G0FA 4ZB9A 2HYXA 1F3AA 3EYTA 3HVXA 4HSCX 5D9XA 2RM5A 5DAKB 3Q74A 4POMA 1PFOA 5AN1A 3FY7A 4ML6A 4ISDA 2I3YA 5DCHA 2MMAA 5G1KA 1M2AA 4GTUA 1PKZA 2FA8A 5H5QA 1M2DA 3G7IA 3E9JB 3CRTA 3VPQA 4K1FA 2JSYA 3EPTA 3O3TA 4I6XA 1TI3A 2P5RA 3ME8A 1TI1A 18GSA 3PR8A 4JEDA 2H71A 3KP8A 3D4MA 2VL9A 1SYRA 5DQSA 1JLWA 1WOUA 7GSSA 3I9V2 2CX4A 1GTIA 4HZ2A 4EUYA 4XTSA 2WFCA 5CYYA 2ON7A 1K0AA 3VFIA 3N5OA 4H86A 3DXBA 3F4TA 2WULA 2YV9A 3FEUA 4GQFA 1WWJA 2XC2A 1EZKA 5EL8A 2GZYA 4HQSA 1BX9A 3A5WA 4FIWA 4EDYA 4N10A 4MJBA 3GURA 1YEPA 3P7XA 1M9BA 1V58A 3D6IA 1SKWB 2FWEA 1K0DA 3ZVJD 2LEGA 1WJKA 1SKSB 3J7Yk 3FZAA 3HKRA 5G5FA 3QFAC 3QAWA 4WR4A 4MPGA 5KOWA 2XPEA 1G7EA 3FZ5A 4GQCA 2C3TA 4IKHA 2DJ3A 1T00A 4BVXA 3CSIA 1XWAA 5IPHA 2XPDA 1PN9A 1JZDA 4HJMA 4IN0A 4MZCA 4CY8A 4G9HA 1S3AA 4F0BA 1Q4JA 3U6VA 5B7CA 1TOFA 5C00A 2K9FA 3GHAA 1JHBA 1XWGA 3M9JA 3JCML 1KTEA 2R37A 1LU4A 1PKWA 2R6KA 4DVCA 4CDOA 5GSSA 2V2GA 2PBJA 3DVWA 3KXOA 5GZZB 4BVYB 1EV4A 4ZBDA 1TJDA 2WB9A 3H93A 4GSNA 3FR9A 5DAKA 4KH7A 3BOAA 3F4RA 1XZOA 1BJXA 1HNCA 2VM1A 4ICYA 2HRNA 1PX6A 2B5EA 4TR1B 1DUGA 5IIZA 4JRRA 3P8WA 3HVNA 2L59A 4EIQA 4HJ2A 1THXA 2H0IA 2JADA 4F2IA 4KAEA 1WRYA 1ZZYA 2H1AA 1SL2B 2VAFA 3TOUA 2YZUA 3G7YA 3NIVA 1MD3A 5DJMA 4JBBA 4F0CA 2RLIA 4HQZA 5HR0A 3LGCA 3PINA 3VI5A 1OKTA 4G0KA 2FWHA 2L57A 4QL9A 3GNJA 4RI6A 1USBA 2VM2A 3UBKA 3BCKA 3HVSA 1F37A 1U6TA 4Q5QA 4ULXA 4IQAA 4O5RA 3KGKA 1Y6EA 5CO3A 5A4UA 3TRQA 3WGXA 4D73B 2PMTA 5IMFA 3GH6A 1Z3EA 2H70A 4N0ZA 2E2MA 3KCMA 6GSYA 2FGXA 3LSZA 5ECMB 4KCAA 2DIYA 2CZ3A 4ACSA 1H75A 2C0EA 3TJFA 3SBCA 3US3A 2QKEA 4K5RA 5ABRA 3F6DA 1NM3A 2GGTA 3VI7A 3LWAA 2GQMA 3ZMKA 3ZL5A 4PUAA 1M3IA 4L5OA 2AUVA 4X0XA 2V32A 4F82A 1AQXA 3QOUA 1BQ7A 1EP8A 1GSSA 4O32A 3FR6A 4BVYA 2GSRA 1UC7A 2IMKA 1TRSA 1VF2A 4ZB8A 2CT6A 3LXTA 4POBA 4K2DA 1K0BA 2BMXA 2LRNA 5G1LA 4IS0A 4TR1A 3L78A 2OKAA 2CQ9A 3I69A 1OE8A 2IIYA 2B6MA 5IMCA 3TKSC 1V9WA 2M72A 1G6WA 5DQYA 1EWXA 2LS5A 1G0TA 3FMWA 3ZITA 1A24A 3TKSA 1NSWA 5IM9A 5H5SA 5L71A 1MEKA 3HJPA 2K8VA 4KA0A 2E0QA 3ZTLA 1GTAA 3Q18A 2VD0A 3MYDA 4WXTA 3HJOA 3GSSA 5IOXA 6GSVA 4DEJA 1EV9A 2ZCTA 1FVJA 3BBYA 4NAXA 5JWRB 1R5AA 4XS6A 1BG5A 2DJJA 4ID0A 3HD5A 1GSQA 2IFQB 1AIUA 1M0UA 2WGRA 2LJKA 1E6BA 4Z2RA 3HDCA 3IR4A 1VRSD 5CNWA 2XBQA 5ECLB 4OFTA 1EEJA 2DC5A 4ECIA 2B7KA 2YANA 4IELA 2H76A 4HDEA 3LJRA 2HNLA 4IBPA 2LNTA 3KTBA 4KE3A 4MZWA 2LTKA 1XXUA 1YDKA 2V6KA 1PGTA 4CHSA 5IMDA 4XS4B 1C72A 3RHCA 5F05A 1MDIA 2HXKA 3EVIA 2F8AA 1UVZA 5J4UA 2VO4A 1XVWA 4YQUA 3CXGA 3HHVA 5IO2A 1GH2A 3LYPA 2PWJA 5IO0A 2X4AA 2DKHA 4GSTA 2VCXA 5HFIA 2OJLA 4MJEA 1TU8A 3ZREA 2H66A 4WF4A 1V40A 2GSSA 4QQ7A 1ZYQB 2L4CA 2AAWA 5B6NA 1O8WA 3F9UA 17GSA 3QCPA 1ACVA 3VK9A 4HU7A 4I5QA 3KM6A 1GLPA 4X1UA 3GUSA 5AISA 3KIJA 4BWSA 2RIIA 4KDUA 2CAIA 3UJ1A 2X8HA 4KCEA 4I2TA 3IPZA 4BA7A 2UZ8A 4TXOB 1TP9A 3IV4A 1ZYEA 1EGRA 4E8HA 1WIKA 4J57E 2OE0A 2VL2C 3DYRA 1LJRA 1M2BA 2R0GA 1GLQA 3BJ5A 4ECCA 2VL2A 4RQRA 2O85A 4G0IA 5KN0A 4YAVA 1SK1A 6GSWA 5JCWA 4L0UA 3GKKA 1GWCA 1K3LA 1ZL9A 3VWUA 1A8LA 13GSA 3CQFA
chains in the Genus database with same CATH topology
2PUKC 1X0RA 1T8EB 2KP2A 3IAM2 2FD3A 1B48A 4EDZA 3L0HA 1IYHA 3AY8A 3P2AA 2R0CA 1HNAA 3UIWA 4OO4A 4NHWA 3TB2A 1TXXA 4Q5FA 2C0GA 2QGVA 3DRNA 4PGTA 4CY6A 2QSIA 4NMUA 1VF1A 1Z6NA 5KN1A 2YP6A 2H6ZA 6GSTA 3ME7A 4XS4A 2HSYA 5FT3A 3ZFLA 3KMOA 3SWLA 3DIEA 2X99A 4TXVA 3A2VA 3A5IA 3GTUA 2H1DA 3KH7A 5D96A 4HS1A 4ZBAA 1GSUA 3DVXA 2D2ZA 1A0RP 2ZNMA 2R5GA 2PN8A 1GRXA 3EE2A 3IA1A 4DSSB 1R7HA 4YKGA 1DSBA 1W89A 2MYGA 2WCIA 1J0FA 3APSA 4OWYA 3EMPA 2C0FA 4OMVA 2AB6A 1THOA 2VUPA 1SJZA 2H75A 1NHOA 5G2ZA 2HSMA 5FWGA 2CA8A 3IRAA 1TRUA 3EMXA 3HZ8A 3TOTA 1SU9A 2AV4A 3VPTA 1SJ6A 3QFBC 4HZ4A 1A8YA 4KGIA 4OFMA 1I5GA 4F03A 1QGVA 3GIXA 1X5DA 4TXOA 5B8AA 4XCSA 3TJGA 4ZL7A 3F63A 3MNGA 1FB6A 3L9VA 1E2YA 1A2LA 2FNOA 1QK8A 2JACA 4POKA 1RQMA 2GS3A 5JCUA 1XVQA 2DKIA 1WPIA 2CZ2A 2CVBA 4V2LA 4XS1A 1AUCA 2JZRA 3C1RA 2TIRA 3FZ4A 3KJYA 5ENUA 1OVNA 1WMJA 3I6AA 4L0WA 3LW9A 2GQKA 1JFUA 2HSHA 2V41A 5F8BA 3WT2A 3FZ9A 2IL3A 2RUEA 2C0DA 3PGTA 3TKQA 3FRCA 2FWFA 1R26A 4IJ3A 3MSZA 5FHIA 4YQVA 10GSA 4G0LA 1H4OA 2EC4A 1FHEA 3CSJA 5J9BA 4USSA 1X5CA 1Y25A 5HQPA 3KP9A 3KTLA 1CQHA 2YN1A 3GSTA 2LNSA 5ELAA 1YZXA 2YCDA 3VWWA 4EE0A 2BJXA 4TR0A 2OA7A 3ERWA 4F9ZA 5HR3A 3ZZXA 5F0GA 3MIXA 3ZIVA 1WE0A 2HRAA 4FO5A 5DDLA 2H6YA 5DCGA 1A0FA 4PXOA 4TW5A 1BYEA 1T3BA 4K7IA 2N5AA 3DEXA 1LBKA 1A23A 3IK9A 5ELGA 1ERTA 1YQ1A 2Z9SA 4DSSA 5HR2A 1VF3A 4TOPA 1SD9A 4OCFA 1M7TA 4JR6A 3HXSA 4YKFA 1T4YA 2A2PA 1FVKA 3CTFA 2KLXA 1YY7A 2VCZA 3GMFA 2DJ2A 2DJ1A 4FYBA 3GL3A 2KUCA 1SENA 1SJIA 2H0HA 3QAVA 3CMIA 1SYXA 3DMLA 4K6XA 1F6MC 2GDRA 5ECRB 11GSA 1ST9A 2H73A 4I97A 2H19A 2DJ0A 1B8XA 1FB0A 3LFLA 3OR5A 4LLRA 1XW6A 5G31A 3ZRDA 1GL8A 2R4VA 3ERGA 2REMA 1FAAA 5E4WA 2VD1A 1S3CA 2JSZA 2H6XA 2CV4A 3TDGA 3RPNA 3IHGA 8GSSA 2H1GA 2M46A 4YAPA 5ECPB 1ML6A 3GKMA 1XOAA 1NHYA 5CRGA 4RUVA 3N9JA 4FYCA 2FLSA 9GSSA 1V2AA 4IP6A 2GT6A 2PVQA 5IPGA 2B1KA 2AHEA 4FH8A 3M0FA 1B9XC 1B9YC 4O7HA 2B3SA 4HI7A 2DIZA 5E59A 1GUKA 3DGQA 3FYGA 4MP4A 4N0VA 1UA5A 5IOWA 2LUSA 4WR5A 5CRWA 2GTUA 2IMFA 3VLNA 2H8LA 2EIQA 3UL3A 4L8EA 2FA4A 2H74A 3GFKA 4HU9A 4MCUA 5CP1A 2VLUA 4PNGA 6GSUA 1QMVA 2K6VA 3RHBA 2A2RA 3M3MA 2GLRA 2VCTA 3GX8A 1HD2A 1UN2A 1ABAA 2JZTA 4WBJA 2YNXA 3APQA 3TJBA 3D5JA 3E3EA 2VLVA 2XBIA 1GULA 3A2XA 1O73A 5HFKA 4K7OA 2H72A 1SK0A 4WEYA 1HYUA 1JZWA 4K7NA 4O5QA 3W8SA 3CTGA 5CRDA 1W4VA 2C8UA 4OD7A 3LQ7A 1T1VA 5LCZA 4EXJA 1XCCA 3EU3A 1SKRB 3HA9A 4JR4A 3VWVA 3L9UA 4ZL9A 2WZ9A 5IQYA 2KOKA 1GSYA 4J2FA 2L4QA 3PH9A 4KNDA 1N2AA 1U87A 2B7JA 3GA4A 4LL4B 4YQMA 3U5RE 4EO3A 4EC0A 2X8CA 2PGTA 1ERWA 2I9HA 1FG4A 4ECJA 3I43A 3L4NA 3D21A 3H8QA 3LG6A 4Z7XA 4OO5A 1HQOA 1G7OA 4IQ1A 3FHKA 3UVTA 1JZRA 5JCGA 1TRVA 2FHEA 4MABA 3KD0A 3GTUB 4HUAA 2A4VA 5BRTA 1RK4A 5D93A 2E7PA 5IMZA 1BAYA 3IAS2 3HZ4A 4FYUA 1OYJA 3IC8A 2HRFA 1K3YA 3GH9A 2YOIA 1M99A 5AIXA 4BL7B 4K8MA 3H1NA 1URMA 2B5YA 1GTBA 2X8GA 3DWVA 3Q6OA 2CVDA 5DALB 2AJQB 2P0GA 4Q5RA 5ECQB 1EGOA 2H0GA 2TRCP 2L5LA 5ID2B 4NXIA 4I2UA 1Z7RA 1GP1A 3V1WA 4G10A 1GNEA 1GSEA 5HFGA 1S3DA 2MMOA 3H4KA 3HY2A 2HT9A 4POLA 4PNFA 1EP7A 2VLTA 2L5OA 4AJ6A 1XPVA 4KF9A 5CAXA 1TKDB 1ZOFA 3KMNA 2ES7A 4ILFA 2N5FA 3TKPA 3LXZA 1AC1A 2P5QA 1PMTA 3WD6A 2YPMA 3DKSA 1ZYNA 2YJHA 3APOA 4KB3A 5B6MA 2YWNA 3VURA 3QAGA 3PPUA 1KBNA 3IDVA 1XW5A 4IHUA 3CRUA 2KP1A 2OE1A 4XRAA 5DVBA 2F8FA 5HR1A 2EIRA 4CW9A 4EIPA 4JU5A 4WF5A 4KW6A 4ZL8A 2A4HA 3O76A 4Q5NA 1OC3A 1VF4A 2X64A 2MBTA 1J08A 1ERUA 5AIVA 2AYTA 5J3RA 3F6FA 3H79A 2BTOT 1GUMA 2VOCA 3FW2A 4X4JA 1O85A 3EWLA 4WKWA 5J5NA 4XRDA 1PL1A 1GSDA 3D4TA 1O6JA 2JU5A 3DD3A 4ZB6A 4MMMA 2MZCA 2PU9C 4JZQA 3R2QA 3BCIA 4RI7A 1V98A 4N11A 4ZILA 3F3QA 5AGYA 2V6OA 2WRTA 5IMVA 2LJAA 3IE3A 2GSQA 2LQOA 2H01A 1K3OA 4IP1A 1OAZA 2YWMA 4MH2A 1AW9A 2ON5A 3F3RA 1PL2A 5ECOB 2I4AA 1B4PA 5INYA 2CX3A 2H30A 1U3AA 5G5EA 1TK0B 4BL7A 2J23A 3TCOA 3F4SA 3QDNA 3O6TA 4ZIJA 3FR3A 5J9CA 1V57A 3EU4A 5DALA 1PD21 3CBUA 4IW9A 1YKCA 2LRTA 3C71A 2RUFA 5ID2A 4MLYA 1F9MA 3K8NA 4K2XA 2GQLA 4PQHA 1FOVA 2N5BA 2O87A 4MJCA 2GZPA 3TRPA 1TU7A 3Q19A 2P31A 1DBYA 4GRFA 4K0GA 1TRWA 4XHMA 4TR4A 3CSHA 3VWXA 4RQXA 3WGDA 4EL1A 5ECSA 2NTOA 19GSA 3GRXA 1ZMAA 2TRXA 1BEDA 1KEBA 2G2QA 4LA1A 1G6YA 4G19A 4PTSA 4IJIA 3ZVJA 1GSFA 2GT5A 4L5LA 4MNNA 3EC3A 2C80A 5G30A 2HFDA 2YWOA 5JWQB 3GKXA 3RBTA 1Z5YE 3IOSA 1OE7A 1OC9B 3HCZA 5COHA 3RAZA 5D9WA 1QXHA 3TGZA 2HZEA 5GAND 3D0ZA 1EOHA 2DMMA 1PSQA 1X9WB 2J9HA 2LKUA 1XFLA 2XHFA 1TK8B 1PN0A 1AAZA 4G2EA 3IBHA 2DSAA 4TVEA 3P90A 3UVHA 2LRCA 5LNKe 1YF1A 4XIHA 2MBSA 4TN8A 2JL4A 1YF0A 2R0PA 3RPPA 3ZIJA 2O89A 5ECKB 1K0CA 2ZUPA 3ZYWA 1EEMA 1MTCA 1FW1A 1OKDA 4GXZA 2OADA 2E2GA 4MJAA 2K8SA 4MF5A 4LMVA 4FQUA 4NV2A 5ECHB 2NDOA 5CRHA 2HI7A 1YEXA 1XWCA 5ECIB 3CYNA 3L9SA 4E8EA 1OC8A 2MMZA 2YV7A 3HVVA 4O92A 4NV5A 5D9VA 1TW9A 1M9AA 3C8EA 3E0UA 4YH2A 5H5RA 2KHPA 1XW9A 2LJRA 2NVLA 1XIYA 1ON4A 4MDCA 2WS2A 3QR6A 1DE1A 3FK8A 3RDWA 2YZHA 4KUNA 1Z6MA 2CAQA 4AJ8A 4DSQA 1FO5A 2K18A 1X5EA 4DSRA 4JE1A 1XWKA 4N30A 1TK5B 3F8UA 3UOMA 2A2SA 4GF0A 5DJLA 3GN3A 3KZQA 1GNWA 4GSSA 4QL7A 4K5SA 4OFNA 1IYIA 4I8BA 20GSA 4X43A 2C1YA 2L6CA 3W8JA 1FOHA 3GKNA 1XWBA 2OBIA 4PQIA 2GSTA 5KN2A 3TKRA 1WP0A 4K9ZA 3WGEA 4PUFC 3G9BA 2H1BA 1PA3A 2C3QA 4PX1A 2RM6A 4J56E 3NOFA 3QMXA 1XOBA 3ED3A 1PRXA 3IC4A 1YKAA 1Z9HA 2MMNA 4V2MA 1KNGA 3TKSE 4BWQA 1AQVA 2IN3A 1K0MA 4MF7A 1T7PB 3S9FA 1OC9A 2GZZA 2IMEA 2PERA 5A4WA 1ERVA 4WETA 5LD0A 4EF0A 3WT1A 1JLVA 3C7MA 2VIMA 2IPAA 5JWOB 3ISOA 2OBKA 2C4JA 4ML1A 4PQ1A 3ERFA 2PPTA 3A3TA 2VCQA 4NHZA 5D73A 2IJYA 1F2EA 1X9SB 4NWYA 6GSSA 1A2JA 2FUG2 2M80A 4P3YB 3UARA 1AXDA 3QD9A 3GV1A 3WYWA 4KSMA 5EVOA 4MF6A 5C04A 2VCWA 3UEMA 3NZNA 14GSA 1EOGA 5A4VA 4HEA2 4K0NA 4LMWA 3F0IA 3M1GA 1U88A 2DMLA 4LL1B 1QUWA 2IMDA 1O7UA 1SL0B 4EKZA 2QA1A 3BD2A 2B5XA 5CREA 1MDKA 1K0OA 1A2MA 1J9BA 3MDKA 1TTZA 5IMAA 1JZOA 3HYPA 4WBRD 4AJ7A 4PURA 4MZBA 3D22A 3MWHA 3ZFBA 4MA9A 2OACA 3ZLPA 5GAPD 4MPFA 2VCVA 4IGJA 1K0NA 4KDYA 2R2JA 1R5PA 1U3IA 1DE2A 4Z2UA 3C73A 3R3EA 2WDUA 3G7JA 2DJKA 2HZFA 4D73A 4GCIA 3GL5A 2O8VB 5F07A 3EURA 5F06A 1PQNA 5BMUA 4V1Ag 2PVOC 1PX7A 3IHQA 1R4WA 1ZCPA 4V1Ap 5EPFA 1SK2A 1O81A 4AF2A 5A5KA 3LORA 1B4QA 4KDXA 2DLXA 4MK3A 1VGLA 1NW2A 3GX0A 2VL3A 3GYKA 4KX4A 3KEBA 1ZYPA 3LYKA 4KSOA 3UBLA 1XBSA 2HRKA 2NBSA 2LQQA 4HOJA 2FY6A 3W6GA 3EINA 22GSA 2YWIA 4V2NA 5KEJA 3C1SA 2X49A 2IMIA 1SL1B 4NPBA 3TUEA 1ILOA 1CQGA 5KOXA 3HJMA 2GVPA 3IXRA 3MAKA 1F3BA 5KN3A 3FKFA 1SD8A 2O7KA 2CVKA 1X9MB 2I1UA 2F3MA 5EY6A 4ECBA 12GSA 4AGSA 2JZSA 2QA2A 4TR3A 2HE3A 3IK7A 4TKYA 2WJUA 2F9SA 2NPBA 3J7Yb 16GSA 4GWRA 1QQ2A 1N8JA 3LEFA 4ZBBA 5D9TA 4OCEA 5DBQA 2L6DA 2LSTA 2F51A 5ECNB 3UAPA 3ZMLA 3M8NA 5GSTA 6GSXA 2LV3A 4O5UA 2FWGA 2C3NA 3KH9A 2I81A 1I9DA 4BPYA 1HNBA 1GTUA 1ZGNA 2R3XA 1TDIA 2IWTA 2B1LA 3UMAA 3A2WA 1MDJA 4IVFA 5J41A 2QC7A 2OE3A 1Q98A 3QPMA 2EIOA 5D8IA 4BVXB 3TRXA 5B8BA 1GUHA 1MD4A 4MH3A 1O8XA 3M9KA 1RW1A 4EVMA 1QFNA 4GLTA 2YJ7A 4TRXA 4ZXGA 1Z7PA 2ALBA 3TJKA 4A5PA 2HZEB 1AQWA 2DBCA 1YJ6A 3TJJA 2V1MA 4Z2TA 2HLSA 2FCHA 2IFQA 1T4ZA 2G0FA 4ZB9A 2HYXA 1F3AA 3EYTA 3HVXA 5D9XA 2RM5A 5DAKB 3Q74A 4POMA 5AN1A 3FY7A 4ML6A 4ISDA 2I3YA 5DCHA 2MMAA 5G1KA 1M2AA 4GTUA 1PKZA 2FA8A 5H5QA 1M2DA 3G7IA 3E9JB 3CRTA 3VPQA 4K1FA 2JSYA 3EPTA 3O3TA 4I6XA 1TI3A 2P5RA 3ME8A 1TI1A 18GSA 3PR8A 4JEDA 2H71A 3KP8A 3D4MA 2VL9A 1SYRA 5DQSA 1JLWA 1WOUA 7GSSA 3I9V2 2CX4A 1GTIA 4HZ2A 4EUYA 4XTSA 2WFCA 5CYYA 2ON7A 1K0AA 3VFIA 3N5OA 4H86A 3DXBA 3F4TA 2WULA 2YV9A 3FEUA 4GQFA 1WWJA 2XC2A 1EZKA 5EL8A 2GZYA 4HQSA 1BX9A 3A5WA 4FIWA 4EDYA 4N10A 4MJBA 3GURA 1YEPA 3P7XA 1M9BA 1V58A 3D6IA 1SKWB 2FWEA 1K0DA 3ZVJD 2LEGA 1WJKA 1SKSB 3J7Yk 3FZAA 3HKRA 5G5FA 3QFAC 3QAWA 4WR4A 4MPGA 5KOWA 2XPEA 1G7EA 3FZ5A 4GQCA 2C3TA 4IKHA 2DJ3A 1T00A 4BVXA 3CSIA 1XWAA 5IPHA 2XPDA 1PN9A 1JZDA 4HJMA 4IN0A 4MZCA 4CY8A 4G9HA 1S3AA 4F0BA 1Q4JA 3U6VA 5B7CA 1TOFA 5C00A 2K9FA 3GHAA 1JHBA 1XWGA 3M9JA 3JCML 1KTEA 2R37A 1LU4A 1PKWA 2R6KA 4DVCA 4CDOA 5GSSA 2V2GA 2PBJA 3DVWA 3KXOA 5GZZB 4BVYB 1EV4A 4ZBDA 1TJDA 2WB9A 3H93A 4GSNA 3FR9A 5DAKA 4KH7A 3BOAA 3F4RA 1XZOA 1BJXA 1HNCA 2VM1A 4ICYA 2HRNA 1PX6A 2B5EA 4TR1B 1DUGA 5IIZA 4JRRA 3P8WA 2L59A 4EIQA 4HJ2A 1THXA 2H0IA 2JADA 4F2IA 4KAEA 1WRYA 1ZZYA 2H1AA 1SL2B 2VAFA 3TOUA 2YZUA 3G7YA 3NIVA 1MD3A 5DJMA 4JBBA 4F0CA 2RLIA 4HQZA 5HR0A 3LGCA 3PINA 3VI5A 1OKTA 4G0KA 2FWHA 2L57A 4QL9A 3GNJA 4RI6A 1USBA 2VM2A 3UBKA 3BCKA 3HVSA 1F37A 1U6TA 4Q5QA 4ULXA 4IQAA 4O5RA 3KGKA 1Y6EA 5CO3A 5A4UA 3TRQA 3WGXA 4D73B 2PMTA 5IMFA 3GH6A 1Z3EA 2H70A 4N0ZA 2E2MA 3KCMA 6GSYA 2FGXA 3LSZA 5ECMB 4KCAA 2DIYA 2CZ3A 4ACSA 1H75A 2C0EA 3TJFA 3SBCA 3US3A 2QKEA 4K5RA 5ABRA 3F6DA 1NM3A 2GGTA 3VI7A 3LWAA 2GQMA 3ZMKA 3ZL5A 4PUAA 4L5OA 2AUVA 4X0XA 2V32A 4F82A 1AQXA 3QOUA 1BQ7A 1EP8A 1GSSA 4O32A 3FR6A 4BVYA 2GSRA 1UC7A 2IMKA 1TRSA 1VF2A 4ZB8A 2CT6A 3LXTA 4POBA 4K2DA 1K0BA 2BMXA 2LRNA 5G1LA 4IS0A 4TR1A 3L78A 2OKAA 2CQ9A 3I69A 1OE8A 2IIYA 2B6MA 5IMCA 3TKSC 1V9WA 2M72A 1G6WA 5DQYA 1EWXA 2LS5A 1G0TA 3FMWA 3ZITA 1A24A 3TKSA 1NSWA 5IM9A 5H5SA 5L71A 1MEKA 3HJPA 2K8VA 4KA0A 2E0QA 3ZTLA 1GTAA 3Q18A 2VD0A 3MYDA 4WXTA 3HJOA 3GSSA 5IOXA 6GSVA 4DEJA 1EV9A 2ZCTA 1FVJA 3BBYA 4NAXA 5JWRB 1R5AA 4XS6A 1BG5A 2DJJA 4ID0A 3HD5A 1GSQA 2IFQB 1AIUA 1M0UA 2WGRA 2LJKA 1E6BA 4Z2RA 3HDCA 3IR4A 1VRSD 5CNWA 2XBQA 5ECLB 4OFTA 1EEJA 2DC5A 4ECIA 2B7KA 2YANA 4IELA 2H76A 4HDEA 3LJRA 2HNLA 4IBPA 2LNTA 3KTBA 4KE3A 4MZWA 2LTKA 1XXUA 1YDKA 2V6KA 1PGTA 4CHSA 5IMDA 4XS4B 1C72A 3RHCA 5F05A 1MDIA 2HXKA 3EVIA 2F8AA 1UVZA 5J4UA 2VO4A 1XVWA 4YQUA 3CXGA 3HHVA 5IO2A 1GH2A 3LYPA 2PWJA 5IO0A 2X4AA 2DKHA 4GSTA 2VCXA 5HFIA 2OJLA 4MJEA 1TU8A 3ZREA 2H66A 4WF4A 1V40A 2GSSA 4QQ7A 1ZYQB 2L4CA 2AAWA 5B6NA 1O8WA 3F9UA 17GSA 3QCPA 1ACVA 3VK9A 4HU7A 4I5QA 3KM6A 1GLPA 4X1UA 3GUSA 5AISA 3KIJA 4BWSA 2RIIA 4KDUA 2CAIA 3UJ1A 2X8HA 4KCEA 4I2TA 3IPZA 4BA7A 2UZ8A 4TXOB 1TP9A 3IV4A 1ZYEA 1EGRA 4E8HA 1WIKA 4J57E 2OE0A 2VL2C 3DYRA 1LJRA 1M2BA 2R0GA 1GLQA 3BJ5A 4ECCA 2VL2A 4RQRA 2O85A 4G0IA 5KN0A 4YAVA 1SK1A 6GSWA 5JCWA 4L0UA 3GKKA 1GWCA 1K3LA 1ZL9A 3VWUA 1A8LA 13GSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PUK C;  1X0R A;  1T8E B;  2KP2 A;  3IAM 2;  2FD3 A;  1B48 A;  4EDZ A;  3L0H A;  1IYH A;  3AY8 A;  3P2A A;  1HNA A;  3UIW A;  4OO4 A;  4NHW A;  3TB2 A;  1TXX A;  4Q5F A;  2C0G A;  2QGV A;  3DRN A;  4PGT A;  2QSI A;  4NMU A;  1VF1 A;  1Z6N A;  5KN1 A;  2YP6 A;  2H6Z A;  6GST A;  3ME7 A;  4XS4 A;  2HSY A;  5FT3 A;  3ZFL A;  3KMO A;  3SWL A;  3DIE A;  2X99 A;  4TXV A;  3A2V A;  3GTU A;  2H1D A;  3KH7 A;  5D96 A;  4HS1 A;  4ZBA A;  1GSU A;  3DVX A;  2D2Z A;  1A0R P;  2ZNM A;  2R5G A;  2PN8 A;  1GRX A;  3EE2 A;  3IA1 A;  4DSS B;  1R7H A;  1DSB A;  1W89 A;  2MYG A;  2WCI A;  1J0F A;  3APS A;  4OWY A;  3EMP A;  2C0F A;  4OMV A;  2AB6 A;  1THO A;  2VUP A;  1SJZ A;  2H75 A;  1NHO A;  5G2Z A;  5FWG A;  2CA8 A;  3IRA A;  1TRU A;  3EMX A;  3HZ8 A;  3TOT A;  1SU9 A;  2AV4 A;  3VPT A;  1SJ6 A;  3QFB C;  4HZ4 A;  1A8Y A;  4KGI A;  4OFM A;  1I5G A;  4F03 A;  1QGV A;  3GIX A;  1X5D A;  4TXO A;  5B8A A;  4XCS A;  3TJG A;  4ZL7 A;  3F63 A;  3MNG A;  1FB6 A;  3L9V A;  1E2Y A;  1A2L A;  2FNO A;  1QK8 A;  2JAC A;  4POK A;  1RQM A;  2GS3 A;  5JCU A;  1XVQ A;  1WPI A;  2CZ2 A;  2CVB A;  4V2L A;  4XS1 A;  1AUC A;  2JZR A;  3C1R A;  2TIR A;  3FZ4 A;  3KJY A;  5ENU A;  1OVN A;  1WMJ A;  3I6A A;  4L0W A;  2GQK A;  1JFU A;  2HSH A;  2V41 A;  5F8B A;  3WT2 A;  3FZ9 A;  2IL3 A;  2RUE A;  2C0D A;  3PGT A;  3TKQ A;  3FRC A;  2FWF A;  1R26 A;  4IJ3 A;  3MSZ A;  5FHI A;  4YQV A;  10GS A;  1H4O A;  2EC4 A;  1FHE A;  3CSJ A;  5J9B A;  1X5C A;  1Y25 A;  5HQP A;  3KP9 A;  3KTL A;  1CQH A;  2YN1 A;  3GST A;  2LNS A;  5ELA A;  1YZX A;  2YCD A;  3VWW A;  4EE0 A;  2BJX A;  4TR0 A;  2OA7 A;  3ERW A;  4F9Z A;  5HR3 A;  3ZZX A;  5F0G A;  3ZIV A;  1WE0 A;  4FO5 A;  5DDL A;  2H6Y A;  5DCG A;  1A0F A;  4PXO A;  4TW5 A;  1BYE A;  1T3B A;  4K7I A;  2N5A A;  3DEX A;  1LBK A;  1A23 A;  3IK9 A;  5ELG A;  1ERT A;  1YQ1 A;  2Z9S A;  4DSS A;  5HR2 A;  1VF3 A;  4TOP A;  1SD9 A;  4OCF A;  1M7T A;  4JR6 A;  3HXS A;  1T4Y A;  1FVK A;  3CTF A;  2KLX A;  1YY7 A;  2VCZ A;  3GMF A;  2DJ2 A;  2DJ1 A;  4FYB A;  3GL3 A;  2KUC A;  1SEN A;  1SJI A;  2H0H A;  3QAV A;  3CMI A;  1SYX A;  3DML A;  4K6X A;  1F6M C;  2GDR A;  5ECR B;  11GS A;  1ST9 A;  2H73 A;  4I97 A;  2H19 A;  2DJ0 A;  1B8X A;  1FB0 A;  3LFL A;  3OR5 A;  4LLR A;  1XW6 A;  5G31 A;  3ZRD A;  1GL8 A;  2R4V A;  3ERG A;  2REM A;  1FAA A;  5E4W A;  2VD1 A;  1S3C A;  2JSZ A;  2H6X A;  2CV4 A;  3TDG A;  3RPN A;  8GSS A;  2H1G A;  2M46 A;  4YAP A;  5ECP B;  1ML6 A;  3GKM A;  1XOA A;  1NHY A;  5CRG A;  4RUV A;  3N9J A;  4FYC A;  2FLS A;  9GSS A;  1V2A A;  4IP6 A;  2GT6 A;  2PVQ A;  5IPG A;  2B1K A;  2AHE A;  4FH8 A;  3M0F A;  1B9X C;  1B9Y C;  4O7H A;  2B3S A;  4HI7 A;  2DIZ A;  5E59 A;  1GUK A;  3DGQ A;  3FYG A;  4MP4 A;  4N0V A;  1UA5 A;  5IOW A;  2LUS A;  4WR5 A;  5CRW A;  2GTU A;  2IMF A;  3VLN A;  2H8L A;  2EIQ A;  3UL3 A;  4L8E A;  2FA4 A;  2H74 A;  3GFK A;  4HU9 A;  4MCU A;  5CP1 A;  2VLU A;  4PNG A;  6GSU A;  1QMV A;  2K6V A;  3RHB A;  2A2R A;  3M3M A;  2GLR A;  2VCT A;  3GX8 A;  1HD2 A;  1UN2 A;  1ABA A;  2JZT A;  4WBJ A;  2YNX A;  3APQ A;  3TJB A;  3D5J A;  3E3E A;  2VLV A;  2XBI A;  1GUL A;  3A2X A;  1O73 A;  5HFK A;  4K7O A;  2H72 A;  1SK0 A;  4WEY A;  1HYU A;  1JZW A;  4K7N A;  3W8S A;  3CTG A;  5CRD A;  1W4V A;  2C8U A;  4OD7 A;  3LQ7 A;  1T1V A;  5LCZ A;  4EXJ A;  1XCC A;  3EU3 A;  1SKR B;  3HA9 A;  4JR4 A;  3VWV A;  3L9U A;  4ZL9 A;  2WZ9 A;  5IQY A;  2KOK A;  1GSY A;  4J2F A;  2L4Q A;  3PH9 A;  4KND A;  1N2A A;  1U87 A;  2B7J A;  3GA4 A;  4LL4 B;  4YQM A;  3U5R E;  4EO3 A;  4EC0 A;  2X8C A;  2PGT A;  1ERW A;  2I9H A;  1FG4 A;  4ECJ A;  3I43 A;  3L4N A;  3D21 A;  3H8Q A;  3LG6 A;  4Z7X A;  4OO5 A;  1HQO A;  1G7O A;  4IQ1 A;  3FHK A;  3UVT A;  1JZR A;  5JCG A;  1TRV A;  2FHE A;  4MAB A;  3KD0 A;  3GTU B;  4HUA A;  2A4V A;  1RK4 A;  5D93 A;  2E7P A;  5IMZ A;  1BAY A;  3IAS 2;  3HZ4 A;  4FYU A;  1OYJ A;  2HRF A;  1K3Y A;  3GH9 A;  2YOI A;  1M99 A;  5AIX A;  4K8M A;  3H1N A;  1URM A;  2B5Y A;  1GTB A;  2X8G A;  3DWV A;  3Q6O A;  2CVD A;  5DAL B;  2AJQ B;  2P0G A;  4Q5R A;  5ECQ B;  1EGO A;  2H0G A;  2TRC P;  2L5L A;  5ID2 B;  4NXI A;  4I2U A;  1Z7R A;  1GP1 A;  3V1W A;  4G10 A;  1GNE A;  1GSE A;  5HFG A;  1S3D A;  2MMO A;  3H4K A;  3HY2 A;  2HT9 A;  4POL A;  4PNF A;  1EP7 A;  2VLT A;  2L5O A;  4AJ6 A;  1XPV A;  5CAX A;  1TKD B;  1ZOF A;  3KMN A;  2ES7 A;  4ILF A;  2N5F A;  3TKP A;  3LXZ A;  1AC1 A;  2P5Q A;  1PMT A;  3WD6 A;  2YPM A;  3DKS A;  2YJH A;  3APO A;  4KB3 A;  5B6M A;  2YWN A;  3VUR A;  3QAG A;  1KBN A;  3IDV A;  1XW5 A;  4IHU A;  3CRU A;  2KP1 A;  2OE1 A;  4XRA A;  5DVB A;  2F8F A;  5HR1 A;  2EIR A;  4CW9 A;  4JU5 A;  4WF5 A;  4KW6 A;  4ZL8 A;  3O76 A;  4Q5N A;  1OC3 A;  1VF4 A;  2X64 A;  2MBT A;  1J08 A;  1ERU A;  5AIV A;  2AYT A;  5J3R A;  3F6F A;  3H79 A;  2BTO T;  1GUM A;  2VOC A;  3FW2 A;  1O85 A;  3EWL A;  4WKW A;  5J5N A;  4XRD A;  1PL1 A;  1GSD A;  3D4T A;  1O6J A;  2JU5 A;  3DD3 A;  4ZB6 A;  4MMM A;  2MZC A;  2PU9 C;  4JZQ A;  3R2Q A;  3BCI A;  4RI7 A;  1V98 A;  4N11 A;  4ZIL A;  3F3Q A;  5AGY A;  2V6O A;  2WRT A;  5IMV A;  2LJA A;  3IE3 A;  2GSQ A;  2LQO A;  2H01 A;  1K3O A;  4IP1 A;  1OAZ A;  2YWM A;  4MH2 A;  1AW9 A;  2ON5 A;  3F3R A;  1PL2 A;  5ECO B;  2I4A A;  1B4P A;  5INY A;  2CX3 A;  2H30 A;  1U3A A;  5G5E A;  1TK0 B;  4BL7 A;  2J23 A;  3TCO A;  3F4S A;  3QDN A;  3O6T A;  4ZIJ A;  3FR3 A;  5J9C A;  1V57 A;  3EU4 A;  5DAL A;  1PD2 1;  3CBU A;  4IW9 A;  1YKC A;  2LRT A;  3C71 A;  2RUF A;  5ID2 A;  4MLY A;  1F9M A;  3K8N A;  2GQL A;  4PQH A;  1FOV A;  2N5B A;  2O87 A;  4MJC A;  2GZP A;  3TRP A;  1TU7 A;  3Q19 A;  2P31 A;  1DBY A;  4GRF A;  4K0G A;  1TRW A;  4XHM A;  4TR4 A;  3CSH A;  3VWX A;  4RQX A;  3WGD A;  4EL1 A;  5ECS A;  2NTO A;  19GS A;  3GRX A;  1ZMA A;  2TRX A;  1BED A;  1KEB A;  2G2Q A;  4LA1 A;  1G6Y A;  4G19 A;  4IJI A;  3ZVJ A;  1GSF A;  2GT5 A;  4L5L A;  3EC3 A;  2C80 A;  5G30 A;  2HFD A;  2YWO A;  5JWQ B;  3GKX A;  3RBT A;  1Z5Y E;  3IOS A;  1OE7 A;  1OC9 B;  3HCZ A;  5COH A;  3RAZ A;  5D9W A;  1QXH A;  3TGZ A;  2HZE A;  5GAN D;  3D0Z A;  1EOH A;  2DMM A;  1PSQ A;  1X9W B;  2J9H A;  2LKU A;  1XFL A;  2XHF A;  1TK8 B;  1AAZ A;  4G2E A;  3IBH A;  2DSA A;  4TVE A;  3P90 A;  3UVH A;  2LRC A;  5LNK e;  1YF1 A;  4XIH A;  2MBS A;  4TN8 A;  2JL4 A;  1YF0 A;  3RPP A;  3ZIJ A;  2O89 A;  5ECK B;  1K0C A;  2ZUP A;  3ZYW A;  1EEM A;  1MTC A;  1FW1 A;  1OKD A;  4GXZ A;  2OAD A;  2E2G A;  4MJA A;  2K8S A;  4MF5 A;  4LMV A;  4NV2 A;  5ECH B;  2NDO A;  5CRH A;  2HI7 A;  1YEX A;  1XWC A;  5ECI B;  3CYN A;  3L9S A;  4E8E A;  1OC8 A;  2MMZ A;  2YV7 A;  3HVV A;  4O92 A;  4NV5 A;  5D9V A;  1TW9 A;  1M9A A;  3C8E A;  3E0U A;  4YH2 A;  5H5R A;  2KHP A;  1XW9 A;  2LJR A;  2NVL A;  1XIY A;  1ON4 A;  4MDC A;  2WS2 A;  3QR6 A;  1DE1 A;  3FK8 A;  3RDW A;  2YZH A;  4KUN A;  1Z6M A;  2CAQ A;  4AJ8 A;  4DSQ A;  1FO5 A;  2K18 A;  1X5E A;  4DSR A;  4JE1 A;  1XWK A;  4N30 A;  1TK5 B;  3F8U A;  3UOM A;  2A2S A;  4GF0 A;  5DJL A;  3GN3 A;  3KZQ A;  1GNW A;  4GSS A;  4QL7 A;  4OFN A;  1IYI A;  4I8B A;  20GS A;  4X43 A;  2C1Y A;  2L6C A;  3W8J A;  3GKN A;  1XWB A;  2OBI A;  4PQI A;  2GST A;  5KN2 A;  3TKR A;  1WP0 A;  4K9Z A;  3WGE A;  4PUF C;  3G9B A;  2H1B A;  1PA3 A;  2C3Q A;  4PX1 A;  2RM6 A;  4J56 E;  3NOF A;  3QMX A;  1XOB A;  3ED3 A;  1PRX A;  3IC4 A;  1YKA A;  1Z9H A;  2MMN A;  4V2M A;  1KNG A;  3TKS E;  4BWQ A;  1AQV A;  2IN3 A;  1K0M A;  4MF7 A;  1T7P B;  3S9F A;  1OC9 A;  2GZZ A;  2IME A;  2PER A;  5A4W A;  1ERV A;  4WET A;  5LD0 A;  4EF0 A;  3WT1 A;  1JLV A;  3C7M A;  2VIM A;  2IPA A;  5JWO B;  3ISO A;  2OBK A;  2C4J A;  4ML1 A;  4PQ1 A;  3ERF A;  2PPT A;  3A3T A;  2VCQ A;  4NHZ A;  5D73 A;  2IJY A;  1F2E A;  1X9S B;  4NWY A;  6GSS A;  1A2J A;  2FUG 2;  2M80 A;  4P3Y B;  3UAR A;  1AXD A;  3QD9 A;  3GV1 A;  3WYW A;  4KSM A;  5EVO A;  4MF6 A;  5C04 A;  2VCW A;  3UEM A;  3NZN A;  14GS A;  1EOG A;  5A4V A;  4HEA 2;  4K0N A;  4LMW A;  3F0I A;  3M1G A;  1U88 A;  2DML A;  4LL1 B;  1QUW A;  2IMD A;  1O7U A;  1SL0 B;  4EKZ A;  3BD2 A;  2B5X A;  5CRE A;  1MDK A;  1K0O A;  1A2M A;  1J9B A;  3MDK A;  1TTZ A;  5IMA A;  1JZO A;  3HYP A;  4WBR D;  4AJ7 A;  4PUR A;  4MZB A;  3D22 A;  3MWH A;  3ZFB A;  4MA9 A;  2OAC A;  3ZLP A;  5GAP D;  4MPF A;  2VCV A;  4IGJ A;  1K0N A;  4KDY A;  2R2J A;  1R5P A;  1U3I A;  1DE2 A;  3C73 A;  2WDU A;  3G7J A;  2DJK A;  2HZF A;  4D73 A;  4GCI A;  3GL5 A;  2O8V B;  5F07 A;  3EUR A;  5F06 A;  1PQN A;  4V1A g;  2PVO C;  1PX7 A;  3IHQ A;  1R4W A;  1ZCP A;  4V1A p;  5EPF A;  1SK2 A;  1O81 A;  4AF2 A;  5A5K A;  3LOR A;  1B4Q A;  4KDX A;  2DLX A;  4MK3 A;  1VGL A;  1NW2 A;  3GX0 A;  2VL3 A;  3GYK A;  4KX4 A;  3KEB A;  3LYK A;  4KSO A;  3UBL A;  1XBS A;  2NBS A;  2LQQ A;  4HOJ A;  2FY6 A;  3W6G A;  3EIN A;  22GS A;  2YWI A;  4V2N A;  5KEJ A;  3C1S A;  2IMI A;  1SL1 B;  4NPB A;  3TUE A;  1ILO A;  1CQG A;  3HJM A;  2GVP A;  3IXR A;  3MAK A;  1F3B A;  5KN3 A;  3FKF A;  1SD8 A;  2O7K A;  2CVK A;  1X9M B;  2I1U A;  2F3M A;  5EY6 A;  4ECB A;  12GS A;  4AGS A;  2JZS A;  4TR3 A;  2HE3 A;  3IK7 A;  4TKY A;  2WJU A;  2F9S A;  2NPB A;  3J7Y b;  16GS A;  4GWR A;  1QQ2 A;  1N8J A;  3LEF A;  4ZBB A;  5D9T A;  4OCE A;  5DBQ A;  2L6D A;  2LST A;  2F51 A;  5ECN B;  3UAP A;  3ZML A;  3M8N A;  5GST A;  6GSX A;  2LV3 A;  2FWG A;  2C3N A;  3KH9 A;  2I81 A;  1I9D A;  4BPY A;  1HNB A;  1GTU A;  1ZGN A;  2R3X A;  1TDI A;  2IWT A;  2B1L A;  3UMA A;  3A2W A;  1MDJ A;  4IVF A;  5J41 A;  2QC7 A;  2OE3 A;  1Q98 A;  3QPM A;  2EIO A;  5D8I A;  3TRX A;  5B8B A;  1GUH A;  1MD4 A;  4MH3 A;  1O8X A;  3M9K A;  1RW1 A;  4EVM A;  1QFN A;  4GLT A;  2YJ7 A;  4TRX A;  4ZXG A;  1Z7P A;  2ALB A;  3TJK A;  2HZE B;  1AQW A;  2DBC A;  1YJ6 A;  3TJJ A;  2V1M A;  2HLS A;  2FCH A;  2IFQ A;  1T4Z A;  2G0F A;  4ZB9 A;  2HYX A;  1F3A A;  3EYT A;  3HVX A;  5D9X A;  2RM5 A;  5DAK B;  3Q74 A;  4POM A;  5AN1 A;  3FY7 A;  4ML6 A;  4ISD A;  2I3Y A;  5DCH A;  2MMA A;  5G1K A;  1M2A A;  4GTU A;  1PKZ A;  2FA8 A;  5H5Q A;  1M2D A;  3G7I A;  3E9J B;  3CRT A;  3VPQ A;  4K1F A;  2JSY A;  3O3T A;  4I6X A;  1TI3 A;  2P5R A;  3ME8 A;  1TI1 A;  18GS A;  3PR8 A;  4JED A;  2H71 A;  3KP8 A;  3D4M A;  2VL9 A;  1SYR A;  5DQS A;  1JLW A;  1WOU A;  7GSS A;  3I9V 2;  2CX4 A;  1GTI A;  4HZ2 A;  4EUY A;  4XTS A;  2WFC A;  5CYY A;  2ON7 A;  1K0A A;  3VFI A;  3N5O A;  4H86 A;  3DXB A;  3F4T A;  2WUL A;  2YV9 A;  3FEU A;  4GQF A;  1WWJ A;  2XC2 A;  1EZK A;  5EL8 A;  2GZY A;  4HQS A;  1BX9 A;  3A5W A;  4FIW A;  4EDY A;  4N10 A;  4MJB A;  3GUR A;  1YEP A;  3P7X A;  1M9B A;  1V58 A;  3D6I A;  1SKW B;  2FWE A;  1K0D A;  3ZVJ D;  2LEG A;  1WJK A;  1SKS B;  3J7Y k;  3FZA A;  3HKR A;  5G5F A;  3QFA C;  3QAW A;  4WR4 A;  4MPG A;  2XPE A;  1G7E A;  3FZ5 A;  4GQC A;  2C3T A;  4IKH A;  2DJ3 A;  1T00 A;  4BVX A;  3CSI A;  1XWA A;  5IPH A;  2XPD A;  1PN9 A;  1JZD A;  4HJM A;  4IN0 A;  4MZC A;  4G9H A;  1S3A A;  4F0B A;  1Q4J A;  3U6V A;  5B7C A;  1TOF A;  5C00 A;  2K9F A;  3GHA A;  1JHB A;  1XWG A;  3M9J A;  3JCM L;  1KTE A;  2R37 A;  1LU4 A;  1PKW A;  2R6K A;  4DVC A;  4CDO A;  5GSS A;  2V2G A;  2PBJ A;  3DVW A;  3KXO A;  5GZZ B;  1EV4 A;  4ZBD A;  1TJD A;  2WB9 A;  3H93 A;  4GSN A;  3FR9 A;  5DAK A;  4KH7 A;  3BOA A;  3F4R A;  1XZO A;  1BJX A;  1HNC A;  2VM1 A;  2HRN A;  1PX6 A;  2B5E A;  4TR1 B;  1DUG A;  5IIZ A;  4JRR A;  3P8W A;  2L59 A;  4HJ2 A;  1THX A;  2H0I A;  2JAD A;  4F2I A;  4KAE A;  1WRY A;  1ZZY A;  2H1A A;  1SL2 B;  2VAF A;  3TOU A;  2YZU A;  3G7Y A;  3NIV A;  1MD3 A;  5DJM A;  4JBB A;  4F0C A;  2RLI A;  4HQZ A;  5HR0 A;  3LGC A;  3PIN A;  3VI5 A;  1OKT A;  2FWH A;  2L57 A;  4QL9 A;  3GNJ A;  4RI6 A;  1USB A;  2VM2 A;  3UBK A;  3BCK A;  3HVS A;  1F37 A;  1U6T A;  4Q5Q A;  4ULX A;  4IQA A;  4O5R A;  3KGK A;  1Y6E A;  5CO3 A;  5A4U A;  3TRQ A;  3WGX A;  4D73 B;  2PMT A;  5IMF A;  3GH6 A;  1Z3E A;  2H70 A;  4N0Z A;  2E2M A;  3KCM A;  6GSY A;  2FGX A;  3LSZ A;  5ECM B;  4KCA A;  2DIY A;  2CZ3 A;  4ACS A;  1H75 A;  2C0E A;  3TJF A;  3SBC A;  3US3 A;  2QKE A;  5ABR A;  3F6D A;  1NM3 A;  2GGT A;  3VI7 A;  3LWA A;  2GQM A;  3ZMK A;  3ZL5 A;  4PUA A;  4L5O A;  2AUV A;  4X0X A;  2V32 A;  4F82 A;  1AQX A;  3QOU A;  1BQ7 A;  1EP8 A;  1GSS A;  4O32 A;  3FR6 A;  4BVY A;  2GSR A;  1UC7 A;  2IMK A;  1TRS A;  1VF2 A;  4ZB8 A;  2CT6 A;  3LXT A;  4POB A;  4K2D A;  1K0B A;  2BMX A;  2LRN A;  5G1L A;  4IS0 A;  4TR1 A;  3L78 A;  2OKA A;  2CQ9 A;  3I69 A;  1OE8 A;  2IIY A;  2B6M A;  5IMC A;  3TKS C;  1V9W A;  2M72 A;  1G6W A;  5DQY A;  1EWX A;  2LS5 A;  1G0T A;  3ZIT A;  1A24 A;  3TKS A;  1NSW A;  5IM9 A;  5H5S A;  5L71 A;  1MEK A;  3HJP A;  2K8V A;  4KA0 A;  2E0Q A;  3ZTL A;  1GTA A;  3Q18 A;  2VD0 A;  4WXT A;  3HJO A;  3GSS A;  5IOX A;  6GSV A;  4DEJ A;  1EV9 A;  2ZCT A;  1FVJ A;  3BBY A;  4NAX A;  5JWR B;  1R5A A;  4XS6 A;  1BG5 A;  2DJJ A;  4ID0 A;  3HD5 A;  1GSQ A;  2IFQ B;  1AIU A;  1M0U A;  2WGR A;  2LJK A;  1E6B A;  3HDC A;  3IR4 A;  1VRS D;  5CNW A;  2XBQ A;  5ECL B;  4OFT A;  1EEJ A;  2DC5 A;  4ECI A;  2B7K A;  2YAN A;  4IEL A;  2H76 A;  4HDE A;  3LJR A;  2HNL A;  4IBP A;  2LNT A;  3KTB A;  4KE3 A;  4MZW A;  2LTK A;  1XXU A;  1YDK A;  2V6K A;  1PGT A;  4CHS A;  5IMD A;  4XS4 B;  1C72 A;  3RHC A;  5F05 A;  1MDI A;  2HXK A;  3EVI A;  2F8A A;  1UVZ A;  5J4U A;  2VO4 A;  1XVW A;  4YQU A;  3CXG A;  3HHV A;  5IO2 A;  1GH2 A;  3LYP A;  2PWJ A;  5IO0 A;  4GST A;  2VCX A;  5HFI A;  2OJL A;  4MJE A;  1TU8 A;  3ZRE A;  2H66 A;  4WF4 A;  1V40 A;  2GSS A;  4QQ7 A;  1ZYQ B;  2L4C A;  2AAW A;  5B6N A;  1O8W A;  3F9U A;  17GS A;  3QCP A;  1ACV A;  3VK9 A;  4HU7 A;  4I5Q A;  3KM6 A;  1GLP A;  4X1U A;  3GUS A;  5AIS A;  3KIJ A;  4BWS A;  2RII A;  4KDU A;  2CAI A;  3UJ1 A;  2X8H A;  4KCE A;  4I2T A;  3IPZ A;  4BA7 A;  4TXO B;  1TP9 A;  3IV4 A;  1ZYE A;  1EGR A;  4E8H A;  1WIK A;  4J57 E;  2OE0 A;  2VL2 C;  3DYR A;  1LJR A;  1M2B A;  1GLQ A;  3BJ5 A;  4ECC A;  2VL2 A;  4RQR A;  2O85 A;  5KN0 A;  4YAV A;  1SK1 A;  6GSW A;  5JCW A;  4L0U A;  3GKK A;  1GWC A;  1K3L A;  1ZL9 A;  3VWU A;  1A8L A;  13GS A; 
#chains in the Genus database with same CATH topology
 2PUK C;  1X0R A;  1T8E B;  2KP2 A;  3IAM 2;  2FD3 A;  1M3J A;  1B48 A;  4EDZ A;  3L0H A;  1IYH A;  3AY8 A;  3P2A A;  2R0C A;  1HNA A;  3UIW A;  4OO4 A;  4NHW A;  3TB2 A;  1TXX A;  4Q5F A;  2C0G A;  2QGV A;  3DRN A;  4PGT A;  4CY6 A;  2QSI A;  4NMU A;  1VF1 A;  1Z6N A;  5KN1 A;  2YP6 A;  2H6Z A;  6GST A;  3ME7 A;  4XS4 A;  2HSY A;  5FT3 A;  3ZFL A;  3KMO A;  3SWL A;  3DIE A;  2X99 A;  4TXV A;  3A2V A;  3A5I A;  3GTU A;  2H1D A;  3KH7 A;  5D96 A;  4HS1 A;  4ZBA A;  1GSU A;  3DVX A;  2D2Z A;  1A0R P;  2ZNM A;  2R5G A;  2PN8 A;  1GRX A;  3EE2 A;  3IA1 A;  4DSS B;  1R7H A;  4YKG A;  1DSB A;  1W89 A;  2MYG A;  2WCI A;  1J0F A;  3APS A;  4OWY A;  3EMP A;  2C0F A;  4OMV A;  2AB6 A;  1THO A;  2VUP A;  1SJZ A;  2H75 A;  1NHO A;  5G2Z A;  2HSM A;  5FWG A;  2CA8 A;  3IRA A;  1TRU A;  3EMX A;  3HZ8 A;  3TOT A;  1SU9 A;  2AV4 A;  3VPT A;  1SJ6 A;  3QFB C;  4HZ4 A;  1A8Y A;  4KGI A;  4OFM A;  1I5G A;  4F03 A;  1QGV A;  3GIX A;  1X5D A;  4TXO A;  5B8A A;  4XCS A;  3TJG A;  4ZL7 A;  3F63 A;  3MNG A;  1FB6 A;  3L9V A;  1E2Y A;  1A2L A;  2FNO A;  1QK8 A;  2JAC A;  4POK A;  1RQM A;  2GS3 A;  5JCU A;  1XVQ A;  2DKI A;  1WPI A;  2CZ2 A;  2CVB A;  4V2L A;  4XS1 A;  1AUC A;  2JZR A;  3C1R A;  2TIR A;  3FZ4 A;  3KJY A;  5ENU A;  1OVN A;  1WMJ A;  3I6A A;  4L0W A;  3LW9 A;  2GQK A;  1JFU A;  2HSH A;  2V41 A;  5F8B A;  3WT2 A;  3FZ9 A;  2IL3 A;  2RUE A;  2C0D A;  3PGT A;  3TKQ A;  3FRC A;  2FWF A;  1R26 A;  4IJ3 A;  3MSZ A;  5FHI A;  4YQV A;  10GS A;  4G0L A;  1H4O A;  2EC4 A;  1FHE A;  3CSJ A;  1S3R A;  5J9B A;  4USS A;  1X5C A;  1Y25 A;  5HQP A;  3KP9 A;  3KTL A;  1CQH A;  2YN1 A;  3GST A;  2LNS A;  5ELA A;  1YZX A;  2YCD A;  3VWW A;  4EE0 A;  2BJX A;  4TR0 A;  2OA7 A;  3ERW A;  4F9Z A;  5HR3 A;  3ZZX A;  5F0G A;  3MIX A;  3ZIV A;  1WE0 A;  2HRA A;  4FO5 A;  5DDL A;  2H6Y A;  5DCG A;  1A0F A;  4PXO A;  4TW5 A;  1BYE A;  1T3B A;  4K7I A;  2N5A A;  3DEX A;  1LBK A;  1A23 A;  3IK9 A;  5ELG A;  1ERT A;  1YQ1 A;  2Z9S A;  4DSS A;  5HR2 A;  1VF3 A;  4TOP A;  1SD9 A;  4OCF A;  1M7T A;  4JR6 A;  3HXS A;  4YKF A;  4BIK A;  1T4Y A;  2A2P A;  1FVK A;  3CTF A;  2KLX A;  1YY7 A;  2VCZ A;  3GMF A;  2DJ2 A;  2DJ1 A;  4FYB A;  3GL3 A;  2KUC A;  1SEN A;  1SJI A;  2H0H A;  3QAV A;  3CMI A;  1SYX A;  3DML A;  4K6X A;  1F6M C;  2GDR A;  5ECR B;  11GS A;  1ST9 A;  2H73 A;  4I97 A;  2H19 A;  2DJ0 A;  1B8X A;  1FB0 A;  3LFL A;  3OR5 A;  4LLR A;  1XW6 A;  5G31 A;  3ZRD A;  1GL8 A;  2R4V A;  3ERG A;  2REM A;  1FAA A;  5E4W A;  2VD1 A;  1S3C A;  2JSZ A;  2H6X A;  2CV4 A;  3TDG A;  3RPN A;  3IHG A;  8GSS A;  2H1G A;  2M46 A;  4YAP A;  5ECP B;  1ML6 A;  3GKM A;  1XOA A;  1NHY A;  5CRG A;  4RUV A;  3N9J A;  4FYC A;  2FLS A;  9GSS A;  1V2A A;  4IP6 A;  2GT6 A;  2PVQ A;  5IPG A;  2B1K A;  2AHE A;  4FH8 A;  3M0F A;  1B9X C;  1B9Y C;  4O7H A;  2B3S A;  4HI7 A;  2DIZ A;  5E59 A;  1GUK A;  3DGQ A;  3FYG A;  4MP4 A;  4N0V A;  1UA5 A;  5IOW A;  2LUS A;  4WR5 A;  5CRW A;  2GTU A;  2IMF A;  3VLN A;  2H8L A;  2EIQ A;  3UL3 A;  4L8E A;  2FA4 A;  2H74 A;  3GFK A;  4HU9 A;  4MCU A;  5CP1 A;  2VLU A;  4PNG A;  6GSU A;  1QMV A;  2K6V A;  3RHB A;  2A2R A;  3M3M A;  2GLR A;  2VCT A;  3GX8 A;  1HD2 A;  1UN2 A;  1ABA A;  2JZT A;  4WBJ A;  2YNX A;  3APQ A;  3TJB A;  3D5J A;  3E3E A;  2VLV A;  2XBI A;  1GUL A;  3A2X A;  1O73 A;  5HFK A;  4K7O A;  2H72 A;  1SK0 A;  4WEY A;  1HYU A;  1JZW A;  4K7N A;  4O5Q A;  3W8S A;  3CTG A;  5CRD A;  1W4V A;  2C8U A;  4OD7 A;  3LQ7 A;  1T1V A;  5LCZ A;  4EXJ A;  1XCC A;  3EU3 A;  1SKR B;  3HA9 A;  4JR4 A;  3VWV A;  3L9U A;  4ZL9 A;  2WZ9 A;  5IQY A;  2KOK A;  1GSY A;  4J2F A;  2L4Q A;  3PH9 A;  4KND A;  1N2A A;  1U87 A;  2B7J A;  3GA4 A;  4LL4 B;  4YQM A;  3U5R E;  4EO3 A;  4EC0 A;  2X8C A;  2PGT A;  1ERW A;  2I9H A;  1FG4 A;  4ECJ A;  3I43 A;  3L4N A;  3D21 A;  3H8Q A;  3LG6 A;  4Z7X A;  4OO5 A;  1HQO A;  1G7O A;  4IQ1 A;  3FHK A;  3UVT A;  1JZR A;  5JCG A;  1TRV A;  2FHE A;  4MAB A;  3KD0 A;  3GTU B;  4HUA A;  2A4V A;  5BRT A;  1RK4 A;  5D93 A;  2E7P A;  5IMZ A;  1BAY A;  3IAS 2;  3HZ4 A;  4FYU A;  1OYJ A;  3IC8 A;  2HRF A;  1K3Y A;  3GH9 A;  2YOI A;  1M99 A;  5AIX A;  4BL7 B;  4K8M A;  3H1N A;  1URM A;  2B5Y A;  1GTB A;  2X8G A;  3DWV A;  3Q6O A;  2CVD A;  5DAL B;  2AJQ B;  2P0G A;  4Q5R A;  5ECQ B;  1EGO A;  2H0G A;  2TRC P;  2L5L A;  5ID2 B;  4NXI A;  4I2U A;  1Z7R A;  1GP1 A;  3V1W A;  4G10 A;  1GNE A;  1GSE A;  5HFG A;  1S3D A;  2MMO A;  3H4K A;  3HY2 A;  2HT9 A;  4POL A;  4PNF A;  1EP7 A;  2VLT A;  2L5O A;  4AJ6 A;  1XPV A;  4KF9 A;  5CAX A;  1TKD B;  1ZOF A;  3KMN A;  2ES7 A;  4ILF A;  2N5F A;  3TKP A;  3LXZ A;  1AC1 A;  2P5Q A;  1PMT A;  3WD6 A;  2YPM A;  3DKS A;  1ZYN A;  2YJH A;  3APO A;  4KB3 A;  5B6M A;  2YWN A;  3VUR A;  3QAG A;  3PPU A;  1KBN A;  3IDV A;  1XW5 A;  4IHU A;  3CRU A;  2KP1 A;  2OE1 A;  4XRA A;  5DVB A;  2F8F A;  5HR1 A;  2EIR A;  4CW9 A;  4EIP A;  4JU5 A;  4WF5 A;  4KW6 A;  4ZL8 A;  2A4H A;  3O76 A;  4Q5N A;  1OC3 A;  1VF4 A;  2X64 A;  2MBT A;  1J08 A;  1ERU A;  5AIV A;  2AYT A;  5J3R A;  3F6F A;  3H79 A;  2BTO T;  1GUM A;  2VOC A;  3FW2 A;  4X4J A;  1O85 A;  3EWL A;  4WKW A;  5J5N A;  4XRD A;  1PL1 A;  1GSD A;  3D4T A;  1O6J A;  2JU5 A;  3DD3 A;  4ZB6 A;  4MMM A;  2MZC A;  2PU9 C;  4JZQ A;  3R2Q A;  3BCI A;  4RI7 A;  1V98 A;  4N11 A;  4ZIL A;  3F3Q A;  5AGY A;  2V6O A;  2WRT A;  5IMV A;  2LJA A;  3IE3 A;  2GSQ A;  2LQO A;  2H01 A;  1K3O A;  4IP1 A;  1OAZ A;  2YWM A;  4MH2 A;  1AW9 A;  2ON5 A;  3F3R A;  1PL2 A;  5ECO B;  2I4A A;  1B4P A;  5INY A;  2CX3 A;  2H30 A;  1U3A A;  5G5E A;  1TK0 B;  4BL7 A;  2J23 A;  3TCO A;  3F4S A;  3QDN A;  3O6T A;  4ZIJ A;  3FR3 A;  5J9C A;  1V57 A;  3EU4 A;  5DAL A;  1PD2 1;  3CBU A;  4IW9 A;  1YKC A;  2LRT A;  3C71 A;  2RUF A;  5ID2 A;  4MLY A;  1F9M A;  3K8N A;  4K2X A;  2GQL A;  4PQH A;  1FOV A;  2N5B A;  2O87 A;  4MJC A;  2GZP A;  3TRP A;  1TU7 A;  3Q19 A;  2P31 A;  1DBY A;  4GRF A;  4K0G A;  1TRW A;  4XHM A;  4TR4 A;  3CSH A;  3VWX A;  4RQX A;  3WGD A;  4EL1 A;  5ECS A;  2NTO A;  19GS A;  3GRX A;  1ZMA A;  2TRX A;  1BED A;  1KEB A;  2G2Q A;  4LA1 A;  1G6Y A;  4G19 A;  4PTS A;  4IJI A;  3ZVJ A;  1GSF A;  2GT5 A;  4L5L A;  4MNN A;  3EC3 A;  2C80 A;  5G30 A;  2HFD A;  2YWO A;  5JWQ B;  3GKX A;  3RBT A;  1Z5Y E;  3IOS A;  1OE7 A;  1OC9 B;  3HCZ A;  5COH A;  3RAZ A;  5D9W A;  1QXH A;  3TGZ A;  2HZE A;  5GAN D;  3D0Z A;  1EOH A;  2DMM A;  1PSQ A;  1X9W B;  2J9H A;  2LKU A;  1XFL A;  2XHF A;  1TK8 B;  1PN0 A;  1AAZ A;  4G2E A;  3IBH A;  2DSA A;  4TVE A;  3P90 A;  3UVH A;  2LRC A;  5LNK e;  1YF1 A;  4XIH A;  2MBS A;  4TN8 A;  2JL4 A;  1YF0 A;  2R0P A;  3RPP A;  3ZIJ A;  2O89 A;  5ECK B;  1K0C A;  2ZUP A;  3ZYW A;  1EEM A;  1MTC A;  1FW1 A;  1OKD A;  4GXZ A;  2OAD A;  2E2G A;  4MJA A;  2K8S A;  4MF5 A;  4LMV A;  4FQU A;  4NV2 A;  5ECH B;  2NDO A;  5CRH A;  2HI7 A;  1YEX A;  1XWC A;  5ECI B;  3CYN A;  3L9S A;  4E8E A;  1OC8 A;  2MMZ A;  2YV7 A;  3HVV A;  4O92 A;  4NV5 A;  5D9V A;  1TW9 A;  1M9A A;  3C8E A;  3E0U A;  4YH2 A;  5H5R A;  2KHP A;  1XW9 A;  2LJR A;  2NVL A;  1XIY A;  1ON4 A;  4MDC A;  2WS2 A;  3QR6 A;  1DE1 A;  3FK8 A;  3RDW A;  2YZH A;  4KUN A;  1Z6M A;  2CAQ A;  4AJ8 A;  4DSQ A;  1FO5 A;  2K18 A;  1X5E A;  4DSR A;  4JE1 A;  1XWK A;  4N30 A;  1TK5 B;  3F8U A;  3UOM A;  2A2S A;  4GF0 A;  5DJL A;  3GN3 A;  3KZQ A;  1GNW A;  4GSS A;  4QL7 A;  4K5S A;  4OFN A;  1IYI A;  4I8B A;  20GS A;  4X43 A;  2C1Y A;  2L6C A;  3W8J A;  1FOH A;  3GKN A;  1XWB A;  2OBI A;  4PQI A;  2GST A;  5KN2 A;  3TKR A;  1WP0 A;  4K9Z A;  3WGE A;  4PUF C;  3G9B A;  2H1B A;  1PA3 A;  2C3Q A;  4PX1 A;  2RM6 A;  4J56 E;  3NOF A;  3QMX A;  1XOB A;  3ED3 A;  1PRX A;  3IC4 A;  1YKA A;  1Z9H A;  2MMN A;  4V2M A;  1KNG A;  3TKS E;  4BWQ A;  1AQV A;  2IN3 A;  1K0M A;  4MF7 A;  1T7P B;  3S9F A;  1OC9 A;  2GZZ A;  2IME A;  2PER A;  5A4W A;  1ERV A;  4WET A;  5LD0 A;  4EF0 A;  3WT1 A;  1JLV A;  3C7M A;  2VIM A;  2IPA A;  5JWO B;  3ISO A;  2OBK A;  2C4J A;  4ML1 A;  4PQ1 A;  3ERF A;  2PPT A;  3A3T A;  2VCQ A;  4NHZ A;  5D73 A;  2IJY A;  1F2E A;  1X9S B;  4NWY A;  6GSS A;  1A2J A;  2FUG 2;  2M80 A;  4P3Y B;  3UAR A;  1AXD A;  3QD9 A;  3GV1 A;  3WYW A;  4KSM A;  5EVO A;  4MF6 A;  1XG8 A;  5C04 A;  2VCW A;  3UEM A;  3NZN A;  14GS A;  1EOG A;  5A4V A;  4HEA 2;  4K0N A;  4LMW A;  3F0I A;  3M1G A;  1U88 A;  2DML A;  4LL1 B;  1QUW A;  2IMD A;  1O7U A;  1SL0 B;  4EKZ A;  2QA1 A;  3BD2 A;  2B5X A;  5CRE A;  1MDK A;  1K0O A;  1A2M A;  1J9B A;  3MDK A;  1TTZ A;  5IMA A;  1JZO A;  3HYP A;  4WBR D;  4AJ7 A;  4PUR A;  4MZB A;  3D22 A;  3MWH A;  3ZFB A;  4MA9 A;  2OAC A;  3ZLP A;  5GAP D;  4MPF A;  2VCV A;  4IGJ A;  1K0N A;  4KDY A;  2R2J A;  1R5P A;  1U3I A;  1DE2 A;  4Z2U A;  3C73 A;  3R3E A;  2WDU A;  3G7J A;  2DJK A;  2HZF A;  4D73 A;  4GCI A;  3GL5 A;  2O8V B;  5F07 A;  3EUR A;  5F06 A;  1PQN A;  5BMU A;  4V1A g;  2PVO C;  1PX7 A;  3IHQ A;  1R4W A;  1ZCP A;  4V1A p;  5EPF A;  1SK2 A;  1O81 A;  4AF2 A;  5A5K A;  3LOR A;  1B4Q A;  4KDX A;  2DLX A;  4MK3 A;  1VGL A;  1NW2 A;  3GX0 A;  2VL3 A;  3GYK A;  4KX4 A;  3KEB A;  1ZYP A;  3LYK A;  4KSO A;  3UBL A;  1XBS A;  2HRK A;  2NBS A;  2LQQ A;  4HOJ A;  2FY6 A;  3W6G A;  3EIN A;  22GS A;  2YWI A;  4V2N A;  5KEJ A;  3C1S A;  2X49 A;  2IMI A;  1SL1 B;  4NPB A;  3TUE A;  1ILO A;  1CQG A;  5KOX A;  3HJM A;  2GVP A;  3IXR A;  3MAK A;  1F3B A;  5KN3 A;  3FKF A;  1SD8 A;  2O7K A;  2CVK A;  1X9M B;  2I1U A;  2F3M A;  5EY6 A;  4ECB A;  12GS A;  4AGS A;  2JZS A;  2QA2 A;  4TR3 A;  2HE3 A;  3IK7 A;  4TKY A;  2WJU A;  2F9S A;  2NPB A;  3J7Y b;  16GS A;  4GWR A;  1QQ2 A;  1N8J A;  3LEF A;  4ZBB A;  5D9T A;  4OCE A;  5DBQ A;  2L6D A;  2LST A;  2F51 A;  5ECN B;  3UAP A;  3ZML A;  3M8N A;  5GST A;  6GSX A;  2LV3 A;  4O5U A;  2FWG A;  2C3N A;  3KH9 A;  2I81 A;  1I9D A;  4BPY A;  1HNB A;  1GTU A;  1ZGN A;  2R3X A;  1TDI A;  2IWT A;  2B1L A;  3UMA A;  3A2W A;  1MDJ A;  4IVF A;  5J41 A;  2QC7 A;  2OE3 A;  1Q98 A;  3QPM A;  2EIO A;  5D8I A;  4BVX B;  3TRX A;  5B8B A;  1GUH A;  1MD4 A;  4MH3 A;  1O8X A;  3M9K A;  1RW1 A;  4EVM A;  1QFN A;  4GLT A;  2YJ7 A;  4TRX A;  4ZXG A;  1Z7P A;  2ALB A;  3TJK A;  4A5P A;  2HZE B;  1AQW A;  2DBC A;  1YJ6 A;  3TJJ A;  2V1M A;  4Z2T A;  2HLS A;  2FCH A;  2IFQ A;  1T4Z A;  2G0F A;  4ZB9 A;  2HYX A;  1F3A A;  3EYT A;  3HVX A;  4HSC X;  5D9X A;  2RM5 A;  5DAK B;  3Q74 A;  4POM A;  1PFO A;  5AN1 A;  3FY7 A;  4ML6 A;  4ISD A;  2I3Y A;  5DCH A;  2MMA A;  5G1K A;  1M2A A;  4GTU A;  1PKZ A;  2FA8 A;  5H5Q A;  1M2D A;  3G7I A;  3E9J B;  3CRT A;  3VPQ A;  4K1F A;  2JSY A;  3EPT A;  3O3T A;  4I6X A;  1TI3 A;  2P5R A;  3ME8 A;  1TI1 A;  18GS A;  3PR8 A;  4JED A;  2H71 A;  3KP8 A;  3D4M A;  2VL9 A;  1SYR A;  5DQS A;  1JLW A;  1WOU A;  7GSS A;  3I9V 2;  2CX4 A;  1GTI A;  4HZ2 A;  4EUY A;  4XTS A;  2WFC A;  5CYY A;  2ON7 A;  1K0A A;  3VFI A;  3N5O A;  4H86 A;  3DXB A;  3F4T A;  2WUL A;  2YV9 A;  3FEU A;  4GQF A;  1WWJ A;  2XC2 A;  1EZK A;  5EL8 A;  2GZY A;  4HQS A;  1BX9 A;  3A5W A;  4FIW A;  4EDY A;  4N10 A;  4MJB A;  3GUR A;  1YEP A;  3P7X A;  1M9B A;  1V58 A;  3D6I A;  1SKW B;  2FWE A;  1K0D A;  3ZVJ D;  2LEG A;  1WJK A;  1SKS B;  3J7Y k;  3FZA A;  3HKR A;  5G5F A;  3QFA C;  3QAW A;  4WR4 A;  4MPG A;  5KOW A;  2XPE A;  1G7E A;  3FZ5 A;  4GQC A;  2C3T A;  4IKH A;  2DJ3 A;  1T00 A;  4BVX A;  3CSI A;  1XWA A;  5IPH A;  2XPD A;  1PN9 A;  1JZD A;  4HJM A;  4IN0 A;  4MZC A;  4CY8 A;  4G9H A;  1S3A A;  4F0B A;  1Q4J A;  3U6V A;  5B7C A;  1TOF A;  5C00 A;  2K9F A;  3GHA A;  1JHB A;  1XWG A;  3M9J A;  3JCM L;  1KTE A;  2R37 A;  1LU4 A;  1PKW A;  2R6K A;  4DVC A;  4CDO A;  5GSS A;  2V2G A;  2PBJ A;  3DVW A;  3KXO A;  5GZZ B;  4BVY B;  1EV4 A;  4ZBD A;  1TJD A;  2WB9 A;  3H93 A;  4GSN A;  3FR9 A;  5DAK A;  4KH7 A;  3BOA A;  3F4R A;  1XZO A;  1BJX A;  1HNC A;  2VM1 A;  4ICY A;  2HRN A;  1PX6 A;  2B5E A;  4TR1 B;  1DUG A;  5IIZ A;  4JRR A;  3P8W A;  3HVN A;  2L59 A;  4EIQ A;  4HJ2 A;  1THX A;  2H0I A;  2JAD A;  4F2I A;  4KAE A;  1WRY A;  1ZZY A;  2H1A A;  1SL2 B;  2VAF A;  3TOU A;  2YZU A;  3G7Y A;  3NIV A;  1MD3 A;  5DJM A;  4JBB A;  4F0C A;  2RLI A;  4HQZ A;  5HR0 A;  3LGC A;  3PIN A;  3VI5 A;  1OKT A;  4G0K A;  2FWH A;  2L57 A;  4QL9 A;  3GNJ A;  4RI6 A;  1USB A;  2VM2 A;  3UBK A;  3BCK A;  3HVS A;  1F37 A;  1U6T A;  4Q5Q A;  4ULX A;  4IQA A;  4O5R A;  3KGK A;  1Y6E A;  5CO3 A;  5A4U A;  3TRQ A;  3WGX A;  4D73 B;  2PMT A;  5IMF A;  3GH6 A;  1Z3E A;  2H70 A;  4N0Z A;  2E2M A;  3KCM A;  6GSY A;  2FGX A;  3LSZ A;  5ECM B;  4KCA A;  2DIY A;  2CZ3 A;  4ACS A;  1H75 A;  2C0E A;  3TJF A;  3SBC A;  3US3 A;  2QKE A;  4K5R A;  5ABR A;  3F6D A;  1NM3 A;  2GGT A;  3VI7 A;  3LWA A;  2GQM A;  3ZMK A;  3ZL5 A;  4PUA A;  1M3I A;  4L5O A;  2AUV A;  4X0X A;  2V32 A;  4F82 A;  1AQX A;  3QOU A;  1BQ7 A;  1EP8 A;  1GSS A;  4O32 A;  3FR6 A;  4BVY A;  2GSR A;  1UC7 A;  2IMK A;  1TRS A;  1VF2 A;  4ZB8 A;  2CT6 A;  3LXT A;  4POB A;  4K2D A;  1K0B A;  2BMX A;  2LRN A;  5G1L A;  4IS0 A;  4TR1 A;  3L78 A;  2OKA A;  2CQ9 A;  3I69 A;  1OE8 A;  2IIY A;  2B6M A;  5IMC A;  3TKS C;  1V9W A;  2M72 A;  1G6W A;  5DQY A;  1EWX A;  2LS5 A;  1G0T A;  3FMW A;  3ZIT A;  1A24 A;  3TKS A;  1NSW A;  5IM9 A;  5H5S A;  5L71 A;  1MEK A;  3HJP A;  2K8V A;  4KA0 A;  2E0Q A;  3ZTL A;  1GTA A;  3Q18 A;  2VD0 A;  3MYD A;  4WXT A;  3HJO A;  3GSS A;  5IOX A;  6GSV A;  4DEJ A;  1EV9 A;  2ZCT A;  1FVJ A;  3BBY A;  4NAX A;  5JWR B;  1R5A A;  4XS6 A;  1BG5 A;  2DJJ A;  4ID0 A;  3HD5 A;  1GSQ A;  2IFQ B;  1AIU A;  1M0U A;  2WGR A;  2LJK A;  1E6B A;  4Z2R A;  3HDC A;  3IR4 A;  1VRS D;  5CNW A;  2XBQ A;  5ECL B;  4OFT A;  1EEJ A;  2DC5 A;  4ECI A;  2B7K A;  2YAN A;  4IEL A;  2H76 A;  4HDE A;  3LJR A;  2HNL A;  4IBP A;  2LNT A;  3KTB A;  4KE3 A;  4MZW A;  2LTK A;  1XXU A;  1YDK A;  2V6K A;  1PGT A;  4CHS A;  5IMD A;  4XS4 B;  1C72 A;  3RHC A;  5F05 A;  1MDI A;  2HXK A;  3EVI A;  2F8A A;  1UVZ A;  5J4U A;  2VO4 A;  1XVW A;  4YQU A;  3CXG A;  3HHV A;  5IO2 A;  1GH2 A;  3LYP A;  2PWJ A;  5IO0 A;  2X4A A;  2DKH A;  4GST A;  2VCX A;  5HFI A;  2OJL A;  4MJE A;  1TU8 A;  3ZRE A;  2H66 A;  4WF4 A;  1V40 A;  2GSS A;  4QQ7 A;  1ZYQ B;  2L4C A;  2AAW A;  5B6N A;  1O8W A;  3F9U A;  17GS A;  3QCP A;  1ACV A;  3VK9 A;  4HU7 A;  4I5Q A;  3KM6 A;  1GLP A;  4X1U A;  3GUS A;  5AIS A;  3KIJ A;  4BWS A;  2RII A;  4KDU A;  2CAI A;  3UJ1 A;  2X8H A;  4KCE A;  4I2T A;  3IPZ A;  4BA7 A;  2UZ8 A;  4TXO B;  1TP9 A;  3IV4 A;  1ZYE A;  1EGR A;  4E8H A;  1WIK A;  4J57 E;  2OE0 A;  2VL2 C;  3DYR A;  1LJR A;  1M2B A;  2R0G A;  1GLQ A;  3BJ5 A;  4ECC A;  2VL2 A;  4RQR A;  2O85 A;  4G0I A;  5KN0 A;  4YAV A;  1SK1 A;  6GSW A;  5JCW A;  4L0U A;  3GKK A;  1GWC A;  1K3L A;  1ZL9 A;  3VWU A;  1A8L A;  13GS A;  3CQF A; 
#chains in the Genus database with same CATH homology
 2PUK C;  1X0R A;  1T8E B;  2KP2 A;  3IAM 2;  2FD3 A;  1B48 A;  4EDZ A;  3L0H A;  1IYH A;  3AY8 A;  3P2A A;  2R0C A;  1HNA A;  3UIW A;  4OO4 A;  4NHW A;  3TB2 A;  1TXX A;  4Q5F A;  2C0G A;  2QGV A;  3DRN A;  4PGT A;  4CY6 A;  2QSI A;  4NMU A;  1VF1 A;  1Z6N A;  5KN1 A;  2YP6 A;  2H6Z A;  6GST A;  3ME7 A;  4XS4 A;  2HSY A;  5FT3 A;  3ZFL A;  3KMO A;  3SWL A;  3DIE A;  2X99 A;  4TXV A;  3A2V A;  3A5I A;  3GTU A;  2H1D A;  3KH7 A;  5D96 A;  4HS1 A;  4ZBA A;  1GSU A;  3DVX A;  2D2Z A;  1A0R P;  2ZNM A;  2R5G A;  2PN8 A;  1GRX A;  3EE2 A;  3IA1 A;  4DSS B;  1R7H A;  4YKG A;  1DSB A;  1W89 A;  2MYG A;  2WCI A;  1J0F A;  3APS A;  4OWY A;  3EMP A;  2C0F A;  4OMV A;  2AB6 A;  1THO A;  2VUP A;  1SJZ A;  2H75 A;  1NHO A;  5G2Z A;  2HSM A;  5FWG A;  2CA8 A;  3IRA A;  1TRU A;  3EMX A;  3HZ8 A;  3TOT A;  1SU9 A;  2AV4 A;  3VPT A;  1SJ6 A;  3QFB C;  4HZ4 A;  1A8Y A;  4KGI A;  4OFM A;  1I5G A;  4F03 A;  1QGV A;  3GIX A;  1X5D A;  4TXO A;  5B8A A;  4XCS A;  3TJG A;  4ZL7 A;  3F63 A;  3MNG A;  1FB6 A;  3L9V A;  1E2Y A;  1A2L A;  2FNO A;  1QK8 A;  2JAC A;  4POK A;  1RQM A;  2GS3 A;  5JCU A;  1XVQ A;  2DKI A;  1WPI A;  2CZ2 A;  2CVB A;  4V2L A;  4XS1 A;  1AUC A;  2JZR A;  3C1R A;  2TIR A;  3FZ4 A;  3KJY A;  5ENU A;  1OVN A;  1WMJ A;  3I6A A;  4L0W A;  3LW9 A;  2GQK A;  1JFU A;  2HSH A;  2V41 A;  5F8B A;  3WT2 A;  3FZ9 A;  2IL3 A;  2RUE A;  2C0D A;  3PGT A;  3TKQ A;  3FRC A;  2FWF A;  1R26 A;  4IJ3 A;  3MSZ A;  5FHI A;  4YQV A;  10GS A;  4G0L A;  1H4O A;  2EC4 A;  1FHE A;  3CSJ A;  5J9B A;  4USS A;  1X5C A;  1Y25 A;  5HQP A;  3KP9 A;  3KTL A;  1CQH A;  2YN1 A;  3GST A;  2LNS A;  5ELA A;  1YZX A;  2YCD A;  3VWW A;  4EE0 A;  2BJX A;  4TR0 A;  2OA7 A;  3ERW A;  4F9Z A;  5HR3 A;  3ZZX A;  5F0G A;  3MIX A;  3ZIV A;  1WE0 A;  2HRA A;  4FO5 A;  5DDL A;  2H6Y A;  5DCG A;  1A0F A;  4PXO A;  4TW5 A;  1BYE A;  1T3B A;  4K7I A;  2N5A A;  3DEX A;  1LBK A;  1A23 A;  3IK9 A;  5ELG A;  1ERT A;  1YQ1 A;  2Z9S A;  4DSS A;  5HR2 A;  1VF3 A;  4TOP A;  1SD9 A;  4OCF A;  1M7T A;  4JR6 A;  3HXS A;  4YKF A;  1T4Y A;  2A2P A;  1FVK A;  3CTF A;  2KLX A;  1YY7 A;  2VCZ A;  3GMF A;  2DJ2 A;  2DJ1 A;  4FYB A;  3GL3 A;  2KUC A;  1SEN A;  1SJI A;  2H0H A;  3QAV A;  3CMI A;  1SYX A;  3DML A;  4K6X A;  1F6M C;  2GDR A;  5ECR B;  11GS A;  1ST9 A;  2H73 A;  4I97 A;  2H19 A;  2DJ0 A;  1B8X A;  1FB0 A;  3LFL A;  3OR5 A;  4LLR A;  1XW6 A;  5G31 A;  3ZRD A;  1GL8 A;  2R4V A;  3ERG A;  2REM A;  1FAA A;  5E4W A;  2VD1 A;  1S3C A;  2JSZ A;  2H6X A;  2CV4 A;  3TDG A;  3RPN A;  3IHG A;  8GSS A;  2H1G A;  2M46 A;  4YAP A;  5ECP B;  1ML6 A;  3GKM A;  1XOA A;  1NHY A;  5CRG A;  4RUV A;  3N9J A;  4FYC A;  2FLS A;  9GSS A;  1V2A A;  4IP6 A;  2GT6 A;  2PVQ A;  5IPG A;  2B1K A;  2AHE A;  4FH8 A;  3M0F A;  1B9X C;  1B9Y C;  4O7H A;  2B3S A;  4HI7 A;  2DIZ A;  5E59 A;  1GUK A;  3DGQ A;  3FYG A;  4MP4 A;  4N0V A;  1UA5 A;  5IOW A;  2LUS A;  4WR5 A;  5CRW A;  2GTU A;  2IMF A;  3VLN A;  2H8L A;  2EIQ A;  3UL3 A;  4L8E A;  2FA4 A;  2H74 A;  3GFK A;  4HU9 A;  4MCU A;  5CP1 A;  2VLU A;  4PNG A;  6GSU A;  1QMV A;  2K6V A;  3RHB A;  2A2R A;  3M3M A;  2GLR A;  2VCT A;  3GX8 A;  1HD2 A;  1UN2 A;  1ABA A;  2JZT A;  4WBJ A;  2YNX A;  3APQ A;  3TJB A;  3D5J A;  3E3E A;  2VLV A;  2XBI A;  1GUL A;  3A2X A;  1O73 A;  5HFK A;  4K7O A;  2H72 A;  1SK0 A;  4WEY A;  1HYU A;  1JZW A;  4K7N A;  4O5Q A;  3W8S A;  3CTG A;  5CRD A;  1W4V A;  2C8U A;  4OD7 A;  3LQ7 A;  1T1V A;  5LCZ A;  4EXJ A;  1XCC A;  3EU3 A;  1SKR B;  3HA9 A;  4JR4 A;  3VWV A;  3L9U A;  4ZL9 A;  2WZ9 A;  5IQY A;  2KOK A;  1GSY A;  4J2F A;  2L4Q A;  3PH9 A;  4KND A;  1N2A A;  1U87 A;  2B7J A;  3GA4 A;  4LL4 B;  4YQM A;  3U5R E;  4EO3 A;  4EC0 A;  2X8C A;  2PGT A;  1ERW A;  2I9H A;  1FG4 A;  4ECJ A;  3I43 A;  3L4N A;  3D21 A;  3H8Q A;  3LG6 A;  4Z7X A;  4OO5 A;  1HQO A;  1G7O A;  4IQ1 A;  3FHK A;  3UVT A;  1JZR A;  5JCG A;  1TRV A;  2FHE A;  4MAB A;  3KD0 A;  3GTU B;  4HUA A;  2A4V A;  5BRT A;  1RK4 A;  5D93 A;  2E7P A;  5IMZ A;  1BAY A;  3IAS 2;  3HZ4 A;  4FYU A;  1OYJ A;  3IC8 A;  2HRF A;  1K3Y A;  3GH9 A;  2YOI A;  1M99 A;  5AIX A;  4BL7 B;  4K8M A;  3H1N A;  1URM A;  2B5Y A;  1GTB A;  2X8G A;  3DWV A;  3Q6O A;  2CVD A;  5DAL B;  2AJQ B;  2P0G A;  4Q5R A;  5ECQ B;  1EGO A;  2H0G A;  2TRC P;  2L5L A;  5ID2 B;  4NXI A;  4I2U A;  1Z7R A;  1GP1 A;  3V1W A;  4G10 A;  1GNE A;  1GSE A;  5HFG A;  1S3D A;  2MMO A;  3H4K A;  3HY2 A;  2HT9 A;  4POL A;  4PNF A;  1EP7 A;  2VLT A;  2L5O A;  4AJ6 A;  1XPV A;  4KF9 A;  5CAX A;  1TKD B;  1ZOF A;  3KMN A;  2ES7 A;  4ILF A;  2N5F A;  3TKP A;  3LXZ A;  1AC1 A;  2P5Q A;  1PMT A;  3WD6 A;  2YPM A;  3DKS A;  1ZYN A;  2YJH A;  3APO A;  4KB3 A;  5B6M A;  2YWN A;  3VUR A;  3QAG A;  3PPU A;  1KBN A;  3IDV A;  1XW5 A;  4IHU A;  3CRU A;  2KP1 A;  2OE1 A;  4XRA A;  5DVB A;  2F8F A;  5HR1 A;  2EIR A;  4CW9 A;  4EIP A;  4JU5 A;  4WF5 A;  4KW6 A;  4ZL8 A;  2A4H A;  3O76 A;  4Q5N A;  1OC3 A;  1VF4 A;  2X64 A;  2MBT A;  1J08 A;  1ERU A;  5AIV A;  2AYT A;  5J3R A;  3F6F A;  3H79 A;  2BTO T;  1GUM A;  2VOC A;  3FW2 A;  4X4J A;  1O85 A;  3EWL A;  4WKW A;  5J5N A;  4XRD A;  1PL1 A;  1GSD A;  3D4T A;  1O6J A;  2JU5 A;  3DD3 A;  4ZB6 A;  4MMM A;  2MZC A;  2PU9 C;  4JZQ A;  3R2Q A;  3BCI A;  4RI7 A;  1V98 A;  4N11 A;  4ZIL A;  3F3Q A;  5AGY A;  2V6O A;  2WRT A;  5IMV A;  2LJA A;  3IE3 A;  2GSQ A;  2LQO A;  2H01 A;  1K3O A;  4IP1 A;  1OAZ A;  2YWM A;  4MH2 A;  1AW9 A;  2ON5 A;  3F3R A;  1PL2 A;  5ECO B;  2I4A A;  1B4P A;  5INY A;  2CX3 A;  2H30 A;  1U3A A;  5G5E A;  1TK0 B;  4BL7 A;  2J23 A;  3TCO A;  3F4S A;  3QDN A;  3O6T A;  4ZIJ A;  3FR3 A;  5J9C A;  1V57 A;  3EU4 A;  5DAL A;  1PD2 1;  3CBU A;  4IW9 A;  1YKC A;  2LRT A;  3C71 A;  2RUF A;  5ID2 A;  4MLY A;  1F9M A;  3K8N A;  4K2X A;  2GQL A;  4PQH A;  1FOV A;  2N5B A;  2O87 A;  4MJC A;  2GZP A;  3TRP A;  1TU7 A;  3Q19 A;  2P31 A;  1DBY A;  4GRF A;  4K0G A;  1TRW A;  4XHM A;  4TR4 A;  3CSH A;  3VWX A;  4RQX A;  3WGD A;  4EL1 A;  5ECS A;  2NTO A;  19GS A;  3GRX A;  1ZMA A;  2TRX A;  1BED A;  1KEB A;  2G2Q A;  4LA1 A;  1G6Y A;  4G19 A;  4PTS A;  4IJI A;  3ZVJ A;  1GSF A;  2GT5 A;  4L5L A;  4MNN A;  3EC3 A;  2C80 A;  5G30 A;  2HFD A;  2YWO A;  5JWQ B;  3GKX A;  3RBT A;  1Z5Y E;  3IOS A;  1OE7 A;  1OC9 B;  3HCZ A;  5COH A;  3RAZ A;  5D9W A;  1QXH A;  3TGZ A;  2HZE A;  5GAN D;  3D0Z A;  1EOH A;  2DMM A;  1PSQ A;  1X9W B;  2J9H A;  2LKU A;  1XFL A;  2XHF A;  1TK8 B;  1PN0 A;  1AAZ A;  4G2E A;  3IBH A;  2DSA A;  4TVE A;  3P90 A;  3UVH A;  2LRC A;  5LNK e;  1YF1 A;  4XIH A;  2MBS A;  4TN8 A;  2JL4 A;  1YF0 A;  2R0P A;  3RPP A;  3ZIJ A;  2O89 A;  5ECK B;  1K0C A;  2ZUP A;  3ZYW A;  1EEM A;  1MTC A;  1FW1 A;  1OKD A;  4GXZ A;  2OAD A;  2E2G A;  4MJA A;  2K8S A;  4MF5 A;  4LMV A;  4FQU A;  4NV2 A;  5ECH B;  2NDO A;  5CRH A;  2HI7 A;  1YEX A;  1XWC A;  5ECI B;  3CYN A;  3L9S A;  4E8E A;  1OC8 A;  2MMZ A;  2YV7 A;  3HVV A;  4O92 A;  4NV5 A;  5D9V A;  1TW9 A;  1M9A A;  3C8E A;  3E0U A;  4YH2 A;  5H5R A;  2KHP A;  1XW9 A;  2LJR A;  2NVL A;  1XIY A;  1ON4 A;  4MDC A;  2WS2 A;  3QR6 A;  1DE1 A;  3FK8 A;  3RDW A;  2YZH A;  4KUN A;  1Z6M A;  2CAQ A;  4AJ8 A;  4DSQ A;  1FO5 A;  2K18 A;  1X5E A;  4DSR A;  4JE1 A;  1XWK A;  4N30 A;  1TK5 B;  3F8U A;  3UOM A;  2A2S A;  4GF0 A;  5DJL A;  3GN3 A;  3KZQ A;  1GNW A;  4GSS A;  4QL7 A;  4K5S A;  4OFN A;  1IYI A;  4I8B A;  20GS A;  4X43 A;  2C1Y A;  2L6C A;  3W8J A;  1FOH A;  3GKN A;  1XWB A;  2OBI A;  4PQI A;  2GST A;  5KN2 A;  3TKR A;  1WP0 A;  4K9Z A;  3WGE A;  4PUF C;  3G9B A;  2H1B A;  1PA3 A;  2C3Q A;  4PX1 A;  2RM6 A;  4J56 E;  3NOF A;  3QMX A;  1XOB A;  3ED3 A;  1PRX A;  3IC4 A;  1YKA A;  1Z9H A;  2MMN A;  4V2M A;  1KNG A;  3TKS E;  4BWQ A;  1AQV A;  2IN3 A;  1K0M A;  4MF7 A;  1T7P B;  3S9F A;  1OC9 A;  2GZZ A;  2IME A;  2PER A;  5A4W A;  1ERV A;  4WET A;  5LD0 A;  4EF0 A;  3WT1 A;  1JLV A;  3C7M A;  2VIM A;  2IPA A;  5JWO B;  3ISO A;  2OBK A;  2C4J A;  4ML1 A;  4PQ1 A;  3ERF A;  2PPT A;  3A3T A;  2VCQ A;  4NHZ A;  5D73 A;  2IJY A;  1F2E A;  1X9S B;  4NWY A;  6GSS A;  1A2J A;  2FUG 2;  2M80 A;  4P3Y B;  3UAR A;  1AXD A;  3QD9 A;  3GV1 A;  3WYW A;  4KSM A;  5EVO A;  4MF6 A;  5C04 A;  2VCW A;  3UEM A;  3NZN A;  14GS A;  1EOG A;  5A4V A;  4HEA 2;  4K0N A;  4LMW A;  3F0I A;  3M1G A;  1U88 A;  2DML A;  4LL1 B;  1QUW A;  2IMD A;  1O7U A;  1SL0 B;  4EKZ A;  2QA1 A;  3BD2 A;  2B5X A;  5CRE A;  1MDK A;  1K0O A;  1A2M A;  1J9B A;  3MDK A;  1TTZ A;  5IMA A;  1JZO A;  3HYP A;  4WBR D;  4AJ7 A;  4PUR A;  4MZB A;  3D22 A;  3MWH A;  3ZFB A;  4MA9 A;  2OAC A;  3ZLP A;  5GAP D;  4MPF A;  2VCV A;  4IGJ A;  1K0N A;  4KDY A;  2R2J A;  1R5P A;  1U3I A;  1DE2 A;  4Z2U A;  3C73 A;  3R3E A;  2WDU A;  3G7J A;  2DJK A;  2HZF A;  4D73 A;  4GCI A;  3GL5 A;  2O8V B;  5F07 A;  3EUR A;  5F06 A;  1PQN A;  5BMU A;  4V1A g;  2PVO C;  1PX7 A;  3IHQ A;  1R4W A;  1ZCP A;  4V1A p;  5EPF A;  1SK2 A;  1O81 A;  4AF2 A;  5A5K A;  3LOR A;  1B4Q A;  4KDX A;  2DLX A;  4MK3 A;  1VGL A;  1NW2 A;  3GX0 A;  2VL3 A;  3GYK A;  4KX4 A;  3KEB A;  1ZYP A;  3LYK A;  4KSO A;  3UBL A;  1XBS A;  2HRK A;  2NBS A;  2LQQ A;  4HOJ A;  2FY6 A;  3W6G A;  3EIN A;  22GS A;  2YWI A;  4V2N A;  5KEJ A;  3C1S A;  2X49 A;  2IMI A;  1SL1 B;  4NPB A;  3TUE A;  1ILO A;  1CQG A;  5KOX A;  3HJM A;  2GVP A;  3IXR A;  3MAK A;  1F3B A;  5KN3 A;  3FKF A;  1SD8 A;  2O7K A;  2CVK A;  1X9M B;  2I1U A;  2F3M A;  5EY6 A;  4ECB A;  12GS A;  4AGS A;  2JZS A;  2QA2 A;  4TR3 A;  2HE3 A;  3IK7 A;  4TKY A;  2WJU A;  2F9S A;  2NPB A;  3J7Y b;  16GS A;  4GWR A;  1QQ2 A;  1N8J A;  3LEF A;  4ZBB A;  5D9T A;  4OCE A;  5DBQ A;  2L6D A;  2LST A;  2F51 A;  5ECN B;  3UAP A;  3ZML A;  3M8N A;  5GST A;  6GSX A;  2LV3 A;  4O5U A;  2FWG A;  2C3N A;  3KH9 A;  2I81 A;  1I9D A;  4BPY A;  1HNB A;  1GTU A;  1ZGN A;  2R3X A;  1TDI A;  2IWT A;  2B1L A;  3UMA A;  3A2W A;  1MDJ A;  4IVF A;  5J41 A;  2QC7 A;  2OE3 A;  1Q98 A;  3QPM A;  2EIO A;  5D8I A;  4BVX B;  3TRX A;  5B8B A;  1GUH A;  1MD4 A;  4MH3 A;  1O8X A;  3M9K A;  1RW1 A;  4EVM A;  1QFN A;  4GLT A;  2YJ7 A;  4TRX A;  4ZXG A;  1Z7P A;  2ALB A;  3TJK A;  4A5P A;  2HZE B;  1AQW A;  2DBC A;  1YJ6 A;  3TJJ A;  2V1M A;  4Z2T A;  2HLS A;  2FCH A;  2IFQ A;  1T4Z A;  2G0F A;  4ZB9 A;  2HYX A;  1F3A A;  3EYT A;  3HVX A;  5D9X A;  2RM5 A;  5DAK B;  3Q74 A;  4POM A;  5AN1 A;  3FY7 A;  4ML6 A;  4ISD A;  2I3Y A;  5DCH A;  2MMA A;  5G1K A;  1M2A A;  4GTU A;  1PKZ A;  2FA8 A;  5H5Q A;  1M2D A;  3G7I A;  3E9J B;  3CRT A;  3VPQ A;  4K1F A;  2JSY A;  3EPT A;  3O3T A;  4I6X A;  1TI3 A;  2P5R A;  3ME8 A;  1TI1 A;  18GS A;  3PR8 A;  4JED A;  2H71 A;  3KP8 A;  3D4M A;  2VL9 A;  1SYR A;  5DQS A;  1JLW A;  1WOU A;  7GSS A;  3I9V 2;  2CX4 A;  1GTI A;  4HZ2 A;  4EUY A;  4XTS A;  2WFC A;  5CYY A;  2ON7 A;  1K0A A;  3VFI A;  3N5O A;  4H86 A;  3DXB A;  3F4T A;  2WUL A;  2YV9 A;  3FEU A;  4GQF A;  1WWJ A;  2XC2 A;  1EZK A;  5EL8 A;  2GZY A;  4HQS A;  1BX9 A;  3A5W A;  4FIW A;  4EDY A;  4N10 A;  4MJB A;  3GUR A;  1YEP A;  3P7X A;  1M9B A;  1V58 A;  3D6I A;  1SKW B;  2FWE A;  1K0D A;  3ZVJ D;  2LEG A;  1WJK A;  1SKS B;  3J7Y k;  3FZA A;  3HKR A;  5G5F A;  3QFA C;  3QAW A;  4WR4 A;  4MPG A;  5KOW A;  2XPE A;  1G7E A;  3FZ5 A;  4GQC A;  2C3T A;  4IKH A;  2DJ3 A;  1T00 A;  4BVX A;  3CSI A;  1XWA A;  5IPH A;  2XPD A;  1PN9 A;  1JZD A;  4HJM A;  4IN0 A;  4MZC A;  4CY8 A;  4G9H A;  1S3A A;  4F0B A;  1Q4J A;  3U6V A;  5B7C A;  1TOF A;  5C00 A;  2K9F A;  3GHA A;  1JHB A;  1XWG A;  3M9J A;  3JCM L;  1KTE A;  2R37 A;  1LU4 A;  1PKW A;  2R6K A;  4DVC A;  4CDO A;  5GSS A;  2V2G A;  2PBJ A;  3DVW A;  3KXO A;  5GZZ B;  4BVY B;  1EV4 A;  4ZBD A;  1TJD A;  2WB9 A;  3H93 A;  4GSN A;  3FR9 A;  5DAK A;  4KH7 A;  3BOA A;  3F4R A;  1XZO A;  1BJX A;  1HNC A;  2VM1 A;  4ICY A;  2HRN A;  1PX6 A;  2B5E A;  4TR1 B;  1DUG A;  5IIZ A;  4JRR A;  3P8W A;  2L59 A;  4EIQ A;  4HJ2 A;  1THX A;  2H0I A;  2JAD A;  4F2I A;  4KAE A;  1WRY A;  1ZZY A;  2H1A A;  1SL2 B;  2VAF A;  3TOU A;  2YZU A;  3G7Y A;  3NIV A;  1MD3 A;  5DJM A;  4JBB A;  4F0C A;  2RLI A;  4HQZ A;  5HR0 A;  3LGC A;  3PIN A;  3VI5 A;  1OKT A;  4G0K A;  2FWH A;  2L57 A;  4QL9 A;  3GNJ A;  4RI6 A;  1USB A;  2VM2 A;  3UBK A;  3BCK A;  3HVS A;  1F37 A;  1U6T A;  4Q5Q A;  4ULX A;  4IQA A;  4O5R A;  3KGK A;  1Y6E A;  5CO3 A;  5A4U A;  3TRQ A;  3WGX A;  4D73 B;  2PMT A;  5IMF A;  3GH6 A;  1Z3E A;  2H70 A;  4N0Z A;  2E2M A;  3KCM A;  6GSY A;  2FGX A;  3LSZ A;  5ECM B;  4KCA A;  2DIY A;  2CZ3 A;  4ACS A;  1H75 A;  2C0E A;  3TJF A;  3SBC A;  3US3 A;  2QKE A;  4K5R A;  5ABR A;  3F6D A;  1NM3 A;  2GGT A;  3VI7 A;  3LWA A;  2GQM A;  3ZMK A;  3ZL5 A;  4PUA A;  4L5O A;  2AUV A;  4X0X A;  2V32 A;  4F82 A;  1AQX A;  3QOU A;  1BQ7 A;  1EP8 A;  1GSS A;  4O32 A;  3FR6 A;  4BVY A;  2GSR A;  1UC7 A;  2IMK A;  1TRS A;  1VF2 A;  4ZB8 A;  2CT6 A;  3LXT A;  4POB A;  4K2D A;  1K0B A;  2BMX A;  2LRN A;  5G1L A;  4IS0 A;  4TR1 A;  3L78 A;  2OKA A;  2CQ9 A;  3I69 A;  1OE8 A;  2IIY A;  2B6M A;  5IMC A;  3TKS C;  1V9W A;  2M72 A;  1G6W A;  5DQY A;  1EWX A;  2LS5 A;  1G0T A;  3FMW A;  3ZIT A;  1A24 A;  3TKS A;  1NSW A;  5IM9 A;  5H5S A;  5L71 A;  1MEK A;  3HJP A;  2K8V A;  4KA0 A;  2E0Q A;  3ZTL A;  1GTA A;  3Q18 A;  2VD0 A;  3MYD A;  4WXT A;  3HJO A;  3GSS A;  5IOX A;  6GSV A;  4DEJ A;  1EV9 A;  2ZCT A;  1FVJ A;  3BBY A;  4NAX A;  5JWR B;  1R5A A;  4XS6 A;  1BG5 A;  2DJJ A;  4ID0 A;  3HD5 A;  1GSQ A;  2IFQ B;  1AIU A;  1M0U A;  2WGR A;  2LJK A;  1E6B A;  4Z2R A;  3HDC A;  3IR4 A;  1VRS D;  5CNW A;  2XBQ A;  5ECL B;  4OFT A;  1EEJ A;  2DC5 A;  4ECI A;  2B7K A;  2YAN A;  4IEL A;  2H76 A;  4HDE A;  3LJR A;  2HNL A;  4IBP A;  2LNT A;  3KTB A;  4KE3 A;  4MZW A;  2LTK A;  1XXU A;  1YDK A;  2V6K A;  1PGT A;  4CHS A;  5IMD A;  4XS4 B;  1C72 A;  3RHC A;  5F05 A;  1MDI A;  2HXK A;  3EVI A;  2F8A A;  1UVZ A;  5J4U A;  2VO4 A;  1XVW A;  4YQU A;  3CXG A;  3HHV A;  5IO2 A;  1GH2 A;  3LYP A;  2PWJ A;  5IO0 A;  2X4A A;  2DKH A;  4GST A;  2VCX A;  5HFI A;  2OJL A;  4MJE A;  1TU8 A;  3ZRE A;  2H66 A;  4WF4 A;  1V40 A;  2GSS A;  4QQ7 A;  1ZYQ B;  2L4C A;  2AAW A;  5B6N A;  1O8W A;  3F9U A;  17GS A;  3QCP A;  1ACV A;  3VK9 A;  4HU7 A;  4I5Q A;  3KM6 A;  1GLP A;  4X1U A;  3GUS A;  5AIS A;  3KIJ A;  4BWS A;  2RII A;  4KDU A;  2CAI A;  3UJ1 A;  2X8H A;  4KCE A;  4I2T A;  3IPZ A;  4BA7 A;  2UZ8 A;  4TXO B;  1TP9 A;  3IV4 A;  1ZYE A;  1EGR A;  4E8H A;  1WIK A;  4J57 E;  2OE0 A;  2VL2 C;  3DYR A;  1LJR A;  1M2B A;  2R0G A;  1GLQ A;  3BJ5 A;  4ECC A;  2VL2 A;  4RQR A;  2O85 A;  4G0I A;  5KN0 A;  4YAV A;  1SK1 A;  6GSW A;  5JCW A;  4L0U A;  3GKK A;  1GWC A;  1K3L A;  1ZL9 A;  3VWU A;  1A8L A;  13GS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...