4HUAA

E. coli thioredoxin variant with (4r)-fluoropro76 as single proline residue
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
107
Chain Sequence
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGACKMIAAILDEIADEYQGKLTVAKLNIDQNAGTAAKYGIRGITLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin-1
publication title (4R)- and (4S)-Fluoroproline in the Conserved cis-Prolyl Peptide Bond of the Thioredoxin Fold: Tertiary Structure Context Dictates Ring Puckering.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 33
structure length 107
sequence length 108
ec nomenclature
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4huaA00
6GSWA 4O32A 3HCZA 2GZYA 3BCKA 4GXZA 3UBKA 3L9SA 1JZRA 3ERWA 3TKRA 1HYUA 4OFNA 3IDVA 1V2AA 2CAQA 1EOHA 1K3LA 2IMFA 4HS1A 3GHAA 2A2SA 3DYRA 1WRYA 4KNDA 4WBJA 3TOUA 1U6TA 3DMLA 4NXIA 1HD2A 3HKRA 3WGDA 3QD9A 5CRDA 4XS6A 1GNWA 4YQVA 4GWRA 1SD8A 1XWGA 1TP9A 2ZCTA 3GUSA 1B4QA 4FYBA 5G2ZA 5DCGA 2X99A 3DD3A 2VLTA 1VGLA 5J9BA 2LQOA 5G1LA 4EDZA 2TIRA 4O92A 2M46A 3TRQA 4L5OA 1EP7A 4LLRA 2CT6A 3HYPA 3HA9A 1M99A 1SYXA 4Z7XA 1ABAA 2VM1A 4MMMA 1F3AA 1TRSA 5G5EA 2K9FA 1R26A 2C3TA 4LA1A 4TRXA 2MZCA 1ZL9A 1TDIA 1G7EA 2PVQA 3ZIVA 2OJLA 3PGTA 3ZRDA 1F9MA 2RIIA 2LEGA 4FYUA 1WOUA 2IFQB 3I9V2 5ECPB 1SJIA 4MP4A 3Q74A 2HNLA 4HOJA 4QQ7A 1ZGNA 2L5LA 1TW9A 3G7IA 1XIYA 4HQZA 2ALBA 4LL4B 4HQSA 3HXSA 4K8MA 3ZREA 2PPTA 3KMNA 4JBBA 3HD5A 4TR1B 1H75A 4IGJA 6GSVA 1ZMAA 4WEYA 3CBUA 7GSSA 3HJOA 2L4QA 11GSA 3WYWA 5JWQB 1YF1A 1XVWA 4TR0A 5JCWA 1YQ1A 1DSBA 4TR3A 5FHIA 1TU7A 4WBRD 2R5GA 1Z7PA 3GTUA 4DSSB 3P8WA 5IMCA 1HQOA 2IMKA 3VFIA 1LU4A 2VLVA 4L8EA 4TOPA 3FR6A 1OC3A 1MEKA 3ED3A 2FA4A 1GUHA 4XTSA 4ILFA 3ZYWA 2C3NA 1RQMA 2PU9C 1DE1A 4ZILA 2CVBA 1GRXA 3VWWA 2MBTA 4ID0A 2DMMA 3TJFA 3QPMA 3HHVA 5G30A 4ZBAA 2YOIA 3M9JA 5CRHA 4K7IA 2ZUPA 2H75A 2FA8A 5ENUA 3EYTA 1SYRA 3TB2A 3WT1A 1FVJA 2GZZA 2GT6A 2YPMA 2H1BA 2MYGA 2H1AA 1K3OA 2KP2A 2VLUA 3ZZXA 2LJRA 2N5AA 1PX7A 3GX8A 3I6AA 2H0GA 4IHUA 5HFIA 1AUCA 4DSQA 4ECIA 4GQCA 2J9HA 1QFNA 1LJRA 3L9VA 1W89A 4JR6A 4MF7A 1QMVA 5ECMB 1ZYQB 5AIXA 2CZ2A 5CRWA 1GTIA 2H73A 4POKA 5IMFA 2L57A 1K0OA 2X64A 5D96A 3RPPA 2FUG2 4TXOB 4EKZA 3GNJA 2B5EA 4NV5A 3GL5A 3KEBA 2F9SA 2XBQA 5E59A 2F3MA 1GL8A 1S3DA 1YY7A 4KDXA 4DVCA 2H01A 1ON4A 3D0ZA 4RI6A 1KEBA 2H66A 4OMVA 1U87A 5HR1A 1VRSD 2B5YA 4JU5A 4RUVA 1PX6A 3F0IA 1PKWA 3TKSC 4KB3A 2IPAA 1SK1A 2GZPA 3ZLPA 1DBYA 1IYIA 5IO2A 3MDKA 4KGIA 3APSA 1X5DA 4G2EA 3KP8A 2VCZA 2H72A 4HU7A 5ELAA 4CDOA 2E7PA 5J41A 1AQVA 1PD21 1EZKA 2LJAA 4HUAA 2QSIA 1X5CA 3TGZA 4ML1A 1YJ6A 1TKDB 4F82A 2IMEA 1J0FA 1G7OA 3KMOA 5D93A 4KAEA 4MF6A 2YN1A 3EURA 4P3YB 2DJ2A 4HJMA 2YWNA 1XBSA 2EIQA 2FLSA 2XBIA 2FY6A 3ZMLA 2P5QA 2B3SA 4I6XA 2LRCA 5HR2A 3TJJA 3GV1A 2E2GA 4MJAA 3O3TA 1GSEA 2VL2A 1ILOA 3C73A 2RM6A 3VPTA 4EVMA 4ECJA 2C1YA 3TJGA 1K0BA 4WKWA 5H5QA 4MABA 1OYJA 2X8HA 2L5OA 3TKSE 1SJZA 2PN8A 1OAZA 3H79A 4IQ1A 1KBNA 4IJ3A 1XVQA 5J5NA 3M9KA 1FG4A 2LNSA 2LS5A 4HEA2 2KLXA 2NTOA 1GULA 3TJBA 3ZFBA 2IJYA 1XWAA 4PNFA 3O76A 1F2EA 1A2MA 4XRDA 1UN2A 4EXJA 2WJUA 4BWSA 4MA9A 4NV2A 1SKRB 4HZ2A 3CXGA 4MZCA 5FWGA 4JE1A 5G5FA 4YAPA 1FB0A 5DBQA 4K0GA 3CSIA 2NDOA 4KCEA 3KJYA 3A2WA 3FR3A 2WZ9A 2GQKA 3GA4A 5IMAA 2HSHA 1N2AA 5EL8A 5AISA 4HZ4A 5CREA 2DMLA 3N9JA 3RHCA 2IFQA 2HSYA 5DQSA 4POBA 2DJJA 4GF0A 3ISOA 3JCML 4ECBA 1SKWB 5ECRB 2CX3A 3CSJA 1PA3A 2YWOA 5DALA 4PUFC 2C0DA 1JZWA 4EDYA 1K0NA 3GL3A 3VWXA 1O8WA 4EUYA 5EPFA 16GSA 2E0QA 3W8JA 5DCHA 1I9DA 2OE1A 4XIHA 2VUPA 5F07A 1BEDA 2LSTA 1DE2A 2FWFA 2MMNA 2I3YA 4IP6A 4K7NA 2WFCA 5KN0A 2H30A 3H1NA 2Z9SA 4XS4A 2GLRA 4PQHA 3EU3A 4V1Ag 2JACA 2CQ9A 4HU9A 5D8IA 3APQA 4G10A 4DSSA 4I97A 4AJ8A 1AW9A 4AF2A 2HLSA 2V41A 5DQYA 2PVOC 3WD6A 1SKSB 4MCUA 1WE0A 5LCZA 5HFGA 4QL7A 3UOMA 1PL2A 2XPEA 1USBA 1BAYA 3US3A 1B9XC 3IBHA 3UBLA 2AAWA 1A8YA 4WR5A 2VCQA 3GH9A 4FH8A 3BCIA 3D5JA 1RK4A 3RAZA 2VO4A 2CVDA 1XOBA 2V1MA 2E2MA 4G9HA 2IWTA 3LWAA 2M80A 4PQ1A 3A3TA 5A4WA 2I4AA 2AUVA 4HDEA 1ERWA 3ZTLA 4Q5QA 3F4RA 2K8VA 1PGTA 1VF2A 1JFUA 5IM9A 2G0FA 5C04A 1M9BA 2R2JA 2WB9A 4Q5NA 4PUAA 3ZVJD 18GSA 3DVXA 1TRUA 2GSRA 1K0DA 1X0RA 3H8QA 4PURA 1TXXA 4IS0A 4HI7A 4XCSA 4HJ2A 3MSZA 2BMXA 3IRAA 3LORA 3CYNA 3LGCA 1VF4A 2HI7A 4F0BA 1K0CA 2VIMA 1NW2A 4TXOA 2HRNA 2V2GA 2HZFA 3W8SA 5HR3A 1FW1A 2FWHA 4MZWA 3WGEA 2XHFA 3F4SA 4ECCA 3KIJA 2HRFA 3FRCA 1X9MB 2EIRA 5HFKA 2AV4A 4XHMA 1NHYA 19GSA 1JHBA 3LFLA 1IYHA 1R7HA 1Z9HA 1MDKA 2AB6A 5G31A 1FB6A 4DEJA 4I5QA 3I43A 1MD4A 2I1UA 4I2TA 5B7CA 1TOFA 1WP0A 1QK8A 10GSA 3ERGA 5DALB 3TKPA 3VWUA 1BX9A 9GSSA 1A0RP 2HYXA 4WXTA 2GTUA 1F37A 3IHQA 3KM6A 5CYYA 4ZBBA 3ZFLA 1JZOA 2IN3A 5CP1A 2H6XA 3QDNA 3MWHA 3ME8A 3LYKA 2HFDA 4XS4B 4POLA 1XCCA 1EEJA 2VM2A 4G19A 2DLXA 4KE3A 4MH3A 1NHOA 2H0HA 3EINA 2V6OA 2LJKA 1AQWA 4MK3A 3CRUA 1ZZYA 1AAZA 3F6DA 5GSSA 1GSQA 4MLYA 6GSTA 3VI7A 3L78A 3F3RA 2FHEA 4POMA 4ZBDA 1OKDA 3UVTA 5B8AA 1T7PB 2B6MA 3FZ5A 3D21A 1WMJA 4J57E 3GYKA 3ERFA 3OR5A 3NZNA 4E8EA 2VOCA 5B6MA 1X5EA 1XXUA 2CA8A 2N5FA 1T4YA 2H1DA 5JCUA 5L71A 4MZBA 1A23A 1B48A 3K8NA 3ME7A 3GSTA 5AN1A 1EGRA 3VK9A 1Z6MA 3QAWA 3WT2A 2X8CA 2L6DA 1SK2A 2QGVA 1EEMA 2O7KA 1ZCPA 1CQHA 2VCTA 4XS1A 3A2VA 1O81A 2OBKA 3KGKA 4IP1A 1NSWA 1THXA 2IMIA 5D9VA 2VL3A 3D4TA 2MBSA 5ECHB 5IMDA 2C3QA 1EV9A 2GQMA 3IAS2 3VURA 2VL2C 1VF3A 3QFBC 3KTBA 1T1VA 2YP6A 4MDCA 2H71A 1X9WB 2P5RA 4ZL7A 3MAKA 1Z6NA 5ELGA 1SL0B 5G1KA 5LNKe 4K2DA 5F0GA 1SL1B 2WULA 3GKMA 4GSTA 2DJ1A 2BJXA 2DSAA 3GKKA 2OA7A 3M1GA 3VPQA 1E6BA 1X9SB 22GSA 2F8AA 2FCHA 4ZB6A 3BJ5A 3FYGA 2DIYA 2R6KA 2A2RA 5JCGA 4IKHA 3V1WA 3N5OA 1BG5A 4KSOA 4F0CA 1XZOA 4WF5A 5KN1A 4EO3A 5DJLA 4IJIA 3F3QA 3NOFA 3QFAC 1T8EB 2O89A 3UAPA 4OFTA 2JZRA 4MJBA 3NIVA 4JZQA 1KNGA 4X43A 5D73A 3FKFA 5IPGA 2KP1A 2P31A 3A2XA 3F63A 1DUGA 2GT5A 2LNTA 2DJ0A 3L4NA 4DSRA 1O6JA 3SBCA 4MPFA 3IK9A 4ZL9A 3CSHA 2IIYA 4TKYA 2YWMA 2KOKA 5IOXA 3PH9A 1F6MC 4AJ7A 1G0TA 4LMWA 1SL2B 1EOGA 1R4WA 2N5BA 1HNAA 1A8LA 4NWYA 2PBJA 4KDUA 1S3CA 4K7OA 5F8BA 1BJXA 1JLVA 5A4UA 1GTUA 5E4WA 1GLPA 4ML6A 4PX1A 1ERVA 1QUWA 4ZB8A 3RDWA 1PL1A 4GTUA 1EV4A 1YF0A 8GSSA 5IMVA 2H6YA 3M8NA 3BD2A 3QR6A 4OO4A 2WGRA 3EE2A 3FK8A 1MTCA 2R4VA 1THOA 2CVKA 3Q6OA 3M0FA 1GUKA 2GSSA 4PNGA 4F03A 5HQPA 1WPIA 3UARA 3HZ4A 5COHA 3HJMA 3GKNA 3EWLA 1I5GA 2GS3A 4KDYA 5DVBA 2PGTA 1SD9A 1TI3A 2H19A 5AGYA 4OFMA 3EU4A 2B7KA 4PGTA 5IPHA 5AIVA 4NAXA 2NPBA 3E3EA 3GRXA 2D2ZA 2REMA 5FT3A 2HE3A 3FY7A 1N8JA 1S3AA 3CRTA 1O8XA 2AJQB 4EC0A 1G6YA 4NMUA 5GZZB 3G7YA 5CRGA 2BTOT 4RQXA 4YQMA 3GIXA 1Y6EA 2XC2A 4I8BA 3DVWA 2O87A 3QAVA 1MDJA 1GSUA 2QC7A 5DDLA 4ZL8A 2B1KA 4BWQA 4WR4A 3RHBA 3KXOA 1V40A 1GSSA 2V32A 3IA1A 5B8BA 4N11A 1M2AA 1BQ7A 1OKTA 2PUKC 5F06A 3ZIJA 2V6KA 3QCPA 3C1RA 1SENA 1T3BA 2F51A 3HZ8A 1PRXA 2GSQA 1SJ6A 5ECQB 1PMTA 2B1LA 3C71A 5D9XA 3LEFA 4F2IA 3AY8A 3J7Yk 1ERUA 3Q19A 2O8VB 3FZAA 1FHEA 4KSMA 6GSXA 20GSA 3D4MA 4I2UA 4KUNA 3E0UA 4FIWA 1J9BA 3KH7A 1OC9B 4J2FA 1PQNA 4GCIA 4GRFA 1Q4JA 4RQRA 3RPNA 3F8UA 2OACA 3LQ7A 3UEMA 4JR4A 3APOA 2OBIA 5CNWA 2KHPA 1T00A 2C8UA 1Y25A 1O73A 2RUEA 2DBCA 2JZSA 1XWBA 3EVIA 1GSFA 2DC5A 2NVLA 4OD7A 1PN9A 1GTBA 3FW2A 1B4PA 2LUSA 2FD3A 5DAKA 4ACSA 3UMAA 3G7JA 3GKXA 3FR9A 1R5PA 1UVZA 1GWCA 2LV3A 1XFLA 4RI7A 1CQGA 2YCDA 3IE3A 2OADA 2CV4A 4OWYA 2WS2A 1FAAA 1SK0A 2VL9A 2MMOA 4L0UA 2VD0A 4ISDA 3A5WA 3F6FA 3D6IA 2CZ3A 3U5RE 2JZTA 3HVSA 2LRNA 3I69A 5J4UA 1OE8A 3GH6A 3WGXA 3GFKA 3O6TA 3DIEA 2L59A 2LTKA 2RLIA 2DJ3A 4OO5A 1ACVA 1GUMA 1XWKA 4F9ZA 4Q5RA 5HR0A 1A2JA 3UL3A 4NPBA 1B9YC 1MD3A 2WCIA 4LL1B 4TR4A 1GTAA 1O7UA 1MDIA 4ZB9A 2O85A 2PMTA 5INYA 4YAVA 3HDCA 2M72A 2CAIA 3R2QA 4IBPA 1FOVA 1TK0B 1LBKA 4N0ZA 2CX4A 1HNBA 4KH7A 5JWRB 4NHZA 5H5RA 3F9UA 3CTFA 2WRTA 3TDGA 4IN0A 2VCVA 1WWJA 5LD0A 3L9UA 5KN3A 1TTZA 3QOUA 3ZL5A 1FVKA 6GSYA 3LXZA 1PKZA 2GQLA 2HXKA 2HT9A 2K18A 3KP9A 2LKUA 2VCXA 1GP1A 4KCAA 1V57A 2FGXA 2K8SA 1G6WA 2LQQA 1U88A 2RUFA 4X1UA 4XRAA 4L5LA 2H76A 4QL9A 2J23A 1O85A 3QMXA 1SU9A 4K6XA 2HZEA 5ID2B 5EVOA 3L0HA 2FNOA 2OE0A 4YH2A 3EC3A 1Z5YE 1AIUA 3BBYA 1GSYA 5A5KA 3DXBA 4BA7A 2TRXA 4IW9A 4JRRA 1WJKA 2C80A 1UA5A 2MMAA 3KCMA 2MMZA 1XPVA 14GSA 2JSZA 3GMFA 5ECOB 1E2YA 4L0WA 1J08A 1BYEA 2YJ7A 4FYCA 1YKCA 3UIWA 1QXHA 2A4VA 3DGQA 6GSSA 2YZUA 4MH2A 5ECNB 3FEUA 2G2QA 1GSDA 4ULXA 2YWIA 4IELA 2FWEA 5DAKB 2I9HA 4IQAA 1A2LA 1Z7RA 1XW9A 2VD1A 5B6NA 1TJDA 3LG6A 3F4TA 3TOTA 4MF5A 3HJPA 5GAND 2IMDA 1RW1A 1YDKA 4MPGA 3FZ9A 1OE7A 3DRNA 2LRTA 1QGVA 3TKQA 3VLNA 2JL4A 3TJKA 1TK5B 4TXVA 1GLQA 3FHKA 2R37A 3KH9A 3IPZA 2X8GA 2NBSA 2VAFA 1C72A 5C00A 1YKAA 1YZXA 3KD0A 1XOAA 3IK7A 2I81A 4PXOA 3LXTA 1R5AA 2FWGA 1V98A 3KZQA 3IR4A 3LJRA 2YV7A 1TRWA 3IC4A 1NM3A 4Q5FA 2IL3A 2YANA 3GN3A 2XPDA 1EWXA 1AQXA 4BL7A 17GSA 3LYPA 1ZYEA 2F8FA 4V2MA 3HVXA 3P90A 5IIZA 2H70A 2ON5A 2L4CA 4OCEA 5D9TA 5IOWA 4TVEA 2YZHA 4IVFA 1HNCA 1W4VA 1V58A 4N0VA 2C4JA 4YQUA 2H1GA 3TUEA 3SWLA 5ECKB 3C1SA 4CW9A 1JLWA 3C7MA 1OC9A 3HY2A 3GX0A 5ECLB 2GSTA 5ECIB 3QAGA 3CTGA 2GGTA 4GQFA 1M2DA 1YEPA 1PSQA 5GAPD 3J7Yb 2DJKA 2P0GA 2HZEB 2TRCP 3FZ4A 4D73A 2H0IA 5JWOB 4NHWA 2K6VA 1XW5A 2OKAA 3G9BA 4WF4A 1A24A 1GH2A 1ZOFA 3GTUB 5IO0A 1M7TA 4CHSA 3PINA 2QKEA 4TN8A 5J9CA 2GVPA 5IMZA 1ML6A 4X0XA 1GNEA 1UC7A 4OCFA 3BOAA 4MJEA 2B7JA 4EF0A 1H4OA 4GSSA 4K9ZA 2JU5A 4BVYA 4GLTA 1EGOA 3TRPA 1K3YA 1VF1A 1TK8B 3DKSA 4KW6A 2AHEA 3VI5A 1FO5A 3IXRA 2B5XA 4WETA 2L6CA 3U6VA 1T4ZA 4AJ6A 1F3BA 4EL1A 2OE3A 3ZITA 5H5SA 2JSYA 1AXDA 3GSSA 1K0MA 4V2LA 1WIKA 4O5RA 3C8EA 3KTLA 3DEXA 2AYTA 4FO5A 2R3XA 5GSTA 3PR8A 4BPYA 2WDUA 3TKSA 3H4KA 3TRXA 4V2NA 2EC4A 3P2AA 4JEDA 3IAM2 2YV9A 3TCOA 1JZDA 2C0FA 3D22A 2C0EA 3S9FA 4MJCA 1ST9A 2JADA 5CO3A 5DJMA 3CMIA 4H86A 2C0GA 4ZIJA 4E8HA 3P7XA 2DIZA 5CAXA 1TU8A 2KUCA 1TRVA 5KN2A 2PERA 2H8LA 1V9WA 3UJ1A 3ZMKA 4K0NA 5IQYA 4N30A 4GSNA 2PWJA 1ERTA 1XWCA 1B8XA 1EP8A 5A4VA 3RBTA 3GURA 1A0FA 2RM5A 4TW5A 3W6GA 3DWVA 2H6ZA 5J3RA 1M2BA 2VCWA 5KEJA 3HVVA 1K0AA 5ABRA 4TR1A 4PQIA 5D9WA 1QQ2A 2ON7A 3IOSA 2ZNMA 2YNXA 1KTEA 4N10A 3E9JB 5ID2A 3EMXA 6GSUA 3MNGA 4J56E 5ECSA 3VWVA 3EMPA 1OVNA 2ES7A 1XW6A 1TI1A 3UVHA 1M9AA 3Q18A 12GSA 3LSZA 1YEXA 3IV4A 4ZXGA 1URMA 4O7HA 4LMVA 1Q98A 3H93A 2YJHA 1Z3EA 3M3MA 2GDRA 5F05A 1M0UA 4BVXA 4EE0A 4K1FA 2H74A 1OC8A 1AC1A 13GSA 1U3AA 2EIOA 5EY6A 4D73B 4AGSA 3ZVJA 4V1Ap 4KA0A 4KX4A 1U3IA
chains in the Genus database with same CATH superfamily
6GSWA 4O32A 3HCZA 2GZYA 3BCKA 4GXZA 3UBKA 3L9SA 4G0IA 1JZRA 3ERWA 3TKRA 1HYUA 4OFNA 3IDVA 1V2AA 2CAQA 1EOHA 1K3LA 2IMFA 4HS1A 3GHAA 2A2SA 3DYRA 1WRYA 4KNDA 4WBJA 3TOUA 1U6TA 3DMLA 4NXIA 1HD2A 3HKRA 3WGDA 3QD9A 5CRDA 4XS6A 3IC8A 1GNWA 4YQVA 4GWRA 1SD8A 1XWGA 1TP9A 2ZCTA 3GUSA 1B4QA 4FYBA 5G2ZA 5DCGA 2X99A 3DD3A 2VLTA 1VGLA 5J9BA 2LQOA 5G1LA 4EDZA 2TIRA 4O92A 2M46A 3TRQA 4PTSA 4YKGA 4L5OA 1EP7A 4LLRA 2CT6A 3HYPA 3HA9A 1M99A 1SYXA 4Z7XA 5KOXA 1ABAA 2VM1A 4MMMA 1F3AA 1TRSA 5G5EA 2K9FA 1R26A 2C3TA 4LA1A 4TRXA 2MZCA 1ZL9A 1TDIA 1G7EA 2PVQA 3ZIVA 2OJLA 3PGTA 3ZRDA 1F9MA 2RIIA 2LEGA 4FYUA 1WOUA 2IFQB 3I9V2 4Z2TA 5ECPB 1SJIA 4MP4A 3Q74A 2HNLA 4HOJA 4QQ7A 1ZGNA 2L5LA 1TW9A 3G7IA 1XIYA 4HQZA 2ALBA 4Z2RA 4LL4B 4HQSA 3HXSA 4K8MA 3ZREA 2PPTA 3KMNA 4JBBA 3HD5A 4TR1B 1H75A 4IGJA 6GSVA 1ZMAA 4WEYA 3CBUA 7GSSA 3HJOA 2L4QA 11GSA 3WYWA 5JWQB 1YF1A 1XVWA 4TR0A 5JCWA 1YQ1A 1DSBA 4TR3A 5FHIA 1TU7A 4WBRD 2R5GA 1Z7PA 3GTUA 4DSSB 3P8WA 5IMCA 1HQOA 2IMKA 3VFIA 4KF9A 1LU4A 2VLVA 4L8EA 4TOPA 3FR6A 1OC3A 1MEKA 3ED3A 2FA4A 1GUHA 4XTSA 4ILFA 3ZYWA 2C3NA 1RQMA 2PU9C 1DE1A 4ZILA 2CVBA 1GRXA 3VWWA 2MBTA 4ID0A 2DMMA 3TJFA 3QPMA 3HHVA 5G30A 4ZBAA 2YOIA 3M9JA 5CRHA 4K7IA 2ZUPA 2H75A 2R0GA 2FA8A 5ENUA 3EYTA 1SYRA 3TB2A 3WT1A 1FVJA 2GZZA 2GT6A 2YPMA 2H1BA 2MYGA 2H1AA 1K3OA 2KP2A 2VLUA 3ZZXA 2LJRA 2N5AA 1PX7A 3GX8A 3I6AA 2H0GA 4IHUA 5HFIA 1AUCA 4DSQA 4EIQA 4ECIA 4GQCA 3HVNA 3EPTA 2J9HA 1QFNA 1LJRA 3L9VA 1W89A 4JR6A 4MF7A 1QMVA 5ECMB 1ZYQB 5AIXA 2CZ2A 5CRWA 1GTIA 2H73A 4POKA 5IMFA 1PN0A 2L57A 1K0OA 2X64A 5D96A 3RPPA 2FUG2 4TXOB 4EKZA 3GNJA 2B5EA 4NV5A 3GL5A 3KEBA 2HRKA 2F9SA 2XBQA 5E59A 2F3MA 1GL8A 1S3DA 1YY7A 4KDXA 4DVCA 2H01A 1ON4A 3D0ZA 4RI6A 1KEBA 2H66A 4OMVA 1U87A 5HR1A 1VRSD 2B5YA 4JU5A 4RUVA 1PX6A 3F0IA 1PKWA 3TKSC 4K5RA 4KB3A 2IPAA 1SK1A 2GZPA 3ZLPA 1DBYA 1IYIA 5IO2A 3MDKA 4KGIA 3APSA 1X5DA 4G2EA 3KP8A 2VCZA 2H72A 4HU7A 5ELAA 4CDOA 2E7PA 5J41A 1AQVA 1PD21 1EZKA 2LJAA 4HUAA 2QSIA 1X5CA 3TGZA 4ML1A 1YJ6A 1TKDB 4F82A 2IMEA 1J0FA 1G7OA 3KMOA 5D93A 4KAEA 4MF6A 2YN1A 3EURA 4P3YB 2DJ2A 4HJMA 2YWNA 1XBSA 2EIQA 2FLSA 2XBIA 2FY6A 3ZMLA 2P5QA 2B3SA 4I6XA 2LRCA 5HR2A 3TJJA 3GV1A 2E2GA 4MJAA 3O3TA 1GSEA 2VL2A 1ILOA 3C73A 2RM6A 3VPTA 4EVMA 4ECJA 2C1YA 3TJGA 1K0BA 4WKWA 5H5QA 4MABA 1OYJA 2X8HA 2L5OA 3TKSE 1SJZA 2PN8A 1OAZA 3H79A 4IQ1A 1KBNA 4IJ3A 1XVQA 5J5NA 3M9KA 1FG4A 2LNSA 2LS5A 4HEA2 2KLXA 2NTOA 1GULA 3TJBA 3ZFBA 2IJYA 1XWAA 4PNFA 3O76A 1F2EA 1A2MA 4XRDA 1UN2A 4EXJA 2WJUA 4BWSA 4MA9A 4NV2A 1SKRB 4HZ2A 3CXGA 4MZCA 5FWGA 4JE1A 5G5FA 4YAPA 3MYDA 1FB0A 5DBQA 4K0GA 3CSIA 2NDOA 4KCEA 3KJYA 3A2WA 3FR3A 2WZ9A 2GQKA 2UZ8A 3GA4A 5IMAA 4G0LA 2A2PA 2HSHA 1N2AA 5EL8A 5AISA 4HZ4A 5CREA 2DMLA 3N9JA 3RHCA 2IFQA 2HSYA 5DQSA 4POBA 2DJJA 4GF0A 3ISOA 3JCML 4ECBA 1SKWB 5ECRB 2CX3A 3CSJA 1PA3A 2YWOA 5DALA 4PUFC 2C0DA 1JZWA 4EDYA 1K0NA 3GL3A 3VWXA 1O8WA 4EUYA 5EPFA 16GSA 2E0QA 3W8JA 5DCHA 1I9DA 2OE1A 4XIHA 2VUPA 5F07A 1BEDA 2LSTA 1DE2A 2FWFA 2MMNA 2I3YA 4IP6A 4K7NA 2WFCA 5KN0A 2H30A 3H1NA 2Z9SA 4XS4A 2GLRA 4PQHA 3EU3A 4V1Ag 2JACA 2CQ9A 4HU9A 5D8IA 3APQA 4G10A 4DSSA 4I97A 4AJ8A 1AW9A 4AF2A 2HLSA 2V41A 5DQYA 2PVOC 3WD6A 1SKSB 4MCUA 1WE0A 5LCZA 5HFGA 4QL7A 3UOMA 1PL2A 2XPEA 4EIPA 1USBA 1BAYA 3US3A 1B9XC 3IBHA 3UBLA 2AAWA 1A8YA 4WR5A 2VCQA 3GH9A 4FH8A 3BCIA 3D5JA 1RK4A 1PFOA 3RAZA 2VO4A 2CVDA 1XOBA 2V1MA 2E2MA 4G9HA 2IWTA 3LWAA 2M80A 4PQ1A 3A3TA 5A4WA 2I4AA 2AUVA 4CY8A 4HDEA 1ERWA 3ZTLA 4Q5QA 3F4RA 2K8VA 1PGTA 1VF2A 1JFUA 5IM9A 4A5PA 2G0FA 5C04A 1M9BA 2R2JA 2WB9A 4Q5NA 4PUAA 3ZVJD 18GSA 3DVXA 1TRUA 4Z2UA 2GSRA 1K0DA 1X0RA 3H8QA 4PURA 1TXXA 4IS0A 4HI7A 1XG8A 4XCSA 4HJ2A 3MSZA 2BMXA 3IRAA 3LORA 3CYNA 3LGCA 1VF4A 2HI7A 4F0BA 1K0CA 2VIMA 1NW2A 4TXOA 2HRNA 2V2GA 2HZFA 3W8SA 5HR3A 1FW1A 4K5SA 2FWHA 4MZWA 3WGEA 2XHFA 3F4SA 4ECCA 3KIJA 2HRFA 3FRCA 1X9MB 2EIRA 5HFKA 2AV4A 4XHMA 1NHYA 19GSA 1JHBA 3LFLA 1IYHA 1R7HA 1Z9HA 1MDKA 2AB6A 5G31A 1FB6A 4DEJA 2A4HA 4I5QA 3I43A 1MD4A 2I1UA 4I2TA 5B7CA 1TOFA 1WP0A 1QK8A 10GSA 3ERGA 5DALB 3TKPA 3VWUA 1BX9A 9GSSA 1A0RP 2HYXA 4WXTA 2GTUA 1F37A 1S3RA 3IHQA 3KM6A 5CYYA 4ZBBA 3ZFLA 1JZOA 2IN3A 5CP1A 2H6XA 3QDNA 3MWHA 3ME8A 3LYKA 2HFDA 4XS4B 4POLA 1XCCA 1EEJA 2VM2A 4G19A 2DLXA 4KE3A 4MH3A 1NHOA 2H0HA 3EINA 2V6OA 2LJKA 1AQWA 4MK3A 3CRUA 1ZZYA 1AAZA 3F6DA 5GSSA 1GSQA 2DKHA 4MLYA 6GSTA 3VI7A 3L78A 3F3RA 2FHEA 4POMA 4ZBDA 1OKDA 3UVTA 5B8AA 1T7PB 2B6MA 3FZ5A 3D21A 1WMJA 4J57E 3GYKA 3ERFA 3OR5A 3NZNA 4E8EA 4FQUA 2VOCA 5B6MA 1X5EA 1XXUA 2CA8A 2N5FA 1T4YA 2H1DA 5JCUA 5L71A 4MZBA 1A23A 1B48A 3K8NA 3ME7A 3GSTA 5AN1A 1EGRA 3VK9A 1Z6MA 3QAWA 3WT2A 2X8CA 2L6DA 1SK2A 2QGVA 1EEMA 2O7KA 1ZCPA 1CQHA 2VCTA 4XS1A 3A2VA 1O81A 2OBKA 3KGKA 4IP1A 1NSWA 1THXA 2IMIA 1M3JA 5D9VA 2VL3A 3D4TA 2MBSA 5ECHB 5IMDA 2C3QA 1EV9A 2GQMA 3IAS2 3VURA 2VL2C 1VF3A 3QFBC 3KTBA 1T1VA 2YP6A 4MDCA 2H71A 1X9WB 2P5RA 4ZL7A 3MAKA 1Z6NA 5ELGA 1SL0B 5G1KA 5LNKe 4K2DA 5F0GA 4G0KA 1SL1B 2WULA 3GKMA 4GSTA 2DJ1A 2QA2A 2BJXA 2DSAA 3GKKA 2OA7A 3M1GA 3VPQA 1E6BA 1X9SB 22GSA 2F8AA 2FCHA 4ZB6A 3BJ5A 3FYGA 2DIYA 2R6KA 2A2RA 5JCGA 4IKHA 3V1WA 3N5OA 1BG5A 4KSOA 4F0CA 1XZOA 4WF5A 5KN1A 4EO3A 5DJLA 4IJIA 3F3QA 3NOFA 3QFAC 1T8EB 2O89A 3UAPA 4OFTA 2JZRA 4MJBA 3NIVA 4JZQA 1KNGA 4X43A 5D73A 3FKFA 5IPGA 2KP1A 2P31A 3A2XA 3F63A 1DUGA 2GT5A 3R3EA 2LNTA 2DJ0A 3L4NA 4DSRA 1O6JA 3SBCA 4MPFA 3IK9A 4ZL9A 3CSHA 2IIYA 4TKYA 2YWMA 2KOKA 3IHGA 5IOXA 3PH9A 1F6MC 4AJ7A 1G0TA 4LMWA 1SL2B 1EOGA 1R4WA 2N5BA 1HNAA 1A8LA 4NWYA 2PBJA 4KDUA 1S3CA 4K7OA 5F8BA 1BJXA 1JLVA 5A4UA 1GTUA 5E4WA 1GLPA 4ML6A 4PX1A 1ERVA 1QUWA 4ZB8A 3RDWA 1PL1A 4GTUA 1EV4A 1YF0A 8GSSA 5IMVA 2H6YA 3M8NA 3BD2A 3QR6A 4OO4A 3PPUA 2WGRA 3EE2A 3FK8A 1MTCA 2R4VA 1THOA 2CVKA 3Q6OA 3M0FA 1GUKA 2GSSA 4PNGA 4F03A 5HQPA 1WPIA 3UARA 3HZ4A 5COHA 1FOHA 3HJMA 3GKNA 3EWLA 1I5GA 2GS3A 4KDYA 5DVBA 2PGTA 1SD9A 1TI3A 2H19A 5AGYA 4OFMA 3EU4A 2B7KA 4PGTA 5IPHA 5AIVA 4NAXA 2NPBA 3E3EA 3GRXA 2D2ZA 2REMA 5FT3A 2HE3A 3FY7A 1N8JA 1S3AA 3CRTA 1O8XA 2AJQB 4EC0A 1G6YA 4NMUA 5GZZB 3G7YA 5CRGA 2BTOT 4RQXA 4YQMA 3GIXA 1Y6EA 2XC2A 4I8BA 3DVWA 2O87A 3QAVA 5BMUA 1MDJA 2DKIA 1GSUA 2QC7A 5DDLA 4ZL8A 2B1KA 4BWQA 4WR4A 3RHBA 4BL7B 3KXOA 1V40A 1GSSA 2V32A 3IA1A 5B8BA 4N11A 1M2AA 1BQ7A 1OKTA 2PUKC 5F06A 3ZIJA 2V6KA 3QCPA 3C1RA 1SENA 1T3BA 2F51A 4MNNA 3HZ8A 1PRXA 2GSQA 1SJ6A 5ECQB 1PMTA 2B1LA 3C71A 5D9XA 3LEFA 4F2IA 3AY8A 3J7Yk 1ERUA 3Q19A 2O8VB 3FZAA 1FHEA 4KSMA 6GSXA 4ICYA 20GSA 3D4MA 4I2UA 4KUNA 3E0UA 4FIWA 1J9BA 3KH7A 1OC9B 4J2FA 3MIXA 1PQNA 4GCIA 4GRFA 1Q4JA 4RQRA 3RPNA 3F8UA 2OACA 3LQ7A 3UEMA 4BIKA 4JR4A 3APOA 2OBIA 5CNWA 2KHPA 1T00A 2C8UA 1Y25A 1O73A 2RUEA 2DBCA 2JZSA 1XWBA 3EVIA 1GSFA 2DC5A 2NVLA 4OD7A 1PN9A 1GTBA 3FW2A 1B4PA 4O5UA 2LUSA 2FD3A 5DAKA 4ACSA 3UMAA 3G7JA 3GKXA 3FR9A 1R5PA 1UVZA 1GWCA 2LV3A 1XFLA 4RI7A 1CQGA 2YCDA 1ZYNA 3IE3A 2OADA 2CV4A 4OWYA 2WS2A 1FAAA 1SK0A 2VL9A 2MMOA 4L0UA 2VD0A 4ISDA 3A5WA 3F6FA 3D6IA 2CZ3A 3U5RE 2JZTA 4BVYB 3HVSA 2LRNA 3I69A 5J4UA 1OE8A 3GH6A 2HRAA 3WGXA 3GFKA 3O6TA 3DIEA 2L59A 2LTKA 2RLIA 2DJ3A 4OO5A 1ACVA 1GUMA 1XWKA 4F9ZA 4Q5RA 5HR0A 1A2JA 3UL3A 4NPBA 1B9YC 1MD3A 2WCIA 4LL1B 4TR4A 1GTAA 1O7UA 1MDIA 4ZB9A 2O85A 2PMTA 5INYA 4YAVA 3HDCA 2M72A 2CAIA 3R2QA 4IBPA 5BRTA 1FOVA 1TK0B 3FMWA 1LBKA 4N0ZA 2CX4A 1HNBA 1M3IA 4KH7A 5JWRB 4NHZA 5H5RA 3F9UA 3CTFA 2WRTA 3TDGA 4IN0A 2VCVA 1WWJA 5LD0A 3L9UA 5KN3A 4CY6A 1TTZA 3QOUA 3ZL5A 1FVKA 6GSYA 3LXZA 1PKZA 2GQLA 2HXKA 2HT9A 2K18A 3KP9A 2LKUA 2VCXA 1GP1A 4KCAA 1V57A 2FGXA 2K8SA 1G6WA 2LQQA 1U88A 2RUFA 4X1UA 4XRAA 4L5LA 2H76A 4QL9A 2J23A 1O85A 3QMXA 1SU9A 4K6XA 2HZEA 5ID2B 5EVOA 3L0HA 2FNOA 2OE0A 4YH2A 3EC3A 1Z5YE 1AIUA 3BBYA 1GSYA 5A5KA 2R0PA 3DXBA 4BA7A 2TRXA 4IW9A 4JRRA 1WJKA 2C80A 1UA5A 2MMAA 3KCMA 2MMZA 1XPVA 14GSA 2JSZA 3GMFA 5ECOB 1E2YA 4L0WA 4BVXB 1J08A 1BYEA 2R0CA 2YJ7A 4FYCA 1YKCA 3UIWA 1QXHA 2A4VA 3DGQA 6GSSA 2YZUA 4MH2A 5ECNB 3FEUA 2G2QA 1GSDA 4ULXA 2YWIA 4IELA 2FWEA 5DAKB 2I9HA 4IQAA 1A2LA 1Z7RA 1XW9A 2VD1A 5B6NA 1TJDA 3LG6A 3F4TA 3TOTA 4MF5A 3HJPA 5GAND 2IMDA 1RW1A 1YDKA 4MPGA 3FZ9A 1OE7A 3DRNA 2LRTA 1QGVA 3TKQA 3VLNA 2JL4A 3TJKA 1TK5B 4TXVA 1GLQA 3FHKA 2R37A 3KH9A 3IPZA 2X8GA 2NBSA 2VAFA 1C72A 5C00A 1YKAA 1YZXA 3KD0A 1XOAA 3IK7A 2I81A 4PXOA 3LXTA 1R5AA 2FWGA 1V98A 3KZQA 3IR4A 3LJRA 2YV7A 1TRWA 3IC4A 1NM3A 4Q5FA 2IL3A 2YANA 3GN3A 2XPDA 1EWXA 1AQXA 4BL7A 17GSA 3LYPA 1ZYEA 2F8FA 4V2MA 3HVXA 3P90A 5IIZA 2H70A 4X4JA 2ON5A 2L4CA 4OCEA 5D9TA 1ZYPA 4O5QA 5IOWA 4TVEA 2YZHA 4IVFA 1HNCA 1W4VA 1V58A 4HSCX 4N0VA 2C4JA 4YQUA 2H1GA 3A5IA 3TUEA 3SWLA 5ECKB 3C1SA 4CW9A 1JLWA 3C7MA 1OC9A 3HY2A 3GX0A 5ECLB 2GSTA 5ECIB 3QAGA 3CTGA 2GGTA 4GQFA 1M2DA 1YEPA 1PSQA 5GAPD 4YKFA 3J7Yb 2DJKA 2P0GA 2HZEB 2TRCP 3FZ4A 4D73A 2H0IA 5JWOB 4NHWA 2K6VA 1XW5A 2OKAA 3G9BA 4WF4A 1A24A 1GH2A 1ZOFA 3GTUB 5IO0A 1M7TA 4CHSA 3PINA 2QKEA 4TN8A 5J9CA 2GVPA 5IMZA 1ML6A 4X0XA 1GNEA 1UC7A 4OCFA 3BOAA 4MJEA 2B7JA 4EF0A 1H4OA 4GSSA 4K9ZA 2JU5A 4BVYA 4GLTA 1EGOA 3TRPA 1K3YA 1VF1A 1TK8B 3DKSA 4KW6A 2AHEA 3VI5A 1FO5A 3IXRA 2B5XA 4WETA 2L6CA 3U6VA 1T4ZA 4AJ6A 1F3BA 4EL1A 2OE3A 3ZITA 5H5SA 2JSYA 1AXDA 3GSSA 1K0MA 4V2LA 1WIKA 4O5RA 3C8EA 3KTLA 3DEXA 2AYTA 4FO5A 2R3XA 5GSTA 3PR8A 4BPYA 2WDUA 3TKSA 3H4KA 3TRXA 4V2NA 2EC4A 3P2AA 4JEDA 3IAM2 2YV9A 3TCOA 1JZDA 2C0FA 3D22A 5KOWA 2C0EA 3S9FA 4MJCA 1ST9A 2JADA 5CO3A 5DJMA 3CMIA 4H86A 2C0GA 4ZIJA 4E8HA 3P7XA 2X49A 2DIZA 5CAXA 1TU8A 2KUCA 1TRVA 5KN2A 2HSMA 2PERA 2H8LA 1V9WA 3UJ1A 3ZMKA 4K0NA 5IQYA 4N30A 4GSNA 2PWJA 1ERTA 1XWCA 1B8XA 1EP8A 5A4VA 3RBTA 3GURA 1A0FA 2RM5A 4TW5A 3W6GA 3DWVA 2H6ZA 5J3RA 1M2BA 2VCWA 5KEJA 3HVVA 1K0AA 5ABRA 4TR1A 4PQIA 2X4AA 5D9WA 1QQ2A 2ON7A 3IOSA 2ZNMA 2YNXA 1KTEA 3LW9A 4N10A 3E9JB 5ID2A 3EMXA 6GSUA 3MNGA 4J56E 4USSA 5ECSA 3VWVA 3EMPA 1OVNA 2ES7A 1XW6A 1TI1A 3UVHA 1M9AA 3Q18A 2QA1A 12GSA 3LSZA 1YEXA 3IV4A 4ZXGA 1URMA 4O7HA 3CQFA 4K2XA 4LMVA 1Q98A 3H93A 2YJHA 1Z3EA 3M3MA 2GDRA 5F05A 1M0UA 4BVXA 4EE0A 4K1FA 2H74A 1OC8A 1AC1A 13GSA 1U3AA 2EIOA 5EY6A 4D73B 4AGSA 3ZVJA 4V1Ap 4KA0A 4KX4A 1U3IA
chains in the Genus database with same CATH topology
6GSWA 4O32A 3HCZA 2GZYA 3BCKA 4GXZA 3UBKA 3L9SA 4G0IA 1JZRA 3ERWA 3TKRA 1HYUA 4OFNA 3IDVA 1V2AA 2CAQA 1EOHA 1K3LA 2IMFA 4HS1A 3GHAA 2A2SA 3DYRA 1WRYA 4KNDA 4WBJA 3TOUA 1U6TA 3DMLA 4NXIA 1HD2A 3HKRA 3WGDA 3QD9A 5CRDA 4XS6A 3IC8A 1GNWA 4YQVA 4GWRA 1SD8A 1XWGA 1TP9A 2ZCTA 3GUSA 1B4QA 4FYBA 5G2ZA 5DCGA 2X99A 3DD3A 2VLTA 1VGLA 5J9BA 2LQOA 5G1LA 4EDZA 2TIRA 4O92A 2M46A 3TRQA 4PTSA 4YKGA 4L5OA 1EP7A 4LLRA 2CT6A 3HYPA 3HA9A 1M99A 1SYXA 4Z7XA 5KOXA 1ABAA 2VM1A 4MMMA 1F3AA 1TRSA 5G5EA 2K9FA 1R26A 2C3TA 4LA1A 4TRXA 2MZCA 1ZL9A 1TDIA 1G7EA 2PVQA 3ZIVA 2OJLA 3PGTA 3ZRDA 1F9MA 2RIIA 2LEGA 4FYUA 1WOUA 2IFQB 3I9V2 4Z2TA 5ECPB 1SJIA 4MP4A 3Q74A 2HNLA 4HOJA 4QQ7A 1ZGNA 2L5LA 1TW9A 3G7IA 1XIYA 4HQZA 2ALBA 4Z2RA 4LL4B 4HQSA 3HXSA 4K8MA 3ZREA 2PPTA 3KMNA 4JBBA 3HD5A 4TR1B 1H75A 4IGJA 6GSVA 1ZMAA 4WEYA 3CBUA 7GSSA 3HJOA 2L4QA 11GSA 3WYWA 5JWQB 1YF1A 1XVWA 4TR0A 5JCWA 1YQ1A 1DSBA 4TR3A 5FHIA 1TU7A 4WBRD 2R5GA 1Z7PA 3GTUA 4DSSB 3P8WA 5IMCA 1HQOA 2IMKA 3VFIA 4KF9A 1LU4A 2VLVA 4L8EA 4TOPA 3FR6A 1OC3A 1MEKA 3ED3A 2FA4A 1GUHA 4XTSA 4ILFA 3ZYWA 2C3NA 1RQMA 2PU9C 1DE1A 4ZILA 2CVBA 1GRXA 3VWWA 2MBTA 4ID0A 2DMMA 3TJFA 3QPMA 3HHVA 5G30A 4ZBAA 2YOIA 3M9JA 5CRHA 4K7IA 2ZUPA 2H75A 2R0GA 2FA8A 5ENUA 3EYTA 1SYRA 3TB2A 3WT1A 1FVJA 2GZZA 2GT6A 2YPMA 2H1BA 2MYGA 2H1AA 1K3OA 2KP2A 2VLUA 3ZZXA 2LJRA 2N5AA 1PX7A 3GX8A 3I6AA 2H0GA 4IHUA 5HFIA 1AUCA 4DSQA 4EIQA 4ECIA 4GQCA 3EPTA 2J9HA 1QFNA 1LJRA 3L9VA 1W89A 4JR6A 4MF7A 1QMVA 5ECMB 1ZYQB 5AIXA 2CZ2A 5CRWA 1GTIA 2H73A 4POKA 5IMFA 1PN0A 2L57A 1K0OA 2X64A 5D96A 3RPPA 2FUG2 4TXOB 4EKZA 3GNJA 2B5EA 4NV5A 3GL5A 3KEBA 2HRKA 2F9SA 2XBQA 5E59A 2F3MA 1GL8A 1S3DA 1YY7A 4KDXA 4DVCA 2H01A 1ON4A 3D0ZA 4RI6A 1KEBA 2H66A 4OMVA 1U87A 5HR1A 1VRSD 2B5YA 4JU5A 4RUVA 1PX6A 3F0IA 1PKWA 3TKSC 4K5RA 4KB3A 2IPAA 1SK1A 2GZPA 3ZLPA 1DBYA 1IYIA 5IO2A 3MDKA 4KGIA 3APSA 1X5DA 4G2EA 3KP8A 2VCZA 2H72A 4HU7A 5ELAA 4CDOA 2E7PA 5J41A 1AQVA 1PD21 1EZKA 2LJAA 4HUAA 2QSIA 1X5CA 3TGZA 4ML1A 1YJ6A 1TKDB 4F82A 2IMEA 1J0FA 1G7OA 3KMOA 5D93A 4KAEA 4MF6A 2YN1A 3EURA 4P3YB 2DJ2A 4HJMA 2YWNA 1XBSA 2EIQA 2FLSA 2XBIA 2FY6A 3ZMLA 2P5QA 2B3SA 4I6XA 2LRCA 5HR2A 3TJJA 3GV1A 2E2GA 4MJAA 3O3TA 1GSEA 2VL2A 1ILOA 3C73A 2RM6A 3VPTA 4EVMA 4ECJA 2C1YA 3TJGA 1K0BA 4WKWA 5H5QA 4MABA 1OYJA 2X8HA 2L5OA 3TKSE 1SJZA 2PN8A 1OAZA 3H79A 4IQ1A 1KBNA 4IJ3A 1XVQA 5J5NA 3M9KA 1FG4A 2LNSA 2LS5A 4HEA2 2KLXA 2NTOA 1GULA 3TJBA 3ZFBA 2IJYA 1XWAA 4PNFA 3O76A 1F2EA 1A2MA 4XRDA 1UN2A 4EXJA 2WJUA 4BWSA 4MA9A 4NV2A 1SKRB 4HZ2A 3CXGA 4MZCA 5FWGA 4JE1A 5G5FA 4YAPA 3MYDA 1FB0A 5DBQA 4K0GA 3CSIA 2NDOA 4KCEA 3KJYA 3A2WA 3FR3A 2WZ9A 2GQKA 2UZ8A 3GA4A 5IMAA 4G0LA 2A2PA 2HSHA 1N2AA 5EL8A 5AISA 4HZ4A 5CREA 2DMLA 3N9JA 3RHCA 2IFQA 2HSYA 5DQSA 4POBA 2DJJA 4GF0A 3ISOA 3JCML 4ECBA 1SKWB 5ECRB 2CX3A 3CSJA 1PA3A 2YWOA 5DALA 4PUFC 2C0DA 1JZWA 4EDYA 1K0NA 3GL3A 3VWXA 1O8WA 4EUYA 5EPFA 16GSA 2E0QA 3W8JA 5DCHA 1I9DA 2OE1A 4XIHA 2VUPA 5F07A 1BEDA 2LSTA 1DE2A 2FWFA 2MMNA 2I3YA 4IP6A 4K7NA 2WFCA 5KN0A 2H30A 3H1NA 2Z9SA 4XS4A 2GLRA 4PQHA 3EU3A 4V1Ag 2JACA 2CQ9A 4HU9A 5D8IA 3APQA 4G10A 4DSSA 4I97A 4AJ8A 1AW9A 4AF2A 2HLSA 2V41A 5DQYA 2PVOC 3WD6A 1SKSB 4MCUA 1WE0A 5LCZA 5HFGA 4QL7A 3UOMA 1PL2A 2XPEA 4EIPA 1USBA 1BAYA 3US3A 1B9XC 3IBHA 3UBLA 2AAWA 1A8YA 4WR5A 2VCQA 3GH9A 4FH8A 3BCIA 3D5JA 1RK4A 3RAZA 2VO4A 2CVDA 1XOBA 2V1MA 2E2MA 4G9HA 2IWTA 3LWAA 2M80A 4PQ1A 3A3TA 5A4WA 2I4AA 2AUVA 4CY8A 4HDEA 1ERWA 3ZTLA 4Q5QA 3F4RA 2K8VA 1PGTA 1VF2A 1JFUA 5IM9A 4A5PA 2G0FA 5C04A 1M9BA 2R2JA 2WB9A 4Q5NA 4PUAA 3ZVJD 18GSA 3DVXA 1TRUA 4Z2UA 2GSRA 1K0DA 1X0RA 3H8QA 4PURA 1TXXA 4IS0A 4HI7A 4XCSA 4HJ2A 3MSZA 2BMXA 3IRAA 3LORA 3CYNA 3LGCA 1VF4A 2HI7A 4F0BA 1K0CA 2VIMA 1NW2A 4TXOA 2HRNA 2V2GA 2HZFA 3W8SA 5HR3A 1FW1A 4K5SA 2FWHA 4MZWA 3WGEA 2XHFA 3F4SA 4ECCA 3KIJA 2HRFA 3FRCA 1X9MB 2EIRA 5HFKA 2AV4A 4XHMA 1NHYA 19GSA 1JHBA 3LFLA 1IYHA 1R7HA 1Z9HA 1MDKA 2AB6A 5G31A 1FB6A 4DEJA 2A4HA 4I5QA 3I43A 1MD4A 2I1UA 4I2TA 5B7CA 1TOFA 1WP0A 1QK8A 10GSA 3ERGA 5DALB 3TKPA 3VWUA 1BX9A 9GSSA 1A0RP 2HYXA 4WXTA 2GTUA 1F37A 3IHQA 3KM6A 5CYYA 4ZBBA 3ZFLA 1JZOA 2IN3A 5CP1A 2H6XA 3QDNA 3MWHA 3ME8A 3LYKA 2HFDA 4XS4B 4POLA 1XCCA 1EEJA 2VM2A 4G19A 2DLXA 4KE3A 4MH3A 1NHOA 2H0HA 3EINA 2V6OA 2LJKA 1AQWA 4MK3A 3CRUA 1ZZYA 1AAZA 3F6DA 5GSSA 1GSQA 2DKHA 4MLYA 6GSTA 3VI7A 3L78A 3F3RA 2FHEA 4POMA 4ZBDA 1OKDA 3UVTA 5B8AA 1T7PB 2B6MA 3FZ5A 3D21A 1WMJA 4J57E 3GYKA 3ERFA 3OR5A 3NZNA 4E8EA 4FQUA 2VOCA 5B6MA 1X5EA 1XXUA 2CA8A 2N5FA 1T4YA 2H1DA 5JCUA 5L71A 4MZBA 1A23A 1B48A 3K8NA 3ME7A 3GSTA 5AN1A 1EGRA 3VK9A 1Z6MA 3QAWA 3WT2A 2X8CA 2L6DA 1SK2A 2QGVA 1EEMA 2O7KA 1ZCPA 1CQHA 2VCTA 4XS1A 3A2VA 1O81A 2OBKA 3KGKA 4IP1A 1NSWA 1THXA 2IMIA 5D9VA 2VL3A 3D4TA 2MBSA 5ECHB 5IMDA 2C3QA 1EV9A 2GQMA 3IAS2 3VURA 2VL2C 1VF3A 3QFBC 3KTBA 1T1VA 2YP6A 4MDCA 2H71A 1X9WB 2P5RA 4ZL7A 3MAKA 1Z6NA 5ELGA 1SL0B 5G1KA 5LNKe 4K2DA 5F0GA 4G0KA 1SL1B 2WULA 3GKMA 4GSTA 2DJ1A 2QA2A 2BJXA 2DSAA 3GKKA 2OA7A 3M1GA 3VPQA 1E6BA 1X9SB 22GSA 2F8AA 2FCHA 4ZB6A 3BJ5A 3FYGA 2DIYA 2R6KA 2A2RA 5JCGA 4IKHA 3V1WA 3N5OA 1BG5A 4KSOA 4F0CA 1XZOA 4WF5A 5KN1A 4EO3A 5DJLA 4IJIA 3F3QA 3NOFA 3QFAC 1T8EB 2O89A 3UAPA 4OFTA 2JZRA 4MJBA 3NIVA 4JZQA 1KNGA 4X43A 5D73A 3FKFA 5IPGA 2KP1A 2P31A 3A2XA 3F63A 1DUGA 2GT5A 3R3EA 2LNTA 2DJ0A 3L4NA 4DSRA 1O6JA 3SBCA 4MPFA 3IK9A 4ZL9A 3CSHA 2IIYA 4TKYA 2YWMA 2KOKA 3IHGA 5IOXA 3PH9A 1F6MC 4AJ7A 1G0TA 4LMWA 1SL2B 1EOGA 1R4WA 2N5BA 1HNAA 1A8LA 4NWYA 2PBJA 4KDUA 1S3CA 4K7OA 5F8BA 1BJXA 1JLVA 5A4UA 1GTUA 5E4WA 1GLPA 4ML6A 4PX1A 1ERVA 1QUWA 4ZB8A 3RDWA 1PL1A 4GTUA 1EV4A 1YF0A 8GSSA 5IMVA 2H6YA 3M8NA 3BD2A 3QR6A 4OO4A 3PPUA 2WGRA 3EE2A 3FK8A 1MTCA 2R4VA 1THOA 2CVKA 3Q6OA 3M0FA 1GUKA 2GSSA 4PNGA 4F03A 5HQPA 1WPIA 3UARA 3HZ4A 5COHA 1FOHA 3HJMA 3GKNA 3EWLA 1I5GA 2GS3A 4KDYA 5DVBA 2PGTA 1SD9A 1TI3A 2H19A 5AGYA 4OFMA 3EU4A 2B7KA 4PGTA 5IPHA 5AIVA 4NAXA 2NPBA 3E3EA 3GRXA 2D2ZA 2REMA 5FT3A 2HE3A 3FY7A 1N8JA 1S3AA 3CRTA 1O8XA 2AJQB 4EC0A 1G6YA 4NMUA 5GZZB 3G7YA 5CRGA 2BTOT 4RQXA 4YQMA 3GIXA 1Y6EA 2XC2A 4I8BA 3DVWA 2O87A 3QAVA 5BMUA 1MDJA 2DKIA 1GSUA 2QC7A 5DDLA 4ZL8A 2B1KA 4BWQA 4WR4A 3RHBA 4BL7B 3KXOA 1V40A 1GSSA 2V32A 3IA1A 5B8BA 4N11A 1M2AA 1BQ7A 1OKTA 2PUKC 5F06A 3ZIJA 2V6KA 3QCPA 3C1RA 1SENA 1T3BA 2F51A 4MNNA 3HZ8A 1PRXA 2GSQA 1SJ6A 5ECQB 1PMTA 2B1LA 3C71A 5D9XA 3LEFA 4F2IA 3AY8A 3J7Yk 1ERUA 3Q19A 2O8VB 3FZAA 1FHEA 4KSMA 6GSXA 4ICYA 20GSA 3D4MA 4I2UA 4KUNA 3E0UA 4FIWA 1J9BA 3KH7A 1OC9B 4J2FA 3MIXA 1PQNA 4GCIA 4GRFA 1Q4JA 4RQRA 3RPNA 3F8UA 2OACA 3LQ7A 3UEMA 4JR4A 3APOA 2OBIA 5CNWA 2KHPA 1T00A 2C8UA 1Y25A 1O73A 2RUEA 2DBCA 2JZSA 1XWBA 3EVIA 1GSFA 2DC5A 2NVLA 4OD7A 1PN9A 1GTBA 3FW2A 1B4PA 4O5UA 2LUSA 2FD3A 5DAKA 4ACSA 3UMAA 3G7JA 3GKXA 3FR9A 1R5PA 1UVZA 1GWCA 2LV3A 1XFLA 4RI7A 1CQGA 2YCDA 1ZYNA 3IE3A 2OADA 2CV4A 4OWYA 2WS2A 1FAAA 1SK0A 2VL9A 2MMOA 4L0UA 2VD0A 4ISDA 3A5WA 3F6FA 3D6IA 2CZ3A 3U5RE 2JZTA 4BVYB 3HVSA 2LRNA 3I69A 5J4UA 1OE8A 3GH6A 2HRAA 3WGXA 3GFKA 3O6TA 3DIEA 2L59A 2LTKA 2RLIA 2DJ3A 4OO5A 1ACVA 1GUMA 1XWKA 4F9ZA 4Q5RA 5HR0A 1A2JA 3UL3A 4NPBA 1B9YC 1MD3A 2WCIA 4LL1B 4TR4A 1GTAA 1O7UA 1MDIA 4ZB9A 2O85A 2PMTA 5INYA 4YAVA 3HDCA 2M72A 2CAIA 3R2QA 4IBPA 5BRTA 1FOVA 1TK0B 3FMWA 1LBKA 4N0ZA 2CX4A 1HNBA 4KH7A 5JWRB 4NHZA 5H5RA 3F9UA 3CTFA 2WRTA 3TDGA 4IN0A 2VCVA 1WWJA 5LD0A 3L9UA 5KN3A 4CY6A 1TTZA 3QOUA 3ZL5A 1FVKA 6GSYA 3LXZA 1PKZA 2GQLA 2HXKA 2HT9A 2K18A 3KP9A 2LKUA 2VCXA 1GP1A 4KCAA 1V57A 2FGXA 2K8SA 1G6WA 2LQQA 1U88A 2RUFA 4X1UA 4XRAA 4L5LA 2H76A 4QL9A 2J23A 1O85A 3QMXA 1SU9A 4K6XA 2HZEA 5ID2B 5EVOA 3L0HA 2FNOA 2OE0A 4YH2A 3EC3A 1Z5YE 1AIUA 3BBYA 1GSYA 5A5KA 2R0PA 3DXBA 4BA7A 2TRXA 4IW9A 4JRRA 1WJKA 2C80A 1UA5A 2MMAA 3KCMA 2MMZA 1XPVA 14GSA 2JSZA 3GMFA 5ECOB 1E2YA 4L0WA 4BVXB 1J08A 1BYEA 2R0CA 2YJ7A 4FYCA 1YKCA 3UIWA 1QXHA 2A4VA 3DGQA 6GSSA 2YZUA 4MH2A 5ECNB 3FEUA 2G2QA 1GSDA 4ULXA 2YWIA 4IELA 2FWEA 5DAKB 2I9HA 4IQAA 1A2LA 1Z7RA 1XW9A 2VD1A 5B6NA 1TJDA 3LG6A 3F4TA 3TOTA 4MF5A 3HJPA 5GAND 2IMDA 1RW1A 1YDKA 4MPGA 3FZ9A 1OE7A 3DRNA 2LRTA 1QGVA 3TKQA 3VLNA 2JL4A 3TJKA 1TK5B 4TXVA 1GLQA 3FHKA 2R37A 3KH9A 3IPZA 2X8GA 2NBSA 2VAFA 1C72A 5C00A 1YKAA 1YZXA 3KD0A 1XOAA 3IK7A 2I81A 4PXOA 3LXTA 1R5AA 2FWGA 1V98A 3KZQA 3IR4A 3LJRA 2YV7A 1TRWA 3IC4A 1NM3A 4Q5FA 2IL3A 2YANA 3GN3A 2XPDA 1EWXA 1AQXA 4BL7A 17GSA 3LYPA 1ZYEA 2F8FA 4V2MA 3HVXA 3P90A 5IIZA 2H70A 4X4JA 2ON5A 2L4CA 4OCEA 5D9TA 1ZYPA 4O5QA 5IOWA 4TVEA 2YZHA 4IVFA 1HNCA 1W4VA 1V58A 4N0VA 2C4JA 4YQUA 2H1GA 3A5IA 3TUEA 3SWLA 5ECKB 3C1SA 4CW9A 1JLWA 3C7MA 1OC9A 3HY2A 3GX0A 5ECLB 2GSTA 5ECIB 3QAGA 3CTGA 2GGTA 4GQFA 1M2DA 1YEPA 1PSQA 5GAPD 4YKFA 3J7Yb 2DJKA 2P0GA 2HZEB 2TRCP 3FZ4A 4D73A 2H0IA 5JWOB 4NHWA 2K6VA 1XW5A 2OKAA 3G9BA 4WF4A 1A24A 1GH2A 1ZOFA 3GTUB 5IO0A 1M7TA 4CHSA 3PINA 2QKEA 4TN8A 5J9CA 2GVPA 5IMZA 1ML6A 4X0XA 1GNEA 1UC7A 4OCFA 3BOAA 4MJEA 2B7JA 4EF0A 1H4OA 4GSSA 4K9ZA 2JU5A 4BVYA 4GLTA 1EGOA 3TRPA 1K3YA 1VF1A 1TK8B 3DKSA 4KW6A 2AHEA 3VI5A 1FO5A 3IXRA 2B5XA 4WETA 2L6CA 3U6VA 1T4ZA 4AJ6A 1F3BA 4EL1A 2OE3A 3ZITA 5H5SA 2JSYA 1AXDA 3GSSA 1K0MA 4V2LA 1WIKA 4O5RA 3C8EA 3KTLA 3DEXA 2AYTA 4FO5A 2R3XA 5GSTA 3PR8A 4BPYA 2WDUA 3TKSA 3H4KA 3TRXA 4V2NA 2EC4A 3P2AA 4JEDA 3IAM2 2YV9A 3TCOA 1JZDA 2C0FA 3D22A 5KOWA 2C0EA 3S9FA 4MJCA 1ST9A 2JADA 5CO3A 5DJMA 3CMIA 4H86A 2C0GA 4ZIJA 4E8HA 3P7XA 2X49A 2DIZA 5CAXA 1TU8A 2KUCA 1TRVA 5KN2A 2HSMA 2PERA 2H8LA 1V9WA 3UJ1A 3ZMKA 4K0NA 5IQYA 4N30A 4GSNA 2PWJA 1ERTA 1XWCA 1B8XA 1EP8A 5A4VA 3RBTA 3GURA 1A0FA 2RM5A 4TW5A 3W6GA 3DWVA 2H6ZA 5J3RA 1M2BA 2VCWA 5KEJA 3HVVA 1K0AA 5ABRA 4TR1A 4PQIA 2X4AA 5D9WA 1QQ2A 2ON7A 3IOSA 2ZNMA 2YNXA 1KTEA 3LW9A 4N10A 3E9JB 5ID2A 3EMXA 6GSUA 3MNGA 4J56E 4USSA 5ECSA 3VWVA 3EMPA 1OVNA 2ES7A 1XW6A 1TI1A 3UVHA 1M9AA 3Q18A 2QA1A 12GSA 3LSZA 1YEXA 3IV4A 4ZXGA 1URMA 4O7HA 4K2XA 4LMVA 1Q98A 3H93A 2YJHA 1Z3EA 3M3MA 2GDRA 5F05A 1M0UA 4BVXA 4EE0A 4K1FA 2H74A 1OC8A 1AC1A 13GSA 1U3AA 2EIOA 5EY6A 4D73B 4AGSA 3ZVJA 4V1Ap 4KA0A 4KX4A 1U3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 6GSW A;  4O32 A;  3HCZ A;  2GZY A;  3BCK A;  4GXZ A;  3UBK A;  3L9S A;  1JZR A;  3ERW A;  3TKR A;  1HYU A;  4OFN A;  3IDV A;  1V2A A;  2CAQ A;  1EOH A;  1K3L A;  2IMF A;  4HS1 A;  3GHA A;  2A2S A;  3DYR A;  1WRY A;  4KND A;  4WBJ A;  3TOU A;  1U6T A;  3DML A;  4NXI A;  1HD2 A;  3HKR A;  3WGD A;  3QD9 A;  5CRD A;  4XS6 A;  1GNW A;  4YQV A;  4GWR A;  1SD8 A;  1XWG A;  1TP9 A;  2ZCT A;  3GUS A;  1B4Q A;  4FYB A;  5G2Z A;  5DCG A;  2X99 A;  3DD3 A;  2VLT A;  1VGL A;  5J9B A;  2LQO A;  5G1L A;  4EDZ A;  2TIR A;  4O92 A;  2M46 A;  3TRQ A;  4L5O A;  1EP7 A;  4LLR A;  2CT6 A;  3HYP A;  3HA9 A;  1M99 A;  1SYX A;  4Z7X A;  1ABA A;  2VM1 A;  4MMM A;  1F3A A;  1TRS A;  5G5E A;  2K9F A;  1R26 A;  2C3T A;  4LA1 A;  4TRX A;  2MZC A;  1ZL9 A;  1TDI A;  1G7E A;  2PVQ A;  3ZIV A;  2OJL A;  3PGT A;  3ZRD A;  1F9M A;  2RII A;  2LEG A;  4FYU A;  1WOU A;  2IFQ B;  3I9V 2;  5ECP B;  1SJI A;  4MP4 A;  3Q74 A;  2HNL A;  4HOJ A;  4QQ7 A;  1ZGN A;  2L5L A;  1TW9 A;  3G7I A;  1XIY A;  4HQZ A;  2ALB A;  4LL4 B;  4HQS A;  3HXS A;  4K8M A;  3ZRE A;  2PPT A;  3KMN A;  4JBB A;  3HD5 A;  4TR1 B;  1H75 A;  4IGJ A;  6GSV A;  1ZMA A;  4WEY A;  3CBU A;  7GSS A;  3HJO A;  2L4Q A;  11GS A;  3WYW A;  5JWQ B;  1YF1 A;  1XVW A;  4TR0 A;  5JCW A;  1YQ1 A;  1DSB A;  4TR3 A;  5FHI A;  1TU7 A;  4WBR D;  2R5G A;  1Z7P A;  3GTU A;  4DSS B;  3P8W A;  5IMC A;  1HQO A;  2IMK A;  3VFI A;  1LU4 A;  2VLV A;  4L8E A;  4TOP A;  3FR6 A;  1OC3 A;  1MEK A;  3ED3 A;  2FA4 A;  1GUH A;  4XTS A;  4ILF A;  3ZYW A;  2C3N A;  1RQM A;  2PU9 C;  1DE1 A;  4ZIL A;  2CVB A;  1GRX A;  3VWW A;  2MBT A;  4ID0 A;  2DMM A;  3TJF A;  3QPM A;  3HHV A;  5G30 A;  4ZBA A;  2YOI A;  3M9J A;  5CRH A;  4K7I A;  2ZUP A;  2H75 A;  2FA8 A;  5ENU A;  3EYT A;  1SYR A;  3TB2 A;  3WT1 A;  1FVJ A;  2GZZ A;  2GT6 A;  2YPM A;  2H1B A;  2MYG A;  2H1A A;  1K3O A;  2KP2 A;  2VLU A;  3ZZX A;  2LJR A;  2N5A A;  1PX7 A;  3GX8 A;  3I6A A;  2H0G A;  4IHU A;  5HFI A;  1AUC A;  4DSQ A;  4ECI A;  4GQC A;  2J9H A;  1QFN A;  1LJR A;  3L9V A;  1W89 A;  4JR6 A;  4MF7 A;  1QMV A;  5ECM B;  1ZYQ B;  5AIX A;  2CZ2 A;  5CRW A;  1GTI A;  2H73 A;  4POK A;  5IMF A;  2L57 A;  1K0O A;  2X64 A;  5D96 A;  3RPP A;  2FUG 2;  4TXO B;  4EKZ A;  3GNJ A;  2B5E A;  4NV5 A;  3GL5 A;  3KEB A;  2F9S A;  2XBQ A;  5E59 A;  2F3M A;  1GL8 A;  1S3D A;  1YY7 A;  4KDX A;  4DVC A;  2H01 A;  1ON4 A;  3D0Z A;  4RI6 A;  1KEB A;  2H66 A;  4OMV A;  1U87 A;  5HR1 A;  1VRS D;  2B5Y A;  4JU5 A;  4RUV A;  1PX6 A;  3F0I A;  1PKW A;  3TKS C;  4KB3 A;  2IPA A;  1SK1 A;  2GZP A;  3ZLP A;  1DBY A;  1IYI A;  5IO2 A;  3MDK A;  4KGI A;  3APS A;  1X5D A;  4G2E A;  3KP8 A;  2VCZ A;  2H72 A;  4HU7 A;  5ELA A;  4CDO A;  2E7P A;  5J41 A;  1AQV A;  1PD2 1;  1EZK A;  2LJA A;  4HUA A;  2QSI A;  1X5C A;  3TGZ A;  4ML1 A;  1YJ6 A;  1TKD B;  4F82 A;  2IME A;  1J0F A;  1G7O A;  3KMO A;  5D93 A;  4KAE A;  4MF6 A;  2YN1 A;  3EUR A;  4P3Y B;  2DJ2 A;  4HJM A;  2YWN A;  1XBS A;  2EIQ A;  2FLS A;  2XBI A;  2FY6 A;  3ZML A;  2P5Q A;  2B3S A;  4I6X A;  2LRC A;  5HR2 A;  3TJJ A;  3GV1 A;  2E2G A;  4MJA A;  3O3T A;  1GSE A;  2VL2 A;  1ILO A;  3C73 A;  2RM6 A;  3VPT A;  4EVM A;  4ECJ A;  2C1Y A;  3TJG A;  1K0B A;  4WKW A;  5H5Q A;  4MAB A;  1OYJ A;  2X8H A;  2L5O A;  3TKS E;  1SJZ A;  2PN8 A;  1OAZ A;  3H79 A;  4IQ1 A;  1KBN A;  4IJ3 A;  1XVQ A;  5J5N A;  3M9K A;  1FG4 A;  2LNS A;  2LS5 A;  4HEA 2;  2KLX A;  2NTO A;  1GUL A;  3TJB A;  3ZFB A;  2IJY A;  1XWA A;  4PNF A;  3O76 A;  1F2E A;  1A2M A;  4XRD A;  1UN2 A;  4EXJ A;  2WJU A;  4BWS A;  4MA9 A;  4NV2 A;  1SKR B;  4HZ2 A;  3CXG A;  4MZC A;  5FWG A;  4JE1 A;  5G5F A;  4YAP A;  1FB0 A;  5DBQ A;  4K0G A;  3CSI A;  2NDO A;  4KCE A;  3KJY A;  3A2W A;  3FR3 A;  2WZ9 A;  2GQK A;  3GA4 A;  5IMA A;  2HSH A;  1N2A A;  5EL8 A;  5AIS A;  4HZ4 A;  5CRE A;  2DML A;  3N9J A;  3RHC A;  2IFQ A;  2HSY A;  5DQS A;  4POB A;  2DJJ A;  4GF0 A;  3ISO A;  3JCM L;  4ECB A;  1SKW B;  5ECR B;  2CX3 A;  3CSJ A;  1PA3 A;  2YWO A;  5DAL A;  4PUF C;  2C0D A;  1JZW A;  4EDY A;  1K0N A;  3GL3 A;  3VWX A;  1O8W A;  4EUY A;  5EPF A;  16GS A;  2E0Q A;  3W8J A;  5DCH A;  1I9D A;  2OE1 A;  4XIH A;  2VUP A;  5F07 A;  1BED A;  2LST A;  1DE2 A;  2FWF A;  2MMN A;  2I3Y A;  4IP6 A;  4K7N A;  2WFC A;  5KN0 A;  2H30 A;  3H1N A;  2Z9S A;  4XS4 A;  2GLR A;  4PQH A;  3EU3 A;  4V1A g;  2JAC A;  2CQ9 A;  4HU9 A;  5D8I A;  3APQ A;  4G10 A;  4DSS A;  4I97 A;  4AJ8 A;  1AW9 A;  4AF2 A;  2HLS A;  2V41 A;  5DQY A;  2PVO C;  3WD6 A;  1SKS B;  4MCU A;  1WE0 A;  5LCZ A;  5HFG A;  4QL7 A;  3UOM A;  1PL2 A;  2XPE A;  1USB A;  1BAY A;  3US3 A;  1B9X C;  3IBH A;  3UBL A;  2AAW A;  1A8Y A;  4WR5 A;  2VCQ A;  3GH9 A;  4FH8 A;  3BCI A;  3D5J A;  1RK4 A;  3RAZ A;  2VO4 A;  2CVD A;  1XOB A;  2V1M A;  2E2M A;  4G9H A;  2IWT A;  3LWA A;  2M80 A;  4PQ1 A;  3A3T A;  5A4W A;  2I4A A;  2AUV A;  4HDE A;  1ERW A;  3ZTL A;  4Q5Q A;  3F4R A;  2K8V A;  1PGT A;  1VF2 A;  1JFU A;  5IM9 A;  2G0F A;  5C04 A;  1M9B A;  2R2J A;  2WB9 A;  4Q5N A;  4PUA A;  3ZVJ D;  18GS A;  3DVX A;  1TRU A;  2GSR A;  1K0D A;  1X0R A;  3H8Q A;  4PUR A;  1TXX A;  4IS0 A;  4HI7 A;  4XCS A;  4HJ2 A;  3MSZ A;  2BMX A;  3IRA A;  3LOR A;  3CYN A;  3LGC A;  1VF4 A;  2HI7 A;  4F0B A;  1K0C A;  2VIM A;  1NW2 A;  4TXO A;  2HRN A;  2V2G A;  2HZF A;  3W8S A;  5HR3 A;  1FW1 A;  2FWH A;  4MZW A;  3WGE A;  2XHF A;  3F4S A;  4ECC A;  3KIJ A;  2HRF A;  3FRC A;  1X9M B;  2EIR A;  5HFK A;  2AV4 A;  4XHM A;  1NHY A;  19GS A;  1JHB A;  3LFL A;  1IYH A;  1R7H A;  1Z9H A;  1MDK A;  2AB6 A;  5G31 A;  1FB6 A;  4DEJ A;  4I5Q A;  3I43 A;  1MD4 A;  2I1U A;  4I2T A;  5B7C A;  1TOF A;  1WP0 A;  1QK8 A;  10GS A;  3ERG A;  5DAL B;  3TKP A;  3VWU A;  1BX9 A;  9GSS A;  1A0R P;  2HYX A;  4WXT A;  2GTU A;  1F37 A;  3IHQ A;  3KM6 A;  5CYY A;  4ZBB A;  3ZFL A;  1JZO A;  2IN3 A;  5CP1 A;  2H6X A;  3QDN A;  3MWH A;  3ME8 A;  3LYK A;  2HFD A;  4XS4 B;  4POL A;  1XCC A;  1EEJ A;  2VM2 A;  4G19 A;  2DLX A;  4KE3 A;  4MH3 A;  1NHO A;  2H0H A;  3EIN A;  2V6O A;  2LJK A;  1AQW A;  4MK3 A;  3CRU A;  1ZZY A;  1AAZ A;  3F6D A;  5GSS A;  1GSQ A;  4MLY A;  6GST A;  3VI7 A;  3L78 A;  3F3R A;  2FHE A;  4POM A;  4ZBD A;  1OKD A;  3UVT A;  5B8A A;  1T7P B;  2B6M A;  3FZ5 A;  3D21 A;  1WMJ A;  4J57 E;  3GYK A;  3ERF A;  3OR5 A;  3NZN A;  4E8E A;  2VOC A;  5B6M A;  1X5E A;  1XXU A;  2CA8 A;  2N5F A;  1T4Y A;  2H1D A;  5JCU A;  5L71 A;  4MZB A;  1A23 A;  1B48 A;  3K8N A;  3ME7 A;  3GST A;  5AN1 A;  1EGR A;  3VK9 A;  1Z6M A;  3QAW A;  3WT2 A;  2X8C A;  2L6D A;  1SK2 A;  2QGV A;  1EEM A;  2O7K A;  1ZCP A;  1CQH A;  2VCT A;  4XS1 A;  3A2V A;  1O81 A;  2OBK A;  3KGK A;  4IP1 A;  1NSW A;  1THX A;  2IMI A;  5D9V A;  2VL3 A;  3D4T A;  2MBS A;  5ECH B;  5IMD A;  2C3Q A;  1EV9 A;  2GQM A;  3IAS 2;  3VUR A;  2VL2 C;  1VF3 A;  3QFB C;  3KTB A;  1T1V A;  2YP6 A;  4MDC A;  2H71 A;  1X9W B;  2P5R A;  4ZL7 A;  3MAK A;  1Z6N A;  5ELG A;  1SL0 B;  5G1K A;  5LNK e;  4K2D A;  5F0G A;  1SL1 B;  2WUL A;  3GKM A;  4GST A;  2DJ1 A;  2BJX A;  2DSA A;  3GKK A;  2OA7 A;  3M1G A;  3VPQ A;  1E6B A;  1X9S B;  22GS A;  2F8A A;  2FCH A;  4ZB6 A;  3BJ5 A;  3FYG A;  2DIY A;  2R6K A;  2A2R A;  5JCG A;  4IKH A;  3V1W A;  3N5O A;  1BG5 A;  4KSO A;  4F0C A;  1XZO A;  4WF5 A;  5KN1 A;  4EO3 A;  5DJL A;  4IJI A;  3F3Q A;  3NOF A;  3QFA C;  1T8E B;  2O89 A;  3UAP A;  4OFT A;  2JZR A;  4MJB A;  3NIV A;  4JZQ A;  1KNG A;  4X43 A;  5D73 A;  3FKF A;  5IPG A;  2KP1 A;  2P31 A;  3A2X A;  3F63 A;  1DUG A;  2GT5 A;  2LNT A;  2DJ0 A;  3L4N A;  4DSR A;  1O6J A;  3SBC A;  4MPF A;  3IK9 A;  4ZL9 A;  3CSH A;  2IIY A;  4TKY A;  2YWM A;  2KOK A;  5IOX A;  3PH9 A;  1F6M C;  4AJ7 A;  1G0T A;  4LMW A;  1SL2 B;  1EOG A;  1R4W A;  2N5B A;  1HNA A;  1A8L A;  4NWY A;  2PBJ A;  4KDU A;  1S3C A;  4K7O A;  5F8B A;  1BJX A;  1JLV A;  5A4U A;  1GTU A;  5E4W A;  1GLP A;  4ML6 A;  4PX1 A;  1ERV A;  1QUW A;  4ZB8 A;  3RDW A;  1PL1 A;  4GTU A;  1EV4 A;  1YF0 A;  8GSS A;  5IMV A;  2H6Y A;  3M8N A;  3BD2 A;  3QR6 A;  4OO4 A;  2WGR A;  3EE2 A;  3FK8 A;  1MTC A;  2R4V A;  1THO A;  2CVK A;  3Q6O A;  3M0F A;  1GUK A;  2GSS A;  4PNG A;  4F03 A;  5HQP A;  1WPI A;  3UAR A;  3HZ4 A;  5COH A;  3HJM A;  3GKN A;  3EWL A;  1I5G A;  2GS3 A;  4KDY A;  5DVB A;  2PGT A;  1SD9 A;  1TI3 A;  2H19 A;  5AGY A;  4OFM A;  3EU4 A;  2B7K A;  4PGT A;  5IPH A;  5AIV A;  4NAX A;  2NPB A;  3E3E A;  3GRX A;  2D2Z A;  2REM A;  5FT3 A;  2HE3 A;  3FY7 A;  1N8J A;  1S3A A;  3CRT A;  1O8X A;  2AJQ B;  4EC0 A;  1G6Y A;  4NMU A;  5GZZ B;  3G7Y A;  5CRG A;  2BTO T;  4RQX A;  4YQM A;  3GIX A;  1Y6E A;  2XC2 A;  4I8B A;  3DVW A;  2O87 A;  3QAV A;  1MDJ A;  1GSU A;  2QC7 A;  5DDL A;  4ZL8 A;  2B1K A;  4BWQ A;  4WR4 A;  3RHB A;  3KXO A;  1V40 A;  1GSS A;  2V32 A;  3IA1 A;  5B8B A;  4N11 A;  1M2A A;  1BQ7 A;  1OKT A;  2PUK C;  5F06 A;  3ZIJ A;  2V6K A;  3QCP A;  3C1R A;  1SEN A;  1T3B A;  2F51 A;  3HZ8 A;  1PRX A;  2GSQ A;  1SJ6 A;  5ECQ B;  1PMT A;  2B1L A;  3C71 A;  5D9X A;  3LEF A;  4F2I A;  3AY8 A;  3J7Y k;  1ERU A;  3Q19 A;  2O8V B;  3FZA A;  1FHE A;  4KSM A;  6GSX A;  20GS A;  3D4M A;  4I2U A;  4KUN A;  3E0U A;  4FIW A;  1J9B A;  3KH7 A;  1OC9 B;  4J2F A;  1PQN A;  4GCI A;  4GRF A;  1Q4J A;  4RQR A;  3RPN A;  3F8U A;  2OAC A;  3LQ7 A;  3UEM A;  4JR4 A;  3APO A;  2OBI A;  5CNW A;  2KHP A;  1T00 A;  2C8U A;  1Y25 A;  1O73 A;  2RUE A;  2DBC A;  2JZS A;  1XWB A;  3EVI A;  1GSF A;  2DC5 A;  2NVL A;  4OD7 A;  1PN9 A;  1GTB A;  3FW2 A;  1B4P A;  2LUS A;  2FD3 A;  5DAK A;  4ACS A;  3UMA A;  3G7J A;  3GKX A;  3FR9 A;  1R5P A;  1UVZ A;  1GWC A;  2LV3 A;  1XFL A;  4RI7 A;  1CQG A;  2YCD A;  3IE3 A;  2OAD A;  2CV4 A;  4OWY A;  2WS2 A;  1FAA A;  1SK0 A;  2VL9 A;  2MMO A;  4L0U A;  2VD0 A;  4ISD A;  3A5W A;  3F6F A;  3D6I A;  2CZ3 A;  3U5R E;  2JZT A;  3HVS A;  2LRN A;  3I69 A;  5J4U A;  1OE8 A;  3GH6 A;  3WGX A;  3GFK A;  3O6T A;  3DIE A;  2L59 A;  2LTK A;  2RLI A;  2DJ3 A;  4OO5 A;  1ACV A;  1GUM A;  1XWK A;  4F9Z A;  4Q5R A;  5HR0 A;  1A2J A;  3UL3 A;  4NPB A;  1B9Y C;  1MD3 A;  2WCI A;  4LL1 B;  4TR4 A;  1GTA A;  1O7U A;  1MDI A;  4ZB9 A;  2O85 A;  2PMT A;  5INY A;  4YAV A;  3HDC A;  2M72 A;  2CAI A;  3R2Q A;  4IBP A;  1FOV A;  1TK0 B;  1LBK A;  4N0Z A;  2CX4 A;  1HNB A;  4KH7 A;  5JWR B;  4NHZ A;  5H5R A;  3F9U A;  3CTF A;  2WRT A;  3TDG A;  4IN0 A;  2VCV A;  1WWJ A;  5LD0 A;  3L9U A;  5KN3 A;  1TTZ A;  3QOU A;  3ZL5 A;  1FVK A;  6GSY A;  3LXZ A;  1PKZ A;  2GQL A;  2HXK A;  2HT9 A;  2K18 A;  3KP9 A;  2LKU A;  2VCX A;  1GP1 A;  4KCA A;  1V57 A;  2FGX A;  2K8S A;  1G6W A;  2LQQ A;  1U88 A;  2RUF A;  4X1U A;  4XRA A;  4L5L A;  2H76 A;  4QL9 A;  2J23 A;  1O85 A;  3QMX A;  1SU9 A;  4K6X A;  2HZE A;  5ID2 B;  5EVO A;  3L0H A;  2FNO A;  2OE0 A;  4YH2 A;  3EC3 A;  1Z5Y E;  1AIU A;  3BBY A;  1GSY A;  5A5K A;  3DXB A;  4BA7 A;  2TRX A;  4IW9 A;  4JRR A;  1WJK A;  2C80 A;  1UA5 A;  2MMA A;  3KCM A;  2MMZ A;  1XPV A;  14GS A;  2JSZ A;  3GMF A;  5ECO B;  1E2Y A;  4L0W A;  1J08 A;  1BYE A;  2YJ7 A;  4FYC A;  1YKC A;  3UIW A;  1QXH A;  2A4V A;  3DGQ A;  6GSS A;  2YZU A;  4MH2 A;  5ECN B;  3FEU A;  2G2Q A;  1GSD A;  4ULX A;  2YWI A;  4IEL A;  2FWE A;  5DAK B;  2I9H A;  4IQA A;  1A2L A;  1Z7R A;  1XW9 A;  2VD1 A;  5B6N A;  1TJD A;  3LG6 A;  3F4T A;  3TOT A;  4MF5 A;  3HJP A;  5GAN D;  2IMD A;  1RW1 A;  1YDK A;  4MPG A;  3FZ9 A;  1OE7 A;  3DRN A;  2LRT A;  1QGV A;  3TKQ A;  3VLN A;  2JL4 A;  3TJK A;  1TK5 B;  4TXV A;  1GLQ A;  3FHK A;  2R37 A;  3KH9 A;  3IPZ A;  2X8G A;  2NBS A;  2VAF A;  1C72 A;  5C00 A;  1YKA A;  1YZX A;  3KD0 A;  1XOA A;  3IK7 A;  2I81 A;  4PXO A;  3LXT A;  1R5A A;  2FWG A;  1V98 A;  3KZQ A;  3IR4 A;  3LJR A;  2YV7 A;  1TRW A;  3IC4 A;  1NM3 A;  4Q5F A;  2IL3 A;  2YAN A;  3GN3 A;  2XPD A;  1EWX A;  1AQX A;  4BL7 A;  17GS A;  3LYP A;  1ZYE A;  2F8F A;  4V2M A;  3HVX A;  3P90 A;  5IIZ A;  2H70 A;  2ON5 A;  2L4C A;  4OCE A;  5D9T A;  5IOW A;  4TVE A;  2YZH A;  4IVF A;  1HNC A;  1W4V A;  1V58 A;  4N0V A;  2C4J A;  4YQU A;  2H1G A;  3TUE A;  3SWL A;  5ECK B;  3C1S A;  4CW9 A;  1JLW A;  3C7M A;  1OC9 A;  3HY2 A;  3GX0 A;  5ECL B;  2GST A;  5ECI B;  3QAG A;  3CTG A;  2GGT A;  4GQF A;  1M2D A;  1YEP A;  1PSQ A;  5GAP D;  3J7Y b;  2DJK A;  2P0G A;  2HZE B;  2TRC P;  3FZ4 A;  4D73 A;  2H0I A;  5JWO B;  4NHW A;  2K6V A;  1XW5 A;  2OKA A;  3G9B A;  4WF4 A;  1A24 A;  1GH2 A;  1ZOF A;  3GTU B;  5IO0 A;  1M7T A;  4CHS A;  3PIN A;  2QKE A;  4TN8 A;  5J9C A;  2GVP A;  5IMZ A;  1ML6 A;  4X0X A;  1GNE A;  1UC7 A;  4OCF A;  3BOA A;  4MJE A;  2B7J A;  4EF0 A;  1H4O A;  4GSS A;  4K9Z A;  2JU5 A;  4BVY A;  4GLT A;  1EGO A;  3TRP A;  1K3Y A;  1VF1 A;  1TK8 B;  3DKS A;  4KW6 A;  2AHE A;  3VI5 A;  1FO5 A;  3IXR A;  2B5X A;  4WET A;  2L6C A;  3U6V A;  1T4Z A;  4AJ6 A;  1F3B A;  4EL1 A;  2OE3 A;  3ZIT A;  5H5S A;  2JSY A;  1AXD A;  3GSS A;  1K0M A;  4V2L A;  1WIK A;  4O5R A;  3C8E A;  3KTL A;  3DEX A;  2AYT A;  4FO5 A;  2R3X A;  5GST A;  3PR8 A;  4BPY A;  2WDU A;  3TKS A;  3H4K A;  3TRX A;  4V2N A;  2EC4 A;  3P2A A;  4JED A;  3IAM 2;  2YV9 A;  3TCO A;  1JZD A;  2C0F A;  3D22 A;  2C0E A;  3S9F A;  4MJC A;  1ST9 A;  2JAD A;  5CO3 A;  5DJM A;  3CMI A;  4H86 A;  2C0G A;  4ZIJ A;  4E8H A;  3P7X A;  2DIZ A;  5CAX A;  1TU8 A;  2KUC A;  1TRV A;  5KN2 A;  2PER A;  2H8L A;  1V9W A;  3UJ1 A;  3ZMK A;  4K0N A;  5IQY A;  4N30 A;  4GSN A;  2PWJ A;  1ERT A;  1XWC A;  1B8X A;  1EP8 A;  5A4V A;  3RBT A;  3GUR A;  1A0F A;  2RM5 A;  4TW5 A;  3W6G A;  3DWV A;  2H6Z A;  5J3R A;  1M2B A;  2VCW A;  5KEJ A;  3HVV A;  1K0A A;  5ABR A;  4TR1 A;  4PQI A;  5D9W A;  1QQ2 A;  2ON7 A;  3IOS A;  2ZNM A;  2YNX A;  1KTE A;  4N10 A;  3E9J B;  5ID2 A;  3EMX A;  6GSU A;  3MNG A;  4J56 E;  5ECS A;  3VWV A;  3EMP A;  1OVN A;  2ES7 A;  1XW6 A;  1TI1 A;  3UVH A;  1M9A A;  3Q18 A;  12GS A;  3LSZ A;  1YEX A;  3IV4 A;  4ZXG A;  1URM A;  4O7H A;  4LMV A;  1Q98 A;  3H93 A;  2YJH A;  1Z3E A;  3M3M A;  2GDR A;  5F05 A;  1M0U A;  4BVX A;  4EE0 A;  4K1F A;  2H74 A;  1OC8 A;  1AC1 A;  13GS A;  1U3A A;  2EIO A;  5EY6 A;  4D73 B;  4AGS A;  3ZVJ A;  4V1A p;  4KA0 A;  4KX4 A;  1U3I A; 
#chains in the Genus database with same CATH topology
 6GSW A;  4O32 A;  3HCZ A;  2GZY A;  3BCK A;  4GXZ A;  3UBK A;  3L9S A;  4G0I A;  1JZR A;  3ERW A;  3TKR A;  1HYU A;  4OFN A;  3IDV A;  1V2A A;  2CAQ A;  1EOH A;  1K3L A;  2IMF A;  4HS1 A;  3GHA A;  2A2S A;  3DYR A;  1WRY A;  4KND A;  4WBJ A;  3TOU A;  1U6T A;  3DML A;  4NXI A;  1HD2 A;  3HKR A;  3WGD A;  3QD9 A;  5CRD A;  4XS6 A;  3IC8 A;  1GNW A;  4YQV A;  4GWR A;  1SD8 A;  1XWG A;  1TP9 A;  2ZCT A;  3GUS A;  1B4Q A;  4FYB A;  5G2Z A;  5DCG A;  2X99 A;  3DD3 A;  2VLT A;  1VGL A;  5J9B A;  2LQO A;  5G1L A;  4EDZ A;  2TIR A;  4O92 A;  2M46 A;  3TRQ A;  4PTS A;  4YKG A;  4L5O A;  1EP7 A;  4LLR A;  2CT6 A;  3HYP A;  3HA9 A;  1M99 A;  1SYX A;  4Z7X A;  5KOX A;  1ABA A;  2VM1 A;  4MMM A;  1F3A A;  1TRS A;  5G5E A;  2K9F A;  1R26 A;  2C3T A;  4LA1 A;  4TRX A;  2MZC A;  1ZL9 A;  1TDI A;  1G7E A;  2PVQ A;  3ZIV A;  2OJL A;  3PGT A;  3ZRD A;  1F9M A;  2RII A;  2LEG A;  4FYU A;  1WOU A;  2IFQ B;  3I9V 2;  4Z2T A;  5ECP B;  1SJI A;  4MP4 A;  3Q74 A;  2HNL A;  4HOJ A;  4QQ7 A;  1ZGN A;  2L5L A;  1TW9 A;  3G7I A;  1XIY A;  4HQZ A;  2ALB A;  4Z2R A;  4LL4 B;  4HQS A;  3HXS A;  4K8M A;  3ZRE A;  2PPT A;  3KMN A;  4JBB A;  3HD5 A;  4TR1 B;  1H75 A;  4IGJ A;  6GSV A;  1ZMA A;  4WEY A;  3CBU A;  7GSS A;  3HJO A;  2L4Q A;  11GS A;  3WYW A;  5JWQ B;  1YF1 A;  1XVW A;  4TR0 A;  5JCW A;  1YQ1 A;  1DSB A;  4TR3 A;  5FHI A;  1TU7 A;  4WBR D;  2R5G A;  1Z7P A;  3GTU A;  4DSS B;  3P8W A;  5IMC A;  1HQO A;  2IMK A;  3VFI A;  4KF9 A;  1LU4 A;  2VLV A;  4L8E A;  4TOP A;  3FR6 A;  1OC3 A;  1MEK A;  3ED3 A;  2FA4 A;  1GUH A;  4XTS A;  4ILF A;  3ZYW A;  2C3N A;  1RQM A;  2PU9 C;  1DE1 A;  4ZIL A;  2CVB A;  1GRX A;  3VWW A;  2MBT A;  4ID0 A;  2DMM A;  3TJF A;  3QPM A;  3HHV A;  5G30 A;  4ZBA A;  2YOI A;  3M9J A;  5CRH A;  4K7I A;  2ZUP A;  2H75 A;  2R0G A;  2FA8 A;  5ENU A;  3EYT A;  1SYR A;  3TB2 A;  3WT1 A;  1FVJ A;  2GZZ A;  2GT6 A;  2YPM A;  2H1B A;  2MYG A;  2H1A A;  1K3O A;  2KP2 A;  2VLU A;  3ZZX A;  2LJR A;  2N5A A;  1PX7 A;  3GX8 A;  3I6A A;  2H0G A;  4IHU A;  5HFI A;  1AUC A;  4DSQ A;  4EIQ A;  4ECI A;  4GQC A;  3HVN A;  3EPT A;  2J9H A;  1QFN A;  1LJR A;  3L9V A;  1W89 A;  4JR6 A;  4MF7 A;  1QMV A;  5ECM B;  1ZYQ B;  5AIX A;  2CZ2 A;  5CRW A;  1GTI A;  2H73 A;  4POK A;  5IMF A;  1PN0 A;  2L57 A;  1K0O A;  2X64 A;  5D96 A;  3RPP A;  2FUG 2;  4TXO B;  4EKZ A;  3GNJ A;  2B5E A;  4NV5 A;  3GL5 A;  3KEB A;  2HRK A;  2F9S A;  2XBQ A;  5E59 A;  2F3M A;  1GL8 A;  1S3D A;  1YY7 A;  4KDX A;  4DVC A;  2H01 A;  1ON4 A;  3D0Z A;  4RI6 A;  1KEB A;  2H66 A;  4OMV A;  1U87 A;  5HR1 A;  1VRS D;  2B5Y A;  4JU5 A;  4RUV A;  1PX6 A;  3F0I A;  1PKW A;  3TKS C;  4K5R A;  4KB3 A;  2IPA A;  1SK1 A;  2GZP A;  3ZLP A;  1DBY A;  1IYI A;  5IO2 A;  3MDK A;  4KGI A;  3APS A;  1X5D A;  4G2E A;  3KP8 A;  2VCZ A;  2H72 A;  4HU7 A;  5ELA A;  4CDO A;  2E7P A;  5J41 A;  1AQV A;  1PD2 1;  1EZK A;  2LJA A;  4HUA A;  2QSI A;  1X5C A;  3TGZ A;  4ML1 A;  1YJ6 A;  1TKD B;  4F82 A;  2IME A;  1J0F A;  1G7O A;  3KMO A;  5D93 A;  4KAE A;  4MF6 A;  2YN1 A;  3EUR A;  4P3Y B;  2DJ2 A;  4HJM A;  2YWN A;  1XBS A;  2EIQ A;  2FLS A;  2XBI A;  2FY6 A;  3ZML A;  2P5Q A;  2B3S A;  4I6X A;  2LRC A;  5HR2 A;  3TJJ A;  3GV1 A;  2E2G A;  4MJA A;  3O3T A;  1GSE A;  2VL2 A;  1ILO A;  3C73 A;  2RM6 A;  3VPT A;  4EVM A;  4ECJ A;  2C1Y A;  3TJG A;  1K0B A;  4WKW A;  5H5Q A;  4MAB A;  1OYJ A;  2X8H A;  2L5O A;  3TKS E;  1SJZ A;  2PN8 A;  1OAZ A;  3H79 A;  4IQ1 A;  1KBN A;  4IJ3 A;  1XVQ A;  5J5N A;  3M9K A;  1FG4 A;  2LNS A;  2LS5 A;  4HEA 2;  2KLX A;  2NTO A;  1GUL A;  3TJB A;  3ZFB A;  2IJY A;  1XWA A;  4PNF A;  3O76 A;  1F2E A;  1A2M A;  4XRD A;  1UN2 A;  4EXJ A;  2WJU A;  4BWS A;  4MA9 A;  4NV2 A;  1SKR B;  4HZ2 A;  3CXG A;  4MZC A;  5FWG A;  4JE1 A;  5G5F A;  4YAP A;  3MYD A;  1FB0 A;  5DBQ A;  4K0G A;  3CSI A;  2NDO A;  4KCE A;  3KJY A;  3A2W A;  3FR3 A;  2WZ9 A;  2GQK A;  2UZ8 A;  3GA4 A;  5IMA A;  4G0L A;  2A2P A;  2HSH A;  1N2A A;  5EL8 A;  5AIS A;  4HZ4 A;  5CRE A;  2DML A;  3N9J A;  3RHC A;  2IFQ A;  2HSY A;  5DQS A;  4POB A;  2DJJ A;  4GF0 A;  3ISO A;  3JCM L;  4ECB A;  1SKW B;  5ECR B;  2CX3 A;  3CSJ A;  1PA3 A;  2YWO A;  5DAL A;  4PUF C;  2C0D A;  1JZW A;  4EDY A;  1K0N A;  3GL3 A;  3VWX A;  1O8W A;  4EUY A;  5EPF A;  16GS A;  2E0Q A;  3W8J A;  5DCH A;  1I9D A;  2OE1 A;  4XIH A;  2VUP A;  5F07 A;  1BED A;  2LST A;  1DE2 A;  2FWF A;  2MMN A;  2I3Y A;  4IP6 A;  4K7N A;  2WFC A;  5KN0 A;  2H30 A;  3H1N A;  2Z9S A;  4XS4 A;  2GLR A;  4PQH A;  3EU3 A;  4V1A g;  2JAC A;  2CQ9 A;  4HU9 A;  5D8I A;  3APQ A;  4G10 A;  4DSS A;  4I97 A;  4AJ8 A;  1AW9 A;  4AF2 A;  2HLS A;  2V41 A;  5DQY A;  2PVO C;  3WD6 A;  1SKS B;  4MCU A;  1WE0 A;  5LCZ A;  5HFG A;  4QL7 A;  3UOM A;  1PL2 A;  2XPE A;  4EIP A;  1USB A;  1BAY A;  3US3 A;  1B9X C;  3IBH A;  3UBL A;  2AAW A;  1A8Y A;  4WR5 A;  2VCQ A;  3GH9 A;  4FH8 A;  3BCI A;  3D5J A;  1RK4 A;  1PFO A;  3RAZ A;  2VO4 A;  2CVD A;  1XOB A;  2V1M A;  2E2M A;  4G9H A;  2IWT A;  3LWA A;  2M80 A;  4PQ1 A;  3A3T A;  5A4W A;  2I4A A;  2AUV A;  4CY8 A;  4HDE A;  1ERW A;  3ZTL A;  4Q5Q A;  3F4R A;  2K8V A;  1PGT A;  1VF2 A;  1JFU A;  5IM9 A;  4A5P A;  2G0F A;  5C04 A;  1M9B A;  2R2J A;  2WB9 A;  4Q5N A;  4PUA A;  3ZVJ D;  18GS A;  3DVX A;  1TRU A;  4Z2U A;  2GSR A;  1K0D A;  1X0R A;  3H8Q A;  4PUR A;  1TXX A;  4IS0 A;  4HI7 A;  1XG8 A;  4XCS A;  4HJ2 A;  3MSZ A;  2BMX A;  3IRA A;  3LOR A;  3CYN A;  3LGC A;  1VF4 A;  2HI7 A;  4F0B A;  1K0C A;  2VIM A;  1NW2 A;  4TXO A;  2HRN A;  2V2G A;  2HZF A;  3W8S A;  5HR3 A;  1FW1 A;  4K5S A;  2FWH A;  4MZW A;  3WGE A;  2XHF A;  3F4S A;  4ECC A;  3KIJ A;  2HRF A;  3FRC A;  1X9M B;  2EIR A;  5HFK A;  2AV4 A;  4XHM A;  1NHY A;  19GS A;  1JHB A;  3LFL A;  1IYH A;  1R7H A;  1Z9H A;  1MDK A;  2AB6 A;  5G31 A;  1FB6 A;  4DEJ A;  2A4H A;  4I5Q A;  3I43 A;  1MD4 A;  2I1U A;  4I2T A;  5B7C A;  1TOF A;  1WP0 A;  1QK8 A;  10GS A;  3ERG A;  5DAL B;  3TKP A;  3VWU A;  1BX9 A;  9GSS A;  1A0R P;  2HYX A;  4WXT A;  2GTU A;  1F37 A;  1S3R A;  3IHQ A;  3KM6 A;  5CYY A;  4ZBB A;  3ZFL A;  1JZO A;  2IN3 A;  5CP1 A;  2H6X A;  3QDN A;  3MWH A;  3ME8 A;  3LYK A;  2HFD A;  4XS4 B;  4POL A;  1XCC A;  1EEJ A;  2VM2 A;  4G19 A;  2DLX A;  4KE3 A;  4MH3 A;  1NHO A;  2H0H A;  3EIN A;  2V6O A;  2LJK A;  1AQW A;  4MK3 A;  3CRU A;  1ZZY A;  1AAZ A;  3F6D A;  5GSS A;  1GSQ A;  2DKH A;  4MLY A;  6GST A;  3VI7 A;  3L78 A;  3F3R A;  2FHE A;  4POM A;  4ZBD A;  1OKD A;  3UVT A;  5B8A A;  1T7P B;  2B6M A;  3FZ5 A;  3D21 A;  1WMJ A;  4J57 E;  3GYK A;  3ERF A;  3OR5 A;  3NZN A;  4E8E A;  4FQU A;  2VOC A;  5B6M A;  1X5E A;  1XXU A;  2CA8 A;  2N5F A;  1T4Y A;  2H1D A;  5JCU A;  5L71 A;  4MZB A;  1A23 A;  1B48 A;  3K8N A;  3ME7 A;  3GST A;  5AN1 A;  1EGR A;  3VK9 A;  1Z6M A;  3QAW A;  3WT2 A;  2X8C A;  2L6D A;  1SK2 A;  2QGV A;  1EEM A;  2O7K A;  1ZCP A;  1CQH A;  2VCT A;  4XS1 A;  3A2V A;  1O81 A;  2OBK A;  3KGK A;  4IP1 A;  1NSW A;  1THX A;  2IMI A;  1M3J A;  5D9V A;  2VL3 A;  3D4T A;  2MBS A;  5ECH B;  5IMD A;  2C3Q A;  1EV9 A;  2GQM A;  3IAS 2;  3VUR A;  2VL2 C;  1VF3 A;  3QFB C;  3KTB A;  1T1V A;  2YP6 A;  4MDC A;  2H71 A;  1X9W B;  2P5R A;  4ZL7 A;  3MAK A;  1Z6N A;  5ELG A;  1SL0 B;  5G1K A;  5LNK e;  4K2D A;  5F0G A;  4G0K A;  1SL1 B;  2WUL A;  3GKM A;  4GST A;  2DJ1 A;  2QA2 A;  2BJX A;  2DSA A;  3GKK A;  2OA7 A;  3M1G A;  3VPQ A;  1E6B A;  1X9S B;  22GS A;  2F8A A;  2FCH A;  4ZB6 A;  3BJ5 A;  3FYG A;  2DIY A;  2R6K A;  2A2R A;  5JCG A;  4IKH A;  3V1W A;  3N5O A;  1BG5 A;  4KSO A;  4F0C A;  1XZO A;  4WF5 A;  5KN1 A;  4EO3 A;  5DJL A;  4IJI A;  3F3Q A;  3NOF A;  3QFA C;  1T8E B;  2O89 A;  3UAP A;  4OFT A;  2JZR A;  4MJB A;  3NIV A;  4JZQ A;  1KNG A;  4X43 A;  5D73 A;  3FKF A;  5IPG A;  2KP1 A;  2P31 A;  3A2X A;  3F63 A;  1DUG A;  2GT5 A;  3R3E A;  2LNT A;  2DJ0 A;  3L4N A;  4DSR A;  1O6J A;  3SBC A;  4MPF A;  3IK9 A;  4ZL9 A;  3CSH A;  2IIY A;  4TKY A;  2YWM A;  2KOK A;  3IHG A;  5IOX A;  3PH9 A;  1F6M C;  4AJ7 A;  1G0T A;  4LMW A;  1SL2 B;  1EOG A;  1R4W A;  2N5B A;  1HNA A;  1A8L A;  4NWY A;  2PBJ A;  4KDU A;  1S3C A;  4K7O A;  5F8B A;  1BJX A;  1JLV A;  5A4U A;  1GTU A;  5E4W A;  1GLP A;  4ML6 A;  4PX1 A;  1ERV A;  1QUW A;  4ZB8 A;  3RDW A;  1PL1 A;  4GTU A;  1EV4 A;  1YF0 A;  8GSS A;  5IMV A;  2H6Y A;  3M8N A;  3BD2 A;  3QR6 A;  4OO4 A;  3PPU A;  2WGR A;  3EE2 A;  3FK8 A;  1MTC A;  2R4V A;  1THO A;  2CVK A;  3Q6O A;  3M0F A;  1GUK A;  2GSS A;  4PNG A;  4F03 A;  5HQP A;  1WPI A;  3UAR A;  3HZ4 A;  5COH A;  1FOH A;  3HJM A;  3GKN A;  3EWL A;  1I5G A;  2GS3 A;  4KDY A;  5DVB A;  2PGT A;  1SD9 A;  1TI3 A;  2H19 A;  5AGY A;  4OFM A;  3EU4 A;  2B7K A;  4PGT A;  5IPH A;  5AIV A;  4NAX A;  2NPB A;  3E3E A;  3GRX A;  2D2Z A;  2REM A;  5FT3 A;  2HE3 A;  3FY7 A;  1N8J A;  1S3A A;  3CRT A;  1O8X A;  2AJQ B;  4EC0 A;  1G6Y A;  4NMU A;  5GZZ B;  3G7Y A;  5CRG A;  2BTO T;  4RQX A;  4YQM A;  3GIX A;  1Y6E A;  2XC2 A;  4I8B A;  3DVW A;  2O87 A;  3QAV A;  5BMU A;  1MDJ A;  2DKI A;  1GSU A;  2QC7 A;  5DDL A;  4ZL8 A;  2B1K A;  4BWQ A;  4WR4 A;  3RHB A;  4BL7 B;  3KXO A;  1V40 A;  1GSS A;  2V32 A;  3IA1 A;  5B8B A;  4N11 A;  1M2A A;  1BQ7 A;  1OKT A;  2PUK C;  5F06 A;  3ZIJ A;  2V6K A;  3QCP A;  3C1R A;  1SEN A;  1T3B A;  2F51 A;  4MNN A;  3HZ8 A;  1PRX A;  2GSQ A;  1SJ6 A;  5ECQ B;  1PMT A;  2B1L A;  3C71 A;  5D9X A;  3LEF A;  4F2I A;  3AY8 A;  3J7Y k;  1ERU A;  3Q19 A;  2O8V B;  3FZA A;  1FHE A;  4KSM A;  6GSX A;  4ICY A;  20GS A;  3D4M A;  4I2U A;  4KUN A;  3E0U A;  4FIW A;  1J9B A;  3KH7 A;  1OC9 B;  4J2F A;  3MIX A;  1PQN A;  4GCI A;  4GRF A;  1Q4J A;  4RQR A;  3RPN A;  3F8U A;  2OAC A;  3LQ7 A;  3UEM A;  4BIK A;  4JR4 A;  3APO A;  2OBI A;  5CNW A;  2KHP A;  1T00 A;  2C8U A;  1Y25 A;  1O73 A;  2RUE A;  2DBC A;  2JZS A;  1XWB A;  3EVI A;  1GSF A;  2DC5 A;  2NVL A;  4OD7 A;  1PN9 A;  1GTB A;  3FW2 A;  1B4P A;  4O5U A;  2LUS A;  2FD3 A;  5DAK A;  4ACS A;  3UMA A;  3G7J A;  3GKX A;  3FR9 A;  1R5P A;  1UVZ A;  1GWC A;  2LV3 A;  1XFL A;  4RI7 A;  1CQG A;  2YCD A;  1ZYN A;  3IE3 A;  2OAD A;  2CV4 A;  4OWY A;  2WS2 A;  1FAA A;  1SK0 A;  2VL9 A;  2MMO A;  4L0U A;  2VD0 A;  4ISD A;  3A5W A;  3F6F A;  3D6I A;  2CZ3 A;  3U5R E;  2JZT A;  4BVY B;  3HVS A;  2LRN A;  3I69 A;  5J4U A;  1OE8 A;  3GH6 A;  2HRA A;  3WGX A;  3GFK A;  3O6T A;  3DIE A;  2L59 A;  2LTK A;  2RLI A;  2DJ3 A;  4OO5 A;  1ACV A;  1GUM A;  1XWK A;  4F9Z A;  4Q5R A;  5HR0 A;  1A2J A;  3UL3 A;  4NPB A;  1B9Y C;  1MD3 A;  2WCI A;  4LL1 B;  4TR4 A;  1GTA A;  1O7U A;  1MDI A;  4ZB9 A;  2O85 A;  2PMT A;  5INY A;  4YAV A;  3HDC A;  2M72 A;  2CAI A;  3R2Q A;  4IBP A;  5BRT A;  1FOV A;  1TK0 B;  3FMW A;  1LBK A;  4N0Z A;  2CX4 A;  1HNB A;  1M3I A;  4KH7 A;  5JWR B;  4NHZ A;  5H5R A;  3F9U A;  3CTF A;  2WRT A;  3TDG A;  4IN0 A;  2VCV A;  1WWJ A;  5LD0 A;  3L9U A;  5KN3 A;  4CY6 A;  1TTZ A;  3QOU A;  3ZL5 A;  1FVK A;  6GSY A;  3LXZ A;  1PKZ A;  2GQL A;  2HXK A;  2HT9 A;  2K18 A;  3KP9 A;  2LKU A;  2VCX A;  1GP1 A;  4KCA A;  1V57 A;  2FGX A;  2K8S A;  1G6W A;  2LQQ A;  1U88 A;  2RUF A;  4X1U A;  4XRA A;  4L5L A;  2H76 A;  4QL9 A;  2J23 A;  1O85 A;  3QMX A;  1SU9 A;  4K6X A;  2HZE A;  5ID2 B;  5EVO A;  3L0H A;  2FNO A;  2OE0 A;  4YH2 A;  3EC3 A;  1Z5Y E;  1AIU A;  3BBY A;  1GSY A;  5A5K A;  2R0P A;  3DXB A;  4BA7 A;  2TRX A;  4IW9 A;  4JRR A;  1WJK A;  2C80 A;  1UA5 A;  2MMA A;  3KCM A;  2MMZ A;  1XPV A;  14GS A;  2JSZ A;  3GMF A;  5ECO B;  1E2Y A;  4L0W A;  4BVX B;  1J08 A;  1BYE A;  2R0C A;  2YJ7 A;  4FYC A;  1YKC A;  3UIW A;  1QXH A;  2A4V A;  3DGQ A;  6GSS A;  2YZU A;  4MH2 A;  5ECN B;  3FEU A;  2G2Q A;  1GSD A;  4ULX A;  2YWI A;  4IEL A;  2FWE A;  5DAK B;  2I9H A;  4IQA A;  1A2L A;  1Z7R A;  1XW9 A;  2VD1 A;  5B6N A;  1TJD A;  3LG6 A;  3F4T A;  3TOT A;  4MF5 A;  3HJP A;  5GAN D;  2IMD A;  1RW1 A;  1YDK A;  4MPG A;  3FZ9 A;  1OE7 A;  3DRN A;  2LRT A;  1QGV A;  3TKQ A;  3VLN A;  2JL4 A;  3TJK A;  1TK5 B;  4TXV A;  1GLQ A;  3FHK A;  2R37 A;  3KH9 A;  3IPZ A;  2X8G A;  2NBS A;  2VAF A;  1C72 A;  5C00 A;  1YKA A;  1YZX A;  3KD0 A;  1XOA A;  3IK7 A;  2I81 A;  4PXO A;  3LXT A;  1R5A A;  2FWG A;  1V98 A;  3KZQ A;  3IR4 A;  3LJR A;  2YV7 A;  1TRW A;  3IC4 A;  1NM3 A;  4Q5F A;  2IL3 A;  2YAN A;  3GN3 A;  2XPD A;  1EWX A;  1AQX A;  4BL7 A;  17GS A;  3LYP A;  1ZYE A;  2F8F A;  4V2M A;  3HVX A;  3P90 A;  5IIZ A;  2H70 A;  4X4J A;  2ON5 A;  2L4C A;  4OCE A;  5D9T A;  1ZYP A;  4O5Q A;  5IOW A;  4TVE A;  2YZH A;  4IVF A;  1HNC A;  1W4V A;  1V58 A;  4HSC X;  4N0V A;  2C4J A;  4YQU A;  2H1G A;  3A5I A;  3TUE A;  3SWL A;  5ECK B;  3C1S A;  4CW9 A;  1JLW A;  3C7M A;  1OC9 A;  3HY2 A;  3GX0 A;  5ECL B;  2GST A;  5ECI B;  3QAG A;  3CTG A;  2GGT A;  4GQF A;  1M2D A;  1YEP A;  1PSQ A;  5GAP D;  4YKF A;  3J7Y b;  2DJK A;  2P0G A;  2HZE B;  2TRC P;  3FZ4 A;  4D73 A;  2H0I A;  5JWO B;  4NHW A;  2K6V A;  1XW5 A;  2OKA A;  3G9B A;  4WF4 A;  1A24 A;  1GH2 A;  1ZOF A;  3GTU B;  5IO0 A;  1M7T A;  4CHS A;  3PIN A;  2QKE A;  4TN8 A;  5J9C A;  2GVP A;  5IMZ A;  1ML6 A;  4X0X A;  1GNE A;  1UC7 A;  4OCF A;  3BOA A;  4MJE A;  2B7J A;  4EF0 A;  1H4O A;  4GSS A;  4K9Z A;  2JU5 A;  4BVY A;  4GLT A;  1EGO A;  3TRP A;  1K3Y A;  1VF1 A;  1TK8 B;  3DKS A;  4KW6 A;  2AHE A;  3VI5 A;  1FO5 A;  3IXR A;  2B5X A;  4WET A;  2L6C A;  3U6V A;  1T4Z A;  4AJ6 A;  1F3B A;  4EL1 A;  2OE3 A;  3ZIT A;  5H5S A;  2JSY A;  1AXD A;  3GSS A;  1K0M A;  4V2L A;  1WIK A;  4O5R A;  3C8E A;  3KTL A;  3DEX A;  2AYT A;  4FO5 A;  2R3X A;  5GST A;  3PR8 A;  4BPY A;  2WDU A;  3TKS A;  3H4K A;  3TRX A;  4V2N A;  2EC4 A;  3P2A A;  4JED A;  3IAM 2;  2YV9 A;  3TCO A;  1JZD A;  2C0F A;  3D22 A;  5KOW A;  2C0E A;  3S9F A;  4MJC A;  1ST9 A;  2JAD A;  5CO3 A;  5DJM A;  3CMI A;  4H86 A;  2C0G A;  4ZIJ A;  4E8H A;  3P7X A;  2X49 A;  2DIZ A;  5CAX A;  1TU8 A;  2KUC A;  1TRV A;  5KN2 A;  2HSM A;  2PER A;  2H8L A;  1V9W A;  3UJ1 A;  3ZMK A;  4K0N A;  5IQY A;  4N30 A;  4GSN A;  2PWJ A;  1ERT A;  1XWC A;  1B8X A;  1EP8 A;  5A4V A;  3RBT A;  3GUR A;  1A0F A;  2RM5 A;  4TW5 A;  3W6G A;  3DWV A;  2H6Z A;  5J3R A;  1M2B A;  2VCW A;  5KEJ A;  3HVV A;  1K0A A;  5ABR A;  4TR1 A;  4PQI A;  2X4A A;  5D9W A;  1QQ2 A;  2ON7 A;  3IOS A;  2ZNM A;  2YNX A;  1KTE A;  3LW9 A;  4N10 A;  3E9J B;  5ID2 A;  3EMX A;  6GSU A;  3MNG A;  4J56 E;  4USS A;  5ECS A;  3VWV A;  3EMP A;  1OVN A;  2ES7 A;  1XW6 A;  1TI1 A;  3UVH A;  1M9A A;  3Q18 A;  2QA1 A;  12GS A;  3LSZ A;  1YEX A;  3IV4 A;  4ZXG A;  1URM A;  4O7H A;  3CQF A;  4K2X A;  4LMV A;  1Q98 A;  3H93 A;  2YJH A;  1Z3E A;  3M3M A;  2GDR A;  5F05 A;  1M0U A;  4BVX A;  4EE0 A;  4K1F A;  2H74 A;  1OC8 A;  1AC1 A;  13GS A;  1U3A A;  2EIO A;  5EY6 A;  4D73 B;  4AGS A;  3ZVJ A;  4V1A p;  4KA0 A;  4KX4 A;  1U3I A; 
#chains in the Genus database with same CATH homology
 6GSW A;  4O32 A;  3HCZ A;  2GZY A;  3BCK A;  4GXZ A;  3UBK A;  3L9S A;  4G0I A;  1JZR A;  3ERW A;  3TKR A;  1HYU A;  4OFN A;  3IDV A;  1V2A A;  2CAQ A;  1EOH A;  1K3L A;  2IMF A;  4HS1 A;  3GHA A;  2A2S A;  3DYR A;  1WRY A;  4KND A;  4WBJ A;  3TOU A;  1U6T A;  3DML A;  4NXI A;  1HD2 A;  3HKR A;  3WGD A;  3QD9 A;  5CRD A;  4XS6 A;  3IC8 A;  1GNW A;  4YQV A;  4GWR A;  1SD8 A;  1XWG A;  1TP9 A;  2ZCT A;  3GUS A;  1B4Q A;  4FYB A;  5G2Z A;  5DCG A;  2X99 A;  3DD3 A;  2VLT A;  1VGL A;  5J9B A;  2LQO A;  5G1L A;  4EDZ A;  2TIR A;  4O92 A;  2M46 A;  3TRQ A;  4PTS A;  4YKG A;  4L5O A;  1EP7 A;  4LLR A;  2CT6 A;  3HYP A;  3HA9 A;  1M99 A;  1SYX A;  4Z7X A;  5KOX A;  1ABA A;  2VM1 A;  4MMM A;  1F3A A;  1TRS A;  5G5E A;  2K9F A;  1R26 A;  2C3T A;  4LA1 A;  4TRX A;  2MZC A;  1ZL9 A;  1TDI A;  1G7E A;  2PVQ A;  3ZIV A;  2OJL A;  3PGT A;  3ZRD A;  1F9M A;  2RII A;  2LEG A;  4FYU A;  1WOU A;  2IFQ B;  3I9V 2;  4Z2T A;  5ECP B;  1SJI A;  4MP4 A;  3Q74 A;  2HNL A;  4HOJ A;  4QQ7 A;  1ZGN A;  2L5L A;  1TW9 A;  3G7I A;  1XIY A;  4HQZ A;  2ALB A;  4Z2R A;  4LL4 B;  4HQS A;  3HXS A;  4K8M A;  3ZRE A;  2PPT A;  3KMN A;  4JBB A;  3HD5 A;  4TR1 B;  1H75 A;  4IGJ A;  6GSV A;  1ZMA A;  4WEY A;  3CBU A;  7GSS A;  3HJO A;  2L4Q A;  11GS A;  3WYW A;  5JWQ B;  1YF1 A;  1XVW A;  4TR0 A;  5JCW A;  1YQ1 A;  1DSB A;  4TR3 A;  5FHI A;  1TU7 A;  4WBR D;  2R5G A;  1Z7P A;  3GTU A;  4DSS B;  3P8W A;  5IMC A;  1HQO A;  2IMK A;  3VFI A;  4KF9 A;  1LU4 A;  2VLV A;  4L8E A;  4TOP A;  3FR6 A;  1OC3 A;  1MEK A;  3ED3 A;  2FA4 A;  1GUH A;  4XTS A;  4ILF A;  3ZYW A;  2C3N A;  1RQM A;  2PU9 C;  1DE1 A;  4ZIL A;  2CVB A;  1GRX A;  3VWW A;  2MBT A;  4ID0 A;  2DMM A;  3TJF A;  3QPM A;  3HHV A;  5G30 A;  4ZBA A;  2YOI A;  3M9J A;  5CRH A;  4K7I A;  2ZUP A;  2H75 A;  2R0G A;  2FA8 A;  5ENU A;  3EYT A;  1SYR A;  3TB2 A;  3WT1 A;  1FVJ A;  2GZZ A;  2GT6 A;  2YPM A;  2H1B A;  2MYG A;  2H1A A;  1K3O A;  2KP2 A;  2VLU A;  3ZZX A;  2LJR A;  2N5A A;  1PX7 A;  3GX8 A;  3I6A A;  2H0G A;  4IHU A;  5HFI A;  1AUC A;  4DSQ A;  4EIQ A;  4ECI A;  4GQC A;  3EPT A;  2J9H A;  1QFN A;  1LJR A;  3L9V A;  1W89 A;  4JR6 A;  4MF7 A;  1QMV A;  5ECM B;  1ZYQ B;  5AIX A;  2CZ2 A;  5CRW A;  1GTI A;  2H73 A;  4POK A;  5IMF A;  1PN0 A;  2L57 A;  1K0O A;  2X64 A;  5D96 A;  3RPP A;  2FUG 2;  4TXO B;  4EKZ A;  3GNJ A;  2B5E A;  4NV5 A;  3GL5 A;  3KEB A;  2HRK A;  2F9S A;  2XBQ A;  5E59 A;  2F3M A;  1GL8 A;  1S3D A;  1YY7 A;  4KDX A;  4DVC A;  2H01 A;  1ON4 A;  3D0Z A;  4RI6 A;  1KEB A;  2H66 A;  4OMV A;  1U87 A;  5HR1 A;  1VRS D;  2B5Y A;  4JU5 A;  4RUV A;  1PX6 A;  3F0I A;  1PKW A;  3TKS C;  4K5R A;  4KB3 A;  2IPA A;  1SK1 A;  2GZP A;  3ZLP A;  1DBY A;  1IYI A;  5IO2 A;  3MDK A;  4KGI A;  3APS A;  1X5D A;  4G2E A;  3KP8 A;  2VCZ A;  2H72 A;  4HU7 A;  5ELA A;  4CDO A;  2E7P A;  5J41 A;  1AQV A;  1PD2 1;  1EZK A;  2LJA A;  4HUA A;  2QSI A;  1X5C A;  3TGZ A;  4ML1 A;  1YJ6 A;  1TKD B;  4F82 A;  2IME A;  1J0F A;  1G7O A;  3KMO A;  5D93 A;  4KAE A;  4MF6 A;  2YN1 A;  3EUR A;  4P3Y B;  2DJ2 A;  4HJM A;  2YWN A;  1XBS A;  2EIQ A;  2FLS A;  2XBI A;  2FY6 A;  3ZML A;  2P5Q A;  2B3S A;  4I6X A;  2LRC A;  5HR2 A;  3TJJ A;  3GV1 A;  2E2G A;  4MJA A;  3O3T A;  1GSE A;  2VL2 A;  1ILO A;  3C73 A;  2RM6 A;  3VPT A;  4EVM A;  4ECJ A;  2C1Y A;  3TJG A;  1K0B A;  4WKW A;  5H5Q A;  4MAB A;  1OYJ A;  2X8H A;  2L5O A;  3TKS E;  1SJZ A;  2PN8 A;  1OAZ A;  3H79 A;  4IQ1 A;  1KBN A;  4IJ3 A;  1XVQ A;  5J5N A;  3M9K A;  1FG4 A;  2LNS A;  2LS5 A;  4HEA 2;  2KLX A;  2NTO A;  1GUL A;  3TJB A;  3ZFB A;  2IJY A;  1XWA A;  4PNF A;  3O76 A;  1F2E A;  1A2M A;  4XRD A;  1UN2 A;  4EXJ A;  2WJU A;  4BWS A;  4MA9 A;  4NV2 A;  1SKR B;  4HZ2 A;  3CXG A;  4MZC A;  5FWG A;  4JE1 A;  5G5F A;  4YAP A;  3MYD A;  1FB0 A;  5DBQ A;  4K0G A;  3CSI A;  2NDO A;  4KCE A;  3KJY A;  3A2W A;  3FR3 A;  2WZ9 A;  2GQK A;  2UZ8 A;  3GA4 A;  5IMA A;  4G0L A;  2A2P A;  2HSH A;  1N2A A;  5EL8 A;  5AIS A;  4HZ4 A;  5CRE A;  2DML A;  3N9J A;  3RHC A;  2IFQ A;  2HSY A;  5DQS A;  4POB A;  2DJJ A;  4GF0 A;  3ISO A;  3JCM L;  4ECB A;  1SKW B;  5ECR B;  2CX3 A;  3CSJ A;  1PA3 A;  2YWO A;  5DAL A;  4PUF C;  2C0D A;  1JZW A;  4EDY A;  1K0N A;  3GL3 A;  3VWX A;  1O8W A;  4EUY A;  5EPF A;  16GS A;  2E0Q A;  3W8J A;  5DCH A;  1I9D A;  2OE1 A;  4XIH A;  2VUP A;  5F07 A;  1BED A;  2LST A;  1DE2 A;  2FWF A;  2MMN A;  2I3Y A;  4IP6 A;  4K7N A;  2WFC A;  5KN0 A;  2H30 A;  3H1N A;  2Z9S A;  4XS4 A;  2GLR A;  4PQH A;  3EU3 A;  4V1A g;  2JAC A;  2CQ9 A;  4HU9 A;  5D8I A;  3APQ A;  4G10 A;  4DSS A;  4I97 A;  4AJ8 A;  1AW9 A;  4AF2 A;  2HLS A;  2V41 A;  5DQY A;  2PVO C;  3WD6 A;  1SKS B;  4MCU A;  1WE0 A;  5LCZ A;  5HFG A;  4QL7 A;  3UOM A;  1PL2 A;  2XPE A;  4EIP A;  1USB A;  1BAY A;  3US3 A;  1B9X C;  3IBH A;  3UBL A;  2AAW A;  1A8Y A;  4WR5 A;  2VCQ A;  3GH9 A;  4FH8 A;  3BCI A;  3D5J A;  1RK4 A;  3RAZ A;  2VO4 A;  2CVD A;  1XOB A;  2V1M A;  2E2M A;  4G9H A;  2IWT A;  3LWA A;  2M80 A;  4PQ1 A;  3A3T A;  5A4W A;  2I4A A;  2AUV A;  4CY8 A;  4HDE A;  1ERW A;  3ZTL A;  4Q5Q A;  3F4R A;  2K8V A;  1PGT A;  1VF2 A;  1JFU A;  5IM9 A;  4A5P A;  2G0F A;  5C04 A;  1M9B A;  2R2J A;  2WB9 A;  4Q5N A;  4PUA A;  3ZVJ D;  18GS A;  3DVX A;  1TRU A;  4Z2U A;  2GSR A;  1K0D A;  1X0R A;  3H8Q A;  4PUR A;  1TXX A;  4IS0 A;  4HI7 A;  4XCS A;  4HJ2 A;  3MSZ A;  2BMX A;  3IRA A;  3LOR A;  3CYN A;  3LGC A;  1VF4 A;  2HI7 A;  4F0B A;  1K0C A;  2VIM A;  1NW2 A;  4TXO A;  2HRN A;  2V2G A;  2HZF A;  3W8S A;  5HR3 A;  1FW1 A;  4K5S A;  2FWH A;  4MZW A;  3WGE A;  2XHF A;  3F4S A;  4ECC A;  3KIJ A;  2HRF A;  3FRC A;  1X9M B;  2EIR A;  5HFK A;  2AV4 A;  4XHM A;  1NHY A;  19GS A;  1JHB A;  3LFL A;  1IYH A;  1R7H A;  1Z9H A;  1MDK A;  2AB6 A;  5G31 A;  1FB6 A;  4DEJ A;  2A4H A;  4I5Q A;  3I43 A;  1MD4 A;  2I1U A;  4I2T A;  5B7C A;  1TOF A;  1WP0 A;  1QK8 A;  10GS A;  3ERG A;  5DAL B;  3TKP A;  3VWU A;  1BX9 A;  9GSS A;  1A0R P;  2HYX A;  4WXT A;  2GTU A;  1F37 A;  3IHQ A;  3KM6 A;  5CYY A;  4ZBB A;  3ZFL A;  1JZO A;  2IN3 A;  5CP1 A;  2H6X A;  3QDN A;  3MWH A;  3ME8 A;  3LYK A;  2HFD A;  4XS4 B;  4POL A;  1XCC A;  1EEJ A;  2VM2 A;  4G19 A;  2DLX A;  4KE3 A;  4MH3 A;  1NHO A;  2H0H A;  3EIN A;  2V6O A;  2LJK A;  1AQW A;  4MK3 A;  3CRU A;  1ZZY A;  1AAZ A;  3F6D A;  5GSS A;  1GSQ A;  2DKH A;  4MLY A;  6GST A;  3VI7 A;  3L78 A;  3F3R A;  2FHE A;  4POM A;  4ZBD A;  1OKD A;  3UVT A;  5B8A A;  1T7P B;  2B6M A;  3FZ5 A;  3D21 A;  1WMJ A;  4J57 E;  3GYK A;  3ERF A;  3OR5 A;  3NZN A;  4E8E A;  4FQU A;  2VOC A;  5B6M A;  1X5E A;  1XXU A;  2CA8 A;  2N5F A;  1T4Y A;  2H1D A;  5JCU A;  5L71 A;  4MZB A;  1A23 A;  1B48 A;  3K8N A;  3ME7 A;  3GST A;  5AN1 A;  1EGR A;  3VK9 A;  1Z6M A;  3QAW A;  3WT2 A;  2X8C A;  2L6D A;  1SK2 A;  2QGV A;  1EEM A;  2O7K A;  1ZCP A;  1CQH A;  2VCT A;  4XS1 A;  3A2V A;  1O81 A;  2OBK A;  3KGK A;  4IP1 A;  1NSW A;  1THX A;  2IMI A;  5D9V A;  2VL3 A;  3D4T A;  2MBS A;  5ECH B;  5IMD A;  2C3Q A;  1EV9 A;  2GQM A;  3IAS 2;  3VUR A;  2VL2 C;  1VF3 A;  3QFB C;  3KTB A;  1T1V A;  2YP6 A;  4MDC A;  2H71 A;  1X9W B;  2P5R A;  4ZL7 A;  3MAK A;  1Z6N A;  5ELG A;  1SL0 B;  5G1K A;  5LNK e;  4K2D A;  5F0G A;  4G0K A;  1SL1 B;  2WUL A;  3GKM A;  4GST A;  2DJ1 A;  2QA2 A;  2BJX A;  2DSA A;  3GKK A;  2OA7 A;  3M1G A;  3VPQ A;  1E6B A;  1X9S B;  22GS A;  2F8A A;  2FCH A;  4ZB6 A;  3BJ5 A;  3FYG A;  2DIY A;  2R6K A;  2A2R A;  5JCG A;  4IKH A;  3V1W A;  3N5O A;  1BG5 A;  4KSO A;  4F0C A;  1XZO A;  4WF5 A;  5KN1 A;  4EO3 A;  5DJL A;  4IJI A;  3F3Q A;  3NOF A;  3QFA C;  1T8E B;  2O89 A;  3UAP A;  4OFT A;  2JZR A;  4MJB A;  3NIV A;  4JZQ A;  1KNG A;  4X43 A;  5D73 A;  3FKF A;  5IPG A;  2KP1 A;  2P31 A;  3A2X A;  3F63 A;  1DUG A;  2GT5 A;  3R3E A;  2LNT A;  2DJ0 A;  3L4N A;  4DSR A;  1O6J A;  3SBC A;  4MPF A;  3IK9 A;  4ZL9 A;  3CSH A;  2IIY A;  4TKY A;  2YWM A;  2KOK A;  3IHG A;  5IOX A;  3PH9 A;  1F6M C;  4AJ7 A;  1G0T A;  4LMW A;  1SL2 B;  1EOG A;  1R4W A;  2N5B A;  1HNA A;  1A8L A;  4NWY A;  2PBJ A;  4KDU A;  1S3C A;  4K7O A;  5F8B A;  1BJX A;  1JLV A;  5A4U A;  1GTU A;  5E4W A;  1GLP A;  4ML6 A;  4PX1 A;  1ERV A;  1QUW A;  4ZB8 A;  3RDW A;  1PL1 A;  4GTU A;  1EV4 A;  1YF0 A;  8GSS A;  5IMV A;  2H6Y A;  3M8N A;  3BD2 A;  3QR6 A;  4OO4 A;  3PPU A;  2WGR A;  3EE2 A;  3FK8 A;  1MTC A;  2R4V A;  1THO A;  2CVK A;  3Q6O A;  3M0F A;  1GUK A;  2GSS A;  4PNG A;  4F03 A;  5HQP A;  1WPI A;  3UAR A;  3HZ4 A;  5COH A;  1FOH A;  3HJM A;  3GKN A;  3EWL A;  1I5G A;  2GS3 A;  4KDY A;  5DVB A;  2PGT A;  1SD9 A;  1TI3 A;  2H19 A;  5AGY A;  4OFM A;  3EU4 A;  2B7K A;  4PGT A;  5IPH A;  5AIV A;  4NAX A;  2NPB A;  3E3E A;  3GRX A;  2D2Z A;  2REM A;  5FT3 A;  2HE3 A;  3FY7 A;  1N8J A;  1S3A A;  3CRT A;  1O8X A;  2AJQ B;  4EC0 A;  1G6Y A;  4NMU A;  5GZZ B;  3G7Y A;  5CRG A;  2BTO T;  4RQX A;  4YQM A;  3GIX A;  1Y6E A;  2XC2 A;  4I8B A;  3DVW A;  2O87 A;  3QAV A;  5BMU A;  1MDJ A;  2DKI A;  1GSU A;  2QC7 A;  5DDL A;  4ZL8 A;  2B1K A;  4BWQ A;  4WR4 A;  3RHB A;  4BL7 B;  3KXO A;  1V40 A;  1GSS A;  2V32 A;  3IA1 A;  5B8B A;  4N11 A;  1M2A A;  1BQ7 A;  1OKT A;  2PUK C;  5F06 A;  3ZIJ A;  2V6K A;  3QCP A;  3C1R A;  1SEN A;  1T3B A;  2F51 A;  4MNN A;  3HZ8 A;  1PRX A;  2GSQ A;  1SJ6 A;  5ECQ B;  1PMT A;  2B1L A;  3C71 A;  5D9X A;  3LEF A;  4F2I A;  3AY8 A;  3J7Y k;  1ERU A;  3Q19 A;  2O8V B;  3FZA A;  1FHE A;  4KSM A;  6GSX A;  4ICY A;  20GS A;  3D4M A;  4I2U A;  4KUN A;  3E0U A;  4FIW A;  1J9B A;  3KH7 A;  1OC9 B;  4J2F A;  3MIX A;  1PQN A;  4GCI A;  4GRF A;  1Q4J A;  4RQR A;  3RPN A;  3F8U A;  2OAC A;  3LQ7 A;  3UEM A;  4JR4 A;  3APO A;  2OBI A;  5CNW A;  2KHP A;  1T00 A;  2C8U A;  1Y25 A;  1O73 A;  2RUE A;  2DBC A;  2JZS A;  1XWB A;  3EVI A;  1GSF A;  2DC5 A;  2NVL A;  4OD7 A;  1PN9 A;  1GTB A;  3FW2 A;  1B4P A;  4O5U A;  2LUS A;  2FD3 A;  5DAK A;  4ACS A;  3UMA A;  3G7J A;  3GKX A;  3FR9 A;  1R5P A;  1UVZ A;  1GWC A;  2LV3 A;  1XFL A;  4RI7 A;  1CQG A;  2YCD A;  1ZYN A;  3IE3 A;  2OAD A;  2CV4 A;  4OWY A;  2WS2 A;  1FAA A;  1SK0 A;  2VL9 A;  2MMO A;  4L0U A;  2VD0 A;  4ISD A;  3A5W A;  3F6F A;  3D6I A;  2CZ3 A;  3U5R E;  2JZT A;  4BVY B;  3HVS A;  2LRN A;  3I69 A;  5J4U A;  1OE8 A;  3GH6 A;  2HRA A;  3WGX A;  3GFK A;  3O6T A;  3DIE A;  2L59 A;  2LTK A;  2RLI A;  2DJ3 A;  4OO5 A;  1ACV A;  1GUM A;  1XWK A;  4F9Z A;  4Q5R A;  5HR0 A;  1A2J A;  3UL3 A;  4NPB A;  1B9Y C;  1MD3 A;  2WCI A;  4LL1 B;  4TR4 A;  1GTA A;  1O7U A;  1MDI A;  4ZB9 A;  2O85 A;  2PMT A;  5INY A;  4YAV A;  3HDC A;  2M72 A;  2CAI A;  3R2Q A;  4IBP A;  5BRT A;  1FOV A;  1TK0 B;  3FMW A;  1LBK A;  4N0Z A;  2CX4 A;  1HNB A;  4KH7 A;  5JWR B;  4NHZ A;  5H5R A;  3F9U A;  3CTF A;  2WRT A;  3TDG A;  4IN0 A;  2VCV A;  1WWJ A;  5LD0 A;  3L9U A;  5KN3 A;  4CY6 A;  1TTZ A;  3QOU A;  3ZL5 A;  1FVK A;  6GSY A;  3LXZ A;  1PKZ A;  2GQL A;  2HXK A;  2HT9 A;  2K18 A;  3KP9 A;  2LKU A;  2VCX A;  1GP1 A;  4KCA A;  1V57 A;  2FGX A;  2K8S A;  1G6W A;  2LQQ A;  1U88 A;  2RUF A;  4X1U A;  4XRA A;  4L5L A;  2H76 A;  4QL9 A;  2J23 A;  1O85 A;  3QMX A;  1SU9 A;  4K6X A;  2HZE A;  5ID2 B;  5EVO A;  3L0H A;  2FNO A;  2OE0 A;  4YH2 A;  3EC3 A;  1Z5Y E;  1AIU A;  3BBY A;  1GSY A;  5A5K A;  2R0P A;  3DXB A;  4BA7 A;  2TRX A;  4IW9 A;  4JRR A;  1WJK A;  2C80 A;  1UA5 A;  2MMA A;  3KCM A;  2MMZ A;  1XPV A;  14GS A;  2JSZ A;  3GMF A;  5ECO B;  1E2Y A;  4L0W A;  4BVX B;  1J08 A;  1BYE A;  2R0C A;  2YJ7 A;  4FYC A;  1YKC A;  3UIW A;  1QXH A;  2A4V A;  3DGQ A;  6GSS A;  2YZU A;  4MH2 A;  5ECN B;  3FEU A;  2G2Q A;  1GSD A;  4ULX A;  2YWI A;  4IEL A;  2FWE A;  5DAK B;  2I9H A;  4IQA A;  1A2L A;  1Z7R A;  1XW9 A;  2VD1 A;  5B6N A;  1TJD A;  3LG6 A;  3F4T A;  3TOT A;  4MF5 A;  3HJP A;  5GAN D;  2IMD A;  1RW1 A;  1YDK A;  4MPG A;  3FZ9 A;  1OE7 A;  3DRN A;  2LRT A;  1QGV A;  3TKQ A;  3VLN A;  2JL4 A;  3TJK A;  1TK5 B;  4TXV A;  1GLQ A;  3FHK A;  2R37 A;  3KH9 A;  3IPZ A;  2X8G A;  2NBS A;  2VAF A;  1C72 A;  5C00 A;  1YKA A;  1YZX A;  3KD0 A;  1XOA A;  3IK7 A;  2I81 A;  4PXO A;  3LXT A;  1R5A A;  2FWG A;  1V98 A;  3KZQ A;  3IR4 A;  3LJR A;  2YV7 A;  1TRW A;  3IC4 A;  1NM3 A;  4Q5F A;  2IL3 A;  2YAN A;  3GN3 A;  2XPD A;  1EWX A;  1AQX A;  4BL7 A;  17GS A;  3LYP A;  1ZYE A;  2F8F A;  4V2M A;  3HVX A;  3P90 A;  5IIZ A;  2H70 A;  4X4J A;  2ON5 A;  2L4C A;  4OCE A;  5D9T A;  1ZYP A;  4O5Q A;  5IOW A;  4TVE A;  2YZH A;  4IVF A;  1HNC A;  1W4V A;  1V58 A;  4N0V A;  2C4J A;  4YQU A;  2H1G A;  3A5I A;  3TUE A;  3SWL A;  5ECK B;  3C1S A;  4CW9 A;  1JLW A;  3C7M A;  1OC9 A;  3HY2 A;  3GX0 A;  5ECL B;  2GST A;  5ECI B;  3QAG A;  3CTG A;  2GGT A;  4GQF A;  1M2D A;  1YEP A;  1PSQ A;  5GAP D;  4YKF A;  3J7Y b;  2DJK A;  2P0G A;  2HZE B;  2TRC P;  3FZ4 A;  4D73 A;  2H0I A;  5JWO B;  4NHW A;  2K6V A;  1XW5 A;  2OKA A;  3G9B A;  4WF4 A;  1A24 A;  1GH2 A;  1ZOF A;  3GTU B;  5IO0 A;  1M7T A;  4CHS A;  3PIN A;  2QKE A;  4TN8 A;  5J9C A;  2GVP A;  5IMZ A;  1ML6 A;  4X0X A;  1GNE A;  1UC7 A;  4OCF A;  3BOA A;  4MJE A;  2B7J A;  4EF0 A;  1H4O A;  4GSS A;  4K9Z A;  2JU5 A;  4BVY A;  4GLT A;  1EGO A;  3TRP A;  1K3Y A;  1VF1 A;  1TK8 B;  3DKS A;  4KW6 A;  2AHE A;  3VI5 A;  1FO5 A;  3IXR A;  2B5X A;  4WET A;  2L6C A;  3U6V A;  1T4Z A;  4AJ6 A;  1F3B A;  4EL1 A;  2OE3 A;  3ZIT A;  5H5S A;  2JSY A;  1AXD A;  3GSS A;  1K0M A;  4V2L A;  1WIK A;  4O5R A;  3C8E A;  3KTL A;  3DEX A;  2AYT A;  4FO5 A;  2R3X A;  5GST A;  3PR8 A;  4BPY A;  2WDU A;  3TKS A;  3H4K A;  3TRX A;  4V2N A;  2EC4 A;  3P2A A;  4JED A;  3IAM 2;  2YV9 A;  3TCO A;  1JZD A;  2C0F A;  3D22 A;  5KOW A;  2C0E A;  3S9F A;  4MJC A;  1ST9 A;  2JAD A;  5CO3 A;  5DJM A;  3CMI A;  4H86 A;  2C0G A;  4ZIJ A;  4E8H A;  3P7X A;  2X49 A;  2DIZ A;  5CAX A;  1TU8 A;  2KUC A;  1TRV A;  5KN2 A;  2HSM A;  2PER A;  2H8L A;  1V9W A;  3UJ1 A;  3ZMK A;  4K0N A;  5IQY A;  4N30 A;  4GSN A;  2PWJ A;  1ERT A;  1XWC A;  1B8X A;  1EP8 A;  5A4V A;  3RBT A;  3GUR A;  1A0F A;  2RM5 A;  4TW5 A;  3W6G A;  3DWV A;  2H6Z A;  5J3R A;  1M2B A;  2VCW A;  5KEJ A;  3HVV A;  1K0A A;  5ABR A;  4TR1 A;  4PQI A;  2X4A A;  5D9W A;  1QQ2 A;  2ON7 A;  3IOS A;  2ZNM A;  2YNX A;  1KTE A;  3LW9 A;  4N10 A;  3E9J B;  5ID2 A;  3EMX A;  6GSU A;  3MNG A;  4J56 E;  4USS A;  5ECS A;  3VWV A;  3EMP A;  1OVN A;  2ES7 A;  1XW6 A;  1TI1 A;  3UVH A;  1M9A A;  3Q18 A;  2QA1 A;  12GS A;  3LSZ A;  1YEX A;  3IV4 A;  4ZXG A;  1URM A;  4O7H A;  4K2X A;  4LMV A;  1Q98 A;  3H93 A;  2YJH A;  1Z3E A;  3M3M A;  2GDR A;  5F05 A;  1M0U A;  4BVX A;  4EE0 A;  4K1F A;  2H74 A;  1OC8 A;  1AC1 A;  13GS A;  1U3A A;  2EIO A;  5EY6 A;  4D73 B;  4AGS A;  3ZVJ A;  4V1A p;  4KA0 A;  4KX4 A;  1U3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...